BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c11047_g1_i1 len=1871 path=[53:0-1870]

Length=1871
                                                                      Score     E

ref|XP_006364329.1|  PREDICTED: uncharacterized protein LOC102587683    319   5e-94   
emb|CDO99467.1|  unnamed protein product                                306   8e-94   
gb|EYU43365.1|  hypothetical protein MIMGU_mgv1a008995mg                283   1e-85   
gb|EYU28024.1|  hypothetical protein MIMGU_mgv1a008250mg                236   2e-67   
gb|EPS63740.1|  hypothetical protein M569_11044                         202   1e-56   



>ref|XP_006364329.1| PREDICTED: uncharacterized protein LOC102587683 [Solanum tuberosum]
Length=829

 Score =   319 bits (817),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 214/431 (50%), Positives = 263/431 (61%), Gaps = 41/431 (10%)
 Frame = -3

Query  1722  MAGTVYLRTNRFEVKLEGITFKAKDFEYLCTEDFLFPKGKVWVHRPIVGIDVMHHPRDPS  1543
             MAGTVYLRTNRFEVKLEGIT+KAK+FE LC  DFLFP+GKVWV  P+VG+DVM HPRDP+
Sbjct  1     MAGTVYLRTNRFEVKLEGITYKAKEFESLCAIDFLFPEGKVWVRPPVVGLDVMRHPRDPT  60

Query  1542  ivlvllcfglgcviLRFRSGAVIPGPILKFLTDERICFVGFGIPEKGELFPFEQLGLTKH  1363
             I+LVLLCFG+GC+ILRF SG  +P P+LKFLTDERI FVGFGIPEK +LFPFE+LGLTK 
Sbjct  61    IILVLLCFGVGCLILRFHSGEQLPDPVLKFLTDERIRFVGFGIPEKKDLFPFEELGLTKD  120

Query  1362  KADVGYLAAKFYNSPKYKRCELGDLAKKVLGIRRMIGLADSSSFERHEQIKCGICQLFIS  1183
             K D+GY+A K++ +PKYK+CELG+LA+KVLGI+RMIGL ++SSFERHEQIKC ICQLFIS
Sbjct  121   KVDIGYIATKYFKNPKYKQCELGELARKVLGIKRMIGLTEASSFERHEQIKCAICQLFIS  180

Query  1182  TVIAMSLFGAIEKKKVNDAPRKSPFQMNLSLLP-LTEGWF------------KLFEGKIR  1042
              VIAMSL    +KKK++DAP+K  F  NLS LP L+EGWF             L  G   
Sbjct  181   NVIAMSLLTTPDKKKLSDAPKKPSFLKNLSSLPLLSEGWFKLPKGKKGDKKPSLRRGTDV  240

Query  1041  NAREKDNNEEGDCDT--AQTRETIGHNEFGCGKGERMYSCGD---YVVRAKVSEADDLVT  877
               R     EE   DT  ++ +E    N+    K      C D   +    K    DD V 
Sbjct  241   LVRTSSEEEEYLVDTTVSKHKEGTNGNDLQQAKIAEFTFCDDSAGFWGDKKDVMVDDRVQ  300

Query  876   GEEPESAANDDSNTTKKPFLGMFKCLFPLGMSQFNPCPAPVPVDPDKEAMSTPRKPLKGI  697
             G+   S  N D   + +   G F     L +         V V  DK    +     K I
Sbjct  301   GK--GSKCNLDDGASPRISGGEFGSGEDLFL---------VKVSEDKSGDGSAYGKAKEI  349

Query  696   LKCPSSSYVELRRSDVSNKEETA--KKQPIKGILKCRSSSA-MERSPFLSLKEP------  544
                  S+   L     ++ +E A   K+P+KGILKC S+      S + +L  P      
Sbjct  350   SAIDDSNEDVLVFFAKNDSKEAAYLSKRPLKGILKCPSAGQEAWNSLYPNLDSPLSVDNA  409

Query  543   ---LKRANSKG  520
                L+RANSKG
Sbjct  410   TISLRRANSKG  420



>emb|CDO99467.1| unnamed protein product [Coffea canephora]
Length=398

 Score =   306 bits (784),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 208/419 (50%), Positives = 260/419 (62%), Gaps = 33/419 (8%)
 Frame = -3

Query  1722  MAGTVYLRTNRFEVKLEGITFKAKDFEYLCTEDFLFPKGKVWVHRPIVGIDVMHHPRDPS  1543
             MAG VYLRTN+FEVKLEGITFKAKDFE +C+ DFLFP GK W   P+VGIDVM HPRDP+
Sbjct  1     MAGIVYLRTNKFEVKLEGITFKAKDFETMCSMDFLFPDGKTWARPPVVGIDVMRHPRDPN  60

Query  1542  ivlvllcfglgcviLRFRSGAVIPGPILKFLTDERICFVGFGIPEKGELFPFEQLGLTKH  1363
              +L+LLCFG+GCVIL+F SG V+P  I +FLTDERI FVGFGIPEK +LFP E+LGLTKH
Sbjct  61    NILMLLCFGVGCVILKFISGDVLPESIYRFLTDERIRFVGFGIPEKKDLFPLEELGLTKH  120

Query  1362  KADVGYLAAKFYNSPKYKRCELGDLAKKVLGIRRMIGLADSSSFERHEQIKCGICQLFIS  1183
             + D+GYLAAK  + PKY++ EL +LA++VL ++ MIGL  SSSFERHEQIKC ICQLFI+
Sbjct  121   QVDIGYLAAKILDDPKYRKYELAELARRVLRVKTMIGLTQSSSFERHEQIKCAICQLFIT  180

Query  1182  TVIAMSLFGAIEKKKVNDAPRK-SPFQMNLSLLPL-TEGWFKL--FEGKIRNAREKDNNE  1015
             + IAM+L G  EKK+  DA +K S F  NL+ LPL TEGWFKL  ++  +R+  + + N+
Sbjct  181   SAIAMALLGKSEKKRPVDASKKSSSFLKNLNQLPLFTEGWFKLPKYKKVVRDKNKVEENK  240

Query  1014  EGDCDTAQTRETI-----GHNEFGCGKGERMYSCGDYVVRAKVSEADDLVTGEEPESAAN  850
               D     T   +     G+  FG  +G+   + GD     K          ++ +  AN
Sbjct  241   VRDKVPLPTATLVDDGFSGYEIFGDAEGDYC-AFGDDPFHGKSVHIPYGDDDDDDDHDAN  299

Query  849   DDSNTTK--KPFLG-MFKCLFPLGMSQFNPCPAPVPVDPDKEAMSTPRKPLKGILKCPSS  679
                   K  + F G  F CL        +  P     +  KEA  T RKPLKGILK  SS
Sbjct  300   GHPFHAKGSQGFFGDAFSCL-----KHKDGSPGD---NHSKEAFGTERKPLKGILKSSSS  351

Query  678   SYVELRRSDVSNKEETAKKQPIKGILKCRSSSAMERSPFLSLKEPLKRANSKGHNVSFK  502
             +     R +VSN       +P  G      SS         +K  LKRANSKG+NV FK
Sbjct  352   A-----RFEVSNH---GSSRPDSG----PDSSESSSQEVFIVKRTLKRANSKGYNVQFK  398



>gb|EYU43365.1| hypothetical protein MIMGU_mgv1a008995mg [Erythranthe guttata]
Length=356

 Score =   283 bits (725),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 198/411 (48%), Positives = 245/411 (60%), Gaps = 57/411 (14%)
 Frame = -3

Query  1722  MAGTVYLRTNRFEVKLEGITFKAKDFEYLCTEDFLFPKGKVWVHRPIVGIDVMHHPRDPS  1543
             MAG VYL+TNRFEVKLEGITFK KDFEYLC  DFLFP+G+VW H PIVG+DVM HPRDPS
Sbjct  1     MAGNVYLKTNRFEVKLEGITFKTKDFEYLCKIDFLFPEGRVWDHPPIVGLDVMRHPRDPS  60

Query  1542  ivlvllcfglgcviLRFRSGAVIPGPILKFLTDERICFVGFGIPEKGELFPFEQLGLTKH  1363
             I+L+LL FG+GCVILRF +G  +P PI KFL+D+RI FVGFGIPEK +LFPF++LGL+K 
Sbjct  61    ILLILLSFGVGCVILRFVAGEPLPLPIHKFLSDKRIRFVGFGIPEKKKLFPFQELGLSKT  120

Query  1362  KADVGYLAAKFYNSPKYKRCELGDLAKKVLGIRRMIGLADSSSFERHEQIKCGICQLFIS  1183
             K D+GYLAAK    PK K  EL +LA++VLGI+RMIG+ ++SSFERHEQIKC ICQLFI+
Sbjct  121   KVDIGYLAAKILKEPKCKTWELAELARRVLGIKRMIGMTEASSFERHEQIKCAICQLFIT  180

Query  1182  TVIAMSLFGAIEKKKVNDAPRKSPFQMNL-SLLPLTEGW-FKLFEGKIRNAREKDNNEEG  1009
             +VIAM L             +KS F  NL SL  L EGW FKL +GK +N +     EEG
Sbjct  181   SVIAMGL-------SKASEKKKSSFLKNLNSLHILAEGWFFKLPKGKKKN-QTVQVEEEG  232

Query  1008  DCDTAQTRETIGHNEFGCGKGERMYSCGDYVVRAKVSEADDLVTGEEPESAANDDSNTTK  829
             D       E    +  G     RM   GD    +K  E+DD    EE  S++  + +++ 
Sbjct  233   DSVHVHIGEM--EDMLGDDFLVRMSPFGD----SKNQESDDT---EEYSSSSKVEQDSSG  283

Query  828   KPFLGMFKCLFPLGMSQFNPCPAPVPVDPDKEAMSTPRKPLKGILKCPSSSYVELRRSDV  649
             + F                        D +K    + + PLKGILKCPS++ +      V
Sbjct  284   EDFSD----------------DKDTSDDGEKNESCSGKLPLKGILKCPSTNNM-FPSEPV  326

Query  648   SNKEETAKKQPIKGILKCRSSSAMERSPFLSLKEPLKRANSKGHNVSFKCN  496
             S   E  +                       +K  LKRANSKG NV FKC 
Sbjct  327   SPSAENDQN---------------------GMKGALKRANSKGCNVRFKCQ  356



>gb|EYU28024.1| hypothetical protein MIMGU_mgv1a008250mg [Erythranthe guttata]
Length=379

 Score =   236 bits (601),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 178/419 (42%), Positives = 230/419 (55%), Gaps = 93/419 (22%)
 Frame = -3

Query  1725  DMAGTVYLRTNRFEVKLEGITFKAKDFEYLCTEDFLFPKGKVWVHRPIVGIDVMHHPRDP  1546
             +MAGTVYL+TNRFEVKLE ITFK KDFE LC  DFLFP GKVW  +PIVG+DVM HPRDP
Sbjct  41    EMAGTVYLKTNRFEVKLEAITFKTKDFESLCKMDFLFPDGKVWARKPIVGLDVMCHPRDP  100

Query  1545  SivlvllcfglgcviLRFRSGAVIPGPILKFLTDERICFVGFGIPEKGELFPFEQLGLTK  1366
             S++L+LLCFG+GCVILRF++G  +P  I +FL D+RI  VGFGIPEK ++FPFE+LGL K
Sbjct  101   SVILLLLCFGVGCVILRFKAGEALPAGIHRFLADKRINVVGFGIPEKTDIFPFEELGLRK  160

Query  1365  HKADVGYLAAKFYNSPKYKRCELGDLAKKVLGIRRMIGLADSSSFERHEQIKCGICQLFI  1186
              + D+GYLAA+     KYKR EL +LA++VLGI++MIGL ++SSFERHEQI         
Sbjct  161   SEVDIGYLAARSLKDSKYKRWELAELAQRVLGIKKMIGLTEASSFERHEQI---------  211

Query  1185  STVIAMSLFGAIEKKKVNDAPRKSPFQMNL-SLLPLTEGWFKLFEGKIRNARE---KDNN  1018
                                    + F  NL SL  L EGWFK+ +GK  N ++   KDNN
Sbjct  212   -----------------------NSFLKNLNSLQLLAEGWFKVPKGKKNNKKQQPGKDNN  248

Query  1017  EEGDCDTAQTRETIGHNEFGCGKGERMYSCGDYVVRAKVSEADDLVTGEEPESAANDDSN  838
                + +              C +G  +    D++  AK+ E D       PE  +     
Sbjct  249   VLVNVE--------------CNEGPFV----DFLANAKIPEGD-----YTPEDYSPPSVR  285

Query  837   TTKKPFLGMFKCLFPLGMSQFNPCPAPVPVDPDK-------EAMSTPRKPLKGILKCPSS  679
             T  K               ++  C   + V+  K       +  S  +KP+KGILKCPS+
Sbjct  286   TRTK---------------KYASCNDLIDVECSKGETGNSSDDSSNGKKPIKGILKCPST  330

Query  678   SYVELRRSDVSNKEETAKKQPIKGILKCRSSSAMERSPFLSLKEPLKRANSKGHNVSFK  502
             +   LR +   + EET              S+          +  LKRANSKG NVSFK
Sbjct  331   TL--LRWNSFPSNEETPPSP----------STPTPSDEMCGARGSLKRANSKGCNVSFK  377



>gb|EPS63740.1| hypothetical protein M569_11044, partial [Genlisea aurea]
Length=228

 Score =   202 bits (513),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 120/227 (53%), Positives = 150/227 (66%), Gaps = 6/227 (3%)
 Frame = -3

Query  1722  MAGTVYLRTNRFEVKLEGITFKAKDFEYLCTEDFLFPKGKVW--VHRPIVGIDVMHHPRD  1549
             MAG V+LRTN FEV+LEGITFK  DF  LC  DFLFPK   W   H P++GIDV+ HPRD
Sbjct  1     MAGIVFLRTNLFEVRLEGITFKPHDFASLCAADFLFPKTAFWPESHPPVIGIDVIPHPRD  60

Query  1548  PSivlvllcfglgcviLRFRSGAVIPGPILKFLTDERICFVGFGIPEKGELFPFEQLGLT  1369
              S++L+LL FG+GCV+LRF +G  +P  I  FL+D+RI FV FG+  K  LFPF +LGL 
Sbjct  61    SSVLLLLLSFGVGCVVLRFPAGEPLPIAIHAFLSDKRIRFVAFGMERKEGLFPFRELGLN  120

Query  1368  KHKADVGYLAAKFYNSPKYKRCELGDLAKKVLGIRRMIGLADSSSFERHEQIKCGICQLF  1189
             +   DVG +AA     P Y+  ELG+LA+ +LGI +++GL D SSF RHE+IK  ICQLF
Sbjct  121   RDAVDVGCIAANVMGDPIYRDSELGELAEAILGIHQVVGLTDVSSFRRHEEIKAAICQLF  180

Query  1188  ISTVIAMSLFGAIEKKKVNDAPRKSPFQMNL----SLLPLTEGWFKL  1060
             ++TVIAM LF        + +   S     L    SL  L EGWFKL
Sbjct  181   LTTVIAMGLFNKSSAPSPSPSSSSSKKASFLKTLNSLHLLAEGWFKL  227



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5509808335512