BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c110224_g1_i1 len=217 path=[1:0-216]

Length=217
                                                                      Score     E

ref|XP_009603523.1|  PREDICTED: uncharacterized protein LOC104098481  97.4    3e-21   
ref|XP_010095595.1|  Copia protein                                    97.4    3e-21   
ref|XP_004170301.1|  PREDICTED: uncharacterized LOC101213309          96.3    5e-21   
ref|XP_002458242.1|  hypothetical protein SORBIDRAFT_03g029780        95.9    7e-21   Sorghum bicolor [broomcorn]
ref|XP_009779221.1|  PREDICTED: uncharacterized protein LOC104228457  95.9    1e-20   
ref|XP_009617827.1|  PREDICTED: uncharacterized protein LOC104110107  95.5    1e-20   
ref|XP_009799299.1|  PREDICTED: uncharacterized protein LOC104245396  95.5    1e-20   
ref|XP_004230382.1|  PREDICTED: uncharacterized protein LOC101246184  95.1    2e-20   
ref|XP_006358496.1|  PREDICTED: uncharacterized protein LOC102597...  95.1    2e-20   
ref|XP_006358495.1|  PREDICTED: uncharacterized protein LOC102597...  95.1    2e-20   
ref|XP_004969341.1|  PREDICTED: uncharacterized protein LOC101769092  94.7    2e-20   
gb|AFW83437.1|  hypothetical protein ZEAMMB73_889772                  93.2    2e-20   
ref|XP_008458090.1|  PREDICTED: uncharacterized protein LOC103497626  94.0    4e-20   
ref|XP_004149319.1|  PREDICTED: uncharacterized protein LOC101213309  94.0    5e-20   
ref|XP_008673285.1|  PREDICTED: hypothetical protein isoform X1       93.6    6e-20   
ref|XP_009358942.1|  PREDICTED: uncharacterized protein LOC103949552  93.2    7e-20   
ref|XP_009420899.1|  PREDICTED: uncharacterized protein LOC104000536  92.8    1e-19   
ref|XP_008673286.1|  PREDICTED: hypothetical protein isoform X2       92.4    1e-19   
gb|KHN20819.1|  hypothetical protein glysoja_050200                   88.2    3e-19   
ref|XP_008657818.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  91.3    4e-19   
ref|XP_009405577.1|  PREDICTED: uncharacterized protein LOC103988692  90.9    5e-19   
ref|XP_008235875.1|  PREDICTED: uncharacterized protein LOC103334677  90.9    5e-19   
ref|XP_007200336.1|  hypothetical protein PRUPE_ppa000254mg           90.9    5e-19   
ref|NP_001043744.1|  Os01g0653800                                     90.5    6e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008798429.1|  PREDICTED: uncharacterized protein LOC103713325  90.5    7e-19   
gb|EEE55099.1|  hypothetical protein OsJ_02855                        90.5    8e-19   Oryza sativa Japonica Group [Japonica rice]
gb|EYU33240.1|  hypothetical protein MIMGU_mgv1a000222mg              90.1    1e-18   
ref|XP_010913344.1|  PREDICTED: uncharacterized protein LOC105039060  89.7    1e-18   
ref|XP_009342400.1|  PREDICTED: uncharacterized protein LOC103934376  89.4    2e-18   
gb|KDO46912.1|  hypothetical protein CISIN_1g000685mg                 89.0    2e-18   
emb|CBI31125.3|  unnamed protein product                              89.0    2e-18   
ref|XP_002521175.1|  conserved hypothetical protein                   89.0    2e-18   Ricinus communis
ref|XP_002263744.1|  PREDICTED: uncharacterized protein LOC100248418  89.0    3e-18   Vitis vinifera
ref|XP_011019918.1|  PREDICTED: uncharacterized protein LOC105122493  89.0    3e-18   
ref|XP_010541522.1|  PREDICTED: uncharacterized protein LOC104814960  89.0    3e-18   
emb|CDP17760.1|  unnamed protein product                              88.6    3e-18   
ref|XP_011092225.1|  PREDICTED: uncharacterized protein LOC105172480  88.2    5e-18   
ref|XP_006658273.1|  PREDICTED: uncharacterized protein LOC102709386  88.2    5e-18   
ref|XP_002309040.1|  WD-40 repeat family protein                      87.4    8e-18   Populus trichocarpa [western balsam poplar]
gb|KDO46909.1|  hypothetical protein CISIN_1g000685mg                 86.7    1e-17   
ref|XP_006441965.1|  hypothetical protein CICLE_v10018511mg           86.3    2e-17   
gb|KDO46910.1|  hypothetical protein CISIN_1g000685mg                 86.3    2e-17   
ref|XP_008791406.1|  PREDICTED: uncharacterized protein LOC103708...  86.3    2e-17   
gb|KDO46911.1|  hypothetical protein CISIN_1g000685mg                 85.9    3e-17   
ref|XP_006478516.1|  PREDICTED: uncharacterized protein LOC102607648  85.9    3e-17   
ref|XP_006606731.1|  PREDICTED: uncharacterized protein LOC100811133  83.2    4e-17   
ref|XP_008791407.1|  PREDICTED: uncharacterized protein LOC103708...  85.5    4e-17   
ref|XP_008791408.1|  PREDICTED: uncharacterized protein LOC103708...  85.1    5e-17   
ref|XP_010241186.1|  PREDICTED: uncharacterized protein LOC104585868  84.7    6e-17   
gb|KDP36340.1|  hypothetical protein JCGZ_09760                       84.7    8e-17   
ref|XP_007014609.1|  Transducin/WD40 repeat-like superfamily prot...  83.6    1e-16   
ref|XP_007014610.1|  Transducin/WD40 repeat-like superfamily prot...  83.6    2e-16   
gb|KHN41320.1|  hypothetical protein glysoja_044588                   81.3    2e-16   
ref|XP_007014608.1|  Transducin/WD40 repeat-like superfamily prot...  83.2    2e-16   
ref|XP_007014605.1|  Transducin/WD40 repeat-like superfamily prot...  82.0    6e-16   
ref|XP_003521631.1|  PREDICTED: uncharacterized protein LOC100777567  81.6    8e-16   
gb|ABD32844.1|  Peptidase S8 and S53, subtilisin, kexin, sedolisi...  81.3    9e-16   Medicago truncatula
gb|KHN14190.1|  hypothetical protein glysoja_028588                   81.3    1e-15   
ref|XP_008382760.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  81.3    1e-15   
gb|KHN43390.1|  hypothetical protein glysoja_001973                   81.3    1e-15   
ref|XP_007014607.1|  Transducin/WD40 repeat-like superfamily prot...  80.9    1e-15   
ref|XP_007014606.1|  Transducin/WD40 repeat-like superfamily prot...  80.9    1e-15   
gb|EPS66148.1|  hypothetical protein M569_08629                       80.5    2e-15   
dbj|BAF02178.1|  hypothetical protein                                 80.1    2e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003626104.1|  hypothetical protein MTR_7g111080                80.1    3e-15   
gb|AES82322.2|  transducin/WD40 repeat protein                        79.0    7e-15   
dbj|BAB09653.1|  unnamed protein product                              78.6    8e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010673184.1|  PREDICTED: uncharacterized protein LOC104889623  78.2    1e-14   
ref|XP_010495460.1|  PREDICTED: uncharacterized protein LOC104772557  77.0    3e-14   
ref|XP_006394724.1|  hypothetical protein EUTSA_v10003520mg           77.0    3e-14   
ref|XP_007163270.1|  hypothetical protein PHAVU_001G220300g           77.0    3e-14   
dbj|BAF01929.1|  hypothetical protein                                 77.0    4e-14   Arabidopsis thaliana [mouse-ear cress]
ref|NP_197859.4|  WD40 domain-containing protein                      77.0    4e-14   Arabidopsis thaliana [mouse-ear cress]
emb|CDX88129.1|  BnaA06g27200D                                        76.3    6e-14   
ref|XP_004290117.1|  PREDICTED: uncharacterized protein LOC101292072  75.9    7e-14   
dbj|BAJ95941.1|  predicted protein                                    75.9    8e-14   
ref|XP_009150997.1|  PREDICTED: uncharacterized protein LOC103874342  75.9    9e-14   
ref|XP_006849192.1|  hypothetical protein AMTR_s00027p00213280        75.5    1e-13   
ref|XP_002874217.1|  hypothetical protein ARALYDRAFT_489332           75.5    1e-13   
ref|XP_010421309.1|  PREDICTED: uncharacterized protein LOC104706...  75.1    2e-13   
ref|XP_010454796.1|  PREDICTED: uncharacterized protein LOC104736495  75.1    2e-13   
ref|XP_010421308.1|  PREDICTED: uncharacterized protein LOC104706...  74.3    2e-13   
dbj|BAJ99483.1|  predicted protein                                    73.9    4e-13   
ref|XP_010232091.1|  PREDICTED: uncharacterized protein LOC100836556  73.9    4e-13   
gb|EMS55149.1|  hypothetical protein TRIUR3_19246                     73.9    4e-13   
ref|XP_004494493.1|  PREDICTED: uncharacterized protein LOC101494449  73.2    6e-13   
emb|CDM83562.1|  unnamed protein product                              73.2    6e-13   
gb|EMT09929.1|  hypothetical protein F775_29330                       72.4    1e-12   
emb|CDX87116.1|  BnaC09g04310D                                        70.9    4e-12   
emb|CDY19826.1|  BnaA09g04790D                                        70.9    4e-12   
ref|XP_006286796.1|  hypothetical protein CARUB_v10003471mg           68.2    4e-11   
ref|XP_009111642.1|  PREDICTED: uncharacterized protein LOC103837068  67.8    6e-11   
ref|XP_010038005.1|  PREDICTED: uncharacterized protein LOC104426595  67.8    6e-11   
gb|KCW84525.1|  hypothetical protein EUGRSUZ_B013612                  67.4    7e-11   
gb|KHG04190.1|  Transcription initiation factor TFIID subunit 5       60.8    6e-09   
ref|XP_011087586.1|  PREDICTED: uncharacterized protein LOC105169027  59.3    4e-08   
gb|KHG22556.1|  Nucleoporin Nup43                                     55.8    2e-07   
ref|XP_001757483.1|  predicted protein                                57.0    2e-07   
ref|XP_002985192.1|  hypothetical protein SELMODRAFT_157186           47.4    5e-04   
ref|XP_002969859.1|  hypothetical protein SELMODRAFT_92496            47.0    7e-04   



>ref|XP_009603523.1| PREDICTED: uncharacterized protein LOC104098481 [Nicotiana tomentosiformis]
Length=1387

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 55/71 (77%), Gaps = 4/71 (6%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGR----TPEQLLVKQT  48
            LPTP G  EHTA+YVVER LKLL+FQLSNT  PA+G+NG  S+TGR     PEQL VKQT
Sbjct  409  LPTPTGSREHTAVYVVERELKLLQFQLSNTTPPALGSNGSLSDTGRFRGEIPEQLHVKQT  468

Query  47   KKKITTPVPHD  15
            KK ITTP PHD
Sbjct  469  KKHITTPAPHD  479



>ref|XP_010095595.1| Copia protein [Morus notabilis]
 gb|EXB61168.1| Copia protein [Morus notabilis]
Length=1303

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 55/71 (77%), Gaps = 4/71 (6%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGR----TPEQLLVKQT  48
            LPTP G  EH+A+YVVER LKLL FQLS TANP++GNNG  S TGR    +PEQL VKQ 
Sbjct  393  LPTPSGSREHSAVYVVERELKLLNFQLSQTANPSLGNNGPLSETGRIRGDSPEQLQVKQI  452

Query  47   KKKITTPVPHD  15
            KK I+TPVPHD
Sbjct  453  KKHISTPVPHD  463



>ref|XP_004170301.1| PREDICTED: uncharacterized LOC101213309, partial [Cucumis sativus]
Length=844

 Score = 96.3 bits (238),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 48/73 (66%), Positives = 56/73 (77%), Gaps = 2/73 (3%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGRTP--EQLLVKQTKK  42
            LPTP GG EH+A+Y+VER LKLL FQLS+T NP++GNNG  S  GR    E L VKQ KK
Sbjct  182  LPTPSGGREHSAVYIVERELKLLNFQLSHTTNPSLGNNGSLSEGGRLKGDELLQVKQVKK  241

Query  41   KITTPVPHDSYSV  3
             I+TPVPHD+YSV
Sbjct  242  HISTPVPHDAYSV  254



>ref|XP_002458242.1| hypothetical protein SORBIDRAFT_03g029780 [Sorghum bicolor]
 gb|EES03362.1| hypothetical protein SORBIDRAFT_03g029780 [Sorghum bicolor]
Length=1048

 Score = 95.9 bits (237),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 46/71 (65%), Positives = 56/71 (79%), Gaps = 4/71 (6%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGRTP----EQLLVKQT  48
            LPTP G  EH+A+Y+VER LKLL FQLSNTANP++GN G+ S+ GR+     EQL+VKQT
Sbjct  496  LPTPTGNKEHSAVYIVERELKLLNFQLSNTANPSLGNAGVASDAGRSRNDSIEQLIVKQT  555

Query  47   KKKITTPVPHD  15
            KK I+TP PHD
Sbjct  556  KKHISTPAPHD  566



>ref|XP_009779221.1| PREDICTED: uncharacterized protein LOC104228457 [Nicotiana sylvestris]
Length=1379

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 50/71 (70%), Positives = 55/71 (77%), Gaps = 4/71 (6%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGR----TPEQLLVKQT  48
            LPTP G  EHTA+YVVER LKLL+FQLSNT  PA+G+NG  S+TGR     PEQL VKQT
Sbjct  409  LPTPTGSREHTAVYVVERELKLLQFQLSNTTPPALGSNGSLSDTGRFRGEIPEQLYVKQT  468

Query  47   KKKITTPVPHD  15
            KK ITTP PHD
Sbjct  469  KKHITTPAPHD  479



>ref|XP_009617827.1| PREDICTED: uncharacterized protein LOC104110107 [Nicotiana tomentosiformis]
Length=1376

 Score = 95.5 bits (236),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 50/71 (70%), Positives = 55/71 (77%), Gaps = 4/71 (6%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGR----TPEQLLVKQT  48
            LPTP G  EHTA+YVVER LKLL+FQLSNT  PA+G+NG  S+TGR     PEQL VKQT
Sbjct  406  LPTPTGSREHTAVYVVERELKLLQFQLSNTTPPALGSNGSLSDTGRFRGEIPEQLHVKQT  465

Query  47   KKKITTPVPHD  15
            KK ITTP PHD
Sbjct  466  KKHITTPAPHD  476



>ref|XP_009799299.1| PREDICTED: uncharacterized protein LOC104245396 [Nicotiana sylvestris]
 ref|XP_009799300.1| PREDICTED: uncharacterized protein LOC104245396 [Nicotiana sylvestris]
Length=1390

 Score = 95.5 bits (236),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 50/71 (70%), Positives = 55/71 (77%), Gaps = 4/71 (6%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGR----TPEQLLVKQT  48
            LPTP G  EHTA+YVVER LKLL+FQLSNT  PA+G+NG  S+TGR     PEQL VKQT
Sbjct  406  LPTPTGSREHTAVYVVERELKLLQFQLSNTTPPALGSNGSLSDTGRFRGEIPEQLHVKQT  465

Query  47   KKKITTPVPHD  15
            KK ITTP PHD
Sbjct  466  KKHITTPAPHD  476



>ref|XP_004230382.1| PREDICTED: uncharacterized protein LOC101246184 [Solanum lycopersicum]
Length=1400

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 54/71 (76%), Gaps = 4/71 (6%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGR----TPEQLLVKQT  48
            LPTP    EHTA+YVVER LKLL+FQLSNT  PA+G+NG  S+TGR     PEQL VKQT
Sbjct  409  LPTPTESREHTAVYVVERELKLLQFQLSNTTAPALGSNGSLSDTGRFRGEIPEQLHVKQT  468

Query  47   KKKITTPVPHD  15
            KK ITTP PHD
Sbjct  469  KKHITTPAPHD  479



>ref|XP_006358496.1| PREDICTED: uncharacterized protein LOC102597779 isoform X2 [Solanum 
tuberosum]
Length=1395

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 54/71 (76%), Gaps = 4/71 (6%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGR----TPEQLLVKQT  48
            LPTP    EHTA+YVVER LKLL+FQLSNT  PA+G+NG  S+TGR     PEQL VKQT
Sbjct  409  LPTPTESREHTAVYVVERELKLLQFQLSNTTAPALGSNGSLSDTGRFRGEIPEQLHVKQT  468

Query  47   KKKITTPVPHD  15
            KK ITTP PHD
Sbjct  469  KKHITTPAPHD  479



>ref|XP_006358495.1| PREDICTED: uncharacterized protein LOC102597779 isoform X1 [Solanum 
tuberosum]
Length=1411

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 54/71 (76%), Gaps = 4/71 (6%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGR----TPEQLLVKQT  48
            LPTP    EHTA+YVVER LKLL+FQLSNT  PA+G+NG  S+TGR     PEQL VKQT
Sbjct  409  LPTPTESREHTAVYVVERELKLLQFQLSNTTAPALGSNGSLSDTGRFRGEIPEQLHVKQT  468

Query  47   KKKITTPVPHD  15
            KK ITTP PHD
Sbjct  469  KKHITTPAPHD  479



>ref|XP_004969341.1| PREDICTED: uncharacterized protein LOC101769092 [Setaria italica]
Length=1380

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 46/71 (65%), Positives = 57/71 (80%), Gaps = 4/71 (6%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGRTP----EQLLVKQT  48
            LPTP G  EH+A+Y+VER LKLL FQLSNTANP++GN G+ S+TGR+     +QL+VKQT
Sbjct  408  LPTPTGNKEHSAVYIVERELKLLNFQLSNTANPSLGNAGVASDTGRSRNESIDQLIVKQT  467

Query  47   KKKITTPVPHD  15
            KK I+TP PHD
Sbjct  468  KKHISTPAPHD  478



>gb|AFW83437.1| hypothetical protein ZEAMMB73_889772 [Zea mays]
Length=490

 Score = 93.2 bits (230),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 44/71 (62%), Positives = 55/71 (77%), Gaps = 4/71 (6%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGRTP----EQLLVKQT  48
            LPTP G  EH+A+Y+VER LKLL FQLSNTANP++GN G+ S+ GR+     EQL+V Q+
Sbjct  408  LPTPTGSKEHSAVYIVERELKLLNFQLSNTANPSLGNAGVASDAGRSRNDSLEQLIVNQS  467

Query  47   KKKITTPVPHD  15
            KK I+TP PHD
Sbjct  468  KKHISTPAPHD  478



>ref|XP_008458090.1| PREDICTED: uncharacterized protein LOC103497626 [Cucumis melo]
Length=1342

 Score = 94.0 bits (232),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 48/73 (66%), Positives = 56/73 (77%), Gaps = 2/73 (3%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGRTP--EQLLVKQTKK  42
            LPTP GG EH+A+Y+VER LKLL FQLS+T NP++GNNG  S  GR    E L VKQ KK
Sbjct  409  LPTPSGGREHSAVYIVERELKLLNFQLSHTTNPSLGNNGSLSEGGRLKGDELLQVKQVKK  468

Query  41   KITTPVPHDSYSV  3
             I+TPVPHD+YSV
Sbjct  469  HISTPVPHDAYSV  481



>ref|XP_004149319.1| PREDICTED: uncharacterized protein LOC101213309 [Cucumis sativus]
 gb|KGN44669.1| hypothetical protein Csa_7G368210 [Cucumis sativus]
Length=1343

 Score = 94.0 bits (232),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 48/73 (66%), Positives = 56/73 (77%), Gaps = 2/73 (3%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGRTP--EQLLVKQTKK  42
            LPTP GG EH+A+Y+VER LKLL FQLS+T NP++GNNG  S  GR    E L VKQ KK
Sbjct  409  LPTPSGGREHSAVYIVERELKLLNFQLSHTTNPSLGNNGSLSEGGRLKGDELLQVKQVKK  468

Query  41   KITTPVPHDSYSV  3
             I+TPVPHD+YSV
Sbjct  469  HISTPVPHDAYSV  481



>ref|XP_008673285.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=1379

 Score = 93.6 bits (231),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 46/71 (65%), Positives = 56/71 (79%), Gaps = 4/71 (6%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGRTP----EQLLVKQT  48
            LPTP G  EH+A+Y+VER LKLL FQLSNTANP++GN G+ S+ GR+     EQL+VKQT
Sbjct  408  LPTPTGNKEHSAVYIVERELKLLNFQLSNTANPSLGNAGVASDAGRSMNNSIEQLIVKQT  467

Query  47   KKKITTPVPHD  15
            KK I+TP PHD
Sbjct  468  KKHISTPAPHD  478



>ref|XP_009358942.1| PREDICTED: uncharacterized protein LOC103949552 [Pyrus x bretschneideri]
Length=1404

 Score = 93.2 bits (230),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 49/75 (65%), Positives = 55/75 (73%), Gaps = 4/75 (5%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGR----TPEQLLVKQT  48
            LPTP G  EH A+YV+ER LKLL FQLS TANP++GNN   S  GR    +PE L VKQ 
Sbjct  409  LPTPSGSREHNAVYVIERELKLLNFQLSQTANPSLGNNASLSEAGRLRGESPETLHVKQI  468

Query  47   KKKITTPVPHDSYSV  3
            KK I+TPVPHDSYSV
Sbjct  469  KKHISTPVPHDSYSV  483



>ref|XP_009420899.1| PREDICTED: uncharacterized protein LOC104000536 [Musa acuminata 
subsp. malaccensis]
Length=1394

 Score = 92.8 bits (229),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 46/74 (62%), Positives = 57/74 (77%), Gaps = 3/74 (4%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGRT---PEQLLVKQTK  45
            LPTP GG EH+A+Y VER LKLL FQL+NT N ++G+ G  S TG++    EQLLVKQTK
Sbjct  449  LPTPPGGREHSAVYTVERELKLLNFQLTNTTNTSLGSTGTISETGKSRMETEQLLVKQTK  508

Query  44   KKITTPVPHDSYSV  3
            K I+TP PHDS+S+
Sbjct  509  KHISTPAPHDSFSI  522



>ref|XP_008673286.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
Length=1229

 Score = 92.4 bits (228),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 46/71 (65%), Positives = 56/71 (79%), Gaps = 4/71 (6%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGRTP----EQLLVKQT  48
            LPTP G  EH+A+Y+VER LKLL FQLSNTANP++GN G+ S+ GR+     EQL+VKQT
Sbjct  258  LPTPTGNKEHSAVYIVERELKLLNFQLSNTANPSLGNAGVASDAGRSMNNSIEQLIVKQT  317

Query  47   KKKITTPVPHD  15
            KK I+TP PHD
Sbjct  318  KKHISTPAPHD  328



>gb|KHN20819.1| hypothetical protein glysoja_050200 [Glycine soja]
Length=282

 Score = 88.2 bits (217),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 44/71 (62%), Positives = 52/71 (73%), Gaps = 4/71 (6%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGRTP----EQLLVKQT  48
            LPTP    EH+AI+V+ER LKLL FQL+N+ANP++GNN   S TGR      E LLVKQ 
Sbjct  200  LPTPSDSREHSAIFVIERELKLLNFQLNNSANPSLGNNSSLSETGRPKGDFFEPLLVKQG  259

Query  47   KKKITTPVPHD  15
            KK I+TPVPHD
Sbjct  260  KKHISTPVPHD  270



>ref|XP_008657818.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103637390 
[Zea mays]
Length=1317

 Score = 91.3 bits (225),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 44/71 (62%), Positives = 55/71 (77%), Gaps = 4/71 (6%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGRTP----EQLLVKQT  48
            LPTP G  EH+A+Y+VER LKLL FQLSNTANP++GN G+ S+ GR+     EQL+V Q+
Sbjct  408  LPTPTGSKEHSAVYIVERELKLLNFQLSNTANPSLGNAGVASDAGRSRNDSLEQLIVNQS  467

Query  47   KKKITTPVPHD  15
            KK I+TP PHD
Sbjct  468  KKHISTPAPHD  478



>ref|XP_009405577.1| PREDICTED: uncharacterized protein LOC103988692 [Musa acuminata 
subsp. malaccensis]
Length=1282

 Score = 90.9 bits (224),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 47/70 (67%), Positives = 54/70 (77%), Gaps = 3/70 (4%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGRT---PEQLLVKQTK  45
            L TP G  EH+A+YVVER LKLL FQLSNTANP++G+ G  S TGR+    EQLLVKQTK
Sbjct  409  LATPPGSREHSAVYVVERELKLLNFQLSNTANPSLGSTGTISETGRSRTETEQLLVKQTK  468

Query  44   KKITTPVPHD  15
            K I+TP PHD
Sbjct  469  KHISTPAPHD  478



>ref|XP_008235875.1| PREDICTED: uncharacterized protein LOC103334677 [Prunus mume]
Length=1384

 Score = 90.9 bits (224),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 48/71 (68%), Positives = 54/71 (76%), Gaps = 2/71 (3%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGRTPEQLLVKQTKKKI  36
            LPTP G  EH A+YV+ER LKLL FQLS TANP++GNN   S  G +PE L VKQ KK I
Sbjct  409  LPTPSGSREHNAVYVIERELKLLNFQLSQTANPSLGNN--TSLRGDSPETLHVKQIKKHI  466

Query  35   TTPVPHDSYSV  3
            +TPVPHDSYSV
Sbjct  467  STPVPHDSYSV  477



>ref|XP_007200336.1| hypothetical protein PRUPE_ppa000254mg [Prunus persica]
 gb|EMJ01535.1| hypothetical protein PRUPE_ppa000254mg [Prunus persica]
Length=1384

 Score = 90.9 bits (224),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 48/71 (68%), Positives = 54/71 (76%), Gaps = 2/71 (3%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGRTPEQLLVKQTKKKI  36
            LPTP G  EH A+YV+ER LKLL FQLS TANP++GNN   S  G +PE L VKQ KK I
Sbjct  409  LPTPSGSREHNAVYVIERELKLLNFQLSQTANPSLGNN--TSLRGDSPETLHVKQIKKHI  466

Query  35   TTPVPHDSYSV  3
            +TPVPHDSYSV
Sbjct  467  STPVPHDSYSV  477



>ref|NP_001043744.1| Os01g0653800 [Oryza sativa Japonica Group]
 dbj|BAD68693.1| WD-40 repeat family protein-like [Oryza sativa Japonica Group]
 dbj|BAF05658.1| Os01g0653800 [Oryza sativa Japonica Group]
 gb|EEC71196.1| hypothetical protein OsI_03104 [Oryza sativa Indica Group]
Length=1377

 Score = 90.5 bits (223),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 46/71 (65%), Positives = 55/71 (77%), Gaps = 4/71 (6%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGRTP----EQLLVKQT  48
            LPTP    EH+A+Y+VER LKLL FQLSNTANP++GN G+ S TGR+     EQL+VKQT
Sbjct  409  LPTPAESKEHSAVYIVERELKLLNFQLSNTANPSLGNAGVTSETGRSRNDPLEQLVVKQT  468

Query  47   KKKITTPVPHD  15
            KK I+TP PHD
Sbjct  469  KKHISTPAPHD  479



>ref|XP_008798429.1| PREDICTED: uncharacterized protein LOC103713325 [Phoenix dactylifera]
Length=1300

 Score = 90.5 bits (223),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 46/71 (65%), Positives = 55/71 (77%), Gaps = 4/71 (6%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGR----TPEQLLVKQT  48
            LPTP G  EH+A+Y+VER LKLL FQLS+TANP++G++G  S TGR    + EQLLVKQT
Sbjct  409  LPTPPGSREHSAVYIVERELKLLNFQLSSTANPSLGSSGSISETGRSRAESTEQLLVKQT  468

Query  47   KKKITTPVPHD  15
            KK I TP PHD
Sbjct  469  KKHINTPAPHD  479



>gb|EEE55099.1| hypothetical protein OsJ_02855 [Oryza sativa Japonica Group]
Length=1377

 Score = 90.5 bits (223),  Expect = 8e-19, Method: Composition-based stats.
 Identities = 46/71 (65%), Positives = 55/71 (77%), Gaps = 4/71 (6%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGRTP----EQLLVKQT  48
            LPTP    EH+A+Y+VER LKLL FQLSNTANP++GN G+ S TGR+     EQL+VKQT
Sbjct  409  LPTPAESKEHSAVYIVERELKLLNFQLSNTANPSLGNAGVTSETGRSRNDPLEQLVVKQT  468

Query  47   KKKITTPVPHD  15
            KK I+TP PHD
Sbjct  469  KKHISTPAPHD  479



>gb|EYU33240.1| hypothetical protein MIMGU_mgv1a000222mg [Erythranthe guttata]
Length=1413

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 51/66 (77%), Gaps = 4/66 (6%)
 Frame = -3

Query  200  GGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGR----TPEQLLVKQTKKKIT  33
            G  EH A+YVVERGL LL+FQLSNT NPA+G+NG  ++ GR    TPEQL VKQ KK+I 
Sbjct  448  GNREHAAVYVVERGLNLLQFQLSNTTNPALGSNGSLNDAGRIRGDTPEQLHVKQIKKRIN  507

Query  32   TPVPHD  15
            TPVPHD
Sbjct  508  TPVPHD  513



>ref|XP_010913344.1| PREDICTED: uncharacterized protein LOC105039060 [Elaeis guineensis]
Length=1300

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 45/71 (63%), Positives = 53/71 (75%), Gaps = 4/71 (6%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGR----TPEQLLVKQT  48
            LPTP G  EH+A+Y+VER LKLL FQLS+TANP++G+ G  S TGR    + EQLLVKQT
Sbjct  409  LPTPPGSREHSAVYIVERELKLLNFQLSSTANPSLGSTGSISETGRSRAESAEQLLVKQT  468

Query  47   KKKITTPVPHD  15
            KK   TP PHD
Sbjct  469  KKHFNTPAPHD  479



>ref|XP_009342400.1| PREDICTED: uncharacterized protein LOC103934376 [Pyrus x bretschneideri]
Length=1400

 Score = 89.4 bits (220),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 48/75 (64%), Positives = 53/75 (71%), Gaps = 4/75 (5%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGR----TPEQLLVKQT  48
            LPTP G  EH A+YV+ER LKLL FQLS TANP++GNN   S  GR     PE L VKQ 
Sbjct  409  LPTPSGSREHNAVYVIERELKLLNFQLSQTANPSLGNNASLSEAGRLRGELPEMLNVKQI  468

Query  47   KKKITTPVPHDSYSV  3
            KK I+T VPHDSYSV
Sbjct  469  KKHISTTVPHDSYSV  483



>gb|KDO46912.1| hypothetical protein CISIN_1g000685mg [Citrus sinensis]
Length=1081

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 42/71 (59%), Positives = 53/71 (75%), Gaps = 4/71 (6%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGR----TPEQLLVKQT  48
            LPTP G  +H+A+Y+VER LKL+ FQLS+ ANP++GNNG  S TGR     P+ L +KQ 
Sbjct  409  LPTPSGSRDHSAVYIVERELKLVNFQLSSAANPSLGNNGSLSETGRLKGDLPDALQIKQI  468

Query  47   KKKITTPVPHD  15
            KK I+TPVPHD
Sbjct  469  KKHISTPVPHD  479



>emb|CBI31125.3| unnamed protein product [Vitis vinifera]
Length=1340

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 46/71 (65%), Positives = 55/71 (77%), Gaps = 4/71 (6%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGR----TPEQLLVKQT  48
            LPTP+G  EH+A+YVVER LKLL FQLS+TANP++G+NG  S TGR    + E L VKQ 
Sbjct  409  LPTPVGSREHSAVYVVERELKLLNFQLSSTANPSLGSNGSLSETGRFRGDSLEPLHVKQI  468

Query  47   KKKITTPVPHD  15
            KK I+TPVPHD
Sbjct  469  KKHISTPVPHD  479



>ref|XP_002521175.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF41206.1| conserved hypothetical protein [Ricinus communis]
Length=1330

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 54/71 (76%), Gaps = 4/71 (6%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGR----TPEQLLVKQT  48
            LPTP G  EH+A+YVVER LKLL FQLSNTAN ++G+NG  S TG+    + E LLVKQ 
Sbjct  408  LPTPSGNREHSAVYVVERELKLLNFQLSNTANLSLGSNGSLSETGKYKGDSSEPLLVKQI  467

Query  47   KKKITTPVPHD  15
            KK I+TPVPHD
Sbjct  468  KKHISTPVPHD  478



>ref|XP_002263744.1| PREDICTED: uncharacterized protein LOC100248418 [Vitis vinifera]
Length=1296

 Score = 89.0 bits (219),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 46/71 (65%), Positives = 55/71 (77%), Gaps = 4/71 (6%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGR----TPEQLLVKQT  48
            LPTP+G  EH+A+YVVER LKLL FQLS+TANP++G+NG  S TGR    + E L VKQ 
Sbjct  409  LPTPVGSREHSAVYVVERELKLLNFQLSSTANPSLGSNGSLSETGRFRGDSLEPLHVKQI  468

Query  47   KKKITTPVPHD  15
            KK I+TPVPHD
Sbjct  469  KKHISTPVPHD  479



>ref|XP_011019918.1| PREDICTED: uncharacterized protein LOC105122493 [Populus euphratica]
Length=1335

 Score = 89.0 bits (219),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 46/71 (65%), Positives = 54/71 (76%), Gaps = 4/71 (6%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGR----TPEQLLVKQT  48
            +PTP G  EH+AIYVVER LKLL FQLSNTANP++G+NG  S TG+    + E L VKQ 
Sbjct  410  IPTPTGNREHSAIYVVERELKLLNFQLSNTANPSLGSNGSLSETGKYRGDSAEPLHVKQM  469

Query  47   KKKITTPVPHD  15
            KK I+TPVPHD
Sbjct  470  KKHISTPVPHD  480



>ref|XP_010541522.1| PREDICTED: uncharacterized protein LOC104814960 [Tarenaya hassleriana]
 ref|XP_010541523.1| PREDICTED: uncharacterized protein LOC104814960 [Tarenaya hassleriana]
Length=1322

 Score = 89.0 bits (219),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 42/71 (59%), Positives = 54/71 (76%), Gaps = 4/71 (6%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGR----TPEQLLVKQT  48
            LPTP    EH+A+Y++ER LK+L FQLSN+ANP++GNN   + TGR    + E L+VKQT
Sbjct  409  LPTPSESREHSAVYIIERELKMLNFQLSNSANPSLGNNSSLAETGRFKGDSSESLIVKQT  468

Query  47   KKKITTPVPHD  15
            KK I+TPVPHD
Sbjct  469  KKHISTPVPHD  479



>emb|CDP17760.1| unnamed protein product [Coffea canephora]
Length=1353

 Score = 88.6 bits (218),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 45/71 (63%), Positives = 54/71 (76%), Gaps = 4/71 (6%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGR----TPEQLLVKQT  48
            LPT  G  EH A+YV+ER LKL++FQLSNT NPA+G+NG  S+TGR     P+QL VKQ 
Sbjct  409  LPTAPGSREHAAVYVIERELKLVQFQLSNTVNPALGSNGSLSDTGRIRGDAPDQLNVKQI  468

Query  47   KKKITTPVPHD  15
            KK I+TPVPHD
Sbjct  469  KKHISTPVPHD  479



>ref|XP_011092225.1| PREDICTED: uncharacterized protein LOC105172480 [Sesamum indicum]
Length=1354

 Score = 88.2 bits (217),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 47/71 (66%), Positives = 54/71 (76%), Gaps = 4/71 (6%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGR----TPEQLLVKQT  48
            LPT  G  EH A+YVVER LKLL+FQLSNTANPA+G+NG  ++ GR    T EQL VKQ 
Sbjct  409  LPTTPGSREHAAVYVVERELKLLQFQLSNTANPALGSNGSLNDVGRVRGDTVEQLHVKQV  468

Query  47   KKKITTPVPHD  15
            KK I+TPVPHD
Sbjct  469  KKHISTPVPHD  479



>ref|XP_006658273.1| PREDICTED: uncharacterized protein LOC102709386 [Oryza brachyantha]
Length=1384

 Score = 88.2 bits (217),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 44/71 (62%), Positives = 54/71 (76%), Gaps = 4/71 (6%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGRTP----EQLLVKQT  48
            LPTP    EH+A+Y+VER L+LL FQLSNTANP++GN G+ S TGR+     E L+VKQT
Sbjct  415  LPTPAESKEHSAVYIVERELQLLNFQLSNTANPSLGNAGVTSETGRSRNDSVEHLVVKQT  474

Query  47   KKKITTPVPHD  15
            KK I+TP PHD
Sbjct  475  KKHISTPAPHD  485



>ref|XP_002309040.1| WD-40 repeat family protein [Populus trichocarpa]
 gb|EEE92563.1| WD-40 repeat family protein [Populus trichocarpa]
Length=1464

 Score = 87.4 bits (215),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 45/71 (63%), Positives = 53/71 (75%), Gaps = 4/71 (6%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGR----TPEQLLVKQT  48
            +PTP G  EH+AIYVVER LKLL FQLSN ANP++G+NG  S TG+    + E L VKQ 
Sbjct  477  IPTPTGNREHSAIYVVERELKLLNFQLSNAANPSLGSNGSLSETGKYRGDSAEPLHVKQM  536

Query  47   KKKITTPVPHD  15
            KK I+TPVPHD
Sbjct  537  KKHISTPVPHD  547



>gb|KDO46909.1| hypothetical protein CISIN_1g000685mg [Citrus sinensis]
Length=1331

 Score = 86.7 bits (213),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 42/71 (59%), Positives = 53/71 (75%), Gaps = 4/71 (6%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGR----TPEQLLVKQT  48
            LPTP G  +H+A+Y+VER LKL+ FQLS+ ANP++GNNG  S TGR     P+ L +KQ 
Sbjct  409  LPTPSGSRDHSAVYIVERELKLVNFQLSSAANPSLGNNGSLSETGRLKGDLPDALQIKQI  468

Query  47   KKKITTPVPHD  15
            KK I+TPVPHD
Sbjct  469  KKHISTPVPHD  479



>ref|XP_006441965.1| hypothetical protein CICLE_v10018511mg [Citrus clementina]
 gb|ESR55205.1| hypothetical protein CICLE_v10018511mg [Citrus clementina]
Length=1390

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 42/71 (59%), Positives = 53/71 (75%), Gaps = 4/71 (6%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGR----TPEQLLVKQT  48
            LPTP G  +H+A+Y+VER LKL+ FQLS+ ANP++GNNG  S TGR     P+ L +KQ 
Sbjct  447  LPTPSGSRDHSAVYIVERELKLVNFQLSSAANPSLGNNGSLSETGRLKGDLPDALQIKQI  506

Query  47   KKKITTPVPHD  15
            KK I+TPVPHD
Sbjct  507  KKHISTPVPHD  517



>gb|KDO46910.1| hypothetical protein CISIN_1g000685mg [Citrus sinensis]
Length=1339

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 42/71 (59%), Positives = 53/71 (75%), Gaps = 4/71 (6%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGR----TPEQLLVKQT  48
            LPTP G  +H+A+Y+VER LKL+ FQLS+ ANP++GNNG  S TGR     P+ L +KQ 
Sbjct  409  LPTPSGSRDHSAVYIVERELKLVNFQLSSAANPSLGNNGSLSETGRLKGDLPDALQIKQI  468

Query  47   KKKITTPVPHD  15
            KK I+TPVPHD
Sbjct  469  KKHISTPVPHD  479



>ref|XP_008791406.1| PREDICTED: uncharacterized protein LOC103708316 isoform X1 [Phoenix 
dactylifera]
Length=1288

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 45/71 (63%), Positives = 52/71 (73%), Gaps = 4/71 (6%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGRTP----EQLLVKQT  48
            LPTP G  EH+A+Y+VER LKLL FQLSNTAN ++G     S TGR+     EQLLVKQT
Sbjct  409  LPTPPGSREHSAVYIVERELKLLNFQLSNTANLSLGGTSSISETGRSRAESMEQLLVKQT  468

Query  47   KKKITTPVPHD  15
            KK I+TP PHD
Sbjct  469  KKHISTPAPHD  479



>gb|KDO46911.1| hypothetical protein CISIN_1g000685mg [Citrus sinensis]
Length=1352

 Score = 85.9 bits (211),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 42/71 (59%), Positives = 53/71 (75%), Gaps = 4/71 (6%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGR----TPEQLLVKQT  48
            LPTP G  +H+A+Y+VER LKL+ FQLS+ ANP++GNNG  S TGR     P+ L +KQ 
Sbjct  409  LPTPSGSRDHSAVYIVERELKLVNFQLSSAANPSLGNNGSLSETGRLKGDLPDALQIKQI  468

Query  47   KKKITTPVPHD  15
            KK I+TPVPHD
Sbjct  469  KKHISTPVPHD  479



>ref|XP_006478516.1| PREDICTED: uncharacterized protein LOC102607648 [Citrus sinensis]
Length=1352

 Score = 85.9 bits (211),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 42/71 (59%), Positives = 53/71 (75%), Gaps = 4/71 (6%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGR----TPEQLLVKQT  48
            LPTP G  +H+A+Y+VER LKL+ FQLS+ ANP++GNNG  S TGR     P+ L +KQ 
Sbjct  409  LPTPSGSRDHSAVYIVERELKLVNFQLSSAANPSLGNNGSLSETGRLKGDLPDALQIKQI  468

Query  47   KKKITTPVPHD  15
            KK I+TPVPHD
Sbjct  469  KKHISTPVPHD  479



>ref|XP_006606731.1| PREDICTED: uncharacterized protein LOC100811133 [Glycine max]
Length=377

 Score = 83.2 bits (204),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 41/71 (58%), Positives = 51/71 (72%), Gaps = 4/71 (6%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGRTP----EQLLVKQT  48
            LPTP    EH+AI+V+ER LKLL F+L+N+ANP++GNN   S TGR      E L +KQ 
Sbjct  200  LPTPSDSKEHSAIFVIERELKLLNFRLNNSANPSLGNNSSLSETGRPKGDFFEPLPIKQG  259

Query  47   KKKITTPVPHD  15
            KK I+TPVPHD
Sbjct  260  KKHISTPVPHD  270



>ref|XP_008791407.1| PREDICTED: uncharacterized protein LOC103708316 isoform X2 [Phoenix 
dactylifera]
Length=1137

 Score = 85.5 bits (210),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 45/71 (63%), Positives = 52/71 (73%), Gaps = 4/71 (6%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGRTP----EQLLVKQT  48
            LPTP G  EH+A+Y+VER LKLL FQLSNTAN ++G     S TGR+     EQLLVKQT
Sbjct  258  LPTPPGSREHSAVYIVERELKLLNFQLSNTANLSLGGTSSISETGRSRAESMEQLLVKQT  317

Query  47   KKKITTPVPHD  15
            KK I+TP PHD
Sbjct  318  KKHISTPAPHD  328



>ref|XP_008791408.1| PREDICTED: uncharacterized protein LOC103708316 isoform X3 [Phoenix 
dactylifera]
Length=1091

 Score = 85.1 bits (209),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 45/71 (63%), Positives = 52/71 (73%), Gaps = 4/71 (6%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGRTP----EQLLVKQT  48
            LPTP G  EH+A+Y+VER LKLL FQLSNTAN ++G     S TGR+     EQLLVKQT
Sbjct  212  LPTPPGSREHSAVYIVERELKLLNFQLSNTANLSLGGTSSISETGRSRAESMEQLLVKQT  271

Query  47   KKKITTPVPHD  15
            KK I+TP PHD
Sbjct  272  KKHISTPAPHD  282



>ref|XP_010241186.1| PREDICTED: uncharacterized protein LOC104585868 [Nelumbo nucifera]
Length=1306

 Score = 84.7 bits (208),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 45/71 (63%), Positives = 52/71 (73%), Gaps = 4/71 (6%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGRTP----EQLLVKQT  48
            LPTP G  EH+A+YVVER LKLL FQLSNTANP++G+    S TGR+     E L VKQ 
Sbjct  409  LPTPPGSREHSAVYVVERELKLLSFQLSNTANPSLGSTSTLSETGRSRAESLEPLHVKQI  468

Query  47   KKKITTPVPHD  15
            KK I+TPVPHD
Sbjct  469  KKHISTPVPHD  479



>gb|KDP36340.1| hypothetical protein JCGZ_09760 [Jatropha curcas]
Length=1328

 Score = 84.7 bits (208),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 43/71 (61%), Positives = 53/71 (75%), Gaps = 4/71 (6%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGR----TPEQLLVKQT  48
            LPTP G  EH+A+YVVER LKLL FQLSNT NP++G+NG  S TG+    + E L VKQ 
Sbjct  409  LPTPPGNREHSAVYVVERELKLLNFQLSNTVNPSLGSNGSLSETGKYRGESAEPLHVKQI  468

Query  47   KKKITTPVPHD  15
            ++ I+TPVPHD
Sbjct  469  RQHISTPVPHD  479



>ref|XP_007014609.1| Transducin/WD40 repeat-like superfamily protein isoform 5 [Theobroma 
cacao]
 gb|EOY32228.1| Transducin/WD40 repeat-like superfamily protein isoform 5 [Theobroma 
cacao]
Length=969

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 42/66 (64%), Positives = 49/66 (74%), Gaps = 4/66 (6%)
 Frame = -3

Query  200  GGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGRTP----EQLLVKQTKKKIT  33
            G  EH+A+Y+VER LKLL FQLSNTANP++GNNG  S TG+      E L VKQ KK I+
Sbjct  413  GSREHSAVYIVERELKLLNFQLSNTANPSLGNNGSLSETGKLKGDSFEPLHVKQIKKHIS  472

Query  32   TPVPHD  15
            TPVPHD
Sbjct  473  TPVPHD  478



>ref|XP_007014610.1| Transducin/WD40 repeat-like superfamily protein isoform 6 [Theobroma 
cacao]
 gb|EOY32229.1| Transducin/WD40 repeat-like superfamily protein isoform 6 [Theobroma 
cacao]
Length=973

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 42/66 (64%), Positives = 49/66 (74%), Gaps = 4/66 (6%)
 Frame = -3

Query  200  GGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGRTP----EQLLVKQTKKKIT  33
            G  EH+A+Y+VER LKLL FQLSNTANP++GNNG  S TG+      E L VKQ KK I+
Sbjct  413  GSREHSAVYIVERELKLLNFQLSNTANPSLGNNGSLSETGKLKGDSFEPLHVKQIKKHIS  472

Query  32   TPVPHD  15
            TPVPHD
Sbjct  473  TPVPHD  478



>gb|KHN41320.1| hypothetical protein glysoja_044588 [Glycine soja]
Length=383

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 40/71 (56%), Positives = 51/71 (72%), Gaps = 4/71 (6%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGRTP----EQLLVKQT  48
            LPTP    +H+AI+V+ER LKLL F+L+N+ANP++GNN   S TGR      E L +KQ 
Sbjct  200  LPTPSDSKKHSAIFVIERELKLLNFRLNNSANPSLGNNSSLSETGRPKGDFFEPLPIKQG  259

Query  47   KKKITTPVPHD  15
            KK I+TPVPHD
Sbjct  260  KKHISTPVPHD  270



>ref|XP_007014608.1| Transducin/WD40 repeat-like superfamily protein isoform 4, partial 
[Theobroma cacao]
 gb|EOY32227.1| Transducin/WD40 repeat-like superfamily protein isoform 4, partial 
[Theobroma cacao]
Length=1050

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 50/66 (76%), Gaps = 4/66 (6%)
 Frame = -3

Query  200  GGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGR----TPEQLLVKQTKKKIT  33
            G  EH+A+Y+VER LKLL FQLSNTANP++GNNG  S TG+    + E L VKQ KK I+
Sbjct  195  GSREHSAVYIVERELKLLNFQLSNTANPSLGNNGSLSETGKLKGDSFEPLHVKQIKKHIS  254

Query  32   TPVPHD  15
            TPVPHD
Sbjct  255  TPVPHD  260



>ref|XP_007014605.1| Transducin/WD40 repeat-like superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY32224.1| Transducin/WD40 repeat-like superfamily protein isoform 1 [Theobroma 
cacao]
Length=1259

 Score = 82.0 bits (201),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 42/66 (64%), Positives = 50/66 (76%), Gaps = 4/66 (6%)
 Frame = -3

Query  200  GGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGR----TPEQLLVKQTKKKIT  33
            G  EH+A+Y+VER LKLL FQLSNTANP++GNNG  S TG+    + E L VKQ KK I+
Sbjct  413  GSREHSAVYIVERELKLLNFQLSNTANPSLGNNGSLSETGKLKGDSFEPLHVKQIKKHIS  472

Query  32   TPVPHD  15
            TPVPHD
Sbjct  473  TPVPHD  478



>ref|XP_003521631.1| PREDICTED: uncharacterized protein LOC100777567 [Glycine max]
Length=1352

 Score = 81.6 bits (200),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 43/71 (61%), Positives = 51/71 (72%), Gaps = 4/71 (6%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGRTP----EQLLVKQT  48
            LPTP    EH+AI+V+ER LKLL FQL+N+ANP++GNN   S TGR      E L VKQ 
Sbjct  406  LPTPSDSREHSAIFVIERELKLLNFQLNNSANPSLGNNSSLSETGRPKGDFFEPLPVKQG  465

Query  47   KKKITTPVPHD  15
            KK I+TPVPHD
Sbjct  466  KKHISTPVPHD  476



>gb|ABD32844.1| Peptidase S8 and S53, subtilisin, kexin, sedolisin; WD40-like 
[Medicago truncatula]
Length=936

 Score = 81.3 bits (199),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 41/71 (58%), Positives = 50/71 (70%), Gaps = 4/71 (6%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGRTP----EQLLVKQT  48
            LPTP    EH+A++V+ER LKLL FQL+N+ NP++GNN   S TGR      E L VKQ 
Sbjct  265  LPTPSDSREHSAVFVIERELKLLNFQLNNSVNPSLGNNSSLSETGRPQGDAFEPLPVKQG  324

Query  47   KKKITTPVPHD  15
            KK I+TPVPHD
Sbjct  325  KKHISTPVPHD  335



>gb|KHN14190.1| hypothetical protein glysoja_028588 [Glycine soja]
Length=1306

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 43/71 (61%), Positives = 51/71 (72%), Gaps = 4/71 (6%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGRTP----EQLLVKQT  48
            LPTP    EH+AI+V+ER LKLL FQL+N+ANP++GNN   S TGR      E L VKQ 
Sbjct  406  LPTPSDSREHSAIFVIERELKLLNFQLNNSANPSLGNNSSLSETGRPKGDFFEPLPVKQG  465

Query  47   KKKITTPVPHD  15
            KK I+TPVPHD
Sbjct  466  KKHISTPVPHD  476



>ref|XP_008382760.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103445517 
[Malus domestica]
Length=1934

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 51/72 (71%), Gaps = 3/72 (4%)
 Frame = -3

Query  215   LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPA-IGNNGLPSNTGRTPEQLLVKQTKKK  39
             LPTP G  EH A+YV+ER LKLL FQLS TANP+ +G+       G +PE L VKQ KK 
Sbjct  960   LPTPSGSXEHNAVYVIERELKLLNFQLSQTANPSLVGSRKXLG--GESPETLHVKQIKKH  1017

Query  38    ITTPVPHDSYSV  3
             I+T VPHDSYSV
Sbjct  1018  ISTTVPHDSYSV  1029



>gb|KHN43390.1| hypothetical protein glysoja_001973 [Glycine soja]
Length=1300

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 43/71 (61%), Positives = 51/71 (72%), Gaps = 4/71 (6%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGRTP----EQLLVKQT  48
            LPTP    EH+AI+V+ER LKLL FQL+N+ANP++GNN   S TGR      E L VKQ 
Sbjct  406  LPTPSDSREHSAIFVIERELKLLNFQLNNSANPSLGNNSSLSETGRPKGDFFEPLPVKQG  465

Query  47   KKKITTPVPHD  15
            KK I+TPVPHD
Sbjct  466  KKHISTPVPHD  476



>ref|XP_007014607.1| Transducin/WD40 repeat-like superfamily protein isoform 3 [Theobroma 
cacao]
 gb|EOY32226.1| Transducin/WD40 repeat-like superfamily protein isoform 3 [Theobroma 
cacao]
Length=1351

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 42/66 (64%), Positives = 50/66 (76%), Gaps = 4/66 (6%)
 Frame = -3

Query  200  GGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGR----TPEQLLVKQTKKKIT  33
            G  EH+A+Y+VER LKLL FQLSNTANP++GNNG  S TG+    + E L VKQ KK I+
Sbjct  413  GSREHSAVYIVERELKLLNFQLSNTANPSLGNNGSLSETGKLKGDSFEPLHVKQIKKHIS  472

Query  32   TPVPHD  15
            TPVPHD
Sbjct  473  TPVPHD  478



>ref|XP_007014606.1| Transducin/WD40 repeat-like superfamily protein isoform 2 [Theobroma 
cacao]
 gb|EOY32225.1| Transducin/WD40 repeat-like superfamily protein isoform 2 [Theobroma 
cacao]
Length=1351

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 42/66 (64%), Positives = 50/66 (76%), Gaps = 4/66 (6%)
 Frame = -3

Query  200  GGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGR----TPEQLLVKQTKKKIT  33
            G  EH+A+Y+VER LKLL FQLSNTANP++GNNG  S TG+    + E L VKQ KK I+
Sbjct  413  GSREHSAVYIVERELKLLNFQLSNTANPSLGNNGSLSETGKLKGDSFEPLHVKQIKKHIS  472

Query  32   TPVPHD  15
            TPVPHD
Sbjct  473  TPVPHD  478



>gb|EPS66148.1| hypothetical protein M569_08629, partial [Genlisea aurea]
Length=1199

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 39/63 (62%), Positives = 48/63 (76%), Gaps = 4/63 (6%)
 Frame = -3

Query  191  EHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGR----TPEQLLVKQTKKKITTPV  24
            EH+A+Y+VER LKLL FQLSN  NPA+G+NG  ++ GR    T EQL VKQ K+ I+TPV
Sbjct  420  EHSAVYIVERELKLLHFQLSNVTNPALGSNGSLNDLGRIRGDTAEQLYVKQVKEHISTPV  479

Query  23   PHD  15
            PHD
Sbjct  480  PHD  482



>dbj|BAF02178.1| hypothetical protein [Arabidopsis thaliana]
Length=1161

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 41/71 (58%), Positives = 50/71 (70%), Gaps = 4/71 (6%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGRTP----EQLLVKQT  48
            LP   G  E++AIY++ R LKLL FQLSNTANP++GNN   S +G +     EQL VKQT
Sbjct  409  LPALPGSRENSAIYILGRELKLLNFQLSNTANPSLGNNSALSESGLSKGDPGEQLTVKQT  468

Query  47   KKKITTPVPHD  15
            KK+I  PVPHD
Sbjct  469  KKQIVAPVPHD  479



>ref|XP_003626104.1| hypothetical protein MTR_7g111080 [Medicago truncatula]
Length=1516

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 50/71 (70%), Gaps = 4/71 (6%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGR----TPEQLLVKQT  48
            LPTP    EH+A++V+ER LKLL FQL+N+ NP++GNN   S TGR      E L VKQ 
Sbjct  594  LPTPSDSREHSAVFVIERELKLLNFQLNNSVNPSLGNNSSLSETGRPQGDAFEPLPVKQG  653

Query  47   KKKITTPVPHD  15
            KK I+TPVPHD
Sbjct  654  KKHISTPVPHD  664



>gb|AES82322.2| transducin/WD40 repeat protein [Medicago truncatula]
Length=1329

 Score = 79.0 bits (193),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 41/71 (58%), Positives = 50/71 (70%), Gaps = 4/71 (6%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGRTP----EQLLVKQT  48
            LPTP    EH+A++V+ER LKLL FQL+N+ NP++GNN   S TGR      E L VKQ 
Sbjct  407  LPTPSDSREHSAVFVIERELKLLNFQLNNSVNPSLGNNSSLSETGRPQGDAFEPLPVKQG  466

Query  47   KKKITTPVPHD  15
            KK I+TPVPHD
Sbjct  467  KKHISTPVPHD  477



>dbj|BAB09653.1| unnamed protein product [Arabidopsis thaliana]
Length=1003

 Score = 78.6 bits (192),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 50/71 (70%), Gaps = 4/71 (6%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGRTP----EQLLVKQT  48
            LP   G  E++AIY++ R LKLL FQLSNTANP++GNN   S +G +     EQL VKQT
Sbjct  35   LPALPGSRENSAIYILGRELKLLNFQLSNTANPSLGNNSALSESGLSKGDPGEQLTVKQT  94

Query  47   KKKITTPVPHD  15
            KK+I  PVPHD
Sbjct  95   KKQIVAPVPHD  105



>ref|XP_010673184.1| PREDICTED: uncharacterized protein LOC104889623 [Beta vulgaris 
subsp. vulgaris]
Length=1406

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 51/70 (73%), Gaps = 3/70 (4%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGRT---PEQLLVKQTK  45
            LP+P G  EH+A+YVVER LK+  FQLSNTAN ++G+NG  + + R+    E L VKQ K
Sbjct  409  LPSPPGNREHSAVYVVERELKVSTFQLSNTANQSLGSNGSLTESARSKVDSEALQVKQIK  468

Query  44   KKITTPVPHD  15
            K ++TPVPHD
Sbjct  469  KPVSTPVPHD  478



>ref|XP_010495460.1| PREDICTED: uncharacterized protein LOC104772557 [Camelina sativa]
Length=900

 Score = 77.0 bits (188),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 40/71 (56%), Positives = 49/71 (69%), Gaps = 4/71 (6%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGRTP----EQLLVKQT  48
            LP   G  E++AIY++ R LKLL FQLSN+ANP +GNN   S +G +     EQL VKQT
Sbjct  409  LPALPGSRENSAIYILGRELKLLNFQLSNSANPTLGNNSALSESGVSKGDPGEQLTVKQT  468

Query  47   KKKITTPVPHD  15
            KK+I  PVPHD
Sbjct  469  KKQIVAPVPHD  479



>ref|XP_006394724.1| hypothetical protein EUTSA_v10003520mg [Eutrema salsugineum]
 gb|ESQ32010.1| hypothetical protein EUTSA_v10003520mg [Eutrema salsugineum]
Length=1369

 Score = 77.0 bits (188),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 39/71 (55%), Positives = 51/71 (72%), Gaps = 4/71 (6%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGRTP----EQLLVKQT  48
            LP   G  E++A+Y++ R LKLL FQLSN+ANP++GNNG  + +G +     EQL VKQT
Sbjct  409  LPALSGSRENSAVYILGRELKLLNFQLSNSANPSLGNNGALAESGMSKGDPGEQLTVKQT  468

Query  47   KKKITTPVPHD  15
            KK+I  PVPHD
Sbjct  469  KKQIVAPVPHD  479



>ref|XP_007163270.1| hypothetical protein PHAVU_001G220300g [Phaseolus vulgaris]
 gb|ESW35264.1| hypothetical protein PHAVU_001G220300g [Phaseolus vulgaris]
Length=1342

 Score = 77.0 bits (188),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 41/71 (58%), Positives = 50/71 (70%), Gaps = 4/71 (6%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGRTP----EQLLVKQT  48
            L TP    EH+A++V+ER LKLL FQL+N+ANP++GNN   S TGR      E L VKQ 
Sbjct  407  LLTPADSREHSAVFVIERELKLLNFQLNNSANPSLGNNSSLSETGRPKGDFFEPLPVKQG  466

Query  47   KKKITTPVPHD  15
            KK I+TPVPHD
Sbjct  467  KKHISTPVPHD  477



>dbj|BAF01929.1| hypothetical protein [Arabidopsis thaliana]
Length=1377

 Score = 77.0 bits (188),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 41/71 (58%), Positives = 50/71 (70%), Gaps = 4/71 (6%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGRTP----EQLLVKQT  48
            LP   G  E++AIY++ R LKLL FQLSNTANP++GNN   S +G +     EQL VKQT
Sbjct  409  LPALPGSRENSAIYILGRELKLLNFQLSNTANPSLGNNSALSESGLSKGDPGEQLTVKQT  468

Query  47   KKKITTPVPHD  15
            KK+I  PVPHD
Sbjct  469  KKQIVAPVPHD  479



>ref|NP_197859.4| WD40 domain-containing protein [Arabidopsis thaliana]
 gb|AED93351.1| WD40 domain-containing protein [Arabidopsis thaliana]
Length=1377

 Score = 77.0 bits (188),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 41/71 (58%), Positives = 50/71 (70%), Gaps = 4/71 (6%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGRTP----EQLLVKQT  48
            LP   G  E++AIY++ R LKLL FQLSNTANP++GNN   S +G +     EQL VKQT
Sbjct  409  LPALPGSRENSAIYILGRELKLLNFQLSNTANPSLGNNSALSESGLSKGDPGEQLTVKQT  468

Query  47   KKKITTPVPHD  15
            KK+I  PVPHD
Sbjct  469  KKQIVAPVPHD  479



>emb|CDX88129.1| BnaA06g27200D [Brassica napus]
Length=1730

 Score = 76.3 bits (186),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 39/71 (55%), Positives = 50/71 (70%), Gaps = 4/71 (6%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGR----TPEQLLVKQT  48
            LP   G  E++A+Y++ R LKLL FQ+SNTANP++GNN   S +G     + EQL VKQT
Sbjct  261  LPALSGSRENSAVYILGRELKLLNFQISNTANPSLGNNSALSESGMAKGDSGEQLTVKQT  320

Query  47   KKKITTPVPHD  15
            KK+I  PVPHD
Sbjct  321  KKQIVAPVPHD  331



>ref|XP_004290117.1| PREDICTED: uncharacterized protein LOC101292072 [Fragaria vesca 
subsp. vesca]
Length=1408

 Score = 75.9 bits (185),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 41/67 (61%), Positives = 48/67 (72%), Gaps = 2/67 (3%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGRTPEQLLVKQTKKKI  36
            L TP G  EH+A+YV+ER LKL+ FQLS TANP +GNN   S  G + E L VKQ KK I
Sbjct  409  LLTPSGSREHSAVYVIERELKLINFQLSQTANPTLGNNA--SLRGDSLETLHVKQIKKHI  466

Query  35   TTPVPHD  15
            +TPVPHD
Sbjct  467  STPVPHD  473



>dbj|BAJ95941.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1368

 Score = 75.9 bits (185),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 41/71 (58%), Positives = 51/71 (72%), Gaps = 7/71 (10%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGR----TPEQLLVKQT  48
            LP      EH+A+Y+VER LKLL FQLSNTANP++G+    S TGR    T +QL+VKQ+
Sbjct  409  LPALTESKEHSAVYIVERELKLLNFQLSNTANPSLGS---ASETGRSRNETIDQLIVKQS  465

Query  47   KKKITTPVPHD  15
            KK I+TP PHD
Sbjct  466  KKHISTPAPHD  476



>ref|XP_009150997.1| PREDICTED: uncharacterized protein LOC103874342 [Brassica rapa]
Length=1371

 Score = 75.9 bits (185),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 39/71 (55%), Positives = 50/71 (70%), Gaps = 4/71 (6%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGR----TPEQLLVKQT  48
            LP   G  E++A+Y++ R LKLL FQ+SNTANP++GNN   S +G     + EQL VKQT
Sbjct  409  LPALSGSRENSAVYILGRELKLLNFQISNTANPSLGNNSALSESGMAKGDSGEQLTVKQT  468

Query  47   KKKITTPVPHD  15
            KK+I  PVPHD
Sbjct  469  KKQIVAPVPHD  479



>ref|XP_006849192.1| hypothetical protein AMTR_s00027p00213280 [Amborella trichopoda]
 gb|ERN10773.1| hypothetical protein AMTR_s00027p00213280 [Amborella trichopoda]
Length=1275

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 41/75 (55%), Positives = 51/75 (68%), Gaps = 4/75 (5%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGRTP----EQLLVKQT  48
            LPTP G  EH+A++VVER L+ L FQLS  A+P++G+ G    T R+     E L VKQT
Sbjct  409  LPTPPGNREHSAVFVVERELRQLSFQLSAPASPSLGSTGSLPETERSRAESIEPLPVKQT  468

Query  47   KKKITTPVPHDSYSV  3
            KK +  PVPHDSYSV
Sbjct  469  KKHLGAPVPHDSYSV  483



>ref|XP_002874217.1| hypothetical protein ARALYDRAFT_489332 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50476.1| hypothetical protein ARALYDRAFT_489332 [Arabidopsis lyrata subsp. 
lyrata]
Length=1376

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 40/71 (56%), Positives = 50/71 (70%), Gaps = 4/71 (6%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGRTP----EQLLVKQT  48
            LP   G  E++AIY++ R LKLL FQLSN+ANP++GNN   S +G +     EQL VKQT
Sbjct  409  LPALPGSRENSAIYILGRELKLLNFQLSNSANPSLGNNSALSESGLSKGDPGEQLTVKQT  468

Query  47   KKKITTPVPHD  15
            KK+I  PVPHD
Sbjct  469  KKQIVAPVPHD  479



>ref|XP_010421309.1| PREDICTED: uncharacterized protein LOC104706783 isoform X2 [Camelina 
sativa]
Length=1364

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 40/71 (56%), Positives = 49/71 (69%), Gaps = 4/71 (6%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGRTP----EQLLVKQT  48
            LP   G  E++AIY++ R LKLL FQLSN+ANP +GNN   S +G +     EQL VKQT
Sbjct  409  LPALPGSRENSAIYILGRELKLLNFQLSNSANPTLGNNSALSESGVSKGDPGEQLTVKQT  468

Query  47   KKKITTPVPHD  15
            KK+I  PVPHD
Sbjct  469  KKQIVAPVPHD  479



>ref|XP_010454796.1| PREDICTED: uncharacterized protein LOC104736495 [Camelina sativa]
Length=1375

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 40/71 (56%), Positives = 49/71 (69%), Gaps = 4/71 (6%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGRTP----EQLLVKQT  48
            LP   G  E++AIY++ R LKLL FQLSN+ANP +GNN   S +G +     EQL VKQT
Sbjct  409  LPALPGSRENSAIYILGRELKLLNFQLSNSANPTLGNNSALSESGVSKGDPGEQLTVKQT  468

Query  47   KKKITTPVPHD  15
            KK+I  PVPHD
Sbjct  469  KKQIVAPVPHD  479



>ref|XP_010421308.1| PREDICTED: uncharacterized protein LOC104706783 isoform X1 [Camelina 
sativa]
Length=1213

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 40/71 (56%), Positives = 49/71 (69%), Gaps = 4/71 (6%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGRTP----EQLLVKQT  48
            LP   G  E++AIY++ R LKLL FQLSN+ANP +GNN   S +G +     EQL VKQT
Sbjct  258  LPALPGSRENSAIYILGRELKLLNFQLSNSANPTLGNNSALSESGVSKGDPGEQLTVKQT  317

Query  47   KKKITTPVPHD  15
            KK+I  PVPHD
Sbjct  318  KKQIVAPVPHD  328



>dbj|BAJ99483.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1042

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 41/71 (58%), Positives = 51/71 (72%), Gaps = 7/71 (10%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGR----TPEQLLVKQT  48
            LP      EH+A+Y+VER LKLL FQLSNTANP++G+    S TGR    T +QL+VKQ+
Sbjct  83   LPALTESKEHSAVYIVERELKLLNFQLSNTANPSLGS---ASETGRSRNETIDQLIVKQS  139

Query  47   KKKITTPVPHD  15
            KK I+TP PHD
Sbjct  140  KKHISTPAPHD  150



>ref|XP_010232091.1| PREDICTED: uncharacterized protein LOC100836556 [Brachypodium 
distachyon]
Length=1381

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 41/71 (58%), Positives = 50/71 (70%), Gaps = 7/71 (10%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGRTP----EQLLVKQT  48
            LP      EH+A+Y+VER LKLL FQLSNTAN ++G+    S TGR+     EQL+VKQT
Sbjct  409  LPALTESKEHSAVYIVERELKLLNFQLSNTANASLGS---ASETGRSRNESIEQLIVKQT  465

Query  47   KKKITTPVPHD  15
            KK I+TP PHD
Sbjct  466  KKHISTPAPHD  476



>gb|EMS55149.1| hypothetical protein TRIUR3_19246 [Triticum urartu]
Length=1352

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 39/71 (55%), Positives = 50/71 (70%), Gaps = 7/71 (10%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGRTP----EQLLVKQT  48
            LP      EH+A+Y+VER LKLL FQLSNTANP++G+    S  GR+     +QL+VKQ+
Sbjct  326  LPALTESKEHSAVYIVERELKLLNFQLSNTANPSLGS---ASEAGRSRSESIDQLIVKQS  382

Query  47   KKKITTPVPHD  15
            KK I+TP PHD
Sbjct  383  KKHISTPAPHD  393



>ref|XP_004494493.1| PREDICTED: uncharacterized protein LOC101494449 [Cicer arietinum]
Length=1329

 Score = 73.2 bits (178),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 49/71 (69%), Gaps = 4/71 (6%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGR----TPEQLLVKQT  48
            L TP    EH+A++V+ER LKLL FQL+N+ NP++GNN     TGR    + E L VKQ 
Sbjct  407  LLTPPDSREHSAVFVIERELKLLNFQLNNSVNPSLGNNSSLLETGRPTGYSFEPLPVKQG  466

Query  47   KKKITTPVPHD  15
            KK I+TPVPHD
Sbjct  467  KKHISTPVPHD  477



>emb|CDM83562.1| unnamed protein product [Triticum aestivum]
Length=1360

 Score = 73.2 bits (178),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 39/71 (55%), Positives = 50/71 (70%), Gaps = 7/71 (10%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGRTP----EQLLVKQT  48
            LP      EH+A+Y+VER LKLL FQ SNTANP++G+    S TGR+     +QL+VKQ+
Sbjct  409  LPALTESKEHSAVYIVERELKLLNFQFSNTANPSLGS---ASETGRSRNESIDQLIVKQS  465

Query  47   KKKITTPVPHD  15
            KK I+TP PHD
Sbjct  466  KKHISTPAPHD  476



>gb|EMT09929.1| hypothetical protein F775_29330 [Aegilops tauschii]
Length=1253

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 39/71 (55%), Positives = 50/71 (70%), Gaps = 7/71 (10%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGRTP----EQLLVKQT  48
            LP      EH+A+Y+VER LKLL FQLSNTANP++G+    S  GR+     +QL+VKQ+
Sbjct  326  LPALTESKEHSAVYIVERELKLLNFQLSNTANPSLGS---ASEAGRSRSESIDQLIVKQS  382

Query  47   KKKITTPVPHD  15
            KK I+TP PHD
Sbjct  383  KKHISTPAPHD  393



>emb|CDX87116.1| BnaC09g04310D [Brassica napus]
Length=1375

 Score = 70.9 bits (172),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 39/71 (55%), Positives = 49/71 (69%), Gaps = 5/71 (7%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGRTP----EQLLVKQT  48
            LP   G  E++A+Y++ R LKLL FQ+SNTANP++GNN L S +G +     EQL VKQT
Sbjct  409  LPALSGSRENSAVYILGRELKLLNFQISNTANPSLGNNAL-SESGVSKLDAGEQLTVKQT  467

Query  47   KKKITTPVPHD  15
            KKK    VPHD
Sbjct  468  KKKSVASVPHD  478



>emb|CDY19826.1| BnaA09g04790D [Brassica napus]
Length=1239

 Score = 70.9 bits (172),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 38/71 (54%), Positives = 49/71 (69%), Gaps = 5/71 (7%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGRTP----EQLLVKQT  48
            LP   G  +++A+Y++ R LKLL FQ+SNTANP++GNN L S +G +     EQL VKQT
Sbjct  409  LPALSGSRDNSAVYILGRELKLLNFQISNTANPSLGNNAL-SESGMSKLDAGEQLTVKQT  467

Query  47   KKKITTPVPHD  15
            KKK    VPHD
Sbjct  468  KKKGVATVPHD  478



>ref|XP_006286796.1| hypothetical protein CARUB_v10003471mg [Capsella rubella]
 gb|EOA19694.1| hypothetical protein CARUB_v10003471mg [Capsella rubella]
Length=1371

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 38/71 (54%), Positives = 46/71 (65%), Gaps = 4/71 (6%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGRTP----EQLLVKQT  48
            LP   G  E++AIY++ R LKLL FQLSN ANP++ NN   S  G +     EQL VKQT
Sbjct  409  LPALSGSRENSAIYILGRELKLLNFQLSNLANPSLANNSALSEPGLSKGDPGEQLNVKQT  468

Query  47   KKKITTPVPHD  15
            KK+I   VPHD
Sbjct  469  KKQIVASVPHD  479



>ref|XP_009111642.1| PREDICTED: uncharacterized protein LOC103837068 [Brassica rapa]
Length=1403

 Score = 67.8 bits (164),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 38/71 (54%), Positives = 47/71 (66%), Gaps = 5/71 (7%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGRTP----EQLLVKQT  48
            LP   G  +++A+Y+  R LKLL FQ+SNTANP +GNN L S +G +     EQL VKQT
Sbjct  409  LPALSGSRDNSAVYIFGRELKLLNFQISNTANPPLGNNAL-SESGMSKLDAGEQLTVKQT  467

Query  47   KKKITTPVPHD  15
            KKK    VPHD
Sbjct  468  KKKGVATVPHD  478



>ref|XP_010038005.1| PREDICTED: uncharacterized protein LOC104426595 [Eucalyptus grandis]
Length=1375

 Score = 67.8 bits (164),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 38/63 (60%), Positives = 44/63 (70%), Gaps = 4/63 (6%)
 Frame = -3

Query  191  EHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGR----TPEQLLVKQTKKKITTPV  24
            EH+AIYVVER LKLL FQLS T NP++GNN   S  GR    + E L VKQ KK I+TPV
Sbjct  417  EHSAIYVVERELKLLNFQLSPTGNPSLGNNASLSEAGRLKGESSELLHVKQIKKHISTPV  476

Query  23   PHD  15
             +D
Sbjct  477  QND  479



>gb|KCW84525.1| hypothetical protein EUGRSUZ_B013612, partial [Eucalyptus grandis]
Length=1302

 Score = 67.4 bits (163),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 38/63 (60%), Positives = 44/63 (70%), Gaps = 4/63 (6%)
 Frame = -3

Query  191  EHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGR----TPEQLLVKQTKKKITTPV  24
            EH+AIYVVER LKLL FQLS T NP++GNN   S  GR    + E L VKQ KK I+TPV
Sbjct  344  EHSAIYVVERELKLLNFQLSPTGNPSLGNNASLSEAGRLKGESSELLHVKQIKKHISTPV  403

Query  23   PHD  15
             +D
Sbjct  404  QND  406



>gb|KHG04190.1| Transcription initiation factor TFIID subunit 5 [Gossypium arboreum]
Length=368

 Score = 60.8 bits (146),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -3

Query  200  GGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGR  78
            G  EH+A+Y+VER LKLL FQLSNT NP++GNNG  S TG+
Sbjct  248  GSREHSAVYIVERELKLLNFQLSNTTNPSLGNNGSLSETGK  288



>ref|XP_011087586.1| PREDICTED: uncharacterized protein LOC105169027 [Sesamum indicum]
Length=1382

 Score = 59.3 bits (142),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 42/71 (59%), Positives = 49/71 (69%), Gaps = 5/71 (7%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGR----TPEQLLVKQT  48
            L T  G  EH A+ VV+R LKLL+FQLSNT NPAIG NG  ++ GR    TPEQL +KQ 
Sbjct  409  LLTAPGSREHAAVCVVKRELKLLQFQLSNTPNPAIGGNGSSNDGGRVRGDTPEQLHLKQI  468

Query  47   KKKITTPVPHD  15
            KK I+  VPHD
Sbjct  469  KKHISV-VPHD  478



>gb|KHG22556.1| Nucleoporin Nup43 [Gossypium arboreum]
Length=281

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 40/61 (66%), Gaps = 4/61 (7%)
 Frame = -3

Query  185  TAIYVVERGLKLLKFQLSNTANPAIGNNGLPSNTGR----TPEQLLVKQTKKKITTPVPH  18
            +A+ ++ + LKLL F LSNT +P++GNN   S TG     + E L V QT+K+I  PVPH
Sbjct  198  SAVCILAKELKLLNFHLSNTTDPSLGNNSSLSETGNLKGDSLEPLHVTQTRKRINAPVPH  257

Query  17   D  15
            D
Sbjct  258  D  258



>ref|XP_001757483.1| predicted protein [Physcomitrella patens]
 gb|EDQ77540.1| predicted protein [Physcomitrella patens]
Length=1168

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 32/78 (41%), Positives = 46/78 (59%), Gaps = 10/78 (13%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGN-------NGLPSNTGRTPEQLLV  57
            L TP G  EH+  + VE+ ++LL FQL+   NP + N       NG P N   TPE   +
Sbjct  410  LITPPGSKEHSVAFAVEKEIRLLTFQLAAPTNPTVSNTGVLIELNGRPRN--ETPEAPPM  467

Query  56   KQTKKKITTPVPHDSYSV  3
            +Q++K++T+   HDSYSV
Sbjct  468  QQSRKRVTS-ASHDSYSV  484



>ref|XP_002985192.1| hypothetical protein SELMODRAFT_157186 [Selaginella moellendorffii]
 gb|EFJ13686.1| hypothetical protein SELMODRAFT_157186 [Selaginella moellendorffii]
Length=1180

 Score = 47.4 bits (111),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 27/71 (38%), Positives = 43/71 (61%), Gaps = 10/71 (14%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLP-SNTGRTPEQLLVKQTKKK  39
            LP P G  EH+ +Y  E+ L LL FQLS+ A      +G P ++ G  P+  ++KQ + +
Sbjct  411  LPVP-GSKEHSVVYTAEKDLNLLSFQLSSPA-----TDGRPRTDIGEAPQ--ILKQVRTR  462

Query  38   ITTPVPHDSYS  6
            +  PVPH+++S
Sbjct  463  V-CPVPHETFS  472



>ref|XP_002969859.1| hypothetical protein SELMODRAFT_92496 [Selaginella moellendorffii]
 gb|EFJ28983.1| hypothetical protein SELMODRAFT_92496 [Selaginella moellendorffii]
Length=1180

 Score = 47.0 bits (110),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 27/71 (38%), Positives = 43/71 (61%), Gaps = 10/71 (14%)
 Frame = -3

Query  215  LPTPIGGHEHTAIYVVERGLKLLKFQLSNTANPAIGNNGLP-SNTGRTPEQLLVKQTKKK  39
            LP P G  EH+ +Y  E+ L LL FQLS+ A      +G P ++ G  P+  ++KQ + +
Sbjct  411  LPVP-GTKEHSVVYTAEKDLNLLSFQLSSPA-----TDGRPRTDIGEAPQ--ILKQVRTR  462

Query  38   ITTPVPHDSYS  6
            +  PVPH+++S
Sbjct  463  V-CPVPHETFS  472



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 509447715952