BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c109259_g1_i1 len=393 path=[1:0-392]

Length=393
                                                                      Score     E

gb|AAA34192.1|  ribulose-1,5-bisphosphate carboxylase, small subu...    187   3e-57   Solanum lycopersicum
ref|XP_004234568.1|  PREDICTED: ribulose bisphosphate carboxylase...    187   4e-57   
ref|XP_009795055.1|  PREDICTED: ribulose bisphosphate carboxylase...    185   2e-56   
ref|XP_009602965.1|  PREDICTED: ribulose bisphosphate carboxylase...    185   2e-56   
ref|XP_009767108.1|  PREDICTED: ribulose bisphosphate carboxylase...    185   3e-56   
ref|XP_009625434.1|  PREDICTED: ribulose bisphosphate carboxylase...    185   3e-56   
ref|XP_009774104.1|  PREDICTED: ribulose bisphosphate carboxylase...    184   3e-56   
ref|XP_009800809.1|  PREDICTED: ribulose bisphosphate carboxylase...    184   3e-56   
sp|P07180.1|RBS3A_SOLLC  RecName: Full=Ribulose bisphosphate carb...    184   3e-56   Solanum lycopersicum
ref|XP_009758143.1|  PREDICTED: ribulose bisphosphate carboxylase...    184   3e-56   
ref|XP_006363111.1|  PREDICTED: ribulose bisphosphate carboxylase...    184   4e-56   
sp|P26575.1|RBSA_SOLTU  RecName: Full=Ribulose bisphosphate carbo...    184   4e-56   Solanum tuberosum [potatoes]
sp|P26576.1|RBSB_SOLTU  RecName: Full=Ribulose bisphosphate carbo...    184   4e-56   Solanum tuberosum [potatoes]
ref|XP_004232356.1|  PREDICTED: ribulose bisphosphate carboxylase...    184   4e-56   
sp|P32764.1|RBS3_SOLTU  RecName: Full=Ribulose bisphosphate carbo...    184   4e-56   Solanum tuberosum [potatoes]
pdb|3RUB|S  Chain S, Crystal Structure Of The Unactivated Form Of...    181   1e-55   
gb|AFB70994.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    183   1e-55   
gb|AAA34111.1|  ribulose-1,5-bisphosphate carboxylase                   179   2e-55   Nicotiana sylvestris
gb|AFW90575.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    182   3e-55   
ref|XP_006358055.1|  PREDICTED: ribulose-1,5-bisphosphate carboxy...    182   4e-55   
pdb|4RUB|S  Chain S, A Crystal Form Of Ribulose-1,5-Bisphosphate ...    179   5e-55   
ref|XP_004233493.1|  PREDICTED: ribulose bisphosphate carboxylase...    181   8e-55   
gb|AAA34191.1|  ribulose-1,5-bisphosphate carboxylase, small subu...    181   1e-54   Solanum lycopersicum
sp|P26574.1|RBS1_SOLTU  RecName: Full=Ribulose bisphosphate carbo...    180   1e-54   Solanum tuberosum [potatoes]
gb|ABY21254.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    180   1e-54   Solanum tuberosum [potatoes]
prf||0902172A  carboxylase/oxygenase,RBP                                178   2e-54
ref|NP_001275244.1|  ribulose bisphosphate carboxylase small chai...    179   5e-54   
gb|AAR83879.1|  Cristal-Glass1 protein                                  179   5e-54   Capsicum annuum
gb|AGT97045.1|  ribulose 1,5-bisphosphate carboxylase/oxygenase s...    179   5e-54   
gb|ABY21253.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    179   5e-54   Solanum tuberosum [potatoes]
gb|AHI85721.1|  stress-induced protein 16                               179   6e-54   
ref|XP_009595081.1|  PREDICTED: ribulose bisphosphate carboxylase...    179   6e-54   
ref|WP_037767734.1|  hypothetical protein                               176   2e-53   
ref|WP_026003795.1|  hypothetical protein                               175   3e-53   
sp|P26573.1|RBS8_NICPL  RecName: Full=Ribulose bisphosphate carbo...    176   6e-53   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
sp|O65349.1|RBS_CAPAN  RecName: Full=Ribulose bisphosphate carbox...    175   1e-52   Capsicum annuum
gb|ABY21255.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    174   3e-52   Solanum tuberosum [potatoes]
sp|Q41351.1|RBS_STELP  RecName: Full=Ribulose bisphosphate carbox...    169   3e-50   Stellaria longipes
ref|XP_008381263.1|  PREDICTED: ribulose bisphosphate carboxylase...    169   5e-50   
sp|P04715.1|RBS2_PETHY  RecName: Full=Ribulose bisphosphate carbo...    168   7e-50   Petunia x hybrida [garden petunia]
gb|AAA33866.1|  ribulose 1,5-bisphosphate carboxylase small subunit     168   7e-50   Malus domestica x Pyrus communis
ref|XP_010263795.1|  PREDICTED: ribulose bisphosphate carboxylase...    168   1e-49   
sp|Q02980.1|RBS_MALSP  RecName: Full=Ribulose bisphosphate carbox...    167   2e-49   Malus sp.
ref|XP_010263805.1|  PREDICTED: ribulose bisphosphate carboxylase...    167   2e-49   
sp|P04714.1|RBS1_PETHY  RecName: Full=Ribulose bisphosphate carbo...    167   3e-49   Petunia x hybrida [garden petunia]
ref|XP_008368660.1|  PREDICTED: ribulose bisphosphate carboxylase...    166   5e-49   
ref|XP_010265138.1|  PREDICTED: ribulose bisphosphate carboxylase...    165   1e-48   
emb|CAH59401.1|  Rubisco SSU                                            165   1e-48   Plantago major [cart-track plant]
gb|AAO25119.1|  ribulose-1,5-bisphosphate carboxylase small subunit     165   1e-48   Chrysanthemum x morifolium [florist's chrysanthemum]
sp|Q39744.1|RBS2_FLAPR  RecName: Full=Ribulose bisphosphate carbo...    165   2e-48   Flaveria pringlei
ref|XP_009357812.1|  PREDICTED: ribulose bisphosphate carboxylase...    165   2e-48   
ref|XP_004303137.1|  PREDICTED: ribulose bisphosphate carboxylase...    164   2e-48   
ref|XP_009342656.1|  PREDICTED: ribulose bisphosphate carboxylase...    164   4e-48   
sp|Q39746.1|RBS4_FLAPR  RecName: Full=Ribulose bisphosphate carbo...    164   4e-48   Flaveria pringlei
sp|P24007.1|RBS_PYRPY  RecName: Full=Ribulose bisphosphate carbox...    164   5e-48   Pyrus pyrifolia [sha li]
gb|ACU13285.1|  unknown                                                 163   6e-48   Glycine max [soybeans]
sp|Q39749.1|RBS7_FLAPR  RecName: Full=Ribulose bisphosphate carbo...    163   6e-48   Flaveria pringlei
ref|NP_001235314.1|  uncharacterized protein LOC100500504               163   6e-48   
ref|NP_001241137.1|  ribulose bisphosphate carboxylase small chai...    163   6e-48   
ref|NP_001235266.1|  ribulose-1,5-bisphosphate carboxylase small ...    163   6e-48   
sp|Q39745.1|RBS3_FLAPR  RecName: Full=Ribulose bisphosphate carbo...    163   7e-48   Flaveria pringlei
sp|Q39747.1|RBS5_FLAPR  RecName: Full=Ribulose bisphosphate carbo...    163   8e-48   Flaveria pringlei
gb|AAK16227.1|AF044395_1  ribulose-1,5-bisphosphate carboxylase s...    161   1e-47   Flaveria ramosissima
gb|AAK16228.1|AF044396_1  ribulose-1,5-bisphosphate carboxylase s...    161   1e-47   Flaveria ramosissima
gb|AFK48034.1|  unknown                                                 162   1e-47   
gb|AAG24884.1|AF303941_1  ribulose-1,5-bisphosphate carboxylase s...    162   1e-47   Glycine max [soybeans]
ref|XP_004299075.1|  PREDICTED: ribulose bisphosphate carboxylase...    162   2e-47   
gb|AFK36660.1|  unknown                                                 162   2e-47   
sp|Q39743.1|RBS1_FLAPR  RecName: Full=Ribulose bisphosphate carbo...    161   3e-47   Flaveria pringlei
gb|AAP31053.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    161   4e-47   Flaveria bidentis
sp|Q42823.1|RBS_GLYTA  RecName: Full=Ribulose bisphosphate carbox...    161   5e-47   Glycine tabacina
emb|CAH59404.1|  Rubisco SSU                                            160   5e-47   Plantago major [cart-track plant]
sp|P07089.1|RBS_FLATR  RecName: Full=Ribulose bisphosphate carbox...    160   7e-47   Flaveria trinervia
gb|AAP31054.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    160   7e-47   Flaveria bidentis
sp|Q39748.1|RBS6_FLAPR  RecName: Full=Ribulose bisphosphate carbo...    160   8e-47   Flaveria pringlei
sp|P00865.1|RBS1_SOYBN  RecName: Full=Ribulose bisphosphate carbo...    160   8e-47   Glycine max [soybeans]
gb|ACO35888.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    160   8e-47   Ageratina adenophora
ref|XP_007215051.1|  hypothetical protein PRUPE_ppa012123mg             160   8e-47   
gb|AFK33868.1|  unknown                                                 160   8e-47   
gb|AAK16231.1|AF044399_1  ribulose-1,5-bisphosphate carboxylase s...    159   1e-46   Flaveria palmeri
ref|XP_010044264.1|  PREDICTED: ribulose bisphosphate carboxylase...    160   1e-46   
gb|AAK16232.1|AF044400_1  ribulose-1,5-bisphosphate carboxylase s...    158   1e-46   Flaveria palmeri
ref|XP_008244506.1|  PREDICTED: ribulose bisphosphate carboxylase...    160   1e-46   
gb|EYU44637.1|  hypothetical protein MIMGU_mgv1a0165712mg               157   1e-46   
gb|AFK42721.1|  unknown                                                 160   1e-46   
gb|AAW31667.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    159   2e-46   Ammopiptanthus mongolicus
gb|ABJ74187.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    157   2e-46   Artemisia annua [sweet Annie]
sp|P08705.1|RBS_HELAN  RecName: Full=Ribulose bisphosphate carbox...    159   2e-46   Helianthus annuus
sp|Q42822.1|RBS_GLYTO  RecName: Full=Ribulose bisphosphate carbox...    159   2e-46   Glycine tomentella [wooly glycine]
ref|XP_002531624.1|  Ribulose bisphosphate carboxylase small chai...    159   2e-46   Ricinus communis
ref|XP_011099669.1|  PREDICTED: ribulose bisphosphate carboxylase...    159   3e-46   
ref|XP_007151650.1|  hypothetical protein PHAVU_004G064800g             159   3e-46   
emb|CAA42618.1|  ribulose bisphosphate carboxylase                      159   3e-46   Phaseolus vulgaris [French bean]
gb|AGV54682.1|  ribulose bisphosphate carboxylase                       159   3e-46   
gb|ABS57004.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    157   4e-46   
ref|XP_007151771.1|  hypothetical protein PHAVU_004G073400g             156   5e-46   
sp|Q08186.1|RBS6_MESCR  RecName: Full=Ribulose bisphosphate carbo...    159   5e-46   Mesembryanthemum crystallinum
gb|AAK16230.1|AF044398_1  ribulose-1,5-bisphosphate carboxylase s...    157   5e-46   Flaveria palmeri
ref|XP_011099670.1|  PREDICTED: ribulose bisphosphate carboxylase...    158   5e-46   
gb|AAA33036.1|  ribulose 1,5-bisphosphate carboxylase/oxygenase s...    158   5e-46   Mesembryanthemum crystallinum
ref|XP_002532149.1|  Ribulose bisphosphate carboxylase small chai...    158   6e-46   Ricinus communis
sp|P16032.2|RBS1_MESCR  RecName: Full=Ribulose bisphosphate carbo...    158   6e-46   Mesembryanthemum crystallinum
gb|AAA33035.1|  ribulose-1-5-bisphosphate carboxylase                   158   7e-46   Mesembryanthemum crystallinum
emb|CAA42617.1|  ribulose bisphosphate carboxylase                      157   7e-46   Phaseolus vulgaris [French bean]
gb|AAU14862.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    158   7e-46   Fagus sylvatica
sp|O22077.1|RBS_FAGCR  RecName: Full=Ribulose bisphosphate carbox...    158   7e-46   Fagus crenata
gb|KDP20120.1|  hypothetical protein JCGZ_05889                         158   9e-46   
ref|XP_002521232.1|  Ribulose bisphosphate carboxylase small chai...    158   9e-46   Ricinus communis
sp|P12468.1|RBS4_SOYBN  RecName: Full=Ribulose bisphosphate carbo...    157   9e-46   Glycine max [soybeans]
gb|AAA82069.1|  ribulose 1,5-bisphosphate carboxylase small subun...    157   1e-45   Glycine soja [wild soybean]
gb|ABS72189.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    157   1e-45   Corchorus olitorius [Nalta jute]
gb|ADB85091.1|  ribulose 1,5-bisphosphate carboxylase small subunit     157   1e-45   
sp|Q08183.1|RBS3_MESCR  RecName: Full=Ribulose bisphosphate carbo...    157   1e-45   Mesembryanthemum crystallinum
ref|XP_010693073.1|  PREDICTED: ribulose bisphosphate carboxylase...    157   1e-45   
sp|Q04450.1|RBS2_MESCR  RecName: Full=Ribulose bisphosphate carbo...    157   1e-45   Mesembryanthemum crystallinum
ref|XP_011089882.1|  PREDICTED: ribulose bisphosphate carboxylase...    157   1e-45   
gb|AAA33037.1|  ribulose 1,5-bisphosphate carboxylase/oxygenase s...    157   1e-45   Mesembryanthemum crystallinum
gb|AIF75346.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    156   2e-45   
gb|AIF75351.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    156   2e-45   
gb|AIF75367.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    156   2e-45   
gb|AIF75359.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    156   2e-45   
gb|AIF75353.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    156   2e-45   
gb|AIF75355.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    156   2e-45   
ref|XP_010693059.1|  PREDICTED: ribulose bisphosphate carboxylase...    157   2e-45   
gb|AIF75349.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    156   2e-45   
gb|AIF75364.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    156   2e-45   
gb|AIF75361.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    156   2e-45   
sp|Q08184.1|RBS4_MESCR  RecName: Full=Ribulose bisphosphate carbo...    157   2e-45   Mesembryanthemum crystallinum
dbj|BAI53118.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    157   2e-45   Eucalyptus globulus [blue gum]
sp|Q08185.1|RBS5_MESCR  RecName: Full=Ribulose bisphosphate carbo...    157   2e-45   Mesembryanthemum crystallinum
ref|XP_011035062.1|  PREDICTED: ribulose bisphosphate carboxylase...    157   3e-45   
dbj|BAE46384.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    156   3e-45   Panax ginseng [Asiatic ginseng]
gb|AGV08375.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    156   4e-45   
ref|XP_006391132.1|  hypothetical protein EUTSA_v10019199mg             156   5e-45   
ref|XP_010669829.1|  PREDICTED: ribulose bisphosphate carboxylase...    156   5e-45   
ref|XP_010103758.1|  hypothetical protein L484_014647                   156   5e-45   
ref|XP_010032637.1|  PREDICTED: ribulose bisphosphate carboxylase...    155   6e-45   
pdb|4MKV|S  Chain S, Structure Of Pisum Sativum Rubisco With Aba        153   8e-45   
sp|Q96542.1|RBS_BETPN  RecName: Full=Ribulose bisphosphate carbox...    155   8e-45   Betula pendula [white birch]
gb|AIF75363.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    154   9e-45   
ref|XP_006663954.1|  PREDICTED: ribulose bisphosphate carboxylase...    154   1e-44   
sp|P07689.1|RBS3_PEA  RecName: Full=Ribulose bisphosphate carboxy...    155   1e-44   Pisum sativum [garden pea]
ref|WP_039311749.1|  hypothetical protein                               153   1e-44   
sp|P00869.1|RBS2_PEA  RecName: Full=Ribulose bisphosphate carboxy...    154   2e-44   Pisum sativum [garden pea]
pdb|3AXK|S  Chain S, Structure Of Rice Rubisco In Complex With Na...    153   2e-44   
gb|AFO67218.1|  putative ribulose-1,5-bisphosphate carboxylase/ox...    154   2e-44   
ref|XP_006663955.1|  PREDICTED: ribulose bisphosphate carboxylase...    154   2e-44   
ref|XP_006663961.1|  PREDICTED: ribulose bisphosphate carboxylase...    154   2e-44   
sp|Q43832.1|RBS2_SPIOL  RecName: Full=Ribulose bisphosphate carbo...    154   2e-44   Spinacia oleracea
ref|XP_006664952.1|  PREDICTED: ribulose bisphosphate carboxylase...    154   2e-44   
gb|AAB81105.1|  ribulose 1,5-bisphosphate carboxylase small subunit     154   3e-44   Spinacia oleracea
ref|XP_007033270.1|  Ribulose bisphosphate carboxylase (small cha...    154   3e-44   
ref|XP_010036887.1|  PREDICTED: ribulose bisphosphate carboxylase...    154   4e-44   
gb|AAA33685.2|  ribulose 1,5 bisphosphate carboxylase                   152   4e-44   Pisum sativum [garden pea]
pdb|1IR1|S  Chain S, Crystal Structure Of Spinach Ribulose-1,5-Bi...    151   6e-44   
dbj|BAK23964.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    152   7e-44   
ref|XP_010528479.1|  PREDICTED: LOW QUALITY PROTEIN: ribulose bis...    154   7e-44   
gb|AAL82195.1|AF396697_1  s/s2                                          150   8e-44   Nicotiana benthamiana
ref|WP_028130706.1|  hypothetical protein                               151   8e-44   
ref|XP_010693099.1|  PREDICTED: ribulose bisphosphate carboxylase...    153   8e-44   
sp|Q9XGX4.1|RBS3_AMAHP  RecName: Full=Ribulose bisphosphate carbo...    153   8e-44   Amaranthus hypochondriacus [prince's feather]
gb|AHC28978.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    152   8e-44   
gb|EAY97115.1|  hypothetical protein OsI_19041                          152   8e-44   Oryza sativa Indica Group [Indian rice]
gb|AIF75365.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    152   8e-44   
gb|ABK15574.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    152   8e-44   Camellia sinensis [black tea]
gb|AAA84592.1|  ribulose 1,5-bisphosphate carboxylase                   152   9e-44   Oryza sativa [red rice]
gb|AAA33716.1|  ribulose 1,5-bisphosphate carboxylase                   150   9e-44   Petunia x hybrida [garden petunia]
pdb|1AUS|S  Chain S, Activated Unliganded Spinach Rubisco               150   1e-43   
ref|XP_010693054.1|  PREDICTED: ribulose bisphosphate carboxylase...    152   1e-43   
ref|XP_011021244.1|  PREDICTED: ribulose bisphosphate carboxylase...    152   1e-43   
ref|NP_001066606.1|  Os12g0291400                                       152   1e-43   Oryza sativa Japonica Group [Japonica rice]
emb|CAD21856.1|  putative ribulose 1,5 biphosphate carboxylase sm...    152   1e-43   Rumex obtusifolius
gb|ABR26086.1|  ribulose bisphosphate carboxylase small chain c         149   1e-43   Oryza sativa Indica Group [Indian rice]
ref|XP_002888576.1|  ribulose bisphosphate carboxylase small chai...    152   2e-43   
ref|NP_176880.1|  ribulose bisphosphate carboxylase small chain 1A      152   2e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008446602.1|  PREDICTED: ribulose bisphosphate carboxylase...    152   2e-43   
ref|NP_001066604.1|  Os12g0291100                                       152   2e-43   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001066559.1|  Os12g0274700                                       152   2e-43   Oryza sativa Japonica Group [Japonica rice]
emb|CAD11990.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    152   2e-43   Coffea arabica [arabica coffee]
ref|WP_039311073.1|  hypothetical protein                               150   2e-43   
dbj|BAA00539.1|  small subunit of ribulose-1,5-bisphosphate carbo...    151   2e-43   Oryza sativa Japonica Group [Japonica rice]
dbj|BAI53119.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    152   2e-43   Eucalyptus globulus [blue gum]
gb|ABN41481.1|  putative chloroplast ribulose-1,5-bisphosphate ca...    149   2e-43   Cucumis sativus [cucumbers]
emb|CAA59218.1|  ribulose-bisphosphate carboxylase                      150   2e-43   
gb|ABK96567.1|  unknown                                                 152   2e-43   Populus trichocarpa x Populus deltoides
pdb|3AXM|S  Chain S, Structure Of Rice Rubisco In Complex With 6pg      150   2e-43   
emb|CBY05833.1|  Ribulose 1,5-bisphosphate carboxylase small subu...    152   2e-43   
ref|XP_007036525.1|  Ribulose bisphosphate carboxylase (small cha...    151   2e-43   
sp|Q42516.1|RBS1_AMAHP  RecName: Full=Ribulose bisphosphate carbo...    151   3e-43   Amaranthus hypochondriacus [prince's feather]
pdb|1WDD|S  Chain S, Crystal Structure Of Activated Rice Rubisco ...    150   3e-43   
gb|ABR25969.1|  ribulose bisphosphate carboxylase small chain c         150   3e-43   Oryza sativa Indica Group [Indian rice]
sp|P00872.2|RBS1_LEMGI  RecName: Full=Ribulose bisphosphate carbo...    151   3e-43   Lemna gibba
ref|NP_001066607.1|  Os12g0292400                                       151   3e-43   Oryza sativa Japonica Group [Japonica rice]
emb|CAA24969.1|  unnamed protein product                                149   3e-43   Lemna gibba
emb|CAA31948.1|  ribulose bisphosphate carboxylase                      151   3e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006383456.1|  Ribulose bisphosphate carboxylase small chai...    151   3e-43   
ref|XP_002868775.1|  ribulose bisphosphate carboxylase small chai...    151   3e-43   
gb|KCW52065.1|  hypothetical protein EUGRSUZ_J01502                     151   3e-43   
ref|XP_002868776.1|  ribulose bisphosphate carboxylase                  151   3e-43   
ref|XP_004135094.1|  PREDICTED: ribulose bisphosphate carboxylase...    151   3e-43   
emb|CDY67657.1|  BnaCnng55860D                                          151   3e-43   
ref|XP_006285696.1|  hypothetical protein CARUB_v10007166mg             151   4e-43   
gb|EYU38174.1|  hypothetical protein MIMGU_mgv1a014707mg                151   4e-43   
gb|EAY82834.1|  hypothetical protein OsI_38046                          151   4e-43   Oryza sativa Indica Group [Indian rice]
emb|CCF55356.1|  ribulose-1,5-bisphosphate carboxylase small subunit    151   4e-43   
ref|XP_006284616.1|  hypothetical protein CARUB_v10005847mg             151   4e-43   
gb|AIB04188.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    151   4e-43   
ref|XP_010450911.1|  PREDICTED: ribulose bisphosphate carboxylase...    151   4e-43   
ref|XP_010521010.1|  PREDICTED: ribulose bisphosphate carboxylase...    151   4e-43   
sp|P08474.1|RBS_CUCSA  RecName: Full=Ribulose bisphosphate carbox...    151   4e-43   Cucumis sativus [cucumbers]
gb|KDP29409.1|  hypothetical protein JCGZ_18330                         150   4e-43   
gb|AIF75357.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    150   4e-43   
ref|XP_010450913.1|  PREDICTED: ribulose bisphosphate carboxylase...    151   4e-43   
ref|XP_006285820.1|  hypothetical protein CARUB_v10007296mg             151   4e-43   
sp|P08135.1|RBS_RAPSA  RecName: Full=Ribulose bisphosphate carbox...    151   4e-43   Raphanus sativus
ref|XP_010450912.1|  PREDICTED: ribulose bisphosphate carboxylase...    151   4e-43   
gb|AIF75342.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    150   5e-43   
gb|AIF75344.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    150   5e-43   
ref|XP_010435745.1|  PREDICTED: ribulose bisphosphate carboxylase...    150   5e-43   
ref|XP_010435743.1|  PREDICTED: ribulose bisphosphate carboxylase...    150   5e-43   
gb|AIF75283.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    150   5e-43   
gb|ABK95229.1|  unknown                                                 150   5e-43   Populus trichocarpa [western balsam poplar]
gb|AAK49590.1|AF372874_1  F1O19.10/F1O19.10                             149   5e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002305162.2|  Ribulose bisphosphate carboxylase small chai...    150   5e-43   Populus trichocarpa [western balsam poplar]
emb|CDP20139.1|  unnamed protein product                                150   6e-43   
gb|ABC17790.1|  plastid ribulose-1,5-bisphosphate carboxylase/oxy...    148   7e-43   Coffea arabica [arabica coffee]
ref|XP_006405770.1|  hypothetical protein EUTSA_v10027955mg             150   7e-43   
sp|P19311.1|RBS5_LEMGI  RecName: Full=Ribulose bisphosphate carbo...    150   8e-43   Lemna gibba
emb|CAA32702.1|  ribulose bisphosphate carboxylase                      150   8e-43   Arabidopsis thaliana [mouse-ear cress]
emb|CAA32701.1|  ribulose bisphosphate carboxylase                      150   8e-43   Arabidopsis thaliana [mouse-ear cress]
sp|P19308.1|RBS2_LEMGI  RecName: Full=Ribulose bisphosphate carbo...    150   8e-43   Lemna gibba
ref|NP_198657.1|  ribulose bisphosphate carboxylase small chain 3B      150   8e-43   Arabidopsis thaliana [mouse-ear cress]
ref|NP_198658.1|  ribulose bisphosphate carboxylase small chain 2B      150   9e-43   Arabidopsis thaliana [mouse-ear cress]
ref|NP_198659.1|  ribulose bisphosphate carboxylase small chain 1B      150   9e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003618736.1|  Ribulose bisphosphate carboxylase small chain      150   9e-43   
sp|P18960.1|RBS_SILPR  RecName: Full=Ribulose bisphosphate carbox...    150   9e-43   Silene latifolia subsp. alba [white campion]
gb|AIF75291.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    149   9e-43   
gb|AFK40375.1|  unknown                                                 150   9e-43   
sp|P19312.1|RBS6_LEMGI  RecName: Full=Ribulose bisphosphate carbo...    150   1e-42   Lemna gibba
gb|AAA33686.1|  ribulose 1,5-bisphosphate carboxylase small subun...    149   1e-42   Pisum sativum [garden pea]
dbj|BAK23963.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    149   1e-42   
gb|AIF75322.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    150   1e-42   
gb|AIF75294.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    149   1e-42   
sp|Q40250.1|RBS_LACSA  RecName: Full=Ribulose bisphosphate carbox...    150   1e-42   Lactuca sativa [cultivated lettuce]
gb|ACQ90229.1|  TuMV resistance protein-like protein                    149   1e-42   
ref|XP_010440945.1|  PREDICTED: ribulose bisphosphate carboxylase...    149   1e-42   
emb|CAA10290.1|  ribulose 1,5-bisphosphate carboxylase small subunit    149   1e-42   Cicer arietinum [garbanzo]
ref|XP_003618735.1|  Ribulose bisphosphate carboxylase small chain      149   1e-42   
emb|CDY52468.1|  BnaA04g27920D                                          149   1e-42   
ref|XP_010440948.1|  PREDICTED: ribulose bisphosphate carboxylase...    149   1e-42   
gb|AIF75296.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    149   2e-42   
sp|Q9XGX5.1|RBS2_AMAHP  RecName: Full=Ribulose bisphosphate carbo...    149   2e-42   Amaranthus hypochondriacus [prince's feather]
gb|AIF75288.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    149   2e-42   
gb|AIF75285.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    149   2e-42   
emb|CDX67402.1|  BnaA07g14420D                                          149   2e-42   
gb|AIF75289.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    149   2e-42   
ref|XP_009125072.1|  PREDICTED: ribulose bisphosphate carboxylase...    149   2e-42   
sp|P05346.2|RBS1_BRANA  RecName: Full=Ribulose bisphosphate carbo...    149   2e-42   Brassica napus [oilseed rape]
gb|AIF75323.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    149   2e-42   
gb|AIR75142.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    149   2e-42   
ref|XP_003581511.1|  PREDICTED: ribulose bisphosphate carboxylase...    149   2e-42   
gb|AIF75340.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    149   2e-42   
emb|CDX99682.1|  BnaC04g34390D                                          149   2e-42   
ref|XP_009139778.1|  PREDICTED: ribulose bisphosphate carboxylase...    149   2e-42   
emb|CAA30290.1|  rubisco ssu precursor                                  149   2e-42   Brassica napus [oilseed rape]
dbj|BAJ08160.1|  ribulose 1,5-bisphosphate carboxylase/oxygenase        149   2e-42   
dbj|BAK23962.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    149   2e-42   
ref|XP_010551266.1|  PREDICTED: ribulose bisphosphate carboxylase...    149   3e-42   
gb|AIF75295.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    148   3e-42   
gb|AIF75332.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    149   3e-42   
gb|AIF75317.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    149   3e-42   
emb|CDY01665.1|  BnaC04g30870D                                          149   3e-42   
gb|AAC14064.1|  ribulose 1,5-bisphosphate carboxylase small subunit     149   3e-42   Oryza sativa Japonica Group [Japonica rice]
gb|AIF75324.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    149   3e-42   
gb|AIF75313.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    149   3e-42   
gb|AAG40356.1|AF325004_1  At1g67090                                     149   3e-42   Arabidopsis thaliana [mouse-ear cress]
gb|ABB51649.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    149   3e-42   Brassica napus [oilseed rape]
ref|XP_004962611.1|  PREDICTED: ribulose bisphosphate carboxylase...    149   3e-42   
gb|AEX60841.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    149   3e-42   
gb|AAF19793.1|AF162210_1  ribulose-1,5-bisphosphate carboxylase/o...    149   3e-42   
sp|P19310.1|RBS4_LEMGI  RecName: Full=Ribulose bisphosphate carbo...    149   3e-42   
gb|AIF75337.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    149   3e-42   
gb|AFS41724.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    149   3e-42   
sp|P19309.1|RBS3_LEMGI  RecName: Full=Ribulose bisphosphate carbo...    149   3e-42   
ref|XP_006391472.1|  hypothetical protein EUTSA_v10019202mg             149   3e-42   
pdb|4HHH|S  Chain S, Structure Of Pisum Sativum Rubisco                 146   4e-42   
gb|EYU38172.1|  hypothetical protein MIMGU_mgv1a014686mg                148   4e-42   
gb|ABK96431.1|  unknown                                                 148   5e-42   
sp|P29684.1|RBS_HEVBR  RecName: Full=Ribulose bisphosphate carbox...    148   5e-42   
gb|ABL97974.1|  ribulose bisphosphate carboxylase                       147   5e-42   
gb|ACQ90230.1|  virus-resistance protein                                150   6e-42   
ref|XP_008339672.1|  PREDICTED: ribulose bisphosphate carboxylase...    148   6e-42   
gb|AAF06100.1|  ribulose 1,5-bisphosphate carboxylase small chain...    148   6e-42   
ref|XP_003576920.1|  PREDICTED: ribulose bisphosphate carboxylase...    147   6e-42   
ref|XP_003577109.1|  PREDICTED: ribulose bisphosphate carboxylase...    147   6e-42   
dbj|BAA35165.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    147   6e-42   
ref|XP_007033269.1|  Ribulose bisphosphate carboxylase (small cha...    148   7e-42   
gb|AFS41733.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    148   7e-42   
gb|AFS41748.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    147   7e-42   
ref|XP_010511625.1|  PREDICTED: ribulose bisphosphate carboxylase...    148   7e-42   
gb|AAF06098.1|  ribulose 1,5-bisphosphate carboxylase small chain...    148   8e-42   
ref|XP_009140170.1|  PREDICTED: ribulose bisphosphate carboxylase...    147   8e-42   
gb|AEX60842.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    147   8e-42   
gb|AEX60839.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    147   8e-42   
gb|ACA42439.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    147   8e-42   
dbj|BAA35150.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    147   8e-42   
dbj|BAA35158.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    147   8e-42   
gb|AFS41753.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    147   9e-42   
gb|KHG18747.1|  Ribulose bisphosphate carboxylase small chain, ch...    147   9e-42   
dbj|BAA35167.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    147   9e-42   
dbj|BAA35145.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    147   1e-41   
emb|CAA30393.1|  ribulose bisphosphate carboxylase                      147   1e-41   
gb|EYU45444.1|  hypothetical protein MIMGU_mgv1a014737mg                147   1e-41   
gb|AIF75321.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    147   1e-41   
ref|XP_009356790.1|  PREDICTED: ribulose bisphosphate carboxylase...    147   1e-41   
gb|AFS41744.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    147   1e-41   
dbj|BAA35162.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    147   1e-41   
ref|XP_009127519.1|  PREDICTED: ribulose bisphosphate carboxylase...    147   1e-41   
dbj|BAJ86022.1|  predicted protein                                      147   1e-41   
dbj|BAJ89884.1|  predicted protein                                      147   1e-41   
gb|ABL97962.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    147   1e-41   
dbj|BAJ90404.1|  predicted protein                                      147   1e-41   
ref|XP_009127518.1|  PREDICTED: ribulose bisphosphate carboxylase...    147   1e-41   
dbj|BAJ90550.1|  predicted protein                                      147   1e-41   
gb|AIF75292.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    146   1e-41   
dbj|BAJ90202.1|  predicted protein                                      147   1e-41   
dbj|BAA35175.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    146   1e-41   
dbj|BAA35169.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    146   2e-41   
dbj|BAJ89663.1|  predicted protein                                      145   2e-41   
ref|XP_006430779.1|  hypothetical protein CICLE_v10012893mg             147   2e-41   
dbj|BAA35153.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    146   2e-41   
gb|EMT21850.1|  Ribulose bisphosphate carboxylase small chain PW9...    146   2e-41   
dbj|BAB19810.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    146   2e-41   
gb|AFS41727.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    146   2e-41   
gb|EMT21846.1|  Ribulose bisphosphate carboxylase small chain PW9...    146   2e-41   
sp|P00871.2|RBS1_WHEAT  RecName: Full=Ribulose bisphosphate carbo...    146   2e-41   
sp|Q40004.1|RBS_HORVU  RecName: Full=Ribulose bisphosphate carbox...    146   2e-41   
emb|CAA53083.1|  ribulose-1,5-bisphosphate carboxylase /oxygenase...    146   2e-41   
ref|XP_006302885.1|  hypothetical protein CARUB_v10021016mg             146   2e-41   
gb|KEH21536.1|  ribulose bisphosphate carboxylase small chain           146   2e-41   
ref|XP_008352922.1|  PREDICTED: ribulose bisphosphate carboxylase...    146   2e-41   
gb|AAB70543.1|  ribulose 1,5-bisphosphate carboxylase small subunit     146   3e-41   
gb|EMS48023.1|  Ribulose bisphosphate carboxylase small chain, ch...    145   3e-41   
gb|ACJ85905.1|  unknown                                                 146   3e-41   
gb|KEH21531.1|  ribulose bisphosphate carboxylase small chain           146   3e-41   
dbj|BAA35161.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    145   3e-41   
dbj|BAA35156.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    145   3e-41   
gb|EMS44969.1|  Ribulose bisphosphate carboxylase small chain PW9...    146   3e-41   
sp|P07398.1|RBS3_WHEAT  RecName: Full=Ribulose bisphosphate carbo...    144   3e-41   
emb|CAA10497.1|  hypothetical protein                                   146   3e-41   
sp|P26667.1|RBS2_WHEAT  RecName: Full=Ribulose bisphosphate carbo...    146   3e-41   
gb|EMT06085.1|  hypothetical protein F775_43781                         146   3e-41   
gb|EMT21848.1|  Ribulose bisphosphate carboxylase small chain PW9...    146   3e-41   
dbj|BAB19812.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    146   3e-41   
gb|EMT25898.1|  Ribulose bisphosphate carboxylase small chain PWS...    145   3e-41   
pir||A05119  ribulose-bisphosphate carboxylase (EC 4.1.1.39) smal...    144   3e-41
gb|EMT21849.1|  Ribulose bisphosphate carboxylase small chain PW9...    144   3e-41   
dbj|BAA35176.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    145   4e-41   
ref|XP_009403968.1|  PREDICTED: ribulose bisphosphate carboxylase...    146   4e-41   
dbj|BAB19814.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    145   4e-41   
gb|EMS44970.1|  Ribulose bisphosphate carboxylase small chain PWS...    145   4e-41   
sp|Q42915.1|RBS_MANES  RecName: Full=Ribulose bisphosphate carbox...    146   4e-41   
gb|AIB55758.1|  ribulose bisphosphate carboxylase small chain, pa...    144   4e-41   
dbj|BAA35178.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    145   4e-41   
gb|ABA46900.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    145   4e-41   
ref|XP_009380302.1|  PREDICTED: ribulose bisphosphate carboxylase...    145   4e-41   
emb|CDY12616.1|  BnaA02g12840D                                          146   4e-41   
gb|EMS44967.1|  Ribulose bisphosphate carboxylase small chain PW9...    144   4e-41   
ref|XP_009127523.1|  PREDICTED: ribulose bisphosphate carboxylase...    145   5e-41   
dbj|BAA35151.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    145   5e-41   
gb|EMS47672.1|  Ribulose bisphosphate carboxylase small chain PWS...    146   5e-41   
gb|EMS67205.1|  Ribulose bisphosphate carboxylase small chain, ch...    144   5e-41   
gb|AFS41732.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    145   5e-41   
emb|CAG25595.1|  putative rubisco small subunit                         145   5e-41   
gb|AFS41725.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    145   5e-41   
gb|AEX60843.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    145   5e-41   
gb|AIF75311.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    145   5e-41   
gb|AFS41754.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    145   6e-41   
gb|AFS41729.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    145   6e-41   
gb|AEJ33935.1|  chloroplast putative ribulose-1,5-bisphosphate ca...    145   6e-41   
ref|XP_003636970.1|  Ribulose bisphosphate carboxylase small chai...    145   7e-41   
ref|XP_003600302.1|  Ribulose bisphosphate carboxylase small chai...    145   7e-41   
gb|KEH21538.1|  ribulose bisphosphate carboxylase small chain           145   7e-41   
ref|XP_003637843.1|  Ribulose bisphosphate carboxylase small chai...    145   7e-41   
gb|AAF06097.1|  ribulose 1,5-bisphosphate carboxylase small chain...    145   8e-41   
gb|EMT21847.1|  Ribulose bisphosphate carboxylase small chain PW9...    144   8e-41   
ref|XP_006482254.1|  PREDICTED: ribulose bisphosphate carboxylase...    145   8e-41   
gb|EMS44968.1|  Ribulose bisphosphate carboxylase small chain PW9...    144   8e-41   
sp|P31333.2|RBS_GOSHI  RecName: Full=Ribulose bisphosphate carbox...    145   8e-41   
ref|XP_008807113.1|  PREDICTED: ribulose bisphosphate carboxylase...    145   9e-41   
ref|NP_001119331.1|  ribulose bisphosphate carboxylase small chai...    145   9e-41   
ref|XP_003573910.1|  PREDICTED: ribulose bisphosphate carboxylase...    145   1e-40   
ref|XP_003555148.2|  PREDICTED: LOW QUALITY PROTEIN: ribulose bis...    145   1e-40   
dbj|BAA35179.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    144   1e-40   
gb|AIF75326.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    145   1e-40   
ref|XP_008797838.1|  PREDICTED: ribulose bisphosphate carboxylase...    145   1e-40   
dbj|BAA35148.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    144   1e-40   
gb|AIF75328.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    144   1e-40   
gb|AAD27881.1|AF139469_1  ribulose-1,5-bisphosphate carboxylase s...    144   1e-40   
gb|AFO59569.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    144   1e-40   
gb|ABQ42552.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    144   1e-40   
sp|O24045.1|RBS_MUSAC  RecName: Full=Ribulose bisphosphate carbox...    144   1e-40   
emb|CAA10496.1|  hypothetical protein                                   144   1e-40   
ref|XP_009390221.1|  PREDICTED: ribulose bisphosphate carboxylase...    144   1e-40   
gb|KEH21530.1|  ribulose bisphosphate carboxylase small chain           144   2e-40   
gb|AER24546.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    142   2e-40   
gb|ABA46901.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    144   2e-40   
ref|XP_007044343.1|  Ribulose bisphosphate carboxylase small chai...    142   2e-40   
dbj|BAA35170.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    144   2e-40   
gb|ABR25937.1|  ribulose bisphosphate carboxylase small chain c         141   2e-40   
ref|XP_010916368.1|  PREDICTED: ribulose bisphosphate carboxylase...    144   2e-40   
dbj|BAA35147.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    143   2e-40   
emb|CDY42338.1|  BnaC02g17150D                                          144   3e-40   
gb|AAL15646.1|AF411547_1  ribulose-1,5-bisphosphate carboxylase s...    141   3e-40   
dbj|BAA35172.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    143   3e-40   
sp|O65194.1|RBS_MEDSA  RecName: Full=Ribulose bisphosphate carbox...    144   3e-40   
dbj|BAB19811.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    143   3e-40   
ref|XP_009357814.1|  PREDICTED: ribulose bisphosphate carboxylase...    143   3e-40   
gb|AIR75141.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    143   4e-40   
gb|AAC67588.1|  ribulose-1,5-bisphosphate carboxylase small subunit     143   4e-40   
dbj|BAB19813.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    143   4e-40   
gb|KEH21539.1|  ribulose bisphosphate carboxylase small chain           143   5e-40   
gb|AAF17589.1|AF202645_1  ribulose-1,5-bisphosphate carboxylase s...    142   5e-40   
gb|AAF17590.1|AF202646_1  ribulose-1,5-bisphosphate carboxylase s...    142   6e-40   
gb|AAC83374.1|  ribulose-1,5-bisphosphate carboxylase small subunit     142   6e-40   
gb|AAF07946.1|AF192777_1  ribulose-1,5-bisphosphate carboxylase s...    142   6e-40   
ref|WP_017428783.1|  hypothetical protein                               140   6e-40   
gb|AAF07945.1|AF192776_1  ribulose-1,5-bisphosphate carboxylase s...    142   7e-40   
gb|AAF17591.1|AF202647_1  ribulose-1,5-bisphosphate carboxylase s...    142   7e-40   
gb|AAF07947.1|AF192778_1  ribulose-1,5-bisphosphate carboxylase s...    142   7e-40   
gb|AAC78643.1|  ribulose-1,5-bisphosphate carboxylase small subunit     142   7e-40   
gb|EPS63610.1|  ribulose bisphosphate carboxylase small chain           142   8e-40   
gb|AAF07949.1|AF192780_1  ribulose-1,5-bisphosphate carboxylase s...    142   8e-40   
dbj|BAA35164.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    142   9e-40   
dbj|BAA35173.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    142   1e-39   
sp|O22572.1|RBS2_FRIAG  RecName: Full=Ribulose bisphosphate carbo...    142   1e-39   
emb|CDY42341.1|  BnaC02g17180D                                          142   1e-39   
emb|CDY42337.1|  BnaC02g17140D                                          142   1e-39   
ref|XP_010926041.1|  PREDICTED: ribulose bisphosphate carboxylase...    142   1e-39   
gb|ABY66908.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    142   1e-39   
gb|ABA46899.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    142   1e-39   
dbj|BAP82418.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    142   1e-39   
gb|AIR75139.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    141   1e-39   
sp|O22573.1|RBS3_FRIAG  RecName: Full=Ribulose bisphosphate carbo...    141   2e-39   
gb|AIR75136.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    141   2e-39   
ref|XP_008243231.1|  PREDICTED: ribulose bisphosphate carboxylase...    141   2e-39   
gb|AGJ76629.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    141   2e-39   
gb|AIL82451.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    141   2e-39   
gb|AIR75140.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    140   2e-39   
ref|XP_002450304.1|  hypothetical protein SORBIDRAFT_05g003480          141   2e-39   
gb|AAF07942.1|AF192773_1  ribulose-1,5-bisphosphate carboxylase s...    141   2e-39   
dbj|BAJ40065.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    141   3e-39   
gb|AIF75330.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    140   4e-39   
sp|O24634.1|RBS1_FRIAG  RecName: Full=Ribulose bisphosphate carbo...    140   4e-39   
gb|AAC83372.1|  ribulose-1,5-bisphosphate carboxylase small subunit     140   5e-39   
gb|ABY66909.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    140   6e-39   
gb|AAF07985.1|AF200303_1  ribulose-1,5-bisphosphate carboxylase s...    140   6e-39   
gb|AAK16229.1|AF044397_1  ribulose-1,5-bisphosphate carboxylase s...    139   6e-39   
emb|CAA70416.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    140   7e-39   
gb|AAG49562.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    138   7e-39   
sp|P13951.1|RBS_SINAL  RecName: Full=Ribulose bisphosphate carbox...    137   8e-39   
gb|ABY66910.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    138   9e-39   
gb|ADT78691.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    140   9e-39   
ref|XP_004962301.1|  PREDICTED: ribulose bisphosphate carboxylase...    139   1e-38   
ref|XP_007225932.1|  hypothetical protein PRUPE_ppa012174mg             139   1e-38   
ref|XP_002276967.1|  PREDICTED: ribulose bisphosphate carboxylase...    139   1e-38   
gb|AAF07943.1|AF192774_1  ribulose-1,5-bisphosphate carboxylase s...    139   1e-38   
ref|NP_001146043.1|  ribulose bisphosphate carboxylase small subu...    138   1e-38   
sp|P17673.1|RBS_TRIRP  RecName: Full=Ribulose bisphosphate carbox...    139   1e-38   
sp|O22645.1|RBS5_FRIAG  RecName: Full=Ribulose bisphosphate carbo...    139   2e-38   
gb|ABR45725.1|  RBCS1                                                   139   2e-38   
ref|XP_004962302.1|  PREDICTED: ribulose bisphosphate carboxylase...    138   2e-38   
gb|AEB00556.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    139   2e-38   
gb|AIR75138.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    138   2e-38   
gb|AFI60243.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    137   2e-38   
emb|CBI15452.3|  unnamed protein product                                138   3e-38   
gb|AFS41770.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    138   3e-38   
gb|AAC83373.1|  ribulose-1,5-bisphosphate carboxylase small subunit     138   3e-38   
gb|AFS41763.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    138   4e-38   
sp|P00868.1|RBS1_PEA  RecName: Full=Ribulose bisphosphate carboxy...    136   5e-38   
gb|ABC86738.1|  ribulose-1,5-bisphophate carboxylase/oxygenase sm...    138   5e-38   
ref|XP_004962610.1|  PREDICTED: ribulose bisphosphate carboxylase...    137   7e-38   
gb|AFS41772.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    137   8e-38   
prf||0709274A  carboxylase S,RBP                                        135   9e-38
gb|AAA33717.1|  ribulose 1,5-bisphosphate carboxylase                   134   1e-37   
ref|NP_001105294.1|  ribulose bisphosphate carboxylase small chai...    137   1e-37   
emb|CAA68419.1|  ribulose 1,5-bisphosphate carboxylase/oxygenase        137   1e-37   
sp|P00870.1|RBS1_SPIOL  RecName: Full=Ribulose bisphosphate carbo...    135   1e-37   
ref|XP_006842277.1|  hypothetical protein AMTR_s00079p00061090          137   1e-37   
gb|AIF75298.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    136   1e-37   
gb|AIF75299.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    136   1e-37   
gb|AFS41756.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    136   2e-37   
gb|ABR45726.1|  RBCS1                                                   136   2e-37   
gb|AFS41766.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    135   2e-37   
sp|O48550.1|RBS_ZANAE  RecName: Full=Ribulose bisphosphate carbox...    136   2e-37   
gb|AFS41771.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    135   3e-37   
gb|AFS41765.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    135   3e-37   
gb|AEA48975.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    135   6e-37   
sp|P10053.1|RBS_PINTH  RecName: Full=Ribulose bisphosphate carbox...    134   8e-37   
dbj|BAA35166.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    134   9e-37   



>gb|AAA34192.1| ribulose-1,5-bisphosphate carboxylase, small subunit precursor 
[Solanum lycopersicum]
Length=180

 Score =   187 bits (475),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 85/85 (100%), Positives = 85/85 (100%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW
Sbjct  96   VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  155

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            VRIIGFDNVRQVQCISFIAYKPEGY
Sbjct  156  VRIIGFDNVRQVQCISFIAYKPEGY  180



>ref|XP_004234568.1| PREDICTED: ribulose bisphosphate carboxylase small chain 2A, 
chloroplastic [Solanum lycopersicum]
 sp|P07179.2|RBS2A_SOLLC RecName: Full=Ribulose bisphosphate carboxylase small chain 2A, 
chloroplastic; Short=RuBisCO small subunit 2A; AltName: Full=LESS 
5; Flags: Precursor [Solanum lycopersicum]
 gb|AAA34189.1| ribulose-1,5-bisphophate carboxylase/ oxygenase small subunit 
(EC 4.1.1.39) [Solanum lycopersicum]
 emb|CAA29401.2| ribulose 1,5-bisphosphate carboxylase/oxygenase [Solanum lycopersicum]
Length=180

 Score =   187 bits (474),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 85/85 (100%), Positives = 85/85 (100%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW
Sbjct  96   VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  155

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            VRIIGFDNVRQVQCISFIAYKPEGY
Sbjct  156  VRIIGFDNVRQVQCISFIAYKPEGY  180



>ref|XP_009795055.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Nicotiana sylvestris]
 ref|XP_009795056.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Nicotiana sylvestris]
 ref|XP_009772497.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Nicotiana sylvestris]
 sp|P69249.1|RBS_TOBAC RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; AltName: Full=TSSU3-8; 
Flags: Precursor [Nicotiana tabacum]
 sp|P69250.1|RBS1_NICSY RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Nicotiana sylvestris]
 emb|CAA25862.1| unnamed protein product [Nicotiana sylvestris]
 emb|CAA26208.1| small subunit ribulose 1,5-bisphosphate carboxylase [Nicotiana 
tabacum]
 prf||1103193A carboxylase,RBP
Length=180

 Score =   185 bits (469),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 83/85 (98%), Positives = 85/85 (100%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEV+EAKKAYPQAW
Sbjct  96   VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAW  155

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQCISFIAYKPEGY
Sbjct  156  IRIIGFDNVRQVQCISFIAYKPEGY  180



>ref|XP_009602965.1| PREDICTED: ribulose bisphosphate carboxylase small chain S41, 
chloroplastic-like [Nicotiana tomentosiformis]
Length=179

 Score =   185 bits (469),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 83/85 (98%), Positives = 85/85 (100%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEV+EAKKAYPQAW
Sbjct  95   VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAW  154

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQCISFIAYKPEGY
Sbjct  155  IRIIGFDNVRQVQCISFIAYKPEGY  179



>ref|XP_009767108.1| PREDICTED: ribulose bisphosphate carboxylase small chain S41, 
chloroplastic-like [Nicotiana sylvestris]
Length=181

 Score =   185 bits (469),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 83/85 (98%), Positives = 85/85 (100%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEV+EAKKAYPQAW
Sbjct  97   VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAW  156

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQCISFIAYKPEGY
Sbjct  157  IRIIGFDNVRQVQCISFIAYKPEGY  181



>ref|XP_009625434.1| PREDICTED: ribulose bisphosphate carboxylase small chain S41, 
chloroplastic [Nicotiana tomentosiformis]
Length=181

 Score =   185 bits (469),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 83/85 (98%), Positives = 85/85 (100%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEV+EAKKAYPQAW
Sbjct  97   VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAW  156

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQCISFIAYKPEGY
Sbjct  157  IRIIGFDNVRQVQCISFIAYKPEGY  181



>ref|XP_009774104.1| PREDICTED: ribulose bisphosphate carboxylase small chain S41, 
chloroplastic-like [Nicotiana sylvestris]
Length=181

 Score =   184 bits (468),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 83/85 (98%), Positives = 85/85 (100%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEV+EAKKAYPQAW
Sbjct  97   VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAW  156

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQCISFIAYKPEGY
Sbjct  157  IRIIGFDNVRQVQCISFIAYKPEGY  181



>ref|XP_009800809.1| PREDICTED: ribulose bisphosphate carboxylase small chain S41, 
chloroplastic-like [Nicotiana sylvestris]
Length=181

 Score =   184 bits (468),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 83/85 (98%), Positives = 85/85 (100%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEV+EAKKAYPQAW
Sbjct  97   VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAW  156

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQCISFIAYKPEGY
Sbjct  157  IRIIGFDNVRQVQCISFIAYKPEGY  181



>sp|P07180.1|RBS3A_SOLLC RecName: Full=Ribulose bisphosphate carboxylase small chain 3A/3C, 
chloroplastic; Short=RuBisCO small subunit 3A/3C; Flags: 
Precursor [Solanum lycopersicum]
 emb|CAA29402.1| ribulose 1,5-bisphosphate carboxylase/oxygenase [Solanum lycopersicum]
 emb|CAA29404.1| ribulose 1,5-bisphosphate carboxylase/oxygenase [Solanum lycopersicum]
 gb|AAA34190.1| ribulose-1,5-bisphophate carboxylase/ oxygenase small subunit 
[Solanum lycopersicum]
Length=180

 Score =   184 bits (468),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 84/85 (99%), Positives = 85/85 (100%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFETEHGFVYREN+KSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW
Sbjct  96   VPCLEFETEHGFVYRENHKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  155

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            VRIIGFDNVRQVQCISFIAYKPEGY
Sbjct  156  VRIIGFDNVRQVQCISFIAYKPEGY  180



>ref|XP_009758143.1| PREDICTED: ribulose bisphosphate carboxylase small chain S41, 
chloroplastic [Nicotiana sylvestris]
 sp|P22433.1|RBS2_NICSY RecName: Full=Ribulose bisphosphate carboxylase small chain S41, 
chloroplastic; Short=RuBisCO small subunit S41; Flags: Precursor 
[Nicotiana sylvestris]
 emb|CAA37516.1| NySS41 [Nicotiana sylvestris]
Length=181

 Score =   184 bits (468),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 83/85 (98%), Positives = 85/85 (100%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEV+EAKKAYPQAW
Sbjct  97   VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAW  156

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQCISFIAYKPEGY
Sbjct  157  IRIIGFDNVRQVQCISFIAYKPEGY  181



>ref|XP_006363111.1| PREDICTED: ribulose bisphosphate carboxylase small chain 2C, 
chloroplastic-like [Solanum tuberosum]
 ref|XP_006363112.1| PREDICTED: ribulose bisphosphate carboxylase small chain 2C, 
chloroplastic-like [Solanum tuberosum]
 sp|P26577.1|RBSC_SOLTU RecName: Full=Ribulose bisphosphate carboxylase small chain 2C, 
chloroplastic; Short=RuBisCO small subunit 2C; Flags: Precursor 
[Solanum tuberosum]
 emb|CAA49416.1| ribulose bisphosphate carboxylase [Solanum tuberosum]
Length=180

 Score =   184 bits (468),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 83/85 (98%), Positives = 85/85 (100%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEV+EAKKAYPQAW
Sbjct  96   VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAW  155

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQCISFIAYKPEGY
Sbjct  156  IRIIGFDNVRQVQCISFIAYKPEGY  180



>sp|P26575.1|RBSA_SOLTU RecName: Full=Ribulose bisphosphate carboxylase small chain 2A, 
chloroplastic; Short=RuBisCO small subunit 2A; Flags: Precursor 
[Solanum tuberosum]
 emb|CAA49414.1| ribulose bisphosphate carboxylase [Solanum tuberosum]
Length=180

 Score =   184 bits (468),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 83/85 (98%), Positives = 85/85 (100%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEV+EAKKAYPQAW
Sbjct  96   VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAW  155

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQCISFIAYKPEGY
Sbjct  156  IRIIGFDNVRQVQCISFIAYKPEGY  180



>sp|P26576.1|RBSB_SOLTU RecName: Full=Ribulose bisphosphate carboxylase small chain 2B, 
chloroplastic; Short=RuBisCO small subunit 2B; Flags: Precursor 
[Solanum tuberosum]
 emb|CAA49415.1| ribulose bisphosphate carboxylase [Solanum tuberosum]
Length=180

 Score =   184 bits (468),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 83/85 (98%), Positives = 85/85 (100%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEV+EAKKAYPQAW
Sbjct  96   VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAW  155

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQCISFIAYKPEGY
Sbjct  156  IRIIGFDNVRQVQCISFIAYKPEGY  180



>ref|XP_004232356.1| PREDICTED: ribulose bisphosphate carboxylase small chain 3B, 
chloroplastic [Solanum lycopersicum]
 sp|P05349.1|RBS3B_SOLLC RecName: Full=Ribulose bisphosphate carboxylase small chain 3B, 
chloroplastic; Short=RuBisCO small subunit 3B; Flags: Precursor 
[Solanum lycopersicum]
 emb|CAA29403.1| ribulose 1,5-bisphosphate carboxylase/oxyenase [Solanum lycopersicum]
 dbj|BAA01888.1| ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit 
[Solanum lycopersicum]
Length=180

 Score =   184 bits (467),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 84/85 (99%), Positives = 85/85 (100%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFETEHGFVYREN+KSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW
Sbjct  96   VPCLEFETEHGFVYRENHKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  155

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            VRIIGFDNVRQVQCISFIAYKPEGY
Sbjct  156  VRIIGFDNVRQVQCISFIAYKPEGY  180



>sp|P32764.1|RBS3_SOLTU RecName: Full=Ribulose bisphosphate carboxylase small chain 3, 
chloroplastic; Short=RuBisCO small subunit 3; Flags: Precursor 
[Solanum tuberosum]
 emb|CAA49417.1| ribulose bisphosphate carboxylase [Solanum tuberosum]
Length=181

 Score =   184 bits (467),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 83/85 (98%), Positives = 85/85 (100%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFETEHGFVYREN+KSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW
Sbjct  97   VPCLEFETEHGFVYRENHKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  156

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQCISFIAYKPEGY
Sbjct  157  IRIIGFDNVRQVQCISFIAYKPEGY  181



>pdb|3RUB|S Chain S, Crystal Structure Of The Unactivated Form Of Ribulose-1,5-Bisphosphate 
Carboxylase(Slash)oxygenase From Tobacco 
Refined At 2.0-Angstroms Resolution
 pdb|1RLC|S Chain S, Crystal Structure Of The Unactivated Ribulose 1, 5-Bisphosphate 
Carboxylase(Slash)oxygenase Complexed With A Transition 
State Analog, 2-Carboxy-D-Arabinitol 1,5-Bisphosphate
 pdb|1RLD|S Chain S, Solid-State Phase Transition In The Crystal Structure 
Of Ribulose 1,5- Biphosphate Carboxylase(Slash)oxygenase
 pdb|1RLD|T Chain T, Solid-State Phase Transition In The Crystal Structure 
Of Ribulose 1,5- Biphosphate Carboxylase(Slash)oxygenase
 pdb|1EJ7|S Chain S, Crystal Structure Of Unactivated Tobacco Rubisco With 
Bound Phosphate Ions
Length=123

 Score =   181 bits (459),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 83/85 (98%), Positives = 85/85 (100%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEV+EAKKAYPQAW
Sbjct  39   VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAW  98

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQCISFIAYKPEGY
Sbjct  99   IRIIGFDNVRQVQCISFIAYKPEGY  123



>gb|AFB70994.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Nicotiana attenuata]
Length=180

 Score =   183 bits (464),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 82/85 (96%), Positives = 84/85 (99%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDA QVLAEV+EAKKAYPQAW
Sbjct  96   VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDAAQVLAEVEEAKKAYPQAW  155

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQCISFIAYKPEGY
Sbjct  156  IRIIGFDNVRQVQCISFIAYKPEGY  180



>gb|AAA34111.1| ribulose-1,5-bisphosphate carboxylase, partial [Nicotiana sylvestris]
 prf||0905192A carboxylase,RBP
Length=86

 Score =   179 bits (454),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 83/85 (98%), Positives = 85/85 (100%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEV+EAKKAYPQAW
Sbjct  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAW  61

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQCISFIAYKPEGY
Sbjct  62   IRIIGFDNVRQVQCISFIAYKPEGY  86



>gb|AFW90575.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Solanum tuberosum]
Length=181

 Score =   182 bits (462),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 82/85 (96%), Positives = 83/85 (98%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQE K AYPQAW
Sbjct  97   VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQECKNAYPQAW  156

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQCISFIAYKPEGY
Sbjct  157  IRIIGFDNVRQVQCISFIAYKPEGY  181



>ref|XP_006358055.1| PREDICTED: ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit [Solanum tuberosum]
Length=181

 Score =   182 bits (461),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 82/85 (96%), Positives = 83/85 (98%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQE K AYPQAW
Sbjct  97   VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQECKNAYPQAW  156

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQCISFIAYKPEGY
Sbjct  157  IRIIGFDNVRQVQCISFIAYKPEGY  181



>pdb|4RUB|S Chain S, A Crystal Form Of Ribulose-1,5-Bisphosphate Carboxylase(Slash) 
Oxygenase From Nicotiana Tabacum In The Activated 
State
 pdb|4RUB|T Chain T, A Crystal Form Of Ribulose-1,5-Bisphosphate Carboxylase(Slash) 
Oxygenase From Nicotiana Tabacum In The Activated 
State
 pdb|4RUB|U Chain U, A Crystal Form Of Ribulose-1,5-Bisphosphate Carboxylase(Slash) 
Oxygenase From Nicotiana Tabacum In The Activated 
State
 pdb|4RUB|V Chain V, A Crystal Form Of Ribulose-1,5-Bisphosphate Carboxylase(Slash) 
Oxygenase From Nicotiana Tabacum In The Activated 
State
Length=123

 Score =   179 bits (455),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 83/85 (98%), Positives = 84/85 (99%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEV EAKKAYPQAW
Sbjct  39   VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVGEAKKAYPQAW  98

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQCISFIAYKPEGY
Sbjct  99   IRIIGFDNVRQVQCISFIAYKPEGY  123



>ref|XP_004233493.1| PREDICTED: ribulose bisphosphate carboxylase small chain 1, chloroplastic 
[Solanum lycopersicum]
 sp|P08706.2|RBS1_SOLLC RecName: Full=Ribulose bisphosphate carboxylase small chain 1, 
chloroplastic; Short=RuBisCO small subunit 1; AltName: Full=LESS 
17; Flags: Precursor [Solanum lycopersicum]
 gb|AAA34188.1| ribulose-1,5-bisphophate carboxylase/ oxygenase small subunit 
[Solanum lycopersicum]
 emb|CAA29400.1| ribulose 1,5-bisphosphate carboxylase/oxygenase [Solanum lycopersicum]
Length=181

 Score =   181 bits (459),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 82/85 (96%), Positives = 83/85 (98%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFETE GFVYRENN SPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW
Sbjct  97   VPCLEFETERGFVYRENNSSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  156

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            VRIIGFDNVRQVQCISFIAYKPEG+
Sbjct  157  VRIIGFDNVRQVQCISFIAYKPEGF  181



>gb|AAA34191.1| ribulose-1,5-bisphosphate carboxylase, small subunit precursor 
[Solanum lycopersicum]
Length=181

 Score =   181 bits (458),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 82/85 (96%), Positives = 83/85 (98%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFETE GFVYRENN SPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW
Sbjct  97   VPCLEFETERGFVYRENNSSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  156

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            VRIIGFDNVRQVQCISFIAYKPEG+
Sbjct  157  VRIIGFDNVRQVQCISFIAYKPEGF  181



>sp|P26574.1|RBS1_SOLTU RecName: Full=Ribulose bisphosphate carboxylase small chain 1, 
chloroplastic; Short=RuBisCO small subunit 1; Flags: Precursor 
[Solanum tuberosum]
 emb|CAA49413.1| ribulose bisphosphate carboxylase [Solanum tuberosum]
Length=181

 Score =   180 bits (457),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 81/85 (95%), Positives = 84/85 (99%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFETEHGFVYREN+KSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQE KK+YPQAW
Sbjct  97   VPCLEFETEHGFVYRENHKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQECKKSYPQAW  156

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQCISFIAYKPEGY
Sbjct  157  IRIIGFDNVRQVQCISFIAYKPEGY  181



>gb|ABY21254.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Solanum tuberosum]
Length=181

 Score =   180 bits (457),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 81/85 (95%), Positives = 84/85 (99%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFETEHGFVYREN+KSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQE KK+YPQAW
Sbjct  97   VPCLEFETEHGFVYRENHKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQECKKSYPQAW  156

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQCISFIAYKPEGY
Sbjct  157  IRIIGFDNVRQVQCISFIAYKPEGY  181



>prf||0902172A carboxylase/oxygenase,RBP
Length=123

 Score =   178 bits (451),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 82/85 (96%), Positives = 84/85 (99%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEV EAKKAYP+AW
Sbjct  39   VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVGEAKKAYPEAW  98

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQCISFIAYKPEGY
Sbjct  99   IRIIGFDNVRQVQCISFIAYKPEGY  123



>ref|NP_001275244.1| ribulose bisphosphate carboxylase small chain C, chloroplastic 
[Solanum tuberosum]
 sp|P10647.1|RBS0_SOLTU RecName: Full=Ribulose bisphosphate carboxylase small chain C, 
chloroplastic; Short=RuBisCO small subunit C; Flags: Precursor 
[Solanum tuberosum]
 gb|AAA33838.1| ribulose bisphosphate carboxylase (EC 4.1.1.39) [Solanum tuberosum]
Length=181

 Score =   179 bits (454),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 80/85 (94%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFETEHGFVYRE+N SPGYYDGRYWTMWKLPMFGCTD TQVLAEVQEAK AYPQAW
Sbjct  97   VPCLEFETEHGFVYREHNSSPGYYDGRYWTMWKLPMFGCTDGTQVLAEVQEAKNAYPQAW  156

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQCISFIAYKPEGY
Sbjct  157  IRIIGFDNVRQVQCISFIAYKPEGY  181



>gb|AAR83879.1| Cristal-Glass1 protein [Capsicum annuum]
Length=180

 Score =   179 bits (454),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 80/85 (94%), Positives = 84/85 (99%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFETEHGFVYRE+++SPGYYDGRYWTMWKLPMFGCTDATQVL EVQEAKKAYPQAW
Sbjct  96   VPCLEFETEHGFVYREHHRSPGYYDGRYWTMWKLPMFGCTDATQVLNEVQEAKKAYPQAW  155

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQCISFIAYKPEGY
Sbjct  156  IRIIGFDNVRQVQCISFIAYKPEGY  180



>gb|AGT97045.1| ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit 
[Capsicum annuum]
Length=180

 Score =   179 bits (454),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 80/85 (94%), Positives = 84/85 (99%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFETEHGFVYRE+++SPGYYDGRYWTMWKLPMFGCTDATQVL EVQEAKKAYPQAW
Sbjct  96   VPCLEFETEHGFVYREHHRSPGYYDGRYWTMWKLPMFGCTDATQVLNEVQEAKKAYPQAW  155

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQCISFIAYKPEGY
Sbjct  156  IRIIGFDNVRQVQCISFIAYKPEGY  180



>gb|ABY21253.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Solanum tuberosum]
Length=181

 Score =   179 bits (453),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 80/85 (94%), Positives = 83/85 (98%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFETEHGFVYREN+KSPGYYDGRYWTMWKLPMFGCTD TQVLAEVQE KK+YPQAW
Sbjct  97   VPCLEFETEHGFVYRENHKSPGYYDGRYWTMWKLPMFGCTDTTQVLAEVQECKKSYPQAW  156

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQCISFIAYKPEGY
Sbjct  157  IRIIGFDNVRQVQCISFIAYKPEGY  181



>gb|AHI85721.1| stress-induced protein 16 [Capsicum annuum]
Length=180

 Score =   179 bits (453),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 80/85 (94%), Positives = 84/85 (99%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFETEHGFVYRE+++SPGYYDGRYWTMWKLPMFGCTDATQVL EVQEAKKAYPQAW
Sbjct  96   VPCLEFETEHGFVYREHHRSPGYYDGRYWTMWKLPMFGCTDATQVLNEVQEAKKAYPQAW  155

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQCISFIAYKPEGY
Sbjct  156  IRIIGFDNVRQVQCISFIAYKPEGY  180



>ref|XP_009595081.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Nicotiana tomentosiformis]
 ref|XP_009609566.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Nicotiana tomentosiformis]
 gb|AAP03874.1| putative ribulose bisphosphate carboxylase small subunit protein 
precursor [Nicotiana tabacum]
Length=180

 Score =   179 bits (453),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 81/85 (95%), Positives = 83/85 (98%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFETE GFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEV EAKKAYP+AW
Sbjct  96   VPCLEFETERGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVGEAKKAYPEAW  155

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQCISFIAYKPEGY
Sbjct  156  IRIIGFDNVRQVQCISFIAYKPEGY  180



>ref|WP_037767734.1| hypothetical protein [Streptomyces olindensis]
 gb|KDN74154.1| hypothetical protein DF19_37695 [Streptomyces olindensis]
Length=123

 Score =   176 bits (445),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 80/85 (94%), Positives = 84/85 (99%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFETEHGFVYRE+++SPGYYDGRYWTMWKLPMFGCTDATQVL EVQEAKKAYPQAW
Sbjct  39   VPCLEFETEHGFVYREHHRSPGYYDGRYWTMWKLPMFGCTDATQVLNEVQEAKKAYPQAW  98

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQCISFIAYKPEGY
Sbjct  99   IRIIGFDNVRQVQCISFIAYKPEGY  123



>ref|WP_026003795.1| hypothetical protein, partial [Pseudomonas luteola]
Length=120

 Score =   175 bits (443),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 81/82 (99%), Positives = 82/82 (100%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFETEHGFVYREN+KSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW
Sbjct  39   VPCLEFETEHGFVYRENHKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  98

Query  182  VRIIGFDNVRQVQCISFIAYKP  247
            VRIIGFDNVRQVQCISFIAYKP
Sbjct  99   VRIIGFDNVRQVQCISFIAYKP  120



>sp|P26573.1|RBS8_NICPL RecName: Full=Ribulose bisphosphate carboxylase small chain 8B, 
chloroplastic; Short=RuBisCO small subunit 8B; Flags: Precursor 
[Nicotiana plumbaginifolia]
 emb|CAA31994.1| ribulose bisphosphate carboxylase [Nicotiana plumbaginifolia]
 gb|AAA34110.1| ribulose bisphosphate carboxylase [Nicotiana plumbaginifolia]
Length=180

 Score =   176 bits (446),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 80/85 (94%), Positives = 83/85 (98%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFETE GFVYRE++ SPGYYDGRYWTMWKLPMFGCTDATQVLAEV+EAKKAYPQAW
Sbjct  96   VPCLEFETERGFVYREHHHSPGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAW  155

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            VRIIGFDNVRQVQCISFIAYKPEGY
Sbjct  156  VRIIGFDNVRQVQCISFIAYKPEGY  180



>sp|O65349.1|RBS_CAPAN RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Capsicum annuum]
 gb|AAC17126.1| ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit 
[Capsicum annuum]
Length=187

 Score =   175 bits (444),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFETEHGFVYRE+++SPGYYDGRYWTMWKLPMFGCTDATQVL EVQEAKKAYPQAW
Sbjct  96   VPCLEFETEHGFVYREHHRSPGYYDGRYWTMWKLPMFGCTDATQVLNEVQEAKKAYPQAW  155

Query  182  VRIIGFDNVRQVQCISFIAYKPEG  253
            +RIIGFDNVRQVQCISFIAYKPE 
Sbjct  156  IRIIGFDNVRQVQCISFIAYKPEA  179



>gb|ABY21255.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Solanum tuberosum]
Length=181

 Score =   174 bits (441),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 78/85 (92%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFETEHG VYRE +KSPGYYDGRYW MWKLPMFGCTDATQVLAEVQE KK+YPQAW
Sbjct  97   VPCLEFETEHGIVYREKHKSPGYYDGRYWNMWKLPMFGCTDATQVLAEVQECKKSYPQAW  156

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQCISFIAYKPEGY
Sbjct  157  IRIIGFDNVRQVQCISFIAYKPEGY  181



>sp|Q41351.1|RBS_STELP RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Stellaria longipes]
 gb|AAA69018.1| ribulose 1,5-bisphosphate carboxylase small subunit [Stellaria 
longipes]
Length=180

 Score =   169 bits (428),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 76/85 (89%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFETEHGFVYRE+  SPGYYDGRYWTMWKLPMFGCTDATQV AEVQEAKKAYP A 
Sbjct  96   VPCLEFETEHGFVYREHTSSPGYYDGRYWTMWKLPMFGCTDATQVAAEVQEAKKAYPDAH  155

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQCISFIAYKPE +
Sbjct  156  IRIIGFDNVRQVQCISFIAYKPEAF  180



>ref|XP_008381263.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Malus domestica]
Length=183

 Score =   169 bits (427),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 74/85 (87%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFE EHGFVYREN+KSPGYYDGRYWTMWKLPMFGCTD++QVL E++EAKKAYP A+
Sbjct  99   VPCLEFELEHGFVYRENHKSPGYYDGRYWTMWKLPMFGCTDSSQVLKELEEAKKAYPNAF  158

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQCISFIAYKP GY
Sbjct  159  IRIIGFDNVRQVQCISFIAYKPAGY  183



>sp|P04715.1|RBS2_PETHY RecName: Full=Ribulose bisphosphate carboxylase small chain SSU11A, 
chloroplastic; Short=RuBisCO small subunit SSU11A; Flags: 
Precursor [Petunia x hybrida]
 pir||RKPJS1 ribulose-bisphosphate carboxylase (EC 4.1.1.39) small chain  
(ssu11A) precursor - garden petunia
 emb|CAA27445.1| ribulose 1,5-bisphosphate carboxylase [Petunia x hybrida]
Length=180

 Score =   168 bits (426),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 76/85 (89%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFETEHGFVYRE + SP YYDGRYWTMWKLPMFGCTDATQVL E+QEAKKAYP AW
Sbjct  96   VPCLEFETEHGFVYREYHASPRYYDGRYWTMWKLPMFGCTDATQVLGELQEAKKAYPNAW  155

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQCISFIAYKP GY
Sbjct  156  IRIIGFDNVRQVQCISFIAYKPPGY  180



>gb|AAA33866.1| ribulose 1,5-bisphosphate carboxylase small subunit [Malus domestica 
x Pyrus communis]
Length=179

 Score =   168 bits (426),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 73/84 (87%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFE EHGFVYRENN+SPGYYDGRYWTMWKLPMFGCTD++QVL E++EAKKAYPQ++
Sbjct  95   VPCLEFELEHGFVYRENNRSPGYYDGRYWTMWKLPMFGCTDSSQVLKELEEAKKAYPQSF  154

Query  182  VRIIGFDNVRQVQCISFIAYKPEG  253
            +RIIGFDNVRQVQCISFIAYKP G
Sbjct  155  IRIIGFDNVRQVQCISFIAYKPPG  178



>ref|XP_010263795.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Nelumbo nucifera]
Length=184

 Score =   168 bits (425),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 73/85 (86%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            +PCLEFE EHGFVYRENN+SPGYYDGRYWTMWKLPMFGCTD++QVLAE++EAKKAYP A+
Sbjct  100  IPCLEFELEHGFVYRENNRSPGYYDGRYWTMWKLPMFGCTDSSQVLAELEEAKKAYPNAF  159

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDN RQVQCISFIAYKP GY
Sbjct  160  IRIIGFDNKRQVQCISFIAYKPPGY  184



>sp|Q02980.1|RBS_MALSP RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Malus sp.]
 emb|CAA46475.1| ribulose bisphosphate carboxylase [Malus sp.]
Length=183

 Score =   167 bits (424),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 72/85 (85%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFE EHGFVYREN++SPGYYDGRYWTMWKLPMFGCTD++QVL E++EAKKAYPQ++
Sbjct  99   VPCLEFELEHGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDSSQVLKELEEAKKAYPQSF  158

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQCISFIAYKP G+
Sbjct  159  IRIIGFDNVRQVQCISFIAYKPAGF  183



>ref|XP_010263805.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Nelumbo nucifera]
Length=182

 Score =   167 bits (423),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 72/85 (85%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            +PCLEFE EHGFVYRENN+SPGYYDGRYWTMWKLPMFGCTD++QVLAE++EAKKAYP A+
Sbjct  98   IPCLEFELEHGFVYRENNRSPGYYDGRYWTMWKLPMFGCTDSSQVLAELEEAKKAYPNAF  157

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDN RQVQCISFIAYKP G+
Sbjct  158  IRIIGFDNKRQVQCISFIAYKPPGF  182



>sp|P04714.1|RBS1_PETHY RecName: Full=Ribulose bisphosphate carboxylase small chain SSU8, 
chloroplastic; Short=RuBisCO small subunit SSU8; Flags: 
Precursor [Petunia x hybrida]
 pir||RKPJS8 ribulose-bisphosphate carboxylase (EC 4.1.1.39) small chain  
(ssu8) precursor - garden petunia
 emb|CAA27444.1| ribulose 1,5-bisphosphate carboxylase [Petunia x hybrida]
Length=180

 Score =   167 bits (422),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 75/85 (88%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFETEHGFVYRE + SP YYDGRYWTMWKLPMFGCTDATQVL E+QEAKKAYP AW
Sbjct  96   VPCLEFETEHGFVYREYHASPRYYDGRYWTMWKLPMFGCTDATQVLGELQEAKKAYPNAW  155

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQCISFIAYKP G+
Sbjct  156  IRIIGFDNVRQVQCISFIAYKPPGF  180



>ref|XP_008368660.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
isoform X1 [Malus domestica]
Length=179

 Score =   166 bits (420),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFE EHGFVYREN++SPGYYDGRYWTMWKLPMFGCTD++QVL E++EAKKAYPQ++
Sbjct  95   VPCLEFELEHGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDSSQVLKELEEAKKAYPQSF  154

Query  182  VRIIGFDNVRQVQCISFIAYKPEG  253
            +RIIGFDNVRQVQCISFIAYKP G
Sbjct  155  IRIIGFDNVRQVQCISFIAYKPPG  178



>ref|XP_010265138.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Nelumbo nucifera]
Length=182

 Score =   165 bits (418),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 71/85 (84%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            +PCLEFE EHGFVYRENN+SPGYYDGRYWTMWKLPMFGCTD++QVLAE++EAKKAYP A+
Sbjct  98   IPCLEFELEHGFVYRENNRSPGYYDGRYWTMWKLPMFGCTDSSQVLAELEEAKKAYPNAF  157

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDN RQVQCISFIAYKP  +
Sbjct  158  IRIIGFDNKRQVQCISFIAYKPPSF  182



>emb|CAH59401.1| Rubisco SSU [Plantago major]
Length=177

 Score =   165 bits (417),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            +PCLEFE EHGFVYRENN+SPGYYDGRYWTMWKLPMFGCTDA+QV+AE++E KK YP AW
Sbjct  93   IPCLEFELEHGFVYRENNRSPGYYDGRYWTMWKLPMFGCTDASQVIAELEECKKEYPNAW  152

Query  182  VRIIGFDNVRQVQCISFIAYKPEG  253
            VRIIGFDNVRQVQCISFIA KP G
Sbjct  153  VRIIGFDNVRQVQCISFIAAKPPG  176



>gb|AAO25119.1| ribulose-1,5-bisphosphate carboxylase small subunit [Chrysanthemum 
x morifolium]
Length=179

 Score =   165 bits (417),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 72/85 (85%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFE EHGF YRENN+SPGYYDGRYWTMWKLPMFGC DA+QVL E+ E KK YPQ+W
Sbjct  95   VPCLEFELEHGFPYRENNRSPGYYDGRYWTMWKLPMFGCNDASQVLKELNECKKEYPQSW  154

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            VRIIGFDNVRQVQCISFIA+KP+GY
Sbjct  155  VRIIGFDNVRQVQCISFIAHKPDGY  179



>sp|Q39744.1|RBS2_FLAPR RecName: Full=Ribulose bisphosphate carboxylase small chain 2, 
chloroplastic; Short=RuBisCO small subunit 2; Flags: Precursor 
[Flaveria pringlei]
 gb|AAB67846.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
protein [Flaveria pringlei]
Length=178

 Score =   165 bits (417),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 72/85 (85%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFE EHGFVYREN +SPGYYDGRYWTMWKLPMFGCTD+ QV+ E+QE KK YPQAW
Sbjct  94   VPCLEFELEHGFVYRENARSPGYYDGRYWTMWKLPMFGCTDSAQVMKELQECKKEYPQAW  153

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQCISFIA KPEG+
Sbjct  154  IRIIGFDNVRQVQCISFIASKPEGF  178



>ref|XP_009357812.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
Length=183

 Score =   165 bits (417),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 73/85 (86%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFE E GFVYREN+KSPGYYDGRYWTMWKLPMFGCTD++QVL E++EAKKAYP A+
Sbjct  99   VPCLEFELETGFVYRENHKSPGYYDGRYWTMWKLPMFGCTDSSQVLKELEEAKKAYPNAF  158

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQCISFIAYKP GY
Sbjct  159  IRIIGFDNVRQVQCISFIAYKPAGY  183



>ref|XP_004303137.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=182

 Score =   164 bits (416),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 74/85 (87%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFE E GFVYREN+KSPGYYDGRYWTMWKLPMFGCTDA+QVL E++EAKKAYP A+
Sbjct  98   VPCLEFELEKGFVYRENHKSPGYYDGRYWTMWKLPMFGCTDASQVLKELEEAKKAYPNAF  157

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQCISFIAYKP GY
Sbjct  158  IRIIGFDNVRQVQCISFIAYKPAGY  182



>ref|XP_009342656.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Pyrus x bretschneideri]
Length=183

 Score =   164 bits (414),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 71/85 (84%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFE E GFVYREN++SPGYYDGRYWTMWKLPMFGCTD++QVL E++EAKKAYPQ++
Sbjct  99   VPCLEFELETGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDSSQVLKELEEAKKAYPQSF  158

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQCISFIAYKP G+
Sbjct  159  IRIIGFDNVRQVQCISFIAYKPAGF  183



>sp|Q39746.1|RBS4_FLAPR RecName: Full=Ribulose bisphosphate carboxylase small chain 4, 
chloroplastic; Short=RuBisCO small subunit 4; Flags: Precursor 
[Flaveria pringlei]
 gb|AAB67848.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
protein [Flaveria pringlei]
Length=178

 Score =   164 bits (414),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 71/85 (84%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFE EHGFVYREN +SPGYYDGRYWTMWKLPMFGCTD+ QV+ E+QE KK YPQAW
Sbjct  94   VPCLEFELEHGFVYRENARSPGYYDGRYWTMWKLPMFGCTDSAQVMKELQECKKEYPQAW  153

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQCISFIA KP+G+
Sbjct  154  IRIIGFDNVRQVQCISFIASKPDGF  178



>sp|P24007.1|RBS_PYRPY RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Pyrus pyrifolia]
 dbj|BAA00450.1| RuBisCO small subunit [Pyrus pyrifolia var. culta]
Length=183

 Score =   164 bits (414),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 71/85 (84%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFE E GFVYREN++SPGYYDGRYWTMWKLPMFGCTD++QVL E++EAKKAYPQ++
Sbjct  99   VPCLEFELETGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDSSQVLKELEEAKKAYPQSF  158

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQCISFIAYKP G+
Sbjct  159  IRIIGFDNVRQVQCISFIAYKPAGF  183



>gb|ACU13285.1| unknown [Glycine max]
Length=178

 Score =   163 bits (413),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 71/85 (84%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            +PCLEFE EHGFVYRE+N+SPGYYDGRYWTMWKLPMFGCTDA+QVL E+QEAK AYP  +
Sbjct  94   IPCLEFELEHGFVYREHNRSPGYYDGRYWTMWKLPMFGCTDASQVLKELQEAKTAYPNGF  153

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQCISFIAYKP G+
Sbjct  154  IRIIGFDNVRQVQCISFIAYKPPGF  178



>sp|Q39749.1|RBS7_FLAPR RecName: Full=Ribulose bisphosphate carboxylase small chain 7, 
chloroplastic; Short=RuBisCO small subunit 7; Flags: Precursor 
[Flaveria pringlei]
 gb|AAB67851.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
protein [Flaveria pringlei]
Length=173

 Score =   163 bits (412),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 71/85 (84%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFE EHGFVYREN +SPGYYDGRYWTMWKLPMFGCTD+ QV+ E+QE KK YPQAW
Sbjct  89   VPCLEFELEHGFVYRENARSPGYYDGRYWTMWKLPMFGCTDSAQVMKELQECKKEYPQAW  148

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQCISFIA KP+G+
Sbjct  149  IRIIGFDNVRQVQCISFIASKPDGF  173



>ref|NP_001235314.1| uncharacterized protein LOC100500504 [Glycine max]
 gb|ACU15604.1| unknown [Glycine max]
 gb|KHN47663.1| Ribulose bisphosphate carboxylase small chain 1, chloroplastic 
[Glycine soja]
Length=178

 Score =   163 bits (413),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 71/85 (84%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            +PCLEFE EHGFVYRE+N+SPGYYDGRYWTMWKLPMFGCTDA+QVL E+QEAK AYP  +
Sbjct  94   IPCLEFELEHGFVYREHNRSPGYYDGRYWTMWKLPMFGCTDASQVLKELQEAKTAYPNGF  153

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQCISFIAYKP G+
Sbjct  154  IRIIGFDNVRQVQCISFIAYKPPGF  178



>ref|NP_001241137.1| ribulose bisphosphate carboxylase small chain 1, chloroplastic-like 
[Glycine max]
 gb|AAG24882.1|AF303939_1 ribulose-1,5-bisphosphate carboxylase small subunit rbcS1 [Glycine 
max]
 gb|AAA81328.1| ribulose-1,5-bisphosphate carboxylase small subunit [Glycine 
max]
 gb|KHN07517.1| Ribulose bisphosphate carboxylase small chain 1, chloroplastic 
[Glycine soja]
 gb|KHN07519.1| Ribulose bisphosphate carboxylase small chain 1, chloroplastic 
[Glycine soja]
Length=178

 Score =   163 bits (413),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 71/85 (84%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            +PCLEFE EHGFVYRE+N+SPGYYDGRYWTMWKLPMFGCTDA+QVL E+QEAK AYP  +
Sbjct  94   IPCLEFELEHGFVYREHNRSPGYYDGRYWTMWKLPMFGCTDASQVLKELQEAKTAYPNGF  153

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQCISFIAYKP G+
Sbjct  154  IRIIGFDNVRQVQCISFIAYKPPGF  178



>ref|NP_001235266.1| ribulose-1,5-bisphosphate carboxylase small subunit rbcS2 [Glycine 
max]
 gb|AAG24883.1|AF303940_1 ribulose-1,5-bisphosphate carboxylase small subunit rbcS2 [Glycine 
max]
Length=178

 Score =   163 bits (413),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 71/85 (84%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            +PCLEFE EHGFVYRE+N+SPGYYDGRYWTMWKLPMFGCTDA+QVL E+QEAK AYP  +
Sbjct  94   IPCLEFELEHGFVYREHNRSPGYYDGRYWTMWKLPMFGCTDASQVLKELQEAKTAYPNGF  153

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQCISFIAYKP G+
Sbjct  154  IRIIGFDNVRQVQCISFIAYKPPGF  178



>sp|Q39745.1|RBS3_FLAPR RecName: Full=Ribulose bisphosphate carboxylase small chain 3, 
chloroplastic; Short=RuBisCO small subunit 3; Flags: Precursor 
[Flaveria pringlei]
 gb|AAB67847.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
protein [Flaveria pringlei]
Length=173

 Score =   163 bits (412),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 71/85 (84%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFE EHGFVYREN +SPGYYDGRYWTMWKLPMFGCTD+ QV+ E+QE KK YPQAW
Sbjct  89   VPCLEFELEHGFVYRENARSPGYYDGRYWTMWKLPMFGCTDSAQVMKELQECKKEYPQAW  148

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQCISFIA KP+G+
Sbjct  149  IRIIGFDNVRQVQCISFIASKPDGF  173



>sp|Q39747.1|RBS5_FLAPR RecName: Full=Ribulose bisphosphate carboxylase small chain 5, 
chloroplastic; Short=RuBisCO small subunit 5; Flags: Precursor 
[Flaveria pringlei]
 gb|AAB67849.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
protein [Flaveria pringlei]
Length=173

 Score =   163 bits (412),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 71/85 (84%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFE EHGFVYREN +SPGYYDGRYWTMWKLPMFGCTD+ QV+ E+QE KK YPQAW
Sbjct  89   VPCLEFELEHGFVYRENARSPGYYDGRYWTMWKLPMFGCTDSAQVMKELQECKKEYPQAW  148

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQCISFIA KP+G+
Sbjct  149  IRIIGFDNVRQVQCISFIASKPDGF  173



>gb|AAK16227.1|AF044395_1 ribulose-1,5-bisphosphate carboxylase small subunit R1 [Flaveria 
ramosissima]
Length=131

 Score =   161 bits (407),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 71/85 (84%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFE EHGFVYREN++SPGYYDGRYWTMWKLPMFGCTD++QV+ E+ E KK YPQAW
Sbjct  47   VPCLEFELEHGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDSSQVMKELGECKKEYPQAW  106

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQCISFIA KP+GY
Sbjct  107  IRIIGFDNVRQVQCISFIASKPDGY  131



>gb|AAK16228.1|AF044396_1 ribulose-1,5-bisphosphate carboxylase small subunit R2 [Flaveria 
ramosissima]
Length=131

 Score =   161 bits (407),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 71/85 (84%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFE EHGFVYREN +SPGYYDGRYWTMWKLPMFGCTD+ QV+ E+QE KK YPQAW
Sbjct  47   VPCLEFELEHGFVYRENARSPGYYDGRYWTMWKLPMFGCTDSAQVMKELQECKKEYPQAW  106

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQCISFIA KP+G+
Sbjct  107  IRIIGFDNVRQVQCISFIASKPDGF  131



>gb|AFK48034.1| unknown [Lotus japonicus]
Length=181

 Score =   162 bits (411),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 73/85 (86%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFETE GFVYREN+KSPGYYDGRYWTMWKLPMFGC+DATQVL E+ EA KAYP A+
Sbjct  97   VPCLEFETEKGFVYRENHKSPGYYDGRYWTMWKLPMFGCSDATQVLKELDEAVKAYPNAF  156

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            VRIIGFDNVRQVQCISFIA++P GY
Sbjct  157  VRIIGFDNVRQVQCISFIAHRPAGY  181



>gb|AAG24884.1|AF303941_1 ribulose-1,5-bisphosphate carboxylase small subunit rbcS3 [Glycine 
max]
Length=178

 Score =   162 bits (410),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            +PCLEFE EHGFVYRE+N+SPGYYDGRYWTMWKLPMFGCTDA+QVL E+QEAK AYP  +
Sbjct  94   IPCLEFELEHGFVYREHNRSPGYYDGRYWTMWKLPMFGCTDASQVLKELQEAKTAYPNGF  153

Query  182  VRIIGFDNVRQVQCISFIAYKPEG  253
            +RIIGFDNVRQVQCISFIAYKP G
Sbjct  154  IRIIGFDNVRQVQCISFIAYKPPG  177



>ref|XP_004299075.1| PREDICTED: ribulose bisphosphate carboxylase small chain 1, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=180

 Score =   162 bits (409),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 69/85 (81%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFE EHGFVYRE+  SPGYYDGRYWTMWKLPMFGCTDA+QV+AE++EAKK YP+A+
Sbjct  96   VPCLEFELEHGFVYREHGNSPGYYDGRYWTMWKLPMFGCTDASQVIAELEEAKKTYPEAF  155

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDN+RQVQC+SFIAYKP  Y
Sbjct  156  IRIIGFDNIRQVQCVSFIAYKPASY  180



>gb|AFK36660.1| unknown [Lotus japonicus]
 gb|AFK45650.1| unknown [Lotus japonicus]
Length=177

 Score =   162 bits (409),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 72/85 (85%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFETE GFVYREN+KSPGYYDGRYWTMWKLPMFG TDA+QVL E++EAKKAYP A+
Sbjct  93   VPCLEFETEKGFVYRENHKSPGYYDGRYWTMWKLPMFGTTDASQVLKELEEAKKAYPNAF  152

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDN RQVQCISFIA++PEGY
Sbjct  153  IRIIGFDNKRQVQCISFIAHRPEGY  177



>sp|Q39743.1|RBS1_FLAPR RecName: Full=Ribulose bisphosphate carboxylase small chain 1, 
chloroplastic; Short=RuBisCO small subunit 1; Flags: Precursor 
[Flaveria pringlei]
 gb|AAB67845.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
protein [Flaveria pringlei]
Length=173

 Score =   161 bits (408),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 71/85 (84%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFE EHGFVYREN +SPGYYDGRYWTMWKLPMFGCTD+ QV+ E+QE KK YPQAW
Sbjct  89   VPCLEFELEHGFVYRENARSPGYYDGRYWTMWKLPMFGCTDSAQVMKELQECKKEYPQAW  148

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQCISFIA KP G+
Sbjct  149  IRIIGFDNVRQVQCISFIASKPGGF  173



>gb|AAP31053.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Flaveria bidentis]
Length=173

 Score =   161 bits (407),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFE EHGFVYREN +SPGYYDGRYWTMWKLPMFGCTD+ QV+ E+QE KK YPQAW
Sbjct  89   VPCLEFELEHGFVYRENARSPGYYDGRYWTMWKLPMFGCTDSAQVMKELQECKKEYPQAW  148

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQC+SFIA KP G+
Sbjct  149  IRIIGFDNVRQVQCVSFIASKPTGF  173



>sp|Q42823.1|RBS_GLYTA RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Glycine tabacina]
 gb|AAA82071.1| ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit 
precursor [Glycine tabacina]
Length=178

 Score =   161 bits (407),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            +PCLEFE EHGFVYRE+++SPGYYDGRYWTMWKLPMFGCTDA+QVL E+QEAK AYP A+
Sbjct  94   IPCLEFELEHGFVYREHHRSPGYYDGRYWTMWKLPMFGCTDASQVLKELQEAKTAYPNAF  153

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQCISFIAYKP  +
Sbjct  154  IRIIGFDNVRQVQCISFIAYKPPSF  178



>emb|CAH59404.1| Rubisco SSU [Plantago major]
Length=174

 Score =   160 bits (406),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            +PCLEFE EHGFVYREN +SPGYYDGRYWTMWKLPMFGCTDA+QV+AE++E KK YP AW
Sbjct  90   IPCLEFELEHGFVYRENARSPGYYDGRYWTMWKLPMFGCTDASQVIAELEECKKEYPNAW  149

Query  182  VRIIGFDNVRQVQCISFIAYKPEG  253
            VRIIGFDNVRQVQCISFIA KP G
Sbjct  150  VRIIGFDNVRQVQCISFIASKPPG  173



>sp|P07089.1|RBS_FLATR RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Flaveria trinervia]
 emb|CAA28711.1| unnamed protein product [Flaveria trinervia]
Length=173

 Score =   160 bits (405),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFE EHGFVYREN  SPGYYDGRYWTMWKLPMFGCTD+ QV+ E+QE KK YPQAW
Sbjct  89   VPCLEFELEHGFVYRENASSPGYYDGRYWTMWKLPMFGCTDSAQVMKELQECKKEYPQAW  148

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQC+SFIA KP G+
Sbjct  149  IRIIGFDNVRQVQCVSFIASKPTGF  173



>gb|AAP31054.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Flaveria bidentis]
Length=173

 Score =   160 bits (405),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFE EHGFVYREN  SPGYYDGRYWTMWKLPMFGCTD+ QV+ E+QE KK YPQAW
Sbjct  89   VPCLEFELEHGFVYRENASSPGYYDGRYWTMWKLPMFGCTDSAQVMKELQECKKEYPQAW  148

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQC+SFIA KP G+
Sbjct  149  IRIIGFDNVRQVQCVSFIASKPTGF  173



>sp|Q39748.1|RBS6_FLAPR RecName: Full=Ribulose bisphosphate carboxylase small chain 6, 
chloroplastic; Short=RuBisCO small subunit 6; Flags: Precursor 
[Flaveria pringlei]
 gb|AAB67850.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
protein [Flaveria pringlei]
Length=173

 Score =   160 bits (405),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFE EHGFVYREN +SPGYYDGRYWTMWKLPMFGCTD+ QV+ E+QE KK YPQAW
Sbjct  89   VPCLEFELEHGFVYRENARSPGYYDGRYWTMWKLPMFGCTDSVQVMKELQECKKEYPQAW  148

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQCISFIA KP+ +
Sbjct  149  IRIIGFDNVRQVQCISFIASKPDXF  173



>sp|P00865.1|RBS1_SOYBN RecName: Full=Ribulose bisphosphate carboxylase small chain 1, 
chloroplastic; Short=RuBisCO small subunit 1; Flags: Precursor 
[Glycine max]
 emb|CAA23736.1| rubpcase [Glycine max]
Length=178

 Score =   160 bits (405),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            +PCLEFE EHGFVYRE+N+SP YYDGRYWTMWKLPMFGCTDA+QVL E+QEAK AYP  +
Sbjct  94   IPCLEFELEHGFVYREHNRSPXYYDGRYWTMWKLPMFGCTDASQVLKELQEAKTAYPNGF  153

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQCISFIAYKP G+
Sbjct  154  IRIIGFDNVRQVQCISFIAYKPPGF  178



>gb|ACO35888.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Ageratina adenophora]
Length=178

 Score =   160 bits (405),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 71/85 (84%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFE EHGFVYRE+ +SPGYYDGR+WTMWKLPMFGCTD+ QVL EV E KK YPQAW
Sbjct  94   VPCLEFELEHGFVYREHARSPGYYDGRHWTMWKLPMFGCTDSAQVLKEVGECKKEYPQAW  153

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQCISFIA KP+GY
Sbjct  154  IRIIGFDNVRQVQCISFIASKPDGY  178



>ref|XP_007215051.1| hypothetical protein PRUPE_ppa012123mg [Prunus persica]
 gb|EMJ16250.1| hypothetical protein PRUPE_ppa012123mg [Prunus persica]
Length=183

 Score =   160 bits (406),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFE E GFVYREN++SPGYYDGRYWTMWKLPMFGCTD++QVL E++EAKKA P ++
Sbjct  99   VPCLEFELEKGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDSSQVLKELEEAKKANPNSF  158

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQCISFIAYKP GY
Sbjct  159  IRIIGFDNVRQVQCISFIAYKPAGY  183



>gb|AFK33868.1| unknown [Lotus japonicus]
Length=177

 Score =   160 bits (405),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 72/85 (85%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFETE GFVYREN KSPGYYDGRYWTMWKLPMFG TDA+QVL E++EAKKAYP A+
Sbjct  93   VPCLEFETEKGFVYRENLKSPGYYDGRYWTMWKLPMFGTTDASQVLKELEEAKKAYPNAF  152

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDN RQVQCISFIA++PEGY
Sbjct  153  IRIIGFDNKRQVQCISFIAHRPEGY  177



>gb|AAK16231.1|AF044399_1 ribulose-1,5-bisphosphate carboxylase small subunit P1B [Flaveria 
palmeri]
 gb|AAK16233.1|AF044401_1 ribulose-1,5-bisphosphate carboxylase small subunit P2B [Flaveria 
palmeri]
Length=131

 Score =   159 bits (401),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFE EHGFVYREN  SPGYYDGRYWTMWKLPMFGCTD+ QV+ E+QE KK YPQAW
Sbjct  47   VPCLEFELEHGFVYRENASSPGYYDGRYWTMWKLPMFGCTDSAQVMKELQECKKEYPQAW  106

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQC+SFIA KP G+
Sbjct  107  IRIIGFDNVRQVQCVSFIASKPTGF  131



>ref|XP_010044264.1| PREDICTED: ribulose bisphosphate carboxylase small chain 3B, 
chloroplastic-like [Eucalyptus grandis]
 dbj|BAI53120.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Eucalyptus globulus]
 gb|KCW86324.1| hypothetical protein EUGRSUZ_B03013 [Eucalyptus grandis]
Length=179

 Score =   160 bits (405),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFE EHGFVYRE++ SPGYYDGRYWTMWKLPMFGCTD+ QVL E++EAKKAYP A+
Sbjct  95   VPCLEFELEHGFVYREHHSSPGYYDGRYWTMWKLPMFGCTDSAQVLKELEEAKKAYPTAF  154

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDN RQVQCISFIAYKP G+
Sbjct  155  IRIIGFDNKRQVQCISFIAYKPPGF  179



>gb|AAK16232.1|AF044400_1 ribulose-1,5-bisphosphate carboxylase small subunit P2A [Flaveria 
palmeri]
Length=131

 Score =   158 bits (400),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFE EHGFVYREN  SPGYYDGRYWTMWKLPMFGCTD+ QV+ E+QE KK YPQAW
Sbjct  47   VPCLEFELEHGFVYRENASSPGYYDGRYWTMWKLPMFGCTDSAQVMKELQECKKEYPQAW  106

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQC+SFIA KP G+
Sbjct  107  IRIIGFDNVRQVQCVSFIASKPTGF  131



>ref|XP_008244506.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
isoform X1 [Prunus mume]
Length=182

 Score =   160 bits (404),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFE E GFVYREN++SPGYYDGRYWTMWKLPMFGCTD++QVL E++EAKKA P ++
Sbjct  98   VPCLEFELEKGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDSSQVLKELEEAKKANPNSF  157

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQCISFIAYKP GY
Sbjct  158  IRIIGFDNVRQVQCISFIAYKPAGY  182



>gb|EYU44637.1| hypothetical protein MIMGU_mgv1a0165712mg, partial [Erythranthe 
guttata]
Length=87

 Score =   157 bits (396),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            +PC+EFE EHGFVYRE N SPGYYDGRYWTMWKLPMFGCTD+ QVL E+ EAKK YP A+
Sbjct  3    IPCIEFELEHGFVYREYNSSPGYYDGRYWTMWKLPMFGCTDSAQVLRELDEAKKTYPSAF  62

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQ ISFIAYKPEGY
Sbjct  63   IRIIGFDNVRQVQSISFIAYKPEGY  87



>gb|AFK42721.1| unknown [Lotus japonicus]
Length=182

 Score =   160 bits (404),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 71/85 (84%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFETE GFVYREN+KSPGYYDGRYWTMWKLPMFGC+DA QVL E+ EA +AYP A+
Sbjct  98   VPCLEFETEKGFVYRENHKSPGYYDGRYWTMWKLPMFGCSDAAQVLKELDEAVRAYPNAF  157

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            VRIIGFDNVRQVQCISFIA++P GY
Sbjct  158  VRIIGFDNVRQVQCISFIAHRPAGY  182



>gb|AAW31667.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Ammopiptanthus mongolicus]
Length=174

 Score =   159 bits (403),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFE EHGFVYRENN+SPGYYDGRYWTMWKLPMFGC+DA+QV+ E++E KK YP A+
Sbjct  88   VPCLEFELEHGFVYRENNRSPGYYDGRYWTMWKLPMFGCSDASQVMKELEECKKEYPTAF  147

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            VRIIGFDN RQVQCISFIAYKP G+
Sbjct  148  VRIIGFDNKRQVQCISFIAYKPPGF  172



>gb|ABJ74187.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit [Artemisia annua]
Length=90

 Score =   157 bits (396),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFE EHGFVYREN++SPGYYDGR WTMWKLPMFGCTD+ QV+ E+QEAKK YP A+
Sbjct  6    VPCLEFEVEHGFVYRENHRSPGYYDGRTWTMWKLPMFGCTDSAQVMKELQEAKKEYPNAF  65

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQCISFIA+KP GY
Sbjct  66   IRIIGFDNVRQVQCISFIAHKPPGY  90



>sp|P08705.1|RBS_HELAN RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Helianthus annuus]
 emb|CAA68490.1| ribulose bisphosphate carboxylase [Helianthus annuus]
 emb|CAA28737.1| RuBisCO (SSU) [Helianthus annuus]
Length=178

 Score =   159 bits (403),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 69/85 (81%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFE EHGFVYREN +SPGYYDGRYWTMWKLPMFGCTD+ QV+ E+ E KK YPQAW
Sbjct  94   VPCLEFELEHGFVYRENARSPGYYDGRYWTMWKLPMFGCTDSAQVMKELAECKKEYPQAW  153

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQCI FIA +P+GY
Sbjct  154  IRIIGFDNVRQVQCIMFIASRPDGY  178



>sp|Q42822.1|RBS_GLYTO RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Glycine tomentella]
 gb|AAA82070.1| ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit 
precursor [Glycine tomentella]
Length=178

 Score =   159 bits (403),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 69/85 (81%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            +PCLEFE EHGFVYREN++SPGYYDGRYWTMWKLP+FGCTDA+QVL E+QEAK AYP  +
Sbjct  94   IPCLEFELEHGFVYRENHRSPGYYDGRYWTMWKLPVFGCTDASQVLKELQEAKTAYPNGF  153

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQCISFIAYKP  +
Sbjct  154  IRIIGFDNVRQVQCISFIAYKPPSF  178



>ref|XP_002531624.1| Ribulose bisphosphate carboxylase small chain, chloroplast precursor, 
putative [Ricinus communis]
 gb|EEF30752.1| Ribulose bisphosphate carboxylase small chain, chloroplast precursor, 
putative [Ricinus communis]
Length=180

 Score =   159 bits (403),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 69/85 (81%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFE EHGFVYREN++SPGYYDGR WTMWKLPMFGCTD++QVL E++EAKKAYP ++
Sbjct  96   VPCLEFELEHGFVYRENHRSPGYYDGRCWTMWKLPMFGCTDSSQVLKELEEAKKAYPNSF  155

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDN RQVQCISFIAYKP G+
Sbjct  156  IRIIGFDNKRQVQCISFIAYKPSGF  180



>ref|XP_011099669.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Sesamum indicum]
Length=180

 Score =   159 bits (402),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 69/85 (81%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            +PC+EFE EHGFVYREN++SPGYYDGRYWTMWKLPM+GCTD+ QVL EV EA +A+P A+
Sbjct  96   IPCVEFELEHGFVYRENHRSPGYYDGRYWTMWKLPMYGCTDSAQVLLEVDEAVRAHPDAF  155

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            VRIIGFDNVRQVQCISFIAYKP GY
Sbjct  156  VRIIGFDNVRQVQCISFIAYKPPGY  180



>ref|XP_007151650.1| hypothetical protein PHAVU_004G064800g [Phaseolus vulgaris]
 ref|XP_007151651.1| hypothetical protein PHAVU_004G064900g [Phaseolus vulgaris]
 gb|ESW23644.1| hypothetical protein PHAVU_004G064800g [Phaseolus vulgaris]
 gb|ESW23645.1| hypothetical protein PHAVU_004G064900g [Phaseolus vulgaris]
Length=180

 Score =   159 bits (402),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFE EHGFVYRE+NKSPGYYDGRYWTMWKLPMFGCTD++QVL E+ EA+ A+P  +
Sbjct  96   VPCLEFELEHGFVYREHNKSPGYYDGRYWTMWKLPMFGCTDSSQVLKELYEAQTAHPDGF  155

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQCISFIAYKP GY
Sbjct  156  IRIIGFDNVRQVQCISFIAYKPPGY  180



>emb|CAA42618.1| ribulose bisphosphate carboxylase [Phaseolus vulgaris]
 emb|CAA40339.1| small subunit of ribulose 1,5-bisphosphate carboxylase/oxygenase 
[Phaseolus vulgaris]
Length=180

 Score =   159 bits (402),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFE EHGFVYRE+NKSPGYYDGRYWTMWKLPMFGCTD++QVL E+ EA+ A+P  +
Sbjct  96   VPCLEFELEHGFVYREHNKSPGYYDGRYWTMWKLPMFGCTDSSQVLKELYEAQTAHPDGF  155

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQCISFIAYKP GY
Sbjct  156  IRIIGFDNVRQVQCISFIAYKPPGY  180



>gb|AGV54682.1| ribulose bisphosphate carboxylase [Phaseolus vulgaris]
Length=180

 Score =   159 bits (401),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFE EHGFVYRE+NKSPGYYDGRYWTMWKLPMFGCTD++QVL E+ EA+ A+P  +
Sbjct  96   VPCLEFELEHGFVYREHNKSPGYYDGRYWTMWKLPMFGCTDSSQVLKELYEAQTAHPDGF  155

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQCISFIAYKP GY
Sbjct  156  IRIIGFDNVRQVQCISFIAYKPPGY  180



>gb|ABS57004.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[synthetic construct]
Length=129

 Score =   157 bits (397),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 69/85 (81%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFE EHGFVYREN +SPGYYDGRYWTMWKLPMFGCTD+ QV+ E+ E KK YPQAW
Sbjct  39   VPCLEFELEHGFVYRENARSPGYYDGRYWTMWKLPMFGCTDSAQVMKELAECKKEYPQAW  98

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQCI FIA +P+GY
Sbjct  99   IRIIGFDNVRQVQCIMFIASRPDGY  123



>ref|XP_007151771.1| hypothetical protein PHAVU_004G073400g, partial [Phaseolus vulgaris]
 gb|ESW23765.1| hypothetical protein PHAVU_004G073400g, partial [Phaseolus vulgaris]
Length=121

 Score =   156 bits (395),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFE EHGFVYRE+NKSPGYYDGRYWTMWKLPMFGCTD++QVL E+ EA+ A+P  +
Sbjct  37   VPCLEFELEHGFVYREHNKSPGYYDGRYWTMWKLPMFGCTDSSQVLKELYEAQTAHPDGF  96

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQCISFIAYKP GY
Sbjct  97   IRIIGFDNVRQVQCISFIAYKPPGY  121



>sp|Q08186.1|RBS6_MESCR RecName: Full=Ribulose bisphosphate carboxylase small chain 6, 
chloroplastic; Short=RuBisCO small subunit 6; Flags: Precursor 
[Mesembryanthemum crystallinum]
 gb|AAA03698.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Mesembryanthemum crystallinum]
Length=186

 Score =   159 bits (401),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 68/85 (80%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFE  HGFVYRE+  +PGYYDGRYWTMWKLPMFGCTD +QV+AE++EAKKAYP+A+
Sbjct  100  VPCLEFEPTHGFVYREHGNTPGYYDGRYWTMWKLPMFGCTDPSQVVAELEEAKKAYPEAF  159

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQC+SFIAYKP  Y
Sbjct  160  IRIIGFDNVRQVQCVSFIAYKPASY  184



>gb|AAK16230.1|AF044398_1 ribulose-1,5-bisphosphate carboxylase small subunit P1A, partial 
[Flaveria palmeri]
Length=131

 Score =   157 bits (396),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 69/85 (81%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFE EHGFVYREN  SPGYYDGRYWTMWKLPMFGCTD+ QV+ E+QE KK YPQAW
Sbjct  47   VPCLEFELEHGFVYRENASSPGYYDGRYWTMWKLPMFGCTDSAQVMKELQECKKEYPQAW  106

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQC+SFI+ KP G+
Sbjct  107  IRIIGFDNVRQVQCVSFISPKPTGF  131



>ref|XP_011099670.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Sesamum indicum]
Length=180

 Score =   158 bits (400),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 69/85 (81%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            +PC+EFE EHGFVYREN++SPGYYDGRYWTMWKLPM+GCTD+ QVL EV EA +A+P A+
Sbjct  96   IPCVEFELEHGFVYRENHRSPGYYDGRYWTMWKLPMYGCTDSAQVLLEVDEAVRAHPDAF  155

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            VRIIGFDNVRQVQCISFIAYKP GY
Sbjct  156  VRIIGFDNVRQVQCISFIAYKPPGY  180



>gb|AAA33036.1| ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit 
[Mesembryanthemum crystallinum]
Length=180

 Score =   158 bits (400),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 69/85 (81%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFE  HGFVYRE+  +PGYYDGRYWTMWKLPMFGCTD +QV+AE++EAKKAYP+A+
Sbjct  94   VPCLEFEPTHGFVYREHGNTPGYYDGRYWTMWKLPMFGCTDPSQVVAELEEAKKAYPEAF  153

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQCISFIAYKP  Y
Sbjct  154  IRIIGFDNVRQVQCISFIAYKPASY  178



>ref|XP_002532149.1| Ribulose bisphosphate carboxylase small chain, chloroplast precursor, 
putative [Ricinus communis]
 gb|EEF30223.1| Ribulose bisphosphate carboxylase small chain, chloroplast precursor, 
putative [Ricinus communis]
Length=185

 Score =   158 bits (400),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFE EHGFVYREN +SPGYYDGRYWTMWKLPMFGC+DA QVL E+ EA KAYP ++
Sbjct  98   VPCLEFELEHGFVYRENARSPGYYDGRYWTMWKLPMFGCSDAVQVLKELDEAIKAYPNSF  157

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            VRIIGFDNVRQVQCISFIAYKP  +
Sbjct  158  VRIIGFDNVRQVQCISFIAYKPPSF  182



>sp|P16032.2|RBS1_MESCR RecName: Full=Ribulose bisphosphate carboxylase small chain 1, 
chloroplastic; Short=RuBisCO small subunit 1; Flags: Precursor 
[Mesembryanthemum crystallinum]
 gb|AAA03693.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Mesembryanthemum crystallinum]
 prf||1802403A RuBisCO:SUBUNIT=small
Length=182

 Score =   158 bits (400),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 69/85 (81%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFE  HGFVYRE+  +PGYYDGRYWTMWKLPMFGCTD +QV+AE++EAKKAYP+A+
Sbjct  96   VPCLEFEPTHGFVYREHGNTPGYYDGRYWTMWKLPMFGCTDPSQVVAELEEAKKAYPEAF  155

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQCISFIAYKP  Y
Sbjct  156  IRIIGFDNVRQVQCISFIAYKPASY  180



>gb|AAA33035.1| ribulose-1-5-bisphosphate carboxylase [Mesembryanthemum crystallinum]
Length=182

 Score =   158 bits (399),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 69/85 (81%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFE  HGFVYRE+  +PGYYDGRYWTMWKLPMFGCTD +QV+AE++EAKKAYP+A+
Sbjct  96   VPCLEFEPTHGFVYREHGNTPGYYDGRYWTMWKLPMFGCTDPSQVVAELREAKKAYPEAF  155

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQCISFIAYKP  Y
Sbjct  156  IRIIGFDNVRQVQCISFIAYKPASY  180



>emb|CAA42617.1| ribulose bisphosphate carboxylase [Phaseolus vulgaris]
Length=135

 Score =   157 bits (396),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFE EHGFVYRE+NKSPGYYDGRYWTMWKLPMFGCTD++QVL E+ EA+ A+P  +
Sbjct  51   VPCLEFELEHGFVYREHNKSPGYYDGRYWTMWKLPMFGCTDSSQVLKELYEAQTAHPDGF  110

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQCISFIAYKP GY
Sbjct  111  IRIIGFDNVRQVQCISFIAYKPPGY  135



>gb|AAU14862.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit [Fagus sylvatica]
Length=181

 Score =   158 bits (399),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 69/82 (84%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            +PCLEFE EH FVYRENN+SPGYYDGRYW MWKLPMFGCTDATQVLAE+QEA K YP + 
Sbjct  98   IPCLEFELEHPFVYRENNRSPGYYDGRYWVMWKLPMFGCTDATQVLAELQEASKTYPTSH  157

Query  182  VRIIGFDNVRQVQCISFIAYKP  247
            +RIIGFDN RQVQCISFIAYKP
Sbjct  158  IRIIGFDNKRQVQCISFIAYKP  179



>sp|O22077.1|RBS_FAGCR RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Fagus crenata]
 dbj|BAA23214.1| small subunit of ribulose-1,5-bisphosphate carboxylase/oxygenase 
[Fagus crenata]
Length=182

 Score =   158 bits (399),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 69/82 (84%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            +PCLEFE EH FVYRENN+SPGYYDGRYW MWKLPMFGCTDATQVLAE+QEA K YP + 
Sbjct  98   IPCLEFELEHPFVYRENNRSPGYYDGRYWVMWKLPMFGCTDATQVLAELQEASKTYPTSH  157

Query  182  VRIIGFDNVRQVQCISFIAYKP  247
            +RIIGFDN RQVQCISFIAYKP
Sbjct  158  IRIIGFDNKRQVQCISFIAYKP  179



>gb|KDP20120.1| hypothetical protein JCGZ_05889 [Jatropha curcas]
Length=181

 Score =   158 bits (399),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 70/84 (83%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFE EHGFVYRENN+SPGYYDGRYWTMWKLPMFGCTDA QVL E+ EA KA+P  +
Sbjct  97   VPCLEFELEHGFVYRENNRSPGYYDGRYWTMWKLPMFGCTDAVQVLNELDEAIKAHPNGF  156

Query  182  VRIIGFDNVRQVQCISFIAYKPEG  253
            VRIIGFD+ RQVQCISFIAYKP+G
Sbjct  157  VRIIGFDSYRQVQCISFIAYKPKG  180



>ref|XP_002521232.1| Ribulose bisphosphate carboxylase small chain 1B, chloroplast 
precursor, putative [Ricinus communis]
 gb|EEF41184.1| Ribulose bisphosphate carboxylase small chain 1B, chloroplast 
precursor, putative [Ricinus communis]
Length=181

 Score =   158 bits (399),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 68/85 (80%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            +PCLEFE EHGFVYREN++SPGYYDGRYWTMWKLPMFGC+D+TQVL E+ EAKKAYP ++
Sbjct  95   IPCLEFELEHGFVYRENHRSPGYYDGRYWTMWKLPMFGCSDSTQVLKELDEAKKAYPNSF  154

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDN RQVQCISFIAYKP  +
Sbjct  155  IRIIGFDNRRQVQCISFIAYKPTTF  179



>sp|P12468.1|RBS4_SOYBN RecName: Full=Ribulose bisphosphate carboxylase small chain 4, 
chloroplastic; Short=RuBisCO small subunit 4; Flags: Precursor 
[Glycine max]
 gb|AAA34008.1| ribulose 1,5-bisphosphate carboxylase [Glycine max]
 prf||1306410A ribulose bisphosphate carboxylase S
Length=178

 Score =   157 bits (398),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 69/85 (81%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            +PCLEFE EHGFVYRE+N+S GYYDGRYWTMWKLPMFGCTDA+QVL E+QEAK AYP  +
Sbjct  94   IPCLEFELEHGFVYREHNRSLGYYDGRYWTMWKLPMFGCTDASQVLKELQEAKTAYPNGF  153

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQCISFIAYKP  +
Sbjct  154  IRIIGFDNVRQVQCISFIAYKPPSF  178



>gb|AAA82069.1| ribulose 1,5-bisphosphate carboxylase small subunit precursor 
[Glycine soja]
Length=178

 Score =   157 bits (398),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 69/85 (81%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            +PCLEFE EHGFVYRE+N+SPGYYDGR WTMWKLPMFGCTDA+QVL E+QEAK AYP  +
Sbjct  94   IPCLEFELEHGFVYREHNRSPGYYDGRCWTMWKLPMFGCTDASQVLKELQEAKTAYPNGF  153

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQCISFIAYKP  +
Sbjct  154  IRIIGFDNVRQVQCISFIAYKPPSF  178



>gb|ABS72189.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
1A [Corchorus olitorius]
Length=183

 Score =   157 bits (398),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 68/85 (80%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            +PCLEFE EHGFVYRE++ SPGYYDGRYWTMWKLPMFGCTD++QVL E++EAKKAYP A+
Sbjct  96   IPCLEFELEHGFVYREHHHSPGYYDGRYWTMWKLPMFGCTDSSQVLKELEEAKKAYPDAF  155

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDN RQVQCISFIAYKP  +
Sbjct  156  IRIIGFDNRRQVQCISFIAYKPPSF  180



>gb|ADB85091.1| ribulose 1,5-bisphosphate carboxylase small subunit [Jatropha 
curcas]
Length=181

 Score =   157 bits (398),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 70/84 (83%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFE EHGFVYRENN+SPGYYDGRYWTMWKLPMFGCTDA QVL E+ EA KA+P  +
Sbjct  97   VPCLEFELEHGFVYRENNRSPGYYDGRYWTMWKLPMFGCTDAVQVLNELDEAIKAHPNGF  156

Query  182  VRIIGFDNVRQVQCISFIAYKPEG  253
            VRIIGFD+ RQVQCISFIAYKP+G
Sbjct  157  VRIIGFDSYRQVQCISFIAYKPKG  180



>sp|Q08183.1|RBS3_MESCR RecName: Full=Ribulose bisphosphate carboxylase small chain 3, 
chloroplastic; Short=RuBisCO small subunit 3; Flags: Precursor 
[Mesembryanthemum crystallinum]
 gb|AAA03695.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Mesembryanthemum crystallinum]
Length=183

 Score =   157 bits (398),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 69/85 (81%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFE  HGFVYRE+  +PGYYDGRYWTMWKLPMFGCTD +QV+AE++EAKKAYP+A+
Sbjct  97   VPCLEFEPTHGFVYREHGNTPGYYDGRYWTMWKLPMFGCTDPSQVVAELEEAKKAYPEAF  156

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQCISFIAYKP  Y
Sbjct  157  IRIIGFDNVRQVQCISFIAYKPASY  181



>ref|XP_010693073.1| PREDICTED: ribulose bisphosphate carboxylase small chain-like 
[Beta vulgaris subsp. vulgaris]
Length=180

 Score =   157 bits (397),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            +PCLEFE + GFVYRE+NKSPGYYDGRYWTMWKLPMFGCTD  QV+ EV+E KKAYP A+
Sbjct  96   IPCLEFEVKDGFVYREHNKSPGYYDGRYWTMWKLPMFGCTDPAQVVNEVEEVKKAYPDAF  155

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            VRIIGFDN RQVQCISFIAYKP GY
Sbjct  156  VRIIGFDNKRQVQCISFIAYKPSGY  180



>sp|Q04450.1|RBS2_MESCR RecName: Full=Ribulose bisphosphate carboxylase small chain 2, 
chloroplastic; Short=RuBisCO small subunit 2; Flags: Precursor 
[Mesembryanthemum crystallinum]
 gb|AAA03694.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Mesembryanthemum crystallinum]
Length=180

 Score =   157 bits (397),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 69/85 (81%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFE  HGFVYRE+  +PGYYDGRYWTMWKLPMFGCTD +QV+AE++EAKKAYP+A+
Sbjct  94   VPCLEFEPTHGFVYREHGNTPGYYDGRYWTMWKLPMFGCTDPSQVVAELEEAKKAYPEAF  153

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
             RIIGFDNVRQVQCISFIAYKP  Y
Sbjct  154  TRIIGFDNVRQVQCISFIAYKPASY  178



>ref|XP_011089882.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Sesamum indicum]
Length=181

 Score =   157 bits (397),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 68/85 (80%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            +PCLEFE EHGFVYREN++SPGYYDGRYWTMWKLPMFGCTDA QVL E+ EA KA+P  +
Sbjct  97   IPCLEFELEHGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDAVQVLLELDEAIKAHPNGF  156

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDN RQVQC SFIAYKP GY
Sbjct  157  IRIIGFDNARQVQCTSFIAYKPPGY  181



>gb|AAA33037.1| ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit 
[Mesembryanthemum crystallinum]
Length=183

 Score =   157 bits (397),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 69/85 (81%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFE  HGFVYRE+  +PGYYDGRYWTMWKLPMFGCTD +QV+AE++EAKKAYP+A+
Sbjct  97   VPCLEFEPTHGFVYREHGNTPGYYDGRYWTMWKLPMFGCTDPSQVVAELEEAKKAYPEAF  156

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQCISFIAYKP  Y
Sbjct  157  IRIIGFDNVRQVQCISFIAYKPASY  181



>gb|AIF75346.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana sylvestris]
 gb|AIF75347.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
 gb|AIF75348.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score =   156 bits (395),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 70/72 (97%), Positives = 72/72 (100%), Gaps = 0/72 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEV+EAKKAYPQAW
Sbjct  81   VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAW  140

Query  182  VRIIGFDNVRQV  217
            +RIIGFDNVRQV
Sbjct  141  IRIIGFDNVRQV  152



>gb|AIF75351.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana sylvestris]
 gb|AIF75352.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score =   156 bits (395),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 70/72 (97%), Positives = 72/72 (100%), Gaps = 0/72 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEV+EAKKAYPQAW
Sbjct  81   VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAW  140

Query  182  VRIIGFDNVRQV  217
            +RIIGFDNVRQV
Sbjct  141  IRIIGFDNVRQV  152



>gb|AIF75367.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tomentosiformis]
 gb|AIF75368.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score =   156 bits (394),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 70/72 (97%), Positives = 72/72 (100%), Gaps = 0/72 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEV+EAKKAYPQAW
Sbjct  81   VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAW  140

Query  182  VRIIGFDNVRQV  217
            +RIIGFDNVRQV
Sbjct  141  IRIIGFDNVRQV  152



>gb|AIF75359.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tomentosiformis]
 gb|AIF75360.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score =   156 bits (394),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 70/72 (97%), Positives = 72/72 (100%), Gaps = 0/72 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEV+EAKKAYPQAW
Sbjct  81   VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAW  140

Query  182  VRIIGFDNVRQV  217
            +RIIGFDNVRQV
Sbjct  141  IRIIGFDNVRQV  152



>gb|AIF75353.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana sylvestris]
 gb|AIF75354.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score =   156 bits (394),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 70/72 (97%), Positives = 72/72 (100%), Gaps = 0/72 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEV+EAKKAYPQAW
Sbjct  81   VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAW  140

Query  182  VRIIGFDNVRQV  217
            +RIIGFDNVRQV
Sbjct  141  IRIIGFDNVRQV  152



>gb|AIF75355.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana sylvestris]
 gb|AIF75356.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score =   156 bits (394),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 70/72 (97%), Positives = 72/72 (100%), Gaps = 0/72 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEV+EAKKAYPQAW
Sbjct  81   VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAW  140

Query  182  VRIIGFDNVRQV  217
            +RIIGFDNVRQV
Sbjct  141  IRIIGFDNVRQV  152



>ref|XP_010693059.1| PREDICTED: ribulose bisphosphate carboxylase small chain [Beta 
vulgaris subsp. vulgaris]
Length=180

 Score =   157 bits (396),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            +PCLEFE + GFVYRE+NKSPGYYDGRYWTMWKLPMFGCTD  QV+ EV+E KKAYP A+
Sbjct  96   IPCLEFEVKDGFVYREHNKSPGYYDGRYWTMWKLPMFGCTDPAQVVNEVEEVKKAYPDAF  155

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            VRIIGFDN RQVQCISFIAYKP GY
Sbjct  156  VRIIGFDNKRQVQCISFIAYKPAGY  180



>gb|AIF75349.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana sylvestris]
 gb|AIF75350.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score =   156 bits (394),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 70/72 (97%), Positives = 72/72 (100%), Gaps = 0/72 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEV+EAKKAYPQAW
Sbjct  81   VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAW  140

Query  182  VRIIGFDNVRQV  217
            +RIIGFDNVRQV
Sbjct  141  IRIIGFDNVRQV  152



>gb|AIF75364.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tomentosiformis]
 gb|AIF75366.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score =   156 bits (394),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 70/72 (97%), Positives = 72/72 (100%), Gaps = 0/72 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEV+EAKKAYPQAW
Sbjct  81   VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAW  140

Query  182  VRIIGFDNVRQV  217
            +RIIGFDNVRQV
Sbjct  141  IRIIGFDNVRQV  152



>gb|AIF75361.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tomentosiformis]
 gb|AIF75362.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score =   156 bits (394),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 70/72 (97%), Positives = 72/72 (100%), Gaps = 0/72 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEV+EAKKAYPQAW
Sbjct  81   VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAW  140

Query  182  VRIIGFDNVRQV  217
            +RIIGFDNVRQV
Sbjct  141  IRIIGFDNVRQV  152



>sp|Q08184.1|RBS4_MESCR RecName: Full=Ribulose bisphosphate carboxylase small chain 4, 
chloroplastic; Short=RuBisCO small subunit 4; Flags: Precursor 
[Mesembryanthemum crystallinum]
 gb|AAA33038.1| ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit 
[Mesembryanthemum crystallinum]
 gb|AAA03696.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Mesembryanthemum crystallinum]
Length=183

 Score =   157 bits (396),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 68/85 (80%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFE  HGFVYRE+  +PGYYDGRYWTMWKLPMFGCTD +QV+AE++EAKKAYP+A+
Sbjct  97   VPCLEFEPTHGFVYREHGNTPGYYDGRYWTMWKLPMFGCTDPSQVVAELEEAKKAYPEAF  156

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQC+SFIAYKP  Y
Sbjct  157  IRIIGFDNVRQVQCVSFIAYKPASY  181



>dbj|BAI53118.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Eucalyptus globulus]
Length=181

 Score =   157 bits (396),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFETE GFVYRE++ SPGYYDGRYWTMWKLPMFGCTD+ QVL E++E KKAYP A+
Sbjct  97   VPCLEFETEKGFVYREHHHSPGYYDGRYWTMWKLPMFGCTDSAQVLKELEECKKAYPTAF  156

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            VRIIGFDN RQVQCISFIA+KP GY
Sbjct  157  VRIIGFDNKRQVQCISFIAFKPPGY  181



>sp|Q08185.1|RBS5_MESCR RecName: Full=Ribulose bisphosphate carboxylase small chain 5, 
chloroplastic; Short=RuBisCO small subunit 5; Flags: Precursor 
[Mesembryanthemum crystallinum]
 gb|AAA03697.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit, 
partial [Mesembryanthemum crystallinum]
Length=182

 Score =   157 bits (396),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 68/85 (80%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFE  HGFVYRE+  +PGYYDGRYWTMWKLPMFGCTD +QV+AE++EAKKAYP+A+
Sbjct  96   VPCLEFEPTHGFVYREHGNTPGYYDGRYWTMWKLPMFGCTDPSQVVAELEEAKKAYPEAF  155

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQC+SFIAYKP  Y
Sbjct  156  IRIIGFDNVRQVQCVSFIAYKPASY  180



>ref|XP_011035062.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Populus euphratica]
Length=181

 Score =   157 bits (396),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 69/84 (82%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFE E G+VYREN++SPGYYDGRYWTMWKLPMFGCT+A+QVL E+QEAKKAYP A+
Sbjct  97   VPCLEFELEKGWVYRENHRSPGYYDGRYWTMWKLPMFGCTEASQVLVELQEAKKAYPNAF  156

Query  182  VRIIGFDNVRQVQCISFIAYKPEG  253
            +RIIGFDNVRQVQCISFIA KP+ 
Sbjct  157  IRIIGFDNVRQVQCISFIAAKPQA  180



>dbj|BAE46384.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Panax ginseng]
Length=183

 Score =   156 bits (395),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFE EHGFVYRE++ SPGYYDGRYWTMWKLPMFGCTD++QVL EV+E KK YP A+
Sbjct  97   VPCLEFELEHGFVYREHHHSPGYYDGRYWTMWKLPMFGCTDSSQVLKEVEECKKEYPNAY  156

Query  182  VRIIGFDNVRQVQCISFIAYKP  247
            +RIIGFDNVRQVQCISFIA+KP
Sbjct  157  IRIIGFDNVRQVQCISFIAFKP  178



>gb|AGV08375.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Arachis hypogaea]
Length=182

 Score =   156 bits (394),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFE  +GF YREN++SPGYYDGRYWTMWKLPMFGCTD+ QV+ E+QEAK AYP+A+
Sbjct  98   VPCLEFEVGYGFPYRENHRSPGYYDGRYWTMWKLPMFGCTDSGQVIKELQEAKAAYPKAF  157

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            VRIIGFDNVRQVQCISFIAYKP GY
Sbjct  158  VRIIGFDNVRQVQCISFIAYKPGGY  182



>ref|XP_006391132.1| hypothetical protein EUTSA_v10019199mg [Eutrema salsugineum]
 gb|ESQ28418.1| hypothetical protein EUTSA_v10019199mg [Eutrema salsugineum]
Length=182

 Score =   156 bits (394),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            +PC+EFE EHGFVYRE+NKSPGYYDGRYWTMWKLP+FGCTD++QVL EV+E KK YP A+
Sbjct  98   IPCVEFELEHGFVYREHNKSPGYYDGRYWTMWKLPLFGCTDSSQVLKEVEECKKEYPNAF  157

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDN RQVQCISFIAYKP  +
Sbjct  158  IRIIGFDNSRQVQCISFIAYKPPHF  182



>ref|XP_010669829.1| PREDICTED: ribulose bisphosphate carboxylase small chain 6, chloroplastic-like 
[Beta vulgaris subsp. vulgaris]
Length=183

 Score =   156 bits (394),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 69/85 (81%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            +PCLEFE + GFVYRE+N SPGYYDGRYWTMWKLPMFGCTD  QV+ E++E KKAYPQA+
Sbjct  99   IPCLEFEVKDGFVYREHNNSPGYYDGRYWTMWKLPMFGCTDPAQVVNELEEVKKAYPQAF  158

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            VRIIGFD  RQVQCISFIAYKPEGY
Sbjct  159  VRIIGFDKNRQVQCISFIAYKPEGY  183



>ref|XP_010103758.1| hypothetical protein L484_014647 [Morus notabilis]
 gb|EXB97036.1| hypothetical protein L484_014647 [Morus notabilis]
Length=182

 Score =   156 bits (394),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            +PCLEFE     +YRENN+SPGYYDGRYWTMWKLPMFGCTDATQVLAEVQE KKAYP A 
Sbjct  98   IPCLEFEVGKAHIYRENNRSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQETKKAYPDAH  157

Query  182  VRIIGFDNVRQVQCISFIAYKP  247
            VRIIGFDN RQVQCISFIAYKP
Sbjct  158  VRIIGFDNNRQVQCISFIAYKP  179



>ref|XP_010032637.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Eucalyptus grandis]
Length=181

 Score =   155 bits (393),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 69/85 (81%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFETE GFVYRE++ SPGYYDGRYWTMWKLPMFGCTD+ QVL E++E KKAYP A+
Sbjct  97   VPCLEFETEKGFVYREHHHSPGYYDGRYWTMWKLPMFGCTDSAQVLKELEECKKAYPTAF  156

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            VRIIGFDN RQVQCISFIA+KP G+
Sbjct  157  VRIIGFDNKRQVQCISFIAFKPPGF  181



>pdb|4MKV|S Chain S, Structure Of Pisum Sativum Rubisco With Aba
 pdb|4MKV|T Chain T, Structure Of Pisum Sativum Rubisco With Aba
 pdb|4MKV|U Chain U, Structure Of Pisum Sativum Rubisco With Aba
 pdb|4MKV|V Chain V, Structure Of Pisum Sativum Rubisco With Aba
Length=123

 Score =   153 bits (387),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFE + GFVYRE+NKSPGYYDGRYWTMWKLPMFG TDA+QVL E+ E KKAYP+A+
Sbjct  39   VPCLEFELKKGFVYREHNKSPGYYDGRYWTMWKLPMFGTTDASQVLKELDEVKKAYPRAF  98

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            VRIIGFDNVRQVQCISFIA+ P GY
Sbjct  99   VRIIGFDNVRQVQCISFIAHTPAGY  123



>sp|Q96542.1|RBS_BETPN RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Betula pendula]
 emb|CAA69102.1| ribulose-bisphosphate carboxylase [Betula pendula]
Length=182

 Score =   155 bits (392),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            +PCLEFE EHGFVYRE+N+SPGYYDGRYWTMWKLPMFGC D++QVL E++E KKAYP A+
Sbjct  98   IPCLEFELEHGFVYREHNRSPGYYDGRYWTMWKLPMFGCNDSSQVLKELEECKKAYPSAF  157

Query  182  VRIIGFDNVRQVQCISFIAYKPEG  253
            +RIIGFDN RQVQ ISFIAYKP G
Sbjct  158  IRIIGFDNKRQVQIISFIAYKPPG  181



>gb|AIF75363.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score =   154 bits (389),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 69/72 (96%), Positives = 72/72 (100%), Gaps = 0/72 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEV+EAKKAYP+AW
Sbjct  81   VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPRAW  140

Query  182  VRIIGFDNVRQV  217
            +RIIGFDNVRQV
Sbjct  141  IRIIGFDNVRQV  152



>ref|XP_006663954.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Oryza brachyantha]
Length=170

 Score =   154 bits (390),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 79/84 (94%), Gaps = 1/84 (1%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEF ++ GFVYREN++SPGYYDGRYWTMWKLPMFGC+DATQVL E++EAKKAYP A+
Sbjct  86   VPCLEF-SKVGFVYRENHRSPGYYDGRYWTMWKLPMFGCSDATQVLKELEEAKKAYPDAF  144

Query  182  VRIIGFDNVRQVQCISFIAYKPEG  253
            VRIIGFDNVRQVQCISFIAYKP G
Sbjct  145  VRIIGFDNVRQVQCISFIAYKPPG  168



>sp|P07689.1|RBS3_PEA RecName: Full=Ribulose bisphosphate carboxylase small chain 3A, 
chloroplastic; Short=RuBisCO small subunit 3A; Flags: Precursor 
[Pisum sativum]
 emb|CAA27864.1| ribulose bisphosphate carboxylase [Pisum sativum]
 prf||1211236A carboxylase,ribulose bisphosphate
Length=180

 Score =   155 bits (391),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFE E GFVYRE+NKSPGYYDGRYWTMWKLPMFG TDA+QVL E+ E   AYPQA+
Sbjct  96   VPCLEFELEKGFVYREHNKSPGYYDGRYWTMWKLPMFGTTDASQVLKELDEVVAAYPQAF  155

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            VRIIGFDNVRQVQCISFIA+ PE Y
Sbjct  156  VRIIGFDNVRQVQCISFIAHTPESY  180



>ref|WP_039311749.1| hypothetical protein [Paenibacillus sp. IHB B 3415]
 gb|KHL91125.1| hypothetical protein QW71_36450 [Paenibacillus sp. IHB B 3415]
Length=123

 Score =   153 bits (386),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 68/85 (80%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            +PCLEFETEHGFVYRE++ SPGYYDGRYWTMWKLPMFGCTD++QVL E+ E  K YP+A+
Sbjct  39   IPCLEFETEHGFVYREHHNSPGYYDGRYWTMWKLPMFGCTDSSQVLKELDECTKEYPKAF  98

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            VRIIGFDN RQVQCISFIA+KP GY
Sbjct  99   VRIIGFDNKRQVQCISFIAHKPPGY  123



>sp|P00869.1|RBS2_PEA RecName: Full=Ribulose bisphosphate carboxylase small chain 3C, 
chloroplastic; Short=RuBisCO small subunit 3C; AltName: Full=PSS15; 
Flags: Precursor [Pisum sativum]
 emb|CAA27865.1| ribulose 1.5-bisphosphate carboxylase (RBC) [Pisum sativum]
 emb|CAA25390.1| ribulose bisphosphate carboxylase [Pisum sativum]
 prf||1211236B carboxylase,ribulose bisphosphate
Length=180

 Score =   154 bits (390),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFE E GFVYRE+NKSPGYYDGRYWTMWKLPMFG TDA+QVL E+ E   AYPQA+
Sbjct  96   VPCLEFELEKGFVYREHNKSPGYYDGRYWTMWKLPMFGTTDASQVLKELDEVVAAYPQAF  155

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            VRIIGFDNVRQVQCISFIA+ PE Y
Sbjct  156  VRIIGFDNVRQVQCISFIAHTPESY  180



>pdb|3AXK|S Chain S, Structure Of Rice Rubisco In Complex With Nadp(h)
 pdb|3AXK|T Chain T, Structure Of Rice Rubisco In Complex With Nadp(h)
Length=129

 Score =   153 bits (386),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 79/84 (94%), Gaps = 1/84 (1%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEF ++ GFVYREN++SPGYYDGRYWTMWKLPMFGCTDATQVL E++EAKKAYP A+
Sbjct  40   VPCLEF-SKVGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDATQVLKELEEAKKAYPDAF  98

Query  182  VRIIGFDNVRQVQCISFIAYKPEG  253
            VRIIGFDNVRQVQCISFIAYKP G
Sbjct  99   VRIIGFDNVRQVQCISFIAYKPPG  122



>gb|AFO67218.1| putative ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit [Aralia elata]
Length=183

 Score =   154 bits (390),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFE EHG+VYREN++SPGYYDGRYWTMWKLPMFGCTD++QVL EV+E KK YP A+
Sbjct  97   VPCLEFELEHGWVYRENHRSPGYYDGRYWTMWKLPMFGCTDSSQVLNEVEECKKEYPNAF  156

Query  182  VRIIGFDNVRQVQCISFIAYKP  247
            +RIIGFDNVRQVQCISFIA+KP
Sbjct  157  IRIIGFDNVRQVQCISFIAFKP  178



>ref|XP_006663955.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Oryza brachyantha]
Length=170

 Score =   154 bits (388),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 79/84 (94%), Gaps = 1/84 (1%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEF ++ GFVYREN++SPGYYDGRYWTMWKLPMFGC+DATQVL E++EAKKAYP A+
Sbjct  86   VPCLEF-SKVGFVYRENHRSPGYYDGRYWTMWKLPMFGCSDATQVLKELEEAKKAYPDAF  144

Query  182  VRIIGFDNVRQVQCISFIAYKPEG  253
            VRIIGFDNVRQVQCISFIAYKP G
Sbjct  145  VRIIGFDNVRQVQCISFIAYKPPG  168



>ref|XP_006663961.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Oryza brachyantha]
Length=182

 Score =   154 bits (389),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 79/84 (94%), Gaps = 1/84 (1%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEF ++ GFVYREN++SPGYYDGRYWTMWKLPMFGC+DATQVL E++EAKKAYP A+
Sbjct  86   VPCLEF-SKVGFVYRENHRSPGYYDGRYWTMWKLPMFGCSDATQVLKELEEAKKAYPDAF  144

Query  182  VRIIGFDNVRQVQCISFIAYKPEG  253
            VRIIGFDNVRQVQCISFIAYKP G
Sbjct  145  VRIIGFDNVRQVQCISFIAYKPPG  168



>sp|Q43832.1|RBS2_SPIOL RecName: Full=Ribulose bisphosphate carboxylase small chain 2, 
chloroplastic; Short=RuBisCO small subunit 2; Flags: Precursor 
[Spinacia oleracea]
 emb|CAA66201.1| ribulose-bisphosphate carboxylase [Spinacia oleracea]
Length=180

 Score =   154 bits (389),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFET+HGFVYRE++ SPGYYDGRYWTMWKLPMFGCTD  QVL E++E KK YP A+
Sbjct  96   VPCLEFETDHGFVYREHHNSPGYYDGRYWTMWKLPMFGCTDPAQVLNELEECKKEYPNAF  155

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFD+ RQVQC+SFIAYKP GY
Sbjct  156  IRIIGFDSNRQVQCVSFIAYKPAGY  180



>ref|XP_006664952.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Oryza brachyantha]
Length=170

 Score =   154 bits (388),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 79/84 (94%), Gaps = 1/84 (1%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEF ++ GFVYREN++SPGYYDGRYWTMWKLPMFGC+DATQVL E++EAKKAYP A+
Sbjct  86   VPCLEF-SKVGFVYRENHRSPGYYDGRYWTMWKLPMFGCSDATQVLKELEEAKKAYPDAF  144

Query  182  VRIIGFDNVRQVQCISFIAYKPEG  253
            VRIIGFDNVRQVQCISFIAYKP G
Sbjct  145  VRIIGFDNVRQVQCISFIAYKPPG  168



>gb|AAB81105.1| ribulose 1,5-bisphosphate carboxylase small subunit [Spinacia 
oleracea]
Length=180

 Score =   154 bits (389),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFET+HGFVYRE++ SPGYYDGRYWTMWKLPMFGCTD  QVL E++E KK YP A+
Sbjct  96   VPCLEFETDHGFVYREHHNSPGYYDGRYWTMWKLPMFGCTDPAQVLNELEECKKEYPNAF  155

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFD+ RQVQC+SFIAYKP GY
Sbjct  156  IRIIGFDSNRQVQCVSFIAYKPAGY  180



>ref|XP_007033270.1| Ribulose bisphosphate carboxylase (small chain) family protein 
isoform 2 [Theobroma cacao]
 gb|EOY04196.1| Ribulose bisphosphate carboxylase (small chain) family protein 
isoform 2 [Theobroma cacao]
Length=184

 Score =   154 bits (388),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 69/85 (81%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFE EHGFVYREN + PGYYDGR W MWKLPMFGCTDA+QVL E+ EAKK YP A+
Sbjct  98   VPCLEFELEHGFVYRENLRIPGYYDGRCWIMWKLPMFGCTDASQVLKELDEAKKTYPTAF  157

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDN RQVQCISFIAYKP GY
Sbjct  158  IRIIGFDNRRQVQCISFIAYKPPGY  182



>ref|XP_010036887.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW48548.1| hypothetical protein EUGRSUZ_K02223 [Eucalyptus grandis]
Length=181

 Score =   154 bits (388),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 69/85 (81%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFE E GFVYR+N+KSPGYYDGRYWTMWKLPMFGCTD  QVL E+ EA K YP A+
Sbjct  97   VPCLEFELEKGFVYRDNHKSPGYYDGRYWTMWKLPMFGCTDPLQVLKELDEAIKTYPNAF  156

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            VRIIGFDN RQVQCISFIAYKP G+
Sbjct  157  VRIIGFDNKRQVQCISFIAYKPPGF  181



>gb|AAA33685.2| ribulose 1,5 bisphosphate carboxylase, partial [Pisum sativum]
Length=139

 Score =   152 bits (384),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFE E GFVYRE+NKSPGYYDGRYWTMWKLPMFG TDA+QVL E+ E   AYPQA+
Sbjct  55   VPCLEFELEKGFVYREHNKSPGYYDGRYWTMWKLPMFGTTDASQVLKELDEVVAAYPQAF  114

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            VRIIGFDNVRQVQCISFIA+ PE Y
Sbjct  115  VRIIGFDNVRQVQCISFIAHTPESY  139



>pdb|1IR1|S Chain S, Crystal Structure Of Spinach Ribulose-1,5-Bisphosphate 
CarboxylaseOXYGENASE (RUBISCO) COMPLEXED WITH CO2, MG2+ AND 
2- Carboxyarabinitol-1,5-Bisphosphate
 pdb|1IR1|T Chain T, Crystal Structure Of Spinach Ribulose-1,5-Bisphosphate 
CarboxylaseOXYGENASE (RUBISCO) COMPLEXED WITH CO2, MG2+ AND 
2- Carboxyarabinitol-1,5-Bisphosphate
 pdb|1IR1|U Chain U, Crystal Structure Of Spinach Ribulose-1,5-Bisphosphate 
CarboxylaseOXYGENASE (RUBISCO) COMPLEXED WITH CO2, MG2+ AND 
2- Carboxyarabinitol-1,5-Bisphosphate
 pdb|1IR1|V Chain V, Crystal Structure Of Spinach Ribulose-1,5-Bisphosphate 
CarboxylaseOXYGENASE (RUBISCO) COMPLEXED WITH CO2, MG2+ AND 
2- Carboxyarabinitol-1,5-Bisphosphate
Length=123

 Score =   151 bits (382),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFET+HGFVYRE++ SPGYYDGRYWTMWKLPMFGCTD  QVL E++E KK YP A+
Sbjct  39   VPCLEFETDHGFVYREHHNSPGYYDGRYWTMWKLPMFGCTDPAQVLNELEECKKEYPNAF  98

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFD+ RQVQC+SFIAYKP GY
Sbjct  99   IRIIGFDSNRQVQCVSFIAYKPAGY  123



>dbj|BAK23964.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[synthetic construct]
Length=170

 Score =   152 bits (385),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 78/84 (93%), Gaps = 1/84 (1%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEF ++ GFVYREN++SPGYYDGRYWTMWKLPMFGCTDATQVL E++EAKKAYP A+
Sbjct  86   VPCLEF-SKVGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDATQVLKELEEAKKAYPDAF  144

Query  182  VRIIGFDNVRQVQCISFIAYKPEG  253
            VRIIGFDNVRQVQ ISFIAYKP G
Sbjct  145  VRIIGFDNVRQVQLISFIAYKPAG  168



>ref|XP_010528479.1| PREDICTED: LOW QUALITY PROTEIN: ribulose bisphosphate carboxylase 
small chain, chloroplastic-like [Tarenaya hassleriana]
Length=208

 Score =   154 bits (388),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 65/84 (77%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = +2

Query  5    PCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAWV  184
            PCLEF+  +GFVYREN++SPGYYDGRYWTMWKLPMFGCTDA QV+ E++EAK+ +P A++
Sbjct  125  PCLEFQLGNGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDAVQVIKELEEAKREHPDAFI  184

Query  185  RIIGFDNVRQVQCISFIAYKPEGY  256
            RIIGFDNVRQVQCISFIAYKP+G+
Sbjct  185  RIIGFDNVRQVQCISFIAYKPKGF  208



>gb|AAL82195.1|AF396697_1 s/s2 [Nicotiana benthamiana]
Length=113

 Score =   150 bits (380),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = +2

Query  14   EFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAWVRII  193
            EF  + GFVYRE++ SPGYYDGRYWTMWKLPMFGCTDATQVLAEV+EAKKAYPQAWVRII
Sbjct  2    EFVPKRGFVYREHHSSPGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAWVRII  61

Query  194  GFDNVRQVQCISFIAYKPEGY*VS  265
            GFDNVRQVQCISFIA KPE   +S
Sbjct  62   GFDNVRQVQCISFIASKPEATKIS  85



>ref|WP_028130706.1| hypothetical protein [Serratia marcescens]
Length=123

 Score =   151 bits (381),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFE E G+VYRE+++SPGYYDGRYWTMWKLPMFGCT+A+QVL E++EAKKAYP ++
Sbjct  39   VPCLEFELEKGWVYREHHRSPGYYDGRYWTMWKLPMFGCTEASQVLIELEEAKKAYPNSF  98

Query  182  VRIIGFDNVRQVQCISFIAYKPEG  253
            +RIIGFDNVRQVQCISFIA KP+G
Sbjct  99   IRIIGFDNVRQVQCISFIASKPKG  122



>ref|XP_010693099.1| PREDICTED: ribulose bisphosphate carboxylase small chain-like 
[Beta vulgaris subsp. vulgaris]
Length=181

 Score =   153 bits (386),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 68/85 (80%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            +PCLEFE + GFVYRE+NKSPGYYDGRYWTMWKLPMFGCTD  QV+ EV+E KKAYP A+
Sbjct  97   IPCLEFEIKDGFVYREHNKSPGYYDGRYWTMWKLPMFGCTDPAQVVNEVEEVKKAYPDAF  156

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            VRIIGFDN RQVQCISFIAYKP  +
Sbjct  157  VRIIGFDNKRQVQCISFIAYKPPSF  181



>sp|Q9XGX4.1|RBS3_AMAHP RecName: Full=Ribulose bisphosphate carboxylase small chain 3, 
chloroplastic; Short=RuBisCO small subunit 3; Flags: Precursor 
[Amaranthus hypochondriacus]
 gb|AAD37440.1|AF150667_1 ribulose 1,5 bisphosphate carboxylase small subunit precursor 
[Amaranthus hypochondriacus]
Length=180

 Score =   153 bits (386),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            +PC+EFE EH FVYREN++SPGY DGRYWTMWKLPM+GCTD  QVL EV+EAKKAYP A+
Sbjct  96   IPCIEFELEHPFVYRENHRSPGYQDGRYWTMWKLPMYGCTDPAQVLNEVEEAKKAYPSAF  155

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDN RQVQC+SFIA+KP GY
Sbjct  156  IRIIGFDNKRQVQCVSFIAFKPPGY  180



>gb|AHC28978.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Phragmites australis]
 gb|AHC28979.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Phragmites australis]
Length=171

 Score =   152 bits (385),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 78/84 (93%), Gaps = 1/84 (1%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            +PCLEF ++ GFVYREN +SPGYYDGRYWTMWKLPMFGCTDATQVL E++EAKKAYP A+
Sbjct  82   IPCLEF-SKVGFVYRENGRSPGYYDGRYWTMWKLPMFGCTDATQVLKELEEAKKAYPDAF  140

Query  182  VRIIGFDNVRQVQCISFIAYKPEG  253
            VRIIGFDNVRQVQCISFIAYKP G
Sbjct  141  VRIIGFDNVRQVQCISFIAYKPPG  164



>gb|EAY97115.1| hypothetical protein OsI_19041 [Oryza sativa Indica Group]
Length=175

 Score =   152 bits (385),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 78/84 (93%), Gaps = 1/84 (1%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEF ++ GFVYREN+KSPGYYDGRYWTMWKLPMFGCTDATQVL E++EAKKAYP A+
Sbjct  86   VPCLEF-SKVGFVYRENHKSPGYYDGRYWTMWKLPMFGCTDATQVLKELEEAKKAYPDAF  144

Query  182  VRIIGFDNVRQVQCISFIAYKPEG  253
            VRIIGFDNVRQVQ ISFIAYKP G
Sbjct  145  VRIIGFDNVRQVQLISFIAYKPPG  168



>gb|AIF75365.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score =   152 bits (383),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 69/72 (96%), Positives = 71/72 (99%), Gaps = 0/72 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFETEHGFVYRENNKSPGYYDGRYWTM KLPMFGCTDATQVLAEV+EAKKAYPQAW
Sbjct  81   VPCLEFETEHGFVYRENNKSPGYYDGRYWTMRKLPMFGCTDATQVLAEVEEAKKAYPQAW  140

Query  182  VRIIGFDNVRQV  217
            +RIIGFDNVRQV
Sbjct  141  IRIIGFDNVRQV  152



>gb|ABK15574.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Camellia sinensis]
Length=176

 Score =   152 bits (385),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            +PCLEF  + GFVYRE+NKSPGYYDGRYWTMWKLPMFGCTD++QVL EV+E KK YPQ++
Sbjct  92   IPCLEFSVQGGFVYREHNKSPGYYDGRYWTMWKLPMFGCTDSSQVLKEVEECKKEYPQSF  151

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDN RQVQCISFI YKP G+
Sbjct  152  IRIIGFDNKRQVQCISFICYKPPGF  176



>gb|AAA84592.1| ribulose 1,5-bisphosphate carboxylase [Oryza sativa]
Length=169

 Score =   152 bits (384),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 78/84 (93%), Gaps = 1/84 (1%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEF ++ GFVYREN+KSPGYYDGRYWTMWKLPMFGCTDATQVL E++EAKKAYP A+
Sbjct  80   VPCLEF-SKVGFVYRENHKSPGYYDGRYWTMWKLPMFGCTDATQVLKELEEAKKAYPDAF  138

Query  182  VRIIGFDNVRQVQCISFIAYKPEG  253
            VRIIGFDNVRQVQ ISFIAYKP G
Sbjct  139  VRIIGFDNVRQVQLISFIAYKPPG  162



>gb|AAA33716.1| ribulose 1,5-bisphosphate carboxylase, partial [Petunia x hybrida]
Length=106

 Score =   150 bits (379),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 67/79 (85%), Positives = 73/79 (92%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFE +H F+YRE + SPGYYDGRYWTMWKLPMFGCTDATQVL E+QEAKKAYP AW
Sbjct  28   VPCLEFELKHKFIYREYHASPGYYDGRYWTMWKLPMFGCTDATQVLGELQEAKKAYPNAW  87

Query  182  VRIIGFDNVRQVQCISFIA  238
            +RIIGF+NVRQVQCISFIA
Sbjct  88   IRIIGFENVRQVQCISFIA  106



>pdb|1AUS|S Chain S, Activated Unliganded Spinach Rubisco
 pdb|8RUC|I Chain I, Activated Spinach Rubisco Complexed With 2-carboxyarabinitol 
Bisphosphate
 pdb|8RUC|J Chain J, Activated Spinach Rubisco Complexed With 2-carboxyarabinitol 
Bisphosphate
 pdb|8RUC|K Chain K, Activated Spinach Rubisco Complexed With 2-carboxyarabinitol 
Bisphosphate
 pdb|8RUC|L Chain L, Activated Spinach Rubisco Complexed With 2-carboxyarabinitol 
Bisphosphate
 pdb|1RBO|S Chain S, Spinach Rubisco In Complex With The Inhibitor 2-carboxyarabinitol-1,5- 
Diphosphate
 pdb|1RBO|C Chain C, Spinach Rubisco In Complex With The Inhibitor 2-carboxyarabinitol-1,5- 
Diphosphate
 pdb|1RBO|F Chain F, Spinach Rubisco In Complex With The Inhibitor 2-carboxyarabinitol-1,5- 
Diphosphate
 pdb|1RBO|I Chain I, Spinach Rubisco In Complex With The Inhibitor 2-carboxyarabinitol-1,5- 
Diphosphate
 pdb|1RCO|S Chain S, Spinach Rubisco In Complex With The Inhibitor D-Xylulose-2, 
2-Diol-1,5-Bisphosphate
 pdb|1RCO|C Chain C, Spinach Rubisco In Complex With The Inhibitor D-Xylulose-2, 
2-Diol-1,5-Bisphosphate
 pdb|1RCO|F Chain F, Spinach Rubisco In Complex With The Inhibitor D-Xylulose-2, 
2-Diol-1,5-Bisphosphate
 pdb|1RCO|I Chain I, Spinach Rubisco In Complex With The Inhibitor D-Xylulose-2, 
2-Diol-1,5-Bisphosphate
 pdb|1RCO|M Chain M, Spinach Rubisco In Complex With The Inhibitor D-Xylulose-2, 
2-Diol-1,5-Bisphosphate
 pdb|1RCO|P Chain P, Spinach Rubisco In Complex With The Inhibitor D-Xylulose-2, 
2-Diol-1,5-Bisphosphate
 pdb|1AA1|S Chain S, Activated Spinach Rubisco In Complex With The Product 
3- Phosphoglycerate
 pdb|1AA1|C Chain C, Activated Spinach Rubisco In Complex With The Product 
3- Phosphoglycerate
 pdb|1AA1|F Chain F, Activated Spinach Rubisco In Complex With The Product 
3- Phosphoglycerate
 pdb|1AA1|I Chain I, Activated Spinach Rubisco In Complex With The Product 
3- Phosphoglycerate
 pdb|1RCX|S Chain S, Non-activated Spinach Rubisco In Complex With Its Substrate 
Ribulose-1,5-bisphosphate
 pdb|1RCX|C Chain C, Non-activated Spinach Rubisco In Complex With Its Substrate 
Ribulose-1,5-bisphosphate
 pdb|1RCX|F Chain F, Non-activated Spinach Rubisco In Complex With Its Substrate 
Ribulose-1,5-bisphosphate
 pdb|1RCX|I Chain I, Non-activated Spinach Rubisco In Complex With Its Substrate 
Ribulose-1,5-bisphosphate
 pdb|1RCX|M Chain M, Non-activated Spinach Rubisco In Complex With Its Substrate 
Ribulose-1,5-bisphosphate
 pdb|1RCX|P Chain P, Non-activated Spinach Rubisco In Complex With Its Substrate 
Ribulose-1,5-bisphosphate
 pdb|1RCX|T Chain T, Non-activated Spinach Rubisco In Complex With Its Substrate 
Ribulose-1,5-bisphosphate
 pdb|1RCX|W Chain W, Non-activated Spinach Rubisco In Complex With Its Substrate 
Ribulose-1,5-bisphosphate
 pdb|1RXO|S Chain S, Activated Spinach Rubisco In Complex With Its Substrate 
Ribulose-1,5- Bisphosphate And Calcium
 pdb|1RXO|C Chain C, Activated Spinach Rubisco In Complex With Its Substrate 
Ribulose-1,5- Bisphosphate And Calcium
 pdb|1RXO|F Chain F, Activated Spinach Rubisco In Complex With Its Substrate 
Ribulose-1,5- Bisphosphate And Calcium
 pdb|1RXO|I Chain I, Activated Spinach Rubisco In Complex With Its Substrate 
Ribulose-1,5- Bisphosphate And Calcium
 pdb|1RCO|T Chain T, Spinach Rubisco In Complex With The Inhibitor D-Xylulose-2, 
2-Diol-1,5-Bisphosphate
 pdb|1RCO|W Chain W, Spinach Rubisco In Complex With The Inhibitor D-Xylulose-2, 
2-Diol-1,5-Bisphosphate
 pdb|1UPM|C Chain C, Activated Spinach Rubisco Complexed With 2-carboxyarabinitol 
2 Bisphosphat And Ca2+.
 pdb|1UPM|F Chain F, Activated Spinach Rubisco Complexed With 2-carboxyarabinitol 
2 Bisphosphat And Ca2+.
 pdb|1UPM|I Chain I, Activated Spinach Rubisco Complexed With 2-carboxyarabinitol 
2 Bisphosphat And Ca2+.
 pdb|1UPM|M Chain M, Activated Spinach Rubisco Complexed With 2-carboxyarabinitol 
2 Bisphosphat And Ca2+.
 pdb|1UPM|P Chain P, Activated Spinach Rubisco Complexed With 2-carboxyarabinitol 
2 Bisphosphat And Ca2+.
 pdb|1UPM|S Chain S, Activated Spinach Rubisco Complexed With 2-carboxyarabinitol 
2 Bisphosphat And Ca2+.
 pdb|1UPM|T Chain T, Activated Spinach Rubisco Complexed With 2-carboxyarabinitol 
2 Bisphosphat And Ca2+.
 pdb|1UPM|W Chain W, Activated Spinach Rubisco Complexed With 2-carboxyarabinitol 
2 Bisphosphat And Ca2+.
 pdb|1UPP|I Chain I, Spinach Rubisco In Complex With 2-Carboxyarabinitol 
2 Bisphosphate And Calcium.
 pdb|1UPP|J Chain J, Spinach Rubisco In Complex With 2-Carboxyarabinitol 
2 Bisphosphate And Calcium.
 pdb|1UPP|K Chain K, Spinach Rubisco In Complex With 2-Carboxyarabinitol 
2 Bisphosphate And Calcium.
 pdb|1UPP|L Chain L, Spinach Rubisco In Complex With 2-Carboxyarabinitol 
2 Bisphosphate And Calcium.
 pdb|1AUS|T Chain T, Activated Unliganded Spinach Rubisco
 pdb|1AUS|U Chain U, Activated Unliganded Spinach Rubisco
 pdb|1AUS|V Chain V, Activated Unliganded Spinach Rubisco
Length=123

 Score =   150 bits (380),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFET+HGFVYRE++ SPGYYDGRYWTMWKLPMFGCTD  QVL E++E KK YP A+
Sbjct  39   VPCLEFETDHGFVYREHHNSPGYYDGRYWTMWKLPMFGCTDPAQVLNELEECKKEYPNAF  98

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFD+ R+VQCISFIAYKP GY
Sbjct  99   IRIIGFDSNREVQCISFIAYKPAGY  123



>ref|XP_010693054.1| PREDICTED: ribulose bisphosphate carboxylase small chain-like 
[Beta vulgaris subsp. vulgaris]
Length=179

 Score =   152 bits (385),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 68/85 (80%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            +PCLEFE + GFVYRE+N SPGYYDGRYWTMWKLPMFGCTD  QV+ EV+E KKAYP A+
Sbjct  95   IPCLEFEVKDGFVYREHNNSPGYYDGRYWTMWKLPMFGCTDPAQVVNEVEEVKKAYPDAF  154

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            VRIIGFDN RQVQCISFIAYKP+ Y
Sbjct  155  VRIIGFDNKRQVQCISFIAYKPKDY  179



>ref|XP_011021244.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Populus euphratica]
Length=181

 Score =   152 bits (385),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFE E G+VYRE+++SPGYYDGRYWTMWKLPMFGCT A+QVL E++EAKKAYP ++
Sbjct  97   VPCLEFELEKGWVYREHHRSPGYYDGRYWTMWKLPMFGCTQASQVLIELEEAKKAYPNSF  156

Query  182  VRIIGFDNVRQVQCISFIAYKPEG  253
            +RIIGFDNVRQVQCISFIA KP+G
Sbjct  157  IRIIGFDNVRQVQCISFIASKPKG  180



>ref|NP_001066606.1| Os12g0291400 [Oryza sativa Japonica Group]
 gb|ABA97173.1| Ribulose bisphosphate carboxylase small chain A, chloroplast 
precursor, putative, expressed [Oryza sativa Japonica Group]
 gb|ABG21973.1| Ribulose bisphosphate carboxylase small chain A, chloroplast 
precursor, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF29625.1| Os12g0291400 [Oryza sativa Japonica Group]
 gb|EAZ20214.1| hypothetical protein OsJ_35814 [Oryza sativa Japonica Group]
 dbj|BAG94202.1| unnamed protein product [Oryza sativa Japonica Group]
Length=175

 Score =   152 bits (384),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 78/84 (93%), Gaps = 1/84 (1%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEF ++ GFVYREN++SPGYYDGRYWTMWKLPMFGCTDATQVL E++EAKKAYP A+
Sbjct  86   VPCLEF-SKVGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDATQVLKELEEAKKAYPDAF  144

Query  182  VRIIGFDNVRQVQCISFIAYKPEG  253
            VRIIGFDNVRQVQ ISFIAYKP G
Sbjct  145  VRIIGFDNVRQVQLISFIAYKPPG  168



>emb|CAD21856.1| putative ribulose 1,5 biphosphate carboxylase small subunit percursor 
[Rumex obtusifolius]
Length=181

 Score =   152 bits (384),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEF+   G VYRE++ SPGYYDGRYWTMWKLPMFGCTDATQV+AE++EAKKAYP A+
Sbjct  93   VPCLEFDVGPGAVYREHHHSPGYYDGRYWTMWKLPMFGCTDATQVVAELEEAKKAYPHAF  152

Query  182  VRIIGFDNVRQVQCISFIAYKP  247
            VRIIGFDNVRQVQC+SFIAYKP
Sbjct  153  VRIIGFDNVRQVQCVSFIAYKP  174



>gb|ABR26086.1| ribulose bisphosphate carboxylase small chain c [Oryza sativa 
Indica Group]
Length=103

 Score =   149 bits (377),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 78/84 (93%), Gaps = 1/84 (1%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEF ++ GFVYREN++SPGYYDGRYWTMWKLPMFGCTDATQVL E++EAKKAYP A+
Sbjct  14   VPCLEF-SKVGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDATQVLKELEEAKKAYPDAF  72

Query  182  VRIIGFDNVRQVQCISFIAYKPEG  253
            VRIIGFDNVRQVQ ISFIAYKP G
Sbjct  73   VRIIGFDNVRQVQLISFIAYKPPG  96



>ref|XP_002888576.1| ribulose bisphosphate carboxylase small chain 1A [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH64835.1| ribulose bisphosphate carboxylase small chain 1A [Arabidopsis 
lyrata subsp. lyrata]
Length=180

 Score =   152 bits (383),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            +PC+EFE EHGFVYRE+  SPGYYDGRYWTMWKLP+FGCTD+ QVL EV+E KK YP+A+
Sbjct  94   IPCVEFELEHGFVYREHGNSPGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPEAF  153

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDN RQVQCISFIAYKP  +
Sbjct  154  IRIIGFDNSRQVQCISFIAYKPPSF  178



>ref|NP_176880.1| ribulose bisphosphate carboxylase small chain 1A [Arabidopsis 
thaliana]
 sp|P10795.2|RBS1A_ARATH RecName: Full=Ribulose bisphosphate carboxylase small chain 1A, 
chloroplastic; Short=RuBisCO small subunit 1A; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAG40363.1|AF325011_1 000C10C11 [Arabidopsis thaliana]
 gb|AAK95277.1|AF410291_1 F1O19.10/F1O19.10 [Arabidopsis thaliana]
 gb|AAD10655.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAK96772.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAL06849.1| At1g67090/F1O19.10 [Arabidopsis thaliana]
 gb|AAL24219.1| At1g67090/F1O19.10 [Arabidopsis thaliana]
 gb|AAL24422.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAL32690.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAL32789.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAL38277.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAM13379.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAM13387.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAM19882.1| At1g67090/F1O19.10 [Arabidopsis thaliana]
 gb|AAN15681.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAN72087.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 dbj|BAE98610.1| ribulose bisphosphate carboxylase like protein, small subunit 
[Arabidopsis thaliana]
 dbj|BAE98685.1| ribulose bisphosphate carboxylase like protein, small subunit 
[Arabidopsis thaliana]
 dbj|BAE98695.1| ribulose bisphosphate carboxylase like protein, small subunit 
[Arabidopsis thaliana]
 dbj|BAE98874.1| ribulose bisphosphate carboxylase like protein, small subunit 
[Arabidopsis thaliana]
 gb|AEE34594.1| ribulose bisphosphate carboxylase small chain 1A [Arabidopsis 
thaliana]
Length=180

 Score =   152 bits (383),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            +PC+EFE EHGFVYRE+  SPGYYDGRYWTMWKLP+FGCTD+ QVL EV+E KK YP A+
Sbjct  94   IPCVEFELEHGFVYREHGNSPGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPNAF  153

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDN RQVQCISFIAYKP  +
Sbjct  154  IRIIGFDNTRQVQCISFIAYKPPSF  178



>ref|XP_008446602.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Cucumis melo]
Length=185

 Score =   152 bits (384),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 63/82 (77%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            +PC+EF+   GFVYREN++SPGYYDGRYWTMWKLPMFGCTD++QV+ E++EAKK YP A+
Sbjct  97   IPCIEFDIHSGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDSSQVVNEIEEAKKEYPDAY  156

Query  182  VRIIGFDNVRQVQCISFIAYKP  247
            +R+IGFDNVRQVQCISFIAYKP
Sbjct  157  IRVIGFDNVRQVQCISFIAYKP  178



>ref|NP_001066604.1| Os12g0291100 [Oryza sativa Japonica Group]
 sp|P18566.2|RBS2_ORYSJ RecName: Full=Ribulose bisphosphate carboxylase small chain A, 
chloroplastic; Short=RuBisCO small subunit A; Flags: Precursor 
[Oryza sativa Japonica Group]
 gb|AAR19268.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Oryza sativa Japonica Group]
 gb|ABA97169.1| Ribulose bisphosphate carboxylase small chain A, chloroplast 
precursor, putative, expressed [Oryza sativa Japonica Group]
 gb|ABG21974.1| Ribulose bisphosphate carboxylase small chain A, chloroplast 
precursor, putative, expressed [Oryza sativa Japonica Group]
 gb|ABG21975.1| Ribulose bisphosphate carboxylase small chain A, chloroplast 
precursor, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF29623.1| Os12g0291100 [Oryza sativa Japonica Group]
 gb|ABR25686.1| ribulose bisphosphate carboxylase small chain c [Oryza sativa 
Indica Group]
 gb|EEC69124.1| hypothetical protein OsI_38042 [Oryza sativa Indica Group]
 gb|EEE53069.1| hypothetical protein OsJ_35811 [Oryza sativa Japonica Group]
 gb|AEP20544.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Oryza sativa Japonica Group]
Length=175

 Score =   152 bits (383),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 78/84 (93%), Gaps = 1/84 (1%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEF ++ GFVYREN++SPGYYDGRYWTMWKLPMFGCTDATQVL E++EAKKAYP A+
Sbjct  86   VPCLEF-SKVGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDATQVLKELEEAKKAYPDAF  144

Query  182  VRIIGFDNVRQVQCISFIAYKPEG  253
            VRIIGFDNVRQVQ ISFIAYKP G
Sbjct  145  VRIIGFDNVRQVQLISFIAYKPPG  168



>ref|NP_001066559.1| Os12g0274700 [Oryza sativa Japonica Group]
 sp|Q0INY7.1|RBS1_ORYSJ RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=Ribulose bisphosphate carboxylase small 
chain C; Short=RuBisCO small subunit; Short=RuBisCO small subunit 
C; Flags: Precursor [Oryza sativa Japonica Group]
 sp|A2Y205.2|RBS1_ORYSI RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=Ribulose bisphosphate carboxylase small 
chain C; Short=RuBisCO small subunit; Short=RuBisCO small subunit 
C; Flags: Precursor [Oryza sativa Indica Group]
 dbj|BAA00538.1| small subunit of ribulose-1,5-bisphosphate carboxylase [Oryza 
sativa Japonica Group]
 gb|AAB70544.1| ribulose 1,5-bisphosphate carboxylase small subunit [Oryza sativa 
Indica Group]
 gb|ABA97056.1| Ribulose bisphosphate carboxylase small chain C, chloroplast 
precursor, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF29578.1| Os12g0274700 [Oryza sativa Japonica Group]
 gb|ABR25908.1| chloroplast ribulose bisphosphate carboxylase small chain precursor 
[Oryza sativa Indica Group]
 dbj|BAG88038.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99587.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00491.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE62884.1| hypothetical protein OsJ_17688 [Oryza sativa Japonica Group]
 prf||1508256A ribulose bisphosphate carboxylase S
Length=175

 Score =   152 bits (383),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 78/84 (93%), Gaps = 1/84 (1%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEF ++ GFVYREN++SPGYYDGRYWTMWKLPMFGCTDATQVL E++EAKKAYP A+
Sbjct  86   VPCLEF-SKVGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDATQVLKELEEAKKAYPDAF  144

Query  182  VRIIGFDNVRQVQCISFIAYKPEG  253
            VRIIGFDNVRQVQ ISFIAYKP G
Sbjct  145  VRIIGFDNVRQVQLISFIAYKPPG  168



>emb|CAD11990.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Coffea arabica]
 emb|CAD11991.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Coffea arabica]
Length=181

 Score =   152 bits (383),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 69/85 (81%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFE E GFVYRE ++SPGYYDGRYWTMWKLPM+GCTDATQVL EV E  K YP  W
Sbjct  97   VPCLEFELEKGFVYREYHRSPGYYDGRYWTMWKLPMYGCTDATQVLNEVGECLKEYPNCW  156

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            VRIIGFDNVRQVQCISFIA KP+G+
Sbjct  157  VRIIGFDNVRQVQCISFIAAKPKGF  181



>ref|WP_039311073.1| hypothetical protein [Paenibacillus sp. IHB B 3415]
 gb|KHL91154.1| hypothetical protein QW71_36295 [Paenibacillus sp. IHB B 3415]
Length=123

 Score =   150 bits (378),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            +PCLEF  + GFVYRE+NKSPGYYDGRYWTMWKLPMFGCTD++QVL EV+E KK YPQ++
Sbjct  39   IPCLEFSVQGGFVYREHNKSPGYYDGRYWTMWKLPMFGCTDSSQVLKEVEECKKEYPQSF  98

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDN RQVQCISFI YKP G+
Sbjct  99   IRIIGFDNKRQVQCISFICYKPPGF  123



>dbj|BAA00539.1| small subunit of ribulose-1,5-bisphosphate carboxylase [Oryza 
sativa Japonica Group]
Length=175

 Score =   151 bits (382),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 70/84 (83%), Positives = 78/84 (93%), Gaps = 1/84 (1%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEF ++ GFVYREN++SPGYYDGRYWTMWKLPMFGCTDATQVL E++EAKKAYP A+
Sbjct  86   VPCLEF-SKVGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDATQVLKELEEAKKAYPDAF  144

Query  182  VRIIGFDNVRQVQCISFIAYKPEG  253
            +RIIGFDNVRQVQ ISFIAYKP G
Sbjct  145  IRIIGFDNVRQVQLISFIAYKPPG  168



>dbj|BAI53119.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Eucalyptus globulus]
Length=181

 Score =   152 bits (383),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 68/85 (80%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFE E GFVYR+N+KSPGYYDGRYWTMWKLPMFGCTD  QV  E+ EA K YP A+
Sbjct  97   VPCLEFELEKGFVYRDNHKSPGYYDGRYWTMWKLPMFGCTDPLQVFKELDEAIKTYPNAF  156

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            VRIIGFDN RQVQCISFIAYKP G+
Sbjct  157  VRIIGFDNKRQVQCISFIAYKPPGF  181



>gb|ABN41481.1| putative chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase 
small subunit [Cucumis sativus]
Length=93

 Score =   149 bits (375),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 77/83 (93%), Gaps = 0/83 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPC+EF+   GFVYREN++SPGYYDGRYWTMWKLPMFGCTD++QV+ E++EAKK YP A+
Sbjct  2    VPCVEFDIGSGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDSSQVIQEIEEAKKEYPDAF  61

Query  182  VRIIGFDNVRQVQCISFIAYKPE  250
            +R+IGFDNVRQVQCISFIAYKP+
Sbjct  62   IRVIGFDNVRQVQCISFIAYKPQ  84



>emb|CAA59218.1| ribulose-bisphosphate carboxylase [synthetic construct]
 gb|ABA97170.1| Ribulose bisphosphate carboxylase small chain A, chloroplast 
precursor, putative, expressed [Oryza sativa Japonica Group]
Length=128

 Score =   150 bits (378),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 78/84 (93%), Gaps = 1/84 (1%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEF ++ GFVYREN++SPGYYDGRYWTMWKLPMFGCTDATQVL E++EAKKAYP A+
Sbjct  39   VPCLEF-SKVGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDATQVLKELEEAKKAYPDAF  97

Query  182  VRIIGFDNVRQVQCISFIAYKPEG  253
            VRIIGFDNVRQVQ ISFIAYKP G
Sbjct  98   VRIIGFDNVRQVQLISFIAYKPPG  121



>gb|ABK96567.1| unknown [Populus trichocarpa x Populus deltoides]
Length=181

 Score =   152 bits (383),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFE E G+VYRE+++SPGYYDGRYWTMWKLPMFGCT+A+QVL E++EAKKAYP ++
Sbjct  97   VPCLEFELEKGWVYREHHQSPGYYDGRYWTMWKLPMFGCTEASQVLIELEEAKKAYPNSF  156

Query  182  VRIIGFDNVRQVQCISFIAYKPEG  253
            VRIIGFDN RQVQCISFIA KP+G
Sbjct  157  VRIIGFDNTRQVQCISFIASKPKG  180



>pdb|3AXM|S Chain S, Structure Of Rice Rubisco In Complex With 6pg
 pdb|3AXM|T Chain T, Structure Of Rice Rubisco In Complex With 6pg
 pdb|3AXM|U Chain U, Structure Of Rice Rubisco In Complex With 6pg
 pdb|3AXM|V Chain V, Structure Of Rice Rubisco In Complex With 6pg
 pdb|3AXM|W Chain W, Structure Of Rice Rubisco In Complex With 6pg
 pdb|3AXM|X Chain X, Structure Of Rice Rubisco In Complex With 6pg
 pdb|3AXM|Y Chain Y, Structure Of Rice Rubisco In Complex With 6pg
 pdb|3AXM|Z Chain Z, Structure Of Rice Rubisco In Complex With 6pg
Length=129

 Score =   150 bits (378),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 78/84 (93%), Gaps = 1/84 (1%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEF ++ GFVYREN++SPGYYDGRYWTMWKLPMFGCTDATQVL E++EAKKAYP A+
Sbjct  40   VPCLEF-SKVGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDATQVLKELEEAKKAYPDAF  98

Query  182  VRIIGFDNVRQVQCISFIAYKPEG  253
            VRIIGFDNVRQVQ ISFIAYKP G
Sbjct  99   VRIIGFDNVRQVQLISFIAYKPPG  122



>emb|CBY05833.1| Ribulose 1,5-bisphosphate carboxylase small subunit precursor 
[Coffea canephora]
 emb|CBY89197.1| ribulose 1,5-bisphosphate carboxylase small subunit precursor 
[Coffea canephora]
Length=181

 Score =   152 bits (383),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 68/85 (80%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            +PCLEFE E G VYRE ++SPGYYDGRYWTMWKLPMFGCTDATQVL EV+E  K YP  W
Sbjct  97   IPCLEFELEKGHVYREYHRSPGYYDGRYWTMWKLPMFGCTDATQVLKEVRECLKEYPNCW  156

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            VRIIGFDNVRQVQCISFIA KP+G+
Sbjct  157  VRIIGFDNVRQVQCISFIAAKPKGF  181



>ref|XP_007036525.1| Ribulose bisphosphate carboxylase (small chain) family protein 
[Theobroma cacao]
 gb|EOY21026.1| Ribulose bisphosphate carboxylase (small chain) family protein 
[Theobroma cacao]
Length=177

 Score =   151 bits (382),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            +PCLEFE EHGFVYREN++S GYYDGRYWTMW+LPMFGCTDA+QVL E+ EA KAY +A+
Sbjct  93   IPCLEFELEHGFVYRENHRSTGYYDGRYWTMWELPMFGCTDASQVLKELDEAIKAYSKAF  152

Query  182  VRIIGFDNVRQVQCISFIAYKP  247
            +RIIGFDN RQVQCISFI YKP
Sbjct  153  IRIIGFDNKRQVQCISFITYKP  174



>sp|Q42516.1|RBS1_AMAHP RecName: Full=Ribulose bisphosphate carboxylase small chain 1, 
chloroplastic; Short=RuBisCO small subunit 1; Flags: Precursor 
[Amaranthus hypochondriacus]
 gb|AAD37438.1|AF150665_1 ribulose 1,5 bisphosphate carboxylase small subunit precursor 
[Amaranthus hypochondriacus]
 emb|CAA60636.1| ribulose 1,5-bisphosphate carboxylase-oxygenase [Amaranthus hypochondriacus]
Length=183

 Score =   151 bits (382),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            +PC+EFE EH FVYREN++SPGY DGRYWTMWKLPM+GCTD  QVL EV+EAKKAYP A+
Sbjct  98   IPCIEFELEHPFVYRENHRSPGYQDGRYWTMWKLPMYGCTDPAQVLNEVEEAKKAYPSAF  157

Query  182  VRIIGFDNVRQVQCISFIAYKPEG  253
            +RIIGFDN RQVQC+SFIAYKP G
Sbjct  158  IRIIGFDNKRQVQCVSFIAYKPAG  181



>pdb|1WDD|S Chain S, Crystal Structure Of Activated Rice Rubisco Complexed 
With 2- Carboxyarabinitol-1,5-bisphosphate
 pdb|1WDD|W Chain W, Crystal Structure Of Activated Rice Rubisco Complexed 
With 2- Carboxyarabinitol-1,5-bisphosphate
Length=128

 Score =   150 bits (378),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 78/84 (93%), Gaps = 1/84 (1%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEF ++ GFVYREN++SPGYYDGRYWTMWKLPMFGCTDATQVL E++EAKKAYP A+
Sbjct  39   VPCLEF-SKVGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDATQVLKELEEAKKAYPDAF  97

Query  182  VRIIGFDNVRQVQCISFIAYKPEG  253
            VRIIGFDNVRQVQ ISFIAYKP G
Sbjct  98   VRIIGFDNVRQVQLISFIAYKPPG  121



>gb|ABR25969.1| ribulose bisphosphate carboxylase small chain c [Oryza sativa 
Indica Group]
Length=157

 Score =   150 bits (380),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 78/84 (93%), Gaps = 1/84 (1%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEF ++ GFVYREN++SPGYYDGRYWTMWKLPMFGCTDATQVL E++EAKKAYP A+
Sbjct  68   VPCLEF-SKVGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDATQVLKELEEAKKAYPDAF  126

Query  182  VRIIGFDNVRQVQCISFIAYKPEG  253
            VRIIGFDNVRQVQ ISFIAYKP G
Sbjct  127  VRIIGFDNVRQVQLISFIAYKPPG  150



>sp|P00872.2|RBS1_LEMGI RecName: Full=Ribulose bisphosphate carboxylase small chain SSU1, 
chloroplastic; Short=RuBisCO small subunit SSU1; Flags: 
Precursor [Lemna gibba]
 emb|CAA35104.1| unnamed protein product [Lemna gibba]
Length=173

 Score =   151 bits (381),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 76/82 (93%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPC+EF  E GFVYRENN SPGYYDGRYWTMWKLPMFGCTDA+QV+AEV+EAKKAYP+ +
Sbjct  92   VPCIEFSKE-GFVYRENNASPGYYDGRYWTMWKLPMFGCTDASQVIAEVEEAKKAYPEYF  150

Query  182  VRIIGFDNVRQVQCISFIAYKP  247
            VRIIGFDN RQVQCISFIAYKP
Sbjct  151  VRIIGFDNKRQVQCISFIAYKP  172



>ref|NP_001066607.1| Os12g0292400 [Oryza sativa Japonica Group]
 gb|ABA97179.1| Ribulose bisphosphate carboxylase small chain C, chloroplast 
precursor, putative, expressed [Oryza sativa Japonica Group]
 gb|ABA97180.1| Ribulose bisphosphate carboxylase small chain C, chloroplast 
precursor, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF29626.1| Os12g0292400 [Oryza sativa Japonica Group]
 gb|EAZ20216.1| hypothetical protein OsJ_35820 [Oryza sativa Japonica Group]
 gb|ABR25478.1| ribulose bisphosphate carboxylase small chain c [Oryza sativa 
Indica Group]
 dbj|BAG90832.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG91855.1| unnamed protein product [Oryza sativa Japonica Group]
Length=175

 Score =   151 bits (381),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 78/84 (93%), Gaps = 1/84 (1%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEF ++ GFVYREN++SPGYYDGRYWTMWKLPMFGCTDATQVL E++EAKKAYP A+
Sbjct  86   VPCLEF-SKVGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDATQVLKELEEAKKAYPDAF  144

Query  182  VRIIGFDNVRQVQCISFIAYKPEG  253
            VRIIGFDNVRQVQ ISFIAYKP G
Sbjct  145  VRIIGFDNVRQVQLISFIAYKPPG  168



>emb|CAA24969.1| unnamed protein product [Lemna gibba]
Length=120

 Score =   149 bits (377),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 76/82 (93%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPC+EF  E GFVYRENN SPGYYDGRYWTMWKLPMFGCTDA+QV+AEV+EAKKAYP+ +
Sbjct  39   VPCIEFSKE-GFVYRENNASPGYYDGRYWTMWKLPMFGCTDASQVIAEVEEAKKAYPEYF  97

Query  182  VRIIGFDNVRQVQCISFIAYKP  247
            VRIIGFDN RQVQCISFIAYKP
Sbjct  98   VRIIGFDNKRQVQCISFIAYKP  119



>emb|CAA31948.1| ribulose bisphosphate carboxylase [Arabidopsis thaliana]
Length=182

 Score =   151 bits (382),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            +PC+EFE EHGFVYRE+  SPGYYDGRYWTMWKLP+FGCTD+ QVL EV+E KK YP A+
Sbjct  96   IPCVEFELEHGFVYREHGNSPGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPNAF  155

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDN RQVQCISF+AYKP  +
Sbjct  156  IRIIGFDNTRQVQCISFVAYKPPSF  180



>ref|XP_006383456.1| Ribulose bisphosphate carboxylase small chain 1A family protein 
[Populus trichocarpa]
 gb|ABK95904.1| unknown [Populus trichocarpa]
 gb|ABK96181.1| unknown [Populus trichocarpa]
 gb|ERP61253.1| Ribulose bisphosphate carboxylase small chain 1A family protein 
[Populus trichocarpa]
Length=181

 Score =   151 bits (382),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFE E G+VYRE+++SPGYYDGRYWTMWKLPMFGCT+A+QVL E++EAKKAYP ++
Sbjct  97   VPCLEFELEKGWVYREHHQSPGYYDGRYWTMWKLPMFGCTEASQVLIELEEAKKAYPNSF  156

Query  182  VRIIGFDNVRQVQCISFIAYKPEG  253
            +RIIGFDN RQVQCISFIA KP+G
Sbjct  157  IRIIGFDNTRQVQCISFIASKPKG  180



>ref|XP_002868775.1| ribulose bisphosphate carboxylase small chain 1B [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH45034.1| ribulose bisphosphate carboxylase small chain 1B [Arabidopsis 
lyrata subsp. lyrata]
Length=181

 Score =   151 bits (381),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            +PC+EFE EHGFVYRE+  +PGYYDGRYWTMWKLP+FGCTD+ QVL EVQE KK YP A+
Sbjct  94   IPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVQECKKEYPNAF  153

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDN RQVQCISFIAYKP  +
Sbjct  154  IRIIGFDNNRQVQCISFIAYKPPSF  178



>gb|KCW52065.1| hypothetical protein EUGRSUZ_J01502 [Eucalyptus grandis]
Length=180

 Score =   151 bits (381),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 69/85 (81%), Positives = 77/85 (91%), Gaps = 1/85 (1%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFETE GFVYRE++ SPGYYDGRYWTMWKLPMFGCTD+ QVL E++E KKAYP A+
Sbjct  97   VPCLEFETE-GFVYREHHHSPGYYDGRYWTMWKLPMFGCTDSAQVLKELEECKKAYPTAF  155

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            VRIIGFDN RQVQCISFIA+KP G+
Sbjct  156  VRIIGFDNKRQVQCISFIAFKPPGF  180



>ref|XP_002868776.1| ribulose bisphosphate carboxylase [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45035.1| ribulose bisphosphate carboxylase [Arabidopsis lyrata subsp. 
lyrata]
Length=181

 Score =   151 bits (381),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            +PC+EFE EHGFVYRE+  +PGYYDGRYWTMWKLP+FGCTD+ QVL EVQE KK YP A+
Sbjct  94   IPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVQECKKEYPNAF  153

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDN RQVQCISFIAYKP  +
Sbjct  154  IRIIGFDNNRQVQCISFIAYKPPSF  178



>ref|XP_004135094.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004164158.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Cucumis sativus]
 gb|KGN52085.1| hypothetical protein Csa_5G609710 [Cucumis sativus]
Length=185

 Score =   151 bits (382),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPC+EF+   GFVYREN++SPGYYDGRYWTMWKLPMFGCTD++QV+ E++EAKK YP A+
Sbjct  98   VPCVEFDIGSGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDSSQVIQEIEEAKKEYPDAF  157

Query  182  VRIIGFDNVRQVQCISFIAYKP  247
            +R+IGFDNVRQVQCISFIAYKP
Sbjct  158  IRVIGFDNVRQVQCISFIAYKP  179



>emb|CDY67657.1| BnaCnng55860D [Brassica napus]
Length=181

 Score =   151 bits (381),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            +PC+EFE EHGFVYRE+  +PGYYDGRYWTMWKLP+FGCTD+ QVL EVQE KK YP A+
Sbjct  94   IPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVQECKKEYPNAF  153

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDN RQVQCISFIAYKP  +
Sbjct  154  IRIIGFDNNRQVQCISFIAYKPPSF  178



>ref|XP_006285696.1| hypothetical protein CARUB_v10007166mg [Capsella rubella]
 gb|EOA18594.1| hypothetical protein CARUB_v10007166mg [Capsella rubella]
Length=181

 Score =   151 bits (381),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            +PC+EFE EHGFVYRE+  +PGYYDGRYWTMWKLP+FGCTD+ QVL EV+E KK YP A+
Sbjct  94   IPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPNAF  153

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDN RQVQCISFIAYKP  +
Sbjct  154  IRIIGFDNTRQVQCISFIAYKPPSF  178



>gb|EYU38174.1| hypothetical protein MIMGU_mgv1a014707mg [Erythranthe guttata]
Length=181

 Score =   151 bits (381),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            +PC+EFE EHGFVYR++N SPGYYDGRYWTMWKLPMFGCTDA QV+ E+ EA KAYP+ +
Sbjct  97   IPCIEFELEHGFVYRQHNSSPGYYDGRYWTMWKLPMFGCTDAVQVVNELDEAIKAYPEGF  156

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGF+N++QVQ ISFIAYKP GY
Sbjct  157  IRIIGFNNLKQVQDISFIAYKPAGY  181



>gb|EAY82834.1| hypothetical protein OsI_38046 [Oryza sativa Indica Group]
Length=175

 Score =   151 bits (381),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 78/84 (93%), Gaps = 1/84 (1%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEF ++ GFVYREN++SPGYYDGRYWTMWKLPMFGCTDATQVL E++EAKKAYP A+
Sbjct  86   VPCLEF-SKVGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDATQVLKELEEAKKAYPDAF  144

Query  182  VRIIGFDNVRQVQCISFIAYKPEG  253
            VRIIGFDNVRQVQ ISFIAYKP G
Sbjct  145  VRIIGFDNVRQVQLISFIAYKPPG  168



>emb|CCF55356.1| ribulose-1,5-bisphosphate carboxylase small subunit [Cucumis 
sativus]
Length=185

 Score =   151 bits (382),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPC+EF+   GFVYREN++SPGYYDGRYWTMWKLPMFGCTD++QV+ E++EAKK YP A+
Sbjct  98   VPCVEFDIGSGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDSSQVIQEIEEAKKEYPDAF  157

Query  182  VRIIGFDNVRQVQCISFIAYKP  247
            +R+IGFDNVRQVQCISFIAYKP
Sbjct  158  IRVIGFDNVRQVQCISFIAYKP  179



>ref|XP_006284616.1| hypothetical protein CARUB_v10005847mg [Capsella rubella]
 gb|EOA17514.1| hypothetical protein CARUB_v10005847mg [Capsella rubella]
Length=181

 Score =   151 bits (381),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            +PC+EFE EHGFVYRE+  +PGYYDGRYWTMWKLP+FGCTD+ QVL EV+E KK YP A+
Sbjct  94   IPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPNAF  153

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDN RQVQCISFIAYKP  +
Sbjct  154  IRIIGFDNTRQVQCISFIAYKPPSF  178



>gb|AIB04188.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Camellia oleifera]
Length=176

 Score =   151 bits (381),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            +PCLEF    GFVYRE+NKSPGYYDGRYWTMWKLPMFGCTD++QVL EV+E KK YPQA+
Sbjct  92   IPCLEFSVVGGFVYREHNKSPGYYDGRYWTMWKLPMFGCTDSSQVLKEVEECKKEYPQAF  151

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDN RQVQCISFIA KP G+
Sbjct  152  IRIIGFDNKRQVQCISFIACKPPGF  176



>ref|XP_010450911.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like [Camelina sativa]
Length=181

 Score =   151 bits (381),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            +PC+EFE EHGFVYRE+  +PGYYDGRYWTMWKLP+FGCTD+ QVL EVQE KK YP A+
Sbjct  94   IPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVQECKKEYPNAF  153

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDN RQVQCISFIAYKP  +
Sbjct  154  IRIIGFDNNRQVQCISFIAYKPPSF  178



>ref|XP_010521010.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Tarenaya hassleriana]
Length=180

 Score =   151 bits (381),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            +PCLEFE  + FVYREN++SPGYYDGRYWTMWKLPMFGCTD+ QV+ E+QEAK  +P A 
Sbjct  96   IPCLEFELGNAFVYRENHRSPGYYDGRYWTMWKLPMFGCTDSAQVMKELQEAKTTHPDAH  155

Query  182  VRIIGFDNVRQVQCISFIAYKPEG  253
            +RIIGFDNVRQVQCISFIAYKP+ 
Sbjct  156  IRIIGFDNVRQVQCISFIAYKPKA  179



>sp|P08474.1|RBS_CUCSA RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Cucumis sativus]
 gb|AAA33131.1| ribulose bisphosphate carboxylase/oxygenase precursor peptide 
[Cucumis sativus]
Length=189

 Score =   151 bits (382),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 77/83 (93%), Gaps = 0/83 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPC+EF+   GFVYREN++SPG+YDGRYWTMWKLPMFGCTD++QV+ E++EAKK YP A+
Sbjct  98   VPCVEFDIGSGFVYRENHRSPGFYDGRYWTMWKLPMFGCTDSSQVIQEIEEAKKEYPDAF  157

Query  182  VRIIGFDNVRQVQCISFIAYKPE  250
            +R+IGFDNVRQVQCISFIAYKP+
Sbjct  158  IRVIGFDNVRQVQCISFIAYKPQ  180



>gb|KDP29409.1| hypothetical protein JCGZ_18330 [Jatropha curcas]
Length=153

 Score =   150 bits (379),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 65/79 (82%), Positives = 73/79 (92%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFE EHGFVYREN++SPGYYDGRYWTMWKLPMFGCTD+ QVL E++EAK AYP ++
Sbjct  75   VPCLEFELEHGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDSAQVLKELEEAKTAYPNSF  134

Query  182  VRIIGFDNVRQVQCISFIA  238
            +RIIGFDN RQVQCISFIA
Sbjct  135  IRIIGFDNKRQVQCISFIA  153



>gb|AIF75357.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tomentosiformis]
 gb|AIF75358.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score =   150 bits (378),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 68/72 (94%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFETE GFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEV EAKKAYP+AW
Sbjct  81   VPCLEFETERGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVGEAKKAYPEAW  140

Query  182  VRIIGFDNVRQV  217
            +RIIGFDNVRQV
Sbjct  141  IRIIGFDNVRQV  152



>ref|XP_010450913.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like [Camelina sativa]
Length=181

 Score =   151 bits (381),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            +PC+EFE EHGFVYRE+  +PGYYDGRYWTMWKLP+FGCTD+ QVL EVQE KK YP A+
Sbjct  94   IPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVQECKKEYPNAF  153

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDN RQVQCISFIAYKP  +
Sbjct  154  IRIIGFDNNRQVQCISFIAYKPPSF  178



>ref|XP_006285820.1| hypothetical protein CARUB_v10007296mg [Capsella rubella]
 gb|EOA18718.1| hypothetical protein CARUB_v10007296mg [Capsella rubella]
Length=181

 Score =   151 bits (381),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            +PC+EFE EHGFVYRE+  +PGYYDGRYWTMWKLP+FGCTD+ QVL EV+E KK YP A+
Sbjct  94   IPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPNAF  153

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDN RQVQCISFIAYKP  +
Sbjct  154  IRIIGFDNTRQVQCISFIAYKPPSF  178



>sp|P08135.1|RBS_RAPSA RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Raphanus sativus]
 emb|CAA29801.1| carboxylase [Raphanus sativus]
 prf||1405335A ribulose bisphosphate carboxylase S
Length=181

 Score =   151 bits (381),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            +PC+EFE EHGFVYRE+  +PGYYDGRYWTMWKLP+FGCTD+ QVL EVQE KK YP A 
Sbjct  94   IPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVQECKKEYPNAL  153

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDN RQVQCISFIAYKP  +
Sbjct  154  IRIIGFDNNRQVQCISFIAYKPPSF  178



>ref|XP_010450912.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic [Camelina sativa]
Length=181

 Score =   151 bits (381),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            +PC+EFE EHGFVYRE+  +PGYYDGRYWTMWKLP+FGCTD+ QVL EVQE KK YP A+
Sbjct  94   IPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVQECKKEYPNAF  153

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDN RQVQCISFIAYKP  +
Sbjct  154  IRIIGFDNNRQVQCISFIAYKPPSF  178



>gb|AIF75342.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica oleracea]
 gb|AIF75343.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica napus]
Length=177

 Score =   150 bits (380),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            +PC+EFE EHGFVYRE+  +PGYYDGRYWTMWKLP+FGCTD+ QVL EVQE KK YP A+
Sbjct  90   IPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVQECKKEYPNAF  149

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDN RQVQCISFIAYKP  +
Sbjct  150  IRIIGFDNNRQVQCISFIAYKPPSF  174



>gb|AIF75344.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica oleracea]
 gb|AIF75345.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica napus]
Length=177

 Score =   150 bits (380),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            +PC+EFE EHGFVYRE+  +PGYYDGRYWTMWKLP+FGCTD+ QVL EVQE KK YP A+
Sbjct  90   IPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVQECKKEYPNAF  149

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDN RQVQCISFIAYKP  +
Sbjct  150  IRIIGFDNNRQVQCISFIAYKPPSF  174



>ref|XP_010435745.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like [Camelina sativa]
Length=181

 Score =   150 bits (380),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            +PC+EFE EHGFVYRE+  +PGYYDGRYWTMWKLP+FGCTD+ QVL EV+E KK YP A+
Sbjct  94   IPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPNAF  153

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDN RQVQCISFIAYKP  +
Sbjct  154  IRIIGFDNTRQVQCISFIAYKPPSF  178



>ref|XP_010435743.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like isoform X1 [Camelina sativa]
 ref|XP_010435744.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like isoform X2 [Camelina sativa]
Length=181

 Score =   150 bits (380),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            +PC+EFE EHGFVYRE+  +PGYYDGRYWTMWKLP+FGCTD+ QVL EV+E KK YP A+
Sbjct  94   IPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPNAF  153

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDN RQVQCISFIAYKP  +
Sbjct  154  IRIIGFDNTRQVQCISFIAYKPPSF  178



>gb|AIF75283.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis thaliana]
 gb|AIF75284.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis suecica]
Length=163

 Score =   150 bits (379),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            +PC+EFE EHGFVYRE+  SPGYYDGRYWTMWKLP+FGCTD+ QVL EV+E KK YP A+
Sbjct  82   IPCVEFELEHGFVYREHGNSPGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPNAF  141

Query  182  VRIIGFDNVRQVQCISFIAYKP  247
            +RIIGFDN RQVQCISFIAYKP
Sbjct  142  IRIIGFDNTRQVQCISFIAYKP  163



>gb|ABK95229.1| unknown [Populus trichocarpa]
 gb|ABK95250.1| unknown [Populus trichocarpa]
Length=182

 Score =   150 bits (380),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFE E G+VYRE++ SPGYYDGRYWTMWKLPMFGCT+A+QVL E++EAKKAYP A+
Sbjct  98   VPCLEFELEKGWVYREHHSSPGYYDGRYWTMWKLPMFGCTEASQVLLELEEAKKAYPNAF  157

Query  182  VRIIGFDNVRQVQCISFIAYKPEG  253
            +RIIGFDN RQVQCISFIA KP+G
Sbjct  158  IRIIGFDNTRQVQCISFIAAKPKG  181



>gb|AAK49590.1|AF372874_1 F1O19.10/F1O19.10 [Arabidopsis thaliana]
Length=125

 Score =   149 bits (376),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            +PC+EFE EHGFVYRE+  SPGYYDGRYWTMWKLP+FGCTD+ QVL EV+E KK YP A+
Sbjct  39   IPCVEFELEHGFVYREHGNSPGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPNAF  98

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDN RQVQCISFIAYKP  +
Sbjct  99   IRIIGFDNTRQVQCISFIAYKPPSF  123



>ref|XP_002305162.2| Ribulose bisphosphate carboxylase small chain 1A family protein 
[Populus trichocarpa]
 gb|ABK95372.1| unknown [Populus trichocarpa]
 gb|ABK95841.1| unknown [Populus trichocarpa]
 gb|EEE85673.2| Ribulose bisphosphate carboxylase small chain 1A family protein 
[Populus trichocarpa]
Length=182

 Score =   150 bits (380),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFE E G+VYRE++ SPGYYDGRYWTMWKLPMFGCT+A+QVL E++EAKKAYP A+
Sbjct  98   VPCLEFELEKGWVYREHHSSPGYYDGRYWTMWKLPMFGCTEASQVLLELEEAKKAYPNAF  157

Query  182  VRIIGFDNVRQVQCISFIAYKPEG  253
            +RIIGFDN RQVQCISFIA KP+G
Sbjct  158  IRIIGFDNTRQVQCISFIAAKPKG  181



>emb|CDP20139.1| unnamed protein product [Coffea canephora]
Length=158

 Score =   150 bits (378),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 68/85 (80%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            +PCLEFE E G VYRE ++SPGYYDGRYWTMWKLPMFGCTDATQVL EV+E  K YP  W
Sbjct  74   IPCLEFELEKGHVYREYHRSPGYYDGRYWTMWKLPMFGCTDATQVLKEVRECLKEYPNCW  133

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            VRIIGFDNVRQVQCISFIA KP+G+
Sbjct  134  VRIIGFDNVRQVQCISFIAAKPKGF  158



>gb|ABC17790.1| plastid ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit [Coffea arabica]
 gb|ABC17791.1| plastid ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit [Coffea arabica]
 gb|ABC17792.1| plastid ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit [Coffea arabica]
 gb|ABC17793.1| plastid ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit [Coffea arabica]
 gb|ABC17794.1| plastid ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit [Coffea arabica]
 gb|ABC17795.1| plastid ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit [Coffea arabica]
 gb|ABC17796.1| plastid ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit [Coffea arabica]
 gb|ABC17797.1| plastid ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit [Coffea arabica]
 gb|ABC17798.1| plastid ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit [Coffea arabica]
 gb|ABC17799.1| plastid ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit [Coffea arabica]
 gb|ABC17800.1| plastid ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit [Coffea arabica]
 gb|ABC17801.1| plastid ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit [Coffea arabica]
Length=117

 Score =   148 bits (374),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 69/84 (82%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFE E GFVYRE ++SPGYYDGRYWTMWKLPM+GCTDATQVL EV E  K YP  W
Sbjct  34   VPCLEFELEKGFVYREYHRSPGYYDGRYWTMWKLPMYGCTDATQVLNEVGECLKEYPNCW  93

Query  182  VRIIGFDNVRQVQCISFIAYKPEG  253
            VRIIGFDNVRQVQCISFIA KP+G
Sbjct  94   VRIIGFDNVRQVQCISFIAAKPKG  117



>ref|XP_006405770.1| hypothetical protein EUTSA_v10027955mg [Eutrema salsugineum]
 gb|ESQ47223.1| hypothetical protein EUTSA_v10027955mg [Eutrema salsugineum]
Length=181

 Score =   150 bits (379),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            +PC+EFE E+GFV+RE+  +PGYYDGRYWTMWKLP+FGCTD+ QVL EVQE KK YPQA+
Sbjct  94   IPCVEFELENGFVHREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVQECKKEYPQAF  153

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDN RQVQCISFIAYKP  +
Sbjct  154  IRIIGFDNTRQVQCISFIAYKPPSF  178



>sp|P19311.1|RBS5_LEMGI RecName: Full=Ribulose bisphosphate carboxylase small chain SSU5A, 
chloroplastic; Short=RuBisCO small subunit SSU5A; Flags: 
Precursor [Lemna gibba]
 emb|CAA35099.1| ribulose bisphosphate carboxylase [Lemna gibba]
Length=177

 Score =   150 bits (379),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 69/82 (84%), Positives = 76/82 (93%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPC+EF  E GFVYREN+ SPGYYDGRYWTMWKLPMFGCTDA+QV+AEV+EAKKAYP+ +
Sbjct  96   VPCIEFSKE-GFVYRENHASPGYYDGRYWTMWKLPMFGCTDASQVIAEVEEAKKAYPEYF  154

Query  182  VRIIGFDNVRQVQCISFIAYKP  247
            VRIIGFDN RQVQCISFIAYKP
Sbjct  155  VRIIGFDNKRQVQCISFIAYKP  176



>emb|CAA32702.1| ribulose bisphosphate carboxylase [Arabidopsis thaliana]
Length=181

 Score =   150 bits (379),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            +PC+EFE EHGFVYRE+  +PGYYDGRYWTMWKLP+FGCTD+ QVL EV+E KK YP A+
Sbjct  94   IPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPGAF  153

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDN RQVQCISFIAYKP  +
Sbjct  154  IRIIGFDNTRQVQCISFIAYKPPSF  178



>emb|CAA32701.1| ribulose bisphosphate carboxylase [Arabidopsis thaliana]
Length=181

 Score =   150 bits (379),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            +PC+EFE EHGFVYRE+  +PGYYDGRYWTMWKLP+FGCTD+ QVL EV+E KK YP A+
Sbjct  94   IPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPGAF  153

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDN RQVQCISFIAYKP  +
Sbjct  154  IRIIGFDNTRQVQCISFIAYKPPSF  178



>sp|P19308.1|RBS2_LEMGI RecName: Full=Ribulose bisphosphate carboxylase small chain SSU26, 
chloroplastic; Short=RuBisCO small subunit SSU26; Flags: 
Precursor [Lemna gibba]
 emb|CAA35101.1| ribulose bisphosphate carboxylase [Lemna gibba]
Length=177

 Score =   150 bits (378),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 69/82 (84%), Positives = 76/82 (93%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPC+EF  E GFVYREN+ SPGYYDGRYWTMWKLPMFGCTDA+QV+AEV+EAKKAYP+ +
Sbjct  96   VPCIEFSKE-GFVYRENHASPGYYDGRYWTMWKLPMFGCTDASQVIAEVEEAKKAYPEYF  154

Query  182  VRIIGFDNVRQVQCISFIAYKP  247
            VRIIGFDN RQVQCISFIAYKP
Sbjct  155  VRIIGFDNKRQVQCISFIAYKP  176



>ref|NP_198657.1| ribulose bisphosphate carboxylase small chain 3B [Arabidopsis 
thaliana]
 sp|P10798.2|RBS3B_ARATH RecName: Full=Ribulose bisphosphate carboxylase small chain 3B, 
chloroplastic; Short=RuBisCO small subunit 3B; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAK25834.1|AF360124_1 putative ribulose bisphosphate carboxylase small chain 3b precursor 
[Arabidopsis thaliana]
 gb|AAK95300.1|AF410314_1 F1O19.10/F1O19.10 [Arabidopsis thaliana]
 gb|AAL58912.1|AF462822_1 At5g38410/F1O19.10 [Arabidopsis thaliana]
 dbj|BAB09353.1| ribulose bisphosphate carboxylase small chain 3b precursor (RuBisCO 
small subunit 3b) [Arabidopsis thaliana]
 gb|AAK93702.1| putative RuBisCO small 3b subunit precursor [Arabidopsis thaliana]
 gb|AAK96743.1| ribulose bisphosphate carboxylase small chain 3b precursor (RuBisCO 
small subunit 3b) [Arabidopsis thaliana]
 gb|AAL47390.1| ribulose bisphosphate carboxylase small chain 3b precursor (RuBisCO 
small subunit 3b) [Arabidopsis thaliana]
 gb|AAM19980.1| At5g38410/F1O19.10 [Arabidopsis thaliana]
 gb|AAN31863.1| putative ribulose bisphosphate carboxylase small chain 3b precursor 
(RuBisCO small subunit 3b) [Arabidopsis thaliana]
 gb|AED94311.1| ribulose bisphosphate carboxylase small chain 3B [Arabidopsis 
thaliana]
Length=181

 Score =   150 bits (379),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            +PC+EFE EHGFVYRE+  +PGYYDGRYWTMWKLP+FGCTD+ QVL EV+E KK YP A+
Sbjct  94   IPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPGAF  153

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDN RQVQCISFIAYKP  +
Sbjct  154  IRIIGFDNTRQVQCISFIAYKPPSF  178



>ref|NP_198658.1| ribulose bisphosphate carboxylase small chain 2B [Arabidopsis 
thaliana]
 sp|P10797.2|RBS2B_ARATH RecName: Full=Ribulose bisphosphate carboxylase small chain 2B, 
chloroplastic; Short=RuBisCO small subunit 2B; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAB09354.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AAL24421.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AAL32515.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AAL32536.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AAL32621.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AAM13287.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AAN72105.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AAO00914.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AAO29974.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AED94314.1| ribulose bisphosphate carboxylase small chain 2B [Arabidopsis 
thaliana]
Length=181

 Score =   150 bits (379),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            +PC+EFE EHGFVYRE+  +PGYYDGRYWTMWKLP+FGCTD+ QVL EV+E KK YP A+
Sbjct  94   IPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPGAF  153

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDN RQVQCISFIAYKP  +
Sbjct  154  IRIIGFDNTRQVQCISFIAYKPPSF  178



>ref|NP_198659.1| ribulose bisphosphate carboxylase small chain 1B [Arabidopsis 
thaliana]
 sp|P10796.1|RBS1B_ARATH RecName: Full=Ribulose bisphosphate carboxylase small chain 1B, 
chloroplastic; Short=RuBisCO small subunit 1B; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAK95269.1|AF410283_1 F1O19.10/F1O19.10 [Arabidopsis thaliana]
 emb|CAA32700.1| ribulose bisphosphate carboxylase [Arabidopsis thaliana]
 dbj|BAB09355.1| ribulose bisphosphate carboxylase small chain 1b precursor (RuBisCO 
small subunit 1b) [Arabidopsis thaliana]
 gb|AAN28753.1| At5g38430/F1O19.10 [Arabidopsis thaliana]
 gb|AED94315.1| ribulose bisphosphate carboxylase small chain 1B [Arabidopsis 
thaliana]
Length=181

 Score =   150 bits (379),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            +PC+EFE EHGFVYRE+  +PGYYDGRYWTMWKLP+FGCTD+ QVL EV+E KK YP A+
Sbjct  94   IPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPGAF  153

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDN RQVQCISFIAYKP  +
Sbjct  154  IRIIGFDNTRQVQCISFIAYKPPSF  178



>ref|XP_003618736.1| Ribulose bisphosphate carboxylase small chain [Medicago truncatula]
 gb|ACJ84141.1| unknown [Medicago truncatula]
 gb|AES74954.1| ribulose bisphosphate carboxylase small chain [Medicago truncatula]
Length=180

 Score =   150 bits (379),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFE E GFVYREN+ SPGYYDGRYWTMWKLP+FG TD++QVL E+ EAK AYP+++
Sbjct  96   VPCLEFELEKGFVYRENHSSPGYYDGRYWTMWKLPLFGATDSSQVLKELAEAKAAYPESF  155

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQCISFIA+ P  Y
Sbjct  156  IRIIGFDNVRQVQCISFIAHTPATY  180



>sp|P18960.1|RBS_SILPR RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Silene latifolia subsp. alba]
 gb|AAB39037.1| ribulose bisphosphate carboxylase precursor [Silene latifolia 
subsp. alba]
Length=177

 Score =   150 bits (378),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 70/83 (84%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFE     VYRENNKSPGYYDGRYWTMWKLPMFGCTDA+QV AEV E K AYP A 
Sbjct  95   VPCLEFEVGPAHVYRENNKSPGYYDGRYWTMWKLPMFGCTDASQVAAEVVECKNAYPDAH  154

Query  182  VRIIGFDNVRQVQCISFIAYKPE  250
            VRIIGFDN RQVQCISFIAYKPE
Sbjct  155  VRIIGFDNKRQVQCISFIAYKPE  177



>gb|AIF75291.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis arenosa]
 gb|AIF75293.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis arenosa]
Length=163

 Score =   149 bits (377),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            +PC+EFE EHGFVYRE+  +PGYYDGRYWTMWKLP+FGCTD+ QVL EVQE KK YP A+
Sbjct  82   IPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVQECKKEYPNAF  141

Query  182  VRIIGFDNVRQVQCISFIAYKP  247
            +RIIGFDN RQVQCISFIAYKP
Sbjct  142  IRIIGFDNNRQVQCISFIAYKP  163



>gb|AFK40375.1| unknown [Medicago truncatula]
Length=180

 Score =   150 bits (378),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFE E GFVYREN+ SPGYYDGRYWTMWKLP+FG TD++QVL E+ EAK AYP+++
Sbjct  96   VPCLEFELEKGFVYRENHSSPGYYDGRYWTMWKLPLFGATDSSQVLKELAEAKAAYPESF  155

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQCISFIA+ P  Y
Sbjct  156  IRIIGFDNVRQVQCISFIAHTPATY  180



>sp|P19312.1|RBS6_LEMGI RecName: Full=Ribulose bisphosphate carboxylase small chain SSU5B, 
chloroplastic; Short=RuBisCO small subunit SSU5B; Flags: 
Precursor [Lemna gibba]
 emb|CAA35100.1| ribulose bisphosphate carboxylase [Lemna gibba]
Length=177

 Score =   150 bits (378),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 69/82 (84%), Positives = 76/82 (93%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPC+EF  E GFVYREN+ SPGYYDGRYWTMWKLPMFGCTDA+QV+AEV+EAKKAYP+ +
Sbjct  96   VPCIEFSKE-GFVYRENHASPGYYDGRYWTMWKLPMFGCTDASQVIAEVEEAKKAYPEYF  154

Query  182  VRIIGFDNVRQVQCISFIAYKP  247
            VRIIGFDN RQVQCISFIAYKP
Sbjct  155  VRIIGFDNKRQVQCISFIAYKP  176



>gb|AAA33686.1| ribulose 1,5-bisphosphate carboxylase small subunit propeptide, 
partial [Pisum sativum]
Length=156

 Score =   149 bits (376),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 69/85 (81%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFE E GFVYRE+NKSP YYDGRYWTMWKLPMFG TDA+QVL E+ E   AYPQA+
Sbjct  72   VPCLEFELEKGFVYREHNKSPRYYDGRYWTMWKLPMFGTTDASQVLKELDEVVAAYPQAF  131

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            VRIIGFDNVRQVQCISFIA+ PE Y
Sbjct  132  VRIIGFDNVRQVQCISFIAHTPESY  156



>dbj|BAK23963.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[synthetic construct]
Length=170

 Score =   149 bits (377),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 75/84 (89%), Gaps = 1/84 (1%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEF  E GFVYREN+ SP YYDGRYWTMWKLPMFGCTDATQVL E++EAKKAYP A+
Sbjct  86   VPCLEFSKE-GFVYRENSTSPCYYDGRYWTMWKLPMFGCTDATQVLKELEEAKKAYPDAF  144

Query  182  VRIIGFDNVRQVQCISFIAYKPEG  253
            VRIIGFDNVRQVQ ISFIAYKP G
Sbjct  145  VRIIGFDNVRQVQLISFIAYKPAG  168



>gb|AIF75322.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica napus]
Length=177

 Score =   150 bits (378),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            +PC+EFE EHGFVYRE+  +PGYYDGRYWTMWKLP+FGCTD++QVL EVQE K  YP A+
Sbjct  90   IPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSSQVLKEVQECKTEYPNAF  149

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDN RQVQCISFIAYKP  +
Sbjct  150  IRIIGFDNNRQVQCISFIAYKPPSF  174



>gb|AIF75294.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis suecica]
Length=163

 Score =   149 bits (376),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            +PC+EFE EHGFVYRE+  +PGYYDGRYWTMWKLP+FGCTD+ QVL EVQE KK YP A+
Sbjct  82   IPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVQECKKEYPNAF  141

Query  182  VRIIGFDNVRQVQCISFIAYKP  247
            +RIIGFDN RQVQCISFIAYKP
Sbjct  142  IRIIGFDNNRQVQCISFIAYKP  163



>sp|Q40250.1|RBS_LACSA RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Lactuca sativa]
 dbj|BAA03103.1| riburose-1,5-bisphosphate carboxylase/oxygenase small subunit 
precursor [Lactuca sativa]
Length=181

 Score =   150 bits (378),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            +PCLEFE EHGFVYRE++ SPGYYDGRYWTMWKLPMFGCTD+ QV+ EV E KK YP A+
Sbjct  96   IPCLEFELEHGFVYREHHHSPGYYDGRYWTMWKLPMFGCTDSAQVMKEVGECKKEYPNAF  155

Query  182  VRIIGFDNVRQVQCISFIAYKPEG  253
            +R+IGFDN+RQVQCISFI  KP G
Sbjct  156  IRVIGFDNIRQVQCISFIVAKPPG  179



>gb|ACQ90229.1| TuMV resistance protein-like protein [Brassica rapa subsp. chinensis]
Length=162

 Score =   149 bits (376),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            +PC+EFE EHGFVYRE+  +PGYYDGRYWTMWKLP+FGCTD+ QVL EVQE K  YP A+
Sbjct  75   IPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVQECKTEYPNAF  134

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDN RQVQCISFIAYKP  +
Sbjct  135  IRIIGFDNNRQVQCISFIAYKPPSF  159



>ref|XP_010440945.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like [Camelina sativa]
 ref|XP_010440946.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like [Camelina sativa]
 ref|XP_010440947.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like [Camelina sativa]
Length=181

 Score =   149 bits (377),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            +PC+EFE EHGFVYRE+  +PGYYDGRYWTMWKLP+FGCTD+ QVL EV+E KK YP A+
Sbjct  94   IPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPNAF  153

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDN RQVQCISFIAYKP  +
Sbjct  154  IRIIGFDNNRQVQCISFIAYKPPSF  178



>emb|CAA10290.1| ribulose 1,5-bisphosphate carboxylase small subunit [Cicer arietinum]
Length=181

 Score =   149 bits (377),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFE E GFVYRE+N SPGYYDGRYWTMWKLP+FGCT+A QVL E+QE  KAYP A+
Sbjct  97   VPCLEFELEKGFVYREHNNSPGYYDGRYWTMWKLPLFGCTEAVQVLKELQEVVKAYPNAF  156

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            VRIIGFDNVRQVQCISFIA+ P+ +
Sbjct  157  VRIIGFDNVRQVQCISFIAHTPKEF  181



>ref|XP_003618735.1| Ribulose bisphosphate carboxylase small chain [Medicago truncatula]
 gb|AES74953.1| ribulose bisphosphate carboxylase small chain [Medicago truncatula]
Length=177

 Score =   149 bits (377),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            VPCLEFE E GFVYREN+ SPGYYDGRYWTMWKLP+FG TD++QVL E+ EAK AYP+++
Sbjct  93   VPCLEFELEKGFVYRENHSSPGYYDGRYWTMWKLPLFGATDSSQVLKELAEAKAAYPESF  152

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDNVRQVQCISFIA+ P  Y
Sbjct  153  IRIIGFDNVRQVQCISFIAHTPATY  177



>emb|CDY52468.1| BnaA04g27920D [Brassica napus]
Length=181

 Score =   149 bits (377),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            +PC+EFE EHGFVYRE+  +PGYYDGRYWTMWKLP+FGCTD+ QVL EVQE K  YP A+
Sbjct  94   IPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVQECKTEYPNAF  153

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDN RQVQCISFIAYKP  +
Sbjct  154  IRIIGFDNNRQVQCISFIAYKPPSF  178



>ref|XP_010440948.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like [Camelina sativa]
Length=181

 Score =   149 bits (377),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    VPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAW  181
            +PC+EFE EHGFVYRE+  +PGYYDGRYWTMWKLP+FGCTD+ QVL EV+E KK YP A+
Sbjct  94   IPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPNAF  153

Query  182  VRIIGFDNVRQVQCISFIAYKPEGY  256
            +RIIGFDN RQVQCISFIAYKP  +
Sbjct  154  IRIIGFDNNRQVQCISFIAYKPPSF  178



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 514367491556