BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c10906_g1_i1 len=342 path=[320:0-341]

Length=342
                                                                      Score     E

emb|CDP01948.1|  unnamed protein product                              50.4    8e-05   
ref|XP_010263954.1|  PREDICTED: probable methyltransferase PMT27      48.9    3e-04   



>emb|CDP01948.1| unnamed protein product [Coffea canephora]
Length=793

 Score = 50.4 bits (119),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +3

Query  3    WEVRMTFYQKQDGMLSAQKTEWRPETYTAST  95
            WEV +TF + Q+G+LSAQKTEWRP++Y AS+
Sbjct  763  WEVHLTFSKNQEGILSAQKTEWRPDSYAASS  793



>ref|XP_010263954.1| PREDICTED: probable methyltransferase PMT27 [Nelumbo nucifera]
Length=934

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +3

Query  3    WEVRMTFYQKQDGMLSAQKTEWRPETYTAST  95
            WEVR+ F + Q+G+LSAQK++WRP TY+AS+
Sbjct  904  WEVRLIFSKDQEGILSAQKSDWRPRTYSASS  934



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 511879084288