BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c10891_g1_i1 len=144 path=[73:0-33 60:34-45 72:46-143]

Length=144
                                                                      Score     E

ref|XP_011046350.1|  PREDICTED: probable LRR receptor-like serine...  49.7    3e-05   
ref|XP_011046349.1|  PREDICTED: probable LRR receptor-like serine...  49.7    3e-05   
ref|XP_006371021.1|  hypothetical protein POPTR_0019s027201g          49.3    3e-05   
ref|XP_002325753.2|  hypothetical protein POPTR_0019s01950g           49.3    4e-05   Populus trichocarpa [western balsam poplar]
ref|XP_006370932.1|  putative receptor-like protein kinase RLPK1      47.4    2e-04   
ref|XP_010316867.1|  PREDICTED: probable LRR receptor-like serine...  46.6    4e-04   
ref|XP_009600347.1|  PREDICTED: probable LRR receptor-like serine...  46.6    4e-04   
ref|XP_010112408.1|  putative leucine-rich repeat receptor-like s...  46.2    5e-04   
ref|XP_006358134.1|  PREDICTED: probable LRR receptor-like serine...  46.2    5e-04   



>ref|XP_011046350.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Populus euphratica]
Length=1003

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 28/49 (57%), Positives = 30/49 (61%), Gaps = 6/49 (12%)
 Frame = +2

Query  2    GPLISAISVEFANFVDFKPPKK--RKTSIIVGAVTSSLFLTFTILCFAW  142
            GPLISAI VE     DFKPP K  RK  I+ GAV  SLFL F +L   W
Sbjct  580  GPLISAIDVE----SDFKPPNKGRRKRFIVAGAVVLSLFLVFILLSSPW  624



>ref|XP_011046349.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Populus euphratica]
Length=1005

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 28/49 (57%), Positives = 30/49 (61%), Gaps = 6/49 (12%)
 Frame = +2

Query  2    GPLISAISVEFANFVDFKPPKK--RKTSIIVGAVTSSLFLTFTILCFAW  142
            GPLISAI VE     DFKPP K  RK  I+ GAV  SLFL F +L   W
Sbjct  580  GPLISAIDVE----SDFKPPNKGRRKRFIVAGAVVLSLFLVFILLSSPW  624



>ref|XP_006371021.1| hypothetical protein POPTR_0019s027201g, partial [Populus trichocarpa]
 gb|ERP48818.1| hypothetical protein POPTR_0019s027201g, partial [Populus trichocarpa]
Length=620

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 28/49 (57%), Positives = 30/49 (61%), Gaps = 6/49 (12%)
 Frame = +2

Query  2    GPLISAISVEFANFVDFKPPKK--RKTSIIVGAVTSSLFLTFTILCFAW  142
            GPLISAI VE     DFKPP K  RK  I+ GAV  SLFL F +L   W
Sbjct  180  GPLISAIDVE----SDFKPPNKGRRKRFIVAGAVVLSLFLVFILLSSLW  224



>ref|XP_002325753.2| hypothetical protein POPTR_0019s01950g [Populus trichocarpa]
 gb|EEF00135.2| hypothetical protein POPTR_0019s01950g [Populus trichocarpa]
Length=972

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 28/49 (57%), Positives = 30/49 (61%), Gaps = 6/49 (12%)
 Frame = +2

Query  2    GPLISAISVEFANFVDFKPPKK--RKTSIIVGAVTSSLFLTFTILCFAW  142
            GPLISAI VE     DFKPP K  RK  I+ GAV  SLFL F +L   W
Sbjct  549  GPLISAIDVE----SDFKPPNKGRRKRFIVAGAVVLSLFLVFILLSSLW  593



>ref|XP_006370932.1| putative receptor-like protein kinase RLPK1 [Populus trichocarpa]
 gb|ERP48729.1| putative receptor-like protein kinase RLPK1 [Populus trichocarpa]
Length=598

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 26/49 (53%), Positives = 31/49 (63%), Gaps = 6/49 (12%)
 Frame = +2

Query  2    GPLISAISVEFANFVDFKPPKK--RKTSIIVGAVTSSLFLTFTILCFAW  142
            GPLISAI +E     +FKPP K  RK  I+ G+V S LFLTF +L   W
Sbjct  518  GPLISAIDIE----PEFKPPTKGKRKKLIVAGSVASLLFLTFILLSVLW  562



>ref|XP_010316867.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Solanum lycopersicum]
Length=998

 Score = 46.6 bits (109),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 26/49 (53%), Positives = 29/49 (59%), Gaps = 6/49 (12%)
 Frame = +2

Query  2    GPLISAISVEFANFVDFKPPK--KRKTSIIVGAVTSSLFLTFTILCFAW  142
            GPL+SAIS E     +FKPP   K+   II GAV SSL L  TI   AW
Sbjct  588  GPLVSAISFE----ANFKPPSNHKKMAHIIAGAVASSLVLLLTIFIVAW  632



>ref|XP_009600347.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Nicotiana tomentosiformis]
Length=1003

 Score = 46.6 bits (109),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 27/55 (49%), Positives = 33/55 (60%), Gaps = 12/55 (22%)
 Frame = +2

Query  2    GPLISAISVEFANFVDFKPP--------KKRKTSIIVGAVTSSLFLTFTILCFAW  142
            GPL+SAIS+E     +FKPP        +K+K  I+VGAV SSL L   IL  AW
Sbjct  581  GPLVSAISLE----ANFKPPPTPENSSNRKKKILIVVGAVMSSLALILMILFVAW  631



>ref|XP_010112408.1| putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase [Morus notabilis]
 gb|EXC33466.1| putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase [Morus notabilis]
Length=941

 Score = 46.2 bits (108),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 32/48 (67%), Gaps = 5/48 (10%)
 Frame = +2

Query  2    GPLISAISVEFANFVDFKPPK-KRKTSIIVGAVTSSLFLTFTILCFAW  142
            GPLISAIS++     +FKPP+ K+K SI +GAV S L L F I+   W
Sbjct  503  GPLISAISMD----SEFKPPEEKKKISIAIGAVISGLGLIFAIISLLW  546



>ref|XP_006358134.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650-like [Solanum tuberosum]
Length=1028

 Score = 46.2 bits (108),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 26/49 (53%), Positives = 29/49 (59%), Gaps = 6/49 (12%)
 Frame = +2

Query  2    GPLISAISVEFANFVDFKPPK--KRKTSIIVGAVTSSLFLTFTILCFAW  142
            GPL+SAIS E     +FKPP   K+   II G V SSL L FTI   AW
Sbjct  615  GPLVSAISFE----ANFKPPSNHKKMAHIIAGVVASSLVLLFTIFFVAW  659



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 506149393984