BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c11125_g1_i1 len=869 path=[41:0-661 40:662-868]

Length=869
                                                                      Score     E

dbj|BAE44112.1|  CENTRORADIALIS homolog                                 362   2e-123   Ipomoea nil [qian niu]
ref|XP_009594494.1|  PREDICTED: CEN-like protein 2                      305   3e-101   
ref|XP_009611784.1|  PREDICTED: CEN-like protein 4                      305   6e-101   
ref|XP_009777303.1|  PREDICTED: CEN-like protein 2                      304   1e-100   
ref|XP_011088881.1|  PREDICTED: protein CENTRORADIALIS                  304   1e-100   
sp|Q9XH42.1|CET4_TOBAC  RecName: Full=CEN-like protein 4                303   2e-100   Nicotiana tabacum [American tobacco]
ref|NP_001233974.1|  protein SELF-PRUNING                               303   3e-100   
ref|XP_007206006.1|  hypothetical protein PRUPE_ppa012343mg             301   1e-99    
ref|NP_001275478.1|  terminal flower 1 protein                          301   1e-99    
ref|XP_008228487.1|  PREDICTED: CEN-like protein 2                      299   8e-99    
gb|ACL27223.1|  fasciculate                                             296   1e-97    Capsicum frutescens [bird pepper]
gb|AGK89940.1|  centroradialis                                          295   4e-97    
gb|AEK06124.1|  terminal flowering 1 protein 1                          295   5e-97    
emb|CAI38702.1|  self-pruning protein                                   295   5e-97    Capsicum annuum
gb|ABW24963.1|  terminal flower 1a                                      295   6e-97    Gossypium hirsutum [American cotton]
gb|ABW24967.1|  terminal flower 1a                                      294   8e-97    Gossypium hirsutum [American cotton]
ref|XP_007015849.1|  Centroradialis                                     294   8e-97    
ref|NP_001267929.1|  TFL1A protein                                      294   1e-96    
gb|ABW24965.1|  terminal flower 1a                                      293   2e-96    Gossypium raimondii
gb|ADO61015.1|  terminal flower 1                                       293   2e-96    
gb|ABW24961.1|  terminal flower 1a                                      293   2e-96    Gossypium arboreum [tree cotton]
gb|ACY80737.1|  TFL1A protein                                           293   3e-96    Vitis vinifera
gb|ADF80896.1|  terminal flower 1                                       293   4e-96    
ref|XP_002312811.1|  TFL1a family protein                               292   4e-96    Populus trichocarpa [western balsam poplar]
gb|AAM46142.1|AF378127_1  terminal flower-like protein 1                292   5e-96    Vitis vinifera
ref|XP_010031504.1|  PREDICTED: protein CENTRORADIALIS-like             292   5e-96    
ref|XP_011000909.1|  PREDICTED: CEN-like protein 2                      292   6e-96    
ref|XP_006384827.1|  TFL1a family protein                               292   6e-96    
dbj|BAD22601.1|  flowering locus T like protein                         291   8e-96    Populus nigra [black poplar]
ref|NP_001267654.1|  protein SELF-PRUNING-like                          291   1e-95    
ref|XP_010045223.1|  PREDICTED: CEN-like protein 2                      291   1e-95    
emb|CAJ44126.1|  centroradialis flower development regulation pro...    291   1e-95    Misopates orontium
dbj|BAD22599.1|  terminal flower 1                                      291   2e-95    Populus nigra [black poplar]
gb|AGW23412.1|  terminal flower                                         291   2e-95    
ref|XP_010557408.1|  PREDICTED: protein CENTRORADIALIS-like             290   3e-95    
dbj|BAN13572.1|  terminal flower1-like protein                          290   3e-95    
ref|XP_004487504.1|  PREDICTED: CEN-like protein 2-like                 290   4e-95    
ref|XP_006487964.1|  PREDICTED: CEN-like protein 2-like                 290   4e-95    
sp|Q41261.1|CEN_ANTMA  RecName: Full=Protein CENTRORADIALIS             290   4e-95    Antirrhinum majus [garden snapdragon]
ref|XP_011007279.1|  PREDICTED: CEN-like protein 2                      290   5e-95    
ref|XP_002453931.1|  hypothetical protein SORBIDRAFT_04g021650          290   6e-95    Sorghum bicolor [broomcorn]
emb|CAC21563.1|  centroradialis                                         289   1e-94    Antirrhinum majus [garden snapdragon]
gb|KDP31551.1|  hypothetical protein JCGZ_15206                         288   2e-94    
gb|AFI93431.1|  terminal flower 1                                       288   2e-94    
gb|ADF80900.1|  terminal flower 1                                       288   3e-94    
emb|CAC21564.1|  centroradialis                                         288   3e-94    Antirrhinum majus [garden snapdragon]
ref|XP_006424257.1|  hypothetical protein CICLE_v10029782mg             287   4e-94    
emb|CDP06933.1|  unnamed protein product                                285   2e-93    
dbj|BAO93910.1|  terminal flower 1                                      285   4e-93    
ref|NP_001280940.1|  CEN-like protein 2                                 285   4e-93    
ref|XP_010417907.1|  PREDICTED: protein CENTRORADIALIS-like             285   5e-93    
ref|NP_180324.1|  protein CENTRORADIALIS-like                           284   6e-93    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002876387.1|  hypothetical protein ARALYDRAFT_486134             284   6e-93    
ref|XP_003596800.1|  Terminal flower                                    284   7e-93    
ref|XP_010510761.1|  PREDICTED: protein CENTRORADIALIS-like             284   9e-93    
ref|XP_004952639.1|  PREDICTED: protein SELF-PRUNING-like               283   2e-92    
ref|XP_009364306.1|  PREDICTED: CEN-like protein 2 isoform X2           283   2e-92    
gb|ACX53295.1|  terminal flower 1-like protein                          283   2e-92    
emb|CAH67157.1|  H0717B12.4                                             283   3e-92    Oryza sativa [red rice]
ref|XP_009371917.1|  PREDICTED: CEN-like protein 2 isoform X2           283   3e-92    
ref|XP_006647339.1|  PREDICTED: protein SELF-PRUNING-like               283   3e-92    
ref|NP_001280813.1|  CEN-like protein 2                                 282   4e-92    
ref|XP_004291610.1|  PREDICTED: CEN-like protein 2-like                 282   5e-92    
ref|XP_009103610.1|  PREDICTED: protein CENTRORADIALIS-like             282   6e-92    
ref|NP_001173006.1|  Os02g0531600                                       281   8e-92    
gb|AFV67432.1|  centroradialis                                          281   8e-92    
ref|NP_001276169.1|  CEN-like protein 2-like                            281   9e-92    
ref|XP_006409758.1|  hypothetical protein EUTSA_v10017312mg             281   9e-92    
ref|XP_009364305.1|  PREDICTED: CEN-like protein 2 isoform X1           281   1e-91    
gb|KHN27653.1|  CEN-like protein 2                                      281   1e-91    
ref|NP_001106241.1|  ZCN2 protein                                       281   1e-91    Zea mays [maize]
ref|XP_009371916.1|  PREDICTED: CEN-like protein 2 isoform X1           281   1e-91    
gb|AEH43350.1|  CEN                                                     281   1e-91    
ref|XP_009140811.1|  PREDICTED: protein CENTRORADIALIS-like             281   1e-91    
ref|XP_009133891.1|  PREDICTED: protein CENTRORADIALIS-like             281   1e-91    
ref|NP_001052733.1|  Os04g0411400                                       281   1e-91    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010271687.1|  PREDICTED: protein SELF-PRUNING-like               281   2e-91    
ref|NP_001066172.1|  Os12g0152000                                       281   2e-91    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006652260.1|  PREDICTED: protein SELF-PRUNING-like               281   2e-91    
ref|XP_009339416.1|  PREDICTED: CEN-like protein 2                      280   2e-91    
ref|XP_010089842.1|  hypothetical protein L484_022359                   280   2e-91    
gb|AFV67441.1|  centroradialis                                          280   2e-91    
gb|EMS48180.1|  hypothetical protein TRIUR3_17327                       280   2e-91    
gb|AFV67438.1|  centroradialis                                          280   3e-91    
gb|AFV67448.1|  centroradialis                                          280   3e-91    
gb|AFV67437.1|  centroradialis                                          280   3e-91    
gb|AFV67436.1|  centroradialis                                          280   3e-91    
gb|EMT24999.1|  hypothetical protein F775_30083                         280   3e-91    
gb|EMT05258.1|  hypothetical protein F775_30982                         280   4e-91    
gb|AGX25254.1|  MCN5                                                    280   5e-91    
ref|XP_008784004.1|  PREDICTED: CEN-like protein 2                      280   5e-91    
ref|XP_009390747.1|  PREDICTED: CEN-like protein 2                      280   5e-91    
ref|XP_002442808.1|  hypothetical protein SORBIDRAFT_08g003210          279   5e-91    Sorghum bicolor [broomcorn]
emb|CDX71440.1|  BnaC04g16750D                                          279   6e-91    
ref|XP_006293432.1|  hypothetical protein CARUB_v10025606mg             279   6e-91    
ref|XP_009393383.1|  PREDICTED: CEN-like protein 2                      279   7e-91    
ref|XP_003579695.1|  PREDICTED: CEN-like protein 2                      279   8e-91    
gb|EMS62911.1|  hypothetical protein TRIUR3_23342                       279   9e-91    
gb|AFV67444.1|  centroradialis                                          278   1e-90    
gb|AFV67439.1|  centroradialis                                          278   1e-90    
gb|AFV67433.1|  centroradialis                                          278   1e-90    
gb|AFV67434.1|  centroradialis                                          278   1e-90    
gb|AFV67443.1|  centroradialis                                          278   1e-90    
gb|AEO72022.1|  RhTFL1                                                  278   1e-90    
ref|NP_001065771.1|  Os11g0152500                                       278   2e-90    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006662737.1|  PREDICTED: CEN-like protein 2-like                 278   2e-90    
gb|AFV67442.1|  centroradialis                                          278   2e-90    
ref|XP_009411957.1|  PREDICTED: CEN-like protein 2                      278   2e-90    
gb|ADO60992.1|  terminal flower 1                                       277   2e-90    
ref|XP_009592311.1|  PREDICTED: protein SELF-PRUNING-like isoform X2    278   3e-90    
ref|XP_010244607.1|  PREDICTED: CEN-like protein 2                      278   3e-90    
ref|XP_003575068.1|  PREDICTED: CEN-like protein 2                      278   3e-90    
dbj|BAL70256.1|  centroradialis                                         277   3e-90    
ref|XP_003578901.1|  PREDICTED: CEN-like protein 2                      277   3e-90    
ref|NP_001105959.1|  LOC100037785                                       277   4e-90    Zea mays [maize]
gb|AGX25244.1|  MCN5                                                    277   5e-90    
dbj|BAH24197.1|  homologous protein to TFL1                             277   5e-90    Hordeum vulgare [barley]
ref|XP_004978696.1|  PREDICTED: CEN-like protein 2-like                 277   6e-90    
ref|XP_010912272.1|  PREDICTED: protein SELF-PRUNING-like               277   6e-90    
emb|CDY31183.1|  BnaC03g47080D                                          276   9e-90    
gb|AGX25241.1|  MCN2                                                    276   9e-90    
gb|ACJ61501.1|  terminal flower                                         276   1e-89    
emb|CDP15403.1|  unnamed protein product                                276   1e-89    
ref|XP_003625808.1|  TFL1                                               275   2e-89    
ref|XP_009792306.1|  PREDICTED: CEN-like protein 2                      275   2e-89    
gb|ADF30943.1|  Dt1                                                     275   2e-89    
gb|ABF85670.1|  terminal flower 1-like protein                          275   3e-89    Hordeum vulgare subsp. vulgare [barley]
gb|AGX25240.1|  MCN1                                                    275   5e-89    
ref|XP_010686025.1|  PREDICTED: CEN-like protein 2                      274   6e-89    
gb|ADF30920.1|  Dt1                                                     274   9e-89    
gb|KHN18765.1|  Protein TERMINAL FLOWER 1                               274   9e-89    
ref|XP_010521662.1|  PREDICTED: protein CENTRORADIALIS-like             274   1e-88    
ref|XP_009420516.1|  PREDICTED: CEN-like protein 2                      273   1e-88    
gb|ABX11008.1|  ZCN6                                                    273   2e-88    Zea mays [maize]
dbj|BAI66119.1|  terminal flower 1b                                     273   2e-88    Glycine max [soybeans]
ref|XP_009592303.1|  PREDICTED: protein SELF-PRUNING-like isoform X1    273   2e-88    
ref|XP_002450283.1|  hypothetical protein SORBIDRAFT_05g003200          273   2e-88    Sorghum bicolor [broomcorn]
ref|XP_004977568.1|  PREDICTED: CEN-like protein 2-like                 273   2e-88    
gb|AGS32268.1|  TFL1-1                                                  273   2e-88    
ref|XP_006430226.1|  hypothetical protein CICLE_v10013475mg             273   2e-88    
ref|XP_008788083.1|  PREDICTED: protein SELF-PRUNING-like               273   2e-88    
ref|XP_010907126.1|  PREDICTED: protein SELF-PRUNING-like               273   2e-88    
ref|XP_007150078.1|  hypothetical protein PHAVU_005G124600g             273   2e-88    
gb|AAG31808.1|AF316419_1  terminal flower 1-like protein                273   2e-88    Lolium perenne [perennial ryegrass]
gb|ABX11005.1|  ZCN3                                                    273   2e-88    Zea mays [maize]
ref|NP_001239629.1|  protein TERMINAL FLOWER 1-like                     272   3e-88    
gb|ABY62770.1|  terminal flower 1b                                      273   3e-88    Gossypium hirsutum [American cotton]
ref|XP_008241250.1|  PREDICTED: CEN-like protein 2                      272   3e-88    
gb|ADF30918.1|  Dt1                                                     272   3e-88    
gb|ADO64261.1|  KSN                                                     272   4e-88    
gb|ABI98712.1|  terminal flower 1                                       272   4e-88    Zea mays [maize]
ref|XP_010101582.1|  hypothetical protein L484_015411                   272   4e-88    
gb|ADP00680.1|  CEN                                                     272   5e-88    
gb|AFP33418.1|  terminal flower 1                                       272   5e-88    
gb|AGX25243.1|  MCN4                                                    272   5e-88    
gb|AEH41277.1|  terminal flower 1                                       272   5e-88    
ref|NP_001267006.1|  protein TERMINAL FLOWER 1-like                     272   5e-88    
ref|NP_001241437.1|  protein TERMINAL FLOWER 1-like                     272   5e-88    
gb|ADP00674.1|  CEN                                                     271   5e-88    
ref|XP_009379789.1|  PREDICTED: protein SELF-PRUNING-like               271   6e-88    
gb|AFA42328.1|  TFL1-like protein                                       271   6e-88    
dbj|BAJ22384.1|  terminal flower 1a                                     271   6e-88    
ref|XP_006663820.1|  PREDICTED: CEN-like protein 2-like                 271   6e-88    
gb|AIA10351.1|  TFL1                                                    271   8e-88    
gb|ADP00689.1|  CEN                                                     271   1e-87    
gb|ABW24964.1|  terminal flower 1b                                      271   1e-87    Gossypium hirsutum [American cotton]
gb|ADP00670.1|  CEN                                                     271   1e-87    
gb|ABW24962.1|  terminal flower 1b                                      271   1e-87    Gossypium arboreum [tree cotton]
gb|ADP00708.1|  CEN                                                     271   1e-87    
gb|AHZ46122.1|  TFL1-like flowering time protein                        271   1e-87    
gb|ADP00694.1|  CEN                                                     271   1e-87    
ref|XP_004494168.1|  PREDICTED: protein CENTRORADIALIS-like             271   1e-87    
gb|ADP00676.1|  CEN                                                     271   1e-87    
gb|AEO72027.1|  TFL1-like protein                                       271   1e-87    
gb|ABW24968.1|  terminal flower 1b                                      271   1e-87    Gossypium hirsutum [American cotton]
gb|ADP00692.1|  CEN                                                     270   2e-87    
gb|ADP00711.1|  CEN                                                     270   2e-87    
ref|NP_001106242.1|  ZCN3 protein                                       270   2e-87    Zea mays [maize]
ref|NP_001106245.1|  ZCN6 protein                                       270   2e-87    Zea mays [maize]
gb|ABY91243.1|  CTRSTFL-like protein                                    270   2e-87    Citrus trifoliata [hardy orange]
ref|XP_007202664.1|  hypothetical protein PRUPE_ppa012369mg             270   2e-87    
gb|ADP00714.1|  CEN                                                     270   2e-87    
ref|XP_006481791.1|  PREDICTED: protein TERMINAL FLOWER 1 isoform X1    270   3e-87    
gb|ADP00690.1|  CEN                                                     270   3e-87    
gb|ADP00678.1|  CEN                                                     270   3e-87    
gb|AIA10356.1|  TFL1                                                    270   3e-87    
gb|AHX00603.1|  TFL1a                                                   270   4e-87    
gb|ADP00713.1|  CEN                                                     270   4e-87    
ref|NP_001267931.1|  TFL1B protein                                      270   4e-87    
gb|AIU44253.1|  TFL1                                                    269   5e-87    
gb|ADP00716.1|  CEN                                                     269   6e-87    
ref|XP_011094364.1|  PREDICTED: protein TERMINAL FLOWER 1-like is...    269   6e-87    
ref|XP_006836050.1|  hypothetical protein AMTR_s00114p00070400          269   6e-87    
gb|ADP00710.1|  CEN                                                     269   8e-87    
ref|XP_007027716.1|  Centroradialis                                     268   9e-87    
gb|ABP73380.1|  TFL1                                                    268   1e-86    Vicia faba [broad bean]
gb|ABW24966.1|  terminal flower 1b                                      268   1e-86    Gossypium raimondii
gb|ABR53775.2|  TFL1y                                                   268   1e-86    Phaseolus vulgaris [French bean]
ref|XP_007162890.1|  hypothetical protein PHAVU_001G189200g             270   1e-86    
ref|XP_004246534.1|  PREDICTED: CEN-like protein 2                      268   1e-86    
emb|CDY14173.1|  BnaC02g02900D                                          268   1e-86    
gb|ABP73384.1|  TFL1                                                    268   2e-86    Vicia faba [broad bean]
ref|NP_001275848.1|  terminal flower                                    268   2e-86    
emb|CBX25328.1|  hypothetical_protein                                   268   2e-86    
gb|AGX25250.1|  MCN1                                                    268   2e-86    
ref|XP_009374732.1|  PREDICTED: protein TERMINAL FLOWER 1-like          268   2e-86    
gb|ADP00672.1|  CEN                                                     267   2e-86    
gb|AFP33421.1|  terminal flower 1                                       268   2e-86    
gb|AHB20161.1|  terminal flower 1-like protein                          268   2e-86    
ref|NP_001106243.1|  ZCN4 protein                                       268   2e-86    Zea mays [maize]
gb|AEO72023.1|  TFL1-like protein                                       267   3e-86    
gb|ADP00703.1|  CEN                                                     267   3e-86    
gb|KHN14994.1|  Protein CENTRORADIALIS-like                             267   4e-86    
gb|ACG31744.1|  RCN4 - Corn Centroradialis/TFL1-like protein            267   4e-86    Zea mays [maize]
ref|XP_009125522.1|  PREDICTED: protein TERMINAL FLOWER 1-like          267   4e-86    
gb|AAQ93599.1|  CEN/TFL1-like GTP-associated binding protein            267   4e-86    Lotus japonicus
gb|AAR03725.1|  TFL1a                                                   267   4e-86    Pisum sativum [garden pea]
ref|XP_004975557.1|  PREDICTED: CEN-like protein 1-like                 267   4e-86    
gb|ADP00693.1|  CEN                                                     266   5e-86    
gb|KDO61123.1|  hypothetical protein CISIN_1g035977mg                   266   5e-86    
dbj|BAD10964.1|  TFL1-like protein                                      266   5e-86    Cydonia oblonga [wen po]
ref|NP_001240029.1|  CEN-like protein 2-like                            266   6e-86    
ref|NP_001280887.1|  protein TERMINAL FLOWER 1-like                     266   8e-86    
gb|AFA25738.1|  hypothetical protein                                    266   9e-86    
ref|XP_002447782.1|  hypothetical protein SORBIDRAFT_06g015490          266   9e-86    Sorghum bicolor [broomcorn]
dbj|BAD10965.1|  TFL1-like protein                                      266   1e-85    Chaenomeles sinensis
gb|ADL62862.1|  terminal flower 1                                       266   1e-85    
dbj|BAD10962.1|  TFL1-like protein                                      266   1e-85    Pyrus pyrifolia [sha li]
ref|NP_001239678.1|  protein SELF-PRUNING-like                          266   1e-85    
gb|ABP73381.1|  TFL1                                                    266   1e-85    Vicia faba [broad bean]
gb|AEO72024.1|  TFL1-like protein                                       265   1e-85    
ref|XP_009614479.1|  PREDICTED: protein TERMINAL FLOWER 1-like          265   2e-85    
dbj|BAM73643.1|  terminal flower1 homologue                             265   2e-85    
ref|XP_009766168.1|  PREDICTED: protein TERMINAL FLOWER 1-like          265   2e-85    
gb|AHY24028.1|  terminal flower 1 protein                               265   3e-85    
gb|AEO72025.1|  TFL1-like protein                                       265   3e-85    
gb|ABP73383.1|  TFL1                                                    265   4e-85    Vicia faba [broad bean]
dbj|BAD10966.1|  TFL1-like protein                                      265   4e-85    Eriobotrya japonica [loquat]
ref|XP_011090356.1|  PREDICTED: protein CENTRORADIALIS-like             265   4e-85    
ref|XP_011094363.1|  PREDICTED: CEN-like protein 2 isoform X2           264   4e-85    
gb|ABP73382.1|  TFL1                                                    264   5e-85    Vicia faba [broad bean]
ref|XP_006341131.1|  PREDICTED: CEN-like protein 2-like isoform X1      264   6e-85    
ref|XP_010255492.1|  PREDICTED: CEN-like protein 1                      264   7e-85    
gb|ADP00717.1|  CEN                                                     263   1e-84    
ref|NP_001280794.1|  protein TERMINAL FLOWER 1-like                     263   1e-84    
ref|XP_006341132.1|  PREDICTED: CEN-like protein 2-like isoform X2      263   2e-84    
gb|AGT41971.1|  TFL1                                                    263   2e-84    
gb|ABX11007.1|  ZCN5                                                    263   2e-84    Zea mays [maize]
emb|CAI61981.1|  TERMINAL FLOWER 1 protein                              263   2e-84    Impatiens balsamina [rose balsam]
ref|XP_008442833.1|  PREDICTED: protein SELF-PRUNING                    262   3e-84    
gb|AFK32780.1|  TFL1-like protein                                       262   4e-84    
emb|CAI61980.1|  TERMINAL FLOWER 1 protein                              262   5e-84    Impatiens balsamina [rose balsam]
ref|XP_009780427.1|  PREDICTED: CEN-like protein 1                      261   6e-84    
ref|XP_008462564.1|  PREDICTED: CEN-like protein 2 isoform X2           261   7e-84    
gb|AEO72026.1|  TFL1-like protein                                       261   8e-84    
gb|AEH43348.1|  TFL1                                                    261   9e-84    
ref|XP_010278585.1|  PREDICTED: CEN-like protein 1                      261   1e-83    
dbj|BAD10970.1|  TFL1-like protein                                      261   1e-83    Cydonia oblonga [wen po]
ref|NP_001106244.1|  ZCN5 protein                                       261   1e-83    Zea mays [maize]
dbj|BAD10971.1|  TFL1-like protein                                      260   1e-83    Chaenomeles sinensis
emb|CDP05230.1|  unnamed protein product                                260   2e-83    
ref|XP_009609848.1|  PREDICTED: CEN-like protein 1                      260   2e-83    
ref|XP_010049502.1|  PREDICTED: protein TERMINAL FLOWER 1-like          259   3e-83    
ref|NP_001289244.1|  protein TERMINAL FLOWER 1-like                     259   3e-83    
ref|XP_011076204.1|  PREDICTED: CEN-like protein 1                      259   3e-83    
ref|XP_004163314.1|  PREDICTED: CEN-like protein 2-like                 260   3e-83    
ref|XP_009130785.1|  PREDICTED: protein TERMINAL FLOWER 1               259   4e-83    
ref|XP_002873117.1|  hypothetical protein ARALYDRAFT_487163             259   5e-83    
ref|XP_009802796.1|  PREDICTED: CEN-like protein 1                      259   5e-83    
dbj|BAD10972.1|  TFL1-like protein                                      259   6e-83    Eriobotrya japonica [loquat]
gb|AAM27957.1|AF466817_1  terminal flower 1                             259   7e-83    Arabidopsis lyrata [lyrate rockcress]
ref|XP_011094361.1|  PREDICTED: CEN-like protein 2 isoform X1           259   7e-83    
ref|XP_006289547.1|  hypothetical protein CARUB_v10003093mg             258   9e-83    
gb|AAM27947.1|AF466807_1  terminal flower 1                             258   1e-82    Arabidopsis thaliana [mouse-ear cress]
dbj|BAH37010.1|  terminal flower1-like protein                          258   2e-82    Raphanus sativus
gb|EYU35477.1|  hypothetical protein MIMGU_mgv1a026117mg                258   2e-82    
gb|KGN48258.1|  hypothetical protein Csa_6G452100                       258   2e-82    
ref|XP_006398842.1|  hypothetical protein EUTSA_v10015708mg             257   3e-82    
dbj|BAA33417.1|  BNTFL1-3                                               257   3e-82    Brassica napus [oilseed rape]
ref|XP_010490878.1|  PREDICTED: protein TERMINAL FLOWER 1-like          257   3e-82    
gb|ACF18104.1|  terminal flower 1                                       257   3e-82    
ref|XP_009122666.1|  PREDICTED: protein TERMINAL FLOWER 1-like          257   3e-82    
dbj|BAA33415.1|  BNTFL1-1                                               257   3e-82    
ref|NP_196004.1|  protein TERMINAL FLOWER 1                             257   4e-82    
gb|ACF18100.1|  terminal flower 1                                       256   4e-82    
gb|ADC32542.1|  terminal flower 1-like protein                          257   4e-82    
pdb|1WKO|A  Chain A, Terminal Flower 1 (Tfl1) From Arabidopsis Th...    257   4e-82    
gb|AGN29206.1|  TFL1                                                    256   5e-82    
ref|XP_006353340.1|  PREDICTED: CEN-like protein 1-like                 256   6e-82    
ref|XP_006365775.1|  PREDICTED: CEN-like protein 1-like                 256   6e-82    
ref|XP_008462563.1|  PREDICTED: CEN-like protein 2 isoform X1           256   9e-82    
ref|XP_004234370.1|  PREDICTED: CEN-like protein 1                      256   1e-81    
ref|XP_010423657.1|  PREDICTED: protein TERMINAL FLOWER 1               256   1e-81    
gb|AAM27952.1|AF466812_1  terminal flower 1                             256   1e-81    
emb|CCI55633.1|  TFL1 protein                                           255   1e-81    
ref|XP_006365770.1|  PREDICTED: CEN-like protein 1-like                 255   1e-81    
dbj|BAH28254.1|  TFL1-like protein                                      255   2e-81    
gb|AFV67435.1|  centroradialis                                          254   3e-81    
ref|XP_010452279.1|  PREDICTED: protein TERMINAL FLOWER 1-like          254   3e-81    
gb|ACF18099.1|  terminal flower 1                                       254   4e-81    
emb|CCI55632.1|  TFL1 protein                                           254   4e-81    
gb|AAM27953.1|AF466813_1  terminal flower 1                             254   5e-81    
ref|XP_010919262.1|  PREDICTED: CEN-like protein 1                      254   5e-81    
dbj|BAA33419.1|  BRTFL1-2                                               254   5e-81    
dbj|BAA33421.1|  BOTFL1-2                                               254   6e-81    
dbj|BAA33416.1|  BNTFL1-2                                               254   7e-81    
ref|NP_001274853.1|  CEN-like protein 1-like                            254   7e-81    
gb|ADF80903.1|  terminal flower 1                                       253   7e-81    
ref|XP_009384535.1|  PREDICTED: CEN-like protein 1                      253   8e-81    
gb|ACF18115.1|  terminal flower 1                                       253   9e-81    
gb|ABY79180.1|  At5g03840                                               253   9e-81    
gb|ADF80901.1|  terminal flower 1                                       252   1e-80    
emb|CDX80890.1|  BnaC03g01440D                                          253   2e-80    
gb|ACF18111.1|  terminal flower 1                                       252   2e-80    
ref|XP_011077877.1|  PREDICTED: CEN-like protein 2                      252   2e-80    
ref|XP_002880983.1|  hypothetical protein ARALYDRAFT_481755             251   2e-80    
gb|ABY79175.1|  At5g03840                                               252   2e-80    
gb|EYU25074.1|  hypothetical protein MIMGU_mgv1a022196mg                252   3e-80    
ref|XP_004228449.1|  PREDICTED: CEN-like protein 1                      252   3e-80    
gb|ACF18122.1|  terminal flower 1                                       251   3e-80    
ref|XP_010543489.1|  PREDICTED: protein TERMINAL FLOWER 1               253   4e-80    
dbj|BAM73642.1|  terminal flower1 homologue                             252   5e-80    
ref|XP_010683747.1|  PREDICTED: CEN-like protein 4                      251   5e-80    
dbj|BAK40196.1|  terminal flower 1                                      251   6e-80    
gb|ACF18112.1|  terminal flower 1                                       251   7e-80    
gb|ACF18118.1|  terminal flower 1                                       251   8e-80    
gb|KDP42735.1|  hypothetical protein JCGZ_23675                         251   9e-80    
ref|NP_001280770.1|  CEN-like protein 1                                 251   1e-79    
ref|XP_008799538.1|  PREDICTED: CEN-like protein 1                      251   1e-79    
gb|AFV67451.1|  centroradialis                                          249   1e-79    
ref|XP_009611986.1|  PREDICTED: CEN-like protein 1                      250   2e-79    
gb|ACF18113.1|  terminal flower 1                                       249   2e-79    
ref|XP_004228452.1|  PREDICTED: CEN-like protein 1                      249   3e-79    
gb|ACF18109.1|  terminal flower 1                                       249   4e-79    
gb|ACF18119.1|  terminal flower 1                                       248   8e-79    
gb|KDP22308.1|  hypothetical protein JCGZ_26139                         248   8e-79    
ref|XP_002528731.1|  phosphatidylethanolamine-binding protein, pu...    248   1e-78    
gb|ADF80898.1|  terminal flower 1                                       246   1e-78    
gb|ADF80904.1|  terminal flower 1                                       246   3e-78    
gb|EMT21165.1|  hypothetical protein F775_12063                         246   4e-78    
dbj|BAA33420.1|  BOTFL1-1                                               246   5e-78    
gb|ACF18116.1|  terminal flower 1                                       246   5e-78    
ref|XP_004149257.1|  PREDICTED: CEN-like protein 2-like                 246   5e-78    
gb|KGN46950.1|  hypothetical protein Csa_6G152360                       246   7e-78    
ref|XP_004512822.1|  PREDICTED: CEN-like protein 4-like                 246   7e-78    
ref|XP_002510818.1|  phosphatidylethanolamine-binding protein, pu...    246   7e-78    
gb|EMS52593.1|  hypothetical protein TRIUR3_34862                       245   8e-78    
ref|XP_003540243.2|  PREDICTED: LOW QUALITY PROTEIN: CEN-like pro...    246   9e-78    
ref|XP_004515607.1|  PREDICTED: CEN-like protein 4-like                 246   1e-77    
dbj|BAJ22383.1|  terminal flower 1b                                     245   2e-77    
emb|CAE53887.1|  putative Cen-like protein, FDR1                        243   3e-77    
gb|AGX25242.1|  MCN3                                                    244   4e-77    
ref|XP_008458582.1|  PREDICTED: CEN-like protein 2                      244   4e-77    
gb|AGX25252.1|  MCN3                                                    244   4e-77    
ref|XP_009401773.1|  PREDICTED: CEN-like protein 1                      244   5e-77    
ref|XP_007221173.1|  hypothetical protein PRUPE_ppa021829mg             244   6e-77    
gb|EPS67746.1|  hypothetical protein M569_07027                         243   9e-77    
ref|NP_001236597.1|  brother of FT and TFL1 protein                     243   1e-76    
ref|XP_007038630.1|  PEBP family protein                                243   1e-76    
ref|XP_008234274.1|  PREDICTED: CEN-like protein 1                      243   1e-76    
dbj|BAN89465.1|  anti-florigenic FT/TFL1 family protein                 242   2e-76    
ref|XP_010693475.1|  PREDICTED: CEN-like protein 1                      242   3e-76    
dbj|BAH28258.1|  TFL1-like protein                                      241   4e-76    
ref|XP_007145323.1|  hypothetical protein PHAVU_007G229300g             241   5e-76    
ref|XP_004308107.1|  PREDICTED: CEN-like protein 1-like                 241   6e-76    
gb|ADZ72839.1|  terminal flower 1-like protein                          241   1e-75    
emb|CDP06934.1|  unnamed protein product                                238   3e-75    
gb|EPS71350.1|  hypothetical protein M569_03409                         238   9e-75    
ref|XP_006587343.1|  PREDICTED: CEN-like protein 1-like isoform X2      238   1e-74    
ref|NP_001276314.1|  uncharacterized protein LOC100783608               237   2e-74    
ref|XP_003635936.1|  CEN-like protein                                   237   2e-74    
ref|NP_001267933.1|  TFL1C protein                                      237   2e-74    
gb|AAQ20811.1|  late-flowering                                          237   3e-74    
ref|XP_004515713.1|  PREDICTED: CEN-like protein 1-like                 236   3e-74    
ref|XP_007152319.1|  hypothetical protein PHAVU_004G119700g             236   5e-74    
dbj|BAK31019.1|  TFL1-like protein                                      233   5e-73    
ref|XP_010107418.1|  hypothetical protein L484_015759                   232   2e-72    
ref|XP_011048673.1|  PREDICTED: CEN-like protein 1                      232   2e-72    
ref|XP_006421880.1|  hypothetical protein CICLE_v10006042mg             232   2e-72    
ref|XP_002321903.2|  flowering locus T like family protein              231   3e-72    
ref|XP_009151327.1|  PREDICTED: protein BROTHER of FT and TFL 1         233   3e-72    
ref|XP_010523529.1|  PREDICTED: protein BROTHER of FT and TFL 1         231   3e-72    
ref|XP_006281443.1|  hypothetical protein CARUB_v10027522mg             231   4e-72    
ref|NP_201010.1|  protein BROTHER of FT and TFL 1                       231   6e-72    
dbj|BAD08339.1|  flowering locus T like protein                         231   7e-72    
emb|CDX86931.1|  BnaC03g52010D                                          232   7e-72    
ref|XP_002864769.1|  brother of FT and TFL1 protein                     231   8e-72    
gb|AEH43349.1|  BFT                                                     230   9e-72    
ref|XP_006394441.1|  hypothetical protein EUTSA_v10005589mg             229   2e-71    
ref|XP_010444040.1|  PREDICTED: protein BROTHER of FT and TFL 1         229   2e-71    
gb|AFV67440.1|  centroradialis                                          229   3e-71    
gb|KEH42040.1|  terminal flower 1                                       229   4e-71    
dbj|BAK31027.1|  TFL1-like protein                                      228   4e-71    
gb|EYU36071.1|  hypothetical protein MIMGU_mgv1a020992mg                228   5e-71    
ref|XP_010035109.1|  PREDICTED: CEN-like protein 1                      227   2e-70    
ref|XP_008376539.1|  PREDICTED: CEN-like protein 1                      226   5e-70    
ref|XP_010458097.1|  PREDICTED: protein BROTHER of FT and TFL 1-like    225   1e-69    
gb|AGT41972.1|  TFL1                                                    223   1e-69    
ref|XP_009371304.1|  PREDICTED: CEN-like protein 1                      224   2e-69    
dbj|BAK31018.1|  TFL1-like protein                                      223   3e-69    
dbj|BAK31021.1|  TFL1-like protein                                      223   3e-69    
dbj|BAK31016.1|  TFL1-like protein                                      222   6e-69    
ref|XP_010483896.1|  PREDICTED: protein BROTHER of FT and TFL 1-like    223   7e-69    
gb|ADO64262.1|  TFL1-like protein                                       221   3e-68    
ref|XP_008439188.1|  PREDICTED: CEN-like protein 1                      222   3e-68    
ref|NP_001267660.1|  CEN-like protein 1-like                            220   8e-68    
dbj|BAK31026.1|  CEN-like protein                                       218   1e-67    
gb|KEH17362.1|  terminal flower 1                                       219   1e-67    
dbj|BAK31017.1|  TFL1-like protein                                      218   2e-67    
dbj|BAK31020.1|  CEN-like protein                                       216   1e-66    
emb|CAX46398.1|  putative TFL1 protein                                  216   1e-66    
gb|KHN32880.1|  Protein CENTRORADIALIS                                  215   3e-66    
gb|AGO81838.1|  FT-like protein                                         216   5e-66    
ref|XP_010268289.1|  PREDICTED: protein HEADING DATE 3A                 214   2e-65    
gb|AEH59567.1|  flowering locus T/Terminal flower1-like protein         214   2e-65    
gb|ABK25607.1|  unknown                                                 213   4e-65    
ref|XP_006418720.1|  hypothetical protein EUTSA_v10002980mg             213   4e-65    
gb|ABQ85553.1|  flowering locus T-like/terminal flower1-like protein    213   6e-65    
gb|ABI94605.1|  flowering locus T-like 1                                213   6e-65    
ref|NP_001276212.1|  protein CENTRORADIALIS-like                        212   6e-65    
gb|ABR23052.1|  terminal flower-like protein                            212   1e-64    
ref|XP_011084685.1|  PREDICTED: protein HEADING DATE 3A-like            212   1e-64    
gb|AGI74990.1|  flowering locus T protein                               212   1e-64    
gb|ADP95116.1|  flowering locus T-like protein                          213   2e-64    
gb|ABR20498.1|  FTL1                                                    211   3e-64    
emb|CAX46426.1|  putative FT protein                                    211   3e-64    
ref|XP_006352146.1|  PREDICTED: protein HEADING DATE 3A-like            211   3e-64    
gb|AIJ02002.1|  FT/TFL1-like 2                                          211   4e-64    
emb|CBY25182.1|  flowering locus T protein                              211   5e-64    
ref|XP_004297273.1|  PREDICTED: protein HEADING DATE 3A-like            211   5e-64    
ref|XP_010109942.1|  hypothetical protein L484_011784                   210   6e-64    
dbj|BAN89456.1|  flowering locus T                                      210   6e-64    
ref|XP_006428231.1|  hypothetical protein CICLE_v10012629mg             212   6e-64    
ref|XP_010915639.1|  PREDICTED: protein HEADING DATE 3A-like isof...    210   7e-64    
dbj|BAO03056.1|  Hd3a                                                   210   8e-64    
gb|EYU39743.1|  hypothetical protein MIMGU_mgv1a014907mg                210   8e-64    
gb|AFK31163.1|  Hd3a                                                    210   9e-64    
ref|XP_004143319.1|  PREDICTED: CEN-like protein 2-like                 209   1e-63    
gb|AFK31118.1|  Hd3a                                                    210   1e-63    
dbj|BAO02929.1|  Hd3a                                                   210   1e-63    
dbj|BAO02921.1|  Hd3a                                                   209   1e-63    
ref|XP_004234883.1|  PREDICTED: protein HEADING DATE 3A                 209   1e-63    
ref|XP_010038569.1|  PREDICTED: protein HEADING DATE 3A isoform X2      209   1e-63    
gb|AFK31132.1|  Hd3a                                                    209   1e-63    
gb|AFK31129.1|  Hd3a                                                    209   1e-63    
gb|ABY91244.1|  CTRSFT1-like protein                                    209   2e-63    
dbj|BAG72295.1|  Hd3a                                                   209   2e-63    
dbj|BAH30250.1|  FT-like protein                                        209   2e-63    
dbj|BAO02881.1|  Hd3a                                                   209   2e-63    
gb|AFK31134.1|  Hd3a                                                    209   2e-63    
gb|AFK31142.1|  Hd3a                                                    208   4e-63    
ref|XP_006480699.1|  PREDICTED: protein HEADING DATE 3A-like            208   4e-63    
ref|XP_010038562.1|  PREDICTED: protein HEADING DATE 3A isoform X1      208   5e-63    
gb|KHM99148.1|  CEN-like protein 1                                      207   5e-63    
dbj|BAO02930.1|  Hd3a                                                   208   5e-63    
gb|AFK31165.1|  Hd3a                                                    208   5e-63    
dbj|BAO03055.1|  Hd3a                                                   208   5e-63    
dbj|BAO02982.1|  Hd3a                                                   208   5e-63    
dbj|BAO03057.1|  Hd3a                                                   208   5e-63    
dbj|BAI60052.1|  flowering locus T-like protein                         207   6e-63    
ref|XP_008443654.1|  PREDICTED: protein HEADING DATE 3A                 208   6e-63    
gb|KFK27940.1|  hypothetical protein AALP_AA8G450800                    207   6e-63    
dbj|BAG72293.1|  Hd3a                                                   208   6e-63    
dbj|BAO03050.1|  Hd3a                                                   208   6e-63    
gb|AFK31116.1|  Hd3a                                                    207   7e-63    
dbj|BAO03052.1|  Hd3a                                                   207   7e-63    
gb|AFK31152.1|  Hd3a                                                    207   7e-63    
gb|AFU82577.1|  Hd3a protein                                            207   8e-63    
dbj|BAG72302.1|  Hd3a                                                   207   9e-63    
gb|AFK31166.1|  Hd3a                                                    207   9e-63    
gb|AEU08961.1|  flowering locus T                                       207   9e-63    
dbj|BAB61027.1|  Hd3a                                                   207   1e-62    
dbj|BAO02994.1|  Hd3a                                                   207   1e-62    
gb|AEZ63950.1|  FLOWERING LOCUS T2                                      207   1e-62    
gb|AFK31131.1|  Hd3a                                                    207   1e-62    
ref|NP_001056860.1|  Os06g0157700                                       207   1e-62    
dbj|BAH56285.1|  FT-like protein                                        207   1e-62    
gb|ABF56526.1|  flowering locus T-like protein                          207   1e-62    
dbj|BAK23998.1|  flowering locus T                                      207   1e-62    
gb|KDO46010.1|  hypothetical protein CISIN_1g030371mg                   207   1e-62    
gb|AFK31136.1|  Hd3a                                                    207   1e-62    
dbj|BAJ14520.1|  CEN-like protein                                       204   1e-62    
gb|AFB71092.1|  flowering locus T 3                                     206   2e-62    
gb|AFS60093.1|  flowering locus T                                       206   2e-62    
ref|XP_006480698.1|  PREDICTED: protein HEADING DATE 3A-like            206   2e-62    
gb|AFK31147.1|  Hd3a                                                    206   2e-62    
gb|AFK31068.1|  Hd3a                                                    206   3e-62    
gb|AGW52157.1|  TFL                                                     207   3e-62    
gb|ABR20499.1|  FTL2                                                    206   3e-62    
dbj|BAA77836.1|  CiFT                                                   206   3e-62    
dbj|BAO02906.1|  Hd3a                                                   206   3e-62    
dbj|BAG72292.1|  Hd3a                                                   206   3e-62    
gb|AFK31062.1|  Hd3a                                                    206   4e-62    
dbj|BAK40194.1|  flowering locus T                                      205   5e-62    
gb|ADF80899.1|  terminal flower 1                                       203   5e-62    
gb|AFK31059.1|  Hd3a                                                    206   5e-62    
gb|AGD93126.1|  flowering locus T                                       205   5e-62    
gb|ABI94606.1|  flowering locus T-like 2                                205   5e-62    
dbj|BAJ53154.1|  JHL23J11.9                                             205   5e-62    
ref|XP_006655811.1|  PREDICTED: protein HEADING DATE 3A-like            205   6e-62    



>dbj|BAE44112.1| CENTRORADIALIS homolog [Ipomoea nil]
Length=175

 Score =   362 bits (929),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 175/175 (100%), Positives = 175/175 (100%), Gaps = 0/175 (0%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD
Sbjct  1    MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF
Sbjct  61   LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR
Sbjct  121  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  175



>ref|XP_009594494.1| PREDICTED: CEN-like protein 2 [Nicotiana tomentosiformis]
Length=173

 Score =   305 bits (782),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 142/175 (81%), Positives = 161/175 (92%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MA+M+DPLVI RVVGDVVD+FS SVKM V+YN +KHVYNGHE FPS +TSKPKVEVH GD
Sbjct  1    MAQMTDPLVISRVVGDVVDYFSPSVKMCVIYNPSKHVYNGHELFPSFVTSKPKVEVHGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +RSFFTLIMTDPDVPGPSDPYLREHLHW++TDIPGTTDSSFG+E+V YE P PNIGIHRF
Sbjct  61   MRSFFTLIMTDPDVPGPSDPYLREHLHWVITDIPGTTDSSFGKEVVGYEMPMPNIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VFLL+KQK+RQ  TVS+  SRDRFNTRK+A++N+LGSPVAAVFFNCQRETAAR+R
Sbjct  121  VFLLFKQKKRQ--TVSAPLSRDRFNTRKYAEENELGSPVAAVFFNCQRETAARKR  173



>ref|XP_009611784.1| PREDICTED: CEN-like protein 4 [Nicotiana tomentosiformis]
 gb|AFY06671.1| TFL protein [Nicotiana tabacum]
Length=175

 Score =   305 bits (781),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 143/174 (82%), Positives = 162/174 (93%), Gaps = 1/174 (1%)
 Frame = -1

Query  791  AKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGDL  612
            +KMSDPLVIGRV+G+VVD+F+ SVKMSV YNS+KHVYNGHE FPS +TSKP+VEVH GDL
Sbjct  3    SKMSDPLVIGRVIGEVVDYFTPSVKMSVTYNSSKHVYNGHELFPSSVTSKPRVEVHGGDL  62

Query  611  RSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRFV  432
            RSFFTLIM DPDVPGPSDPYLREHLHWIVTDIPGTTD SFGREIV YE P+PNIGIHRFV
Sbjct  63   RSFFTLIMIDPDVPGPSDPYLREHLHWIVTDIPGTTDCSFGREIVGYEMPRPNIGIHRFV  122

Query  431  FLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            FLL+KQK+RQ++ +S+  SRDRFNTRKF+++N+LGSPVAAVFFNCQRETAARRR
Sbjct  123  FLLFKQKKRQTL-LSAPLSRDRFNTRKFSEENELGSPVAAVFFNCQRETAARRR  175



>ref|XP_009777303.1| PREDICTED: CEN-like protein 2 [Nicotiana sylvestris]
 sp|Q9XH43.1|CET2_TOBAC RecName: Full=CEN-like protein 2 [Nicotiana tabacum]
 gb|AAD43529.1|AF145260_1 CEN-like protein 2 [Nicotiana tabacum]
Length=175

 Score =   304 bits (779),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 162/174 (93%), Gaps = 1/174 (1%)
 Frame = -1

Query  791  AKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGDL  612
            +KMSDPLVIGRV+G+VVD+F+ SVKMSV YNS+KHVYNGHE FPS +TSKP+VEVH GDL
Sbjct  3    SKMSDPLVIGRVIGEVVDYFTPSVKMSVTYNSSKHVYNGHELFPSSVTSKPRVEVHGGDL  62

Query  611  RSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRFV  432
            RSFFT+IM DPDVPGPSDPYLREHLHWIVTDIPGTTD SFG+EIV YE P+PNIGIHRFV
Sbjct  63   RSFFTMIMIDPDVPGPSDPYLREHLHWIVTDIPGTTDCSFGKEIVGYEMPRPNIGIHRFV  122

Query  431  FLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            FLL+KQK+RQ+V +++  SRDRFNTRKFA++N+LGSPVAAVFFNCQRETAARRR
Sbjct  123  FLLFKQKKRQTV-LTAPLSRDRFNTRKFAEENELGSPVAAVFFNCQRETAARRR  175



>ref|XP_011088881.1| PREDICTED: protein CENTRORADIALIS [Sesamum indicum]
Length=176

 Score =   304 bits (778),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 143/176 (81%), Positives = 157/176 (89%), Gaps = 1/176 (1%)
 Frame = -1

Query  794  MAKMS-DPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDG  618
            MAKMS DPLVIGRVVGDVVDHFS +VKMSV YNSNKHVYNGHE FPS +TSKP+VEVH G
Sbjct  1    MAKMSSDPLVIGRVVGDVVDHFSSTVKMSVTYNSNKHVYNGHELFPSTVTSKPRVEVHGG  60

Query  617  DLRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHR  438
            D+RSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFG+E+VSYE P+PNIGIHR
Sbjct  61   DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGKEVVSYEMPRPNIGIHR  120

Query  437  FVFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            F F+L+KQK+RQ   V +   RD FNTR FA +N+LG PVAAV+FNCQRETAARRR
Sbjct  121  FAFVLFKQKKRQLGCVRAPACRDGFNTRNFAQENELGLPVAAVYFNCQRETAARRR  176



>sp|Q9XH42.1|CET4_TOBAC RecName: Full=CEN-like protein 4 [Nicotiana tabacum]
 gb|AAD43530.1|AF145261_1 CEN-like protein 4 [Nicotiana tabacum]
Length=175

 Score =   303 bits (777),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 161/174 (93%), Gaps = 1/174 (1%)
 Frame = -1

Query  791  AKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGDL  612
            +KMSDPLVIGRV+G+VVD+F+ SVKMSV YNS+KHVYNGHE FPS +TSKP+VEVH GDL
Sbjct  3    SKMSDPLVIGRVIGEVVDYFTPSVKMSVTYNSSKHVYNGHELFPSSVTSKPRVEVHGGDL  62

Query  611  RSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRFV  432
            RSFFTLIM DPDVPGPSDPYLREHLHWIVTDIPGTTD SFGREIV YE P+PNIGIHRFV
Sbjct  63   RSFFTLIMIDPDVPGPSDPYLREHLHWIVTDIPGTTDCSFGREIVGYEMPRPNIGIHRFV  122

Query  431  FLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            FLL+KQK+RQ++ +S+  SRDRFNTRKF+++N+LGSPVAA FFNCQRETAARRR
Sbjct  123  FLLFKQKKRQTL-LSAPLSRDRFNTRKFSEENELGSPVAAAFFNCQRETAARRR  175



>ref|NP_001233974.1| protein SELF-PRUNING [Solanum lycopersicum]
 sp|O82088.1|SELFP_SOLLC RecName: Full=Protein SELF-PRUNING [Solanum lycopersicum]
 gb|AAC26161.1| self-pruning protein [Solanum lycopersicum]
Length=175

 Score =   303 bits (776),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 142/177 (80%), Positives = 164/177 (93%), Gaps = 3/177 (2%)
 Frame = -1

Query  797  IMAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDG  618
            + +KM +PLVIGRV+G+VVD+F  SVKMSVVYN+NKHVYNGHEFFPS +TSKP+VEVH G
Sbjct  1    MASKMCEPLVIGRVIGEVVDYFCPSVKMSVVYNNNKHVYNGHEFFPSSVTSKPRVEVHGG  60

Query  617  DLRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHR  438
            DLRSFFTLIM DPDVPGPSDPYLREHLHWIVTDIPGTTD SFGRE+V YE P+PNIGIHR
Sbjct  61   DLRSFFTLIMIDPDVPGPSDPYLREHLHWIVTDIPGTTDCSFGREVVGYEMPRPNIGIHR  120

Query  437  FVFLLYKQKRRQSVTVSSSP-SRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            FVFLL+KQK+RQ  T+SS+P SRD+F++RKF+++N+LGSPVAAVFFNCQRETAARRR
Sbjct  121  FVFLLFKQKKRQ--TISSAPVSRDQFSSRKFSEENELGSPVAAVFFNCQRETAARRR  175



>ref|XP_007206006.1| hypothetical protein PRUPE_ppa012343mg [Prunus persica]
 gb|EMJ07205.1| hypothetical protein PRUPE_ppa012343mg [Prunus persica]
Length=173

 Score =   301 bits (772),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 144/175 (82%), Positives = 156/175 (89%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MAKMSDPLV+GRV+GDVVD FSQSVKM+V YNSNK VYNGHE FPS LT KPKVEVH GD
Sbjct  1    MAKMSDPLVVGRVIGDVVDSFSQSVKMTVTYNSNKKVYNGHELFPSSLTLKPKVEVHGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            LRSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FG+E+V YE P+PNIGIHRF
Sbjct  61   LRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDNTFGKEVVKYEIPRPNIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VFLL+KQK RQ  TV   PS+D FNTRKFA+ NDLG PVAAVFFN QRETAARRR
Sbjct  121  VFLLFKQKGRQ--TVIPPPSKDNFNTRKFAEANDLGLPVAAVFFNAQRETAARRR  173



>ref|NP_001275478.1| terminal flower 1 protein [Solanum tuberosum]
 gb|ABC24691.1| terminal flower 1 protein [Solanum tuberosum]
Length=175

 Score =   301 bits (771),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 140/177 (79%), Positives = 164/177 (93%), Gaps = 3/177 (2%)
 Frame = -1

Query  797  IMAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDG  618
            + +KM +PLVIGRV+G+VVD+F  SVKMSVVYN+NKHVYNGHEFFPS +TSKP+VEVH G
Sbjct  1    MASKMCEPLVIGRVIGEVVDNFCPSVKMSVVYNNNKHVYNGHEFFPSSVTSKPRVEVHGG  60

Query  617  DLRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHR  438
            DLR+FFTL+M DPDVPGPSDPYLREHLHWIVTDIPGTTD SFGRE+V YE P+PNIGIHR
Sbjct  61   DLRTFFTLVMIDPDVPGPSDPYLREHLHWIVTDIPGTTDCSFGREVVGYEMPRPNIGIHR  120

Query  437  FVFLLYKQKRRQSVTVSSSP-SRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            FVFLL+KQK+RQ  T+SS+P SRD+F++RKF+++N+LGSPVAAVFFNCQRETAARRR
Sbjct  121  FVFLLFKQKKRQ--TISSAPVSRDQFSSRKFSEENELGSPVAAVFFNCQRETAARRR  175



>ref|XP_008228487.1| PREDICTED: CEN-like protein 2 [Prunus mume]
Length=173

 Score =   299 bits (766),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 143/175 (82%), Positives = 155/175 (89%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MAKMSDPLV+GRV+GDVVD FSQSVKM+V YNSNK VYNGHE FPS LT KPKVEVH GD
Sbjct  1    MAKMSDPLVVGRVIGDVVDSFSQSVKMTVTYNSNKKVYNGHELFPSSLTLKPKVEVHGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            LRSFFTL+MTDPDVPGPSDPYLREHLHWIV DIPGTTD++FG+E+V YE P+PNIGIHRF
Sbjct  61   LRSFFTLVMTDPDVPGPSDPYLREHLHWIVNDIPGTTDTTFGKEMVKYEIPRPNIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VFLL+KQK RQ  TV   PS+D FNTRKFA+ NDLG PVAAVFFN QRETAARRR
Sbjct  121  VFLLFKQKGRQ--TVIPPPSKDHFNTRKFAEANDLGLPVAAVFFNAQRETAARRR  173



>gb|ACL27223.1| fasciculate [Capsicum frutescens]
Length=175

 Score =   296 bits (759),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 138/177 (78%), Positives = 161/177 (91%), Gaps = 3/177 (2%)
 Frame = -1

Query  797  IMAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDG  618
            + +KM +PLVIGRV+G+VVD+F  SVKMSV+YNSNKHVYNGHE FPS +T+KP+VEV+ G
Sbjct  1    MASKMCEPLVIGRVIGEVVDYFCPSVKMSVIYNSNKHVYNGHELFPSSVTTKPRVEVNGG  60

Query  617  DLRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHR  438
            DLRSFFTLIM DPDVPGPSDPYLREHLHWIVTDIPGTTD SFGRE+V YE P+P IGIHR
Sbjct  61   DLRSFFTLIMIDPDVPGPSDPYLREHLHWIVTDIPGTTDCSFGREVVGYEMPRPTIGIHR  120

Query  437  FVFLLYKQKRRQSVTVSSSP-SRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            FVFLL++QK+RQ  T+S++P SRDRF TRKF+++N+LGSPVAAVFFNCQRETAARRR
Sbjct  121  FVFLLFQQKKRQ--TISNAPLSRDRFCTRKFSEENELGSPVAAVFFNCQRETAARRR  175



>gb|AGK89940.1| centroradialis [Actinidia deliciosa]
Length=173

 Score =   295 bits (755),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 139/175 (79%), Positives = 158/175 (90%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MAK SDPLV+GRV+GDVVD+F  SVKMSV YNSNK VYNGHE FPS++T+KP+VEVH GD
Sbjct  1    MAKKSDPLVVGRVIGDVVDNFYGSVKMSVTYNSNKRVYNGHELFPSIVTTKPRVEVHGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +RSFFTLIMTDPDVPGPSDPYL+EHLHWI+TDIPGTTDSSFGRE+V+YE P+PNIGIHRF
Sbjct  61   MRSFFTLIMTDPDVPGPSDPYLKEHLHWIITDIPGTTDSSFGREVVNYEIPRPNIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VF+L+KQ  RQSVT    PSRD+F+TRKFA++NDL  PVAAVFFN QRETAARRR
Sbjct  121  VFVLFKQTSRQSVT--PPPSRDQFSTRKFAEENDLSLPVAAVFFNAQRETAARRR  173



>gb|AEK06124.1| terminal flowering 1 protein 1 [Populus balsamifera]
 gb|AEK06125.1| terminal flowering 1 protein 1 [Populus balsamifera]
 gb|AEK06126.1| terminal flowering 1 protein 1 [Populus balsamifera]
 gb|AEK06127.1| terminal flowering 1 protein 1 [Populus balsamifera]
 gb|AEK06128.1| terminal flowering 1 protein 1 [Populus balsamifera]
 gb|AEK06129.1| terminal flowering 1 protein 1 [Populus balsamifera]
 gb|AEK06130.1| terminal flowering 1 protein 1 [Populus balsamifera]
 gb|AEK06131.1| terminal flowering 1 protein 1 [Populus balsamifera]
Length=173

 Score =   295 bits (755),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 135/175 (77%), Positives = 159/175 (91%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MA +SDPLV+GRV+GDV+D+F+Q+VKM+V YNSNK VYNGHE FPS +T KPKVEVH GD
Sbjct  1    MANLSDPLVVGRVIGDVIDYFTQNVKMTVTYNSNKQVYNGHELFPSAVTHKPKVEVHGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +RSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FGRE+V+YE P+PNIGIHRF
Sbjct  61   MRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGREVVNYEMPRPNIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            V+LL++QK RQ  TVS+  SRD+FNTRKFA++N+L  PVAAVFFN QRETAARRR
Sbjct  121  VYLLFRQKGRQ--TVSTPSSRDKFNTRKFAEENELDLPVAAVFFNAQRETAARRR  173



>emb|CAI38702.1| self-pruning protein [Capsicum annuum]
 gb|AAZ66798.1| self-pruning-like protein [Capsicum annuum]
Length=175

 Score =   295 bits (755),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 134/176 (76%), Positives = 160/176 (91%), Gaps = 1/176 (1%)
 Frame = -1

Query  797  IMAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDG  618
            + +KM +PLVIGRV+G+VVD+F  SVKMSV+YNSNKHVYNGHE FPS +T+KP+VEV+ G
Sbjct  1    MASKMCEPLVIGRVIGEVVDYFCPSVKMSVIYNSNKHVYNGHELFPSSVTTKPRVEVNGG  60

Query  617  DLRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHR  438
            DLRSFFTLIM DPDVPGPSDPYLREHLHWIVTDIPGTTD S GRE+V YE P+PNIGIHR
Sbjct  61   DLRSFFTLIMIDPDVPGPSDPYLREHLHWIVTDIPGTTDCSLGREVVGYEMPRPNIGIHR  120

Query  437  FVFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            FVFLL++QK+RQ+++ +++ SRDRF TRKF+++N+LGSPVAAVFFNCQRETA RRR
Sbjct  121  FVFLLFQQKKRQTIS-NAALSRDRFCTRKFSEENELGSPVAAVFFNCQRETATRRR  175



>gb|ABW24963.1| terminal flower 1a [Gossypium hirsutum]
 gb|ABW24970.1| terminal flower 1a [Gossypium hirsutum]
 gb|AIY34696.1| terminal flower 1-like protein [Gossypium hirsutum]
Length=174

 Score =   295 bits (754),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 139/176 (79%), Positives = 160/176 (91%), Gaps = 3/176 (2%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MAK+SDPLV+GRV+GDV+D  S SVKMSV +N+NK VYNGHEFFPS +T+KPKVEVH GD
Sbjct  1    MAKLSDPLVVGRVIGDVIDALSPSVKMSVTFNTNKQVYNGHEFFPSAVTNKPKVEVHGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +RSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FGRE+V+YE P+PNIGIHRF
Sbjct  61   MRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGREMVNYEMPRPNIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSP-SRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VFLL+KQK RQ  TV S P SRDRF+TRKFA++N+LG PVAAV+FN QRETAARRR
Sbjct  121  VFLLFKQKGRQ--TVRSIPSSRDRFDTRKFAEENELGVPVAAVYFNAQRETAARRR  174



>gb|ABW24967.1| terminal flower 1a [Gossypium hirsutum]
 gb|ABY62769.1| terminal flower 1a [Gossypium hirsutum]
Length=174

 Score =   294 bits (753),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 139/176 (79%), Positives = 160/176 (91%), Gaps = 3/176 (2%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MAK+SDPLV+GRV+GDV+D  S SVKMSV +N+NK VYNGHEFFPS +T+KPKVEVH GD
Sbjct  1    MAKLSDPLVLGRVIGDVIDALSPSVKMSVTFNTNKQVYNGHEFFPSAVTNKPKVEVHGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +RSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FGRE+V+YE P+PNIGIHRF
Sbjct  61   MRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGREMVNYEMPRPNIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSP-SRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VFLL+KQK RQ  TV S P SRDRF+TRKFA++N+LG PVAAV+FN QRETAARRR
Sbjct  121  VFLLFKQKGRQ--TVRSIPSSRDRFDTRKFAEENELGVPVAAVYFNAQRETAARRR  174



>ref|XP_007015849.1| Centroradialis [Theobroma cacao]
 gb|EOY33468.1| Centroradialis [Theobroma cacao]
Length=174

 Score =   294 bits (753),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 134/175 (77%), Positives = 160/175 (91%), Gaps = 1/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MAK+SDPLV+GRV+GDV+D  + SVKM+V +N+NK VYNGHE FPS +T+KPKV+VH GD
Sbjct  1    MAKLSDPLVVGRVIGDVIDAITPSVKMTVTFNANKQVYNGHELFPSSVTNKPKVDVHGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +RSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FGRE+V+YE P+PNIGIHRF
Sbjct  61   MRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGREVVNYEMPRPNIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VFLL+KQKRRQ+V +S+  SRD FNTRKFA++N+LG PVAAV+FN QRETAARRR
Sbjct  121  VFLLFKQKRRQAV-ISTPSSRDHFNTRKFAEENELGLPVAAVYFNAQRETAARRR  174



>ref|NP_001267929.1| TFL1A protein [Vitis vinifera]
 gb|ABI99466.1| TFL1A protein [Vitis vinifera]
 emb|CAN69924.1| hypothetical protein VITISV_019378 [Vitis vinifera]
 gb|ACY80736.1| TFL1A protein [Vitis vinifera]
 gb|ADF80895.1| terminal flower 1 [Vitis aestivalis]
 gb|ADF80897.1| terminal flower 1 [Vitis cinerea]
 gb|ADF80902.1| terminal flower 1 [Vitis riparia]
 emb|CBI28335.3| unnamed protein product [Vitis vinifera]
Length=173

 Score =   294 bits (752),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 137/175 (78%), Positives = 156/175 (89%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MA+MSDPL++GRV+GDVVD F  +VKM+V YNSNK VYNGHE FPS +T KPK+EV  GD
Sbjct  1    MARMSDPLIVGRVIGDVVDSFCSTVKMTVTYNSNKQVYNGHELFPSSVTIKPKIEVEGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +RSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDS+FGREIV+YE P+PNIGIHRF
Sbjct  61   MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSTFGREIVNYEMPRPNIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VFLL+KQKRRQ+V   S  SRDRF+TR FA++N+LG PVAAVFFN QRETAAR+R
Sbjct  121  VFLLFKQKRRQTVNPPS--SRDRFSTRNFAEENELGPPVAAVFFNAQRETAARKR  173



>gb|ABW24965.1| terminal flower 1a [Gossypium raimondii]
Length=174

 Score =   293 bits (751),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 139/176 (79%), Positives = 159/176 (90%), Gaps = 3/176 (2%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MAK+SDPLV+GRV+GDV+D  S SVKMSV +N+NK VYNGHEFFPS +T+KPKVEVH GD
Sbjct  1    MAKLSDPLVLGRVIGDVIDALSPSVKMSVTFNTNKQVYNGHEFFPSAVTNKPKVEVHGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +RSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FGRE+V+YE P+PNIGIHRF
Sbjct  61   MRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGREMVNYEMPRPNIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSP-SRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VFLL+KQK RQ  TV S P SRDRF TRKFA++N+LG PVAAV+FN QRETAARRR
Sbjct  121  VFLLFKQKGRQ--TVRSIPSSRDRFYTRKFAEENELGVPVAAVYFNAQRETAARRR  174



>gb|ADO61015.1| terminal flower 1 [Helianthus annuus]
Length=173

 Score =   293 bits (750),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 140/175 (80%), Positives = 155/175 (89%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MA+MSDPLVIGRVVGDVVD+F+Q V MSV YNS+K VYNGHE FPS +T+KPKV+V  GD
Sbjct  1    MARMSDPLVIGRVVGDVVDNFTQCVDMSVTYNSSKQVYNGHELFPSSVTTKPKVDVRGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +RSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFG+E+VSYE P+PNIGIHRF
Sbjct  61   MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGKEVVSYEIPRPNIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VFLL+KQ+ RQ  TV+  PSR  FNTR FA +N LGSPVA VFFNCQRETAARRR
Sbjct  121  VFLLFKQRGRQ--TVNCPPSRHGFNTRNFAHENKLGSPVAGVFFNCQRETAARRR  173



>gb|ABW24961.1| terminal flower 1a [Gossypium arboreum]
Length=174

 Score =   293 bits (750),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 160/176 (91%), Gaps = 3/176 (2%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MAK+SDPLV+GRV+GDV+D  S SVKMSV +N+NK VYNGHEFFPS +T+KPKVEVH GD
Sbjct  1    MAKLSDPLVVGRVIGDVIDALSPSVKMSVTFNTNKQVYNGHEFFPSAVTNKPKVEVHGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +RSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FGRE+V+YE P+PNIGIHRF
Sbjct  61   MRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGREMVNYEMPRPNIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSP-SRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VFLL+KQK RQ  TV S P SRDRF+TRKFA++N+LG PVAAV+FN QRETA+RRR
Sbjct  121  VFLLFKQKGRQ--TVRSIPSSRDRFDTRKFAEENELGVPVAAVYFNAQRETASRRR  174



>gb|ACY80737.1| TFL1A protein [Vitis vinifera]
Length=173

 Score =   293 bits (749),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 136/175 (78%), Positives = 156/175 (89%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MA+M+DPL++GRV+GDVVD F  +VKM+V YNSNK VYNGHE FPS +T KPK+EV  GD
Sbjct  1    MARMTDPLIVGRVIGDVVDSFCSTVKMTVTYNSNKQVYNGHELFPSSVTIKPKIEVEGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +RSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDS+FGREIV+YE P+PNIGIHRF
Sbjct  61   MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSTFGREIVNYEMPRPNIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VFLL+KQKRRQ+V   S  SRDRF+TR FA++N+LG PVAAVFFN QRETAAR+R
Sbjct  121  VFLLFKQKRRQTVNPPS--SRDRFSTRTFAEENELGPPVAAVFFNAQRETAARKR  173



>gb|ADF80896.1| terminal flower 1 [Vitis californica]
Length=173

 Score =   293 bits (749),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 137/175 (78%), Positives = 155/175 (89%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MA+MSDPL++GRV+GDVVD F  +VKM+V YNSNK VYNGHE FPS +T KPK+EV  GD
Sbjct  1    MARMSDPLIVGRVIGDVVDSFCSTVKMTVTYNSNKQVYNGHELFPSSVTIKPKIEVEGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +RSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDS+FGREIV+YE P+PNIGIHRF
Sbjct  61   MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSTFGREIVNYEMPRPNIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VFLL+KQKRRQ+V   S  SRDRF+TR FA +N+LG PVAAVFFN QRETAAR+R
Sbjct  121  VFLLFKQKRRQTVNPPS--SRDRFSTRNFAGENELGPPVAAVFFNAQRETAARKR  173



>ref|XP_002312811.1| TFL1a family protein [Populus trichocarpa]
 gb|EEE86766.1| TFL1a family protein [Populus trichocarpa]
Length=173

 Score =   292 bits (748),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 135/175 (77%), Positives = 158/175 (90%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MA +SDPLV+GRV+GDV+D+F+ +VKM+V YNSNK VYNGHE FPS +T KPKVEVH GD
Sbjct  1    MANLSDPLVVGRVIGDVIDYFTPNVKMTVTYNSNKQVYNGHELFPSAVTHKPKVEVHGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +RSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FGRE+V+YE P+PNIGIHRF
Sbjct  61   MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGREVVNYEMPRPNIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            V+LL++QK RQ  TVS+  SRD+FNTRKFA++N+L  PVAAVFFN QRETAARRR
Sbjct  121  VYLLFRQKGRQ--TVSTPSSRDKFNTRKFAEENELDLPVAAVFFNAQRETAARRR  173



>gb|AAM46142.1|AF378127_1 terminal flower-like protein 1 [Vitis vinifera]
Length=173

 Score =   292 bits (748),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 136/175 (78%), Positives = 156/175 (89%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MA+MSDPL++GRV+GDVVD F  +VKM+V YNSNK VYNGHE FPS +T KPK+EV  GD
Sbjct  1    MARMSDPLIVGRVIGDVVDSFCSTVKMTVTYNSNKQVYNGHELFPSSVTIKPKIEVEGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +RSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDS+FGREIV+YE P+PNIGIHRF
Sbjct  61   MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSTFGREIVNYEMPRPNIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VFLL+KQKRRQ+V   S  SRDRF++R FA++N+LG PVAAVFFN QRETAAR+R
Sbjct  121  VFLLFKQKRRQTVNPPS--SRDRFSSRNFAEENELGPPVAAVFFNAQRETAARKR  173



>ref|XP_010031504.1| PREDICTED: protein CENTRORADIALIS-like [Eucalyptus grandis]
 gb|KCW50824.1| hypothetical protein EUGRSUZ_J00485 [Eucalyptus grandis]
Length=174

 Score =   292 bits (748),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 157/176 (89%), Gaps = 3/176 (2%)
 Frame = -1

Query  794  MAKMS-DPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDG  618
            MAK+S +PLV+GR++GDV D FS SVKM+V YNSNK V+NGHE FPS +T+KPKVEVH G
Sbjct  1    MAKVSSNPLVVGRIIGDVTDSFSASVKMTVTYNSNKQVFNGHELFPSWVTAKPKVEVHGG  60

Query  617  DLRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHR  438
            D+RSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FG+E+V YE P+PNIGIHR
Sbjct  61   DMRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGKEVVGYEMPRPNIGIHR  120

Query  437  FVFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            FVFLL+KQKRR+ V   S  SRDRFNTRKFADDN+LG PVAAVFFN QRETAARRR
Sbjct  121  FVFLLFKQKRREMVRPPS--SRDRFNTRKFADDNELGLPVAAVFFNAQRETAARRR  174



>ref|XP_011000909.1| PREDICTED: CEN-like protein 2 [Populus euphratica]
Length=173

 Score =   292 bits (747),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 134/175 (77%), Positives = 158/175 (90%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MA +SDPLV+GRV+GDV+D+F+ +VKM+V YNSNK VYNGHE FPS +T KPKVEVH GD
Sbjct  1    MANLSDPLVVGRVIGDVIDYFTPNVKMTVTYNSNKQVYNGHELFPSAVTHKPKVEVHGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +RSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FGRE+VSYE P+PNIGIHRF
Sbjct  61   MRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGREVVSYEMPRPNIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            V++L++QK RQ  TVS+  SRD+FNTRKFA++N+L  PVAAVFFN QRETAARRR
Sbjct  121  VYILFRQKGRQ--TVSTPSSRDKFNTRKFAEENELDLPVAAVFFNAQRETAARRR  173



>ref|XP_006384827.1| TFL1a family protein [Populus trichocarpa]
 gb|AAQ88444.1| CEN-like protein 1 [Populus trichocarpa]
 dbj|BAD01610.1| terminal flower 1 [Populus nigra]
 dbj|BAD01611.1| terminal flower 1 [Populus nigra]
 gb|ERP62624.1| TFL1a family protein [Populus trichocarpa]
Length=174

 Score =   292 bits (747),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 134/176 (76%), Positives = 159/176 (90%), Gaps = 3/176 (2%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSN-KHVYNGHEFFPSLLTSKPKVEVHDG  618
            MAKMS+PLV+GRV+GDV+DHF+ +VKM+V Y SN K V+NGHE FPS +T KPKVEVH G
Sbjct  1    MAKMSEPLVVGRVIGDVIDHFTANVKMTVTYQSNRKQVFNGHELFPSAVTHKPKVEVHGG  60

Query  617  DLRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHR  438
            D+RSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FGRE+++YE P+PNIGIHR
Sbjct  61   DMRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGREVMNYEMPRPNIGIHR  120

Query  437  FVFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            FVFLL+KQK RQ+VT  +  SRD+FNTRKFA++N+LG PVAAVFFN QRETAAR+R
Sbjct  121  FVFLLFKQKGRQTVTTPA--SRDKFNTRKFAEENELGLPVAAVFFNAQRETAARKR  174



>dbj|BAD22601.1| flowering locus T like protein [Populus nigra]
 dbj|BAD22602.1| flowering locus T like protein [Populus nigra]
 dbj|BAD22675.1| flowering locus T like protein [Populus nigra]
 dbj|BAD22676.1| flowering locus T like protein [Populus nigra]
 gb|AEK06114.1| terminal flowering 1 protein 1 [Populus balsamifera]
 gb|AEK06115.1| terminal flowering 1 protein 1 [Populus balsamifera]
 gb|AEK06116.1| terminal flowering 1 protein 1 [Populus balsamifera]
 gb|AEK06117.1| terminal flowering 1 protein 1 [Populus balsamifera]
 gb|AEK06118.1| terminal flowering 1 protein 1 [Populus balsamifera]
 gb|AEK06119.1| terminal flowering 1 protein 1 [Populus balsamifera]
 gb|AEK06120.1| terminal flowering 1 protein 1 [Populus balsamifera]
 gb|AEK06121.1| terminal flowering 1 protein 1 [Populus balsamifera]
 gb|AEK06122.1| terminal flowering 1 protein 1 [Populus balsamifera]
 gb|AEK06123.1| terminal flowering 1 protein 1 [Populus balsamifera]
Length=173

 Score =   291 bits (746),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 134/175 (77%), Positives = 158/175 (90%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MA +SDPLV+GRV+GDV+D+F+ +VKM+V YNSNK VYNGHE FPS +T KPKVEVH GD
Sbjct  1    MANLSDPLVVGRVIGDVIDYFTPNVKMTVTYNSNKQVYNGHELFPSAVTHKPKVEVHGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +RSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FGRE+V+YE P+PNIGIHRF
Sbjct  61   MRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGREVVNYEMPRPNIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            V+LL++QK RQ  TVS+  SRD+FNTRKFA++N+L  PVAAVFFN QRETAARRR
Sbjct  121  VYLLFRQKGRQ--TVSTPSSRDKFNTRKFAEENELDLPVAAVFFNAQRETAARRR  173



>ref|NP_001267654.1| protein SELF-PRUNING-like [Cucumis sativus]
 dbj|BAH28255.1| TFL1-like protein [Cucumis sativus]
 gb|KGN59123.1| hypothetical protein Csa_3G776350 [Cucumis sativus]
Length=177

 Score =   291 bits (746),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 136/174 (78%), Positives = 156/174 (90%), Gaps = 2/174 (1%)
 Frame = -1

Query  791  AKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGDL  612
            A  S+PLV+GRV+GDV+D F+QS+KMSV Y++NK V+NGHEFFPS + +KP+ E+H GDL
Sbjct  6    AMSSEPLVVGRVIGDVLDSFTQSMKMSVFYSNNKQVFNGHEFFPSAVAAKPRAEIHGGDL  65

Query  611  RSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRFV  432
            RSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FGRE+VSYETPKPNIGIHRFV
Sbjct  66   RSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGREVVSYETPKPNIGIHRFV  125

Query  431  FLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            F+L+KQKRRQSV   S  SR+RFNTR FA DNDLG PVAAV+FN QRETAARRR
Sbjct  126  FVLFKQKRRQSVNPPS--SRERFNTRAFAVDNDLGLPVAAVYFNAQRETAARRR  177



>ref|XP_010045223.1| PREDICTED: CEN-like protein 2 [Eucalyptus grandis]
 gb|KCW87386.1| hypothetical protein EUGRSUZ_B03867 [Eucalyptus grandis]
Length=173

 Score =   291 bits (745),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 133/175 (76%), Positives = 157/175 (90%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MA+MSDPLV+GRV+GDV+D F+ SVK +V YNSNKHV+NGHE FPS +T+KP+VEVH GD
Sbjct  1    MARMSDPLVVGRVIGDVIDCFATSVKTTVTYNSNKHVFNGHELFPSTVTAKPRVEVHGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +RSFFTL+MTDPDVPGPSDPYLREHLHW+VTDIPGTTD++FG+E+V YE P+PNIGIHRF
Sbjct  61   MRSFFTLVMTDPDVPGPSDPYLREHLHWMVTDIPGTTDATFGKEVVEYEMPRPNIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VF+L+KQKRR  V   S  SRDRFNTR+FA+DN+LG PVAAV+FN QRETAARRR
Sbjct  121  VFILFKQKRRDMVRGPS--SRDRFNTRRFAEDNELGLPVAAVYFNAQRETAARRR  173



>emb|CAJ44126.1| centroradialis flower development regulation protein [Misopates 
orontium]
Length=181

 Score =   291 bits (745),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 138/175 (79%), Positives = 155/175 (89%), Gaps = 4/175 (2%)
 Frame = -1

Query  782  SDPLVIGRVVGDVVDHFSQSVKMSVVYNSN---KHVYNGHEFFPSLLTSKPKVEVHDGDL  612
            SDPLVIGRV+GDVVDHF+ SVKMSV+YN+N   KHVYNGHE FPS +TS P+VEVH GD+
Sbjct  7    SDPLVIGRVIGDVVDHFTSSVKMSVIYNANNSVKHVYNGHELFPSAVTSTPRVEVHGGDM  66

Query  611  RSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRFV  432
            RSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFG+E+VSYE P+PNIGIHRFV
Sbjct  67   RSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGKEVVSYEMPRPNIGIHRFV  126

Query  431  FLLYKQKRR-QSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            FLL+KQK+R Q++      +RD FNTRKF  +N+LG PVAAVFFNCQRETAARRR
Sbjct  127  FLLFKQKKRGQAIMSPPLVTRDGFNTRKFTQENELGLPVAAVFFNCQRETAARRR  181



>dbj|BAD22599.1| terminal flower 1 [Populus nigra]
 dbj|BAD22600.1| terminal flower 1 [Populus nigra]
 dbj|BAG12897.1| terminal flower 1 [Populus nigra]
Length=174

 Score =   291 bits (745),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 133/176 (76%), Positives = 160/176 (91%), Gaps = 3/176 (2%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSN-KHVYNGHEFFPSLLTSKPKVEVHDG  618
            MAKMS+PLV+GRV+GDV+DHF+ +VKM+V Y S+ K V+NGHE FPS +T+KPKVEVH G
Sbjct  1    MAKMSEPLVVGRVIGDVIDHFTANVKMTVTYQSSRKQVFNGHELFPSAVTNKPKVEVHGG  60

Query  617  DLRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHR  438
            D+RSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FGRE+++YE P+PNIGIHR
Sbjct  61   DMRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGREVMNYEMPRPNIGIHR  120

Query  437  FVFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            FVFLL+KQK RQ+VT  +  SRD+FNTRKFA++N+LG PVAAVFFN QRETAAR+R
Sbjct  121  FVFLLFKQKGRQTVTTPA--SRDKFNTRKFAEENELGLPVAAVFFNAQRETAARKR  174



>gb|AGW23412.1| terminal flower [Mangifera indica]
Length=175

 Score =   291 bits (745),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 158/176 (90%), Gaps = 2/176 (1%)
 Frame = -1

Query  794  MAKM-SDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDG  618
            MA+M SDPLV+GRV+GDVVD   Q+VKM+V YNS+K VYNGHE FPS +T KPKVEVH G
Sbjct  1    MARMPSDPLVVGRVIGDVVDCCDQTVKMAVTYNSSKQVYNGHELFPSSVTVKPKVEVHGG  60

Query  617  DLRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHR  438
            D+RSFFTLIMTDPDVPGPSDPYLREHLHW+VTDIPGTTD++FG+E+V+YE P+PNIGIHR
Sbjct  61   DMRSFFTLIMTDPDVPGPSDPYLREHLHWVVTDIPGTTDATFGKELVNYEMPRPNIGIHR  120

Query  437  FVFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            FVFLL++QKRRQ+V +S   SRD FNTRKFA+DNDLG PVAAVFFN QRETAARRR
Sbjct  121  FVFLLFRQKRRQTV-ISIPSSRDGFNTRKFAEDNDLGQPVAAVFFNAQRETAARRR  175



>ref|XP_010557408.1| PREDICTED: protein CENTRORADIALIS-like [Tarenaya hassleriana]
Length=175

 Score =   290 bits (743),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 158/176 (90%), Gaps = 2/176 (1%)
 Frame = -1

Query  794  MAKMS-DPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDG  618
            MA++S DPLV+GRV+GDVVD+ +Q+VKM+V YNSNK VYNGHEFFPS +T KPKV+VH G
Sbjct  1    MARISSDPLVVGRVIGDVVDNVTQAVKMTVTYNSNKQVYNGHEFFPSAVTIKPKVDVHGG  60

Query  617  DLRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHR  438
            D+RSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FG+EIV YE P+PNIGIHR
Sbjct  61   DMRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGQEIVGYEMPRPNIGIHR  120

Query  437  FVFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            FVF+L+KQKRR SV VS    RD+FNTR FA +NDLG PVAAVFFNCQRETAARRR
Sbjct  121  FVFMLFKQKRRGSV-VSVPSYRDQFNTRMFAHENDLGLPVAAVFFNCQRETAARRR  175



>dbj|BAN13572.1| terminal flower1-like protein [Chrysanthemum seticuspe f. boreale]
 dbj|BAN89466.1| TFL1 family protein [Chrysanthemum seticuspe f. boreale]
Length=173

 Score =   290 bits (742),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 141/175 (81%), Positives = 151/175 (86%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MAKMSDPLVIGRVVGDVVD F+  V MSV YNS+K VYNGHE FPS +T+KPKVEV  GD
Sbjct  1    MAKMSDPLVIGRVVGDVVDTFTPCVDMSVTYNSSKQVYNGHELFPSSVTAKPKVEVRGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +RSFFTLIMTDPDVPGPSDPYLREHLHWIVT+IPGTTDSSFG E+V YE P+PNIGIHRF
Sbjct  61   MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTNIPGTTDSSFGNEVVGYEMPRPNIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VFLL+KQK RQSVT  S  SR  FNTR FA +N LGSPVA VFFNCQRETAARRR
Sbjct  121  VFLLFKQKGRQSVT--SPSSRHNFNTRSFALENQLGSPVAGVFFNCQRETAARRR  173



>ref|XP_004487504.1| PREDICTED: CEN-like protein 2-like [Cicer arietinum]
 ref|XP_004487505.1| PREDICTED: CEN-like protein 2-like [Cicer arietinum]
Length=177

 Score =   290 bits (742),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 134/172 (78%), Positives = 154/172 (90%), Gaps = 1/172 (1%)
 Frame = -1

Query  785  MSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGDLRS  606
            ++DPLVIGRVVGDVVD+F+ +VKMSV YN+ K VYNGHEFFPS LT KPKV +H GD+RS
Sbjct  7    LADPLVIGRVVGDVVDYFNTTVKMSVTYNNTKQVYNGHEFFPSSLTIKPKVHIHGGDMRS  66

Query  605  FFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRFVFL  426
            FFTLIMTDPDVPGPSDPYL+EHLHWIVTDIPGTTD++FG+E++ YE P+PNIGIHRFVF+
Sbjct  67   FFTLIMTDPDVPGPSDPYLKEHLHWIVTDIPGTTDATFGKEVIKYEMPRPNIGIHRFVFI  126

Query  425  LYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            LYKQKRRQ+V +    SRD FNT+KFA+DNDLG PVAAVFFN QRETAARRR
Sbjct  127  LYKQKRRQTV-MKIPTSRDHFNTKKFAEDNDLGPPVAAVFFNAQRETAARRR  177



>ref|XP_006487964.1| PREDICTED: CEN-like protein 2-like [Citrus sinensis]
Length=175

 Score =   290 bits (742),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 139/176 (79%), Positives = 157/176 (89%), Gaps = 2/176 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKH-VYNGHEFFPSLLTSKPKVEVHDG  618
            MAKMSD LV+GRVVG+V+D+F+ SVKM+V YNS K  VYNGHE FPS +T KPKVEV  G
Sbjct  1    MAKMSDALVLGRVVGEVIDYFTPSVKMTVTYNSIKQQVYNGHEMFPSQVTQKPKVEVLGG  60

Query  617  DLRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHR  438
            D+RSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTD+SFG+E+V+YE P+PNIGIHR
Sbjct  61   DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGKEVVNYEIPRPNIGIHR  120

Query  437  FVFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            FVFLL+KQKRRQ+  +S   SRDRFNTRKFA++NDLG PVAAVFFN QRETAARRR
Sbjct  121  FVFLLFKQKRRQT-EMSVPASRDRFNTRKFAEENDLGLPVAAVFFNAQRETAARRR  175



>sp|Q41261.1|CEN_ANTMA RecName: Full=Protein CENTRORADIALIS [Antirrhinum majus]
 pdb|1QOU|A Chain A, Cen (Centroradialis) Protein From Antirrhinum
 pdb|1QOU|B Chain B, Cen (Centroradialis) Protein From Antirrhinum
 gb|AAB36112.1| CEN [Antirrhinum]
 prf||2206476A CEN gene
Length=181

 Score =   290 bits (742),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 138/175 (79%), Positives = 153/175 (87%), Gaps = 4/175 (2%)
 Frame = -1

Query  782  SDPLVIGRVVGDVVDHFSQSVKMSVVYNSN---KHVYNGHEFFPSLLTSKPKVEVHDGDL  612
            SDPLVIGRV+GDVVDHF+ +VKMSV+YNSN   KHVYNGHE FPS +TS P+VEVH GD+
Sbjct  7    SDPLVIGRVIGDVVDHFTSTVKMSVIYNSNNSIKHVYNGHELFPSAVTSTPRVEVHGGDM  66

Query  611  RSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRFV  432
            RSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFG+E+VSYE P+PNIGIHRFV
Sbjct  67   RSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGKEVVSYEMPRPNIGIHRFV  126

Query  431  FLLYKQKRRQSVTVSSS-PSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            FLL+KQK+R    +S     RD FNTRKF  +N+LG PVAAVFFNCQRETAARRR
Sbjct  127  FLLFKQKKRGQAMLSPPVVCRDGFNTRKFTQENELGLPVAAVFFNCQRETAARRR  181



>ref|XP_011007279.1| PREDICTED: CEN-like protein 2 [Populus euphratica]
Length=174

 Score =   290 bits (741),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 132/176 (75%), Positives = 159/176 (90%), Gaps = 3/176 (2%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSN-KHVYNGHEFFPSLLTSKPKVEVHDG  618
            MAKMS+PLV+GRV+GDV+DHF+ +VKM+V Y SN K V+NGHE FPS +T KPKVEVH G
Sbjct  1    MAKMSEPLVVGRVIGDVIDHFTANVKMTVTYQSNRKQVFNGHELFPSAVTHKPKVEVHGG  60

Query  617  DLRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHR  438
            D+RSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FGRE+++YE P+PNIGIHR
Sbjct  61   DMRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGREVMNYEMPRPNIGIHR  120

Query  437  FVFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            FVF+L+KQK RQ+VT  +  SR++FNTRKFA++N+LG PVAAVFFN QRETAAR+R
Sbjct  121  FVFVLFKQKGRQTVTTPA--SREKFNTRKFAEENELGLPVAAVFFNAQRETAARKR  174



>ref|XP_002453931.1| hypothetical protein SORBIDRAFT_04g021650 [Sorghum bicolor]
 gb|EES06907.1| hypothetical protein SORBIDRAFT_04g021650 [Sorghum bicolor]
Length=173

 Score =   290 bits (741),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 131/175 (75%), Positives = 160/175 (91%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            M+++ +PL++G+V+G+V+DHF+ +VKM V YNSNK V+NGHEFFPS +T+KP+VEV  GD
Sbjct  1    MSRVLEPLIVGKVIGEVLDHFNPTVKMVVTYNSNKQVFNGHEFFPSAVTAKPRVEVQGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            LRSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD+SFGRE+VSYETPKPNIGIHRF
Sbjct  61   LRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGREVVSYETPKPNIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            +F+L++QKRRQ+V   S  S+DRF+TR+FA+DNDLG PVAAV+FN QRETAARRR
Sbjct  121  IFVLFRQKRRQAVNPPS--SKDRFSTRQFAEDNDLGLPVAAVYFNAQRETAARRR  173



>emb|CAC21563.1| centroradialis [Antirrhinum majus]
Length=181

 Score =   289 bits (740),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 137/175 (78%), Positives = 153/175 (87%), Gaps = 4/175 (2%)
 Frame = -1

Query  782  SDPLVIGRVVGDVVDHFSQSVKMSVVYNSN---KHVYNGHEFFPSLLTSKPKVEVHDGDL  612
            SDPLVIGRV+GDVVDHF+ +VKMSV+YN+N   KHVYNGHE FPS +TS P+VEVH GD+
Sbjct  7    SDPLVIGRVIGDVVDHFTSTVKMSVIYNANNSIKHVYNGHELFPSAVTSTPRVEVHGGDM  66

Query  611  RSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRFV  432
            RSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFG+E+VSYE P+PNIGIHRFV
Sbjct  67   RSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGKEVVSYEMPRPNIGIHRFV  126

Query  431  FLLYKQKRRQSVTVSSS-PSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            FLL+KQK+R    +S     RD FNTRKF  +N+LG PVAAVFFNCQRETAARRR
Sbjct  127  FLLFKQKKRGQAMLSPPVVCRDGFNTRKFTQENELGLPVAAVFFNCQRETAARRR  181



>gb|KDP31551.1| hypothetical protein JCGZ_15206 [Jatropha curcas]
 gb|AID51386.1| terminal flower 1a [Jatropha curcas]
 gb|AID51392.1| terminal flower 1a [Jatropha curcas]
Length=173

 Score =   288 bits (738),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 132/175 (75%), Positives = 155/175 (89%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MAK+SDPLV+GRV+GDV+D+F+  +KM+V YNSNK VYNGHE FPS +T KPKVEV   D
Sbjct  1    MAKVSDPLVVGRVIGDVIDYFTPCMKMTVSYNSNKQVYNGHELFPSAVTHKPKVEVQGAD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +RSFFTL+MTDPDVPGPSDPY REHLHWIVTDIPGTTD++FG+E+VSYE P+PNIGIHRF
Sbjct  61   MRSFFTLVMTDPDVPGPSDPYQREHLHWIVTDIPGTTDATFGKEVVSYEMPRPNIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VF+L+KQKRRQ V   +  SRD+FNTRKFA++N+LG PVAAVFFN QRETAARRR
Sbjct  121  VFILFKQKRRQMVNTPT--SRDKFNTRKFAEENELGLPVAAVFFNAQRETAARRR  173



>gb|AFI93431.1| terminal flower 1 [Rosa chinensis]
Length=173

 Score =   288 bits (737),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 135/175 (77%), Positives = 155/175 (89%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MAKMSDPLV+GRV+GDVVD+FS SVKM+V YNS+K VYNGHE FPS +T+KPKVEV  GD
Sbjct  1    MAKMSDPLVVGRVIGDVVDYFSPSVKMAVTYNSSKKVYNGHELFPSSVTTKPKVEVQGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            LRSFFTL+MTDPDVPGPSDPYL+EHLHWIVTDIPGTTD++FGRE+V YE P+PNIGIHRF
Sbjct  61   LRSFFTLVMTDPDVPGPSDPYLKEHLHWIVTDIPGTTDNTFGREVVKYEMPRPNIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VFLL+KQK RQ  TV   PS+D F++RKFA+ N+ G PVAAVFFN QRETAAR+R
Sbjct  121  VFLLFKQKGRQ--TVIPPPSKDHFDSRKFAEANEFGLPVAAVFFNAQRETAARKR  173



>gb|ADF80900.1| terminal flower 1 [Vitis mustangensis]
Length=173

 Score =   288 bits (736),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 135/175 (77%), Positives = 154/175 (88%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MA+MSDPL++G V+GDVVD F  +VKM+V YNSNK VYNGHE FPS +T KPK+EV  GD
Sbjct  1    MARMSDPLIVGGVIGDVVDSFCSTVKMTVTYNSNKQVYNGHELFPSSVTIKPKIEVEGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +RSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDS+FGREIV+YE P+PNIGIH F
Sbjct  61   MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSTFGREIVNYEMPRPNIGIHGF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VFLL+KQKRRQ+V   S  SRDRF+TR FA++N+LG PVAAVFFN QRETAAR+R
Sbjct  121  VFLLFKQKRRQTVNPPS--SRDRFSTRNFAEENELGPPVAAVFFNAQRETAARKR  173



>emb|CAC21564.1| centroradialis [Antirrhinum majus]
Length=181

 Score =   288 bits (737),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 136/175 (78%), Positives = 153/175 (87%), Gaps = 4/175 (2%)
 Frame = -1

Query  782  SDPLVIGRVVGDVVDHFSQSVKMSVVYNSN---KHVYNGHEFFPSLLTSKPKVEVHDGDL  612
            SDPLVIGRV+GDVVDHF+ +V+MSV+YN+N   KHVYNGHE FPS +TS P+VEVH GD+
Sbjct  7    SDPLVIGRVIGDVVDHFTSTVQMSVIYNANNSIKHVYNGHELFPSAVTSTPRVEVHGGDM  66

Query  611  RSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRFV  432
            RSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFG+E+VSYE P+PNIGIHRFV
Sbjct  67   RSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGKEVVSYEMPRPNIGIHRFV  126

Query  431  FLLYKQKRRQSVTVSSS-PSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            FLL+KQK+R    +S     RD FNTRKF  +N+LG PVAAVFFNCQRETAARRR
Sbjct  127  FLLFKQKKRGQAMLSPPVVCRDGFNTRKFTQENELGLPVAAVFFNCQRETAARRR  181



>ref|XP_006424257.1| hypothetical protein CICLE_v10029782mg [Citrus clementina]
 gb|ESR37497.1| hypothetical protein CICLE_v10029782mg [Citrus clementina]
 gb|KDO58063.1| hypothetical protein CISIN_1g030564mg [Citrus sinensis]
Length=175

 Score =   287 bits (735),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 137/176 (78%), Positives = 157/176 (89%), Gaps = 2/176 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKH-VYNGHEFFPSLLTSKPKVEVHDG  618
            MAKMSD LV+GRVVG+V+D+F+ SVKM++ Y+S K  VYNGHE FPS +T KPKVEV  G
Sbjct  1    MAKMSDALVLGRVVGEVIDYFTPSVKMTITYSSIKQQVYNGHEMFPSQVTQKPKVEVLGG  60

Query  617  DLRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHR  438
            D+RSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTD+SFG+E+V+YE P+PNIGIHR
Sbjct  61   DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGKEVVNYEIPRPNIGIHR  120

Query  437  FVFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            FVFLL+KQKRRQ+  +S   SRDRFNTRKFA++NDLG PVAAVFFN QRETAARRR
Sbjct  121  FVFLLFKQKRRQT-EMSVPASRDRFNTRKFAEENDLGLPVAAVFFNAQRETAARRR  175



>emb|CDP06933.1| unnamed protein product [Coffea canephora]
Length=173

 Score =   285 bits (730),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 137/175 (78%), Positives = 153/175 (87%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MAK++DPLVIGR+VGDVVD+ S +VKMSV YNSNK VYNGHE +PS + +KPKVEV  GD
Sbjct  1    MAKVADPLVIGRIVGDVVDNISPTVKMSVTYNSNKQVYNGHELYPSSVVNKPKVEVLGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +RSFFTL+MTDPD PGPSDPYLREHLHWIVTDIPGTTDSSFG E+VSYE P+PNIGIHRF
Sbjct  61   MRSFFTLVMTDPDAPGPSDPYLREHLHWIVTDIPGTTDSSFGIEMVSYEVPRPNIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VFLL+KQK RQ  TV+   SRD F+TRKFA +N LG PVAAVFFNCQRETAARRR
Sbjct  121  VFLLFKQKGRQ--TVNPPLSRDGFSTRKFAQENQLGLPVAAVFFNCQRETAARRR  173



>dbj|BAO93910.1| terminal flower 1 [Fragaria x ananassa]
Length=173

 Score =   285 bits (729),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 133/175 (76%), Positives = 154/175 (88%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MAK+SDPLV+GRV+GDV+D F+ SVKM+V YNS+K VYNGHE +PS +T KPKVEVH GD
Sbjct  1    MAKISDPLVVGRVIGDVIDCFTPSVKMTVTYNSSKKVYNGHELYPSSVTVKPKVEVHGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +RSFFTL+MTDPDVPGPSDPYL+EHLHWIVTDIPGTTD++FGRE+V YE P+PNIGIHRF
Sbjct  61   MRSFFTLVMTDPDVPGPSDPYLKEHLHWIVTDIPGTTDNTFGREVVKYEMPRPNIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VFLL+KQK RQ  TV   PS+D FN+RKFA+ N+ G PVAAVFFN QRETAARRR
Sbjct  121  VFLLFKQKGRQ--TVIPPPSKDHFNSRKFAEANEFGLPVAAVFFNAQRETAARRR  173



>ref|NP_001280940.1| CEN-like protein 2 [Malus domestica]
 dbj|BAG31954.1| CENTRORADIALIS like protein [Malus domestica]
 dbj|BAG31958.1| CENTRORADIALIS like protein [Malus domestica]
Length=174

 Score =   285 bits (728),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 137/176 (78%), Positives = 153/176 (87%), Gaps = 3/176 (2%)
 Frame = -1

Query  794  MAKMS-DPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDG  618
            MA MS DPLV+GRV+GDVVD+FS SV+M+V YNSNK VYNGHE FPS +T KPKVEVH G
Sbjct  1    MAMMSSDPLVVGRVIGDVVDYFSPSVRMTVTYNSNKKVYNGHELFPSSVTIKPKVEVHGG  60

Query  617  DLRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHR  438
            DLRSFFTL+MTDPDVPGPSDPYL+EHLHWIVTDIPGTTD++FG+E+V YE P+PNIGIHR
Sbjct  61   DLRSFFTLVMTDPDVPGPSDPYLKEHLHWIVTDIPGTTDNTFGKEVVKYEMPRPNIGIHR  120

Query  437  FVFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            FVFLL+KQK RQ  TV    S+D FNTRKFA+ NDLG PV AVFFN QRETAARRR
Sbjct  121  FVFLLFKQKARQ--TVIPPASKDHFNTRKFAEANDLGLPVTAVFFNAQRETAARRR  174



>ref|XP_010417907.1| PREDICTED: protein CENTRORADIALIS-like [Camelina sativa]
Length=175

 Score =   285 bits (728),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 135/176 (77%), Positives = 156/176 (89%), Gaps = 2/176 (1%)
 Frame = -1

Query  794  MAKMS-DPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDG  618
            MA++S DPL++GRV+GDVVD+  Q+VKM+V YNS+K VYNGHE FPS +T+KPKVEVH G
Sbjct  1    MARISSDPLMVGRVIGDVVDNCLQAVKMTVTYNSDKQVYNGHELFPSAVTNKPKVEVHGG  60

Query  617  DLRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHR  438
            DLRSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD SFG+E++ YE P+PNIGIHR
Sbjct  61   DLRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDVSFGKEMIGYEMPRPNIGIHR  120

Query  437  FVFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            FV+LL+KQ RR SV VS    RD+FNTR+FA +NDLG PVAAVFFNCQRETAARRR
Sbjct  121  FVYLLFKQNRRGSV-VSVPSYRDQFNTREFAHENDLGLPVAAVFFNCQRETAARRR  175



>ref|NP_180324.1| protein CENTRORADIALIS-like [Arabidopsis thaliana]
 sp|Q9ZNV5.1|CEN_ARATH RecName: Full=Protein CENTRORADIALIS-like [Arabidopsis thaliana]
 gb|AAC73043.1| similar to terminal flower [Arabidopsis thaliana]
 dbj|BAA75933.1| ATC [Arabidopsis thaliana]
 dbj|BAA75931.1| ATC [Arabidopsis thaliana]
 dbj|BAA75932.1| ATC [Arabidopsis thaliana]
 gb|AAL38687.1| putative terminal flower protein [Arabidopsis thaliana]
 gb|AAM15187.1| similar to terminal flower [Arabidopsis thaliana]
 gb|AAM20165.1| putative terminal flower protein [Arabidopsis thaliana]
 gb|AEC08014.1| protein CENTRORADIALIS-like [Arabidopsis thaliana]
Length=175

 Score =   284 bits (727),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 135/176 (77%), Positives = 156/176 (89%), Gaps = 2/176 (1%)
 Frame = -1

Query  794  MAKMS-DPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDG  618
            MA++S DPL++GRV+GDVVD+  Q+VKM+V YNS+K VYNGHE FPS++T KPKVEVH G
Sbjct  1    MARISSDPLMVGRVIGDVVDNCLQAVKMTVTYNSDKQVYNGHELFPSVVTYKPKVEVHGG  60

Query  617  DLRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHR  438
            D+RSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD SFG+EI+ YE P+PNIGIHR
Sbjct  61   DMRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDVSFGKEIIGYEMPRPNIGIHR  120

Query  437  FVFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            FV+LL+KQ RR SV VS    RD+FNTR+FA +NDLG PVAAVFFNCQRETAARRR
Sbjct  121  FVYLLFKQTRRGSV-VSVPSYRDQFNTREFAHENDLGLPVAAVFFNCQRETAARRR  175



>ref|XP_002876387.1| hypothetical protein ARALYDRAFT_486134 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52646.1| hypothetical protein ARALYDRAFT_486134 [Arabidopsis lyrata subsp. 
lyrata]
Length=175

 Score =   284 bits (727),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 134/176 (76%), Positives = 156/176 (89%), Gaps = 2/176 (1%)
 Frame = -1

Query  794  MAKMS-DPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDG  618
            MA++S DPL++GRV+GDVVD+  Q+VKM+V YNS+K VYNGHE FPS +T+KPKVEVH G
Sbjct  1    MARISSDPLMVGRVIGDVVDNCLQAVKMTVTYNSDKQVYNGHELFPSAVTNKPKVEVHGG  60

Query  617  DLRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHR  438
            D+RSFFTL+MTDPDVPGPSDPYLREHLHW+VTDIPGTTD SFG+EI+ YE P+PNIGIHR
Sbjct  61   DMRSFFTLVMTDPDVPGPSDPYLREHLHWVVTDIPGTTDVSFGKEIIGYEMPRPNIGIHR  120

Query  437  FVFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            FV+LL+KQ RR SV VS    RD+FNTR+FA +NDLG PVAAVFFNCQRETAARRR
Sbjct  121  FVYLLFKQNRRGSV-VSVPSYRDQFNTREFAHENDLGLPVAAVFFNCQRETAARRR  175



>ref|XP_003596800.1| Terminal flower [Medicago truncatula]
 gb|AES67051.1| terminal flower 1 [Medicago truncatula]
Length=173

 Score =   284 bits (727),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 131/175 (75%), Positives = 156/175 (89%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            M+ ++DPL IGRV+GDVVD+F+ ++KMSV YN+ K VYNGHEFFPS +T+KPKV++H GD
Sbjct  1    MSIVTDPLAIGRVIGDVVDYFTSTMKMSVTYNT-KQVYNGHEFFPSSVTTKPKVQIHGGD  59

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +RSFFTL+MTDPDVPGPSDPYL+EHLHWIVTDIPGTTD++FG+E++ YE P+PNIGIHRF
Sbjct  60   MRSFFTLVMTDPDVPGPSDPYLKEHLHWIVTDIPGTTDATFGKEVMKYEMPRPNIGIHRF  119

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VFLLYKQKRRQ+V +    SRD FNT+KFA DNDLG PVAAVFFN QRETAARRR
Sbjct  120  VFLLYKQKRRQTV-MKIPTSRDLFNTKKFAQDNDLGPPVAAVFFNAQRETAARRR  173



>ref|XP_010510761.1| PREDICTED: protein CENTRORADIALIS-like [Camelina sativa]
 ref|XP_010473146.1| PREDICTED: protein CENTRORADIALIS-like [Camelina sativa]
Length=175

 Score =   284 bits (726),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 134/176 (76%), Positives = 156/176 (89%), Gaps = 2/176 (1%)
 Frame = -1

Query  794  MAKMS-DPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDG  618
            MA++S DPL++GRV+GDVVD+  Q+VKM+V YNS+K VYNGHE FPS +T+KPKVEVH G
Sbjct  1    MARISSDPLMVGRVIGDVVDNCLQAVKMTVTYNSDKQVYNGHELFPSAVTNKPKVEVHGG  60

Query  617  DLRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHR  438
            D+RSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD SFG+E++ YE P+PNIGIHR
Sbjct  61   DMRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDVSFGKEMIGYEMPRPNIGIHR  120

Query  437  FVFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            FV+LL+KQ RR SV VS    RD+FNTR+FA +NDLG PVAAVFFNCQRETAARRR
Sbjct  121  FVYLLFKQNRRGSV-VSVPSYRDQFNTREFAHENDLGLPVAAVFFNCQRETAARRR  175



>ref|XP_004952639.1| PREDICTED: protein SELF-PRUNING-like [Setaria italica]
Length=173

 Score =   283 bits (724),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 159/175 (91%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            M+++ +PL++G+V+G+V+DHF+ +VKM V YNSNK V+NGHEFFPS++ +KP+VEV  GD
Sbjct  1    MSRVLEPLIVGKVIGEVLDHFNPTVKMMVTYNSNKQVFNGHEFFPSVVANKPRVEVQGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            LRSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD+SFGRE+VSYE P+PNIGIHRF
Sbjct  61   LRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGRELVSYENPRPNIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            +F+L++Q RRQ+V+  S  SRDRF+TR+FA++NDLG PVAAV+FN QRETAARRR
Sbjct  121  IFVLFRQSRRQAVSPPS--SRDRFSTRQFAEENDLGLPVAAVYFNAQRETAARRR  173



>ref|XP_009364306.1| PREDICTED: CEN-like protein 2 isoform X2 [Pyrus x bretschneideri]
Length=173

 Score =   283 bits (723),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 135/175 (77%), Positives = 152/175 (87%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            M+++ DPLV+GRV+GDVVD+FS SVKM+V YNSNK VYNGHE FPS +T KPKVEVH GD
Sbjct  1    MSRLLDPLVVGRVIGDVVDYFSPSVKMTVSYNSNKKVYNGHELFPSSVTIKPKVEVHGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            LRSFFTL+MTDPDVPGPSDPYL+EHLHWIVTDIPGTTD++FG E+V YE P+PNIGIHRF
Sbjct  61   LRSFFTLVMTDPDVPGPSDPYLKEHLHWIVTDIPGTTDNTFGIEVVKYEMPRPNIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VFLL+KQK RQ  TV    S+D FNTRKFA+ NDLG PV AVFFN QRETAARRR
Sbjct  121  VFLLFKQKGRQ--TVIPPASKDHFNTRKFAEANDLGLPVTAVFFNAQRETAARRR  173



>gb|ACX53295.1| terminal flower 1-like protein [Crocus sativus]
Length=173

 Score =   283 bits (723),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 130/175 (74%), Positives = 154/175 (88%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MA++ +PL++GRV+G+V+D F QS+KM V YNSNK V NGHEFFPS +  KP+VEV   D
Sbjct  1    MARVMEPLIVGRVIGEVLDSFEQSMKMMVTYNSNKLVCNGHEFFPSAVAPKPRVEVQGAD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +RSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD+SFGRE+VSYE+P+PNIGIHRF
Sbjct  61   MRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGREMVSYESPRPNIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VF+L++QKRRQS  V   PSRDRF+TR+FA +NDLG PVAAV+FN QRETAARRR
Sbjct  121  VFVLFRQKRRQS--VGPPPSRDRFSTRRFAAENDLGLPVAAVYFNAQRETAARRR  173



>emb|CAH67157.1| H0717B12.4 [Oryza sativa Indica Group]
 gb|EAY94026.1| hypothetical protein OsI_15804 [Oryza sativa Indica Group]
Length=173

 Score =   283 bits (723),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 130/175 (74%), Positives = 157/175 (90%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            M+++ +PLV+G+V+G+V+D+F+ +VKM+  Y+SNK V+NGHEFFPS + SKP+VEV  GD
Sbjct  1    MSRVLEPLVVGKVIGEVIDNFNPTVKMTATYSSNKQVFNGHEFFPSAVVSKPRVEVQGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            LRSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD+SFGRE+VSYE+PKPNIGIHRF
Sbjct  61   LRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGREVVSYESPKPNIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            V +L+KQKRRQ+VT  S  SRD F+TR+FA DNDLG PVAAV+FN QRETAARRR
Sbjct  121  VLVLFKQKRRQAVTPPS--SRDYFSTRRFAADNDLGLPVAAVYFNAQRETAARRR  173



>ref|XP_009371917.1| PREDICTED: CEN-like protein 2 isoform X2 [Pyrus x bretschneideri]
Length=173

 Score =   283 bits (723),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 134/175 (77%), Positives = 153/175 (87%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            M+++ DPLV+GRV+GDVVD+FS SVKM+V YNSNK VYNGHE FPS +T KPKVEVH GD
Sbjct  1    MSRLLDPLVVGRVIGDVVDYFSPSVKMTVSYNSNKKVYNGHELFPSSVTIKPKVEVHGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            LRSFFTL+MTDPDVPGPSDPYL+EHLHWIVTDIPGTTD++FG E+V YE P+PNIGIHRF
Sbjct  61   LRSFFTLVMTDPDVPGPSDPYLKEHLHWIVTDIPGTTDNTFGIEVVKYEMPRPNIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VFLL+KQK RQ+V   +  S+D FNTRKFA+ NDLG PV AVFFN QRETAARRR
Sbjct  121  VFLLFKQKGRQTVIPPT--SKDHFNTRKFAEANDLGLPVTAVFFNAQRETAARRR  173



>ref|XP_006647339.1| PREDICTED: protein SELF-PRUNING-like [Oryza brachyantha]
Length=173

 Score =   283 bits (723),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 157/175 (90%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            M+++ +PL++G+V+G+V+D+F+ +VKM   Y +NK V+NGHEFFPS +  KP+VEV  GD
Sbjct  1    MSRVLEPLIVGKVIGEVLDNFNPTVKMMATYGANKQVFNGHEFFPSAVAGKPRVEVQGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            LRSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD+SFGRE+VSYE+P+PNIGIHRF
Sbjct  61   LRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGREVVSYESPRPNIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            +F+L++QKRRQ+  VS  PSRDRF+TR+FA+DNDLG PVAAV+FN QRETAARRR
Sbjct  121  IFVLFRQKRRQA--VSPPPSRDRFSTRQFAEDNDLGLPVAAVYFNAQRETAARRR  173



>ref|NP_001280813.1| CEN-like protein 2 [Malus domestica]
 dbj|BAG31953.1| CENTRORADIALIS like protein [Malus domestica]
 dbj|BAG31957.1| CENTRORADIALIS like protein [Malus domestica]
Length=174

 Score =   282 bits (722),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 135/171 (79%), Positives = 149/171 (87%), Gaps = 2/171 (1%)
 Frame = -1

Query  782  SDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGDLRSF  603
            SDPLV+GRV+GDVVD+FS SVKM+V YNSNK VYNGHE FPS +T KPKVEVH GDLRSF
Sbjct  6    SDPLVVGRVIGDVVDYFSPSVKMTVSYNSNKKVYNGHELFPSSVTIKPKVEVHGGDLRSF  65

Query  602  FTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRFVFLL  423
            FTL+MTDPDVPGPSDPYL+EHLHWIVTDIPGTTD++FG E+V YE P+PNIGIHRFVFLL
Sbjct  66   FTLVMTDPDVPGPSDPYLKEHLHWIVTDIPGTTDNTFGMEVVKYEMPRPNIGIHRFVFLL  125

Query  422  YKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            +KQK RQ  TV    S+D FNTRKFA+ NDLG PV AVFFN QRETAARRR
Sbjct  126  FKQKGRQ--TVIPPASKDHFNTRKFAEANDLGLPVTAVFFNAQRETAARRR  174



>ref|XP_004291610.1| PREDICTED: CEN-like protein 2-like [Fragaria vesca subsp. vesca]
Length=173

 Score =   282 bits (721),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 131/175 (75%), Positives = 154/175 (88%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MAK+SDPLV+GRV+GDV+D F+ SVKM+V YNS+K VYNGHE +PS +T KPKVEVH GD
Sbjct  1    MAKISDPLVVGRVIGDVIDCFTPSVKMTVTYNSSKKVYNGHELYPSSVTVKPKVEVHGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +RSFFTL+MTDPDVPGPSDPYL+EHLHWIVTDIPGTTD++FG+E+V YE P+PNIGIHRF
Sbjct  61   MRSFFTLVMTDPDVPGPSDPYLKEHLHWIVTDIPGTTDNTFGKEVVKYEMPRPNIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VFLL+KQK RQ  TV   PS+D F++RKFA+ N+ G PVAAVFFN QRETAARRR
Sbjct  121  VFLLFKQKGRQ--TVIPPPSKDHFDSRKFAETNEFGLPVAAVFFNAQRETAARRR  173



>ref|XP_009103610.1| PREDICTED: protein CENTRORADIALIS-like [Brassica rapa]
 emb|CDY04503.1| BnaA07g13290D [Brassica napus]
Length=175

 Score =   282 bits (721),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 135/176 (77%), Positives = 152/176 (86%), Gaps = 2/176 (1%)
 Frame = -1

Query  794  MAKMS-DPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDG  618
            MA++S DPL++GRV+GDVVD   Q+VKM+V YN +K VYNGHE FPS +T+KPKVEVH G
Sbjct  1    MARISADPLMVGRVIGDVVDSCLQAVKMTVTYNCDKQVYNGHELFPSAVTNKPKVEVHGG  60

Query  617  DLRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHR  438
            D+RSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD +FG EIV YE P+PNIGIHR
Sbjct  61   DMRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDVTFGNEIVGYEMPRPNIGIHR  120

Query  437  FVFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            FV+LL+KQ RR SV VS    RD+FNTR FA DNDLG PVAAVFFNCQRETAARRR
Sbjct  121  FVYLLFKQNRRGSV-VSVPSYRDQFNTRMFAHDNDLGLPVAAVFFNCQRETAARRR  175



>ref|NP_001173006.1| Os02g0531600 [Oryza sativa Japonica Group]
 dbj|BAD28412.1| putative Cen-like protein [Oryza sativa Japonica Group]
 gb|EAY86144.1| hypothetical protein OsI_07517 [Oryza sativa Indica Group]
 gb|EAZ23305.1| hypothetical protein OsJ_07001 [Oryza sativa Japonica Group]
 dbj|BAH01422.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH91735.1| Os02g0531600 [Oryza sativa Japonica Group]
Length=173

 Score =   281 bits (720),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 157/175 (90%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            M+++ +PL++G+V+G+V+D+F+ +VKM+  Y +NK V+NGHEFFPS +  KP+VEV  GD
Sbjct  1    MSRVLEPLIVGKVIGEVLDNFNPTVKMTATYGANKQVFNGHEFFPSAVAGKPRVEVQGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            LRSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD+SFGRE+VSYE+P+PNIGIHRF
Sbjct  61   LRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGREVVSYESPRPNIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            + +L++QKRRQ+  VS  PSRDRF+TR+FA+DNDLG PVAAV+FN QRETAARRR
Sbjct  121  ILVLFRQKRRQA--VSPPPSRDRFSTRQFAEDNDLGLPVAAVYFNAQRETAARRR  173



>gb|AFV67432.1| centroradialis [Hordeum vulgare]
 gb|AFV67445.1| centroradialis [Hordeum vulgare]
 gb|AFV67446.1| centroradialis [Hordeum vulgare]
 gb|AFV67447.1| centroradialis [Hordeum vulgare]
 gb|AFV67449.1| centroradialis [Hordeum vulgare]
 gb|AFV67450.1| centroradialis [Hordeum vulgare]
Length=173

 Score =   281 bits (720),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 158/175 (90%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MA++ +PLV+G+V+G+V+D+F+ +VKM+V Y+SNK V+NGHEFFPS + SKP++EV  GD
Sbjct  1    MARVLEPLVVGKVIGEVIDNFNPTVKMTVTYSSNKQVFNGHEFFPSAVVSKPRIEVQGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +RSFFTL+MTDPDVPGPSDPYLREHLHWIV+DIPGTTD+SFGRE+VSYE+PKPNIGIHRF
Sbjct  61   MRSFFTLVMTDPDVPGPSDPYLREHLHWIVSDIPGTTDASFGREVVSYESPKPNIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
             F+L++QK+RQ++   S  +RD FNTR+FAD+NDLG PVAAV+FN QRETAARRR
Sbjct  121  TFVLFQQKKRQAMNAPS--TRDYFNTRRFADENDLGLPVAAVYFNAQRETAARRR  173



>ref|NP_001276169.1| CEN-like protein 2-like [Glycine max]
 gb|ACU00129.1| CENTRORADIALIS-like protein 3 [Glycine max]
Length=175

 Score =   281 bits (720),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 127/171 (74%), Positives = 154/171 (90%), Gaps = 1/171 (1%)
 Frame = -1

Query  782  SDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGDLRSF  603
            SDPLVIG+V+GDVVDHF+ +VK++V YN+NK VYNGHEFFPS +T+KPKV++H GD+RSF
Sbjct  6    SDPLVIGKVIGDVVDHFTPTVKITVSYNNNKQVYNGHEFFPSSVTTKPKVQIHGGDMRSF  65

Query  602  FTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRFVFLL  423
            FTL+MTDPDVPGPSDPYLREHLHW+VTDIPGTTD++FG E+V YE P+PNIGIHRFVFL+
Sbjct  66   FTLVMTDPDVPGPSDPYLREHLHWLVTDIPGTTDATFGNEVVEYEIPRPNIGIHRFVFLV  125

Query  422  YKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            +KQKRRQ V + +  +RD FN+R FA++N+LG PVAAVFFN QRETAARRR
Sbjct  126  FKQKRRQGV-LKTPTTRDLFNSRSFAEENELGPPVAAVFFNAQRETAARRR  175



>ref|XP_006409758.1| hypothetical protein EUTSA_v10017312mg [Eutrema salsugineum]
 gb|ESQ51211.1| hypothetical protein EUTSA_v10017312mg [Eutrema salsugineum]
Length=175

 Score =   281 bits (720),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 133/176 (76%), Positives = 155/176 (88%), Gaps = 2/176 (1%)
 Frame = -1

Query  794  MAKMS-DPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDG  618
            MA++S DPL++GRV+GDVVD+  Q+VKM+V YNS+K VYNGHE FPS +T+KPKV+VH G
Sbjct  1    MARISSDPLIVGRVIGDVVDNCLQAVKMTVTYNSDKQVYNGHEIFPSTVTNKPKVDVHGG  60

Query  617  DLRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHR  438
            D+RSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD +FG+EIV YE P+PNIGIHR
Sbjct  61   DMRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDVTFGKEIVGYEMPRPNIGIHR  120

Query  437  FVFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            FV+LL+KQ RR SV V+    RD+FNTR FA +NDLG PVAAVFFNCQRETAARRR
Sbjct  121  FVYLLFKQNRRGSV-VAVPSYRDQFNTRMFAHENDLGLPVAAVFFNCQRETAARRR  175



>ref|XP_009364305.1| PREDICTED: CEN-like protein 2 isoform X1 [Pyrus x bretschneideri]
Length=174

 Score =   281 bits (720),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 135/171 (79%), Positives = 149/171 (87%), Gaps = 2/171 (1%)
 Frame = -1

Query  782  SDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGDLRSF  603
            SDPLV+GRV+GDVVD+FS SVKM+V YNSNK VYNGHE FPS +T KPKVEVH GDLRSF
Sbjct  6    SDPLVVGRVIGDVVDYFSPSVKMTVSYNSNKKVYNGHELFPSSVTIKPKVEVHGGDLRSF  65

Query  602  FTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRFVFLL  423
            FTL+MTDPDVPGPSDPYL+EHLHWIVTDIPGTTD++FG E+V YE P+PNIGIHRFVFLL
Sbjct  66   FTLVMTDPDVPGPSDPYLKEHLHWIVTDIPGTTDNTFGIEVVKYEMPRPNIGIHRFVFLL  125

Query  422  YKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            +KQK RQ  TV    S+D FNTRKFA+ NDLG PV AVFFN QRETAARRR
Sbjct  126  FKQKGRQ--TVIPPASKDHFNTRKFAEANDLGLPVTAVFFNAQRETAARRR  174



>gb|KHN27653.1| CEN-like protein 2 [Glycine soja]
Length=175

 Score =   281 bits (720),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 127/171 (74%), Positives = 154/171 (90%), Gaps = 1/171 (1%)
 Frame = -1

Query  782  SDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGDLRSF  603
            SDPLVIG+V+GDVVDHF+ +VK++V YN+NK VYNGHEFFPS +T+KPKV++H GD+RSF
Sbjct  6    SDPLVIGKVIGDVVDHFTPTVKITVSYNNNKQVYNGHEFFPSSVTTKPKVQIHGGDMRSF  65

Query  602  FTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRFVFLL  423
            FTL+MTDPDVPGPSDPYLREHLHW+VTDIPGTTD++FG E+V YE P+PNIGIHRFVFL+
Sbjct  66   FTLVMTDPDVPGPSDPYLREHLHWMVTDIPGTTDATFGNEVVEYEIPRPNIGIHRFVFLV  125

Query  422  YKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            +KQKRRQ V + +  +RD FN+R FA++N+LG PVAAVFFN QRETAARRR
Sbjct  126  FKQKRRQGV-LKTPTTRDLFNSRSFAEENELGPPVAAVFFNAQRETAARRR  175



>ref|NP_001106241.1| ZCN2 protein [Zea mays]
 gb|ABW96225.1| ZCN2 [Zea mays]
 gb|ABX11004.1| ZCN2 [Zea mays]
 gb|AFW62511.1| ZCN2 [Zea mays]
Length=173

 Score =   281 bits (719),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 157/175 (90%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            M+++ +PL++G+V+G+V+DHF+ +VKM V YNSNK V+NGHEFFPS + +KP+VEV  GD
Sbjct  1    MSRVLEPLIVGKVIGEVLDHFNPTVKMVVTYNSNKQVFNGHEFFPSAVAAKPRVEVQGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            LRSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD+SFG+E+VSYE PKPNIGIHRF
Sbjct  61   LRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGKEVVSYEIPKPNIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            +F+L++QK RQ+V   S  S+DRF+TR+FA++NDLG PVAAV+FN QRETAARRR
Sbjct  121  IFVLFRQKSRQAVNPPS--SKDRFSTRQFAEENDLGLPVAAVYFNAQRETAARRR  173



>ref|XP_009371916.1| PREDICTED: CEN-like protein 2 isoform X1 [Pyrus x bretschneideri]
Length=174

 Score =   281 bits (719),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 134/171 (78%), Positives = 150/171 (88%), Gaps = 2/171 (1%)
 Frame = -1

Query  782  SDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGDLRSF  603
            SDPLV+GRV+GDVVD+FS SVKM+V YNSNK VYNGHE FPS +T KPKVEVH GDLRSF
Sbjct  6    SDPLVVGRVIGDVVDYFSPSVKMTVSYNSNKKVYNGHELFPSSVTIKPKVEVHGGDLRSF  65

Query  602  FTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRFVFLL  423
            FTL+MTDPDVPGPSDPYL+EHLHWIVTDIPGTTD++FG E+V YE P+PNIGIHRFVFLL
Sbjct  66   FTLVMTDPDVPGPSDPYLKEHLHWIVTDIPGTTDNTFGIEVVKYEMPRPNIGIHRFVFLL  125

Query  422  YKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            +KQK RQ+V   +  S+D FNTRKFA+ NDLG PV AVFFN QRETAARRR
Sbjct  126  FKQKGRQTVIPPT--SKDHFNTRKFAEANDLGLPVTAVFFNAQRETAARRR  174



>gb|AEH43350.1| CEN [Arabis alpina]
 gb|AEH43356.1| CEN [Arabis alpina]
 gb|KFK32394.1| hypothetical protein AALP_AA6G235900 [Arabis alpina]
Length=175

 Score =   281 bits (719),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 134/176 (76%), Positives = 155/176 (88%), Gaps = 2/176 (1%)
 Frame = -1

Query  794  MAKMS-DPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDG  618
            MA++S DPL++GRV+GDVVD+  Q+VKM+V YNS+K VYNGHE FPS +T+KPKVEVH G
Sbjct  1    MARISSDPLMVGRVIGDVVDNCLQAVKMTVTYNSDKQVYNGHELFPSAVTNKPKVEVHGG  60

Query  617  DLRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHR  438
            D+RSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD +FG++IV YE P+PNIGIHR
Sbjct  61   DMRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDVTFGKDIVGYEMPRPNIGIHR  120

Query  437  FVFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            FV+LL+KQ RR SV VS    RD+FNTR FA +NDLG PVAAVFFNCQRETAARRR
Sbjct  121  FVYLLFKQSRRGSV-VSVPSYRDQFNTRMFAYENDLGLPVAAVFFNCQRETAARRR  175



>ref|XP_009140811.1| PREDICTED: protein CENTRORADIALIS-like [Brassica rapa]
 emb|CDY51916.1| BnaC01g41050D [Brassica napus]
 emb|CDY30540.1| BnaA04g15930D [Brassica napus]
 emb|CDY27416.1| BnaC03g64560D [Brassica napus]
Length=175

 Score =   281 bits (719),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 150/171 (88%), Gaps = 1/171 (1%)
 Frame = -1

Query  782  SDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGDLRSF  603
            SDPL++GRV+GDVVD+  Q+VKM+V YN +K VYNGHE FPS +T+KPKVEVH GD+RSF
Sbjct  6    SDPLMVGRVIGDVVDNCLQAVKMTVTYNCDKQVYNGHELFPSAVTNKPKVEVHGGDMRSF  65

Query  602  FTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRFVFLL  423
            FTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD +FG+EIV YE P+PNIGIHRFV+LL
Sbjct  66   FTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDVTFGKEIVGYEMPRPNIGIHRFVYLL  125

Query  422  YKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            +KQ RR SV VS    RD+FNTR FA +NDLG PVAAVFFNCQRETAARRR
Sbjct  126  FKQNRRGSV-VSVPSYRDQFNTRMFAYENDLGLPVAAVFFNCQRETAARRR  175



>ref|XP_009133891.1| PREDICTED: protein CENTRORADIALIS-like [Brassica rapa]
 emb|CDX83272.1| BnaA03g22340D [Brassica napus]
Length=175

 Score =   281 bits (719),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 133/176 (76%), Positives = 155/176 (88%), Gaps = 2/176 (1%)
 Frame = -1

Query  794  MAKMS-DPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDG  618
            MA++S DPL++GRV+GDVVD+  Q+VKM+V YNS+K VYNGHE FPS++T+KPKVEVH G
Sbjct  1    MARISSDPLMVGRVIGDVVDNCLQAVKMTVTYNSDKQVYNGHELFPSVVTNKPKVEVHGG  60

Query  617  DLRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHR  438
            D+RSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD +FG+EIV YE P+PNIGIHR
Sbjct  61   DMRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDVTFGKEIVGYEMPRPNIGIHR  120

Query  437  FVFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            FV+LL+KQ  R SV +S    RD+FNTR FA +NDLG PVAAVFFNCQRETAARRR
Sbjct  121  FVYLLFKQNCRGSV-ISVPSYRDQFNTRMFAHENDLGLPVAAVFFNCQRETAARRR  175



>ref|NP_001052733.1| Os04g0411400 [Oryza sativa Japonica Group]
 emb|CAD40659.2| OSJNBa0073L04.4 [Oryza sativa Japonica Group]
 dbj|BAF14647.1| Os04g0411400 [Oryza sativa Japonica Group]
 gb|EAZ30664.1| hypothetical protein OsJ_14719 [Oryza sativa Japonica Group]
 dbj|BAG98998.1| unnamed protein product [Oryza sativa Japonica Group]
Length=173

 Score =   281 bits (718),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 129/175 (74%), Positives = 156/175 (89%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            M+++ +PLV+G+V+G+V+D+F+ +VKM+  Y+SNK V+NGHE FPS + SKP+VEV  GD
Sbjct  1    MSRVLEPLVVGKVIGEVIDNFNPTVKMTATYSSNKQVFNGHELFPSAVVSKPRVEVQGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            LRSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD+SFGRE+VSYE+PKPNIGIHRF
Sbjct  61   LRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGREVVSYESPKPNIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            V +L+KQKRRQ+VT  S  SRD F+TR+FA DNDLG PVAAV+FN QRETAARRR
Sbjct  121  VLVLFKQKRRQAVTPPS--SRDYFSTRRFAADNDLGLPVAAVYFNAQRETAARRR  173



>ref|XP_010271687.1| PREDICTED: protein SELF-PRUNING-like [Nelumbo nucifera]
Length=176

 Score =   281 bits (718),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 127/174 (73%), Positives = 154/174 (89%), Gaps = 2/174 (1%)
 Frame = -1

Query  791  AKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGDL  612
            AK+ +PL +G+V+GDV+D FS +VKM+V YNSNK VYNGHEF+PS +T+KP+VEV  GD+
Sbjct  5    AKLLEPLTVGKVIGDVLDSFSPTVKMTVTYNSNKQVYNGHEFYPSSVTTKPRVEVQGGDM  64

Query  611  RSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRFV  432
            R+FFTL+MTDPD PGPSDPYL EHLHWIVTDIPGTTD++FGRE+VSYE P+P IGIHRFV
Sbjct  65   RTFFTLVMTDPDAPGPSDPYLMEHLHWIVTDIPGTTDATFGREVVSYEIPRPTIGIHRFV  124

Query  431  FLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            F+L+KQKRRQ++T  +  SRD F+TRKFA++NDLG PVAAVFFN QRETAARRR
Sbjct  125  FVLFKQKRRQTITPPA--SRDHFSTRKFAEENDLGLPVAAVFFNAQRETAARRR  176



>ref|NP_001066172.1| Os12g0152000 [Oryza sativa Japonica Group]
 gb|AAD42896.1|AF159883_1 Cen-like protein FDR1 [Oryza sativa]
 gb|ABA95827.1| CENTRORADIALIS, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF29191.1| Os12g0152000 [Oryza sativa Japonica Group]
 gb|EAY82277.1| hypothetical protein OsI_37487 [Oryza sativa Indica Group]
 gb|EAZ19669.1| hypothetical protein OsJ_35245 [Oryza sativa Japonica Group]
Length=173

 Score =   281 bits (718),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 129/175 (74%), Positives = 155/175 (89%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            M++  +PLV+GRV+G+V+D F+   KM V YNSNK V+NGHEF+PS + SKP+VEV  GD
Sbjct  1    MSRSVEPLVVGRVIGEVIDSFNPCTKMIVTYNSNKLVFNGHEFYPSAVVSKPRVEVQGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +RSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD+SFGREI+SYE+PKP+IGIHRF
Sbjct  61   MRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGREIISYESPKPSIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VF+L+KQKRRQ+V V S  SRD FNTR+FA++N+LG PVAAV+FN QRETAARRR
Sbjct  121  VFVLFKQKRRQAVVVPS--SRDHFNTRQFAEENELGLPVAAVYFNAQRETAARRR  173



>ref|XP_006652260.1| PREDICTED: protein SELF-PRUNING-like [Oryza brachyantha]
Length=173

 Score =   281 bits (718),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 157/175 (90%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            M+++ +PLV+G+V+G+V+D+F+ +VKM+  Y+SNK V+NGHEFFPS + SKP+VEV  GD
Sbjct  1    MSRVLEPLVVGKVIGEVIDNFNPTVKMTATYSSNKQVFNGHEFFPSAVVSKPRVEVQGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +RSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD+SFGRE+VSYE+PKPNIGIHRF
Sbjct  61   MRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGREVVSYESPKPNIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            V +L+KQKRRQ+V+  S  SRD F+TR+FA DNDLG PVAAV+FN QRETAARRR
Sbjct  121  VLVLFKQKRRQAVSPPS--SRDYFSTRRFAADNDLGLPVAAVYFNAQRETAARRR  173



>ref|XP_009339416.1| PREDICTED: CEN-like protein 2 [Pyrus x bretschneideri]
Length=174

 Score =   280 bits (717),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 135/176 (77%), Positives = 152/176 (86%), Gaps = 3/176 (2%)
 Frame = -1

Query  794  MAKMS-DPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDG  618
            MA MS DPLV+GRV+GDVVD+FS SV+M++ YNSNK VYNGHE FPS +T KPKVEVH G
Sbjct  1    MAMMSSDPLVVGRVIGDVVDYFSSSVRMTITYNSNKVVYNGHELFPSSVTIKPKVEVHGG  60

Query  617  DLRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHR  438
            DLRSFFTL+MTDPDVPGPSDPYL+EHLHWIVTDIPGTTD++FG+E+V YE P+PNIGIHR
Sbjct  61   DLRSFFTLVMTDPDVPGPSDPYLKEHLHWIVTDIPGTTDNTFGKEVVKYEMPRPNIGIHR  120

Query  437  FVFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            FVFLL+KQK  Q  TV    S+D FNTRKFA+ NDLG PV AVFFN QRETAARRR
Sbjct  121  FVFLLFKQKGWQ--TVIPPASKDHFNTRKFAEANDLGLPVTAVFFNAQRETAARRR  174



>ref|XP_010089842.1| hypothetical protein L484_022359 [Morus notabilis]
 gb|EXB38458.1| hypothetical protein L484_022359 [Morus notabilis]
Length=174

 Score =   280 bits (717),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 136/176 (77%), Positives = 154/176 (88%), Gaps = 3/176 (2%)
 Frame = -1

Query  794  MAK-MSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDG  618
            MAK MSDPLV+GRV+GDVVD FS S+++SV Y SNK VYNGHE  PS +T+KPKVEVH G
Sbjct  1    MAKHMSDPLVLGRVIGDVVDPFSPSLRISVTY-SNKKVYNGHELLPSSVTTKPKVEVHGG  59

Query  617  DLRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHR  438
            D+RSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD SFGRE+VSYE P+PNIGIHR
Sbjct  60   DMRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDVSFGREVVSYEMPRPNIGIHR  119

Query  437  FVFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            FV LL+KQKRRQ+V  +  PSR+RF+TR FA +N+LG PVAAVFFN QRETA RRR
Sbjct  120  FVLLLFKQKRRQTV-AAPPPSRERFSTRSFAQENELGLPVAAVFFNAQRETACRRR  174



>gb|AFV67441.1| centroradialis [Hordeum vulgare]
Length=173

 Score =   280 bits (717),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 158/175 (90%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MA++ +PLV+G+V+G+V+D+F+ +VKM+V Y+SNK V+NGHEFFPS + SKP++EV  GD
Sbjct  1    MARVLEPLVVGKVIGEVIDNFNPTVKMTVTYSSNKQVFNGHEFFPSAVVSKPRIEVQGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +RSFFTL+MTDPDVPGPSDPYLREHLHWIV+DIPGTTD+SFG+E+VSYE+PKPNIGIHRF
Sbjct  61   MRSFFTLVMTDPDVPGPSDPYLREHLHWIVSDIPGTTDASFGKEVVSYESPKPNIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
             F+L++QK+RQ++   S  +RD FNTR+FAD+NDLG PVAAV+FN QRETAARRR
Sbjct  121  TFVLFQQKKRQAMNAPS--TRDYFNTRRFADENDLGLPVAAVYFNAQRETAARRR  173



>gb|EMS48180.1| hypothetical protein TRIUR3_17327 [Triticum urartu]
Length=173

 Score =   280 bits (717),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 153/175 (87%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            M++  +PL++GRV+G+V+D F+  VKM   YNSNK V+NGHE +PS + SKP+VEV  GD
Sbjct  1    MSRSVEPLIVGRVIGEVLDTFNPCVKMVTTYNSNKLVFNGHELYPSAVVSKPRVEVQGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            LRS FTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD+SFGRE++SYE+PKPNIGIHRF
Sbjct  61   LRSLFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGREVISYESPKPNIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            +F+L+KQKRRQ+VTV S   RD FNTR+FA +NDLG PVAAV+FNCQRETAARRR
Sbjct  121  IFVLFKQKRRQTVTVPS--FRDHFNTRQFAAENDLGLPVAAVYFNCQRETAARRR  173



>gb|AFV67438.1| centroradialis [Hordeum vulgare]
Length=173

 Score =   280 bits (717),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 158/175 (90%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MA++ +PLV+G+V+G+V+D+F+ +VKM+V Y+SNK V+NGHEFFPS + SKP++EV  GD
Sbjct  1    MARVLEPLVVGKVIGEVIDNFNPTVKMTVTYSSNKQVFNGHEFFPSAVVSKPRIEVQGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +RSFFTL+MTDPDVPGP+DPYLREHLHWIV+DIPGTTD+SFGRE+VSYE+PKPNIGIHRF
Sbjct  61   MRSFFTLVMTDPDVPGPNDPYLREHLHWIVSDIPGTTDASFGREVVSYESPKPNIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
             F+L++QK+RQ++   S  +RD FNTR+FAD+NDLG PVAAV+FN QRETAARRR
Sbjct  121  TFVLFQQKKRQAMNAPS--TRDYFNTRRFADENDLGLPVAAVYFNAQRETAARRR  173



>gb|AFV67448.1| centroradialis [Hordeum vulgare]
Length=173

 Score =   280 bits (716),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 158/175 (90%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MA++ +PLV+G+V+G+V+D+F+ +VKM+V Y+SNK V+NGHEFFPS + SKP++EV  GD
Sbjct  1    MARVLEPLVVGKVIGEVIDNFNPTVKMTVTYSSNKQVFNGHEFFPSAVVSKPRIEVQGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +RSFFTL+MTDPDVPGPSDPYLREHLHWIV+DIPGTTD+SFGRE+VSYE+PKPNIGIHRF
Sbjct  61   MRSFFTLVMTDPDVPGPSDPYLREHLHWIVSDIPGTTDASFGREVVSYESPKPNIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
             F+L++QK+RQ++   S  +RD FNTR+FAD+NDLG PVAAV+FN QRETAARRR
Sbjct  121  TFVLFQQKKRQAMNPPS--TRDYFNTRRFADENDLGLPVAAVYFNAQRETAARRR  173



>gb|AFV67437.1| centroradialis [Hordeum vulgare]
Length=173

 Score =   280 bits (716),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 158/175 (90%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MA++ +PLV+G+V+G+V+D+F+ +VKM+V Y+SNK V+NGHEFFPS + SKP++EV  GD
Sbjct  1    MARVLEPLVVGKVIGEVIDNFNPTVKMTVTYSSNKQVFNGHEFFPSAVVSKPRIEVQGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +RSFFTL+MTDP+VPGPSDPYLREHLHWIV+DIPGTTD+SFGRE+VSYE+PKPNIGIHRF
Sbjct  61   MRSFFTLVMTDPNVPGPSDPYLREHLHWIVSDIPGTTDASFGREVVSYESPKPNIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
             F+L++QK+RQ++   S  +RD FNTR+FAD+NDLG PVAAV+FN QRETAARRR
Sbjct  121  TFVLFQQKKRQAMNAPS--TRDYFNTRRFADENDLGLPVAAVYFNAQRETAARRR  173



>gb|AFV67436.1| centroradialis [Hordeum vulgare]
Length=173

 Score =   280 bits (716),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 158/175 (90%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MA++ +PLV+G+V+G+V+D+F+ +VKM+V Y+SNK V+NGHEFFPS + SKP++EV  GD
Sbjct  1    MARVLEPLVVGKVIGEVIDNFNPTVKMTVTYSSNKQVFNGHEFFPSAVVSKPRIEVQGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +RSFFTL+MT+PDVPGPSDPYLREHLHWIV+DIPGTTD+SFGRE+VSYE+PKPNIGIHRF
Sbjct  61   MRSFFTLVMTNPDVPGPSDPYLREHLHWIVSDIPGTTDASFGREVVSYESPKPNIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
             F+L++QK+RQ++   S  +RD FNTR+FAD+NDLG PVAAV+FN QRETAARRR
Sbjct  121  TFVLFQQKKRQAMNAPS--TRDYFNTRRFADENDLGLPVAAVYFNAQRETAARRR  173



>gb|EMT24999.1| hypothetical protein F775_30083 [Aegilops tauschii]
Length=173

 Score =   280 bits (716),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 153/175 (87%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            M++  +PL++GRV+G+V+D F+  VKM   YNSNK V+NGHE +PS + SKP+VEV  GD
Sbjct  1    MSRSVEPLIVGRVIGEVLDTFNPCVKMVTTYNSNKLVFNGHELYPSAVVSKPRVEVQGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            LRS FTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD+SFGRE++SYE+PKPNIGIHRF
Sbjct  61   LRSMFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGREVISYESPKPNIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            +F+L+KQKRRQ+VTV S   RD FNTR+FA +NDLG PVAAV+FNCQRETAARRR
Sbjct  121  IFVLFKQKRRQTVTVPS--FRDHFNTRQFAAENDLGLPVAAVYFNCQRETAARRR  173



>gb|EMT05258.1| hypothetical protein F775_30982 [Aegilops tauschii]
Length=173

 Score =   280 bits (715),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 158/175 (90%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MA++ +PL++G+V+G+V+D+F+ +VKM+V Y+SNK V+NGHEFFPS + SKP++EV  GD
Sbjct  1    MARVLEPLIVGKVIGEVIDNFNPTVKMTVTYSSNKQVFNGHEFFPSAVVSKPRIEVQGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +RSFFTL+MTDPDVPGPSDPYLREHLHWIV+DIPGTTD+SFGRE+VSYE+PKPNIGIHRF
Sbjct  61   MRSFFTLVMTDPDVPGPSDPYLREHLHWIVSDIPGTTDASFGREVVSYESPKPNIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
             F+L++QK+RQ++   S  +RD FNTR+FAD+NDLG PVAAV+FN QRETAARRR
Sbjct  121  TFVLFQQKKRQAMNPPS--TRDYFNTRRFADENDLGLPVAAVYFNAQRETAARRR  173



>gb|AGX25254.1| MCN5 [Musa AAB Group]
 gb|AGX25259.1| MCN5 [Musa AAB Group]
Length=173

 Score =   280 bits (715),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 129/175 (74%), Positives = 156/175 (89%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            M+++ DPLV+GRV+G+V+D F+ SVKM V YNSNK V+NGHE +PS + SKP+VEV  GD
Sbjct  1    MSRLIDPLVVGRVIGEVLDSFNPSVKMLVTYNSNKLVFNGHELYPSAVASKPRVEVQGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +RSFFTL+MTDPD PGPSDPYLREHLHWIVTDIPGTTD+SFGRE+VSYE+P+PNIGIHRF
Sbjct  61   MRSFFTLVMTDPDAPGPSDPYLREHLHWIVTDIPGTTDASFGREMVSYESPRPNIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VF+L+KQ+RRQ+V+  S  SRD F+TR+FA++NDLG PVAAVFFN QRETAARRR
Sbjct  121  VFVLFKQQRRQAVSPPS--SRDYFSTRRFAEENDLGLPVAAVFFNSQRETAARRR  173



>ref|XP_008784004.1| PREDICTED: CEN-like protein 2 [Phoenix dactylifera]
Length=173

 Score =   280 bits (715),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 129/175 (74%), Positives = 155/175 (89%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MA++ +PL++GRV+G+V+D F+ SVKM V YNSNK V NGHEF+PS + SKP+VEV   D
Sbjct  1    MARILEPLIVGRVIGEVLDPFNPSVKMVVTYNSNKLVCNGHEFYPSAVASKPRVEVQGAD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +RSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD+SFGRE+VSYE+P+PNIGIHRF
Sbjct  61   MRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGREVVSYESPRPNIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VF+L+KQKRRQ+  V+   SRD FNTR+FA++NDLG PVAAV+FN QRETAARRR
Sbjct  121  VFVLFKQKRRQA--VAPPDSRDNFNTRRFAEENDLGLPVAAVYFNAQRETAARRR  173



>ref|XP_009390747.1| PREDICTED: CEN-like protein 2 [Musa acuminata subsp. malaccensis]
Length=173

 Score =   280 bits (715),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 129/175 (74%), Positives = 157/175 (90%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            M+++ DPLV+GRV+G+V+D F+ SVKM V YNSNK V+NGHE +PS +TSKP+VEV  GD
Sbjct  1    MSRLIDPLVVGRVIGEVLDSFNPSVKMLVTYNSNKLVFNGHELYPSAVTSKPRVEVQGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +RSFFTL+MTDPD PGPSDPYLREHLHWIVT+IPGTTD+SFGRE+VSYE+P+PNIGIHRF
Sbjct  61   MRSFFTLVMTDPDAPGPSDPYLREHLHWIVTNIPGTTDASFGREMVSYESPRPNIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VF+L+KQ+RRQ+V+  S  SRD F+TR+FA++NDLG PVAAVFFN QRETAARRR
Sbjct  121  VFVLFKQQRRQAVSPPS--SRDYFSTRRFAEENDLGLPVAAVFFNSQRETAARRR  173



>ref|XP_002442808.1| hypothetical protein SORBIDRAFT_08g003210 [Sorghum bicolor]
 gb|EES16646.1| hypothetical protein SORBIDRAFT_08g003210 [Sorghum bicolor]
Length=173

 Score =   279 bits (714),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 155/175 (89%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            M++  +PL++GRV+G+V+D F+  VKM V YNSNK V+NGHE +PS + SKP+VEV  GD
Sbjct  1    MSRSVEPLIVGRVIGEVLDSFNPCVKMIVTYNSNKLVFNGHEIYPSAVVSKPRVEVQGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            LRSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD+SFGRE++SYE+P+PNIGIHRF
Sbjct  61   LRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGREVISYESPRPNIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            +F+L+KQK RQ+VTV S  SRD FNTR+FA++NDLG PVAAV+FN QRETAARRR
Sbjct  121  IFVLFKQKGRQTVTVPS--SRDHFNTRQFAEENDLGLPVAAVYFNAQRETAARRR  173



>emb|CDX71440.1| BnaC04g16750D [Brassica napus]
Length=175

 Score =   279 bits (714),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 134/176 (76%), Positives = 151/176 (86%), Gaps = 2/176 (1%)
 Frame = -1

Query  794  MAKMS-DPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDG  618
            MA++S DPL++GRV+GDVVD   Q+VKM+V YN +K VYNGHE FPS +T+KPKVEVH G
Sbjct  1    MARISADPLMVGRVIGDVVDSCLQAVKMTVTYNCDKQVYNGHELFPSAVTNKPKVEVHGG  60

Query  617  DLRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHR  438
            D+RSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD +FG EIV YE P+PNIGIHR
Sbjct  61   DMRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDVTFGNEIVGYEMPRPNIGIHR  120

Query  437  FVFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            FV+LL+KQ RR SV VS    RD+FNTR FA DNDLG PVAAVFFNCQRETAAR R
Sbjct  121  FVYLLFKQNRRGSV-VSVPSYRDQFNTRMFAHDNDLGLPVAAVFFNCQRETAARCR  175



>ref|XP_006293432.1| hypothetical protein CARUB_v10025606mg [Capsella rubella]
 gb|EOA26330.1| hypothetical protein CARUB_v10025606mg [Capsella rubella]
Length=175

 Score =   279 bits (714),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 133/176 (76%), Positives = 155/176 (88%), Gaps = 2/176 (1%)
 Frame = -1

Query  794  MAKMS-DPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDG  618
            MA++S DPL++GRV+GDVVD+  Q+VKM+V YNS+K VYNGHE FPS++T+KPKVEVH G
Sbjct  1    MARISSDPLMVGRVIGDVVDNCLQAVKMTVTYNSDKQVYNGHELFPSVVTNKPKVEVHGG  60

Query  617  DLRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHR  438
            D+RSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD SFG+E + YE P+PNIGIHR
Sbjct  61   DMRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDVSFGKERIGYEMPRPNIGIHR  120

Query  437  FVFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            FV+LL+KQ RR SV VS    RD+F+TR+FA  NDLG PVAAVFFNCQRETAARRR
Sbjct  121  FVYLLFKQNRRGSV-VSVPSYRDQFSTREFAHANDLGLPVAAVFFNCQRETAARRR  175



>ref|XP_009393383.1| PREDICTED: CEN-like protein 2 [Musa acuminata subsp. malaccensis]
Length=174

 Score =   279 bits (714),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 131/176 (74%), Positives = 158/176 (90%), Gaps = 3/176 (2%)
 Frame = -1

Query  794  MAKM-SDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDG  618
            MA++ SDPLV+G V+G+V+D FS SVKM+V YNSNK V NGHEFFPS + SKP+VEV  G
Sbjct  1    MARVPSDPLVVGMVIGEVIDSFSPSVKMTVTYNSNKLVCNGHEFFPSAVVSKPRVEVQGG  60

Query  617  DLRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHR  438
            D+RSFFTL+MTDPDVPGPSDPYLREH+HWIV+DIPGTTD+SFG+E+VSYE+P+PNIGIHR
Sbjct  61   DMRSFFTLVMTDPDVPGPSDPYLREHVHWIVSDIPGTTDASFGKEMVSYESPRPNIGIHR  120

Query  437  FVFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            FVF+L++QKRRQSVT+ +  SRD F+TR+FA +NDLG PVAAV+FN QRETAARRR
Sbjct  121  FVFVLFQQKRRQSVTLPA--SRDHFSTRQFAQENDLGLPVAAVYFNAQRETAARRR  174



>ref|XP_003579695.1| PREDICTED: CEN-like protein 2 [Brachypodium distachyon]
Length=173

 Score =   279 bits (713),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 155/175 (89%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MA+  +PLV+G+V+G+V+D+F+ ++KM+  Y+SNK V+NGHEFFPS + SKP++EV   D
Sbjct  1    MARALEPLVVGKVIGEVIDNFNPTMKMTATYSSNKQVFNGHEFFPSAVVSKPRIEVQGSD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +RSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD SFGRE+VSYE+PKPNIGIHRF
Sbjct  61   MRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDDSFGREVVSYESPKPNIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            +F+L+KQKRRQ+V+  S  SRD FNTR+FA +N+LG PVAAV+FN QRETAARRR
Sbjct  121  IFVLFKQKRRQAVSTPS--SRDYFNTRRFAAENELGLPVAAVYFNAQRETAARRR  173



>gb|EMS62911.1| hypothetical protein TRIUR3_23342 [Triticum urartu]
Length=173

 Score =   279 bits (713),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 158/175 (90%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MA++ +PLV+G+V+G+V+D+F+ +VKM+V Y+SNK V+NGHEFFPS + SKP++EV  GD
Sbjct  1    MARVLEPLVVGKVIGEVIDNFNPTVKMTVTYSSNKQVFNGHEFFPSAVVSKPRIEVQGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +RSFFTL+MTDPDVPGPSDPYLREHLHWIV+DIPGTTD+SFGRE+VSYE+PKPNIGIHRF
Sbjct  61   MRSFFTLVMTDPDVPGPSDPYLREHLHWIVSDIPGTTDASFGREVVSYESPKPNIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
             F+L++QK+RQ++   S  +RD FNTR+FA++NDLG PVAAV+FN QRETAARRR
Sbjct  121  TFVLFQQKKRQAMNPPS--TRDYFNTRRFANENDLGLPVAAVYFNAQRETAARRR  173



>gb|AFV67444.1| centroradialis [Hordeum vulgare]
Length=173

 Score =   278 bits (712),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 157/175 (90%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MA++ +PLV+G+V+G+V+D+F+ +VKM+V Y+SNK V+NGHEFFPS + SKP++EV  GD
Sbjct  1    MARVLEPLVVGKVIGEVIDNFNPTVKMTVTYSSNKQVFNGHEFFPSAVVSKPRIEVQGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +RSFFTL+MTDPDVPGPSDPYLREHLHWIV+DIPGTTD+SFGRE+VSYE+PKPNIGIHRF
Sbjct  61   MRSFFTLVMTDPDVPGPSDPYLREHLHWIVSDIPGTTDASFGREVVSYESPKPNIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
             F+L++QK+RQ++   S  + D FNTR+FAD+NDLG PVAAV+FN QRETAARRR
Sbjct  121  TFVLFQQKKRQAMNAPS--TWDYFNTRRFADENDLGLPVAAVYFNAQRETAARRR  173



>gb|AFV67439.1| centroradialis [Hordeum vulgare]
Length=173

 Score =   278 bits (712),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 157/175 (90%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MA++ +PLV+G+V+G+V+D+F+ +VKM+V Y+SNK V+NGHEFFPS + SKP++EV  GD
Sbjct  1    MARVLEPLVVGKVIGEVIDNFNPTVKMTVTYSSNKQVFNGHEFFPSAVVSKPRIEVQGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +RSFFTL+MTDPDVPGPSDPYL EHLHWIV+DIPGTTD+SFGRE+VSYE+PKPNIGIHRF
Sbjct  61   MRSFFTLVMTDPDVPGPSDPYLWEHLHWIVSDIPGTTDASFGREVVSYESPKPNIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
             F+L++QK+RQ++   S  +RD FNTR+FAD+NDLG PVAAV+FN QRETAARRR
Sbjct  121  TFVLFQQKKRQAMNAPS--TRDYFNTRRFADENDLGLPVAAVYFNAQRETAARRR  173



>gb|AFV67433.1| centroradialis [Hordeum vulgare]
Length=173

 Score =   278 bits (712),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 157/175 (90%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MA++ +PLV+G+V+G+V+D+F+ +VKM+V Y+SNK V+NGHEFFPS + SK ++EV  GD
Sbjct  1    MARVLEPLVVGKVIGEVIDNFNPTVKMTVTYSSNKQVFNGHEFFPSAVVSKSRIEVQGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +RSFFTL+MTDPDVPGPSDPYLREHLHWIV+DIPGTTD+SFGRE+VSYE+PKPNIGIHRF
Sbjct  61   MRSFFTLVMTDPDVPGPSDPYLREHLHWIVSDIPGTTDASFGREVVSYESPKPNIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
             F+L++QK+RQ++   S  +RD FNTR+FAD+NDLG PVAAV+FN QRETAARRR
Sbjct  121  TFVLFQQKKRQAMNAPS--TRDYFNTRRFADENDLGLPVAAVYFNAQRETAARRR  173



>gb|AFV67434.1| centroradialis [Hordeum vulgare]
Length=173

 Score =   278 bits (712),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 157/175 (90%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MA++ +PLV+G+V+G+V+D+F+ +VKM+V Y+SNK V+NGHEFFPS + SK ++EV  GD
Sbjct  1    MARVLEPLVVGKVIGEVIDNFNPTVKMTVTYSSNKQVFNGHEFFPSAVVSKTRIEVQGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +RSFFTL+MTDPDVPGPSDPYLREHLHWIV+DIPGTTD+SFGRE+VSYE+PKPNIGIHRF
Sbjct  61   MRSFFTLVMTDPDVPGPSDPYLREHLHWIVSDIPGTTDASFGREVVSYESPKPNIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
             F+L++QK+RQ++   S  +RD FNTR+FAD+NDLG PVAAV+FN QRETAARRR
Sbjct  121  TFVLFQQKKRQAMNAPS--TRDYFNTRRFADENDLGLPVAAVYFNAQRETAARRR  173



>gb|AFV67443.1| centroradialis [Hordeum vulgare]
Length=173

 Score =   278 bits (712),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 157/175 (90%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MA++ +PLV+G+V+G+V+D+F+ +VKM+V Y+SNK V+NGHEFFPS + SKP++EV  GD
Sbjct  1    MARVLEPLVVGKVIGEVIDNFNPTVKMTVTYSSNKQVFNGHEFFPSAVVSKPRIEVQGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +RSFFTL+MTDPDVPGPSDPYLREHLHWIV+DIPGTTD+SFGRE+VSYE+PKPNI IHRF
Sbjct  61   MRSFFTLVMTDPDVPGPSDPYLREHLHWIVSDIPGTTDASFGREVVSYESPKPNIDIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
             F+L++QK+RQ++   S  +RD FNTR+FAD+NDLG PVAAV+FN QRETAARRR
Sbjct  121  TFVLFQQKKRQAMNAPS--TRDYFNTRRFADENDLGLPVAAVYFNAQRETAARRR  173



>gb|AEO72022.1| RhTFL1 [Rosa hybrid cultivar]
Length=170

 Score =   278 bits (711),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 131/172 (76%), Positives = 151/172 (88%), Gaps = 2/172 (1%)
 Frame = -1

Query  785  MSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGDLRS  606
            MSDPLV+GRV+GDVVD+FS SVKM+V YNS+K VYNGHE FPS +T+KPKVEV  GDLRS
Sbjct  1    MSDPLVVGRVIGDVVDYFSPSVKMAVTYNSSKKVYNGHELFPSSVTTKPKVEVQGGDLRS  60

Query  605  FFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRFVFL  426
            FFTL++TDPDVPGPSDPYL+EHLHWIV DIPGTTD++FGRE+V YE P+PNIGIHRFVFL
Sbjct  61   FFTLVVTDPDVPGPSDPYLKEHLHWIVMDIPGTTDNTFGREVVKYEMPRPNIGIHRFVFL  120

Query  425  LYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            L+KQK RQ  TV   PS+D F++RKFA+ N+ G PVAAVFFN QRETAARRR
Sbjct  121  LFKQKGRQ--TVIPPPSKDHFDSRKFAEANEFGLPVAAVFFNAQRETAARRR  170



>ref|NP_001065771.1| Os11g0152500 [Oryza sativa Japonica Group]
 gb|AAD42895.1|AF159882_1 Cen-like protein FDR2 [Oryza sativa]
 gb|AAX94844.1| Phosphatidylethanolamine-binding protein [Oryza sativa Japonica 
Group]
 gb|ABA91511.1| CEN-like protein 2, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF27616.1| Os11g0152500 [Oryza sativa Japonica Group]
 gb|EAZ17463.1| hypothetical protein OsJ_32992 [Oryza sativa Japonica Group]
 gb|EEC67689.1| hypothetical protein OsI_35142 [Oryza sativa Indica Group]
Length=173

 Score =   278 bits (711),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 154/175 (88%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            M++  +PLV+GRV+G+V+D F+  +KM V YNSNK V+NGHE +PS + SKP+VEV  GD
Sbjct  1    MSRSVEPLVVGRVIGEVLDTFNPCMKMIVTYNSNKLVFNGHELYPSAVVSKPRVEVQGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            LRSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD+SFGRE++SYE+PKPNIGIHRF
Sbjct  61   LRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGREVISYESPKPNIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            +F+L+KQKRRQ+V V S   RD FNTR+FA++NDLG PVAAV+FN QRETAARRR
Sbjct  121  IFVLFKQKRRQTVIVPS--FRDHFNTRRFAEENDLGLPVAAVYFNAQRETAARRR  173



>ref|XP_006662737.1| PREDICTED: CEN-like protein 2-like [Oryza brachyantha]
Length=173

 Score =   278 bits (711),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 154/175 (88%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            M++  +PLV+GRV+G+V+D F+  +KM V YNSNK V+NGHE +PS + SKP+VEV  GD
Sbjct  1    MSRSVEPLVVGRVIGEVLDTFNPCMKMIVTYNSNKLVFNGHELYPSAVVSKPRVEVQGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            LRSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD+SFGRE++SYE+PKPNIGIHRF
Sbjct  61   LRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGREVISYESPKPNIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            +F+L+KQKRRQ+V V S   RD FNTR+FA++NDLG PVAAV+FN QRETAARRR
Sbjct  121  IFVLFKQKRRQTVLVPS--FRDHFNTRRFAEENDLGLPVAAVYFNAQRETAARRR  173



>gb|AFV67442.1| centroradialis [Hordeum vulgare]
Length=173

 Score =   278 bits (710),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 157/175 (90%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MA++ +PLV+G+V+G+V+D+F+ +VKM+V Y+SNK V+NGHEFFPS + SKP++EV  GD
Sbjct  1    MARVLEPLVVGKVIGEVIDNFNPTVKMTVTYSSNKQVFNGHEFFPSAVVSKPRIEVQGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +RSFFTL+MTDPDVPGPSDPYLREHLHWIV+DIPGTTD+SFGRE+VSYE+PK NIGIHRF
Sbjct  61   MRSFFTLVMTDPDVPGPSDPYLREHLHWIVSDIPGTTDASFGREVVSYESPKLNIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
             F+L++QK+RQ++   S  +RD FNTR+FAD+NDLG PVAAV+FN QRETAARRR
Sbjct  121  TFVLFQQKKRQAMNAPS--TRDYFNTRRFADENDLGLPVAAVYFNAQRETAARRR  173



>ref|XP_009411957.1| PREDICTED: CEN-like protein 2 [Musa acuminata subsp. malaccensis]
Length=175

 Score =   278 bits (710),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 128/176 (73%), Positives = 155/176 (88%), Gaps = 2/176 (1%)
 Frame = -1

Query  794  MAKMS-DPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDG  618
            MA++S DPL +GRV+G+V+D F+ SVKM V YNSNK VYNGHE FPS + SKP+VEV  G
Sbjct  1    MARLSSDPLTVGRVIGEVIDSFNPSVKMMVTYNSNKLVYNGHELFPSAVVSKPRVEVQGG  60

Query  617  DLRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHR  438
            ++RSFFTL+MTDPD PGPSDPYLREH+HW+VTDIPGTTD+SFG+E+VSYE+P+P+IGIHR
Sbjct  61   EMRSFFTLVMTDPDAPGPSDPYLREHVHWVVTDIPGTTDASFGKEVVSYESPRPSIGIHR  120

Query  437  FVFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            FVF+L+KQKRRQSV  ++ PSRDRF+TR FA +NDL  PVAAV+FN QRETAARRR
Sbjct  121  FVFVLFKQKRRQSVA-AAPPSRDRFSTRGFAQENDLDLPVAAVYFNAQRETAARRR  175



>gb|ADO60992.1| terminal flower 1 [Helianthus annuus]
 gb|ADO60993.1| terminal flower 1 [Helianthus annuus]
Length=165

 Score =   277 bits (709),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 133/167 (80%), Positives = 147/167 (88%), Gaps = 2/167 (1%)
 Frame = -1

Query  785  MSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGDLRS  606
            MSDPLVIGRVVGDVVD+F+Q V MSV YNS+K VYNGHE FPS +T+KPKV+V  GD+RS
Sbjct  1    MSDPLVIGRVVGDVVDNFTQCVDMSVTYNSSKQVYNGHELFPSSVTTKPKVDVRGGDMRS  60

Query  605  FFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRFVFL  426
            FFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFG+E+VSYE P+PNIGIHRFVFL
Sbjct  61   FFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGKEVVSYEIPRPNIGIHRFVFL  120

Query  425  LYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRET  285
            L+KQ+ RQ  TV+  PSR  FNTR FA +N LGSPVA VFFNCQRET
Sbjct  121  LFKQRGRQ--TVNCPPSRHGFNTRNFAHENKLGSPVAGVFFNCQRET  165



>ref|XP_009592311.1| PREDICTED: protein SELF-PRUNING-like isoform X2 [Nicotiana tomentosiformis]
Length=172

 Score =   278 bits (710),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 132/175 (75%), Positives = 153/175 (87%), Gaps = 3/175 (2%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MA+  +PL++GRVVGDV+D FS  VKM++ YN NK V NGHEFFPS++TS+PKVEV  GD
Sbjct  1    MARSLEPLIVGRVVGDVLDSFSPIVKMTITYN-NKLVCNGHEFFPSIVTSRPKVEVQGGD  59

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            LR+FFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FGRE+VSYE P+PNIGIHRF
Sbjct  60   LRTFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGRELVSYEIPRPNIGIHRF  119

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VF+L+KQ+RRQS  VS   SRD FNTR FA++NDL  PVAAVFFN QRETAARRR
Sbjct  120  VFVLFKQRRRQS--VSPPTSRDNFNTRNFAEENDLSQPVAAVFFNAQRETAARRR  172



>ref|XP_010244607.1| PREDICTED: CEN-like protein 2 [Nelumbo nucifera]
Length=176

 Score =   278 bits (710),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 128/174 (74%), Positives = 153/174 (88%), Gaps = 2/174 (1%)
 Frame = -1

Query  791  AKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGDL  612
            A+M +PL++GRV+GDV+D FS +VKM+V YNSNK V NGHEF+PS +T+KP+VEVH GD+
Sbjct  5    ARMLEPLIVGRVIGDVLDSFSPTVKMTVTYNSNKQVCNGHEFYPSSITTKPRVEVHGGDM  64

Query  611  RSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRFV  432
            RSFFT++MTDPD PGPSDPYLREHLHWIVTDIPGTTD++FGRE+V YE PKP IGIHR+V
Sbjct  65   RSFFTVVMTDPDAPGPSDPYLREHLHWIVTDIPGTTDATFGRELVGYEIPKPYIGIHRYV  124

Query  431  FLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            F+L+KQK RQ+VT  S  SRD F TRKFA++N+LG PVAAVFFN QRETAARRR
Sbjct  125  FVLFKQKGRQTVTPPS--SRDHFRTRKFAEENNLGLPVAAVFFNAQRETAARRR  176



>ref|XP_003575068.1| PREDICTED: CEN-like protein 2 [Brachypodium distachyon]
Length=173

 Score =   278 bits (710),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 156/175 (89%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            M+++ +PLV+G+V+G+V+D+F+ +VKM+  Y+SNK V+NGHEFFPS +  KP+VEV  GD
Sbjct  1    MSRVLEPLVVGKVIGEVLDNFNPTVKMTATYSSNKQVFNGHEFFPSAIAVKPRVEVQGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            LRSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD+SFGRE+VSYE+P+PNIGIHRF
Sbjct  61   LRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGREMVSYESPRPNIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            + +L++QK R +V+  S  SRDRFNTR+FA++NDLG PVAAV+FN QRETAARRR
Sbjct  121  ILVLFRQKSRNAVSAPS--SRDRFNTRQFAEENDLGLPVAAVYFNAQRETAARRR  173



>dbj|BAL70256.1| centroradialis [Rhododendron x pulchrum]
Length=174

 Score =   277 bits (709),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 131/175 (75%), Positives = 151/175 (86%), Gaps = 1/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MA+ SDPLV+GRV+GDVVD+F  SVKMSV Y SNK V NGHE FPS +T +P+VEVH GD
Sbjct  1    MARKSDPLVVGRVIGDVVDNFFASVKMSVTYTSNKKVCNGHELFPSAVTLQPRVEVHGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            LRSFFTLIMTDPDVPGPSDPYL+EHLHWI+TDIPGTTDSSFG+E V YE P PNIGIHR+
Sbjct  61   LRSFFTLIMTDPDVPGPSDPYLKEHLHWIITDIPGTTDSSFGKEAVKYEMPMPNIGIHRY  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VF+L+KQKRR  + V+ S SRD F+TR+FA++N LG PVAAVFFN QRETA+RRR
Sbjct  121  VFVLFKQKRRL-LAVTGSTSRDGFSTRRFAEENGLGLPVAAVFFNAQRETASRRR  174



>ref|XP_003578901.1| PREDICTED: CEN-like protein 2 [Brachypodium distachyon]
Length=173

 Score =   277 bits (709),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 151/175 (86%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            M++  +PL++GRV+G+V+D F+  VKM   YNSNK V+NGHE +PS + SKP+VEV  GD
Sbjct  1    MSRSVEPLIVGRVIGEVLDTFNPCVKMVTTYNSNKLVFNGHELYPSAVASKPRVEVQGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            LRS FTL+MTDPDVPGPSDPY REHLHWIVTDIPGTTD+SFGRE++SYE+PKPNIGIHRF
Sbjct  61   LRSLFTLVMTDPDVPGPSDPYQREHLHWIVTDIPGTTDASFGREVISYESPKPNIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            +F+L+KQKRRQ+VT  S   RD FNTR+FA+ NDLG PVAAV+FNCQRETAARRR
Sbjct  121  IFVLFKQKRRQTVTAPS--FRDHFNTRQFAEQNDLGLPVAAVYFNCQRETAARRR  173



>ref|NP_001105959.1| LOC100037785 [Zea mays]
 gb|ABW96224.1| ZCN1 [Zea mays]
 gb|ABX11003.1| ZCN1 [Zea mays]
 tpg|DAA59258.1| TPA: terminal flower 1 [Zea mays]
Length=173

 Score =   277 bits (708),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 154/175 (88%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            M++  +PL++GRV+G+V+D F+  VKM V YNSNK V+NGHE +PS + SKP+VEV  GD
Sbjct  1    MSRSVEPLIVGRVIGEVLDSFNPCVKMIVTYNSNKLVFNGHEIYPSAIVSKPRVEVQGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            LRSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD+SFGRE++SYE+P+PNIGIHRF
Sbjct  61   LRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGREVISYESPRPNIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            +F+L+KQK RQ+VTV S   RD FNTR+FA++NDLG PVAAV+FN QRETAARRR
Sbjct  121  IFVLFKQKGRQTVTVPS--FRDHFNTRQFAEENDLGLPVAAVYFNAQRETAARRR  173



>gb|AGX25244.1| MCN5 [Musa acuminata AAA Group]
 gb|AGX25249.1| MCN5 [Musa acuminata AAA Group]
Length=173

 Score =   277 bits (708),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 155/175 (89%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            M+++ DPLV+GRV+G+V+D F+ SVKM V YNSNK V+NGHE +PS + SKP+VEV  GD
Sbjct  1    MSRLIDPLVVGRVIGEVLDSFNPSVKMLVTYNSNKLVFNGHELYPSAVASKPRVEVQGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +RSFFTL+MTDPD PGPSDPYLREHLHWIVTDIPGTTD+SFGRE+VSYE+P+PNIGIHRF
Sbjct  61   MRSFFTLVMTDPDAPGPSDPYLREHLHWIVTDIPGTTDASFGREMVSYESPRPNIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VF+L+KQ+RRQ+V+  S  S D F+TR+FA++NDLG PVAAVFFN QRETAARRR
Sbjct  121  VFVLFKQQRRQAVSPPS--STDYFSTRRFAEENDLGLPVAAVFFNSQRETAARRR  173



>dbj|BAH24197.1| homologous protein to TFL1 [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95559.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ99487.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=173

 Score =   277 bits (708),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 153/175 (87%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            M++  +PL++GRV+G+V+D F+  VKM   YNSNK V+NGHE +PS + SKP+VEV    
Sbjct  1    MSRSVEPLIVGRVIGEVLDTFNPCVKMVTTYNSNKLVFNGHELYPSAVVSKPRVEVQGDG  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            LRS FTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD+SFGRE++SYE+PKPNIGIHRF
Sbjct  61   LRSLFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGREVISYESPKPNIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            +F+L+KQKRRQ+VTV S   RD+FNTR+FA++NDLG PVAAV+FNCQRETAARRR
Sbjct  121  IFVLFKQKRRQTVTVPS--FRDQFNTRQFAEENDLGLPVAAVYFNCQRETAARRR  173



>ref|XP_004978696.1| PREDICTED: CEN-like protein 2-like [Setaria italica]
Length=173

 Score =   277 bits (708),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 155/175 (89%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            M++  +PL++GRV+G+V+D F+  VKM V YNSNK V+NGHE +PS + SKP+VEV  GD
Sbjct  1    MSRSVEPLIVGRVIGEVLDSFNPCVKMIVTYNSNKLVFNGHEIYPSAVVSKPRVEVQGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            LRSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD+SFGRE+++YE+P+P+IGIHRF
Sbjct  61   LRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGREVINYESPRPSIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            +F+L+KQKRRQ+VTV S   RD FNTR+FA++NDLG PVAAV+FN QRETAARRR
Sbjct  121  IFVLFKQKRRQTVTVPS--VRDHFNTRQFAEENDLGLPVAAVYFNAQRETAARRR  173



>ref|XP_010912272.1| PREDICTED: protein SELF-PRUNING-like [Elaeis guineensis]
Length=173

 Score =   277 bits (708),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 154/175 (88%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MA++ +PL++GRV+G+V+D F+ SVKM V YNSNK V NGHEF+PS + S+P+VEV  GD
Sbjct  1    MARILEPLIVGRVIGEVLDPFNPSVKMVVTYNSNKLVCNGHEFYPSAVASRPRVEVQGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +RSFFTL+MTDPDVPGPSDPYLREHL WIVTDIPGTTD+SFGRE+VSYE+P+PNIGIHRF
Sbjct  61   MRSFFTLVMTDPDVPGPSDPYLREHLQWIVTDIPGTTDASFGREVVSYESPRPNIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VF+L+KQKRRQ+VT     SRD F+TR+FA +NDLG PVAAV+FN QRETAARRR
Sbjct  121  VFVLFKQKRRQAVTPPD--SRDNFSTRRFAQENDLGLPVAAVYFNAQRETAARRR  173



>emb|CDY31183.1| BnaC03g47080D [Brassica napus]
Length=175

 Score =   276 bits (707),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 131/176 (74%), Positives = 153/176 (87%), Gaps = 2/176 (1%)
 Frame = -1

Query  794  MAKMS-DPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDG  618
            MA++S DPL++GRV+GDVVD+   +VKM+V YNS+K VYNGHE  PS++T+KPKVEVH G
Sbjct  1    MARISSDPLMVGRVIGDVVDNCLHAVKMTVTYNSDKQVYNGHELLPSVVTNKPKVEVHGG  60

Query  617  DLRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHR  438
            D+RSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD +FG+EIV+YE P+PNIGIHR
Sbjct  61   DMRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDVTFGKEIVAYEMPRPNIGIHR  120

Query  437  FVFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            FV+LL+KQ  R SV +S    RD+FNTR FA  NDLG PVAAVFFNCQRETAARRR
Sbjct  121  FVYLLFKQNCRGSV-ISVPSYRDQFNTRMFAHANDLGLPVAAVFFNCQRETAARRR  175



>gb|AGX25241.1| MCN2 [Musa acuminata AAA Group]
 gb|AGX25246.1| MCN2 [Musa acuminata AAA Group]
 gb|AGX25251.1| MCN2 [Musa AAB Group]
 gb|AGX25256.1| MCN2 [Musa AAB Group]
Length=174

 Score =   276 bits (706),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 130/176 (74%), Positives = 157/176 (89%), Gaps = 3/176 (2%)
 Frame = -1

Query  794  MAKMS-DPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDG  618
            MA++S DPLV+G V+G+V+D FS SVKM+V  NSNK V NGHEFFPS + SKP+VEV  G
Sbjct  1    MARVSSDPLVVGMVIGEVIDSFSPSVKMTVTCNSNKLVCNGHEFFPSAVVSKPRVEVQGG  60

Query  617  DLRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHR  438
            D+RSFFTL+MTDPDVPGPSDPYLREH+HWIV+DIPGTTD+SFG+E+VSYE+P+PNIGIHR
Sbjct  61   DMRSFFTLVMTDPDVPGPSDPYLREHVHWIVSDIPGTTDASFGKEMVSYESPRPNIGIHR  120

Query  437  FVFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            FVF+L++QKRRQSVT+ +  SRD F+TR+FA +NDLG PVAAV+FN QRETAARRR
Sbjct  121  FVFVLFQQKRRQSVTLPA--SRDHFSTRRFAQENDLGLPVAAVYFNAQRETAARRR  174



>gb|ACJ61501.1| terminal flower [Glycine max]
 gb|ACU00123.1| terminal flowering 1-like protein 1 [Glycine max]
 gb|ADF30893.1| Dt1 [Glycine max]
 gb|ADF30894.1| Dt1 [Glycine max]
 gb|ADF30897.1| Dt1 [Glycine max]
 gb|ADF30898.1| Dt1 [Glycine max]
 gb|ADF30900.1| Dt1 [Glycine max]
 gb|ADF30901.1| Dt1 [Glycine max]
 gb|ADF30903.1| Dt1 [Glycine max]
 gb|ADF30906.1| Dt1 [Glycine max]
 gb|ADF30907.1| Dt1 [Glycine max]
 gb|ADF30908.1| Dt1 [Glycine max]
 gb|ADF30911.1| Dt1 [Glycine max]
 gb|ADF30912.1| Dt1 [Glycine max]
 gb|ADF30913.1| Dt1 [Glycine max]
 gb|ADF30915.1| Dt1 [Glycine max]
 gb|ADF30916.1| Dt1 [Glycine max]
 gb|ADF30917.1| Dt1 [Glycine max]
 gb|ADF30919.1| Dt1 [Glycine max]
 gb|ADF30922.1| Dt1 [Glycine max]
 gb|ADF30926.1| Dt1 [Glycine max]
 gb|ADF30928.1| Dt1 [Glycine max]
 gb|ADF30931.1| Dt1 [Glycine max]
 gb|ADF30937.1| Dt1 [Glycine max]
 gb|ADF30939.1| Dt1 [Glycine max]
 gb|ADF30940.1| Dt1 [Glycine max]
 gb|ADF30941.1| Dt1 [Glycine max]
 gb|ADF30946.1| Dt1 [Glycine max]
 gb|ADF30947.1| Dt1 [Glycine max]
 gb|ADF30954.1| Dt1 [Glycine max]
 gb|ADF30956.1| Dt1 [Glycine max]
 gb|ADF30957.1| Dt1 [Glycine max]
 gb|ADF30964.1| Dt1 [Glycine max]
 gb|ADF30966.1| Dt1 [Glycine max]
 gb|ADF30967.1| Dt1 [Glycine max]
 gb|ADF30969.1| Dt1 [Glycine max]
 gb|ADF30971.1| Dt1 [Glycine max]
 gb|ADF30973.1| Dt1 [Glycine max]
 gb|ADF30974.1| Dt1 [Glycine max]
 gb|ADF30976.1| Dt1 [Glycine max]
 gb|ADF30978.1| Dt1 [Glycine max]
 gb|ADF30979.1| Dt1 [Glycine max]
 gb|ADF30980.1| Dt1 [Glycine max]
 gb|ADF30981.1| Dt1 [Glycine soja]
 gb|ADF30982.1| Dt1 [Glycine soja]
 gb|ADF30983.1| Dt1 [Glycine soja]
 gb|ADF30984.1| Dt1 [Glycine soja]
 gb|ADF30985.1| Dt1 [Glycine soja]
 gb|ADF30986.1| Dt1 [Glycine soja]
 gb|ADF30987.1| Dt1 [Glycine soja]
 gb|ADF30988.1| Dt1 [Glycine soja]
 gb|ADF30989.1| Dt1 [Glycine soja]
 gb|ADF30990.1| Dt1 [Glycine soja]
 gb|ADF30991.1| Dt1 [Glycine soja]
 gb|ADF30992.1| Dt1 [Glycine soja]
 gb|ADF30993.1| Dt1 [Glycine soja]
 gb|ADF30994.1| Dt1 [Glycine soja]
 gb|ADF30995.1| Dt1 [Glycine soja]
 gb|ADF30996.1| Dt1 [Glycine soja]
 gb|ADF30997.1| Dt1 [Glycine soja]
 gb|ADF30998.1| Dt1 [Glycine soja]
 gb|ADF30999.1| Dt1 [Glycine soja]
 gb|ADF31000.1| Dt1 [Glycine soja]
 gb|ADF31002.1| Dt1 [Glycine max]
 gb|ADF31003.1| Dt1 [Glycine max]
 gb|ADF31004.1| Dt1 [Glycine max]
 gb|ADF31005.1| Dt1 [Glycine max]
 gb|ADF31008.1| Dt1 [Glycine max]
 gb|ADF31009.1| Dt1 [Glycine max]
 gb|ADF31010.1| Dt1 [Glycine max]
 gb|ADF31011.1| Dt1 [Glycine max]
 gb|ADF31013.1| Dt1 [Glycine max]
 gb|ADF31014.1| Dt1 [Glycine max]
 gb|ADF31016.1| Dt1 [Glycine max]
 gb|ADF31017.1| Dt1 [Glycine max]
 gb|ADF31020.1| Dt1 [Glycine max]
 gb|ADF31021.1| Dt1 [Glycine max]
 gb|ADF31025.1| Dt1 [Glycine max]
 gb|ADF31026.1| Dt1 [Glycine max]
 gb|ADF31027.1| Dt1 [Glycine max]
 gb|ADF31031.1| Dt1 [Glycine max]
 gb|ADF31034.1| Dt1 [Glycine max]
 gb|ADF31039.1| Dt1 [Glycine max]
 gb|ADF31040.1| Dt1 [Glycine max]
 gb|ADF31041.1| Dt1 [Glycine max]
 gb|ADF31045.1| Dt1 [Glycine max]
 gb|ADF31050.1| Dt1 [Glycine max]
 gb|ADF31051.1| Dt1 [Glycine max]
 gb|ADF31052.1| Dt1 [Glycine max]
 gb|ADF31053.1| Dt1 [Glycine max]
 gb|ADF31054.1| Dt1 [Glycine max]
 gb|ADF31055.1| Dt1 [Glycine max]
 gb|ADF31056.1| Dt1 [Glycine max]
 gb|ADF31058.1| Dt1 [Glycine max]
 gb|ADF31060.1| Dt1 [Glycine max]
 gb|ADF31062.1| Dt1 [Glycine max]
 gb|ADF31063.1| Dt1 [Glycine max]
 gb|ADF31064.1| Dt1 [Glycine max]
 gb|ADF31065.1| Dt1 [Glycine max]
 gb|ADF31066.1| Dt1 [Glycine max]
 gb|ADF31067.1| Dt1 [Glycine max]
 gb|ADF31069.1| Dt1 [Glycine max]
 gb|ADF31070.1| Dt1 [Glycine max]
 gb|ADF31073.1| Dt1 [Glycine max]
 gb|ADF31078.1| Dt1 [Glycine max]
 gb|ADF31083.1| Dt1 [Glycine max]
 gb|ADF31095.1| Dt1 [Glycine max]
 gb|ADF31102.1| Dt1 [Glycine max]
 gb|ADF31110.1| Dt1 [Glycine max]
 gb|ADF31111.1| Dt1 [Glycine max]
 gb|ADF31112.1| Dt1 [Glycine max]
 gb|ADF31113.1| Dt1 [Glycine max]
 gb|ADF31114.1| Dt1 [Glycine max]
 gb|ADF31115.1| Dt1 [Glycine max]
 gb|ADF31117.1| Dt1 [Glycine max]
 gb|ADF31118.1| Dt1 [Glycine max]
 gb|ADF31121.1| Dt1 [Glycine max]
 gb|ADF31124.1| Dt1 [Glycine max]
 gb|ADF31125.1| Dt1 [Glycine max]
 gb|ADF31127.1| Dt1 [Glycine max]
 gb|ADF31129.1| Dt1 [Glycine max]
 gb|ADF31130.1| Dt1 [Glycine max]
 gb|ADF31132.1| Dt1 [Glycine max]
 gb|ADF31137.1| Dt1 [Glycine max]
 gb|ADF31138.1| Dt1 [Glycine max]
 gb|ADF31139.1| Dt1 [Glycine max]
 gb|ADF31140.1| Dt1 [Glycine max]
 gb|ADF31141.1| Dt1 [Glycine max]
 gb|ADF31142.1| Dt1 [Glycine max]
 gb|ADF31146.1| Dt1 [Glycine max]
 gb|ADF31148.1| Dt1 [Glycine max]
 gb|ADF31149.1| Dt1 [Glycine max]
 gb|ADF31150.1| Dt1 [Glycine max]
 gb|ADF31153.1| Dt1 [Glycine max]
 gb|ADF31154.1| Dt1 [Glycine max]
 gb|ADF31156.1| Dt1 [Glycine max]
 gb|ADF31157.1| Dt1 [Glycine max]
 gb|ADF31161.1| Dt1 [Glycine max]
 gb|ADF31163.1| Dt1 [Glycine max]
 gb|ADF31164.1| Dt1 [Glycine max]
 gb|ADF31169.1| Dt1 [Glycine max]
 gb|ADF31173.1| Dt1 [Glycine max]
 gb|ADF31177.1| Dt1 [Glycine max]
 gb|ADF31178.1| Dt1 [Glycine max]
 gb|ADF31180.1| Dt1 [Glycine max]
 gb|ADF31181.1| Dt1 [Glycine max]
 gb|ADF31183.1| Dt1 [Glycine max]
 gb|ADF31187.1| Dt1 [Glycine max]
 gb|ADF31188.1| Dt1 [Glycine max]
 gb|ADF31192.1| Dt1 [Glycine max]
 gb|ADF31193.1| Dt1 [Glycine max]
 gb|ADF31194.1| Dt1 [Glycine max]
 gb|ADF31195.1| Dt1 [Glycine max]
Length=173

 Score =   276 bits (706),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 131/176 (74%), Positives = 152/176 (86%), Gaps = 4/176 (2%)
 Frame = -1

Query  794  MAKMS-DPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDG  618
            MAKM  +PL++GRV+G+V+D F+ S KM+V YN  K VYNGHE FPS + +KPKVE+  G
Sbjct  1    MAKMPLEPLIVGRVIGEVLDSFTTSTKMTVSYN-KKQVYNGHELFPSTVNTKPKVEIEGG  59

Query  617  DLRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHR  438
            D+RSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FG+E+VSYE PKPNIGIHR
Sbjct  60   DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGKELVSYEVPKPNIGIHR  119

Query  437  FVFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            FVF+L+KQKRRQ VT  +  SRD FNTRKFA +NDLG PVAAV+FN QRETAARRR
Sbjct  120  FVFVLFKQKRRQCVTPPT--SRDHFNTRKFAAENDLGLPVAAVYFNAQRETAARRR  173



>emb|CDP15403.1| unnamed protein product [Coffea canephora]
Length=172

 Score =   276 bits (705),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 155/175 (89%), Gaps = 3/175 (2%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MA+ ++PLV+GRV+GDV+++F+ S+KM+V+YN NK V NGHE FPS + S+P+VE+  GD
Sbjct  1    MARSAEPLVVGRVIGDVLEYFTPSIKMTVIYN-NKQVCNGHELFPSAVVSRPRVEILGGD  59

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +R+FFTL+MTDPDVPGPSDPYLREHLHW+VTDIPGTTD +FG+E+VSYE P+PNIGIHRF
Sbjct  60   MRNFFTLVMTDPDVPGPSDPYLREHLHWVVTDIPGTTDVTFGKELVSYEIPRPNIGIHRF  119

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VF+L+KQKRRQ  TV+  PSRD+FNTR FA +NDLG PVAAVFFN QRETAARRR
Sbjct  120  VFVLFKQKRRQ--TVNPPPSRDQFNTRNFATENDLGEPVAAVFFNAQRETAARRR  172



>ref|XP_003625808.1| TFL1 [Medicago truncatula]
 gb|AES82026.1| terminal flower 1 [Medicago truncatula]
Length=174

 Score =   275 bits (704),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 129/176 (73%), Positives = 154/176 (88%), Gaps = 3/176 (2%)
 Frame = -1

Query  794  MAKMS-DPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDG  618
            MA+MS +PL++GRV+G+V+D F+ S+KM+V YN  K V+NGHEFFPS + +KPKVE+  G
Sbjct  1    MARMSQEPLIVGRVIGEVLDSFTTSMKMTVSYNK-KQVFNGHEFFPSTINTKPKVEIDGG  59

Query  617  DLRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHR  438
            D+RSF+TL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FG+E+VSYE PKPNIGIHR
Sbjct  60   DMRSFYTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGKEVVSYEIPKPNIGIHR  119

Query  437  FVFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            FVF+L+KQK R+SVT S S SRD FNTR FA  NDLG PVAAV+FN QRETAARRR
Sbjct  120  FVFVLFKQKNRESVTASPS-SRDYFNTRNFASQNDLGLPVAAVYFNAQRETAARRR  174



>ref|XP_009792306.1| PREDICTED: CEN-like protein 2 [Nicotiana sylvestris]
Length=172

 Score =   275 bits (703),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 131/175 (75%), Positives = 152/175 (87%), Gaps = 3/175 (2%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MA+  +PL++GRVVGDV+D FS  +KM++ YN NK V NGHE  PS++T++PKVEV  GD
Sbjct  1    MARSLEPLIVGRVVGDVLDSFSPIMKMTISYN-NKLVCNGHELLPSVVTARPKVEVQGGD  59

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            LR+FFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FGRE+VSYE P PNIGIHRF
Sbjct  60   LRTFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGRELVSYEIPMPNIGIHRF  119

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VF+L+KQKRRQS  VSS  SRD FNTR FA++NDLG PVAAVFFN QRETAARRR
Sbjct  120  VFVLFKQKRRQS--VSSPTSRDHFNTRNFAEENDLGQPVAAVFFNAQRETAARRR  172



>gb|ADF30943.1| Dt1 [Glycine max]
 gb|ADF30951.1| Dt1 [Glycine max]
 gb|ADF30952.1| Dt1 [Glycine max]
 gb|ADF31012.1| Dt1 [Glycine max]
 gb|ADF31015.1| Dt1 [Glycine max]
 gb|ADF31018.1| Dt1 [Glycine max]
 gb|ADF31024.1| Dt1 [Glycine max]
 gb|ADF31029.1| Dt1 [Glycine max]
 gb|ADF31030.1| Dt1 [Glycine max]
 gb|ADF31059.1| Dt1 [Glycine max]
 gb|ADF31071.1| Dt1 [Glycine max]
 gb|ADF31074.1| Dt1 [Glycine max]
 gb|ADF31079.1| Dt1 [Glycine max]
 gb|ADF31108.1| Dt1 [Glycine max]
 gb|ADF31131.1| Dt1 [Glycine max]
 gb|ADF31147.1| Dt1 [Glycine max]
 gb|ADF31166.1| Dt1 [Glycine max]
 gb|ADF31189.1| Dt1 [Glycine max]
Length=173

 Score =   275 bits (703),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 130/176 (74%), Positives = 152/176 (86%), Gaps = 4/176 (2%)
 Frame = -1

Query  794  MAKMS-DPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDG  618
            MAKM  +PL++GRV+G+V+D F+ S KM+V YN  K VYNGHE FPS + +KPKVE+  G
Sbjct  1    MAKMPLEPLIVGRVIGEVLDSFTTSTKMTVSYN-KKQVYNGHELFPSTVNTKPKVEIEGG  59

Query  617  DLRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHR  438
            D+RSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FG+E+VSYE PKPNIGIHR
Sbjct  60   DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGKELVSYEVPKPNIGIHR  119

Query  437  FVFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            FVF+L+KQKR+Q VT  +  SRD FNTRKFA +NDLG PVAAV+FN QRETAARRR
Sbjct  120  FVFVLFKQKRKQCVTPPT--SRDHFNTRKFAAENDLGLPVAAVYFNAQRETAARRR  173



>gb|ABF85670.1| terminal flower 1-like protein [Hordeum vulgare subsp. vulgare]
Length=173

 Score =   275 bits (703),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 153/175 (87%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            M++  +PL++GRV+G+V+D F+  VKM   YNSNK V+NGHE +PS + SKP+VEV    
Sbjct  1    MSRSVEPLIVGRVIGEVLDTFNPCVKMVTTYNSNKLVFNGHELYPSAVVSKPRVEVQGDG  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            LRS FTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD+SFGRE++SYE+PKPNIGIHRF
Sbjct  61   LRSLFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGREVISYESPKPNIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            +F+L+KQKRRQ+VTV S   RD+FNTR+FA++NDLG PVAAV+FNC+RETAARRR
Sbjct  121  IFVLFKQKRRQTVTVPS--FRDQFNTRQFAEENDLGLPVAAVYFNCRRETAARRR  173



>gb|AGX25240.1| MCN1 [Musa acuminata AAA Group]
 gb|AGX25245.1| MCN1 [Musa acuminata AAA Group]
Length=175

 Score =   275 bits (702),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 127/176 (72%), Positives = 154/176 (88%), Gaps = 2/176 (1%)
 Frame = -1

Query  794  MAKMS-DPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDG  618
            MA++S DPL +GRV+G+V+D F+ SVKM V YNSNK V NGHE FPS + SKP+VEV  G
Sbjct  1    MARLSSDPLTVGRVIGEVIDSFNPSVKMMVTYNSNKLVCNGHELFPSAVVSKPRVEVQGG  60

Query  617  DLRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHR  438
            ++RSFFTL+MTDPD PGPSDPYLREH+HW+VTDIPGTTD+SFG+E+VSYE+P+P+IGIHR
Sbjct  61   EMRSFFTLVMTDPDAPGPSDPYLREHVHWVVTDIPGTTDASFGKEVVSYESPRPSIGIHR  120

Query  437  FVFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            FVF+L+KQKRRQSV  ++ PSRDRF+TR FA +NDL  PVAAV+FN QRETAARRR
Sbjct  121  FVFVLFKQKRRQSVA-AAPPSRDRFSTRGFAQENDLDLPVAAVYFNAQRETAARRR  175



>ref|XP_010686025.1| PREDICTED: CEN-like protein 2 [Beta vulgaris subsp. vulgaris]
 gb|ADM92611.1| centroradialis-like protein CEN1 [Beta vulgaris]
 gb|ADM92612.1| centroradialis-like protein CEN1 [Beta vulgaris]
 gb|AEI55781.1| centroradialis [Beta vulgaris subsp. vulgaris]
Length=171

 Score =   274 bits (701),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 132/175 (75%), Positives = 152/175 (87%), Gaps = 4/175 (2%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MA+ SDPL+IGRV+GDV+D F+ SVKMSV YN NK VYNGHE FPS +  KP+V+VHDGD
Sbjct  1    MAR-SDPLIIGRVIGDVIDPFNPSVKMSVTYN-NKQVYNGHELFPSSVNLKPRVQVHDGD  58

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            L+SFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FG+EIVSYE P+PNIGIHRF
Sbjct  59   LKSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGKEIVSYEVPRPNIGIHRF  118

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
             F+L+KQ RR SV   S  +RDRF T+KFA+ N LG PVAAV++NCQRETAARRR
Sbjct  119  AFILFKQNRRGSVVPPS--TRDRFFTKKFAEQNQLGLPVAAVYYNCQRETAARRR  171



>gb|ADF30920.1| Dt1 [Glycine max]
 gb|ADF30923.1| Dt1 [Glycine max]
 gb|ADF30935.1| Dt1 [Glycine max]
 gb|ADF30942.1| Dt1 [Glycine max]
 gb|ADF31035.1| Dt1 [Glycine max]
 gb|ADF31036.1| Dt1 [Glycine max]
 gb|ADF31042.1| Dt1 [Glycine max]
 gb|ADF31044.1| Dt1 [Glycine max]
 gb|ADF31048.1| Dt1 [Glycine max]
 gb|ADF31049.1| Dt1 [Glycine max]
 gb|ADF31061.1| Dt1 [Glycine max]
 gb|ADF31072.1| Dt1 [Glycine max]
 gb|ADF31075.1| Dt1 [Glycine max]
 gb|ADF31080.1| Dt1 [Glycine max]
 gb|ADF31084.1| Dt1 [Glycine max]
 gb|ADF31091.1| Dt1 [Glycine max]
 gb|ADF31097.1| Dt1 [Glycine max]
 gb|ADF31099.1| Dt1 [Glycine max]
 gb|ADF31122.1| Dt1 [Glycine max]
 gb|ADF31143.1| Dt1 [Glycine max]
 gb|ADF31145.1| Dt1 [Glycine max]
 gb|ADF31155.1| Dt1 [Glycine max]
 gb|ADF31160.1| Dt1 [Glycine max]
 gb|ADF31162.1| Dt1 [Glycine max]
 gb|ADF31190.1| Dt1 [Glycine max]
Length=173

 Score =   274 bits (700),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 130/176 (74%), Positives = 151/176 (86%), Gaps = 4/176 (2%)
 Frame = -1

Query  794  MAKMS-DPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDG  618
            MAKM  +PL++GRV+G+V+D F+ S KM+V YN  K VYNGHE FPS + +KPKVE+  G
Sbjct  1    MAKMPLEPLIVGRVIGEVLDSFTTSTKMTVSYN-KKQVYNGHELFPSTVNTKPKVEIEGG  59

Query  617  DLRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHR  438
            D+ SFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FG+E+VSYE PKPNIGIHR
Sbjct  60   DMSSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGKELVSYEVPKPNIGIHR  119

Query  437  FVFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            FVF+L+KQKRRQ VT  +  SRD FNTRKFA +NDLG PVAAV+FN QRETAARRR
Sbjct  120  FVFVLFKQKRRQCVTPPT--SRDHFNTRKFAAENDLGLPVAAVYFNAQRETAARRR  173



>gb|KHN18765.1| Protein TERMINAL FLOWER 1 [Glycine soja]
Length=173

 Score =   274 bits (700),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 130/176 (74%), Positives = 152/176 (86%), Gaps = 4/176 (2%)
 Frame = -1

Query  794  MAKMS-DPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDG  618
            MA+M  +PL++GRV+G+V+D F+ S KM V YN N+ VYNGHE FPS + +KPKVE+  G
Sbjct  1    MARMPLEPLIVGRVIGEVLDSFTTSTKMIVSYNKNQ-VYNGHELFPSTVNTKPKVEIEGG  59

Query  617  DLRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHR  438
            D+RSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FG+E+VSYE PKPNIGIHR
Sbjct  60   DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGKELVSYEIPKPNIGIHR  119

Query  437  FVFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            FVF+L+KQKRRQ VT  +  SRD FNTRKFA +NDLG PVAAV+FN QRETAARRR
Sbjct  120  FVFVLFKQKRRQCVTPPT--SRDHFNTRKFAAENDLGLPVAAVYFNAQRETAARRR  173



>ref|XP_010521662.1| PREDICTED: protein CENTRORADIALIS-like [Tarenaya hassleriana]
Length=175

 Score =   274 bits (700),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 128/176 (73%), Positives = 151/176 (86%), Gaps = 2/176 (1%)
 Frame = -1

Query  794  MAKM-SDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDG  618
            MA+M SDPLV+G V+GD+VD+ +  VKM+V Y S+K VYNGHE  PS + +KPKVEVH  
Sbjct  1    MARMYSDPLVVGGVIGDIVDNVTHVVKMTVTYGSSKQVYNGHELLPSTVANKPKVEVHGC  60

Query  617  DLRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHR  438
            D+RSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FG+E++ YE P+PNIGIHR
Sbjct  61   DMRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGKEMIGYEMPRPNIGIHR  120

Query  437  FVFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            FVF+L+KQKRR SV VS    RD+FNTR FA +NDLG PVAAVFFNCQRETA+RRR
Sbjct  121  FVFMLFKQKRRSSV-VSVPSYRDQFNTRIFAQENDLGLPVAAVFFNCQRETASRRR  175



>ref|XP_009420516.1| PREDICTED: CEN-like protein 2 [Musa acuminata subsp. malaccensis]
Length=174

 Score =   273 bits (699),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 153/175 (87%), Gaps = 1/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MA++SDPL +GRV+G+V+D F  SV+M+V YNS+K V NGHEF+PS + S+P+VEV  GD
Sbjct  1    MARLSDPLAVGRVIGEVIDSFHPSVRMTVTYNSSKLVCNGHEFYPSAVVSEPRVEVQCGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +RSFFTL+MTDPD PGPSDPYLREH+HWIVTDIPGT D+S G+E+V YE+P+P+IGIHRF
Sbjct  61   MRSFFTLVMTDPDAPGPSDPYLREHVHWIVTDIPGTPDASLGKEVVGYESPRPSIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VF+L++QKRRQSV V+  PSRDRFN R+FA +NDLG PVAAV+FN QRETAARRR
Sbjct  121  VFVLFQQKRRQSV-VAPPPSRDRFNPRRFAQENDLGLPVAAVYFNAQRETAARRR  174



>gb|ABX11008.1| ZCN6 [Zea mays]
 gb|ACG45277.1| RCN1 - Corn Centroradialis/TFL1-like protein [Zea mays]
 gb|AFW64821.1| RCN1-Corn Centroradialis/TFL1-like proteinZCN6 [Zea mays]
Length=177

 Score =   273 bits (699),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 127/177 (72%), Positives = 152/177 (86%), Gaps = 2/177 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            M++  + LV+GRV+G+V+D FS  VKM V YNSN+ V+NGHE +PS + SKP+VEV  GD
Sbjct  1    MSRSVESLVVGRVIGEVLDCFSPCVKMVVTYNSNRLVFNGHEIYPSAVVSKPRVEVQGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            LRSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD+SFGRE+VSYE+P+P IGIHRF
Sbjct  61   LRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGREVVSYESPRPGIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSP--SRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            +F+L+KQKRRQ  TV++ P  SRD F TR+FA +NDLG PVAAV+FN QRETAARRR
Sbjct  121  IFVLFKQKRRQQQTVAAVPSSSRDHFITRQFAAENDLGHPVAAVYFNAQRETAARRR  177



>dbj|BAI66119.1| terminal flower 1b [Glycine max]
 gb|ADF30892.1| Dt1 [Glycine max]
 gb|ADF30895.1| Dt1 [Glycine max]
 gb|ADF30896.1| Dt1 [Glycine max]
 gb|ADF30899.1| Dt1 [Glycine max]
 gb|ADF30902.1| Dt1 [Glycine max]
 gb|ADF30904.1| Dt1 [Glycine max]
 gb|ADF30905.1| Dt1 [Glycine max]
 gb|ADF30909.1| Dt1 [Glycine max]
 gb|ADF30910.1| Dt1 [Glycine max]
 gb|ADF30914.1| Dt1 [Glycine max]
 gb|ADF30921.1| Dt1 [Glycine max]
 gb|ADF30929.1| Dt1 [Glycine max]
 gb|ADF30933.1| Dt1 [Glycine max]
 gb|ADF30934.1| Dt1 [Glycine max]
 gb|ADF30936.1| Dt1 [Glycine max]
 gb|ADF30945.1| Dt1 [Glycine max]
 gb|ADF30948.1| Dt1 [Glycine max]
 gb|ADF30950.1| Dt1 [Glycine max]
 gb|ADF30958.1| Dt1 [Glycine max]
 gb|ADF30959.1| Dt1 [Glycine max]
 gb|ADF30960.1| Dt1 [Glycine max]
 gb|ADF30961.1| Dt1 [Glycine max]
 gb|ADF30965.1| Dt1 [Glycine max]
 gb|ADF30968.1| Dt1 [Glycine max]
 gb|ADF30972.1| Dt1 [Glycine max]
 gb|ADF30975.1| Dt1 [Glycine max]
 gb|ADF30977.1| Dt1 [Glycine max]
 gb|ADF31001.1| Dt1 [Glycine max]
 gb|ADF31006.1| Dt1 [Glycine max]
 gb|ADF31007.1| Dt1 [Glycine max]
 gb|ADF31023.1| Dt1 [Glycine max]
 gb|ADF31033.1| Dt1 [Glycine max]
 gb|ADF31037.1| Dt1 [Glycine max]
 gb|ADF31076.1| Dt1 [Glycine max]
 gb|ADF31082.1| Dt1 [Glycine max]
 gb|ADF31090.1| Dt1 [Glycine max]
 gb|ADF31093.1| Dt1 [Glycine max]
 gb|ADF31109.1| Dt1 [Glycine max]
 gb|ADF31126.1| Dt1 [Glycine max]
 gb|ADF31133.1| Dt1 [Glycine max]
 gb|ADF31136.1| Dt1 [Glycine max]
 gb|ADF31144.1| Dt1 [Glycine max]
 gb|ADF31152.1| Dt1 [Glycine max]
 gb|ADF31158.1| Dt1 [Glycine max]
 gb|ADF31167.1| Dt1 [Glycine max]
 gb|ADF31179.1| Dt1 [Glycine max]
 gb|ADF31182.1| Dt1 [Glycine max]
 gb|ADF31191.1| Dt1 [Glycine max]
Length=173

 Score =   273 bits (698),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 130/176 (74%), Positives = 151/176 (86%), Gaps = 4/176 (2%)
 Frame = -1

Query  794  MAKMS-DPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDG  618
            MAKM  +PL++GRV+G+V+D F+ S KM+V YN  K VYNGHE FPS + +KPKVE+  G
Sbjct  1    MAKMPLEPLIVGRVIGEVLDSFTTSTKMTVSYN-KKQVYNGHELFPSTVNTKPKVEIEGG  59

Query  617  DLRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHR  438
            D+RSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FG+E+VSYE PKPNIGIHR
Sbjct  60   DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGKELVSYEVPKPNIGIHR  119

Query  437  FVFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            FVF+L+KQKRRQ VT  +  SRD FNTRKFA +NDLG PVAAV+FN Q ETAARRR
Sbjct  120  FVFVLFKQKRRQCVTPPT--SRDHFNTRKFAAENDLGLPVAAVYFNAQWETAARRR  173



>ref|XP_009592303.1| PREDICTED: protein SELF-PRUNING-like isoform X1 [Nicotiana tomentosiformis]
Length=173

 Score =   273 bits (698),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 132/176 (75%), Positives = 153/176 (87%), Gaps = 4/176 (2%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MA+  +PL++GRVVGDV+D FS  VKM++ YN NK V NGHEFFPS++TS+PKVEV  GD
Sbjct  1    MARSLEPLIVGRVVGDVLDSFSPIVKMTITYN-NKLVCNGHEFFPSIVTSRPKVEVQGGD  59

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSF-GREIVSYETPKPNIGIHR  438
            LR+FFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD++F GRE+VSYE P+PNIGIHR
Sbjct  60   LRTFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFVGRELVSYEIPRPNIGIHR  119

Query  437  FVFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            FVF+L+KQ+RRQS  VS   SRD FNTR FA++NDL  PVAAVFFN QRETAARRR
Sbjct  120  FVFVLFKQRRRQS--VSPPTSRDNFNTRNFAEENDLSQPVAAVFFNAQRETAARRR  173



>ref|XP_002450283.1| hypothetical protein SORBIDRAFT_05g003200 [Sorghum bicolor]
 gb|EES09271.1| hypothetical protein SORBIDRAFT_05g003200 [Sorghum bicolor]
Length=173

 Score =   273 bits (698),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 153/175 (87%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            M++  + L++GRV+G+V+D FS  VKM V YNSNK V+NGHE +PS + SKP+VEV  GD
Sbjct  1    MSRSVESLIVGRVIGEVLDSFSPCVKMVVTYNSNKLVFNGHEIYPSAVVSKPRVEVQGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            LRSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD+SFGRE++SYE+P+P+IGIHRF
Sbjct  61   LRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGREVISYESPRPSIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            +F+L+KQKRRQ+V + S  SRD F TR+FA++NDLG PVAAV+FN QRETAARRR
Sbjct  121  IFVLFKQKRRQTVAMPS--SRDHFITRQFAEENDLGLPVAAVYFNAQRETAARRR  173



>ref|XP_004977568.1| PREDICTED: CEN-like protein 2-like [Setaria italica]
Length=173

 Score =   273 bits (698),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 154/175 (88%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            M++  + LV+GRV+G+V+D F+  VKM+V YNSNK V+NGHE +PS + SKP+VEV  GD
Sbjct  1    MSRSVEALVVGRVIGEVLDSFNPCVKMTVTYNSNKLVFNGHEIYPSAVVSKPRVEVQGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            LRSFFTL+MTDPDVPGPSDPY REHLHWIVTDIPGTTD+SFGRE++SYE+P+P+IGIHRF
Sbjct  61   LRSFFTLVMTDPDVPGPSDPYQREHLHWIVTDIPGTTDASFGREVISYESPRPSIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            +F+L+KQKRRQ+VTV S   RD FNT++FA++NDLG PVAAV+FN QRETAARRR
Sbjct  121  IFVLFKQKRRQTVTVPS--FRDHFNTKQFAEENDLGLPVAAVYFNAQRETAARRR  173



>gb|AGS32268.1| TFL1-1 [Litchi chinensis]
Length=173

 Score =   273 bits (698),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 125/174 (72%), Positives = 153/174 (88%), Gaps = 3/174 (2%)
 Frame = -1

Query  791  AKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGDL  612
            ++M DPLV+GRV+GDV++ F+ S++MSV +N NK V NGHEFFPS +T+KPKV +   D+
Sbjct  3    SRMQDPLVVGRVIGDVLEAFTPSIRMSVTFN-NKQVCNGHEFFPSAVTNKPKVLIQGADM  61

Query  611  RSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRFV  432
            RSFFTL+MTDPDVPGPSDPYLREHLHWIV+DIPGTTD++FG+E+V YE PKPNIGIHRFV
Sbjct  62   RSFFTLVMTDPDVPGPSDPYLREHLHWIVSDIPGTTDATFGKEVVGYEIPKPNIGIHRFV  121

Query  431  FLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            F+L+KQKRRQ  T+S+ PSRD+F+T+ FA DNDLG PVAAV+FN QRETAARRR
Sbjct  122  FVLFKQKRRQ--TISAPPSRDQFSTKAFAADNDLGLPVAAVYFNAQRETAARRR  173



>ref|XP_006430226.1| hypothetical protein CICLE_v10013475mg [Citrus clementina]
 gb|ABY91242.1| CTRSTFL-like protein [Citrus trifoliata]
 gb|ESR43466.1| hypothetical protein CICLE_v10013475mg [Citrus clementina]
Length=173

 Score =   273 bits (698),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 127/176 (72%), Positives = 150/176 (85%), Gaps = 3/176 (2%)
 Frame = -1

Query  797  IMAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDG  618
            + A+M +PL +GRV+GDV++ F+ S+KMSV YN NK V NGHE FPS + SKP+VE+  G
Sbjct  1    MAARMLEPLAVGRVIGDVIESFTPSIKMSVTYN-NKQVCNGHELFPSTVVSKPRVEIQGG  59

Query  617  DLRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHR  438
            D+RSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FGRE+VSYE P+PNIGIHR
Sbjct  60   DMRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGRELVSYEIPRPNIGIHR  119

Query  437  FVFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            FVF+L+KQ RRQ+V   S  SRD FNTR FA +NDLG PVAAV+FN QRETAARRR
Sbjct  120  FVFVLFKQTRRQTVNPPS--SRDHFNTRAFAAENDLGLPVAAVYFNAQRETAARRR  173



>ref|XP_008788083.1| PREDICTED: protein SELF-PRUNING-like [Phoenix dactylifera]
Length=173

 Score =   273 bits (698),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 154/175 (88%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MA+  +PL++GRV+G+V+D F+ SVKM V YN NK V NGHEF+PS +TSKP+VEV  GD
Sbjct  1    MARALEPLIVGRVIGEVLDSFNPSVKMVVAYNFNKVVCNGHEFYPSAVTSKPRVEVQGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +RSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD+SFGRE+V YE+P+P++GIHRF
Sbjct  61   MRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGREVVIYESPRPSVGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VF+L+KQKRR+ VT  +  SRD F+TR+FA++NDLG PVAAV+FN QRETAARRR
Sbjct  121  VFVLFKQKRREVVTPPA--SRDNFSTRRFAEENDLGLPVAAVYFNAQRETAARRR  173



>ref|XP_010907126.1| PREDICTED: protein SELF-PRUNING-like [Elaeis guineensis]
Length=173

 Score =   273 bits (697),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 154/175 (88%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MA+  +PL++GRV+G+V+D F+ SVKM V YN NK V NGHEF+PS +TSKP+VEV   D
Sbjct  1    MARALEPLIVGRVIGEVLDSFNPSVKMVVTYNFNKLVCNGHEFYPSAVTSKPRVEVQGDD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +RSFFTL+MTDPDVPGPSDPYLREHLHWIV+DIPGTTD+SFGRE+VSYE+P+P+IGIHRF
Sbjct  61   MRSFFTLVMTDPDVPGPSDPYLREHLHWIVSDIPGTTDASFGREVVSYESPRPSIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VF+L+KQKRRQ VT  +  SRD F+TR+FA++NDLG PVAAV+FN QRETAARRR
Sbjct  121  VFVLFKQKRRQVVTPPA--SRDNFSTRRFAEENDLGLPVAAVYFNAQRETAARRR  173



>ref|XP_007150078.1| hypothetical protein PHAVU_005G124600g [Phaseolus vulgaris]
 gb|ESW22072.1| hypothetical protein PHAVU_005G124600g [Phaseolus vulgaris]
Length=176

 Score =   273 bits (698),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 129/171 (75%), Positives = 151/171 (88%), Gaps = 2/171 (1%)
 Frame = -1

Query  782  SDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGDLRSF  603
            +DPLVIGRV+GDVVD F+ ++K++V YN NK VYNGHEFFPS +T+KPKV++  GD+RSF
Sbjct  8    TDPLVIGRVIGDVVDPFTTTLKITVSYN-NKQVYNGHEFFPSSVTTKPKVQIRGGDMRSF  66

Query  602  FTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRFVFLL  423
            FTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FG E+V+YE P+PNIGIHRFVFLL
Sbjct  67   FTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDTTFGNEVVNYEIPRPNIGIHRFVFLL  126

Query  422  YKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            +KQK RQ+V    S SRD FNTR FA++NDLG PVAAVFFN QRETAARRR
Sbjct  127  FKQKCRQAVMKVPS-SRDLFNTRSFAEENDLGLPVAAVFFNAQRETAARRR  176



>gb|AAG31808.1|AF316419_1 terminal flower 1-like protein [Lolium perenne]
Length=173

 Score =   273 bits (697),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 152/175 (87%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            M++  +PL++GRV+G+V+D F+  VKM   YNSNK V+NGHE +PS + SKP+VEV  GD
Sbjct  1    MSRSVEPLIVGRVIGEVLDPFNPCVKMVATYNSNKLVFNGHELYPSAVVSKPRVEVQGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            LRS FTL+MTDPDVPGPSDPYLREHLHWIV++IPGTTD+SFG E++SYE+PKPNIGIHRF
Sbjct  61   LRSLFTLVMTDPDVPGPSDPYLREHLHWIVSNIPGTTDASFGGEVMSYESPKPNIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            +F+L+KQKRRQ+V+V S   RD FNTR+FA DNDLG PVAAV+FNCQRETAARRR
Sbjct  121  IFVLFKQKRRQTVSVPS--FRDHFNTRQFAVDNDLGLPVAAVYFNCQRETAARRR  173



>gb|ABX11005.1| ZCN3 [Zea mays]
Length=173

 Score =   273 bits (697),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 154/175 (88%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            M++  +PL++GRV+G+V+D F+  VKM V YNSNK V+NGHE +PS + SKP+VEV  GD
Sbjct  1    MSRSVEPLIVGRVIGEVLDSFNPCVKMMVTYNSNKLVFNGHEIYPSAVVSKPRVEVQGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            LRSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD+SFGR+I+SYE+P+P+IGIHRF
Sbjct  61   LRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGRQIISYESPRPSIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            +F+L+KQ+ RQ+VTV S   RD FNTR+FA++NDLG PVAAV+FN QRETAARRR
Sbjct  121  IFVLFKQQGRQNVTVPS--FRDHFNTRQFAEENDLGLPVAAVYFNAQRETAARRR  173



>ref|NP_001239629.1| protein TERMINAL FLOWER 1-like [Glycine max]
 gb|ACM45957.1| TFL1-like protein [Glycine max]
 gb|KHN02232.1| Protein TERMINAL FLOWER 1 [Glycine soja]
Length=170

 Score =   272 bits (696),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 127/170 (75%), Positives = 148/170 (87%), Gaps = 3/170 (2%)
 Frame = -1

Query  779  DPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGDLRSFF  600
            +PL++GRV+G+V+D F+ S KM+V YN  K VYNGHE FPS + +KPKVE+  GD+RSFF
Sbjct  4    EPLIVGRVIGEVLDSFTTSTKMTVSYN-KKQVYNGHELFPSTVNTKPKVEIEGGDMRSFF  62

Query  599  TLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRFVFLLY  420
            TLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FG+E+VSYE PKPNIGIHRFVF+L+
Sbjct  63   TLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGKELVSYEVPKPNIGIHRFVFVLF  122

Query  419  KQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            KQKRRQ VT  +  SRD FNTRKFA +NDLG PVAAV+FN QRETAARRR
Sbjct  123  KQKRRQCVTPPT--SRDHFNTRKFAAENDLGLPVAAVYFNAQRETAARRR  170



>gb|ABY62770.1| terminal flower 1b [Gossypium hirsutum]
Length=172

 Score =   273 bits (697),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 152/175 (87%), Gaps = 3/175 (2%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MA+  +PL++GRV+GDV+D F  S+KMSV +N NK V+NGHEF+PS + +KP+VEV  GD
Sbjct  1    MAREVEPLMVGRVIGDVMDSFIPSIKMSVTFN-NKQVFNGHEFYPSTVVTKPRVEVVGGD  59

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +R+FFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FGRE+VSYE PKPNIGIHRF
Sbjct  60   MRTFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGREVVSYENPKPNIGIHRF  119

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VF+L+KQKRRQ   + S  SRD FNTR+FA +NDLG PVAAV+FN QRETAARRR
Sbjct  120  VFVLFKQKRRQ--IIKSPCSRDNFNTRRFASENDLGLPVAAVYFNAQRETAARRR  172



>ref|XP_008241250.1| PREDICTED: CEN-like protein 2 [Prunus mume]
 dbj|BAJ14521.1| TFL1-like protein [Prunus mume]
 gb|AEO72021.1| TFL1-like protein [Prunus mume]
Length=172

 Score =   272 bits (696),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 153/175 (87%), Gaps = 3/175 (2%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MA+MS+PLV+GRV+GDV+D F+ + KMSV YN+ + V NG+E +PS +T+KP+VE+  GD
Sbjct  1    MARMSEPLVVGRVIGDVLDCFTPTTKMSVTYNT-RLVCNGYELYPSAVTTKPRVEIQGGD  59

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +R+FFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FGRE+VSYE P+PNIGIHRF
Sbjct  60   MRTFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGREVVSYEMPRPNIGIHRF  119

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VF+L+KQ+RRQSV   S  SRD F+ R FA +NDLG PVAAV+FNCQRETAARRR
Sbjct  120  VFVLFKQRRRQSVNPPS--SRDHFSARSFAAENDLGLPVAAVYFNCQRETAARRR  172



>gb|ADF30918.1| Dt1 [Glycine max]
 gb|ADF30924.1| Dt1 [Glycine max]
 gb|ADF30925.1| Dt1 [Glycine max]
 gb|ADF30927.1| Dt1 [Glycine max]
 gb|ADF30930.1| Dt1 [Glycine max]
 gb|ADF30932.1| Dt1 [Glycine max]
 gb|ADF30938.1| Dt1 [Glycine max]
 gb|ADF30944.1| Dt1 [Glycine max]
 gb|ADF30949.1| Dt1 [Glycine max]
 gb|ADF30953.1| Dt1 [Glycine max]
 gb|ADF30955.1| Dt1 [Glycine max]
 gb|ADF30962.1| Dt1 [Glycine max]
 gb|ADF30963.1| Dt1 [Glycine max]
 gb|ADF30970.1| Dt1 [Glycine max]
 gb|ADF31019.1| Dt1 [Glycine max]
 gb|ADF31022.1| Dt1 [Glycine max]
 gb|ADF31028.1| Dt1 [Glycine max]
 gb|ADF31032.1| Dt1 [Glycine max]
 gb|ADF31038.1| Dt1 [Glycine max]
 gb|ADF31043.1| Dt1 [Glycine max]
 gb|ADF31046.1| Dt1 [Glycine max]
 gb|ADF31047.1| Dt1 [Glycine max]
 gb|ADF31057.1| Dt1 [Glycine max]
 gb|ADF31068.1| Dt1 [Glycine max]
 gb|ADF31077.1| Dt1 [Glycine max]
 gb|ADF31081.1| Dt1 [Glycine max]
 gb|ADF31085.1| Dt1 [Glycine max]
 gb|ADF31086.1| Dt1 [Glycine max]
 gb|ADF31087.1| Dt1 [Glycine max]
 gb|ADF31088.1| Dt1 [Glycine max]
 gb|ADF31089.1| Dt1 [Glycine max]
 gb|ADF31092.1| Dt1 [Glycine max]
 gb|ADF31094.1| Dt1 [Glycine max]
 gb|ADF31096.1| Dt1 [Glycine max]
 gb|ADF31098.1| Dt1 [Glycine max]
 gb|ADF31100.1| Dt1 [Glycine max]
 gb|ADF31101.1| Dt1 [Glycine max]
 gb|ADF31103.1| Dt1 [Glycine max]
 gb|ADF31104.1| Dt1 [Glycine max]
 gb|ADF31105.1| Dt1 [Glycine max]
 gb|ADF31106.1| Dt1 [Glycine max]
 gb|ADF31107.1| Dt1 [Glycine max]
 gb|ADF31116.1| Dt1 [Glycine max]
 gb|ADF31119.1| Dt1 [Glycine max]
 gb|ADF31120.1| Dt1 [Glycine max]
 gb|ADF31123.1| Dt1 [Glycine max]
 gb|ADF31128.1| Dt1 [Glycine max]
 gb|ADF31134.1| Dt1 [Glycine max]
 gb|ADF31135.1| Dt1 [Glycine max]
 gb|ADF31151.1| Dt1 [Glycine max]
 gb|ADF31159.1| Dt1 [Glycine max]
 gb|ADF31165.1| Dt1 [Glycine max]
 gb|ADF31168.1| Dt1 [Glycine max]
 gb|ADF31170.1| Dt1 [Glycine max]
 gb|ADF31171.1| Dt1 [Glycine max]
 gb|ADF31172.1| Dt1 [Glycine max]
 gb|ADF31174.1| Dt1 [Glycine max]
 gb|ADF31175.1| Dt1 [Glycine max]
 gb|ADF31176.1| Dt1 [Glycine max]
 gb|ADF31184.1| Dt1 [Glycine max]
 gb|ADF31185.1| Dt1 [Glycine max]
 gb|ADF31186.1| Dt1 [Glycine max]
Length=173

 Score =   272 bits (696),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 130/176 (74%), Positives = 151/176 (86%), Gaps = 4/176 (2%)
 Frame = -1

Query  794  MAKMS-DPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDG  618
            MAKM  +PL++GRV+G+V+D F+ S KM+V YN  K VYNGHE FPS + +KPKVE+  G
Sbjct  1    MAKMPLEPLIVGRVIGEVLDSFTTSTKMTVSYN-KKQVYNGHELFPSTVNTKPKVEIEGG  59

Query  617  DLRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHR  438
            D+RSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FG+E+VSYE PK NIGIHR
Sbjct  60   DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGKELVSYEVPKLNIGIHR  119

Query  437  FVFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            FVF+L+KQKRRQ VT  +  SRD FNTRKFA +NDLG PVAAV+FN QRETAARRR
Sbjct  120  FVFVLFKQKRRQCVTPPT--SRDHFNTRKFAAENDLGLPVAAVYFNAQRETAARRR  173



>gb|ADO64261.1| KSN [Rosa chinensis var. spontanea]
Length=172

 Score =   272 bits (696),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 152/175 (87%), Gaps = 3/175 (2%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MA++S+PLV+GRV+GDV+D+F+ + KM V Y S K V+NGHE FPS +T+KP+VE+  GD
Sbjct  1    MARISEPLVVGRVIGDVLDYFTPNTKMIVTY-STKLVFNGHELFPSAVTAKPRVEIQGGD  59

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +RSFFTL+MTDPDVPGPSDPYL+EHLHWIVTDIPGTTD +FGRE+VSYE P+PNIGIHRF
Sbjct  60   MRSFFTLVMTDPDVPGPSDPYLKEHLHWIVTDIPGTTDVTFGREMVSYEMPRPNIGIHRF  119

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VF+L+KQKRRQSV   S  SRD FNTR FA +NDLG PVAAV+FN QRETAARRR
Sbjct  120  VFVLFKQKRRQSVNPPS--SRDHFNTRSFAAENDLGLPVAAVYFNAQRETAARRR  172



>gb|ABI98712.1| terminal flower 1 [Zea mays]
Length=173

 Score =   272 bits (696),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 153/175 (87%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            M++  +PL++GRV+G+V+D F+  VKM V Y+SNK V+NGHE +PS + SKP+VEV  GD
Sbjct  1    MSRSVEPLIVGRVIGEVLDSFNPCVKMIVTYDSNKLVFNGHEIYPSAIVSKPRVEVQGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            LRSFFTL+MTDPDVPGPSDPYL EHLHWIVTDIPGTTD+SFGRE++SYE+P+PNIGIHRF
Sbjct  61   LRSFFTLVMTDPDVPGPSDPYLGEHLHWIVTDIPGTTDASFGREVISYESPRPNIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            +F+L+KQK RQ+VTV S   RD FNTR+FA++NDLG PVAAV+FN QRETAARRR
Sbjct  121  IFVLFKQKGRQTVTVPS--FRDHFNTRQFAEENDLGLPVAAVYFNAQRETAARRR  173



>ref|XP_010101582.1| hypothetical protein L484_015411 [Morus notabilis]
 gb|EXB88721.1| hypothetical protein L484_015411 [Morus notabilis]
Length=169

 Score =   272 bits (695),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 130/172 (76%), Positives = 147/172 (85%), Gaps = 3/172 (2%)
 Frame = -1

Query  785  MSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGDLRS  606
            MS+PLVIGRV+GDV+D F+ + KMSV YN  K V NGHE FPS +T+KP+VE+  GD+R 
Sbjct  1    MSEPLVIGRVIGDVLDSFTPTTKMSVSYN-KKQVCNGHELFPSAVTTKPRVEIQGGDMRC  59

Query  605  FFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRFVFL  426
            FFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FGRE+VSYE PKPNIGIHRFVF+
Sbjct  60   FFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGREVVSYEMPKPNIGIHRFVFV  119

Query  425  LYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            L+KQK RQSV   S  SRD FNTR FA +NDLG PVAAV+FN QRETAARRR
Sbjct  120  LFKQKSRQSVNPPS--SRDHFNTRNFAAENDLGLPVAAVYFNAQRETAARRR  169



>gb|ADP00680.1| CEN [Festuca arundinacea]
 gb|ADP00682.1| CEN [Festuca arundinacea]
Length=169

 Score =   272 bits (695),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 149/170 (88%), Gaps = 2/170 (1%)
 Frame = -1

Query  779  DPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGDLRSFF  600
            +PL++GRV+G+V+D F+  VKM   YNSNK V+NGHE +PS + SKP+VEV  GDLRS F
Sbjct  2    EPLIVGRVIGEVLDPFNPCVKMVATYNSNKLVFNGHELYPSAVVSKPRVEVQGGDLRSLF  61

Query  599  TLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRFVFLLY  420
            TL+MTDPDVPGPSDPYLREHLHWIV++IPGTTD+SFG E++SYE+PKPNIGIHRF+F+L+
Sbjct  62   TLVMTDPDVPGPSDPYLREHLHWIVSNIPGTTDASFGEEVISYESPKPNIGIHRFIFVLF  121

Query  419  KQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            KQKRRQ+V+V S   RD FNTR+FA DNDLG PVAAV+FNCQRETAARRR
Sbjct  122  KQKRRQTVSVPS--FRDHFNTRQFAVDNDLGLPVAAVYFNCQRETAARRR  169



>gb|AFP33418.1| terminal flower 1 [Arachis hypogaea]
Length=180

 Score =   272 bits (696),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 129/172 (75%), Positives = 150/172 (87%), Gaps = 4/172 (2%)
 Frame = -1

Query  782  SDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGDLRSF  603
            SDPL IGRV+GDVVD F+++VKM+V YN NKHVYNG EFFPS +++KP+V +H GDLRS 
Sbjct  12   SDPLTIGRVIGDVVDDFTETVKMTVTYN-NKHVYNGFEFFPSSISAKPRVHIHGGDLRSS  70

Query  602  FTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRFVFLL  423
            FTLIMTDPDVPGPSDPYLREHLHW+VTDIPGTTD++FG+E++ YE PKPNIGIHRFV +L
Sbjct  71   FTLIMTDPDVPGPSDPYLREHLHWMVTDIPGTTDATFGKEVIKYEMPKPNIGIHRFVLVL  130

Query  422  YKQKRRQSVTVSSSP-SRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            YKQKRRQ  TV+  P SRD FNTRKF  +NDLG+PVAAVFFN QRETA R+R
Sbjct  131  YKQKRRQ--TVNKVPNSRDLFNTRKFVVENDLGTPVAAVFFNAQRETACRKR  180



>gb|AGX25243.1| MCN4 [Musa acuminata AAA Group]
 gb|AGX25248.1| MCN4 [Musa acuminata AAA Group]
 gb|AGX25253.1| MCN4 [Musa AAB Group]
 gb|AGX25258.1| MCN4 [Musa AAB Group]
Length=173

 Score =   272 bits (695),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 155/175 (89%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            M++  +PLV+GRV+G+V+D F  SV++ V Y+SNK V+NGHEF+PS +TS+P+VEV  GD
Sbjct  1    MSRPVEPLVVGRVIGEVLDSFRPSVRILVTYSSNKLVFNGHEFYPSTVTSRPRVEVQGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +RSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD+SFGRE+VSYE+P+PNIGIHRF
Sbjct  61   MRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGREVVSYESPRPNIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VF+L+KQKRRQ+  VS   SRDRF+TR+FA++N L  PVAAV+FN QRETAARRR
Sbjct  121  VFVLFKQKRRQA--VSPPASRDRFSTRRFAEENGLDLPVAAVYFNSQRETAARRR  173



>gb|AEH41277.1| terminal flower 1 [Bambusa oldhamii]
Length=173

 Score =   272 bits (695),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 152/175 (87%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            M++  +PL++GRV+G+V+D F+  VKM V YNSN+  +NGHE +PS + SKP+VEV  GD
Sbjct  1    MSRSVEPLIVGRVIGEVLDSFNPCVKMIVTYNSNRLAFNGHELYPSAVESKPRVEVQGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            LRS FTL+MTDPDVPGPSDPYLREHLHWIV+DIPGTTD+SFGRE++SYE+PKPNIGIHRF
Sbjct  61   LRSSFTLVMTDPDVPGPSDPYLREHLHWIVSDIPGTTDASFGREVISYESPKPNIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            +F+L+KQKRRQ+V V S   RD FNTR+FA++NDLG PVAAV+FN QRETAARRR
Sbjct  121  IFVLFKQKRRQTVIVPS--FRDHFNTRRFAEENDLGLPVAAVYFNAQRETAARRR  173



>ref|NP_001267006.1| protein TERMINAL FLOWER 1-like [Fragaria vesca]
 gb|ADO64258.1| TFL1-like protein [Fragaria vesca]
 gb|AEP23097.1| terminal flower 1 [Fragaria vesca]
 dbj|BAO93909.1| terminal flower 1 [Fragaria x ananassa]
Length=172

 Score =   272 bits (695),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 150/175 (86%), Gaps = 3/175 (2%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MA+MS+PL +GRV+GDV+D F+ + KM V YNS K V NGHE FPS +T+KP+VE+  GD
Sbjct  1    MARMSEPLAVGRVIGDVLDSFTPTTKMIVSYNS-KLVCNGHELFPSAVTAKPRVEIQGGD  59

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +RSFFTL+MTDPDVPGPSDPYL+EHLHWIVTDIPGTTD++FGRE+VSYE P+PNIGIHRF
Sbjct  60   MRSFFTLVMTDPDVPGPSDPYLKEHLHWIVTDIPGTTDATFGREVVSYEMPRPNIGIHRF  119

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VF+L+ QKRRQSV   S  SRD FNTR FA +NDLG PVAAV+FN QRETAARRR
Sbjct  120  VFVLFMQKRRQSVNPPS--SRDHFNTRTFAAENDLGVPVAAVYFNAQRETAARRR  172



>ref|NP_001241437.1| protein TERMINAL FLOWER 1-like [Glycine max]
 gb|ACU00124.1| terminal flowering 1-like protein 2 [Glycine max]
 gb|ACU24420.1| unknown [Glycine max]
 dbj|BAI66120.1| terminal flower 1a [Glycine max]
 gb|ADF31196.1| Dt1-like protein [Glycine max]
 gb|ADF31197.1| Dt1-like protein [Glycine max]
 gb|ADF31198.1| Dt1-like protein [Glycine max]
 gb|ADF31199.1| Dt1-like protein [Glycine max]
 gb|ADF31200.1| Dt1-like protein [Glycine max]
 gb|ADF31201.1| Dt1-like protein [Glycine max]
 gb|ADF31202.1| Dt1-like protein [Glycine max]
 gb|ADF31203.1| Dt1-like protein [Glycine max]
 gb|ADF31204.1| Dt1-like protein [Glycine max]
 gb|ADF31205.1| Dt1-like protein [Glycine max]
 gb|ADF31206.1| Dt1-like protein [Glycine max]
 gb|ADF31207.1| Dt1-like protein [Glycine max]
 gb|ADF31208.1| Dt1-like protein [Glycine max]
 gb|ADF31209.1| Dt1-like protein [Glycine max]
 gb|ADF31210.1| Dt1-like protein [Glycine max]
 gb|ADF31211.1| Dt1-like protein [Glycine max]
 gb|ADF31212.1| Dt1-like protein [Glycine max]
 gb|ADF31213.1| Dt1-like protein [Glycine max]
 gb|ADF31214.1| Dt1-like protein [Glycine max]
 gb|ADF31215.1| Dt1-like protein [Glycine max]
 gb|ADF31216.1| Dt1-like protein [Glycine max]
 gb|ADF31217.1| Dt1-like protein [Glycine max]
 gb|ADF31218.1| Dt1-like protein [Glycine max]
 gb|ADF31219.1| Dt1-like protein [Glycine max]
 gb|ADF31220.1| Dt1-like protein [Glycine max]
 gb|ADF31221.1| Dt1-like protein [Glycine max]
 gb|ADF31222.1| Dt1-like protein [Glycine max]
 gb|ADF31223.1| Dt1-like protein [Glycine max]
 gb|ADF31224.1| Dt1-like protein [Glycine max]
 gb|ADF31225.1| Dt1-like protein [Glycine max]
 gb|ADF31226.1| Dt1-like protein [Glycine max]
 gb|ADF31227.1| Dt1-like protein [Glycine max]
 gb|ADF31228.1| Dt1-like protein [Glycine max]
 gb|ADF31229.1| Dt1-like protein [Glycine max]
 gb|ADF31230.1| Dt1-like protein [Glycine max]
 gb|ADF31231.1| Dt1-like protein [Glycine max]
 gb|ADF31232.1| Dt1-like protein [Glycine max]
 gb|ADF31233.1| Dt1-like protein [Glycine max]
 gb|ADF31234.1| Dt1-like protein [Glycine max]
 gb|ADF31235.1| Dt1-like protein [Glycine max]
 gb|ADF31236.1| Dt1-like protein [Glycine max]
 gb|ADF31237.1| Dt1-like protein [Glycine max]
 gb|ADF31238.1| Dt1-like protein [Glycine max]
 gb|ADF31239.1| Dt1-like protein [Glycine max]
 gb|ADF31240.1| Dt1-like protein [Glycine max]
 gb|ADF31241.1| Dt1-like protein [Glycine max]
 gb|ADF31242.1| Dt1-like protein [Glycine max]
 gb|ADF31243.1| Dt1-like protein [Glycine max]
 gb|ADF31244.1| Dt1-like protein [Glycine max]
 gb|ADF31245.1| Dt1-like protein [Glycine max]
 gb|ADF31246.1| Dt1-like protein [Glycine max]
 gb|ADF31247.1| Dt1-like protein [Glycine max]
 gb|ADF31248.1| Dt1-like protein [Glycine max]
 gb|ADF31249.1| Dt1-like protein [Glycine max]
 gb|ADF31250.1| Dt1-like protein [Glycine max]
 gb|ADF31251.1| Dt1-like protein [Glycine max]
 gb|ADF31252.1| Dt1-like protein [Glycine max]
 gb|ADF31253.1| Dt1-like protein [Glycine max]
 gb|ADF31254.1| Dt1-like protein [Glycine max]
 gb|ADF31255.1| Dt1-like protein [Glycine max]
 gb|ADF31256.1| Dt1-like protein [Glycine max]
 gb|ADF31257.1| Dt1-like protein [Glycine max]
 gb|ADF31258.1| Dt1-like protein [Glycine max]
 gb|ADF31259.1| Dt1-like protein [Glycine max]
 gb|ADF31260.1| Dt1-like protein [Glycine max]
 gb|ADF31261.1| Dt1-like protein [Glycine max]
 gb|ADF31262.1| Dt1-like protein [Glycine max]
 gb|ADF31263.1| Dt1-like protein [Glycine max]
 gb|ADF31264.1| Dt1-like protein [Glycine max]
 gb|ADF31265.1| Dt1-like protein [Glycine max]
 gb|ADF31266.1| Dt1-like protein [Glycine max]
 gb|ADF31267.1| Dt1-like protein [Glycine max]
 gb|ADF31268.1| Dt1-like protein [Glycine max]
 gb|ADF31269.1| Dt1-like protein [Glycine max]
 gb|ADF31270.1| Dt1-like protein [Glycine max]
 gb|ADF31271.1| Dt1-like protein [Glycine max]
 gb|ADF31272.1| Dt1-like protein [Glycine max]
 gb|ADF31273.1| Dt1-like protein [Glycine max]
 gb|ADF31274.1| Dt1-like protein [Glycine max]
 gb|ADF31275.1| Dt1-like protein [Glycine max]
 gb|ADF31276.1| Dt1-like protein [Glycine max]
 gb|ADF31277.1| Dt1-like protein [Glycine max]
 gb|ADF31278.1| Dt1-like protein [Glycine max]
 gb|ADF31279.1| Dt1-like protein [Glycine max]
 gb|ADF31280.1| Dt1-like protein [Glycine max]
 gb|ADF31281.1| Dt1-like protein [Glycine max]
 gb|ADF31282.1| Dt1-like protein [Glycine max]
 gb|ADF31283.1| Dt1-like protein [Glycine max]
 gb|ADF31284.1| Dt1-like protein [Glycine max]
 gb|ADF31285.1| Dt1-like protein [Glycine soja]
 gb|ADF31286.1| Dt1-like protein [Glycine soja]
 gb|ADF31287.1| Dt1-like protein [Glycine soja]
 gb|ADF31288.1| Dt1-like protein [Glycine soja]
 gb|ADF31289.1| Dt1-like protein [Glycine soja]
 gb|ADF31290.1| Dt1-like protein [Glycine soja]
 gb|ADF31291.1| Dt1-like protein [Glycine soja]
 gb|ADF31292.1| Dt1-like protein [Glycine soja]
 gb|ADF31293.1| Dt1-like protein [Glycine soja]
 gb|ADF31294.1| Dt1-like protein [Glycine soja]
 gb|ADF31295.1| Dt1-like protein [Glycine soja]
 gb|ADF31296.1| Dt1-like protein [Glycine soja]
 gb|ADF31297.1| Dt1-like protein [Glycine soja]
 gb|ADF31298.1| Dt1-like protein [Glycine soja]
 gb|ADF31299.1| Dt1-like protein [Glycine soja]
 gb|ADF31300.1| Dt1-like protein [Glycine soja]
 gb|ADF31301.1| Dt1-like protein [Glycine soja]
 gb|ADF31302.1| Dt1-like protein [Glycine soja]
 gb|ADF31303.1| Dt1-like protein [Glycine soja]
 gb|ADF31304.1| Dt1-like protein [Glycine soja]
Length=173

 Score =   272 bits (695),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 129/176 (73%), Positives = 151/176 (86%), Gaps = 4/176 (2%)
 Frame = -1

Query  794  MAKMS-DPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDG  618
            MA+M  +PL++GRV+G+V+D F+ S KM V YN N+ VYNGHE FPS + +KPKVE+  G
Sbjct  1    MARMPLEPLIVGRVIGEVLDSFTTSTKMIVSYNKNQ-VYNGHELFPSTVNTKPKVEIEGG  59

Query  617  DLRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHR  438
            D+RSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FG+E+VSYE PKPNIGIHR
Sbjct  60   DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGKELVSYEIPKPNIGIHR  119

Query  437  FVFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            FVF+L+KQKRRQ VT  +  SRD FNTRKFA +NDL  PVAAV+FN QRETAARRR
Sbjct  120  FVFVLFKQKRRQCVTPPT--SRDHFNTRKFAAENDLALPVAAVYFNAQRETAARRR  173



>gb|ADP00674.1| CEN [Festuca arundinacea]
 gb|ADP00686.1| CEN [Festuca arundinacea]
Length=169

 Score =   271 bits (694),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 149/170 (88%), Gaps = 2/170 (1%)
 Frame = -1

Query  779  DPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGDLRSFF  600
            +PL++GRV+G+V+D F+  VKM   YNSNK V+NGHE +PS + SKP+VEV  GDLRS F
Sbjct  2    EPLIVGRVIGEVLDPFNPCVKMVATYNSNKLVFNGHELYPSAVVSKPRVEVQGGDLRSLF  61

Query  599  TLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRFVFLLY  420
            TL+MTDPDVPGPSDPYLREHLHWIV++IPGTTD+SFG E++SYE+PKPNIGIHRF+F+L+
Sbjct  62   TLVMTDPDVPGPSDPYLREHLHWIVSNIPGTTDASFGGEVISYESPKPNIGIHRFIFVLF  121

Query  419  KQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            KQKRRQ+V+V S   RD FNTR+FA DNDLG PVAAV+FNCQRETAARRR
Sbjct  122  KQKRRQTVSVPS--FRDHFNTRQFAADNDLGLPVAAVYFNCQRETAARRR  169



>ref|XP_009379789.1| PREDICTED: protein SELF-PRUNING-like [Musa acuminata subsp. malaccensis]
Length=173

 Score =   271 bits (694),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 155/175 (89%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            M++  +PLV+GRV+G+V+D F  SV++ + Y+SNK V+NGHEF+PS +TS+P+VEV  GD
Sbjct  1    MSRPVEPLVVGRVIGEVLDSFRPSVRILITYSSNKLVFNGHEFYPSTVTSRPRVEVQGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +RSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD+SFGRE+VSYE+P+PNIGIHRF
Sbjct  61   MRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGREVVSYESPRPNIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VF+L+KQKRRQ+  VS   SRDRF+TR+FA++N L  PVAAV+FN QRETAARRR
Sbjct  121  VFVLFKQKRRQA--VSPPASRDRFSTRRFAEENGLDLPVAAVYFNSQRETAARRR  173



>gb|AFA42328.1| TFL1-like protein [Fragaria x ananassa]
 gb|AFA52237.1| TFL1-like protein [Fragaria x ananassa]
Length=172

 Score =   271 bits (694),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 150/175 (86%), Gaps = 3/175 (2%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MA+MS+PL +GRV+GDV+D F+ + KM V YN+ K V NGHE FPS +T+KP+VE+  GD
Sbjct  1    MARMSEPLAVGRVIGDVLDSFTPTTKMIVTYNT-KLVCNGHELFPSAVTAKPRVEIQGGD  59

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +RSFFTL+MTDPDVPGPSDPYL+EHLHWIVTDIPGTTD++FGRE+VSYE P+PNIGIHRF
Sbjct  60   MRSFFTLVMTDPDVPGPSDPYLKEHLHWIVTDIPGTTDATFGREVVSYEMPRPNIGIHRF  119

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VF+L+ QKRRQSV   S  SRD FNTR FA +NDLG PVAAV+FN QRETAARRR
Sbjct  120  VFVLFMQKRRQSVNPPS--SRDHFNTRTFAAENDLGVPVAAVYFNAQRETAARRR  172



>dbj|BAJ22384.1| terminal flower 1a [Vigna unguiculata]
 gb|AIA10354.1| TFL1 [Vigna unguiculata]
 gb|AIA10355.1| TFL1 [Vigna unguiculata]
Length=173

 Score =   271 bits (694),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 130/176 (74%), Positives = 150/176 (85%), Gaps = 4/176 (2%)
 Frame = -1

Query  794  MAKMS-DPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDG  618
            MA+M  +PL++GRV+G+V+D F+ S KM+V YN  K VYNGHEFFPS +  KPKVE+  G
Sbjct  1    MARMPLEPLIVGRVIGEVLDSFTTSTKMTVSYN-KKQVYNGHEFFPSSINIKPKVEIEGG  59

Query  617  DLRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHR  438
            D+RSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FG+E+VSYE PKPNIGIHR
Sbjct  60   DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGKELVSYEIPKPNIGIHR  119

Query  437  FVFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            FVF+L+KQKRRQ VT  S  SRD FNTR FA  N+LG PVAAV+FN QRETAARRR
Sbjct  120  FVFVLFKQKRRQCVTPPS--SRDHFNTRNFAAQNELGLPVAAVYFNAQRETAARRR  173



>ref|XP_006663820.1| PREDICTED: CEN-like protein 2-like [Oryza brachyantha]
Length=173

 Score =   271 bits (694),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 153/175 (87%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            M+   +PL++GRV+G+V+D F+  +KM V YNSNK V NGHE++PS + SKP+VEV  GD
Sbjct  1    MSISVEPLIVGRVIGEVLDSFNPCMKMIVTYNSNKLVCNGHEYYPSAVVSKPRVEVQGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +RSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD+SFG+EI+SYE+PKP+IGIHRF
Sbjct  61   MRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGQEIISYESPKPSIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            +F+L+KQK RQ+V V S  SRD FNTR+FA++N+LG PVAAV+FN QRETAARRR
Sbjct  121  IFVLFKQKHRQTVVVPS--SRDNFNTRRFAEENELGLPVAAVYFNAQRETAARRR  173



>gb|AIA10351.1| TFL1 [Vigna unguiculata]
 gb|AIA10352.1| TFL1 [Vigna unguiculata]
 gb|AIA10353.1| TFL1 [Vigna unguiculata]
Length=173

 Score =   271 bits (693),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 130/176 (74%), Positives = 150/176 (85%), Gaps = 4/176 (2%)
 Frame = -1

Query  794  MAKMS-DPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDG  618
            MA+M  +PL++GRV+G+V+D F+ S KM+V YN  K VYNGHEFFPS +  KPKVE+  G
Sbjct  1    MARMPLEPLIVGRVIGEVLDSFTTSTKMTVSYNK-KQVYNGHEFFPSSINIKPKVEIEGG  59

Query  617  DLRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHR  438
            D+RSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FG+E+VSYE PKPNIGIHR
Sbjct  60   DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGKELVSYEIPKPNIGIHR  119

Query  437  FVFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            FVF+L+KQKRRQ VT  S  SRD FNTR FA  N+LG PVAAV+FN QRETAARRR
Sbjct  120  FVFVLFKQKRRQCVTPHS--SRDHFNTRNFAAQNELGLPVAAVYFNAQRETAARRR  173



>gb|ADP00689.1| CEN [Festuca pallens]
 gb|ADP00691.1| CEN [Festuca ovina]
Length=169

 Score =   271 bits (693),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 149/170 (88%), Gaps = 2/170 (1%)
 Frame = -1

Query  779  DPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGDLRSFF  600
            +PL++GRV+G+V+D F+  VKM   YNSNK V+NGHE +PS + SKP+VEV  GDLRS F
Sbjct  2    EPLIVGRVIGEVLDSFNPCVKMVATYNSNKLVFNGHELYPSAVVSKPRVEVQGGDLRSLF  61

Query  599  TLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRFVFLLY  420
            TL+MTDPDVPGPSDPYLREHLHWIV++IPGTTD+SFG E+VSYE+PKPNIGIHRF+F+L+
Sbjct  62   TLVMTDPDVPGPSDPYLREHLHWIVSNIPGTTDASFGGEVVSYESPKPNIGIHRFIFVLF  121

Query  419  KQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            KQKRRQ+++V S   RD FNTR+FA DNDLG PVAAV+FNCQRETAARRR
Sbjct  122  KQKRRQTLSVPS--FRDHFNTRQFAVDNDLGLPVAAVYFNCQRETAARRR  169



>gb|ABW24964.1| terminal flower 1b [Gossypium hirsutum]
Length=172

 Score =   271 bits (693),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 151/175 (86%), Gaps = 3/175 (2%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MA+  +PL++GRV+GDV+D F  S+KM V +N NK V+NGHEF+PS + +KP+VEV  GD
Sbjct  1    MAREVEPLMVGRVIGDVMDSFIPSIKMLVTFN-NKQVFNGHEFYPSTVVTKPRVEVAGGD  59

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +R+FFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FGRE+VSYE PKPNIGIHRF
Sbjct  60   MRTFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGREVVSYENPKPNIGIHRF  119

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VF+L+KQKRRQ   + S  SRD FNTR+FA +NDLG PVAAV+FN QRETAARRR
Sbjct  120  VFVLFKQKRRQ--IIKSPCSRDNFNTRRFASENDLGLPVAAVYFNAQRETAARRR  172



>gb|ADP00670.1| CEN [Festuca arundinacea]
 gb|ADP00671.1| CEN [Festuca arundinacea]
 gb|ADP00673.1| CEN [Festuca arundinacea]
 gb|ADP00675.1| CEN [Festuca arundinacea]
 gb|ADP00677.1| CEN [Festuca arundinacea]
 gb|ADP00683.1| CEN [Festuca arundinacea]
 gb|ADP00684.1| CEN [Festuca arundinacea]
 gb|ADP00685.1| CEN [Festuca arundinacea]
 gb|ADP00687.1| CEN [Festuca arundinacea]
 gb|ADP00695.1| CEN [Festuca mairei]
 gb|ADP00696.1| CEN [Festuca arundinacea subsp. cirtensis]
 gb|ADP00697.1| CEN [Festuca arundinacea subsp. cirtensis]
 gb|ADP00698.1| CEN [Festuca arundinacea subsp. fenas]
 gb|ADP00699.1| CEN [Festuca drymeja]
 gb|ADP00700.1| CEN [Festuca lasto]
 gb|ADP00701.1| CEN [Festuca arundinacea subsp. atlantigena]
 gb|ADP00702.1| CEN [Festuca altissima]
 gb|ADP00704.1| CEN [Lolium multiflorum]
 gb|ADP00705.1| CEN [Festuca pratensis]
 gb|ADP00706.1| CEN [Festuca mairei]
 gb|ADP00707.1| CEN [Festuca arundinacea subsp. cirtensis]
 gb|ADP00709.1| CEN [Festuca arundinacea subsp. fenas]
 gb|ADP00712.1| CEN [Festuca gigantea]
Length=169

 Score =   271 bits (692),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 149/170 (88%), Gaps = 2/170 (1%)
 Frame = -1

Query  779  DPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGDLRSFF  600
            +PL++GRV+G+V+D F+  VKM   YNSNK V+NGHE +PS + SKP+VEV  GDLRS F
Sbjct  2    EPLIVGRVIGEVLDPFNPCVKMVATYNSNKLVFNGHELYPSAVVSKPRVEVQGGDLRSLF  61

Query  599  TLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRFVFLLY  420
            TL+MTDPDVPGPSDPYLREHLHWIV++IPGTTD+SFG E++SYE+PKPNIGIHRF+F+L+
Sbjct  62   TLVMTDPDVPGPSDPYLREHLHWIVSNIPGTTDASFGGEVISYESPKPNIGIHRFIFVLF  121

Query  419  KQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            KQKRRQ+V+V S   RD FNTR+FA DNDLG PVAAV+FNCQRETAARRR
Sbjct  122  KQKRRQTVSVPS--FRDHFNTRQFAVDNDLGLPVAAVYFNCQRETAARRR  169



>gb|ABW24962.1| terminal flower 1b [Gossypium arboreum]
 gb|ABW24969.1| terminal flower 1b [Gossypium arboreum]
Length=172

 Score =   271 bits (693),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 152/175 (87%), Gaps = 3/175 (2%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MA+  +PL++GRV+GDV+D F  S+KMSV +N NK V+NGHEF+PS + +KP+VEV  GD
Sbjct  1    MAREVEPLMVGRVIGDVMDSFIPSIKMSVTFN-NKQVFNGHEFYPSTVVTKPRVEVVGGD  59

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +R+FFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FGRE+VSYE PKPNIGIHRF
Sbjct  60   MRTFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGREVVSYENPKPNIGIHRF  119

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VF+L+KQKRRQ   + S  SRD FNTR+FA +NDLG PVAAV+FN QRETAARRR
Sbjct  120  VFVLFKQKRRQ--IIKSPCSRDNFNTRRFAFENDLGLPVAAVYFNAQRETAARRR  172



>gb|ADP00708.1| CEN [Festuca arundinacea subsp. cirtensis]
Length=169

 Score =   271 bits (692),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 123/170 (72%), Positives = 149/170 (88%), Gaps = 2/170 (1%)
 Frame = -1

Query  779  DPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGDLRSFF  600
            +PL++GRV+G+V+D F+  VKM   YNSNK V+NGHE +PS + SKP+VEV  GDLRS F
Sbjct  2    EPLIVGRVIGEVLDPFNTCVKMVATYNSNKLVFNGHELYPSAVVSKPRVEVQGGDLRSLF  61

Query  599  TLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRFVFLLY  420
            TL+MTDPDVPGPSDPYLREHLHWIV++IPGTTD+SFG E++SYE+PKPNIGIHRF+F+L+
Sbjct  62   TLVMTDPDVPGPSDPYLREHLHWIVSNIPGTTDASFGGEVISYESPKPNIGIHRFIFVLF  121

Query  419  KQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            KQKRRQ+++V S   RD FNTR+FA DNDLG PVAAV+FNCQRETAARRR
Sbjct  122  KQKRRQTISVPS--FRDHFNTRQFAVDNDLGLPVAAVYFNCQRETAARRR  169



>gb|AHZ46122.1| TFL1-like flowering time protein [Saccharum hybrid cultivar]
Length=173

 Score =   271 bits (692),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 151/175 (86%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            M++  + LV+GRV+G+V+D FS  V M V YNSNK V+NGHE +PS + SKP+VEV  GD
Sbjct  1    MSRSVESLVVGRVIGEVLDFFSPCVNMVVTYNSNKLVFNGHEIYPSAVVSKPRVEVQGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            LRSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD+SFGRE++SYE+P+P+IGIHRF
Sbjct  61   LRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGREVISYESPRPSIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            +F+L+KQKRRQ+V V S  SRD F TR+FA +NDLG PVAAV+FN QRETAARRR
Sbjct  121  IFVLFKQKRRQTVAVPS--SRDHFVTRQFAXENDLGLPVAAVYFNAQRETAARRR  173



>gb|ADP00694.1| CEN [Festuca scariosa]
Length=169

 Score =   271 bits (692),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 149/170 (88%), Gaps = 2/170 (1%)
 Frame = -1

Query  779  DPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGDLRSFF  600
            +PL++GRV+G+V+D F+  VKM   YNSNK V+NGHE +PS + SKP+VEV  GDLRS F
Sbjct  2    EPLIVGRVIGEVLDPFNPCVKMVATYNSNKLVFNGHELYPSAVESKPRVEVQGGDLRSLF  61

Query  599  TLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRFVFLLY  420
            TL+MTDPDVPGPSDPYLREHLHWIV++IPGTTD+SFG E++SYE+PKPNIGIHRF+F+L+
Sbjct  62   TLVMTDPDVPGPSDPYLREHLHWIVSNIPGTTDASFGGEVISYESPKPNIGIHRFIFVLF  121

Query  419  KQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            KQKRRQ+V+V S   RD FNTR+FA DNDLG PVAAV+FNCQRETAARRR
Sbjct  122  KQKRRQTVSVPS--FRDHFNTRQFAVDNDLGLPVAAVYFNCQRETAARRR  169



>ref|XP_004494168.1| PREDICTED: protein CENTRORADIALIS-like [Cicer arietinum]
Length=174

 Score =   271 bits (692),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 128/176 (73%), Positives = 152/176 (86%), Gaps = 3/176 (2%)
 Frame = -1

Query  794  MAKMS-DPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDG  618
            MA+MS +PL++GRV+G+V+D F+ S+KM+V YN  K V+NGHEFFPS +  KPKVE+  G
Sbjct  1    MARMSQEPLLVGRVIGEVLDSFTTSMKMTVSYN-KKQVFNGHEFFPSTINIKPKVEIDGG  59

Query  617  DLRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHR  438
            D+RSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FG+E+VSYE PKPNIGIHR
Sbjct  60   DMRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGKELVSYEIPKPNIGIHR  119

Query  437  FVFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            FVF+L+KQK R+SV  + S SRD FNTR FA  NDLG PVAAV+FN QRETAARRR
Sbjct  120  FVFVLFKQKSRESVMTTPS-SRDHFNTRNFASQNDLGLPVAAVYFNAQRETAARRR  174



>gb|ADP00676.1| CEN [Festuca arundinacea]
 gb|ADP00688.1| CEN [Festuca arundinacea]
Length=169

 Score =   271 bits (692),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 149/170 (88%), Gaps = 2/170 (1%)
 Frame = -1

Query  779  DPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGDLRSFF  600
            +PL++GRV+G+V+D F+  VKM   YNSNK V+NGHE +PS + SKP+VEV  GDLRS F
Sbjct  2    EPLIVGRVIGEVLDPFNPCVKMVATYNSNKLVFNGHELYPSAVVSKPRVEVQGGDLRSLF  61

Query  599  TLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRFVFLLY  420
            TL+MTDPDVPGPSDPYLREHLHWIV++IPGTTD+SFG E++SYE+PKPNIGIHRF+F+L+
Sbjct  62   TLVMTDPDVPGPSDPYLREHLHWIVSNIPGTTDTSFGGEVISYESPKPNIGIHRFIFVLF  121

Query  419  KQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            KQKRRQ+V+V S   RD FNTR+FA DNDLG PVAAV+FNCQRETAARRR
Sbjct  122  KQKRRQTVSVPS--FRDHFNTRQFAVDNDLGLPVAAVYFNCQRETAARRR  169



>gb|AEO72027.1| TFL1-like protein [Fragaria vesca]
Length=172

 Score =   271 bits (692),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 150/175 (86%), Gaps = 3/175 (2%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MA+MS+PL +GRV+GDV+D F+ + KM V YNS K V NGHE FPS +T+KP+VE+  GD
Sbjct  1    MARMSEPLAVGRVIGDVLDSFTPTTKMIVSYNS-KLVCNGHELFPSAVTAKPRVEIQGGD  59

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +RSFFTL+MTDPDVPGPSDPYL+EHLHWIVTDIPGTTD++FGRE+VSYE P+PNIGIHRF
Sbjct  60   MRSFFTLVMTDPDVPGPSDPYLKEHLHWIVTDIPGTTDATFGREVVSYEMPRPNIGIHRF  119

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VF+L+ QKRRQS+   S  SRD FNTR FA +NDLG PVAAV+FN QRETAARRR
Sbjct  120  VFVLFMQKRRQSMNPPS--SRDHFNTRTFAAENDLGVPVAAVYFNAQRETAARRR  172



>gb|ABW24968.1| terminal flower 1b [Gossypium hirsutum]
Length=172

 Score =   271 bits (692),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 151/175 (86%), Gaps = 3/175 (2%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MA+  +PL++GRV+GDV+D F  S+KMSV +N NK V+NGHEF+PS + +KP+VEV  GD
Sbjct  1    MAREVEPLMVGRVIGDVMDSFIPSIKMSVTFN-NKQVFNGHEFYPSTVVTKPRVEVVGGD  59

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +R+FFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FGRE+VSYE PKPNIGIHRF
Sbjct  60   MRTFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGREVVSYENPKPNIGIHRF  119

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VF+L+KQKRRQ   + S  SRD FNTR+F  +NDLG PVAAV+FN QRETAARRR
Sbjct  120  VFVLFKQKRRQ--IIKSPCSRDNFNTRRFVSENDLGLPVAAVYFNAQRETAARRR  172



>gb|ADP00692.1| CEN [Festuca tatrae]
Length=169

 Score =   270 bits (691),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 149/170 (88%), Gaps = 2/170 (1%)
 Frame = -1

Query  779  DPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGDLRSFF  600
            +PL++GRV+G+V+D F+  VKM   YNSNK V+NGHE +PS + SKP+VEV  GDLRS F
Sbjct  2    EPLIVGRVIGEVLDPFNPCVKMVATYNSNKLVFNGHELYPSAVVSKPRVEVQGGDLRSLF  61

Query  599  TLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRFVFLLY  420
            TL+MTDPDVPGPSDPYLREHLHWIV++IPGTTD+SFG E+VSYE+PKPNIGIHRF+F+L+
Sbjct  62   TLVMTDPDVPGPSDPYLREHLHWIVSNIPGTTDASFGGEVVSYESPKPNIGIHRFIFVLF  121

Query  419  KQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            KQKRRQ+++V S   RD FNTR+FA DNDLG PVAAV+FNCQRETAARRR
Sbjct  122  KQKRRQTLSVPS--FRDHFNTRQFAVDNDLGLPVAAVYFNCQRETAARRR  169



>gb|ADP00711.1| CEN [Festuca gigantea]
 gb|ADP00715.1| CEN [Festuca pratensis subsp. apennina]
Length=169

 Score =   270 bits (691),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 149/170 (88%), Gaps = 2/170 (1%)
 Frame = -1

Query  779  DPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGDLRSFF  600
            +PL++GRV+G+V+D F+  VKM   YNSNK V+NGHE +PS + SKP+VEV  GDLRS F
Sbjct  2    EPLIVGRVIGEVLDPFNPCVKMVATYNSNKLVFNGHELYPSAVVSKPRVEVQGGDLRSLF  61

Query  599  TLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRFVFLLY  420
            TL+MTDPDVPGPSDPYLREHLHWIV++IPGTTD+SFG E++SYE+PKPNIGIHRF+F+L+
Sbjct  62   TLVMTDPDVPGPSDPYLREHLHWIVSNIPGTTDASFGGEVMSYESPKPNIGIHRFIFVLF  121

Query  419  KQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            KQKRRQ+V+V S   RD FNTR+FA DNDLG PVAAV+FNCQRETAARRR
Sbjct  122  KQKRRQTVSVPS--FRDHFNTRQFAVDNDLGLPVAAVYFNCQRETAARRR  169



>ref|NP_001106242.1| ZCN3 protein [Zea mays]
 gb|ABW96226.1| ZCN3 [Zea mays]
Length=173

 Score =   270 bits (691),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 153/175 (87%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            M++  +PL++GRV+G+V+D F+  VKM V YNSNK V+NGHE +PS + SKP+V V  GD
Sbjct  1    MSRSVEPLIVGRVIGEVLDSFNPCVKMIVTYNSNKLVFNGHEIYPSAVVSKPRVAVQGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            LRSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD+SFGR+I+SYE+P+P+IGIHRF
Sbjct  61   LRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGRQIISYESPRPSIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            +F+L+KQ+ RQ+VTV S   RD FNTR+FA++NDLG PVAAV+FN QRETAARRR
Sbjct  121  IFVLFKQQGRQNVTVPS--FRDHFNTRQFAEENDLGLPVAAVYFNAQRETAARRR  173



>ref|NP_001106245.1| ZCN6 protein [Zea mays]
 gb|ABW96229.1| ZCN6 [Zea mays]
Length=177

 Score =   270 bits (691),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 126/177 (71%), Positives = 151/177 (85%), Gaps = 2/177 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            M++  + LV+GRV+G+V+D FS  VKM V YNSN+ V+NGHE +PS + SKP+VEV  GD
Sbjct  1    MSRSVESLVVGRVIGEVLDCFSPCVKMVVTYNSNRLVFNGHEIYPSAVVSKPRVEVQGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            LRSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD+SFGRE+VSYE+P+P IGIHRF
Sbjct  61   LRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGREVVSYESPRPGIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSP--SRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            +F+L+KQKRRQ  TV++ P  SRD   TR+FA +NDLG PVAAV+FN QRETAARRR
Sbjct  121  IFVLFKQKRRQQQTVAAVPSSSRDHSITRQFAAENDLGHPVAAVYFNAQRETAARRR  177



>gb|ABY91243.1| CTRSTFL-like protein [Citrus trifoliata]
Length=173

 Score =   270 bits (691),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 126/176 (72%), Positives = 149/176 (85%), Gaps = 3/176 (2%)
 Frame = -1

Query  797  IMAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDG  618
            + A+M +PL +GRV+GDV++ F+ S+K SV YN NK V NGHE FPS + SKP+VE+  G
Sbjct  1    MAARMLEPLAVGRVIGDVIESFTPSIKKSVTYN-NKQVCNGHELFPSTVVSKPRVEIQGG  59

Query  617  DLRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHR  438
            D+RSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FGRE+VSYE P+PNIGIHR
Sbjct  60   DMRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGRELVSYEIPRPNIGIHR  119

Query  437  FVFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            FVF+L+KQ RRQ+V   S  SRD FNTR FA +NDLG PVAAV+FN QRETAARRR
Sbjct  120  FVFVLFKQTRRQTVNPPS--SRDHFNTRAFAAENDLGLPVAAVYFNAQRETAARRR  173



>ref|XP_007202664.1| hypothetical protein PRUPE_ppa012369mg [Prunus persica]
 gb|ADL62867.1| terminal flower 1 [Prunus persica]
 gb|EMJ03863.1| hypothetical protein PRUPE_ppa012369mg [Prunus persica]
Length=172

 Score =   270 bits (690),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 152/175 (87%), Gaps = 3/175 (2%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MA++S+PLV+GRV+GDV+D F+ + KMSV YN+ + V NG+E +PS +T+KP+VE+  GD
Sbjct  1    MARISEPLVVGRVIGDVLDCFTPTTKMSVTYNT-RLVCNGYELYPSAVTTKPRVEIQGGD  59

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +R+FFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FGRE+VSYE P+PNIGIHRF
Sbjct  60   MRTFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGREVVSYEMPRPNIGIHRF  119

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VF+L+KQ RRQSV   S  SRD F+ R FA +NDLG PVAAV+FNCQRETAARRR
Sbjct  120  VFVLFKQTRRQSVNPPS--SRDHFSARSFAAENDLGPPVAAVYFNCQRETAARRR  172



>gb|ADP00714.1| CEN [Festuca pratensis subsp. apennina]
Length=169

 Score =   270 bits (690),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 123/170 (72%), Positives = 149/170 (88%), Gaps = 2/170 (1%)
 Frame = -1

Query  779  DPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGDLRSFF  600
            +PL++GRV+G+V+D F+  VKM   YNSNK V+NGHE +PS + SKP+VEV  GDLRS F
Sbjct  2    EPLIVGRVIGEVLDPFNPCVKMVATYNSNKLVFNGHELYPSAVVSKPRVEVQGGDLRSLF  61

Query  599  TLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRFVFLLY  420
            TL+MTDPDVPGPSDPYLREHLHWIV++IPGTTD+SFG E+++YE+PKPNIGIHRF+F+L+
Sbjct  62   TLVMTDPDVPGPSDPYLREHLHWIVSNIPGTTDASFGGEVITYESPKPNIGIHRFIFVLF  121

Query  419  KQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            KQKRRQ+V+V S   RD FNTR+FA DNDLG PVAAV+FNCQRETAARRR
Sbjct  122  KQKRRQTVSVPS--FRDHFNTRQFAVDNDLGLPVAAVYFNCQRETAARRR  169



>ref|XP_006481791.1| PREDICTED: protein TERMINAL FLOWER 1 isoform X1 [Citrus sinensis]
Length=173

 Score =   270 bits (690),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 126/176 (72%), Positives = 149/176 (85%), Gaps = 3/176 (2%)
 Frame = -1

Query  797  IMAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDG  618
            + A+M +PL +G V+GDV++ F+ S+KMSV YN NK V NGHE FPS + SKP+VE+  G
Sbjct  1    MAARMLEPLAVGGVIGDVIESFTPSIKMSVTYN-NKQVCNGHELFPSTVVSKPRVEIQGG  59

Query  617  DLRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHR  438
            D+RSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FGRE+VSYE P+PNIGIHR
Sbjct  60   DMRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGRELVSYEIPRPNIGIHR  119

Query  437  FVFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            FVF+L+KQ RRQ+V   S  SRD FNTR FA +NDLG PVAAV+FN QRETAARRR
Sbjct  120  FVFVLFKQTRRQTVNPPS--SRDHFNTRAFAAENDLGLPVAAVYFNAQRETAARRR  173



>gb|ADP00690.1| CEN [Festuca circummediterranea]
Length=169

 Score =   270 bits (689),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 123/170 (72%), Positives = 148/170 (87%), Gaps = 2/170 (1%)
 Frame = -1

Query  779  DPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGDLRSFF  600
            +PL++GRV+G+V+D F+  VKM   YNSNK V+NGHE +PS +  KP+VEV  GDLRS F
Sbjct  2    EPLIVGRVIGEVLDSFNPCVKMVATYNSNKLVFNGHELYPSAVVCKPRVEVQGGDLRSLF  61

Query  599  TLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRFVFLLY  420
            TL+MTDPDVPGPSDPYLREHLHWIV++IPGTTD+SFG E+VSYE+PKPNIGIHRF+F+L+
Sbjct  62   TLVMTDPDVPGPSDPYLREHLHWIVSNIPGTTDASFGGEVVSYESPKPNIGIHRFIFVLF  121

Query  419  KQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            KQKRRQ+++V S   RD FNTR+FA DNDLG PVAAV+FNCQRETAARRR
Sbjct  122  KQKRRQTLSVPS--FRDHFNTRQFAVDNDLGLPVAAVYFNCQRETAARRR  169



>gb|ADP00678.1| CEN [Festuca arundinacea]
 gb|ADP00679.1| CEN [Festuca arundinacea]
 gb|ADP00681.1| CEN [Festuca arundinacea]
Length=169

 Score =   270 bits (689),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 123/170 (72%), Positives = 149/170 (88%), Gaps = 2/170 (1%)
 Frame = -1

Query  779  DPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGDLRSFF  600
            +PL++GRV+G+V+D F+  VKM   YNSNK V+NGHE +PS + SKP+VEV  GDLRS F
Sbjct  2    EPLIVGRVIGEVLDPFNPCVKMVATYNSNKLVFNGHELYPSAVVSKPRVEVQGGDLRSLF  61

Query  599  TLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRFVFLLY  420
            TL+MTDPDVPGPSDPYLREHLHWIV++IPGTTD+SFG E++SYE+PKPNIGIHRF+F+L+
Sbjct  62   TLVMTDPDVPGPSDPYLREHLHWIVSNIPGTTDASFGGEVISYESPKPNIGIHRFIFVLF  121

Query  419  KQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            KQKRRQ+V+V S   RD FNTR+FA +NDLG PVAAV+FNCQRETAARRR
Sbjct  122  KQKRRQTVSVPS--FRDHFNTRQFAVNNDLGLPVAAVYFNCQRETAARRR  169



>gb|AIA10356.1| TFL1 [Vigna unguiculata]
Length=173

 Score =   270 bits (689),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 129/176 (73%), Positives = 149/176 (85%), Gaps = 4/176 (2%)
 Frame = -1

Query  794  MAKMS-DPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDG  618
            MA+M  +PL++GRV+G+V+D F+ S KM+V YN  K VYNGHEFFPS +  KPKVE+  G
Sbjct  1    MARMPLEPLIVGRVIGEVLDSFTTSTKMTVSYN-KKQVYNGHEFFPSSINIKPKVEIEGG  59

Query  617  DLRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHR  438
            D+RSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FG+E+VSYE PKPNIGIHR
Sbjct  60   DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGKELVSYEIPKPNIGIHR  119

Query  437  FVFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            FVF+L+KQKRRQ VT  S  SRD FNTR FA  N+ G PVAAV+FN QRETAARRR
Sbjct  120  FVFVLFKQKRRQCVTPPS--SRDHFNTRNFAAQNEFGLPVAAVYFNAQRETAARRR  173



>gb|AHX00603.1| TFL1a [Lupinus angustifolius]
 gb|AHX00604.1| TFL1a [Lupinus angustifolius]
Length=173

 Score =   270 bits (689),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 127/176 (72%), Positives = 153/176 (87%), Gaps = 4/176 (2%)
 Frame = -1

Query  794  MAKMS-DPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDG  618
            MA++S +PL++GRV+GDV+D F+ S+KM+V YN NK V+NGHE FPS +T+KP+VE+   
Sbjct  1    MARISSEPLIVGRVIGDVLDSFTTSMKMTVSYN-NKQVFNGHELFPSTVTNKPRVEIDGA  59

Query  617  DLRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHR  438
            DLRSFFTL+MTDPDVPGPSDPY+REHLHWIVTDIPGTTD++FG+E+V+YE PKPNIGIHR
Sbjct  60   DLRSFFTLVMTDPDVPGPSDPYMREHLHWIVTDIPGTTDATFGKELVNYEIPKPNIGIHR  119

Query  437  FVFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            FVF+L+KQKRRQ VT  S  SRD FNT  FA +NDLG PVAAV+FN QRETAARRR
Sbjct  120  FVFVLFKQKRRQCVTQPS--SRDHFNTMNFASENDLGLPVAAVYFNAQRETAARRR  173



>gb|ADP00713.1| CEN [Festuca arundinacea subsp. atlantigena]
Length=169

 Score =   270 bits (689),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 123/170 (72%), Positives = 149/170 (88%), Gaps = 2/170 (1%)
 Frame = -1

Query  779  DPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGDLRSFF  600
            +PL++GRV+G+V+D F+  VKM   YNSNK V+NGHE +PS + SKP+VEV  GDLRS F
Sbjct  2    EPLIVGRVIGEVLDPFNPCVKMVATYNSNKLVFNGHELYPSAVVSKPRVEVQGGDLRSLF  61

Query  599  TLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRFVFLLY  420
            TL+MTDPDVPGPSDPYLREHLHWIV++IPGTTD+SFG E++SYE+PKPNIGIHRF+F+L+
Sbjct  62   TLVMTDPDVPGPSDPYLREHLHWIVSNIPGTTDASFGGEVISYESPKPNIGIHRFIFVLF  121

Query  419  KQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            KQKRRQ+V+V S   RD FNTR+F+ DNDLG PVAAV+FNCQRETAARRR
Sbjct  122  KQKRRQTVSVPS--FRDHFNTRQFSVDNDLGLPVAAVYFNCQRETAARRR  169



>ref|NP_001267931.1| TFL1B protein [Vitis vinifera]
 gb|ABI99467.1| TFL1B protein [Vitis vinifera]
 emb|CAN61194.1| hypothetical protein VITISV_028345 [Vitis vinifera]
 emb|CBI30285.3| unnamed protein product [Vitis vinifera]
Length=172

 Score =   270 bits (689),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 152/175 (87%), Gaps = 3/175 (2%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MA++ +PL++GRV+GDV+D F  ++KM+V Y+ NK + NG+E +PS +T KP+VEV  GD
Sbjct  1    MARILEPLIVGRVIGDVLDPFPPTIKMTVTYH-NKQICNGYELYPSSITVKPRVEVQGGD  59

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            LRSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FGRE++SYE PKPNIGIHRF
Sbjct  60   LRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGREVLSYEIPKPNIGIHRF  119

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VF+L+KQKRRQ  TV++  SRD FNTR FA +NDLG PVAAVFFN QRETAARRR
Sbjct  120  VFVLFKQKRRQ--TVNTPTSRDHFNTRSFAAENDLGLPVAAVFFNAQRETAARRR  172



>gb|AIU44253.1| TFL1 [Oncidium hybrid cultivar]
Length=173

 Score =   269 bits (688),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 150/175 (86%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MA+  +PLV+GRV+G+V++ F+ SVKM V YN NKHVYNGHE +PS++   P+VEV  GD
Sbjct  1    MARAIEPLVVGRVIGEVLELFNPSVKMKVTYNCNKHVYNGHELYPSVILDMPRVEVQGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            LRSFFTLIMTDPDVPGPSDPYLREH+HWIVTDIPGTTD+SFGRE+V YE+P+P IGIHRF
Sbjct  61   LRSFFTLIMTDPDVPGPSDPYLREHVHWIVTDIPGTTDASFGREVVPYESPRPRIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VF+L+ QKRR  +TV    SRDRFNTR FA+++DLG PV+AV+FN QRETAARRR
Sbjct  121  VFVLFMQKRR--LTVGPPISRDRFNTRGFAEEHDLGLPVSAVYFNAQRETAARRR  173



>gb|ADP00716.1| CEN [Festuca valesiaca]
Length=169

 Score =   269 bits (687),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 148/170 (87%), Gaps = 2/170 (1%)
 Frame = -1

Query  779  DPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGDLRSFF  600
            +PL +GRV+G+V+D F+  VKM   YNSNK V+NGHE +PS + SKP+VEV  GDLRS F
Sbjct  2    EPLKVGRVIGEVLDSFNPCVKMVATYNSNKLVFNGHELYPSAVVSKPRVEVQGGDLRSLF  61

Query  599  TLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRFVFLLY  420
            TL+MTDPDVPGPSDPYLREHLHWIV++IPGTTD+SFG E+VSYE+PKPNIGIHRF+F+L+
Sbjct  62   TLVMTDPDVPGPSDPYLREHLHWIVSNIPGTTDASFGGEVVSYESPKPNIGIHRFIFVLF  121

Query  419  KQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            KQKRRQ+++V S   RD FNTR+FA DNDLG PVAAV+FNCQRETAARRR
Sbjct  122  KQKRRQTLSVPS--FRDHFNTRQFAVDNDLGLPVAAVYFNCQRETAARRR  169



>ref|XP_011094364.1| PREDICTED: protein TERMINAL FLOWER 1-like isoform X3 [Sesamum 
indicum]
Length=172

 Score =   269 bits (688),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 150/175 (86%), Gaps = 3/175 (2%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MA+MSDPL++GRV+GDV+D FS + KM V Y +NK V+NGHEF+PS +  KP+VE+  GD
Sbjct  1    MARMSDPLIVGRVIGDVLDSFSPTTKMFVTY-ANKQVFNGHEFYPSAVVMKPRVEIQGGD  59

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            LR+F+TL+MTDPDVPGPSDPYLREHLHW+VTDIPGTTD++FG+E+ SYE PKPNIGIHRF
Sbjct  60   LRTFYTLVMTDPDVPGPSDPYLREHLHWLVTDIPGTTDATFGKELASYEIPKPNIGIHRF  119

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VF+L+KQ  RQ  TV + P+RD FNTR+FA +N LG PVAAVFFN QRETAARRR
Sbjct  120  VFVLFKQTGRQ--TVKNLPTRDCFNTRRFAVENGLGLPVAAVFFNAQRETAARRR  172



>ref|XP_006836050.1| hypothetical protein AMTR_s00114p00070400 [Amborella trichopoda]
 gb|ERM98903.1| hypothetical protein AMTR_s00114p00070400 [Amborella trichopoda]
Length=173

 Score =   269 bits (687),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 149/175 (85%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MA+  +PLV+GRV+GDV++ F  S+KM+V YNSNK V NGHEF PS +  KP+VEV  GD
Sbjct  1    MARQIEPLVVGRVIGDVINSFFPSIKMNVTYNSNKQVCNGHEFMPSTVIQKPRVEVSGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            LR+F+TL++TDPDVPGPSDPYLREHLHWIVTDIPGTTD++FGREIV YE+P+P+IGIHRF
Sbjct  61   LRTFYTLVLTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGREIVGYESPRPSIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VF+L+KQ+ RQ  TV S  SRDRFNTR+FA+ N LG PVA V+FN QRETAARRR
Sbjct  121  VFVLFKQRGRQ--TVGSPSSRDRFNTREFAEQNQLGLPVAVVYFNAQRETAARRR  173



>gb|ADP00710.1| CEN [Festuca gigantea]
Length=169

 Score =   269 bits (687),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 123/170 (72%), Positives = 148/170 (87%), Gaps = 2/170 (1%)
 Frame = -1

Query  779  DPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGDLRSFF  600
            +PL++GRV+G+V+D F+  VKM   YNSNK V+NGHE +PS + SKP+VEV  GDLRS F
Sbjct  2    EPLIVGRVIGEVLDPFNPCVKMVATYNSNKLVFNGHELYPSAVVSKPRVEVQGGDLRSLF  61

Query  599  TLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRFVFLLY  420
            TL+M DPDVPGPSDPYLREHLHWIV++IPGTTD+SFG E++SYE+PKPNIGIHRF+F+L+
Sbjct  62   TLVMMDPDVPGPSDPYLREHLHWIVSNIPGTTDASFGGEVISYESPKPNIGIHRFIFVLF  121

Query  419  KQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            KQKRRQ+V+V S   RD FNTR+FA DNDLG PVAAV+FNCQRETAARRR
Sbjct  122  KQKRRQTVSVPS--FRDHFNTRQFAVDNDLGLPVAAVYFNCQRETAARRR  169



>ref|XP_007027716.1| Centroradialis [Theobroma cacao]
 gb|EOY08218.1| Centroradialis [Theobroma cacao]
Length=172

 Score =   268 bits (686),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 152/175 (87%), Gaps = 3/175 (2%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            M++ ++PLV+GRV+GDV+D F  S+ M+V +N NK V+NGHEF+PS + +KP+VE+  GD
Sbjct  1    MSRAAEPLVVGRVIGDVLDSFIPSITMTVTFN-NKRVFNGHEFYPSTVATKPRVEIEGGD  59

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +R+FFTL+MTDPDVPGPSDPYLREH+HWIVTDIPGTTD++FGRE+VSYE P+PNIGIHRF
Sbjct  60   MRTFFTLVMTDPDVPGPSDPYLREHIHWIVTDIPGTTDATFGREVVSYEIPRPNIGIHRF  119

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VF+L+KQKRRQ +T  S  SRD F+TR FA +NDLG PVAAV+FN QRETAARRR
Sbjct  120  VFVLFKQKRRQMIT--SPSSRDNFSTRGFAAENDLGLPVAAVYFNAQRETAARRR  172



>gb|ABP73380.1| TFL1 [Vicia faba]
Length=174

 Score =   268 bits (686),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 126/176 (72%), Positives = 152/176 (86%), Gaps = 3/176 (2%)
 Frame = -1

Query  794  MAKMS-DPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDG  618
            MA+M+ +PL++GRV+G+V+D F++S+KM+V YN  K V+NGHEFFPS + +KPKVE+   
Sbjct  1    MARMAQEPLIVGRVIGEVLDSFTRSMKMTVSYN-KKQVFNGHEFFPSTINTKPKVEIDGA  59

Query  617  DLRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHR  438
            D+RSF+TL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FG+EIVSYE PKPNIGIHR
Sbjct  60   DMRSFYTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGKEIVSYEIPKPNIGIHR  119

Query  437  FVFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            FVF+L+KQK R SV  + S SRD FNTR FA  NDLG PVAAV+FN QRETAARRR
Sbjct  120  FVFVLFKQKARDSVRTTPS-SRDHFNTRNFASQNDLGLPVAAVYFNAQRETAARRR  174



>gb|ABW24966.1| terminal flower 1b [Gossypium raimondii]
Length=172

 Score =   268 bits (686),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 150/175 (86%), Gaps = 3/175 (2%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MA+  +PL+ GRV+GDV+D F  S+KM V +N NK V+NGHEF+PS + +KP+VEV  GD
Sbjct  1    MAREVEPLMGGRVIGDVMDSFIPSIKMLVTFN-NKQVFNGHEFYPSTVVTKPRVEVAGGD  59

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +R+FFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FGRE+VSYE PKPNIGIHRF
Sbjct  60   MRTFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGREVVSYENPKPNIGIHRF  119

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VF+L+KQKRRQ   + S  SRD FNTR+FA +NDLG PVAAV+FN QRETAARRR
Sbjct  120  VFVLFKQKRRQ--IIKSPCSRDNFNTRRFASENDLGLPVAAVYFNAQRETAARRR  172



>gb|ABR53775.2| TFL1y [Phaseolus vulgaris]
 gb|ABR53776.2| TFL1y [Phaseolus vulgaris]
 gb|ABR53777.2| TFL1y [Phaseolus vulgaris]
 gb|AFI47666.1| TFLly [Phaseolus vulgaris]
 gb|AFI47667.1| TFLly [Phaseolus vulgaris]
 gb|AFI47668.1| TFLly [Phaseolus vulgaris]
 gb|AFI47669.1| TFLly [Phaseolus vulgaris]
 gb|AFI47670.1| TFLly [Phaseolus vulgaris]
 gb|AFI47671.1| TFLly [Phaseolus vulgaris]
 gb|AFI47672.1| TFLly [Phaseolus vulgaris]
 gb|AFI47673.1| TFLly [Phaseolus vulgaris]
 gb|AFI47674.1| TFLly [Phaseolus vulgaris]
 gb|AFI47675.1| TFLly [Phaseolus vulgaris]
 gb|AFI47676.1| TFLly [Phaseolus vulgaris]
 gb|AFI47677.1| TFLly [Phaseolus vulgaris]
 gb|AFI47678.1| TFLly [Phaseolus vulgaris]
 gb|AFI47679.1| TFLly [Phaseolus vulgaris]
 gb|AFI47680.1| TFLly [Phaseolus vulgaris]
 gb|AFI47681.1| TFLly [Phaseolus vulgaris]
 gb|AFI47682.1| TFLly [Phaseolus vulgaris]
 gb|AFI47683.1| TFLly [Phaseolus vulgaris]
 gb|AFI47684.1| TFLly [Phaseolus vulgaris]
Length=173

 Score =   268 bits (686),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 127/176 (72%), Positives = 150/176 (85%), Gaps = 4/176 (2%)
 Frame = -1

Query  794  MAKMS-DPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDG  618
            MA+M  +PL++GRV+G+V+D F+ S+KM+V YN  K VYNGHE FPS + +KPKV++   
Sbjct  1    MARMPLEPLIVGRVIGEVLDSFTTSMKMTVSYNK-KQVYNGHELFPSSVNTKPKVQIEGA  59

Query  617  DLRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHR  438
            D+RSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FG+E+VSYE PKPNIGIHR
Sbjct  60   DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGKELVSYEIPKPNIGIHR  119

Query  437  FVFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            FVF+L+KQKRRQ VT  +  SRD FNTR FA  NDLG PVAAV+FN QRETAARRR
Sbjct  120  FVFVLFKQKRRQCVTPPT--SRDHFNTRNFAAQNDLGLPVAAVYFNAQRETAARRR  173



>ref|XP_007162890.1| hypothetical protein PHAVU_001G189200g [Phaseolus vulgaris]
 gb|ESW34884.1| hypothetical protein PHAVU_001G189200g [Phaseolus vulgaris]
Length=220

 Score =   270 bits (690),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 127/177 (72%), Positives = 151/177 (85%), Gaps = 4/177 (2%)
 Frame = -1

Query  797  IMAKMS-DPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHD  621
            +MA+M  +PL++GRV+G+V+D F+ S+KM+V YN  K VYNGHE FPS + +KPKV++  
Sbjct  47   VMARMPLEPLIVGRVIGEVLDSFTTSMKMTVSYN-KKQVYNGHELFPSSVNTKPKVQIEG  105

Query  620  GDLRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIH  441
             D+RSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FG+E+VSYE PKPNIGIH
Sbjct  106  ADMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGKELVSYEIPKPNIGIH  165

Query  440  RFVFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            RFVF+L+KQKRRQ VT  +  SRD FNTR FA  NDLG PVAAV+FN QRETAARRR
Sbjct  166  RFVFVLFKQKRRQCVTPPT--SRDHFNTRNFAAQNDLGLPVAAVYFNAQRETAARRR  220



>ref|XP_004246534.1| PREDICTED: CEN-like protein 2 [Solanum lycopersicum]
 gb|AAO31795.1| SP9D [Solanum lycopersicum]
Length=172

 Score =   268 bits (685),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 150/175 (86%), Gaps = 3/175 (2%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MA+  +PL++GRV+GDV+D F+ ++KMS+ YN NK V NGHE FPS+++S+PKVEV  GD
Sbjct  1    MARSLEPLIVGRVIGDVIDSFNPTIKMSITYN-NKLVCNGHELFPSVVSSRPKVEVQGGD  59

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            LR+FFTL+MTDPDVPGPSDPY+REHLHWI+TDIPGTTD++FGRE+VSYETP+PNIGIHRF
Sbjct  60   LRTFFTLVMTDPDVPGPSDPYMREHLHWIITDIPGTTDATFGRELVSYETPRPNIGIHRF  119

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VF+L+KQK R S  VS   SRD FNTR FA +N+L  PV AVFFN QRETAARRR
Sbjct  120  VFVLFKQKSRSS--VSQPTSRDHFNTRNFAQENNLEQPVTAVFFNAQRETAARRR  172



>emb|CDY14173.1| BnaC02g02900D [Brassica napus]
 emb|CDY04899.1| BnaAnng00810D [Brassica napus]
Length=179

 Score =   268 bits (686),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 122/180 (68%), Positives = 159/180 (88%), Gaps = 2/180 (1%)
 Frame = -1

Query  806  VENIMAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEV  627
            +EN+ +++ +PL++GRVVG+V+D F+Q+++M+V YN  K V NGHE FPS ++SKP+VE+
Sbjct  1    MENMGSRVIEPLIVGRVVGEVLDFFTQTIEMNVSYNK-KQVCNGHELFPSFVSSKPRVEI  59

Query  626  HDGDLRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIG  447
            H GDLRSFFTL+M DPDVPGPSDP+L+EHLHWIVT+IPGTTD++FG+E+VSYE P+PNIG
Sbjct  60   HGGDLRSFFTLVMIDPDVPGPSDPFLKEHLHWIVTNIPGTTDATFGKEVVSYEFPRPNIG  119

Query  446  IHRFVFLLYKQKRRQSVTVSSS-PSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            IHRFVF+L+KQK+R  + +S + PSRD+FNTRKFA ++DLG PVAAVFFN QRETAARRR
Sbjct  120  IHRFVFVLFKQKQRHVIDISPNIPSRDKFNTRKFAIEHDLGLPVAAVFFNAQRETAARRR  179



>gb|ABP73384.1| TFL1 [Vicia faba]
 gb|ABP73385.1| TFL1 [Vicia faba]
Length=174

 Score =   268 bits (685),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 126/176 (72%), Positives = 151/176 (86%), Gaps = 3/176 (2%)
 Frame = -1

Query  794  MAKMS-DPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDG  618
            MA+M+ +PL++GRV+G+V+D F+ S+KM+V YN  K V+NGHEFFPS + +KPKVE+   
Sbjct  1    MARMAQEPLIVGRVIGEVLDSFTTSMKMTVSYN-KKQVFNGHEFFPSTINTKPKVEIDGA  59

Query  617  DLRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHR  438
            D+RSF+TL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FG+EIVSYE PKPNIGIHR
Sbjct  60   DMRSFYTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGKEIVSYEIPKPNIGIHR  119

Query  437  FVFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            FVF+L+KQK R SV  + S SRD FNTR FA  NDLG PVAAV+FN QRETAARRR
Sbjct  120  FVFVLFKQKARDSVRTTPS-SRDHFNTRNFASQNDLGLPVAAVYFNAQRETAARRR  174



>ref|NP_001275848.1| terminal flower [Citrus sinensis]
 gb|AAR04683.1| terminal flower [Citrus sinensis]
 gb|AAR04684.1| terminal flower [Citrus sinensis]
Length=173

 Score =   268 bits (685),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 125/176 (71%), Positives = 149/176 (85%), Gaps = 3/176 (2%)
 Frame = -1

Query  797  IMAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDG  618
            + A+M +PL +G V+GDV++ F+ S+KMSV Y+ NK V NGHE FPS + SKP+VE+  G
Sbjct  1    MAARMLEPLAVGGVIGDVIESFTPSIKMSVTYD-NKQVCNGHELFPSTVVSKPRVEIQGG  59

Query  617  DLRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHR  438
            D+RSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FGRE+VSYE P+PNIGIHR
Sbjct  60   DMRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGRELVSYEIPRPNIGIHR  119

Query  437  FVFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            FVF+L+KQ RRQ+V   S  SRD FNTR FA +NDLG PVAAV+FN QRETAARRR
Sbjct  120  FVFVLFKQTRRQTVNPPS--SRDHFNTRAFAAENDLGLPVAAVYFNAQRETAARRR  173



>emb|CBX25328.1| hypothetical_protein [Oryza brachyantha]
Length=176

 Score =   268 bits (685),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 128/178 (72%), Positives = 154/178 (87%), Gaps = 5/178 (3%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            M++  +PLV+GRV+G+V+D F+  +KM V YNSNK V+NGHE +PS + SKP+VEV  GD
Sbjct  1    MSRSVEPLVVGRVIGEVLDTFNPCMKMIVTYNSNKLVFNGHELYPSAVVSKPRVEVQGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHW-IVTDIPGTTDSSF--GREIVSYETPKPNIGI  444
            LRSFFTL+MTDPDVPGPSDPYLREHLHW IVTDIPGTTD+SF  GRE++SYE+PKPNIGI
Sbjct  61   LRSFFTLVMTDPDVPGPSDPYLREHLHWRIVTDIPGTTDASFGRGREVISYESPKPNIGI  120

Query  443  HRFVFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            HRF+F+L+KQKRRQ+V V S   RD FNTR+FA++NDLG PVAAV+FN QRETAARRR
Sbjct  121  HRFIFVLFKQKRRQTVLVPS--FRDHFNTRRFAEENDLGLPVAAVYFNAQRETAARRR  176



>gb|AGX25250.1| MCN1 [Musa AAB Group]
 gb|AGX25255.1| MCN1 [Musa AAB Group]
Length=175

 Score =   268 bits (685),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 125/176 (71%), Positives = 152/176 (86%), Gaps = 2/176 (1%)
 Frame = -1

Query  794  MAKMS-DPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDG  618
            MA++S DPL +GRV+G+V+D F+ SVKM V YNSNK V NGHE FPS + SKP+VEV  G
Sbjct  1    MARLSSDPLTVGRVIGEVIDSFNPSVKMMVTYNSNKLVCNGHELFPSAVVSKPRVEVQGG  60

Query  617  DLRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHR  438
            ++RSFFTL+MTDPD PGPSDPYLREH+HW+VTDIPGTTD+SFG+E+VSYE+P+P+IGIHR
Sbjct  61   EMRSFFTLVMTDPDAPGPSDPYLREHVHWVVTDIPGTTDASFGKEVVSYESPRPSIGIHR  120

Query  437  FVFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            FVF+L+KQKR QSV  ++  SRDRF+TR FA +NDL  PVAAV+FN QRETAARRR
Sbjct  121  FVFVLFKQKRGQSVA-AAPLSRDRFSTRGFAQENDLDLPVAAVYFNAQRETAARRR  175



>ref|XP_009374732.1| PREDICTED: protein TERMINAL FLOWER 1-like [Pyrus x bretschneideri]
 dbj|BAD10963.1| TFL1-like protein [Pyrus communis]
 dbj|BAJ33557.1| terminal flower 1 [Pyrus pyrifolia var. culta]
 dbj|BAK74838.1| terminal flowering 1 [Pyrus pyrifolia]
Length=172

 Score =   268 bits (684),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 149/175 (85%), Gaps = 3/175 (2%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            M + S+PLV+GRV+GDV+D F+ + KMSV YN+ K V NG E FPS++T+KP+VE+  GD
Sbjct  1    MKRASEPLVVGRVIGDVLDSFTATTKMSVTYNT-KLVCNGLELFPSVVTAKPRVEIQGGD  59

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +RSFFTL+MTDPD PGPSDPYLREHLHWIVTDIPGTTD++FGRE+VSYE PKPNIGIHRF
Sbjct  60   MRSFFTLVMTDPDFPGPSDPYLREHLHWIVTDIPGTTDATFGREVVSYEMPKPNIGIHRF  119

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VF+L+KQ RRQS+   S  SRD F+TR FA +NDLG PVAAV+FN QRETAARRR
Sbjct  120  VFVLFKQNRRQSINTPS--SRDHFSTRSFAAENDLGLPVAAVYFNAQRETAARRR  172



>gb|ADP00672.1| CEN [Festuca arundinacea]
Length=169

 Score =   267 bits (683),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 123/170 (72%), Positives = 148/170 (87%), Gaps = 2/170 (1%)
 Frame = -1

Query  779  DPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGDLRSFF  600
            +PL++GRV+G+V+D F+  VKM   YNSNK V+NGHE +PS + SKP+VEV  GDLRS F
Sbjct  2    EPLIVGRVIGEVLDPFNPCVKMVATYNSNKLVFNGHELYPSAVVSKPRVEVQGGDLRSLF  61

Query  599  TLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRFVFLLY  420
            TL+MTDPDVPGPSDPYLREHLHWIV++IPGTTD+SFG E++SYE+PKPNIGIHRF+F+L+
Sbjct  62   TLVMTDPDVPGPSDPYLREHLHWIVSNIPGTTDASFGGEVISYESPKPNIGIHRFIFVLF  121

Query  419  KQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            KQKRRQ+V+V S   RD FNTR+FA DNDLG PVAAV+F CQRETAARRR
Sbjct  122  KQKRRQTVSVPS--FRDHFNTRQFAVDNDLGLPVAAVYFICQRETAARRR  169



>gb|AFP33421.1| terminal flower 1 [Arachis hypogaea]
Length=180

 Score =   268 bits (684),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 127/170 (75%), Positives = 148/170 (87%), Gaps = 4/170 (2%)
 Frame = -1

Query  776  PLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGDLRSFFT  597
            PL IGRV+GDVVD F+++VKM+V YN NKHVYNG EFFPS +++KP+V +H GDLRS FT
Sbjct  14   PLTIGRVIGDVVDDFTETVKMTVTYN-NKHVYNGFEFFPSSISAKPRVHIHGGDLRSSFT  72

Query  596  LIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRFVFLLYK  417
            LIMTDPDVPGPSDPYLREHLHW+VTDIPGTTD++FG+E++ YE PKPNIGIHRFV +LYK
Sbjct  73   LIMTDPDVPGPSDPYLREHLHWMVTDIPGTTDATFGKEVIKYEMPKPNIGIHRFVLVLYK  132

Query  416  QKRRQSVTVSSSP-SRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            QKRRQ  TV+  P SRD FNTRKF  +NDLG+PVAAVFFN QRETA R+R
Sbjct  133  QKRRQ--TVNKVPNSRDLFNTRKFVVENDLGTPVAAVFFNAQRETACRKR  180



>gb|AHB20161.1| terminal flower 1-like protein [Hemerocallis middendorffii]
 gb|AHB60659.1| terminal flower 1-like protein [Hemerocallis middendorffii]
Length=173

 Score =   268 bits (684),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 146/175 (83%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MA+   PL++GRV+GDV+D F  S KM V YNSNK V N HEF PS + SKP+V+V  GD
Sbjct  1    MARAVQPLIVGRVIGDVLDTFEPSAKMMVTYNSNKLVCNCHEFSPSAVVSKPRVKVPGGD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            LRSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD+SFGRE+V+YE+P+PNIGIHRF
Sbjct  61   LRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGRELVAYESPRPNIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VF+L+KQKRR SV      SRDRFN R+FA+ N+ G PVAAV+FN QRETAARRR
Sbjct  121  VFVLFKQKRRGSVNTPG--SRDRFNARQFAEKNEFGLPVAAVYFNAQRETAARRR  173



>ref|NP_001106243.1| ZCN4 protein [Zea mays]
 gb|ABW96227.1| ZCN4 [Zea mays]
 gb|ABX11006.1| ZCN4 [Zea mays]
 tpg|DAA37935.1| TPA: RCN4-Corn Centroradialis/TFL1-like protein [Zea mays]
Length=176

 Score =   268 bits (684),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 124/176 (70%), Positives = 150/176 (85%), Gaps = 1/176 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            M++  +PLV+G+V+G+V+D+F+ +VKM+V Y SNK V+NGHEFFPS + SKP+VEV   D
Sbjct  1    MSRALEPLVVGKVIGEVIDNFNPTVKMTVTYGSNKQVFNGHEFFPSAVLSKPRVEVQGDD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +RSFFTL+MTDPDVPGPSDPYLREH+HWIVTDIPGTTD+SFGRE+V YE+PKP IGIHRF
Sbjct  61   MRSFFTLVMTDPDVPGPSDPYLREHIHWIVTDIPGTTDASFGRELVMYESPKPYIGIHRF  120

Query  434  VFLLYKQKRRQSV-TVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VF+L+KQ  RQS    SS   RD FNTR+FA DN+LG PVAAV+FN QRETAARRR
Sbjct  121  VFVLFKQSSRQSARPPSSGGGRDYFNTRRFAADNNLGLPVAAVYFNAQRETAARRR  176



>gb|AEO72023.1| TFL1-like protein [Prunus yedoensis]
Length=172

 Score =   267 bits (683),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 151/175 (86%), Gaps = 3/175 (2%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MA+ S+PLV+GRV+GDV+D F+ + KMSV YN+ K V NG+E +PS +T+KP+VE+  GD
Sbjct  1    MARTSEPLVVGRVIGDVLDCFTPTTKMSVTYNT-KLVCNGYELYPSAVTTKPRVEIQGGD  59

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +R+FFTLIMTDPDVP PSDPYLREHLHWIVTDIPGTTD++FGRE++SYE P+P+IGIHRF
Sbjct  60   MRTFFTLIMTDPDVPAPSDPYLREHLHWIVTDIPGTTDATFGREVMSYEMPRPDIGIHRF  119

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VF+L+KQKRRQSV   S  SRD F+ R FA +NDLG PVAAV+FNCQRETAARRR
Sbjct  120  VFVLFKQKRRQSVNPPS--SRDHFSARSFAAENDLGLPVAAVYFNCQRETAARRR  172



>gb|ADP00703.1| CEN [Lolium perenne]
Length=169

 Score =   267 bits (683),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 123/170 (72%), Positives = 148/170 (87%), Gaps = 2/170 (1%)
 Frame = -1

Query  779  DPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGDLRSFF  600
            +P ++GRV+G+V+D F+  VKM   YNSNK V+NGHE +PS + SKP+VEV  GDLRS F
Sbjct  2    EPPIVGRVIGEVLDPFNPCVKMVATYNSNKLVFNGHELYPSAVVSKPRVEVQGGDLRSLF  61

Query  599  TLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRFVFLLY  420
            TL+MTDPDVPGPSDPYLREHLHWIV++IPGTTD+SFG E++SYE+PKPNIGIHRF+F+L+
Sbjct  62   TLVMTDPDVPGPSDPYLREHLHWIVSNIPGTTDASFGGEVMSYESPKPNIGIHRFIFVLF  121

Query  419  KQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            KQKRRQ+V+V S   RD FNTR+FA DNDLG PVAAV+FNCQRETAARRR
Sbjct  122  KQKRRQTVSVPS--FRDHFNTRQFAVDNDLGLPVAAVYFNCQRETAARRR  169



>gb|KHN14994.1| Protein CENTRORADIALIS-like [Glycine soja]
Length=173

 Score =   267 bits (682),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 128/176 (73%), Positives = 152/176 (86%), Gaps = 4/176 (2%)
 Frame = -1

Query  794  MAKMS-DPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDG  618
            MAKMS DPL IGRV+GDV+D F+ ++KM+V Y   K VYNGHEFFPS +T++PKVE+  G
Sbjct  1    MAKMSTDPLFIGRVIGDVLDSFTPTIKMTVTYK--KQVYNGHEFFPSTITTRPKVEIGGG  58

Query  617  DLRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHR  438
            D+RSF+TLIMTDPDVPGPSDPYLREHLHW+VTDIPGTT++SFG  +VSYE PKPNIGIHR
Sbjct  59   DMRSFYTLIMTDPDVPGPSDPYLREHLHWMVTDIPGTTNASFGNVLVSYEMPKPNIGIHR  118

Query  437  FVFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            +VF+L+KQKRRQ VT   S SRD F+TRKF+ +NDLG PVA+V+FN QRETAARRR
Sbjct  119  YVFVLFKQKRRQCVTRPPS-SRDHFSTRKFSAENDLGLPVASVYFNAQRETAARRR  173



>gb|ACG31744.1| RCN4 - Corn Centroradialis/TFL1-like protein [Zea mays]
Length=176

 Score =   267 bits (683),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 124/176 (70%), Positives = 150/176 (85%), Gaps = 1/176 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            M++  +PLV+G+V+G+V+D+F+ +VKM+V Y SNK V+NGHEFFPS +  KP+VEV   D
Sbjct  1    MSRALEPLVVGKVIGEVIDNFNPTVKMTVTYGSNKQVFNGHEFFPSAVLCKPRVEVQGDD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +RSFFTL+MTDPDVPGPSDPYLREH+HWIVTDIPGTTD+SFGRE+V YE+PKP IGIHRF
Sbjct  61   MRSFFTLVMTDPDVPGPSDPYLREHIHWIVTDIPGTTDASFGRELVMYESPKPYIGIHRF  120

Query  434  VFLLYKQKRRQSV-TVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VF+L+KQ  RQS    SS  SRD FNTR+FA DN+LG PVAAV+FN QRETAARRR
Sbjct  121  VFVLFKQSSRQSARPPSSGGSRDYFNTRRFAADNNLGLPVAAVYFNAQRETAARRR  176



>ref|XP_009125522.1| PREDICTED: protein TERMINAL FLOWER 1-like [Brassica rapa]
Length=179

 Score =   267 bits (683),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 122/180 (68%), Positives = 159/180 (88%), Gaps = 2/180 (1%)
 Frame = -1

Query  806  VENIMAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEV  627
            +EN+ +++ +PL++GRVVG+V+D F+Q+++M+V YN  K V NGHE FPS ++SKP+VE+
Sbjct  1    MENMGSRVIEPLIVGRVVGEVLDFFTQTIEMNVSYNK-KQVCNGHELFPSSVSSKPRVEI  59

Query  626  HDGDLRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIG  447
            H GDLRSFFTL+M DPDVPGPSDP+L+EHLHWIVT+IPGTTD++FG+E+VSYE P+PNIG
Sbjct  60   HGGDLRSFFTLVMIDPDVPGPSDPFLKEHLHWIVTNIPGTTDATFGKEVVSYEFPRPNIG  119

Query  446  IHRFVFLLYKQKRRQSVTVSSS-PSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            IHRFVF+L+KQK+R  + +S + PSRD+FNTRKFA ++DLG PVAAVFFN QRETAARRR
Sbjct  120  IHRFVFVLFKQKQRHVIDISPNIPSRDKFNTRKFAIEHDLGLPVAAVFFNAQRETAARRR  179



>gb|AAQ93599.1| CEN/TFL1-like GTP-associated binding protein [Lotus japonicus]
Length=174

 Score =   267 bits (682),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 125/171 (73%), Positives = 149/171 (87%), Gaps = 3/171 (2%)
 Frame = -1

Query  782  SDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGDLRSF  603
            +DPLV+GRVVGDV+D F+ S+K++V +N NK V+NGHEFFPS + +KPKV++  GD+RSF
Sbjct  7    TDPLVVGRVVGDVLDSFTTSMKLTVSFN-NKQVFNGHEFFPSTINTKPKVDIGGGDMRSF  65

Query  602  FTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRFVFLL  423
            FTLIMTDPDVPGPSDPYL+EHLHW+VTDIPGTTD++FG+E+VSYE PKPNIGIHRFVF+L
Sbjct  66   FTLIMTDPDVPGPSDPYLKEHLHWMVTDIPGTTDATFGKELVSYEIPKPNIGIHRFVFVL  125

Query  422  YKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            +KQKRRQ V+  S  SRD FNTR FA  NDL  PVAAV+FN QRETAARRR
Sbjct  126  FKQKRRQCVSPPS--SRDHFNTRSFAAQNDLALPVAAVYFNAQRETAARRR  174



>gb|AAR03725.1| TFL1a [Pisum sativum]
Length=174

 Score =   267 bits (682),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 125/176 (71%), Positives = 151/176 (86%), Gaps = 3/176 (2%)
 Frame = -1

Query  794  MAKMS-DPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDG  618
            MA+M+ +PL++GRV+G+V+D F+ S+KM+V YN  K V+NGHEFFPS + +KPKVE+   
Sbjct  1    MARMAQEPLIVGRVIGEVLDSFTTSMKMTVSYN-KKQVFNGHEFFPSTINTKPKVEIDGA  59

Query  617  DLRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHR  438
            D+RSF+TL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FG+EIVSYE PKPNIGIHR
Sbjct  60   DMRSFYTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGKEIVSYEIPKPNIGIHR  119

Query  437  FVFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            FVF+L+KQ+ R SV  + S SRD FNTR FA  NDLG PVAAV+FN QRETAARRR
Sbjct  120  FVFVLFKQRARDSVRATPS-SRDHFNTRSFASQNDLGLPVAAVYFNAQRETAARRR  174



>ref|XP_004975557.1| PREDICTED: CEN-like protein 1-like [Setaria italica]
Length=173

 Score =   267 bits (682),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 151/175 (86%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            M+++ +PLV+G+V+G+V+D+F+ +VKM+V Y+SNK V+NGHEFFPS + SKP+VEV   D
Sbjct  1    MSRVLEPLVMGKVIGEVIDNFNPTVKMTVTYSSNKQVFNGHEFFPSAIVSKPRVEVGGDD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +RSFFTL+MTDPDVPGPSD YLREHLHWIVTDIPGTTD+SFGRE+V YE+PKP IGIHRF
Sbjct  61   MRSFFTLVMTDPDVPGPSDSYLREHLHWIVTDIPGTTDASFGRELVMYESPKPYIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VF L+KQK RQ V   S  SRD F+TR+FA DNDLG PVAAV+FN QRETAARRR
Sbjct  121  VFALFKQKCRQGVRAPS--SRDYFSTRRFAADNDLGLPVAAVYFNAQRETAARRR  173



>gb|ADP00693.1| CEN [Lolium temulentum]
Length=169

 Score =   266 bits (681),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 123/170 (72%), Positives = 148/170 (87%), Gaps = 2/170 (1%)
 Frame = -1

Query  779  DPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGDLRSFF  600
            +PL++GRV+G+V+D F+  VKM   YNSNK V+NGHE +PS + SKP+VEV  GDLRS F
Sbjct  2    EPLIVGRVIGEVLDPFNPCVKMVATYNSNKLVFNGHELYPSAVVSKPRVEVQGGDLRSLF  61

Query  599  TLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRFVFLLY  420
            TL+MTDPDVPGPSDPYLREHLHWIV++IPGTTD+SFG E++SYE+PKPNIGIHRF+F+L+
Sbjct  62   TLVMTDPDVPGPSDPYLREHLHWIVSNIPGTTDASFGGEVISYESPKPNIGIHRFIFVLF  121

Query  419  KQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            KQKRRQ+V+V S   RD FNTR+FA DNDLG PVAAV+FN QRETAARRR
Sbjct  122  KQKRRQTVSVPS--FRDHFNTRQFAVDNDLGLPVAAVYFNSQRETAARRR  169



>gb|KDO61123.1| hypothetical protein CISIN_1g035977mg [Citrus sinensis]
Length=169

 Score =   266 bits (681),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 125/172 (73%), Positives = 146/172 (85%), Gaps = 3/172 (2%)
 Frame = -1

Query  785  MSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGDLRS  606
            M +PL +G V+GDV++ F+ S+KMSV YN NK V NGHE FPS + SKP+VE+  GD+RS
Sbjct  1    MLEPLAVGGVIGDVIESFTPSIKMSVTYN-NKQVCNGHELFPSTVVSKPRVEIQGGDMRS  59

Query  605  FFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRFVFL  426
            FFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FGRE+VSYE P+PNIGIHRFVF+
Sbjct  60   FFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGRELVSYEIPRPNIGIHRFVFV  119

Query  425  LYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            L+KQ RRQ+V   S  SRD FNTR FA +NDLG PVAAV+FN QRETAARRR
Sbjct  120  LFKQTRRQTVNPPS--SRDHFNTRAFAAENDLGLPVAAVYFNAQRETAARRR  169



>dbj|BAD10964.1| TFL1-like protein [Cydonia oblonga]
Length=172

 Score =   266 bits (681),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 149/175 (85%), Gaps = 3/175 (2%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            M K S+PLV+GRV+GDV+D F+ + KMSV YN+ K V NG E FPS++T+KP+VE+  GD
Sbjct  1    MKKASEPLVVGRVIGDVLDSFTATTKMSVTYNT-KLVCNGLELFPSVVTAKPRVEIQGGD  59

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +RSFFTL+MTDPD PGPSDPYLREHLHWIVTDIPGTTD++FGRE++SYE P+PNIGIHRF
Sbjct  60   MRSFFTLVMTDPDFPGPSDPYLREHLHWIVTDIPGTTDATFGREVLSYEMPRPNIGIHRF  119

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VF+L+KQ RRQS+   S  SRD F+TR FA +NDLG PVAAV+FN QRETAARRR
Sbjct  120  VFVLFKQNRRQSINTPS--SRDHFSTRSFAAENDLGLPVAAVYFNAQRETAARRR  172



>ref|NP_001240029.1| CEN-like protein 2-like [Glycine max]
 gb|ACU00128.1| CENTRORADIALIS-like protein 2 [Glycine max]
 gb|KHN13508.1| CEN-like protein 2 [Glycine soja]
Length=174

 Score =   266 bits (681),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 126/176 (72%), Positives = 152/176 (86%), Gaps = 3/176 (2%)
 Frame = -1

Query  794  MAKMS-DPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDG  618
            MA+MS DPL+IGRV+GDV+  F+ ++KM+V YN  K VYNG+EFFPS +T++P+VE+  G
Sbjct  1    MARMSTDPLIIGRVIGDVLGSFTPTIKMTVTYN-KKQVYNGYEFFPSTITTRPRVEIGGG  59

Query  617  DLRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHR  438
            D+RSF+TLIMTDPDVPGPSDPYLREHLHW+VTDIPGTT++SFG+ +VSYE P PNIGIHR
Sbjct  60   DMRSFYTLIMTDPDVPGPSDPYLREHLHWMVTDIPGTTNASFGKVLVSYEMPNPNIGIHR  119

Query  437  FVFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            +VF+L KQKRRQ VT   S SRD FNTRKF+ +NDLG PVAAV+FN QRETAARRR
Sbjct  120  YVFVLLKQKRRQCVTRPPS-SRDHFNTRKFSAENDLGLPVAAVYFNAQRETAARRR  174



>ref|NP_001280887.1| protein TERMINAL FLOWER 1-like [Malus domestica]
 dbj|BAD06418.1| TFL1-like protein [Malus domestica]
 dbj|BAD10961.1| TFL1-like protein [Malus domestica]
 gb|ABF84011.1| terminal flower 1 [Malus domestica]
 dbj|BAG31955.1| TFL1 like protein [Malus domestica]
Length=172

 Score =   266 bits (680),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 149/175 (85%), Gaps = 3/175 (2%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            M + S+PLV+GRV+GDV+D F+ + KMSV YN+ K V NG E FPS++T+KP+VE+  GD
Sbjct  1    MKRASEPLVVGRVIGDVLDSFTATTKMSVTYNT-KLVCNGLELFPSVVTAKPRVEIQGGD  59

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +RSFFTL+MTDPD PGPSDPYLREHLHWIVTDIPGTTD++FGRE+VSYE PKPNIGIHRF
Sbjct  60   MRSFFTLVMTDPDFPGPSDPYLREHLHWIVTDIPGTTDATFGREVVSYEMPKPNIGIHRF  119

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VF+L+KQ +RQS+   S  SRD F+TR FA +NDLG PVAAV+FN QRETAARRR
Sbjct  120  VFVLFKQNQRQSINTPS--SRDHFSTRSFAAENDLGLPVAAVYFNAQRETAARRR  172



>gb|AFA25738.1| hypothetical protein [Phaseolus vulgaris]
Length=170

 Score =   266 bits (679),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 146/170 (86%), Gaps = 3/170 (2%)
 Frame = -1

Query  779  DPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGDLRSFF  600
            +PL++GRV+G+V+D F+ S+KM+V YN  K VYNGHE FPS + +KPKV++   D+RSFF
Sbjct  4    EPLIVGRVIGEVLDSFTTSMKMTVSYNK-KQVYNGHELFPSSVNTKPKVQIEGADMRSFF  62

Query  599  TLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRFVFLLY  420
            TLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FG+E+VSYE PKPNIGIHRFVF+L+
Sbjct  63   TLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGKELVSYEIPKPNIGIHRFVFVLF  122

Query  419  KQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            KQKRRQ VT  +  SRD FNTR FA  NDLG PVAAV+FN QRETAARRR
Sbjct  123  KQKRRQCVTPPT--SRDHFNTRNFAAQNDLGLPVAAVYFNAQRETAARRR  170



>ref|XP_002447782.1| hypothetical protein SORBIDRAFT_06g015490 [Sorghum bicolor]
 gb|EES12110.1| hypothetical protein SORBIDRAFT_06g015490 [Sorghum bicolor]
Length=173

 Score =   266 bits (680),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 150/175 (86%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            M+++ +PLV+G+V+G+V+D+F+ +VKM+V Y SN  V+NGHEFFPS + SKP+VEV   D
Sbjct  1    MSRVLEPLVVGKVIGEVIDNFNPTVKMTVTYGSNNQVFNGHEFFPSAVLSKPRVEVQGDD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +RSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD+SFG E+  YE+PKP IGIHRF
Sbjct  61   MRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGTELAMYESPKPYIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VF+L+KQK RQSV   S  SRD F+TR+FA DNDLG PVAAV+FN QRETAARRR
Sbjct  121  VFVLFKQKSRQSVRPPS--SRDYFSTRRFAADNDLGLPVAAVYFNAQRETAARRR  173



>dbj|BAD10965.1| TFL1-like protein [Pseudocydonia sinensis]
Length=172

 Score =   266 bits (679),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 148/175 (85%), Gaps = 3/175 (2%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            M + S+PLV+GRV+GDV+D F+ + KMSV YN+ K V NG E FPS++T+KPKVE+  GD
Sbjct  1    MKRASEPLVVGRVIGDVLDSFTATTKMSVTYNT-KLVCNGLELFPSVVTAKPKVEIQGGD  59

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +RSFFTL+MTDPD PGPSDPYLREHLHWIV DIPGTTD++FGRE+VSYE P+PNIGIHRF
Sbjct  60   MRSFFTLVMTDPDFPGPSDPYLREHLHWIVADIPGTTDATFGREVVSYEMPRPNIGIHRF  119

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VF+L+KQ RRQS+   S  SRD F+TR FA +NDLG PVAAV+FN QRETAARRR
Sbjct  120  VFVLFKQNRRQSINTPS--SRDHFSTRSFAAENDLGLPVAAVYFNAQRETAARRR  172



>gb|ADL62862.1| terminal flower 1 [Prunus armeniaca]
Length=172

 Score =   266 bits (679),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 150/175 (86%), Gaps = 3/175 (2%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MA+MS+PLV+GRV+GDV+D F+ + KMSV YN+ + V NG+E +PS +T+KP+VE+  GD
Sbjct  1    MARMSEPLVVGRVIGDVLDCFTPTTKMSVTYNT-RLVCNGYELYPSAVTTKPRVEIQGGD  59

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +R+FFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FGRE+VSYE P+PNIGIH F
Sbjct  60   MRTFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGREVVSYEMPRPNIGIHTF  119

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            V +L+KQKRRQSV   S  SRD F+ R FA +NDL  PVAAV+FNCQRETAARRR
Sbjct  120  VCVLFKQKRRQSVNPPS--SRDHFSARSFAAENDLDLPVAAVYFNCQRETAARRR  172



>dbj|BAD10962.1| TFL1-like protein [Pyrus pyrifolia]
Length=172

 Score =   266 bits (679),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 148/175 (85%), Gaps = 3/175 (2%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            M K S+P V+GRV+GDV+D F+ + KMSV YN+ K V NG E FPS++T+KP+VE+  GD
Sbjct  1    MKKASEPPVVGRVIGDVLDSFTATTKMSVTYNT-KLVCNGLELFPSVVTAKPRVEIQGGD  59

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +RSFFTL+MTDPD PGPSDPYLREHLHWIVTDIPGTTD++FGRE+VSYE PKPNIGIHRF
Sbjct  60   MRSFFTLVMTDPDFPGPSDPYLREHLHWIVTDIPGTTDATFGREVVSYEMPKPNIGIHRF  119

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VF+L+KQ RRQS+   S  SRD F+TR FA +NDLG PVAAV+FN QRETAARRR
Sbjct  120  VFVLFKQNRRQSINTPS--SRDHFSTRSFAAENDLGLPVAAVYFNAQRETAARRR  172



>ref|NP_001239678.1| protein SELF-PRUNING-like [Glycine max]
 gb|ACU00127.1| CENTRORADIALIS-like protein 1 [Glycine max]
Length=173

 Score =   266 bits (679),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 127/176 (72%), Positives = 152/176 (86%), Gaps = 4/176 (2%)
 Frame = -1

Query  794  MAKM-SDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDG  618
            MAKM +DPL IGRV+GDV+D F+ ++KM+V Y   K VYNGHEFFPS +T++PKVE+  G
Sbjct  1    MAKMWTDPLFIGRVIGDVLDSFTPTIKMTVTYK--KQVYNGHEFFPSTITTRPKVEIGGG  58

Query  617  DLRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHR  438
            D+RSF+TLIMTDPDVPGPSDPYLREHLHW+VTDIPGTT++SFG  +VSYE PKPNIGIHR
Sbjct  59   DMRSFYTLIMTDPDVPGPSDPYLREHLHWMVTDIPGTTNASFGNVLVSYEMPKPNIGIHR  118

Query  437  FVFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            +VF+L+KQKRRQ VT   S SRD F+TRKF+ +NDLG PVA+V+FN QRETAARRR
Sbjct  119  YVFVLFKQKRRQCVTRPPS-SRDHFSTRKFSAENDLGLPVASVYFNAQRETAARRR  173



>gb|ABP73381.1| TFL1 [Vicia faba]
Length=174

 Score =   266 bits (679),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 125/176 (71%), Positives = 150/176 (85%), Gaps = 3/176 (2%)
 Frame = -1

Query  794  MAKMS-DPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDG  618
            MA+M+ +P ++GRV+G+V+D F+ S+KM+V YN  K V+NGHEFFPS + +KPKVE+   
Sbjct  1    MARMAQEPRIVGRVIGEVLDSFTTSMKMTVSYN-KKQVFNGHEFFPSTINTKPKVEIDGA  59

Query  617  DLRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHR  438
            D+RSF+TL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FG+EIVSYE PKPNIGIHR
Sbjct  60   DMRSFYTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGKEIVSYEIPKPNIGIHR  119

Query  437  FVFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            FVF+L+KQK R SV  + S SRD FNTR FA  NDLG PVAAV+FN QRETAARRR
Sbjct  120  FVFVLFKQKARDSVRTTPS-SRDHFNTRNFASQNDLGLPVAAVYFNAQRETAARRR  174



>gb|AEO72024.1| TFL1-like protein [Photinia serratifolia]
Length=172

 Score =   265 bits (678),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 123/175 (70%), Positives = 150/175 (86%), Gaps = 3/175 (2%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MA++ +PLV+GRV+GDV+D F+ + KMSV YN+ K V NG E FPS++T+KP+VE+  GD
Sbjct  1    MARVPEPLVVGRVIGDVLDSFTATTKMSVTYNT-KLVCNGLELFPSVVTAKPRVEIQGGD  59

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +RSFFTL+MTDPD PGPSDPYLREHLHWIVTDIPGTTD++FGRE+VSYE P+PNIGIHRF
Sbjct  60   MRSFFTLVMTDPDFPGPSDPYLREHLHWIVTDIPGTTDATFGREVVSYEMPRPNIGIHRF  119

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VF+L+KQ RRQS+   S  SRD F+TR FA +NDLG PVAAV+FN QRE+AARRR
Sbjct  120  VFVLFKQNRRQSINTPS--SRDHFSTRSFAAENDLGLPVAAVYFNAQRESAARRR  172



>ref|XP_009614479.1| PREDICTED: protein TERMINAL FLOWER 1-like [Nicotiana tomentosiformis]
Length=173

 Score =   265 bits (678),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 148/175 (85%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MA+  +PLV+GRVVGDV+D FS  VKM+V YN NK V NG E FPS +T +P+VEV  GD
Sbjct  1    MARNVEPLVVGRVVGDVLDSFSPKVKMTVTYN-NKQVCNGQELFPSAVTIRPRVEVQGGD  59

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +R+FFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FG+E+VSYE P+PNIGIHRF
Sbjct  60   MRTFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGKELVSYEIPRPNIGIHRF  119

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VF+L+KQK RQSV+     SRD FNTR FA+ NDLG PVAAVFFN QRETAARRR
Sbjct  120  VFVLFKQKCRQSVS-PHDVSRDHFNTRNFANVNDLGPPVAAVFFNAQRETAARRR  173



>dbj|BAM73643.1| terminal flower1 homologue [Ipomoea nil]
Length=175

 Score =   265 bits (678),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 152/175 (87%), Gaps = 3/175 (2%)
 Frame = -1

Query  791  AKMSDPLVIGRVVGDVVDHFS-QSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            ++  +PL++GRVVG+VVD F+  S+++ V YN NK V NGHEFFPS LTS+P+VE+H GD
Sbjct  3    SRALEPLILGRVVGEVVDPFTPTSIRIVVTYN-NKLVSNGHEFFPSALTSRPRVEIHGGD  61

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            LR+FFTL+MTDPDVPGPSDPYLREH+HWIVTDIPGTTD++FGRE+VSYE+PKPNIGIHRF
Sbjct  62   LRTFFTLVMTDPDVPGPSDPYLREHIHWIVTDIPGTTDATFGRELVSYESPKPNIGIHRF  121

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VF+L+KQ RR SV V+   SRD FNTR+FA DN LG PVAAVFFN QRETAARRR
Sbjct  122  VFILFKQTRRLSV-VTPPLSRDHFNTRRFAADNGLGLPVAAVFFNAQRETAARRR  175



>ref|XP_009766168.1| PREDICTED: protein TERMINAL FLOWER 1-like [Nicotiana sylvestris]
Length=172

 Score =   265 bits (677),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 149/175 (85%), Gaps = 3/175 (2%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MA+  +PLV+GRVVGDV+D FS +VKM+V YN NK V NG E FPS +T +P+VEV  GD
Sbjct  1    MARNVEPLVVGRVVGDVLDSFSPTVKMTVTYN-NKQVCNGQELFPSAVTIRPRVEVQGGD  59

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +R+FFTL++TDPDVPGPSDPYLREH+HWIVTDIPGTTD++FG+E+VSYE P+PNIGIHRF
Sbjct  60   MRTFFTLVITDPDVPGPSDPYLREHVHWIVTDIPGTTDATFGKELVSYEIPRPNIGIHRF  119

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VF+L+KQK RQS  VS   SRD FNTR FA+ NDLG PVAAVFFN QRETAARRR
Sbjct  120  VFVLFKQKCRQS--VSPPTSRDHFNTRNFANVNDLGPPVAAVFFNAQRETAARRR  172



>gb|AHY24028.1| terminal flower 1 protein [Dimocarpus longan]
 gb|AHZ89714.1| terminal flower 1 [Dimocarpus longan]
 gb|AIY68668.1| TFL1 [Dimocarpus longan]
Length=175

 Score =   265 bits (677),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 135/174 (78%), Positives = 155/174 (89%), Gaps = 1/174 (1%)
 Frame = -1

Query  791  AKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGDL  612
            AK+ +PLV+G+VVGDVVD+F+ SVKM++ YNS K VYNGHE FPS +T KPKVEVH GDL
Sbjct  3    AKLFEPLVVGKVVGDVVDYFNPSVKMTITYNSMKQVYNGHELFPSAVTQKPKVEVHGGDL  62

Query  611  RSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRFV  432
            RSFFTL+MTDPDVPGPSDPYLREHLHW+VTDIPGTTD +FG+E+VSYE P+PNIGIHRFV
Sbjct  63   RSFFTLVMTDPDVPGPSDPYLREHLHWMVTDIPGTTDVTFGKEVVSYEIPRPNIGIHRFV  122

Query  431  FLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            FLL+KQKRRQ+VT S   SRD FNTR FA++N+LG PVAAVFFN QRETAARRR
Sbjct  123  FLLFKQKRRQTVT-SLPASRDCFNTRNFAEENELGLPVAAVFFNAQRETAARRR  175



>gb|AEO72025.1| TFL1-like protein [Spiraea cantoniensis]
Length=172

 Score =   265 bits (676),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 147/175 (84%), Gaps = 3/175 (2%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MA+MS+PLV+GRV+GDV+D F  + KM+V + SN+ V NGHE  PS +T KP+VE+  GD
Sbjct  1    MARMSEPLVVGRVIGDVLDFFIPTTKMTVTF-SNRLVRNGHELLPSAVTVKPRVEIQGGD  59

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +RSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FGRE VSYE P+PNIGIHRF
Sbjct  60   MRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGREAVSYEKPRPNIGIHRF  119

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VF+LYKQ+RRQS+   S  SRD F  R FA +NDLG PVAAV+FN QRETAARRR
Sbjct  120  VFILYKQQRRQSINPPS--SRDHFCARTFAAENDLGLPVAAVYFNAQRETAARRR  172



>gb|ABP73383.1| TFL1 [Vicia faba]
Length=174

 Score =   265 bits (676),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 124/176 (70%), Positives = 150/176 (85%), Gaps = 3/176 (2%)
 Frame = -1

Query  794  MAKMS-DPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDG  618
            MA+M+ +P ++GR++G+V+D F+ S+KM+V YN  K V+NGHEFFPS + +KPKVE+   
Sbjct  1    MARMAQEPRIVGRMIGEVLDSFTTSMKMTVSYN-KKQVFNGHEFFPSTINTKPKVEIDGA  59

Query  617  DLRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHR  438
            D+RSF+TL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FG+EIVSYE PKPNIGIHR
Sbjct  60   DMRSFYTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGKEIVSYEIPKPNIGIHR  119

Query  437  FVFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            FVF+L+KQK R SV  + S SRD FNTR FA  NDLG PVAAV+FN QRETAARRR
Sbjct  120  FVFVLFKQKARDSVRTTPS-SRDHFNTRNFASQNDLGLPVAAVYFNAQRETAARRR  174



>dbj|BAD10966.1| TFL1-like protein [Eriobotrya japonica]
 gb|ADB92194.1| TFL1-like protein [Eriobotrya japonica]
Length=172

 Score =   265 bits (676),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 123/175 (70%), Positives = 148/175 (85%), Gaps = 3/175 (2%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            M +  +PLV+GRV+GDV+D F+ + KMSV YN+ K V NG E FPS++T+KP+VE+  GD
Sbjct  1    MTRALEPLVVGRVIGDVLDSFTATTKMSVTYNT-KLVCNGLELFPSVVTAKPRVEIQGGD  59

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +RSFFTL+MTDPD PGPSDPYLREHLHWIVTDIPGTTD++FGRE+VSYE P+PNIGIHRF
Sbjct  60   MRSFFTLVMTDPDFPGPSDPYLREHLHWIVTDIPGTTDATFGREVVSYEMPRPNIGIHRF  119

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VF+L+KQ RRQS+   S  SRD F+TR FA +NDLG PVAAV+FN QRETAARRR
Sbjct  120  VFVLFKQNRRQSINTPS--SRDHFSTRSFAAENDLGLPVAAVYFNAQRETAARRR  172



>ref|XP_011090356.1| PREDICTED: protein CENTRORADIALIS-like [Sesamum indicum]
Length=174

 Score =   265 bits (676),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 124/172 (72%), Positives = 144/172 (84%), Gaps = 1/172 (1%)
 Frame = -1

Query  782  SDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGDLRSF  603
            S+ LVIGRV+GDVVD+FS +VKMSV Y  N HVYNGH+  PS L S PKV V  GD+R+F
Sbjct  3    SEALVIGRVIGDVVDNFSSTVKMSVRYKCNNHVYNGHQLSPSTLASTPKVHVLGGDMRTF  62

Query  602  FTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRFVFLL  423
            FTLIMTDPDVPGPSDPYLREHLHWI+TDIPGTTDSSFGRE+VSYE P+PNIGIHR VF+L
Sbjct  63   FTLIMTDPDVPGPSDPYLREHLHWIITDIPGTTDSSFGREVVSYEMPRPNIGIHRLVFVL  122

Query  422  YKQKRRQSVT-VSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            ++QKRR  V  ++ S  RD F+TR FA++N+LG PVAA+FFNCQR TA RRR
Sbjct  123  FEQKRRMQVQGIAPSVCRDGFSTRNFAEENELGLPVAALFFNCQRHTAPRRR  174



>ref|XP_011094363.1| PREDICTED: CEN-like protein 2 isoform X2 [Sesamum indicum]
Length=173

 Score =   264 bits (675),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 124/176 (70%), Positives = 150/176 (85%), Gaps = 4/176 (2%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MA+MSDPL++GRV+GDV+D FS + KM V Y +NK V+NGHEF+PS +  KP+VE+  GD
Sbjct  1    MARMSDPLIVGRVIGDVLDSFSPTTKMFVTY-ANKQVFNGHEFYPSAVVMKPRVEIQGGD  59

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            LR+F+TL+MTDPDVPGPSDPYLREHLHW+VTDIPGTTD++FG+E+ SYE PKPNIGIHRF
Sbjct  60   LRTFYTLVMTDPDVPGPSDPYLREHLHWLVTDIPGTTDATFGKELASYEIPKPNIGIHRF  119

Query  434  VFLLYKQKRRQSVTVSSSP-SRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VF+L+KQ  RQ  TV + P +RD FNTR+FA +N LG PVAAVFFN QRETAARRR
Sbjct  120  VFVLFKQTGRQ--TVKNLPTTRDCFNTRRFAVENGLGLPVAAVFFNAQRETAARRR  173



>gb|ABP73382.1| TFL1 [Vicia faba]
Length=174

 Score =   264 bits (675),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 124/176 (70%), Positives = 150/176 (85%), Gaps = 3/176 (2%)
 Frame = -1

Query  794  MAKMS-DPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDG  618
            MA+M+ +P ++GRV+G+V+D F+ S++M+V YN  K V+NGHEFFPS + +KPKVE+   
Sbjct  1    MARMAQEPRIVGRVIGEVLDSFTTSMEMTVSYN-KKQVFNGHEFFPSTINTKPKVEIDGA  59

Query  617  DLRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHR  438
            D+RSF+TL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FG+EIVSYE PKPNIGIHR
Sbjct  60   DMRSFYTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGKEIVSYEIPKPNIGIHR  119

Query  437  FVFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            FVF+L+KQK R SV  + S SRD FNTR FA  NDLG PVAAV+FN QRETAARRR
Sbjct  120  FVFVLFKQKARDSVRTTPS-SRDHFNTRNFASQNDLGLPVAAVYFNAQRETAARRR  174



>ref|XP_006341131.1| PREDICTED: CEN-like protein 2-like isoform X1 [Solanum tuberosum]
Length=172

 Score =   264 bits (674),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 123/175 (70%), Positives = 148/175 (85%), Gaps = 3/175 (2%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MA+  +PL++GRV+GDV+D F+ ++KMS+ YN NK V NGHE FPS ++S+PKVEV  GD
Sbjct  1    MARSLEPLIVGRVIGDVIDSFNPTIKMSITYN-NKLVCNGHELFPSAVSSRPKVEVQGGD  59

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +R+FFTL+MTDPDVPGPSD YLREHLHWI+TDIPGTTD++FGRE+VSY+ P+PNIGIHRF
Sbjct  60   MRTFFTLVMTDPDVPGPSDTYLREHLHWIITDIPGTTDATFGRELVSYDIPRPNIGIHRF  119

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VF+L+KQK R S  VS   SRD FNTR FA +NDL  PVAAVFFN QRETAARRR
Sbjct  120  VFVLFKQKSRSS--VSQPTSRDHFNTRNFAQENDLEQPVAAVFFNAQRETAARRR  172



>ref|XP_010255492.1| PREDICTED: CEN-like protein 1 [Nelumbo nucifera]
Length=173

 Score =   264 bits (674),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 147/175 (84%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            M +  +PL +GRVVG+VVD F+ SVKM+V YN NK VYNGHEF PS++TS+P+VE+   D
Sbjct  1    MERNLEPLTVGRVVGEVVDAFTPSVKMNVTYNFNKQVYNGHEFMPSVITSRPRVEIGGED  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            LR+ FTLIMTDPD P PSDPYLREHLHWIVTDIPGTTD+SFGREIV YETPKP IGIHRF
Sbjct  61   LRAAFTLIMTDPDAPSPSDPYLREHLHWIVTDIPGTTDASFGREIVGYETPKPVIGIHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VF+L+KQK R+  TV    SRD+F+TRKF+++N LG PVAAV+FN QRETAARRR
Sbjct  121  VFILFKQKGRK--TVKPPASRDQFSTRKFSEENGLGLPVAAVYFNAQRETAARRR  173



>gb|ADP00717.1| CEN [Cynosurus cristatus]
Length=169

 Score =   263 bits (672),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 120/170 (71%), Positives = 146/170 (86%), Gaps = 2/170 (1%)
 Frame = -1

Query  779  DPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGDLRSFF  600
            +PL++GRV+G+V+D F+  V+M   YNSNK V+NGHE +PS + SKP+VEV  GDLRS F
Sbjct  2    EPLIVGRVIGEVLDPFNPCVRMVATYNSNKLVFNGHEIYPSAVVSKPRVEVQGGDLRSLF  61

Query  599  TLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRFVFLLY  420
            TL+MTDPDVPGPSDPYLREHLHWIV +IPGTTD+SFG E++SYE+PKPNIGIHRF+ +L+
Sbjct  62   TLVMTDPDVPGPSDPYLREHLHWIVGNIPGTTDASFGGEVISYESPKPNIGIHRFILVLF  121

Query  419  KQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            KQK RQ+++V S   RD FNTR+FA DNDLG PVAAV+FNCQRETAARRR
Sbjct  122  KQKGRQTLSVPS--FRDHFNTRQFAVDNDLGLPVAAVYFNCQRETAARRR  169



>ref|NP_001280794.1| protein TERMINAL FLOWER 1-like [Malus domestica]
 dbj|BAD10967.1| TFL1-like protein [Malus domestica]
 dbj|BAG31956.1| TFL1 like protein [Malus domestica]
 dbj|BAG31959.1| TFL1 like protein [Malus domestica]
 gb|ACD69429.1| terminal flower 1 [Malus domestica]
 gb|ACF18114.1| terminal flower 1 [Malus domestica]
Length=172

 Score =   263 bits (672),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 150/175 (86%), Gaps = 3/175 (2%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MA++ +PLV+GRV+GDV+D F+ +  MSV YN+ K V NG E FPS++T+KP+VE+  G+
Sbjct  1    MARVPEPLVVGRVIGDVLDSFTPTTHMSVTYNA-KLVCNGLELFPSVVTAKPRVEIQGGE  59

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            LRSFFTL+MTDPD PGPSDPYLREHLHWIVTDIPGTTD++FGRE +SYE P+PNIGIHRF
Sbjct  60   LRSFFTLVMTDPDCPGPSDPYLREHLHWIVTDIPGTTDAAFGREALSYEMPRPNIGIHRF  119

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VF+L+KQKRRQS+ + S  SRD F+TR FA +NDLG PVAAV+FN QRE+AARRR
Sbjct  120  VFVLFKQKRRQSINIPS--SRDCFSTRSFAAENDLGLPVAAVYFNAQRESAARRR  172



>ref|XP_006341132.1| PREDICTED: CEN-like protein 2-like isoform X2 [Solanum tuberosum]
Length=172

 Score =   263 bits (671),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 148/175 (85%), Gaps = 3/175 (2%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            MA+  +PL++GRV+GDV+D F+ ++KMS+ YN NK V NGHE FPS ++S+PKVEV  GD
Sbjct  1    MARSLEPLIVGRVIGDVIDSFNPTIKMSITYN-NKLVCNGHELFPSAVSSRPKVEVQGGD  59

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +R+FFTL+MTDPDVPGPSD YLREHLHWI+TDIPGTTD++FG+E+VSY+ P+PNIGIHRF
Sbjct  60   MRTFFTLVMTDPDVPGPSDTYLREHLHWIITDIPGTTDATFGKELVSYDIPRPNIGIHRF  119

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VF+L+KQK R S  VS   SRD FNTR FA +NDL  PVAAVFFN QRETAARRR
Sbjct  120  VFVLFKQKSRSS--VSQPTSRDHFNTRNFAQENDLEQPVAAVFFNAQRETAARRR  172



>gb|AGT41971.1| TFL1 [Dimocarpus longan]
Length=173

 Score =   263 bits (672),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 150/174 (86%), Gaps = 3/174 (2%)
 Frame = -1

Query  791  AKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGDL  612
            ++M DPLV+GRV+GDV++ F+ S+KMSV +N NK V NGHEF PS +T+KP+V +   D+
Sbjct  3    SRMQDPLVVGRVIGDVLEAFTPSIKMSVTFN-NKQVCNGHEFLPSAVTNKPRVLIQGADM  61

Query  611  RSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRFV  432
            RSFFTL+MTDPDVPGPSDPYLREHLHWIV+DIPGTTD++FG+E+V YE PKPNIGIHRFV
Sbjct  62   RSFFTLVMTDPDVPGPSDPYLREHLHWIVSDIPGTTDATFGKEVVGYEIPKPNIGIHRFV  121

Query  431  FLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            F+L+KQK RQ  T+S+  SRD+F+T+ FA +NDLG PV+AV+FN QRETAARRR
Sbjct  122  FVLFKQKCRQ--TISAPASRDQFSTKAFAAENDLGLPVSAVYFNAQRETAARRR  173



>gb|ABX11007.1| ZCN5 [Zea mays]
 gb|AFW58184.1| hypothetical protein ZEAMMB73_478740 [Zea mays]
Length=173

 Score =   263 bits (671),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 149/175 (85%), Gaps = 2/175 (1%)
 Frame = -1

Query  794  MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  615
            M++  +PLV+G+V+G+V+D+F+ +VKM+V Y S+K V+NGHEFFPS + SKP+V+V   D
Sbjct  1    MSRALEPLVVGKVIGEVIDNFNPTVKMTVTYGSDKQVFNGHEFFPSAVLSKPRVQVQGDD  60

Query  614  LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  435
            +RSFFTL+MTDPDVPGPSDPYLREHLHW+VTDIPGTTD+SFGRE V YE+PKP IG HRF
Sbjct  61   MRSFFTLVMTDPDVPGPSDPYLREHLHWMVTDIPGTTDASFGREQVMYESPKPYIGFHRF  120

Query  434  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            VF+L+KQ  RQSV   S  SRD FNTR+FA DN+LG PVAAV+FN QRETAARRR
Sbjct  121  VFVLFKQSSRQSVCPPS--SRDYFNTRRFAADNNLGLPVAAVYFNAQRETAARRR  173



>emb|CAI61981.1| TERMINAL FLOWER 1 protein [Impatiens balsamina]
 emb|CAI61982.1| TERMINAL FLOWER 1 protein [Impatiens balsamina]
Length=181

 Score =   263 bits (671),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 124/171 (73%), Positives = 146/171 (85%), Gaps = 3/171 (2%)
 Frame = -1

Query  782  SDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGDLRSF  603
            ++PL +GRV+GDV+D F  SVKM V YN NK VYNG+E FPS +TSKP+VEVH GDLR+F
Sbjct  13   TEPLAVGRVIGDVIDPFVLSVKMLVTYN-NKQVYNGYELFPSQITSKPRVEVHGGDLRTF  71

Query  602  FTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRFVFLL  423
            +TL+MTDPDVPGPSDPYL+EHLHW+VTDIPGTTD++FG+E+V YE P PNIGIHRFVF+L
Sbjct  72   YTLVMTDPDVPGPSDPYLKEHLHWMVTDIPGTTDATFGKEMVKYEMPMPNIGIHRFVFVL  131

Query  422  YKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            +KQ+ RQSV   S  SR+ FNTR+FA DNDLG PVAAVFFN QRETAAR R
Sbjct  132  FKQRCRQSVQPPS--SREHFNTRRFAADNDLGQPVAAVFFNAQRETAARCR  180



>ref|XP_008442833.1| PREDICTED: protein SELF-PRUNING [Cucumis melo]
Length=170

 Score =   262 bits (670),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 125/171 (73%), Positives = 145/171 (85%), Gaps = 9/171 (5%)
 Frame = -1

Query  782  SDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGDLRSF  603
            S+PLV+GRV+GDV+D F+QS+KMSV Y++NK V+NGHEFFPS + +KP+ E+H GDLRSF
Sbjct  9    SEPLVVGRVIGDVLDSFTQSMKMSVFYSNNKQVFNGHEFFPSAVAAKPRAEIHGGDLRSF  68

Query  602  FTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRFVFLL  423
            FTLIMTDPDVPGPSDPYLREHLHWI+ +I        GRE+VSYETP+PNIGIHRFVF+L
Sbjct  69   FTLIMTDPDVPGPSDPYLREHLHWILNEIT-------GREVVSYETPRPNIGIHRFVFVL  121

Query  422  YKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  270
            +KQKRRQSV   S  SRD FNTR FA DNDLG PVAAV+FN QRETAARRR
Sbjct  122  FKQKRRQSVNPPS--SRDHFNTRAFAVDNDLGLPVAAVYFNAQRETAARRR  170



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1737498245028