BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c110886_g1_i1 len=449 path=[1:0-448]

Length=449
                                                                      Score     E

ref|XP_009593237.1|  PREDICTED: uncharacterized protein LOC104089...  57.4    1e-06   
ref|XP_009593238.1|  PREDICTED: uncharacterized protein LOC104089...  57.4    1e-06   
ref|XP_004303344.1|  PREDICTED: uncharacterized protein LOC101309464  55.8    3e-06   
ref|XP_004249188.1|  PREDICTED: uncharacterized protein LOC101258014  54.7    8e-06   
emb|CDP10180.1|  unnamed protein product                              54.7    9e-06   
ref|XP_009787205.1|  PREDICTED: uncharacterized protein LOC104235...  53.5    2e-05   
ref|XP_009787206.1|  PREDICTED: uncharacterized protein LOC104235...  53.5    2e-05   
ref|XP_004171604.1|  PREDICTED: uncharacterized protein LOC101226631  48.5    2e-04   
ref|XP_007203211.1|  hypothetical protein PRUPE_ppa000350mg           50.4    2e-04   
ref|XP_010111380.1|  hypothetical protein L484_028037                 50.1    2e-04   
ref|XP_008240898.1|  PREDICTED: uncharacterized protein LOC103339393  49.7    3e-04   
ref|XP_002530363.1|  conserved hypothetical protein                   49.3    4e-04   Ricinus communis
ref|XP_008442254.1|  PREDICTED: uncharacterized protein LOC103486163  48.5    6e-04   
gb|KGN54868.1|  hypothetical protein Csa_4G563700                     48.5    6e-04   
ref|XP_004144693.1|  PREDICTED: uncharacterized protein LOC101210448  48.5    6e-04   
ref|XP_003553437.1|  PREDICTED: uncharacterized protein LOC100813046  48.5    7e-04   
gb|KHN45414.1|  hypothetical protein glysoja_028421                   48.5    7e-04   
ref|XP_011039488.1|  PREDICTED: uncharacterized protein LOC105136031  48.5    7e-04   
ref|XP_006429912.1|  hypothetical protein CICLE_v100109262mg          47.4    0.001   



>ref|XP_009593237.1| PREDICTED: uncharacterized protein LOC104089926 isoform X1 [Nicotiana 
tomentosiformis]
Length=1257

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 34/46 (74%), Gaps = 5/46 (11%)
 Frame = -3

Query  126  MPGIAQRNDHEYADGAAVLFNGSVSST----GFWSKHCDDVSYNQL  1
            MPG+AQ+ND EYA+  AV+FN S  S     GFWSKH +DVSYNQL
Sbjct  1    MPGLAQKNDEEYAN-EAVVFNASSKSISSNGGFWSKHSEDVSYNQL  45



>ref|XP_009593238.1| PREDICTED: uncharacterized protein LOC104089926 isoform X2 [Nicotiana 
tomentosiformis]
Length=1226

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 34/46 (74%), Gaps = 5/46 (11%)
 Frame = -3

Query  126  MPGIAQRNDHEYADGAAVLFNGSVSST----GFWSKHCDDVSYNQL  1
            MPG+AQ+ND EYA+  AV+FN S  S     GFWSKH +DVSYNQL
Sbjct  1    MPGLAQKNDEEYAN-EAVVFNASSKSISSNGGFWSKHSEDVSYNQL  45



>ref|XP_004303344.1| PREDICTED: uncharacterized protein LOC101309464 [Fragaria vesca 
subsp. vesca]
Length=1267

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 36/46 (78%), Gaps = 1/46 (2%)
 Frame = -3

Query  138  IE*KMPGIAQRNDHEYADGAAVLFNGSVSSTGFWSKHCDDVSYNQL  1
            +E KMPG+A+R+D +++DG++ ++  S S   FWSKH DDVSYNQL
Sbjct  7    LEPKMPGLAERDD-QFSDGSSPIYTLSSSPNAFWSKHRDDVSYNQL  51



>ref|XP_004249188.1| PREDICTED: uncharacterized protein LOC101258014 [Solanum lycopersicum]
Length=1254

 Score = 54.7 bits (130),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 32/45 (71%), Gaps = 4/45 (9%)
 Frame = -3

Query  126  MPGIAQRNDHEYADGAAVLFNGS---VSSTGFWSKHCDDVSYNQL  1
            MPG+AQRND E  D    +FN S   +SS GFWSKH +D+SYNQL
Sbjct  1    MPGLAQRND-EQNDNETAVFNASSKSISSNGFWSKHREDISYNQL  44



>emb|CDP10180.1| unnamed protein product [Coffea canephora]
Length=1251

 Score = 54.7 bits (130),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 33/50 (66%), Gaps = 8/50 (16%)
 Frame = -3

Query  126  MPGIA--------QRNDHEYADGAAVLFNGSVSSTGFWSKHCDDVSYNQL  1
            MPGIA        +RNDH++A GA   +N   SS GFWSKH +D+SYNQL
Sbjct  1    MPGIASAAAAAAAERNDHQFAKGATPSYNSLSSSNGFWSKHREDISYNQL  50



>ref|XP_009787205.1| PREDICTED: uncharacterized protein LOC104235195 isoform X1 [Nicotiana 
sylvestris]
Length=1257

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 32/46 (70%), Gaps = 5/46 (11%)
 Frame = -3

Query  126  MPGIAQRNDHEYADGAAVLFNGSV----SSTGFWSKHCDDVSYNQL  1
            MPG+AQ+ND EY +   V FN S     S+ GFWSKH +DVSYNQL
Sbjct  1    MPGLAQKNDEEYVN-ETVAFNASSKSISSNVGFWSKHSEDVSYNQL  45



>ref|XP_009787206.1| PREDICTED: uncharacterized protein LOC104235195 isoform X2 [Nicotiana 
sylvestris]
Length=1226

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 32/46 (70%), Gaps = 5/46 (11%)
 Frame = -3

Query  126  MPGIAQRNDHEYADGAAVLFNGSV----SSTGFWSKHCDDVSYNQL  1
            MPG+AQ+ND EY +   V FN S     S+ GFWSKH +DVSYNQL
Sbjct  1    MPGLAQKNDEEYVN-ETVAFNASSKSISSNVGFWSKHSEDVSYNQL  45



>ref|XP_004171604.1| PREDICTED: uncharacterized protein LOC101226631, partial [Cucumis 
sativus]
Length=164

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 30/42 (71%), Gaps = 3/42 (7%)
 Frame = -3

Query  126  MPGIAQRNDHEYADGAAVLFNGSVSSTGFWSKHCDDVSYNQL  1
            MPG+ Q+NDH     +A+    S+S+ GFWS+H DDVSYNQL
Sbjct  1    MPGLTQKNDHLNGGSSAIY---SLSAHGFWSQHRDDVSYNQL  39



>ref|XP_007203211.1| hypothetical protein PRUPE_ppa000350mg [Prunus persica]
 gb|EMJ04410.1| hypothetical protein PRUPE_ppa000350mg [Prunus persica]
Length=1257

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 34/42 (81%), Gaps = 2/42 (5%)
 Frame = -3

Query  126  MPGIAQRNDHEYADGAAVLFNGSVSSTGFWSKHCDDVSYNQL  1
            MPG+ QRND ++++G++ +++ S S  GFWSKH DDVSYNQL
Sbjct  1    MPGLPQRND-QFSNGSSPIYSLS-SPNGFWSKHRDDVSYNQL  40



>ref|XP_010111380.1| hypothetical protein L484_028037 [Morus notabilis]
 gb|EXC30858.1| hypothetical protein L484_028037 [Morus notabilis]
Length=1339

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 36/42 (86%), Gaps = 1/42 (2%)
 Frame = -3

Query  126  MPGIAQRNDHEYADGAAVLFNGSVSSTGFWSKHCDDVSYNQL  1
            MPG+AQRND ++++G++ +++ S S+ GFWSKH DDVSYNQL
Sbjct  1    MPGLAQRND-QFSNGSSQMYSLSSSANGFWSKHRDDVSYNQL  41



>ref|XP_008240898.1| PREDICTED: uncharacterized protein LOC103339393 [Prunus mume]
Length=1257

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 33/42 (79%), Gaps = 2/42 (5%)
 Frame = -3

Query  126  MPGIAQRNDHEYADGAAVLFNGSVSSTGFWSKHCDDVSYNQL  1
            MPG+ QRND ++ +G++ +++ S S  GFWSKH DDVSYNQL
Sbjct  1    MPGLPQRND-QFCNGSSPIYSLS-SPNGFWSKHRDDVSYNQL  40



>ref|XP_002530363.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF32024.1| conserved hypothetical protein [Ricinus communis]
Length=1239

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 30/42 (71%), Gaps = 2/42 (5%)
 Frame = -3

Query  126  MPGIAQRNDHEYADGAAVLFNGSVSSTGFWSKHCDDVSYNQL  1
            MPGIAQRN+      +  ++  SVS+ GFWSKH DDVSYNQL
Sbjct  1    MPGIAQRNEQLRNATSNGVY--SVSTNGFWSKHRDDVSYNQL  40



>ref|XP_008442254.1| PREDICTED: uncharacterized protein LOC103486163 [Cucumis melo]
Length=1279

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 30/42 (71%), Gaps = 3/42 (7%)
 Frame = -3

Query  126  MPGIAQRNDHEYADGAAVLFNGSVSSTGFWSKHCDDVSYNQL  1
            MPG+ Q+NDH     +A+    S+S+ GFWS+H DDVSYNQL
Sbjct  1    MPGLTQKNDHLNGGSSAIY---SLSAHGFWSQHRDDVSYNQL  39



>gb|KGN54868.1| hypothetical protein Csa_4G563700 [Cucumis sativus]
Length=1270

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 30/42 (71%), Gaps = 3/42 (7%)
 Frame = -3

Query  126  MPGIAQRNDHEYADGAAVLFNGSVSSTGFWSKHCDDVSYNQL  1
            MPG+ Q+NDH     +A+    S+S+ GFWS+H DDVSYNQL
Sbjct  1    MPGLTQKNDHLNGGSSAIY---SLSAHGFWSQHRDDVSYNQL  39



>ref|XP_004144693.1| PREDICTED: uncharacterized protein LOC101210448 [Cucumis sativus]
Length=1230

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 30/42 (71%), Gaps = 3/42 (7%)
 Frame = -3

Query  126  MPGIAQRNDHEYADGAAVLFNGSVSSTGFWSKHCDDVSYNQL  1
            MPG+ Q+NDH     +A+    S+S+ GFWS+H DDVSYNQL
Sbjct  1    MPGLTQKNDHLNGGSSAIY---SLSAHGFWSQHRDDVSYNQL  39



>ref|XP_003553437.1| PREDICTED: uncharacterized protein LOC100813046 [Glycine max]
Length=1274

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 32/42 (76%), Gaps = 2/42 (5%)
 Frame = -3

Query  126  MPGIAQRNDHEYADGAAVLFNGSVSSTGFWSKHCDDVSYNQL  1
            MPG+AQRN+H   +G++     S+S+ GFWSK+ DDVSYNQL
Sbjct  1    MPGLAQRNEH-LTNGSSTP-TCSLSANGFWSKNSDDVSYNQL  40



>gb|KHN45414.1| hypothetical protein glysoja_028421 [Glycine soja]
Length=1279

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 32/42 (76%), Gaps = 2/42 (5%)
 Frame = -3

Query  126  MPGIAQRNDHEYADGAAVLFNGSVSSTGFWSKHCDDVSYNQL  1
            MPG+AQRN+H   +G++     S+S+ GFWSK+ DDVSYNQL
Sbjct  1    MPGLAQRNEH-LTNGSSTP-TCSLSANGFWSKNSDDVSYNQL  40



>ref|XP_011039488.1| PREDICTED: uncharacterized protein LOC105136031 [Populus euphratica]
Length=1278

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 22/42 (52%), Positives = 33/42 (79%), Gaps = 1/42 (2%)
 Frame = -3

Query  126  MPGIAQRNDHEYADGAAVLFNGSVSSTGFWSKHCDDVSYNQL  1
            MPG+AQRN+ ++++  +   + S+S+ GFWSKH DDVS+NQL
Sbjct  1    MPGLAQRNE-QFSNATSSGGSYSLSANGFWSKHRDDVSFNQL  41



>ref|XP_006429912.1| hypothetical protein CICLE_v100109262mg, partial [Citrus clementina]
 gb|ESR43152.1| hypothetical protein CICLE_v100109262mg, partial [Citrus clementina]
Length=247

 Score = 47.4 bits (111),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 29/42 (69%), Gaps = 6/42 (14%)
 Frame = -3

Query  126  MPGIAQRNDHEYADGAAVLFNGSVSSTGFWSKHCDDVSYNQL  1
            MPG+AQRN+ ++++        SVS+ GFWSKH DDV Y QL
Sbjct  1    MPGLAQRNNEQFSN------TYSVSANGFWSKHSDDVGYQQL  36



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 523688455404