BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c10996_g1_i1 len=939 path=[966:0-443 46:444-938]

Length=939
                                                                      Score     E

ref|XP_009587187.1|  PREDICTED: transcription factor bHLH137            100   1e-20   
emb|CCF72395.1|  bHLH trascription factor                             99.8    2e-20   
emb|CCF72394.1|  bHLH trascription factor                             98.6    2e-20   
ref|XP_009786910.1|  PREDICTED: transcription factor bHLH137          96.7    2e-19   
gb|ABW22630.1|  bHLH transcription factor Upa20                       95.5    4e-19   Capsicum annuum
ref|XP_002284464.1|  PREDICTED: transcription factor bHLH137          92.0    6e-18   Vitis vinifera
ref|XP_006363974.1|  PREDICTED: transcription factor bHLH137-like     91.3    9e-18   
ref|NP_001266190.1|  basic helix-loop-helix                           90.1    2e-17   
ref|XP_010318148.1|  PREDICTED: basic helix-loop-helix isoform X1     90.1    2e-17   
ref|XP_011073133.1|  PREDICTED: transcription factor bHLH137 isof...  85.5    8e-16   
emb|CDO98661.1|  unnamed protein product                              82.8    1e-14   
ref|XP_007038100.1|  Basic helix-loop-helix DNA-binding superfami...  82.0    2e-14   
gb|KDO44050.1|  hypothetical protein CISIN_1g017497mg                 81.3    5e-14   
ref|XP_006436929.1|  hypothetical protein CICLE_v10031873mg           81.3    5e-14   
ref|NP_001275808.1|  putative bHLH transcription factor               81.3    5e-14   
ref|XP_007038102.1|  Basic helix-loop-helix DNA-binding superfami...  81.3    7e-14   
ref|XP_002318764.2|  basic helix-loop-helix family protein            80.1    1e-13   Populus trichocarpa [western balsam poplar]
gb|KHG05669.1|  Transcription factor protein                          79.0    2e-13   
gb|KDP22555.1|  hypothetical protein JCGZ_26386                       77.4    9e-13   
ref|XP_008239542.1|  PREDICTED: transcription factor bHLH137 isof...  77.0    1e-12   
ref|XP_011073134.1|  PREDICTED: transcription factor bHLH137 isof...  75.5    2e-12   
ref|XP_003630566.1|  BHLH transcription factor                        74.3    8e-12   
ref|XP_007209284.1|  hypothetical protein PRUPE_ppa008085mg           73.6    2e-11   
ref|XP_011042945.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...  72.8    4e-11   
ref|XP_009337524.1|  PREDICTED: transcription factor bHLH137          72.4    6e-11   
ref|XP_002322296.2|  basic helix-loop-helix family protein            71.6    9e-11   Populus trichocarpa [western balsam poplar]
gb|EYU32918.1|  hypothetical protein MIMGU_mgv11b022778mg             68.6    1e-10   
gb|KEH35698.1|  transcription factor bHLH137                          70.5    2e-10   
ref|XP_010093954.1|  hypothetical protein L484_008847                 70.5    2e-10   
gb|ACU19194.1|  unknown                                               67.4    3e-10   Glycine max [soybeans]
ref|XP_003526933.2|  PREDICTED: transcription factor bHLH137-like     70.5    3e-10   
ref|XP_003532431.2|  PREDICTED: transcription factor bHLH137-like...  70.1    3e-10   
gb|KHN16873.1|  Transcription factor bHLH137                          70.1    3e-10   
ref|XP_009334315.1|  PREDICTED: transcription factor bHLH137-like     68.2    1e-09   
ref|XP_007137888.1|  hypothetical protein PHAVU_009G164300g           68.2    2e-09   
ref|XP_008392769.1|  PREDICTED: transcription factor bHLH137-like     68.2    2e-09   
ref|XP_004145216.1|  PREDICTED: transcription factor bHLH49-like      65.1    2e-08   
ref|XP_004154003.1|  PREDICTED: uncharacterized protein LOC101205943  65.1    2e-08   
ref|XP_008440060.1|  PREDICTED: transcription factor bHLH137-like     64.7    2e-08   
ref|XP_006580621.1|  PREDICTED: transcription factor bHLH137-like...  64.3    3e-08   
ref|XP_008374189.1|  PREDICTED: transcription factor bHLH137-like     63.9    4e-08   
ref|XP_011083355.1|  PREDICTED: transcription factor bHLH137-like     63.9    4e-08   
ref|XP_008239541.1|  PREDICTED: transcription factor bHLH137 isof...  63.5    6e-08   
ref|XP_006578721.1|  PREDICTED: transcription factor bHLH137-like     62.4    1e-07   
ref|XP_002511110.1|  DNA binding protein, putative                    62.0    2e-07   Ricinus communis
ref|XP_009368786.1|  PREDICTED: transcription factor bHLH137-like     60.1    7e-07   
ref|XP_010536589.1|  PREDICTED: transcription factor bHLH137 isof...  57.8    4e-06   
ref|XP_006584697.1|  PREDICTED: transcription factor bHLH137-like...  57.8    4e-06   
ref|XP_010322508.1|  PREDICTED: transcription factor bHLH137-like     56.2    9e-06   
ref|XP_011002106.1|  PREDICTED: transcription factor bHLH137-like...  55.8    2e-05   
ref|XP_011002104.1|  PREDICTED: transcription factor bHLH137-like...  55.8    2e-05   
ref|XP_011002105.1|  PREDICTED: transcription factor bHLH137-like...  55.5    2e-05   
ref|XP_006347483.1|  PREDICTED: transcription factor bHLH137-like     55.1    2e-05   
gb|KDO44051.1|  hypothetical protein CISIN_1g017497mg                 55.1    3e-05   
ref|XP_006436930.1|  hypothetical protein CICLE_v10031873mg           55.1    3e-05   
ref|XP_006436928.1|  hypothetical protein CICLE_v10031873mg           54.3    4e-05   
ref|XP_004298536.1|  PREDICTED: transcription factor bHLH137-like     53.9    6e-05   
ref|XP_004501739.1|  PREDICTED: transcription factor bHLH137-like     53.5    8e-05   
ref|XP_007038103.1|  DNA binding protein, putative isoform 4          53.1    1e-04   
ref|XP_007159982.1|  hypothetical protein PHAVU_002G283100g           53.1    1e-04   
gb|ACN21645.1|  putative basic helix-loop-helix protein BHLH8         53.1    1e-04   Lotus japonicus



>ref|XP_009587187.1| PREDICTED: transcription factor bHLH137 [Nicotiana tomentosiformis]
Length=357

 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 70/136 (51%), Positives = 84/136 (62%), Gaps = 19/136 (14%)
 Frame = +2

Query  2    FLSMKLASVSPMFYDYGMDLDTLMVRPDQEMNIQRVNGLTLPMPNMQQCNPTTTHTPPAV  181
            FLSMKLAS++PM+YD+GMDLD LMVRPDQ +     +GL  P+PNMQQ +PT   +  A 
Sbjct  241  FLSMKLASLNPMYYDFGMDLDALMVRPDQSL-----SGLGTPLPNMQQASPTNITSQAAE  295

Query  182  VSDANTVLTIPSSPPNCDDFSLLDPSApplfqhpphllnnnlfnqgngqllWGVEDQRQK  361
            V        IP+   N   +  LD SA             N  +QGNGQLLWG +DQRQK
Sbjct  296  V--------IPN--INNSGYPFLDNSA---SLMFQQAHFPNSISQGNGQLLWGADDQRQK  342

Query  362  FINQNGFTSNNLCSFH  409
            FINQ+G  SNN CSFH
Sbjct  343  FINQSGL-SNNFCSFH  357



>emb|CCF72395.1| bHLH trascription factor [Nicotiana occidentalis subsp. hesperis]
Length=362

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 71/136 (52%), Positives = 84/136 (62%), Gaps = 19/136 (14%)
 Frame = +2

Query  2    FLSMKLASVSPMFYDYGMDLDTLMVRPDQEMNIQRVNGLTLPMPNMQQCNPTTTHTPPAV  181
            FLSMKLAS +PM+YD+GMDLDTLMVRPDQ +     +GL  P+PNMQQ +PT   +  A 
Sbjct  246  FLSMKLASSNPMYYDFGMDLDTLMVRPDQSL-----SGLGTPLPNMQQPSPTNITSQAAE  300

Query  182  VSDANTVLTIPSSPPNCDDFSLLDPSApplfqhpphllnnnlfnqgngqllWGVEDQRQK  361
            V        IP+   N   +  LD SA             N  +QGNGQLLWG +DQRQK
Sbjct  301  V--------IPN--INNSGYLFLDNSA---SLMFQQAHFPNSISQGNGQLLWGADDQRQK  347

Query  362  FINQNGFTSNNLCSFH  409
            FINQ+G  SNN CSFH
Sbjct  348  FINQSGL-SNNFCSFH  362



>emb|CCF72394.1| bHLH trascription factor [Nicotiana tabacum]
 emb|CCF72396.1| bHLH transcription factor [Nicotiana tabacum]
Length=260

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 69/136 (51%), Positives = 83/136 (61%), Gaps = 19/136 (14%)
 Frame = +2

Query  2    FLSMKLASVSPMFYDYGMDLDTLMVRPDQEMNIQRVNGLTLPMPNMQQCNPTTTHTPPAV  181
            FL MKLAS++PM+YD+GMDLD LMVRPDQ +     +GL  P+PNMQQ +PT   +  A 
Sbjct  144  FLFMKLASLNPMYYDFGMDLDALMVRPDQSL-----SGLGTPLPNMQQASPTNITSQAAE  198

Query  182  VSDANTVLTIPSSPPNCDDFSLLDPSApplfqhpphllnnnlfnqgngqllWGVEDQRQK  361
            V        IP+   N   +  LD SA             N  +QGNGQLLWG +DQRQK
Sbjct  199  V--------IPN--INNSGYPFLDNSA---SLMFQQAHFPNSISQGNGQLLWGADDQRQK  245

Query  362  FINQNGFTSNNLCSFH  409
            FINQ+G  SNN CSFH
Sbjct  246  FINQSGL-SNNFCSFH  260



>ref|XP_009786910.1| PREDICTED: transcription factor bHLH137 [Nicotiana sylvestris]
 emb|CCF72393.1| bHLH trascription factor [Nicotiana tabacum]
 emb|CCF72397.1| bHLH transcription factor [Nicotiana tabacum]
Length=362

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 69/136 (51%), Positives = 83/136 (61%), Gaps = 19/136 (14%)
 Frame = +2

Query  2    FLSMKLASVSPMFYDYGMDLDTLMVRPDQEMNIQRVNGLTLPMPNMQQCNPTTTHTPPAV  181
            FLSMKLAS +PM+YD+GMDLD LMVRPDQ +     +GL  P+PNMQQ +PT   +  A 
Sbjct  246  FLSMKLASSNPMYYDFGMDLDALMVRPDQSL-----SGLGTPLPNMQQTSPTNITSQAAE  300

Query  182  VSDANTVLTIPSSPPNCDDFSLLDPSApplfqhpphllnnnlfnqgngqllWGVEDQRQK  361
            V        IP+   N   +  LD SA         +   N  +QGNGQLLWG +DQRQK
Sbjct  301  V--------IPN--INNSGYPFLDNSA---SLMFQQVHFPNSISQGNGQLLWGADDQRQK  347

Query  362  FINQNGFTSNNLCSFH  409
             INQ+G  SNN CSFH
Sbjct  348  LINQSGL-SNNFCSFH  362



>gb|ABW22630.1| bHLH transcription factor Upa20 [Capsicum annuum]
 gb|ABW22631.1| bHLH transcription factor Upa20 [Capsicum annuum]
 gb|ABW22632.1| bHLH transcription factor Upa20 [Capsicum annuum]
Length=340

 Score = 95.5 bits (236),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 75/136 (55%), Gaps = 21/136 (15%)
 Frame = +2

Query  2    FLSMKLASVSPMFYDYGMDLDTLMVRPDQEMNIQRVNGLTLPMPNMQQCNPTTTHTPPAV  181
            FLSMKLAS++PM+YD+GMDLD LMVRPD     Q ++GL   +PN+QQ + TT+     +
Sbjct  226  FLSMKLASLNPMYYDFGMDLDALMVRPDD----QNLSGLETQLPNIQQASTTTSQAAEVI  281

Query  182  VSDANTVLTIPSSPPNCDDFSLLDPSApplfqhpphllnnnlfnqgngqllWGVEDQRQK  361
                         P     +  LD SA  +FQ      + +          WG EDQRQK
Sbjct  282  -------------PNTNSGYPFLDNSASLMFQQAHFPNSIHQGIGQLL---WGAEDQRQK  325

Query  362  FINQNGFTSNNLCSFH  409
             INQ+GF SNN CSFH
Sbjct  326  IINQSGF-SNNFCSFH  340



>ref|XP_002284464.1| PREDICTED: transcription factor bHLH137 [Vitis vinifera]
 emb|CBI15739.3| unnamed protein product [Vitis vinifera]
Length=349

 Score = 92.0 bits (227),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 82/135 (61%), Gaps = 19/135 (14%)
 Frame = +2

Query  2    FLSMKLASVSPMFYDYGMDLDTLMVRPDQEMNIQRVNGLTLPMPNMQQCNPTTTHTPPAV  181
            FLSMKLASV+PMFYD+GMDLD LMVRP+      R++ LT P+P++QQC+P         
Sbjct  233  FLSMKLASVNPMFYDFGMDLDALMVRPE------RLSALTSPLPSLQQCSP---------  277

Query  182  VSDANTVLTIPSSPPNCDDFSLLDPSApplfqhpphllnnnlfnqgngqllWGVEDQRQK  361
             S         ++    +++ ++D SA             N+F+Q NG LLW V+DQRQK
Sbjct  278  -SQPTAYADTTTTFTATNNYPVMDTSA---SILFHQGQRLNVFSQDNGSLLWDVDDQRQK  333

Query  362  FINQNGFTSNNLCSF  406
            FIN +G  SNNLCSF
Sbjct  334  FINPSGLISNNLCSF  348



>ref|XP_006363974.1| PREDICTED: transcription factor bHLH137-like [Solanum tuberosum]
Length=338

 Score = 91.3 bits (225),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 63/136 (46%), Positives = 79/136 (58%), Gaps = 20/136 (15%)
 Frame = +2

Query  2    FLSMKLASVSPMFYDYGMDLDTLMVRPDQEMNIQRVNGLTLPMPNMQQCNPTTTHTPPAV  181
            FLSMKL S++PM+YD+GMDLD LMV+PD     Q ++GL   M N+QQ + TTT     V
Sbjct  223  FLSMKLTSLNPMYYDFGMDLDALMVKPDD----QSLSGLETQMANIQQGSTTTTSQAAEV  278

Query  182  VSDANTVLTIPSSPPNCDDFSLLDPSApplfqhpphllnnnlfnqgngqllWGVEDQRQK  361
            +++ N+             +  LD S              N   QGNGQLLWG +DQRQK
Sbjct  279  IANTNS------------GYPFLDNST---SLMFQQAHFPNSIPQGNGQLLWGADDQRQK  323

Query  362  FINQNGFTSNNLCSFH  409
             INQ+GF SNN CSFH
Sbjct  324  IINQSGF-SNNFCSFH  338



>ref|NP_001266190.1| basic helix-loop-helix [Solanum lycopersicum]
 gb|AFM30927.1| basic helix-loop-helix [Solanum lycopersicum]
Length=330

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 77/136 (57%), Gaps = 20/136 (15%)
 Frame = +2

Query  2    FLSMKLASVSPMFYDYGMDLDTLMVRPDQEMNIQRVNGLTLPMPNMQQCNPTTTHTPPAV  181
            FLSMKL S++PM+YD+GMDLD LMVRPD     Q ++GL   M N+QQ + TTT     V
Sbjct  215  FLSMKLTSLNPMYYDFGMDLDALMVRPDD----QSLSGLETQMANIQQGSTTTTSQAAEV  270

Query  182  VSDANTVLTIPSSPPNCDDFSLLDPSApplfqhpphllnnnlfnqgngqllWGVEDQRQK  361
            +++ N+             +  LD S              N   QG GQLLWG ++Q QK
Sbjct  271  IANTNS------------GYQFLDNST---SLMFQQSHFPNSIPQGIGQLLWGADEQTQK  315

Query  362  FINQNGFTSNNLCSFH  409
             INQ+GF SNN CSFH
Sbjct  316  IINQSGF-SNNFCSFH  330



>ref|XP_010318148.1| PREDICTED: basic helix-loop-helix isoform X1 [Solanum lycopersicum]
Length=330

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 77/136 (57%), Gaps = 20/136 (15%)
 Frame = +2

Query  2    FLSMKLASVSPMFYDYGMDLDTLMVRPDQEMNIQRVNGLTLPMPNMQQCNPTTTHTPPAV  181
            FLSMKL S++PM+YD+GMDLD LMVRPD     Q ++GL   M N+QQ + TTT     V
Sbjct  215  FLSMKLTSLNPMYYDFGMDLDALMVRPDD----QSLSGLETQMANIQQGSTTTTSQAAEV  270

Query  182  VSDANTVLTIPSSPPNCDDFSLLDPSApplfqhpphllnnnlfnqgngqllWGVEDQRQK  361
            +++ N+             +  LD S              N   QG GQLLWG ++Q QK
Sbjct  271  IANTNS------------GYQFLDNST---SLMFQQSHFPNSIPQGIGQLLWGADEQTQK  315

Query  362  FINQNGFTSNNLCSFH  409
             INQ+GF SNN CSFH
Sbjct  316  IINQSGF-SNNFCSFH  330



>ref|XP_011073133.1| PREDICTED: transcription factor bHLH137 isoform X1 [Sesamum indicum]
Length=309

 Score = 85.5 bits (210),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 73/139 (53%), Gaps = 37/139 (27%)
 Frame = +2

Query  2    FLSMKLASVSPMFYDYGMDLDTLMVRPDQEMNIQRVNGLTLPMPNMQQCNPTT---THTP  172
            FLSMKLAS++P+FYD+G+DL ++MVR DQE+       L  P+P+MQ+CNPTT    + P
Sbjct  205  FLSMKLASLNPIFYDFGVDLQSIMVRSDQEL-----GNLASPLPSMQECNPTTGIINNYP  259

Query  173  PAVVSDANTVLTIPSSPPNCDDFSLLDPSApplfqhpphllnnnlfnqgngqllWGVEDQ  352
            P   S +N++L   +  P       L                            W VE+ 
Sbjct  260  PLQNSASNSILFQEAQIPQGSRDERL----------------------------WEVEEH  291

Query  353  RQKFINQNGFTSNNLCSFH  409
            RQK +NQ+ F SN+L SFH
Sbjct  292  RQKIMNQSAF-SNSLFSFH  309



>emb|CDO98661.1| unnamed protein product [Coffea canephora]
Length=376

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 80/136 (59%), Gaps = 15/136 (11%)
 Frame = +2

Query  2    FLSMKLASVSPMFYDYGMDLDTLMVRPDQEMNIQRVNGLTLPMPNMQQCNPTTTHTPPAV  181
            FLSMKLAS++PMFYD+GMDLD  + RP+  +     + +  P+ NMQQC+P      P +
Sbjct  256  FLSMKLASLNPMFYDFGMDLDPYIARPEPTL-----SNMASPVQNMQQCDPMQA---PII  307

Query  182  VSDANTVLTIPSSPPNCDDFSLLDPSApplfqhpphllnnnlfnqgngqllWGVEDQRQK  361
             +  N++ T        +++  LD SA              + +Q NGQLLW V+D+RQK
Sbjct  308  SATNNSLRT-----DTANNYPQLDSSA-SALLIQESHHIPQILSQENGQLLWDVDDRRQK  361

Query  362  FINQNGFTSNNLCSFH  409
             INQ GF +NNLCSFH
Sbjct  362  LINQTGF-NNNLCSFH  376



>ref|XP_007038100.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 1 [Theobroma cacao]
 ref|XP_007038101.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOY22601.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOY22602.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 1 [Theobroma cacao]
Length=348

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 61/137 (45%), Positives = 80/137 (58%), Gaps = 20/137 (15%)
 Frame = +2

Query  2    FLSMKLASVSPMFYDYGMDLDTLMVRPDQEMNIQRVNG-LTLPMPNMQQCNPTTTHTPPA  178
            FLSMKLASV+PMFYD+G+DL+ LMVRP+      RVNG +  P+P++QQCNPT     P 
Sbjct  231  FLSMKLASVNPMFYDFGVDLEALMVRPE------RVNGSIASPLPSLQQCNPTQ----PT  280

Query  179  VVSDANTVLTIPSSPPNCDDFSLLDPSApplfqhpphllnnnlfnqgngqllWGVEDQRQ  358
              +D  T   +P++                           N+F+Q NG LLW VEDQRQ
Sbjct  281  AFADTTTTTFVPANN--------YPLLDASAALLLQQGQRPNVFSQDNGSLLWDVEDQRQ  332

Query  359  KFINQNGFTSNNLCSFH  409
            KF+N +G  ++NLC FH
Sbjct  333  KFLNSSGL-NDNLCCFH  348



>gb|KDO44050.1| hypothetical protein CISIN_1g017497mg [Citrus sinensis]
Length=370

 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 79/136 (58%), Gaps = 12/136 (9%)
 Frame = +2

Query  2    FLSMKLASVSPMFYDYGMDLD-TLMVRPDQEMNIQRVNGLTLPMPNMQQCNPTTTHTPPA  178
            FLSMKLASV+PMFYD+GMDLD T MVRPD + N+  +   +   P + QC+PT   T   
Sbjct  245  FLSMKLASVNPMFYDFGMDLDNTFMVRPDDQQNLNSIIAASASAPQV-QCSPTAQLT---  300

Query  179  VVSDANTVLTIPSSPPNCDDFSLLDPSApplfqhpphllnnnlfnqgngqllWGVEDQRQ  358
              +D  T    P+   N  ++ +LD +   L        N  ++      LLW VEDQ+Q
Sbjct  301  AFADTTTAFA-PADHRN--NYPVLDTA---LLLQQGQRPNALIYQDNGNSLLWDVEDQKQ  354

Query  359  KFINQNGFTSNNLCSF  406
            +F+N +GFTS NLCSF
Sbjct  355  RFLNPSGFTS-NLCSF  369



>ref|XP_006436929.1| hypothetical protein CICLE_v10031873mg [Citrus clementina]
 gb|ESR50169.1| hypothetical protein CICLE_v10031873mg [Citrus clementina]
Length=370

 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 79/136 (58%), Gaps = 12/136 (9%)
 Frame = +2

Query  2    FLSMKLASVSPMFYDYGMDLD-TLMVRPDQEMNIQRVNGLTLPMPNMQQCNPTTTHTPPA  178
            FLSMKLASV+PMFYD+GMDLD T MVRPD + N+  +   +   P + QC+PT   T   
Sbjct  245  FLSMKLASVNPMFYDFGMDLDNTFMVRPDDQQNLNSIIAASASAPQV-QCSPTAQLT---  300

Query  179  VVSDANTVLTIPSSPPNCDDFSLLDPSApplfqhpphllnnnlfnqgngqllWGVEDQRQ  358
              +D  T    P+   N  ++ +LD +   L        N  ++      LLW VEDQ+Q
Sbjct  301  AFADTTTAFA-PADHRN--NYPVLDTA---LLLQQGQRPNALIYQDNGNSLLWDVEDQKQ  354

Query  359  KFINQNGFTSNNLCSF  406
            +F+N +GFTS NLCSF
Sbjct  355  RFLNPSGFTS-NLCSF  369



>ref|NP_001275808.1| putative bHLH transcription factor [Citrus sinensis]
 gb|ABW97699.1| putative bHLH transcription factor [Citrus sinensis]
Length=370

 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 79/136 (58%), Gaps = 12/136 (9%)
 Frame = +2

Query  2    FLSMKLASVSPMFYDYGMDLD-TLMVRPDQEMNIQRVNGLTLPMPNMQQCNPTTTHTPPA  178
            FLSMKLASV+PMFYD+GMDLD T MVRPD + N+  +   +   P + QC+PT   T   
Sbjct  245  FLSMKLASVNPMFYDFGMDLDNTFMVRPDDQQNLNSIIAASASAPQV-QCSPTAQLT---  300

Query  179  VVSDANTVLTIPSSPPNCDDFSLLDPSApplfqhpphllnnnlfnqgngqllWGVEDQRQ  358
              +D  T    P+   N  ++ +LD +   L        N  ++      LLW VEDQ+Q
Sbjct  301  AFADTTTAFA-PADHRN--NYPVLDTA---LLLQQGQRPNALIYQDNGNSLLWDVEDQKQ  354

Query  359  KFINQNGFTSNNLCSF  406
            +F+N +GFTS NLCSF
Sbjct  355  RFLNPSGFTS-NLCSF  369



>ref|XP_007038102.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 3, partial [Theobroma cacao]
 gb|EOY22603.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 3, partial [Theobroma cacao]
Length=411

 Score = 81.3 bits (199),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 61/137 (45%), Positives = 80/137 (58%), Gaps = 20/137 (15%)
 Frame = +2

Query  2    FLSMKLASVSPMFYDYGMDLDTLMVRPDQEMNIQRVNG-LTLPMPNMQQCNPTTTHTPPA  178
            FLSMKLASV+PMFYD+G+DL+ LMVRP+      RVNG +  P+P++QQCNPT     P 
Sbjct  294  FLSMKLASVNPMFYDFGVDLEALMVRPE------RVNGSIASPLPSLQQCNPTQ----PT  343

Query  179  VVSDANTVLTIPSSPPNCDDFSLLDPSApplfqhpphllnnnlfnqgngqllWGVEDQRQ  358
              +D  T   +P++                           N+F+Q NG LLW VEDQRQ
Sbjct  344  AFADTTTTTFVPANN--------YPLLDASAALLLQQGQRPNVFSQDNGSLLWDVEDQRQ  395

Query  359  KFINQNGFTSNNLCSFH  409
            KF+N +G  ++NLC FH
Sbjct  396  KFLNSSGL-NDNLCCFH  411



>ref|XP_002318764.2| basic helix-loop-helix family protein [Populus trichocarpa]
 gb|EEE96984.2| basic helix-loop-helix family protein [Populus trichocarpa]
Length=359

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 81/136 (60%), Gaps = 10/136 (7%)
 Frame = +2

Query  2    FLSMKLASVSPMFYDYGMDLDTLMVRPDQEMNIQRVNGLTLPMPNMQQCNPTTTHTPPAV  181
            FLSMKLASV+PMFYD+GM+LD  MVRP+      R++ ++ P+P++QQC+P         
Sbjct  234  FLSMKLASVNPMFYDFGMELDAFMVRPE------RLSSMSPPLPSLQQCSPIQPTAFADA  287

Query  182  VSDANTVLTIPSSPPNCDDFSLLDPSApplfqhpphllnnnlfnqgngqllWGVEDQRQK  361
             + A T  T  +S    +++ L+D S          +  +    + +  L+W V+++RQK
Sbjct  288  AAAATTTATPTTSFATANNYPLIDNST---SLLLQGMRPSAFTTEDSCNLMWDVDERRQK  344

Query  362  FINQNGFTSNNLCSFH  409
            F++ +G TS NLCSFH
Sbjct  345  FLSPSGLTS-NLCSFH  359



>gb|KHG05669.1| Transcription factor protein [Gossypium arboreum]
Length=332

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 73/145 (50%), Gaps = 41/145 (28%)
 Frame = +2

Query  2    FLSMKLASVSPMFYDYGMDLDTLMVRPDQEMNIQRVNGLTLPMPNMQQCNPTTTHTPPAV  181
            FLSMKLAS+SPMFYD+G+DL+TLM+RP++   +       LPMP  QQCNP  T   P+ 
Sbjct  220  FLSMKLASLSPMFYDFGVDLETLMIRPER---VSSTETSPLPMPCPQQCNPIQTTIAPSH  276

Query  182  ---VSDANTVLTIPSS-PPNC-----DDFSLLDPSApplfqhpphllnnnlfnqgngqll  334
               + D +T L +     PN      D+ SLL                            
Sbjct  277  NYPLLDVSTALFLQQGLRPNLFSHSQDNGSLL----------------------------  308

Query  335  WGVEDQRQKFINQNGFTSNNLCSFH  409
            W VEDQRQK  N +   ++NLCSFH
Sbjct  309  WDVEDQRQKIFNSSQL-NDNLCSFH  332



>gb|KDP22555.1| hypothetical protein JCGZ_26386 [Jatropha curcas]
Length=363

 Score = 77.4 bits (189),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 76/136 (56%), Gaps = 12/136 (9%)
 Frame = +2

Query  2    FLSMKLASVSPMFYDYGMDLDTLMVRPDQEMNIQRVNGLTLPMPNMQQCNPTTTHTPPAV  181
            FLS+KLASV+P+FYD+GMDLD LMVRP+  M       L   +P MQQC   T       
Sbjct  240  FLSLKLASVNPLFYDFGMDLDALMVRPEGLM-----GNLAPSLPPMQQCTTATATATATA  294

Query  182  VSDANTVLTIPSSPPNCDDFSLLDPSApplfqhpphllnnnlfnqgngqllWGVEDQRQK  361
             +   T  T   +  N  ++ L+D SA             N F Q +  LLW V++QRQK
Sbjct  295  TTTPITTTTATFATAN--NYPLIDSSA----LLLLQEQRPNDFIQDSNSLLWDVDEQRQK  348

Query  362  FINQNGFTSNNLCSFH  409
            F+N +GFT NNLCSFH
Sbjct  349  FLNPSGFT-NNLCSFH  363



>ref|XP_008239542.1| PREDICTED: transcription factor bHLH137 isoform X2 [Prunus mume]
Length=343

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 54/130 (42%), Positives = 75/130 (58%), Gaps = 16/130 (12%)
 Frame = +2

Query  2    FLSMKLASVSPMFYDYGMDLDTLMVRPDQEMNIQRVNGLTLPMPNMQQCNPTTTHTPPAV  181
            FLSMKLASV+P+FYD GMDL  LMV+P      +R++ +  P P++ QC+PT     P  
Sbjct  226  FLSMKLASVNPLFYDLGMDLGALMVKP------ERLSSMASPYPSVPQCSPTQ----PTA  275

Query  182  VSDANTVLTIPSSPPNCDDFSLLDPSApplfqhpphllnnnlfnqgngqllWGVEDQRQK  361
             +D +T +T  S+  N   +  LD SA             N F+Q +  L+W VEDQRQ 
Sbjct  276  FADTSTNITTFSTANN---YPFLDGSA---SILLQQGQRLNDFSQDSESLMWDVEDQRQN  329

Query  362  FINQNGFTSN  391
            F+N +GF +N
Sbjct  330  FLNPSGFGNN  339



>ref|XP_011073134.1| PREDICTED: transcription factor bHLH137 isoform X2 [Sesamum indicum]
Length=288

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 56/84 (67%), Gaps = 12/84 (14%)
 Frame = +2

Query  2    FLSMKLASVSPMFYDYGMDLDTLMVRPDQEMNIQRVNGLTLPMPNMQQCNPTT---THTP  172
            FLSMKLAS++P+FYD+G+DL ++MVR DQE+       L  P+P+MQ+CNPTT    + P
Sbjct  205  FLSMKLASLNPIFYDFGVDLQSIMVRSDQEL-----GNLASPLPSMQECNPTTGIINNYP  259

Query  173  PAVVSDANTVL----TIPSSPPNC  232
            P   S +N++L     IP S  NC
Sbjct  260  PLQNSASNSILFQEAQIPQSVRNC  283



>ref|XP_003630566.1| BHLH transcription factor [Medicago truncatula]
 gb|AET05042.1| basic helix loop helix protein BHLH8 [Medicago truncatula]
Length=327

 Score = 74.3 bits (181),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 77/138 (56%), Gaps = 21/138 (15%)
 Frame = +2

Query  2    FLSMKLASVSPMFYDYGMDLDTLMVRPDQEMNIQRVNGLT---LPMPNMQQCNPTTTHTP  172
            FLSMKLASV+P+F+D+ MDLDTL+VRPD     QR+N +T    P+P++  C  ++ H  
Sbjct  207  FLSMKLASVNPIFFDFAMDLDTLLVRPDH----QRLNSITSPSTPIPHVSLC--SSNHAT  260

Query  173  PAVVSDANTVLTIPSSPPNCDDFSLLDPSApplfqhpphllnnnlfnqgngqllWGVEDQ  352
            P     A+T+ T  S  P  +D+ L  P++            +N F +      W VEDQ
Sbjct  261  PF----ADTITT--SFHPANNDYVLDYPTS-----IFLQGQRSNTFFEHTDGPFWDVEDQ  309

Query  353  RQKFINQNGFTSNNLCSF  406
            RQK +N  GF  NN CS 
Sbjct  310  RQKLLNPYGF-GNNTCSL  326



>ref|XP_007209284.1| hypothetical protein PRUPE_ppa008085mg [Prunus persica]
 gb|EMJ10483.1| hypothetical protein PRUPE_ppa008085mg [Prunus persica]
Length=346

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 75/130 (58%), Gaps = 13/130 (10%)
 Frame = +2

Query  2    FLSMKLASVSPMFYDYGMDLDTLMVRPDQEMNIQRVNGLTLPMPNMQQCNPTTTHTPPAV  181
            FLSMKLASV+P+FYD+GMDL  LMV+P      +R++ +  P P++ QC+PT     P  
Sbjct  226  FLSMKLASVNPLFYDFGMDLGALMVKP------ERLSSMASPYPSVPQCSPTQ----PTP  275

Query  182  VSDANTVLTIPSSPPNCDDFSLLDPSApplfqhpphllnnnlfnqgngqllWGVEDQRQK  361
             +D +  +T  ++    +++   D SA             N F+Q +  L+W VEDQRQ 
Sbjct  276  FADTSPNITTNTTFSTANNYPFPDSSA---SILLQQGQRPNDFSQDSESLMWDVEDQRQN  332

Query  362  FINQNGFTSN  391
            F+N +GF +N
Sbjct  333  FLNPSGFGNN  342



>ref|XP_011042945.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor bHLH137-like 
[Populus euphratica]
Length=360

 Score = 72.8 bits (177),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 78/137 (57%), Gaps = 11/137 (8%)
 Frame = +2

Query  2    FLSMKLASVSPMFYDYGMDLDTLMVRPDQEMNIQRVNGLTLPMPNMQQCNPT-TTHTPPA  178
            FLSMKLASV+P+FYD+GM LD  M+RP      +R++ ++ P+P++QQC+P   T    A
Sbjct  234  FLSMKLASVNPIFYDFGMGLDAFMIRP------ERLSSMSPPLPSLQQCSPIQPTAFAAA  287

Query  179  VVSDANTVLTIPSSPPNCDDFSLLDPSApplfqhpphllnnnlfnqgngqllWGVEDQRQ  358
                     T  SS    +++ L+D S          +  +    + +  L+W V+++R 
Sbjct  288  APPPPPPPATPTSSFATANNYPLIDNST---SLLLKGMRPSAFTTEDSCNLMWDVDERRP  344

Query  359  KFINQNGFTSNNLCSFH  409
            KF++ +G TS NLCSFH
Sbjct  345  KFLSPSGLTS-NLCSFH  360



>ref|XP_009337524.1| PREDICTED: transcription factor bHLH137 [Pyrus x bretschneideri]
 ref|XP_009337525.1| PREDICTED: transcription factor bHLH137 [Pyrus x bretschneideri]
Length=355

 Score = 72.4 bits (176),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 78/137 (57%), Gaps = 15/137 (11%)
 Frame = +2

Query  2    FLSMKLASVSPMFYDYGMDLDTLMVRPDQEMNIQRVNGLTLPMPNMQQCNPTTTHTPPAV  181
            FLS+KLAS +PMF+D+GMD+  L+V+P      +R+  +  P P+ QQCNP  + TP A 
Sbjct  231  FLSLKLASSNPMFFDFGMDMGALVVKP------ERLCSMVSPYPSAQQCNPIQS-TPFAD  283

Query  182  VS--DANTVLTIPSSPPNCDDFSLLDPSApplfqhpphllnnnlfnqgngqllWGVEDQR  355
             S     T +   ++    +++  LD SA         L     F+Q +  LLW VEDQR
Sbjct  284  TSTNITATTVAATAAITTNNNYHFLDNSA------SHLLQRPKTFSQDSESLLWDVEDQR  337

Query  356  QKFINQNGFTSNNLCSF  406
            Q F N  GF+++NLCSF
Sbjct  338  QNFHNPCGFSNSNLCSF  354



>ref|XP_002322296.2| basic helix-loop-helix family protein [Populus trichocarpa]
 gb|EEF06423.2| basic helix-loop-helix family protein [Populus trichocarpa]
Length=357

 Score = 71.6 bits (174),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 80/136 (59%), Gaps = 14/136 (10%)
 Frame = +2

Query  2    FLSMKLASVSPMFYDYGMDLDTLMVRPDQEMNIQRVNGLTLPMPNMQQCNPTTTHTPPAV  181
            FLSMKLASV+P+ YD+GMD D  MVRP+      R++ ++ P+P++Q  +P     P A 
Sbjct  236  FLSMKLASVNPLLYDFGMDRDAFMVRPE------RLSSMSPPLPSLQHNSPI---QPTAF  286

Query  182  VSDANTVLTIPSSPPNCDDFSLLDPSApplfqhpphllnnnlfnqgngqllWGVEDQRQK  361
               A+      ++  N  ++ L+D SA           ++   +Q +G L+W V++QRQK
Sbjct  287  ADTASATTATFATEEN--NYPLIDNSA--TLFLQGMRPSDFTTHQDSGYLMWDVDEQRQK  342

Query  362  FINQNGFTSNNLCSFH  409
            F+N +G T NNLCSFH
Sbjct  343  FLNPSGLT-NNLCSFH  357



>gb|EYU32918.1| hypothetical protein MIMGU_mgv11b022778mg [Erythranthe guttata]
Length=171

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 42/54 (78%), Gaps = 9/54 (17%)
 Frame = +2

Query  2    FLSMKLASVSPMFYDYGMDLDTLMVRPDQEMNIQRVNGLTLPMPNMQQCNPTTT  163
            FLSMKLASV+PMFYD+G+DL++ MVRPDQ+++          +PNMQ+C+PT T
Sbjct  83   FLSMKLASVNPMFYDFGVDLESFMVRPDQDLS---------NLPNMQECHPTVT  127



>gb|KEH35698.1| transcription factor bHLH137 [Medicago truncatula]
Length=330

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 53/138 (38%), Positives = 71/138 (51%), Gaps = 18/138 (13%)
 Frame = +2

Query  2    FLSMKLASVSPMFYDYGMDLDTLMVRPDQEMNIQRVNGLTLP--MPNMQQCNPTTTHTPP  175
            FLSMKL SV+PMFYD   DLDTL+VR +      ++N L  P  + ++  CN     +P 
Sbjct  209  FLSMKLTSVNPMFYDMATDLDTLLVRQE------KLNNLASPSTLSSVSHCN-----SPK  257

Query  176  AVVSDANTVLTIPSSPPNCDDFSLLDPSApplfqhpphllnnnlfnqgngqllWGVEDQR  355
               + A+T    P++     +  LLD SA    Q        +          W VEDQR
Sbjct  258  QGTTFADTTTMTPTNIFQAANDYLLDTSASIFLQGQRSSNVVSEDASHF----WEVEDQR  313

Query  356  QKFINQNGFTSNNLCSFH  409
            QKF++ +GF S NLCSFH
Sbjct  314  QKFLHSHGFNS-NLCSFH  330



>ref|XP_010093954.1| hypothetical protein L484_008847 [Morus notabilis]
 gb|EXB54917.1| hypothetical protein L484_008847 [Morus notabilis]
Length=342

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 73/140 (52%), Gaps = 19/140 (14%)
 Frame = +2

Query  2    FLSMKLASVSPMFYDYGMDLDTLMVRPDQEMNIQRVNGLTLPMPNMQQCNPTTTHTPPAV  181
            FLSMKLAS++PMFYD+GMDLD  +VRP          GL      + Q  P  +   P  
Sbjct  218  FLSMKLASLNPMFYDFGMDLDAFLVRP---------VGLNTLASQINQSVPQCSQNQPTA  268

Query  182  VSDANTVLTIPSSPPN----CDDFSLLDPSApplfqhpphllnnnlfnqgngqllWGVED  349
            V  A+    +P +P N     +D+ +LD S              + F+  NG LLW VED
Sbjct  269  VFAADHNSAVP-APTNFNVTANDYPILDNS---DSLLLQQGHRPSAFSNENGTLLWDVED  324

Query  350  QRQKFINQNGFTSNNLCSFH  409
             RQ F+N +GF+  NLCSF+
Sbjct  325  HRQSFLNPSGFS--NLCSFN  342



>gb|ACU19194.1| unknown [Glycine max]
Length=156

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 72/136 (53%), Gaps = 16/136 (12%)
 Frame = +2

Query  2    FLSMKLASVSPMFYDYGMDLDTLMVRPDQEMNIQRVNGLTLPMPNMQQCNPTTTHTPPAV  181
            FLSMKLA V+PMFYD  +DLDTLMVRPDQ++N      +  P P + Q  P         
Sbjct  37   FLSMKLALVNPMFYDLAIDLDTLMVRPDQKLNYN----IASPSPCLAQFRPNQA----IA  88

Query  182  VSDANTVLTIPSSPPNCDDFSLLDPSApplfqhpphllnnnlfnqgngqllWGVEDQRQK  361
             +D  T  + P++  N  D+  LD S+            +N F + NG   W VEDQRQK
Sbjct  89   FADTTTTNSFPTA--NNGDY-FLDYSS----SLFFQGPRSNFFFEYNGGQFWDVEDQRQK  141

Query  362  FINQNGFTSNNLCSFH  409
            F +  GF  NN  SF+
Sbjct  142  FFHPYGF-GNNSGSFN  156



>ref|XP_003526933.2| PREDICTED: transcription factor bHLH137-like [Glycine max]
 gb|KHN23952.1| Transcription factor bHLH137 [Glycine soja]
Length=349

 Score = 70.5 bits (171),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 72/138 (52%), Gaps = 16/138 (12%)
 Frame = +2

Query  2    FLSMKLASVSPMFYDYGMDLDTLMVRPDQEMNIQRVNGLT--LPMPNMQQCNPTTTHTPP  175
            FLSMKLASV+PMFYD   DLDTL+VRP+      ++N +    P+P+M  CN        
Sbjct  226  FLSMKLASVNPMFYDLATDLDTLLVRPE------KLNSMASPSPLPSMSHCNSPNNQ---  276

Query  176  AVVSDANTVLTIPSSPPNCDDFSLLDPSApplfqhpphllnnnlfnqgngqllWGVEDQR  355
               + A+T    P++  +     LLD S             N L  +  G   W  EDQR
Sbjct  277  -ATTFADTTTMTPTNIFHTTSDYLLDNSV---SFFLQGQRPNVLSEEDTGSHFWDAEDQR  332

Query  356  QKFINQNGFTSNNLCSFH  409
            QKF++  GF SNNLCSFH
Sbjct  333  QKFLHPYGF-SNNLCSFH  349



>ref|XP_003532431.2| PREDICTED: transcription factor bHLH137-like isoform X1 [Glycine 
max]
Length=339

 Score = 70.1 bits (170),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 58/135 (43%), Positives = 74/135 (55%), Gaps = 16/135 (12%)
 Frame = +2

Query  2    FLSMKLASVSPMFYDYGMDLDTLMVRPDQEMNIQRVNGLTLPMPNMQQCNPTTTHTPPAV  181
            FLSMKLA V+PMFYD  +DLDTLMVRPDQ++N      +  P P + Q  P         
Sbjct  220  FLSMKLALVNPMFYDLAIDLDTLMVRPDQKLNY----NIASPSPCLAQFRPNQA----IA  271

Query  182  VSDANTVLTIPSSPPNCDDFSLLDPSApplfqhpphllnnnlfnqgngqllWGVEDQRQK  361
             +D  T  + P++  N  D+ LLD S+            +NLF + NG   W VEDQRQK
Sbjct  272  FADTTTTNSFPTA--NNGDY-LLDYSS----SLFLQGPRSNLFFEYNGGQFWDVEDQRQK  324

Query  362  FINQNGFTSNNLCSF  406
            F++  GF  NN  SF
Sbjct  325  FLHPYGF-GNNSGSF  338



>gb|KHN16873.1| Transcription factor bHLH137 [Glycine soja]
Length=349

 Score = 70.1 bits (170),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 58/135 (43%), Positives = 74/135 (55%), Gaps = 16/135 (12%)
 Frame = +2

Query  2    FLSMKLASVSPMFYDYGMDLDTLMVRPDQEMNIQRVNGLTLPMPNMQQCNPTTTHTPPAV  181
            FLSMKLA V+PMFYD  +DLDTLMVRPDQ++N      +  P P + Q  P         
Sbjct  230  FLSMKLALVNPMFYDLAIDLDTLMVRPDQKLNY----NIASPSPCLAQFRPNQA----IA  281

Query  182  VSDANTVLTIPSSPPNCDDFSLLDPSApplfqhpphllnnnlfnqgngqllWGVEDQRQK  361
             +D  T  + P++  N  D+ LLD S+            +NLF + NG   W VEDQRQK
Sbjct  282  FADTTTTNSFPTA--NNGDY-LLDYSS----SLFLQGPRSNLFFEYNGGQFWDVEDQRQK  334

Query  362  FINQNGFTSNNLCSF  406
            F++  GF  NN  SF
Sbjct  335  FLHPYGF-GNNSGSF  348



>ref|XP_009334315.1| PREDICTED: transcription factor bHLH137-like [Pyrus x bretschneideri]
 ref|XP_009334316.1| PREDICTED: transcription factor bHLH137-like [Pyrus x bretschneideri]
Length=355

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 77/137 (56%), Gaps = 15/137 (11%)
 Frame = +2

Query  2    FLSMKLASVSPMFYDYGMDLDTLMVRPDQEMNIQRVNGLTLPMPNMQQCNPTTTHTPPAV  181
            FLS+KLAS +PMF+D+GMD+  L+V+P      +R+  +  P P+ QQCN   + TP A 
Sbjct  231  FLSLKLASSNPMFFDFGMDMGALVVKP------ERLCSMVSPYPSAQQCNLIQS-TPFAD  283

Query  182  VS--DANTVLTIPSSPPNCDDFSLLDPSApplfqhpphllnnnlfnqgngqllWGVEDQR  355
             S     T     ++    +++  LD SA         L   N F+Q +  LLW VEDQR
Sbjct  284  TSTNITATTAAATAAITTNNNYHFLDNSA------SHLLQRPNTFSQDSESLLWDVEDQR  337

Query  356  QKFINQNGFTSNNLCSF  406
            Q F N  GF+++NLCSF
Sbjct  338  QNFHNPCGFSNSNLCSF  354



>ref|XP_007137888.1| hypothetical protein PHAVU_009G164300g [Phaseolus vulgaris]
 gb|ESW09882.1| hypothetical protein PHAVU_009G164300g [Phaseolus vulgaris]
Length=343

 Score = 68.2 bits (165),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 54/139 (39%), Positives = 75/139 (54%), Gaps = 19/139 (14%)
 Frame = +2

Query  2    FLSMKLASVSPMFYDYGMDLDTLMVRPDQEMNIQRVNGLTLP--MPNMQQCNPTTTHTPP  175
            FLSMKLAS++PMFYD   D+DTL+VRP+      ++N +  P  +P +  CN     +P 
Sbjct  221  FLSMKLASMNPMFYDLSSDIDTLLVRPE------KLNSMASPSPIPCVSHCN-----SPN  269

Query  176  AVVSDANTVLTIPSSP-PNCDDFSLLDPSApplfqhpphllnnnlfnqgngqllWGVEDQ  352
               + A+T    P++   N  D+ LLD S     Q     + +      +    W  EDQ
Sbjct  270  QATTFADTTTMTPTNIFHNASDY-LLDNSTSFFLQGQRSTMFSEEDTGSHL---WDAEDQ  325

Query  353  RQKFINQNGFTSNNLCSFH  409
            RQKF++  GF SNNLCSFH
Sbjct  326  RQKFLHPYGF-SNNLCSFH  343



>ref|XP_008392769.1| PREDICTED: transcription factor bHLH137-like [Malus domestica]
 ref|XP_008392771.1| PREDICTED: transcription factor bHLH137-like [Malus domestica]
 ref|XP_008392772.1| PREDICTED: transcription factor bHLH137-like [Malus domestica]
Length=358

 Score = 68.2 bits (165),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 51/136 (38%), Positives = 75/136 (55%), Gaps = 15/136 (11%)
 Frame = +2

Query  2    FLSMKLASVSPMFYDYGMDLDTLMVRPDQEMNIQRVNGLTLPMPNMQQCNPTTTHTPPA-  178
            FLS+KLAS++PMF+D+GMD+  L+V+P      +R+  +  P P++QQCNP  + TP A 
Sbjct  234  FLSLKLASLNPMFFDFGMDMGALVVKP------ERLCSMESPYPSVQQCNPIQS-TPFAD  286

Query  179  -VVSDANTVLTIPSSPPNCDDFSLLDPSApplfqhpphllnnnlfnqgngqllWGVEDQR  355
               +   T     ++    ++   LD SA  L Q P     ++          W VEDQR
Sbjct  287  TSTNITATTAAAXTAFTTNNNXHFLDNSASHLLQRPNTFSQDSESLL------WDVEDQR  340

Query  356  QKFINQNGFTSNNLCS  403
            Q F N  GF+++NLCS
Sbjct  341  QNFHNPCGFSNSNLCS  356



>ref|XP_004145216.1| PREDICTED: transcription factor bHLH49-like [Cucumis sativus]
Length=340

 Score = 65.1 bits (157),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 47/144 (33%), Positives = 72/144 (50%), Gaps = 21/144 (15%)
 Frame = +2

Query  2    FLSMKLASVSPMFYDYGMDLDTLMVRPDQEMNIQRVNGLTLPMPNMQQCNPTTTHTPPAV  181
            FLSMKLAS++P+F+D+ MDLD LM++P+       ++ +T  +P M QC         +V
Sbjct  210  FLSMKLASLNPIFFDFRMDLDGLMIQPE----TTSLSSITPTLPAMAQC---------SV  256

Query  182  VSDANTVLTIPSSPPN-----CDDFSLLDPSAp---plfqhpphllnnnlfnqgngqllW  337
            VS    + T P + P+      ++F L+DPSA          P    +           W
Sbjct  257  VSQPALIDTTPPATPSPAISTGNNFPLMDPSANLFLLQQGISPSNGYSQSSQDNVKVSSW  316

Query  338  GVEDQRQKFINQNGFTSNNLCSFH  409
             VEDQ++K +  +    +NLC FH
Sbjct  317  DVEDQKRKQLLISSGIGDNLCYFH  340



>ref|XP_004154003.1| PREDICTED: uncharacterized protein LOC101205943 [Cucumis sativus]
 ref|XP_004166345.1| PREDICTED: uncharacterized LOC101205943 [Cucumis sativus]
 gb|KGN64437.1| hypothetical protein Csa_1G051740 [Cucumis sativus]
Length=372

 Score = 65.1 bits (157),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 47/144 (33%), Positives = 72/144 (50%), Gaps = 21/144 (15%)
 Frame = +2

Query  2    FLSMKLASVSPMFYDYGMDLDTLMVRPDQEMNIQRVNGLTLPMPNMQQCNPTTTHTPPAV  181
            FLSMKLAS++P+F+D+ MDLD LM++P+       ++ +T  +P M QC         +V
Sbjct  242  FLSMKLASLNPIFFDFRMDLDGLMIQPE----TTSLSSITPTLPAMAQC---------SV  288

Query  182  VSDANTVLTIPSSPPN-----CDDFSLLDPSA---pplfqhpphllnnnlfnqgngqllW  337
            VS    + T P + P+      ++F L+DPSA          P    +           W
Sbjct  289  VSQPALIDTTPPATPSPAISTGNNFPLMDPSANLFLLQQGISPSNGYSQSSQDNVKVSSW  348

Query  338  GVEDQRQKFINQNGFTSNNLCSFH  409
             VEDQ++K +  +    +NLC FH
Sbjct  349  DVEDQKRKQLLISSGIGDNLCYFH  372



>ref|XP_008440060.1| PREDICTED: transcription factor bHLH137-like [Cucumis melo]
Length=368

 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/139 (32%), Positives = 68/139 (49%), Gaps = 11/139 (8%)
 Frame = +2

Query  2    FLSMKLASVSPMFYDYGMDLDTLMVRPDQEMNIQRVNGLTLPMPNMQQCNPTTTHTPPAV  181
            FLSMKLAS++P+F+D+ MDLD LM++P+       ++ +T  +P M QC    +  PP  
Sbjct  238  FLSMKLASLNPIFFDFRMDLDGLMIQPE----TTSLSSITPTLPAMAQC----SVVPPQA  289

Query  182  VSDANTVLTIPSSPPNCDDFSLLDPSApplfqhpphl---lnnnlfnqgngqllWGVEDQ  352
            + D     T   +    ++F L+DPSA               +           W VEDQ
Sbjct  290  LIDTTPPATPSPAISTGNNFPLMDPSANLFLLQQGISPNNGYSQSSQDNVKVSSWDVEDQ  349

Query  353  RQKFINQNGFTSNNLCSFH  409
            ++K +  +    +NLC FH
Sbjct  350  KRKQLLISSGIGDNLCYFH  368



>ref|XP_006580621.1| PREDICTED: transcription factor bHLH137-like isoform X1 [Glycine 
max]
 ref|XP_006580622.1| PREDICTED: transcription factor bHLH137-like isoform X2 [Glycine 
max]
 gb|KHN17470.1| Transcription factor bHLH137 [Glycine soja]
Length=342

 Score = 64.3 bits (155),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 58/137 (42%), Positives = 72/137 (53%), Gaps = 15/137 (11%)
 Frame = +2

Query  2    FLSMKLASVSPMFYDYGMDLDTLMVRPDQEM-NIQRVNGLTLPMPNMQQCNPTTTHTPPA  178
            FLSMKLASV+PMF+D  MDLDTLMVRPDQ++ NI   +    P+P + Q  P   H   A
Sbjct  218  FLSMKLASVNPMFFDSAMDLDTLMVRPDQKLSNIASPS----PLPCVAQFRP---HQAIA  270

Query  179  VVSDANTVLTIPSSPPNC-DDFSLLDPSApplfqhpphllnnnlfnqgngqllWGVEDQR  355
                  T  T  +S P   +D  LLD S+           +     + NG   W VEDQR
Sbjct  271  FADTITTPTTTTNSFPTANNDGYLLDYSS-----SLFLQGHRPNIFEDNGGQFWDVEDQR  325

Query  356  QKFINQNGFTSNNLCSF  406
            QKF++   F  NN  SF
Sbjct  326  QKFLHPYRF-GNNSGSF  341



>ref|XP_008374189.1| PREDICTED: transcription factor bHLH137-like [Malus domestica]
 ref|XP_008374190.1| PREDICTED: transcription factor bHLH137-like [Malus domestica]
Length=362

 Score = 63.9 bits (154),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 52/138 (38%), Positives = 75/138 (54%), Gaps = 15/138 (11%)
 Frame = +2

Query  2    FLSMKLASVSPMFYDYGMDLDTLMVRPDQEMNIQRVNGLTLPMPNMQQCNPTTTHTPPAV  181
            FLS+KL S++PMFYD+G+D+  L+V+P      +R+     P  ++ QCNPT   TP A 
Sbjct  238  FLSVKLDSLNPMFYDFGIDIGALVVKP------ERLCSTESPYQSVPQCNPTQP-TPFAD  290

Query  182  VSDANTVLTIPSSPPNCDDFS--LLDPSApplfqhpphllnnnlfnqgngqllWGVEDQR  355
             S   T  T  ++     + +   LD SA  L Q P     +           W VEDQR
Sbjct  291  TSTNITATTAVAAAAATTNNNCPFLDSSASLLLQRPNTFFQDGESLL------WDVEDQR  344

Query  356  QKFINQNGFTSNNLCSFH  409
            Q F+N +GF+++NLCSF+
Sbjct  345  QSFLNPSGFSNSNLCSFN  362



>ref|XP_011083355.1| PREDICTED: transcription factor bHLH137-like [Sesamum indicum]
Length=320

 Score = 63.9 bits (154),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 74/136 (54%), Gaps = 32/136 (24%)
 Frame = +2

Query  2    FLSMKLASVSPMFYDYGMDLDTLMVRPDQEMNIQRVNGLTLPMPNMQQCNPTTTHTPPAV  181
            FLSMKLASV+P+ YD+GMDL++LMVRP  + N+      +LP P MQ C+P T +    +
Sbjct  217  FLSMKLASVNPISYDFGMDLESLMVRPPPDQNLS-----SLPSPLMQSCSPATANPYDPL  271

Query  182  VSDANTVLTIPSSPPNCDDFSLLDPSApplfqhpphllnnnlfnqgngqllWGVEDQRQK  361
            +   N +L   S   N                            QGN Q+LWGV+DQRQK
Sbjct  272  LD--NCLLFQQSQISNA-------------------------LPQGNRQVLWGVDDQRQK  304

Query  362  FINQNGFTSNNLCSFH  409
             INQ+  +S++L SFH
Sbjct  305  IINQSKISSSSLFSFH  320



>ref|XP_008239541.1| PREDICTED: transcription factor bHLH137 isoform X1 [Prunus mume]
Length=347

 Score = 63.5 bits (153),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 53/87 (61%), Gaps = 13/87 (15%)
 Frame = +2

Query  2    FLSMKLASVSPMFYDYGMDLDTLMVRPDQEMNIQRVNGLTLPMPNMQQCNPTTTHTPPAV  181
            FLSMKLASV+P+FYD GMDL  LMV+P+      R++ +  P P++ QC+PT     P  
Sbjct  226  FLSMKLASVNPLFYDLGMDLGALMVKPE------RLSSMASPYPSVPQCSPTQ----PTA  275

Query  182  VSDANTVLTIPSSPPNCDDFSLLDPSA  262
             +D +T +T  S+  N   +  LD SA
Sbjct  276  FADTSTNITTFSTANN---YPFLDGSA  299



>ref|XP_006578721.1| PREDICTED: transcription factor bHLH137-like [Glycine max]
 gb|KHN31268.1| Transcription factor bHLH137 [Glycine soja]
Length=346

 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 50/136 (37%), Positives = 66/136 (49%), Gaps = 11/136 (8%)
 Frame = +2

Query  2    FLSMKLASVSPMFYDYGMDLDTLMVRPDQEMNIQRVNGLTLPMPNMQQCNPTTTHTPPAV  181
            FLSMKLASV+PMFYD   DLDTL+VRP++  ++   +     + +    N   T      
Sbjct  222  FLSMKLASVNPMFYDLATDLDTLLVRPEKLNSMASPSPPLPSVSHCNSPNNQATTFADTT  281

Query  182  VSDANTVLTIPSSPPNCDDFSLLDPSApplfqhpphllnnnlfnqgngqllWGVEDQRQK  361
                  +  I S      D+ LLD S     Q     + +      +    W  EDQRQK
Sbjct  282  TMTPTNIFHIAS------DY-LLDNSVSFFLQGQRSNVFSEEDTGSHF---WDAEDQRQK  331

Query  362  FINQNGFTSNNLCSFH  409
            F++  GF SNNLCSFH
Sbjct  332  FLHPCGF-SNNLCSFH  346



>ref|XP_002511110.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF51712.1| DNA binding protein, putative [Ricinus communis]
Length=422

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 36/51 (71%), Gaps = 6/51 (12%)
 Frame = +2

Query  2    FLSMKLASVSPMFYDYGMDLDTLMVRPDQEMNIQRVNGLTLPMPNMQQCNP  154
            FLSMKLASV+P+FYD+GMD D LMVRP+       +N L   +P MQQC P
Sbjct  234  FLSMKLASVNPLFYDFGMDFDALMVRPEG------LNSLASSLPLMQQCPP  278



>ref|XP_009368786.1| PREDICTED: transcription factor bHLH137-like [Pyrus x bretschneideri]
 ref|XP_009368787.1| PREDICTED: transcription factor bHLH137-like [Pyrus x bretschneideri]
Length=354

 Score = 60.1 bits (144),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 49/146 (34%), Positives = 67/146 (46%), Gaps = 39/146 (27%)
 Frame = +2

Query  2    FLSMKLASVSPMFYDYGMDLDTLMVRPDQ----EMNIQRVNGLTLPMPNMQQCNPTTTHT  169
            FLSMKL S +PMFYD+GMDL  L+V+P++    E   Q V     P  +       T   
Sbjct  238  FLSMKLDSSNPMFYDFGMDLGALVVKPERLCSMESPYQSVQTQPTPFADTSTNITATAAA  297

Query  170  P------PAVVSDANTVLTIPSSPPNCDDFSLLDPSApplfqhpphllnnnlfnqgngql  331
                   P + S A+ +L  P++    D  SLL                           
Sbjct  298  FTTNNNCPFLDSSASLLLQRPNTFSQ-DSESLL---------------------------  329

Query  332  lWGVEDQRQKFINQNGFTSNNLCSFH  409
             W VEDQRQ F+N +GF+++NLCSF+
Sbjct  330  -WDVEDQRQSFLNPSGFSNSNLCSFN  354



>ref|XP_010536589.1| PREDICTED: transcription factor bHLH137 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010536590.1| PREDICTED: transcription factor bHLH137 isoform X2 [Tarenaya 
hassleriana]
 ref|XP_010536591.1| PREDICTED: transcription factor bHLH137 isoform X1 [Tarenaya 
hassleriana]
Length=314

 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 63/135 (47%), Gaps = 48/135 (36%)
 Frame = +2

Query  2    FLSMKLASVSPMFYDYGMDLDTLMVRPDQEMNIQRVNGLTLPMPNMQQCNPTTTHTPPAV  181
            FLSMKLAS+SP+ YD+G+DLDT MVRP  EM +      T  MP        TT TP   
Sbjct  227  FLSMKLASMSPVVYDFGVDLDTFMVRP--EMGL--TEAFTEAMP--------TTTTPLF-  273

Query  182  VSDANTVLTIPSSPPNCDDFSLLDPSApplfqhpphllnnnlfnqgngqllWGVEDQRQK  361
                          PN    SLL P  P    +  +                  ++QRQK
Sbjct  274  --------------PN----SLLHPHLPLSHGNNIND-----------------DEQRQK  298

Query  362  FINQNGFTSNNLCSF  406
            FIN +GFT+N+ CSF
Sbjct  299  FINPSGFTNNSFCSF  313



>ref|XP_006584697.1| PREDICTED: transcription factor bHLH137-like isoform X2 [Glycine 
max]
Length=312

 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 50/87 (57%), Gaps = 11/87 (13%)
 Frame = +2

Query  2    FLSMKLASVSPMFYDYGMDLDTLMVRPDQEMNIQRVNGLTLPMPNMQQCNPTTTHTPPAV  181
            FLSMKLA V+PMFYD  +DLDTLMVRPDQ++N      +  P P + Q  P         
Sbjct  220  FLSMKLALVNPMFYDLAIDLDTLMVRPDQKLNY----NIASPSPCLAQFRPNQA----IA  271

Query  182  VSDANTVLTIPSSPPNCDDFSLLDPSA  262
             +D  T  + P++  N  D+ LLD S+
Sbjct  272  FADTTTTNSFPTA--NNGDY-LLDYSS  295



>ref|XP_010322508.1| PREDICTED: transcription factor bHLH137-like [Solanum lycopersicum]
Length=289

 Score = 56.2 bits (134),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +2

Query  2    FLSMKLASVSPMFYDYGMDLDTLMVRPDQ  88
            FLSMKLAS++PM+YD+GMDLD LMV+PDQ
Sbjct  187  FLSMKLASLNPMYYDFGMDLDALMVKPDQ  215



>ref|XP_011002106.1| PREDICTED: transcription factor bHLH137-like isoform X3 [Populus 
euphratica]
Length=358

 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 76/135 (56%), Gaps = 14/135 (10%)
 Frame = +2

Query  5    LSMKLASVSPMFYDYGMDLDTLMVRPDQEMNIQRVNGLTLPMPNMQQCNPTTTHTPPAVV  184
            LSMKLASV+P  YD+GMD D  MVRP+       ++ ++ P+P++++ +P     P A  
Sbjct  238  LSMKLASVNPPLYDFGMDRDAFMVRPES------LSSMSPPLPSLRRNSPI---QPTAFA  288

Query  185  SDANTVLTIPSSPPNCDDFSLLDPSApplfqhpphllnnnlfnqgngqllWGVEDQRQKF  364
              A+      ++  N  ++ L+D SA           ++   +Q +G L+  V++QRQKF
Sbjct  289  DTASATTATFATEEN--NYPLIDNSA--TLFLQGMKPSDFTTHQDSGYLMGDVDEQRQKF  344

Query  365  INQNGFTSNNLCSFH  409
             N +G T NNLCSFH
Sbjct  345  PNPSGLT-NNLCSFH  358



>ref|XP_011002104.1| PREDICTED: transcription factor bHLH137-like isoform X1 [Populus 
euphratica]
Length=362

 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 76/135 (56%), Gaps = 14/135 (10%)
 Frame = +2

Query  5    LSMKLASVSPMFYDYGMDLDTLMVRPDQEMNIQRVNGLTLPMPNMQQCNPTTTHTPPAVV  184
            LSMKLASV+P  YD+GMD D  MVRP+       ++ ++ P+P++++ +P     P A  
Sbjct  242  LSMKLASVNPPLYDFGMDRDAFMVRPES------LSSMSPPLPSLRRNSPI---QPTAFA  292

Query  185  SDANTVLTIPSSPPNCDDFSLLDPSApplfqhpphllnnnlfnqgngqllWGVEDQRQKF  364
              A+      ++  N  ++ L+D SA           ++   +Q +G L+  V++QRQKF
Sbjct  293  DTASATTATFATEEN--NYPLIDNSA--TLFLQGMKPSDFTTHQDSGYLMGDVDEQRQKF  348

Query  365  INQNGFTSNNLCSFH  409
             N +G T NNLCSFH
Sbjct  349  PNPSGLT-NNLCSFH  362



>ref|XP_011002105.1| PREDICTED: transcription factor bHLH137-like isoform X2 [Populus 
euphratica]
Length=359

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 47/135 (35%), Positives = 71/135 (53%), Gaps = 17/135 (13%)
 Frame = +2

Query  5    LSMKLASVSPMFYDYGMDLDTLMVRPDQEMNIQRVNGLTLPMPNMQQCNPTTTHTPPAVV  184
            LSMKLASV+P  YD+GMD D  MVRP+       ++ ++ P+P++++ +P     P A  
Sbjct  242  LSMKLASVNPPLYDFGMDRDAFMVRPES------LSSMSPPLPSLRRNSPI---QPTAFA  292

Query  185  SDANTVLTIPSSPPNCDDFSLLDPSApplfqhpphllnnnlfnqgngqllWGVEDQRQKF  364
              A+      ++  N  ++ L+D SA                   +  L+  V++QRQKF
Sbjct  293  DTASATTATFATEEN--NYPLIDNSA-----TLFLQGMKPSDFTTHQDLMGDVDEQRQKF  345

Query  365  INQNGFTSNNLCSFH  409
             N +G T NNLCSFH
Sbjct  346  PNPSGLT-NNLCSFH  359



>ref|XP_006347483.1| PREDICTED: transcription factor bHLH137-like [Solanum tuberosum]
Length=258

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +2

Query  2    FLSMKLASVSPMFYDYGMDLDTLMVRPDQ  88
            FLSMKLAS++PM+YD+GM+LD LMV+PDQ
Sbjct  187  FLSMKLASLNPMYYDFGMELDALMVKPDQ  215



>gb|KDO44051.1| hypothetical protein CISIN_1g017497mg [Citrus sinensis]
Length=326

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 33/45 (73%), Gaps = 2/45 (4%)
 Frame = +2

Query  2    FLSMKLASVSPMFYDYGMDLD-TLMVRPDQEMNIQRVNGLTLPMP  133
            FLSMKLASV+PMFYD+GMDLD T MVRPD +  +Q +     P P
Sbjct  245  FLSMKLASVNPMFYDFGMDLDNTFMVRPD-DQQLQHLKCNAAPQP  288



>ref|XP_006436930.1| hypothetical protein CICLE_v10031873mg [Citrus clementina]
 gb|ESR50170.1| hypothetical protein CICLE_v10031873mg [Citrus clementina]
Length=326

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 33/45 (73%), Gaps = 2/45 (4%)
 Frame = +2

Query  2    FLSMKLASVSPMFYDYGMDLD-TLMVRPDQEMNIQRVNGLTLPMP  133
            FLSMKLASV+PMFYD+GMDLD T MVRPD +  +Q +     P P
Sbjct  245  FLSMKLASVNPMFYDFGMDLDNTFMVRPD-DQQLQHLKCNAAPQP  288



>ref|XP_006436928.1| hypothetical protein CICLE_v10031873mg [Citrus clementina]
 gb|ESR50168.1| hypothetical protein CICLE_v10031873mg [Citrus clementina]
Length=286

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 1/29 (3%)
 Frame = +2

Query  2    FLSMKLASVSPMFYDYGMDLD-TLMVRPD  85
            FLSMKLASV+PMFYD+GMDLD T MVRPD
Sbjct  245  FLSMKLASVNPMFYDFGMDLDNTFMVRPD  273



>ref|XP_004298536.1| PREDICTED: transcription factor bHLH137-like [Fragaria vesca 
subsp. vesca]
Length=291

 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 68/136 (50%), Gaps = 24/136 (18%)
 Frame = +2

Query  2    FLSMKLASVSPMFYDYGMDLDTLMVRPDQEMNIQRVNGLTLPMPNMQQCNPTTTHTPPAV  181
            FLSMKLASV+PMFY++G DL  LMV+  QE +         P     QC+PT     P  
Sbjct  180  FLSMKLASVNPMFYEFGPDLGDLMVK--QEAS---------PFSTGPQCSPTQ----PTN  224

Query  182  VSDANTVLTIPSSPPNCDDFSLLDPSApplfqhpphllnnnlfnqgngqllWGVEDQRQK  361
             +D +T     +     +++  LD                  F+Q N  LLW  EDQRQ 
Sbjct  225  FADTSTTAATTTFTAATNNYPFLD-------SLLHQSPRPTAFHQDNESLLWDGEDQRQS  277

Query  362  FINQNGFTSNNLCSFH  409
            F+N +GF  NNLCSF+
Sbjct  278  FLNPSGF--NNLCSFN  291



>ref|XP_004501739.1| PREDICTED: transcription factor bHLH137-like [Cicer arietinum]
Length=331

 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 49/137 (36%), Positives = 67/137 (49%), Gaps = 18/137 (13%)
 Frame = +2

Query  2    FLSMKLASVSPMFYDYGMDLDTLMVRPDQEMNIQRVNGLTLPMPNMQQCNPTTTHTPPAV  181
            FLSMKLASV+PM YD   DLDT + R ++ +N        L   ++  CN     +P   
Sbjct  212  FLSMKLASVNPMIYDLATDLDTFLGRTEK-LNSLASP-SPLSSVSVSHCN-----SPKQA  264

Query  182  VSDANTVLTIPSSPPNCDDFSLLDPSApplfqhpphllnnnlfnqgngqllWGVEDQRQK  361
             + A+    I  +  +     LLD SA    Q     + +   +       W  EDQRQK
Sbjct  265  TTFADPTTNIFQTATDY----LLDNSASIFLQGQRSNVVSEDGSNF-----WDTEDQRQK  315

Query  362  F-INQNGFTSNNLCSFH  409
            F ++ +GF SNNLCSFH
Sbjct  316  FLLHSHGF-SNNLCSFH  331



>ref|XP_007038103.1| DNA binding protein, putative isoform 4, partial [Theobroma cacao]
 gb|EOY22604.1| DNA binding protein, putative isoform 4, partial [Theobroma cacao]
Length=292

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = +2

Query  2    FLSMKLASVSPMFYDYGMDLDTLMVRPD  85
            FLSMKLASV+PMFYD+G+DL+ LMVRP+
Sbjct  231  FLSMKLASVNPMFYDFGVDLEALMVRPE  258



>ref|XP_007159982.1| hypothetical protein PHAVU_002G283100g [Phaseolus vulgaris]
 gb|ESW31976.1| hypothetical protein PHAVU_002G283100g [Phaseolus vulgaris]
Length=359

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 69/134 (51%), Gaps = 24/134 (18%)
 Frame = +2

Query  2    FLSMKLASVSPMFYDYGMDLDTLMVRPDQEMNIQRVNGLTLP--MPNMQQCNPTTTHTPP  175
            FLSMKLASV+PMF+D  MDLDTLM          ++N    P  +P ++QC P       
Sbjct  241  FLSMKLASVNPMFFDLAMDLDTLM----------KLNNAASPSLLPCVEQCRPNQA----  286

Query  176  AVVSDANTVLTIPSSPP--NCDDFSLLDPSApplfqhpphllnnnlfnqgngqllWGVED  349
               +D  T+ T  SS P  N DD+ LLD S+             N F + NG  +W V D
Sbjct  287  LAFADTTTLTTTTSSFPTANNDDY-LLDYSS----SSFLQPHRPNAFFEYNGGQIWEV-D  340

Query  350  QRQKFINQNGFTSN  391
            QRQKF++  GF  N
Sbjct  341  QRQKFLHPYGFADN  354



>gb|ACN21645.1| putative basic helix-loop-helix protein BHLH8 [Lotus japonicus]
Length=309

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 36/54 (67%), Gaps = 8/54 (15%)
 Frame = +2

Query  2    FLSMKLASVSPMFYDYGMDLDTLMVRPDQEMNIQRVNGLTLP---MPNMQQCNP  154
            FLSMKLASV+PM +D  MDLD L+VRP+     Q+VN L  P   +P +  CNP
Sbjct  181  FLSMKLASVNPMLFDMAMDLDNLLVRPE-----QKVNSLASPPLVLPCVPLCNP  229



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2009378593860