BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c10884_g1_i1 len=1920 path=[1:0-482 484:483-1919]

Length=1920
                                                                      Score     E

ref|XP_009588943.1|  PREDICTED: uncharacterized protein At4g06744...    377   2e-119   
ref|XP_009793223.1|  PREDICTED: uncharacterized protein At4g06744...    370   7e-117   
ref|XP_006360245.1|  PREDICTED: uncharacterized protein At4g06744...    359   4e-114   
emb|CDP02523.1|  unnamed protein product                                357   5e-112   
gb|EYU44430.1|  hypothetical protein MIMGU_mgv1a005057mg                351   1e-109   
ref|XP_004233445.1|  PREDICTED: uncharacterized protein At4g06744...    350   2e-109   
ref|XP_011099103.1|  PREDICTED: uncharacterized protein At4g06744...    333   8e-103   
gb|KDO59787.1|  hypothetical protein CISIN_1g011101mg                   333   1e-102   
gb|AEI72268.1|  leucine-rich repeat family protein                      331   1e-102   
ref|XP_006422961.1|  hypothetical protein CICLE_v10028242mg             331   7e-102   
gb|KDP47121.1|  hypothetical protein JCGZ_22117                         328   5e-101   
ref|XP_010555995.1|  PREDICTED: uncharacterized protein At4g06744...    325   1e-99    
ref|XP_011004883.1|  PREDICTED: uncharacterized protein At4g06744...    320   5e-99    
ref|XP_006406513.1|  hypothetical protein EUTSA_v10020680mg             321   1e-98    
emb|CDX92324.1|  BnaA05g20830D                                          319   9e-98    
ref|XP_009145802.1|  PREDICTED: uncharacterized protein At4g06744       319   9e-98    
ref|XP_010519298.1|  PREDICTED: uncharacterized protein At4g06744...    318   1e-97    
ref|XP_011004900.1|  PREDICTED: uncharacterized protein At4g06744...    317   1e-97    
emb|CDX99236.1|  BnaC05g33510D                                          317   6e-97    
ref|XP_010028214.1|  PREDICTED: uncharacterized protein At4g06744...    318   1e-96    
ref|XP_007042489.1|  Leucine-rich repeat family protein, putative       317   2e-96    
ref|XP_002282482.2|  PREDICTED: uncharacterized protein At4g06744...    317   2e-96    Vitis vinifera
gb|KDP47120.1|  hypothetical protein JCGZ_22116                         315   4e-96    
ref|NP_188563.1|  leucine-rich repeat-containing protein                316   5e-96    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011088225.1|  PREDICTED: uncharacterized protein At4g06744...    315   5e-96    
ref|XP_006393218.1|  hypothetical protein EUTSA_v10011424mg             316   5e-96    
ref|XP_006356575.1|  PREDICTED: uncharacterized protein At4g06744...    313   2e-95    
gb|KFK39280.1|  hypothetical protein AALP_AA3G224000                    313   2e-95    
emb|CDY20865.1|  BnaC05g26270D                                          313   7e-95    
emb|CDY29337.1|  BnaA05g16040D                                          311   2e-94    
ref|XP_004248758.1|  PREDICTED: uncharacterized protein At4g06744...    309   4e-94    
ref|XP_010263447.1|  PREDICTED: uncharacterized protein At4g06744...    309   7e-94    
ref|XP_009145107.1|  PREDICTED: uncharacterized protein At4g06744...    311   1e-93    
ref|XP_009762067.1|  PREDICTED: uncharacterized protein At4g06744...    307   3e-93    
ref|XP_009622015.1|  PREDICTED: uncharacterized protein At4g06744...    307   4e-93    
ref|XP_002885307.1|  leucine-rich repeat family protein                 306   2e-92    
ref|XP_007201703.1|  hypothetical protein PRUPE_ppa004109mg             306   4e-92    
ref|XP_006297641.1|  hypothetical protein CARUB_v10013659mg             304   5e-92    
ref|XP_009107284.1|  PREDICTED: uncharacterized protein At4g06744       304   7e-92    
ref|XP_010107857.1|  Uncharacterized protein L484_027444                301   3e-91    
emb|CDY16514.1|  BnaA08g02530D                                          302   5e-91    
ref|XP_002518709.1|  serine-threonine protein kinase, plant-type,...    302   9e-91    Ricinus communis
emb|CDY32853.1|  BnaC08g02750D                                          300   2e-90    
ref|XP_008236576.1|  PREDICTED: uncharacterized protein At4g06744...    300   2e-90    
gb|KDP41695.1|  hypothetical protein JCGZ_16102                         297   6e-90    
ref|XP_006346520.1|  PREDICTED: uncharacterized protein At4g06744...    296   6e-90    
ref|XP_010507626.1|  PREDICTED: uncharacterized protein At4g06744...    298   1e-89    
gb|KDP24991.1|  hypothetical protein JCGZ_23974                         296   2e-89    
ref|XP_006472980.1|  PREDICTED: uncharacterized protein At4g06744...    296   3e-89    
ref|XP_008236575.1|  PREDICTED: uncharacterized protein At4g06744...    295   3e-89    
ref|NP_175397.1|  leucine-rich repeat (LRR) family protein              297   6e-89    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004305945.1|  PREDICTED: uncharacterized protein LOC101303150    303   8e-89    
gb|KFK35980.1|  hypothetical protein AALP_AA4G062700                    296   1e-88    
ref|XP_007227115.1|  hypothetical protein PRUPE_ppa025707mg             296   1e-88    
ref|XP_006433575.1|  hypothetical protein CICLE_v10003526mg             294   1e-88    
ref|XP_006374888.1|  hypothetical protein POPTR_0014s02430g             294   1e-88    
ref|XP_006487027.1|  PREDICTED: uncharacterized protein At4g06744...    293   2e-88    
ref|XP_009592678.1|  PREDICTED: uncharacterized protein At4g06744...    293   4e-88    
gb|KDO59786.1|  hypothetical protein CISIN_1g048561mg                   291   4e-88    
ref|XP_010466072.1|  PREDICTED: uncharacterized protein At4g06744...    293   6e-88    
ref|XP_010487869.1|  PREDICTED: uncharacterized protein At4g06744...    293   8e-88    
ref|XP_008236564.1|  PREDICTED: uncharacterized protein At4g06744...    291   1e-87    
ref|XP_002518710.1|  serine-threonine protein kinase, plant-type,...    291   1e-87    Ricinus communis
gb|KDP24986.1|  hypothetical protein JCGZ_23969                         291   1e-87    
ref|XP_006307323.1|  hypothetical protein CARUB_v10008944mg             293   1e-87    
gb|KDO37099.1|  hypothetical protein CISIN_1g037101mg                   290   2e-87    
ref|XP_009784047.1|  PREDICTED: uncharacterized protein At4g06744...    291   2e-87    
emb|CDO97205.1|  unnamed protein product                                291   2e-87    
ref|XP_004304027.1|  PREDICTED: uncharacterized protein At4g06744...    290   3e-87    
ref|XP_008220262.1|  PREDICTED: uncharacterized protein At4g06744...    291   3e-87    
ref|XP_010270768.1|  PREDICTED: uncharacterized protein At4g06744...    292   4e-87    
ref|XP_011000139.1|  PREDICTED: uncharacterized protein At4g06744...    290   4e-87    
ref|XP_002300228.2|  hypothetical protein POPTR_0001s30990g             289   9e-87    Populus trichocarpa [western balsam poplar]
ref|XP_007201495.1|  hypothetical protein PRUPE_ppa014775mg             289   1e-86    
ref|XP_007160878.1|  hypothetical protein PHAVU_001G024400g             289   1e-86    
ref|XP_010932202.1|  PREDICTED: uncharacterized protein At4g06744...    290   1e-86    
ref|XP_011029410.1|  PREDICTED: uncharacterized protein At4g06744...    289   1e-86    
ref|XP_002894215.1|  hypothetical protein ARALYDRAFT_474107             290   1e-86    
ref|XP_010479447.1|  PREDICTED: leucine-rich repeat extensin-like...    291   2e-86    
ref|XP_010461823.1|  PREDICTED: uncharacterized protein At4g06744...    290   3e-86    
emb|CDP01296.1|  unnamed protein product                                286   6e-86    
gb|KHN22492.1|  Hypothetical protein glysoja_041167                     286   7e-86    
ref|XP_006422962.1|  hypothetical protein CICLE_v10028712mg             284   9e-86    
ref|XP_003545325.1|  PREDICTED: uncharacterized protein At4g06744...    286   1e-85    
ref|XP_011000899.1|  PREDICTED: uncharacterized protein At4g06744...    286   1e-85    
ref|XP_010263446.1|  PREDICTED: uncharacterized protein At4g06744...    287   2e-85    
ref|XP_010061722.1|  PREDICTED: uncharacterized protein At4g06744...    286   3e-85    
ref|XP_009417193.1|  PREDICTED: uncharacterized protein At4g06744...    285   5e-85    
ref|XP_003528523.1|  PREDICTED: uncharacterized protein At4g06744...    284   7e-85    
ref|XP_004170987.1|  PREDICTED: uncharacterized protein At4g06744...    282   7e-85    
ref|XP_010691719.1|  PREDICTED: uncharacterized protein At4g06744...    285   1e-84    
ref|XP_010500525.1|  PREDICTED: leucine-rich repeat extensin-like...    286   1e-84    
ref|XP_010927582.1|  PREDICTED: uncharacterized protein At4g06744...    285   1e-84    
gb|KGN43906.1|  hypothetical protein Csa_7G073420                       285   2e-84    
ref|XP_008798694.1|  PREDICTED: uncharacterized protein At4g06744...    284   2e-84    
ref|XP_002510174.1|  serine-threonine protein kinase, plant-type,...    283   2e-84    Ricinus communis
ref|XP_002313863.2|  hypothetical protein POPTR_0009s10140g             283   2e-84    Populus trichocarpa [western balsam poplar]
ref|XP_010270780.1|  PREDICTED: uncharacterized protein At4g06744...    285   3e-84    
dbj|BAH19934.1|  AT1G49750                                              277   4e-84    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003538630.1|  PREDICTED: uncharacterized protein At4g06744...    282   4e-84    
gb|KHN05611.1|  Hypothetical protein glysoja_047056                     281   5e-84    
ref|XP_003550327.1|  PREDICTED: uncharacterized protein At4g06744...    282   9e-84    
ref|XP_008454973.1|  PREDICTED: uncharacterized protein At4g06744...    284   9e-84    
ref|XP_004137107.1|  PREDICTED: uncharacterized protein At4g06744...    282   1e-83    
ref|XP_004291077.1|  PREDICTED: uncharacterized protein At4g06744...    281   1e-83    
ref|XP_011074595.1|  PREDICTED: uncharacterized protein At4g06744...    280   2e-83    
ref|XP_008342943.1|  PREDICTED: uncharacterized protein At4g06744...    280   2e-83    
ref|XP_010688602.1|  PREDICTED: uncharacterized protein At4g06744       281   2e-83    
ref|XP_007199295.1|  hypothetical protein PRUPE_ppa023082mg             279   2e-83    
ref|XP_007017157.1|  Leucine-rich repeat family protein                 280   2e-83    
ref|XP_008393778.1|  PREDICTED: uncharacterized protein At4g06744...    280   6e-83    
ref|XP_007157235.1|  hypothetical protein PHAVU_002G054000g             279   9e-83    
ref|XP_007042487.1|  Leucine-rich repeat family protein, putative       278   1e-82    
ref|XP_004304026.1|  PREDICTED: uncharacterized protein At4g06744...    278   2e-82    
ref|XP_009345138.1|  PREDICTED: uncharacterized protein At4g06744...    277   2e-82    
ref|XP_009395500.1|  PREDICTED: uncharacterized protein At4g06744...    277   6e-82    
ref|XP_009359966.1|  PREDICTED: uncharacterized protein At4g06744...    278   6e-82    
ref|XP_004499033.1|  PREDICTED: uncharacterized protein At4g06744...    275   7e-82    
ref|XP_008796513.1|  PREDICTED: uncharacterized protein At4g06744...    275   8e-82    
ref|XP_010928365.1|  PREDICTED: uncharacterized protein At4g06744...    277   9e-82    
gb|KHN30415.1|  Hypothetical protein glysoja_033153                     274   2e-81    
ref|XP_010094651.1|  Uncharacterized protein L484_008883                275   3e-81    
ref|XP_011069732.1|  PREDICTED: uncharacterized protein At4g06744...    274   3e-81    
ref|XP_004141388.1|  PREDICTED: uncharacterized protein At4g06744...    274   5e-81    
ref|XP_003516778.2|  PREDICTED: uncharacterized protein At4g06744...    275   6e-81    
ref|XP_008799889.1|  PREDICTED: uncharacterized protein At4g06744...    274   8e-81    
ref|XP_007157716.1|  hypothetical protein PHAVU_002G092300g             273   1e-80    
ref|XP_008456145.1|  PREDICTED: uncharacterized protein At4g06744...    273   2e-80    
ref|XP_008452581.1|  PREDICTED: uncharacterized protein At4g06744...    273   2e-80    
gb|EYU37650.1|  hypothetical protein MIMGU_mgv11b016249mg               273   2e-80    
ref|XP_004142874.1|  PREDICTED: uncharacterized protein At4g06744...    272   3e-80    
ref|XP_009605357.1|  PREDICTED: uncharacterized protein At4g06744...    270   6e-80    
ref|XP_009396708.1|  PREDICTED: uncharacterized protein At4g06744...    271   7e-80    
ref|XP_004231393.1|  PREDICTED: uncharacterized protein At4g06744       270   1e-79    
ref|XP_006653860.1|  PREDICTED: uncharacterized protein At4g06744...    271   2e-79    
ref|XP_004167460.1|  PREDICTED: uncharacterized protein At4g06744...    270   2e-79    
gb|ADN33724.1|  LRR-family protein                                      269   4e-79    
ref|XP_009413340.1|  PREDICTED: uncharacterized protein At4g06744...    270   4e-79    
ref|XP_010094650.1|  Uncharacterized protein L484_008882                268   5e-79    
ref|XP_004137106.1|  PREDICTED: uncharacterized protein At4g06744...    268   5e-79    
ref|XP_006653579.1|  PREDICTED: uncharacterized protein At4g06744...    269   7e-79    
gb|AES90113.2|  Serine/Threonine kinase, plant-type protein, puta...    269   7e-79    
ref|XP_009768848.1|  PREDICTED: uncharacterized protein At4g06744...    267   9e-79    
ref|XP_003555862.1|  PREDICTED: uncharacterized protein At4g06744...    269   9e-79    
ref|XP_008454972.1|  PREDICTED: uncharacterized protein At4g06744...    268   1e-78    
ref|XP_003589141.1|  hypothetical protein MTR_1g018910                  266   1e-78    
ref|XP_004171357.1|  PREDICTED: uncharacterized protein At4g06744...    268   2e-78    
emb|CAE02949.1|  OSJNBa0014K14.21                                       268   2e-78    
ref|XP_008444596.1|  PREDICTED: uncharacterized protein At4g06744...    270   2e-78    
ref|XP_004505255.1|  PREDICTED: uncharacterized protein At4g06744...    266   2e-78    
gb|KGN43905.1|  hypothetical protein Csa_7G073410                       268   2e-78    
ref|XP_004960235.1|  PREDICTED: uncharacterized protein At4g06744...    270   2e-78    
ref|XP_007017156.1|  LRR-family protein                                 267   4e-78    
gb|EMT03089.1|  hypothetical protein F775_11041                         267   4e-78    
ref|XP_009617390.1|  PREDICTED: uncharacterized protein At4g06744...    265   8e-78    
ref|XP_009394537.1|  PREDICTED: uncharacterized protein At4g06744...    265   1e-77    
ref|XP_010523006.1|  PREDICTED: uncharacterized protein At4g06744...    265   2e-77    
gb|KEH30896.1|  Serine/Threonine kinase, plant-type protein, puta...    264   2e-77    
ref|XP_008663372.1|  PREDICTED: uncharacterized protein At4g06744...    268   2e-77    
ref|XP_010066095.1|  PREDICTED: uncharacterized protein At4g06744...    263   2e-77    
dbj|BAJ86461.1|  predicted protein                                      265   2e-77    
gb|AEV41070.1|  uncharacterized protein At4g06744 precursor             265   3e-77    
ref|XP_010065987.1|  PREDICTED: uncharacterized protein At4g06744...    263   4e-77    
gb|ACG34018.1|  protein binding protein                                 264   4e-77    Zea mays [maize]
gb|AEV41116.1|  uncharacterized protein At4g06744 precursor             265   4e-77    
ref|NP_849339.1|  Leucine-rich repeat-containing protein                262   8e-77    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004976154.1|  PREDICTED: uncharacterized protein At4g06744...    264   9e-77    
ref|XP_002446758.1|  hypothetical protein SORBIDRAFT_06g021870          263   1e-76    Sorghum bicolor [broomcorn]
gb|AEV40972.1|  uncharacterized protein At4g06744 precursor             263   1e-76    
gb|EPS58531.1|  hypothetical protein M569_16282                         259   2e-76    
ref|XP_010455221.1|  PREDICTED: uncharacterized protein At4g06744...    261   3e-76    
ref|XP_010664552.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    262   4e-76    
ref|XP_003529407.1|  PREDICTED: uncharacterized protein At4g06744...    261   4e-76    
gb|EMT04546.1|  hypothetical protein F775_44003                         259   5e-76    
gb|KDP41694.1|  hypothetical protein JCGZ_16101                         260   9e-76    
ref|XP_004505256.1|  PREDICTED: uncharacterized protein At4g06744...    261   1e-75    
ref|XP_004140710.1|  PREDICTED: uncharacterized protein At4g06744...    260   1e-75    
ref|XP_010438766.1|  PREDICTED: uncharacterized protein At4g06744       259   1e-75    
ref|XP_003580786.1|  PREDICTED: uncharacterized protein At4g06744       260   2e-75    
gb|AEV41023.1|  uncharacterized protein At4g06744 precursor             261   2e-75    
dbj|BAJ86489.1|  predicted protein                                      260   2e-75    
ref|XP_010421726.1|  PREDICTED: uncharacterized protein At4g06744       258   2e-75    
gb|EMS59107.1|  hypothetical protein TRIUR3_04108                       259   2e-75    
ref|XP_004168435.1|  PREDICTED: uncharacterized protein At4g06744...    260   2e-75    
ref|XP_010664550.1|  PREDICTED: uncharacterized protein At4g06744...    259   3e-75    
gb|EMS61305.1|  hypothetical protein TRIUR3_11917                       258   4e-75    
gb|KHN43047.1|  Hypothetical protein glysoja_007577                     259   5e-75    
ref|XP_002284965.1|  PREDICTED: uncharacterized protein At4g06744...    258   6e-75    Vitis vinifera
ref|XP_007157715.1|  hypothetical protein PHAVU_002G092200g             258   1e-74    
gb|KFK39606.1|  hypothetical protein AALP_AA3G265800                    256   2e-74    
ref|NP_001141186.1|  leucine-rich repeat (LRR) family protein pre...    256   2e-74    Zea mays [maize]
gb|ACG42798.1|  leucine-rich repeat, plant specific                     256   4e-74    Zea mays [maize]
ref|XP_006397360.1|  hypothetical protein EUTSA_v10028721mg             254   5e-74    
ref|XP_004140807.1|  PREDICTED: uncharacterized protein LOC101203557    269   8e-74    
ref|XP_002874478.1|  leucine-rich repeat family protein                 254   9e-74    
ref|XP_009141268.1|  PREDICTED: uncharacterized protein At4g06744...    253   1e-73    
ref|XP_002447298.1|  hypothetical protein SORBIDRAFT_06g032310          254   3e-73    Sorghum bicolor [broomcorn]
ref|XP_002282474.2|  PREDICTED: uncharacterized protein At4g06744       254   4e-73    Vitis vinifera
ref|XP_006289202.1|  hypothetical protein CARUB_v10002650mg             252   5e-73    
gb|EMT08852.1|  hypothetical protein F775_11606                         255   7e-73    
ref|NP_001054210.2|  Os04g0670100                                       252   1e-72    Oryza sativa Japonica Group [Japonica rice]
gb|EAZ32358.1|  hypothetical protein OsJ_16568                          252   4e-72    Oryza sativa Japonica Group [Japonica rice]
emb|CAJ86091.1|  H0818H01.13                                            252   4e-72    Oryza sativa [red rice]
gb|AIE88270.1|  hypothetical protein OG_BBa0063K01.1                    252   4e-72    
dbj|BAJ91151.1|  predicted protein                                      253   5e-72    
ref|XP_010227187.1|  PREDICTED: probable LRR receptor-like serine...    263   2e-71    
ref|XP_008456159.1|  PREDICTED: uncharacterized protein At4g06744...    244   6e-71    
ref|XP_010554992.1|  PREDICTED: uncharacterized protein At4g06744       243   1e-69    
gb|KCW68710.1|  hypothetical protein EUGRSUZ_F02313                     241   2e-69    
gb|EYU25462.1|  hypothetical protein MIMGU_mgv1a024676mg                242   2e-69    
ref|XP_006354850.1|  PREDICTED: uncharacterized protein At4g06744...    241   3e-69    
ref|XP_004291078.1|  PREDICTED: uncharacterized protein At4g06744...    239   3e-68    
gb|EEC78222.1|  hypothetical protein OsI_17861                          231   3e-65    Oryza sativa Indica Group [Indian rice]
ref|XP_004238131.2|  PREDICTED: probable inactive receptor kinase...    239   8e-64    
ref|XP_006855188.1|  hypothetical protein AMTR_s00051p00142580          229   8e-64    
gb|KCW54907.1|  hypothetical protein EUGRSUZ_I00886                     221   2e-63    
gb|EEE61292.1|  hypothetical protein OsJ_15379                          224   3e-62    Oryza sativa Japonica Group [Japonica rice]
gb|KCW54905.1|  hypothetical protein EUGRSUZ_I00883                     223   2e-61    
ref|NP_001148637.1|  LOC100282253                                       219   3e-60    Zea mays [maize]
ref|XP_006647518.1|  PREDICTED: uncharacterized protein At4g06744...    218   4e-60    
gb|ACF84038.1|  unknown                                                 218   5e-60    Zea mays [maize]
ref|XP_004953107.1|  PREDICTED: uncharacterized protein At4g06744...    216   2e-59    
ref|XP_008677766.1|  PREDICTED: uncharacterized protein LOC100856...    217   2e-59    
gb|ACF79045.1|  unknown                                                 217   2e-59    Zea mays [maize]
ref|NP_001241706.1|  uncharacterized protein LOC100856884               217   3e-59    
ref|XP_002452450.1|  hypothetical protein SORBIDRAFT_04g026020          216   3e-59    Sorghum bicolor [broomcorn]
gb|KHN12808.1|  Hypothetical protein glysoja_008771                     208   1e-58    
ref|XP_006476103.1|  PREDICTED: leucine-rich repeat extensin-like...    220   1e-58    
emb|CDX94809.1|  BnaC03g43790D                                          216   2e-58    
ref|XP_003575361.1|  PREDICTED: uncharacterized protein At4g06744...    214   2e-58    
gb|EAY86685.1|  hypothetical protein OsI_08067                          213   3e-58    Oryza sativa Indica Group [Indian rice]
ref|XP_006300268.1|  hypothetical protein CARUB_v100163570mg            213   4e-58    
emb|CDX93014.1|  BnaA03g37360D                                          213   4e-58    
ref|NP_001150111.1|  protein binding protein precursor                  212   5e-58    Zea mays [maize]
ref|XP_009627507.1|  PREDICTED: leucine-rich repeat extensin-like...    215   1e-57    
ref|XP_011078360.1|  PREDICTED: leucine-rich repeat extensin-like...    213   1e-57    
ref|XP_010488556.1|  PREDICTED: leucine-rich repeat extensin-like...    212   1e-57    
ref|XP_009144429.1|  PREDICTED: pollen-specific leucine-rich repe...    210   2e-57    
ref|XP_006389336.1|  hypothetical protein POPTR_0028s00200g             212   3e-57    
ref|XP_002885650.1|  predicted protein                                  212   4e-57    
ref|XP_009627506.1|  PREDICTED: leucine-rich repeat extensin-like...    214   4e-57    
ref|NP_189091.1|  leucine-rich repeat extensin-like protein 4           211   5e-57    Arabidopsis thaliana [mouse-ear cress]
emb|CDY72552.1|  BnaCnng78240D                                          209   5e-57    
ref|NP_001141180.1|  uncharacterized protein LOC100273267 precursor     210   5e-57    Zea mays [maize]
emb|CDY18974.1|  BnaC01g20940D                                          208   5e-57    
gb|EPS61338.1|  hypothetical protein M569_13456                         208   6e-57    
ref|XP_006389464.1|  hypothetical protein POPTR_0024s00730g             213   9e-57    
ref|XP_003607916.1|  Receptor protein kinase                            206   3e-56    
gb|EAY86686.1|  hypothetical protein OsI_08068                          207   3e-56    Oryza sativa Indica Group [Indian rice]
emb|CDY49661.1|  BnaC09g41390D                                          206   3e-56    
ref|XP_009135898.1|  PREDICTED: leucine-rich repeat extensin-like...    214   8e-56    
ref|XP_006414930.1|  hypothetical protein EUTSA_v100275740mg            205   9e-56    
ref|XP_009760538.1|  PREDICTED: leucine-rich repeat extensin-like...    212   1e-55    
ref|XP_006285388.1|  hypothetical protein CARUB_v10006785mg             212   1e-55    
ref|XP_001759047.1|  predicted protein                                  207   1e-55    
ref|XP_007013226.1|  Leucine-rich repeat family protein                 212   1e-55    
ref|XP_010513507.1|  PREDICTED: leucine-rich repeat extensin-like...    211   1e-55    
ref|XP_006282938.1|  hypothetical protein CARUB_v100074500mg            207   2e-55    
ref|XP_002514194.1|  serine-threonine protein kinase, plant-type,...    205   2e-55    Ricinus communis
ref|XP_004173680.1|  PREDICTED: leucine-rich repeat extensin-like...    206   2e-55    
ref|XP_006414071.1|  hypothetical protein EUTSA_v10024510mg             211   2e-55    
ref|XP_003575360.1|  PREDICTED: uncharacterized protein At4g06744...    205   2e-55    
ref|XP_006371912.1|  hypothetical protein POPTR_0018s06150g             207   2e-55    
ref|XP_008344101.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    207   3e-55    
gb|KDP32304.1|  hypothetical protein JCGZ_13229                         211   3e-55    
ref|XP_010088853.1|  Leucine-rich repeat extensin-like protein 4        211   3e-55    
ref|XP_011043443.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    210   3e-55    
ref|XP_010249819.1|  PREDICTED: leucine-rich repeat extensin-like...    210   5e-55    
ref|XP_004953109.1|  PREDICTED: uncharacterized protein At4g06744...    203   1e-54    
gb|EYU25784.1|  hypothetical protein MIMGU_mgv1a026389mg                202   1e-54    
ref|XP_010434500.1|  PREDICTED: leucine-rich repeat extensin-like...    209   2e-54    
ref|XP_011019702.1|  PREDICTED: leucine-rich repeat extensin-like...    203   2e-54    
ref|XP_004139428.1|  PREDICTED: leucine-rich repeat extensin-like...    206   2e-54    
emb|CDY43618.1|  BnaC09g17570D                                          195   3e-54    
ref|XP_010434501.1|  PREDICTED: leucine-rich repeat extensin-like...    208   3e-54    
ref|XP_010449482.1|  PREDICTED: leucine-rich repeat extensin-like...    208   3e-54    
ref|NP_193070.1|  leucine-rich repeat extensin-like protein 3           208   3e-54    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011019700.1|  PREDICTED: leucine-rich repeat extensin-like...    203   3e-54    
ref|XP_002863246.1|  hypothetical protein ARALYDRAFT_497051             205   3e-54    
ref|XP_010450227.1|  PREDICTED: leucine-rich repeat extensin-like...    207   4e-54    
ref|XP_011019699.1|  PREDICTED: leucine-rich repeat extensin-like...    203   4e-54    
ref|XP_010450228.1|  PREDICTED: leucine-rich repeat extensin-like...    207   5e-54    
ref|XP_010450229.1|  PREDICTED: leucine-rich repeat extensin-like...    207   5e-54    
ref|XP_011093910.1|  PREDICTED: leucine-rich repeat extensin-like...    207   5e-54    
ref|XP_009132101.1|  PREDICTED: leucine-rich repeat extensin-like...    207   5e-54    
ref|XP_009408826.1|  PREDICTED: leucine-rich repeat extensin-like...    204   6e-54    
ref|XP_010439825.1|  PREDICTED: leucine-rich repeat extensin-like...    208   6e-54    
dbj|BAD21636.1|  leucine-rich repeat-like protein                       201   7e-54    
ref|XP_002867981.1|  hypothetical protein ARALYDRAFT_492992             207   7e-54    
ref|XP_007227690.1|  hypothetical protein PRUPE_ppa1027218m2g           201   8e-54    
ref|XP_006353562.1|  PREDICTED: leucine-rich repeat extensin-like...    206   8e-54    
ref|XP_010440602.1|  PREDICTED: leucine-rich repeat extensin-like...    206   8e-54    
ref|XP_004252054.1|  PREDICTED: leucine-rich repeat extensin-like...    206   9e-54    
ref|XP_002308630.2|  hypothetical protein POPTR_0006s26190g             202   9e-54    
emb|CDP03355.1|  unnamed protein product                                207   1e-53    
ref|XP_006366874.1|  PREDICTED: leucine-rich repeat extensin-like...    206   1e-53    
gb|KGN60627.1|  hypothetical protein Csa_2G004760                       206   1e-53    
ref|XP_008458246.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    205   1e-53    
ref|XP_009336917.1|  PREDICTED: leucine-rich repeat extensin-like...    206   1e-53    
ref|XP_010925532.1|  PREDICTED: leucine-rich repeat extensin-like...    202   2e-53    
ref|XP_010435287.1|  PREDICTED: leucine-rich repeat extensin-like...    206   2e-53    
ref|XP_010532845.1|  PREDICTED: leucine-rich repeat extensin-like...    204   3e-53    
ref|XP_009403414.1|  PREDICTED: leucine-rich repeat extensin-like...    202   3e-53    
gb|KEH27082.1|  LRR extensin-like protein                               205   4e-53    
ref|XP_003620502.1|  Extensin-like protein                              205   4e-53    
gb|KDO79655.1|  hypothetical protein CISIN_1g041736mg                   201   4e-53    
ref|XP_009381253.1|  PREDICTED: leucine-rich repeat extensin-like...    202   4e-53    
ref|XP_008242638.1|  PREDICTED: leucine-rich repeat extensin-like...    204   4e-53    
ref|XP_011078162.1|  PREDICTED: leucine-rich repeat extensin-like...    204   4e-53    
ref|XP_006476177.1|  PREDICTED: leucine-rich repeat extensin-like...    201   5e-53    
ref|XP_004512961.1|  PREDICTED: leucine-rich repeat extensin-like...    204   5e-53    
ref|XP_006450582.1|  hypothetical protein CICLE_v10010264mg             200   6e-53    
ref|XP_004157952.1|  PREDICTED: leucine-rich repeat extensin-like...    198   6e-53    
ref|XP_004141032.1|  PREDICTED: leucine-rich repeat extensin-like...    198   6e-53    
ref|XP_010527189.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    204   7e-53    
ref|XP_008219840.1|  PREDICTED: leucine-rich repeat extensin-like...    201   7e-53    
emb|CAN61023.1|  hypothetical protein VITISV_001143                     199   8e-53    
ref|XP_004287084.1|  PREDICTED: leucine-rich repeat extensin-like...    203   9e-53    
ref|XP_008776836.1|  PREDICTED: leucine-rich repeat extensin-like...    202   1e-52    
gb|KFK28537.1|  hypothetical protein AALP_AA7G009800                    203   1e-52    
ref|XP_009352479.1|  PREDICTED: leucine-rich repeat extensin-like...    200   1e-52    
gb|AGE09569.1|  LRRK-like protein                                       197   1e-52    
emb|CAB37452.1|  extensin-like protein                                  204   1e-52    
ref|XP_010047660.1|  PREDICTED: leucine-rich repeat extensin-like...    197   2e-52    
gb|ENH81556.1|  leucine-rich repeat family protein                      194   2e-52    
ref|XP_007013716.1|  Leucine-rich repeat family protein                 201   2e-52    
ref|XP_002281292.2|  PREDICTED: leucine-rich repeat extensin-like...    202   2e-52    
ref|NP_193602.4|  leucine-rich repeat extensin-like protein 5           203   2e-52    
ref|XP_010251730.1|  PREDICTED: pollen-specific leucine-rich repe...    201   3e-52    
ref|XP_008793507.1|  PREDICTED: leucine-rich repeat extensin-like...    201   3e-52    
ref|XP_007152809.1|  hypothetical protein PHAVU_004G161500g             202   3e-52    
ref|XP_004512856.1|  PREDICTED: leucine-rich repeat extensin-like...    201   3e-52    
ref|XP_011093658.1|  PREDICTED: leucine-rich repeat extensin-like...    196   3e-52    
gb|KDO74484.1|  hypothetical protein CISIN_1g045950mg                   196   4e-52    
emb|CDP07600.1|  unnamed protein product                                199   4e-52    
ref|XP_006420010.1|  hypothetical protein CICLE_v10005037mg             196   5e-52    
ref|XP_006384469.1|  hypothetical protein POPTR_0004s153601g            199   5e-52    
ref|XP_006489595.1|  PREDICTED: leucine-rich repeat extensin-like...    195   6e-52    
emb|CDP14269.1|  unnamed protein product                                201   6e-52    
ref|XP_008459038.1|  PREDICTED: leucine-rich repeat extensin-like...    195   8e-52    
ref|XP_007601154.1|  crisp-1                                            192   1e-51    
ref|XP_002982230.1|  hypothetical protein SELMODRAFT_54019              194   2e-51    
ref|XP_002888025.1|  hypothetical protein ARALYDRAFT_475099             199   2e-51    
ref|XP_007012977.1|  Leucine-rich repeat family protein / extensi...    194   2e-51    
ref|XP_006838987.1|  hypothetical protein AMTR_s00002p00271610          196   2e-51    
tpg|DAA58808.1|  TPA: leucine-rich repeat (LRR) family protein          197   3e-51    
ref|XP_008775577.1|  PREDICTED: LOW QUALITY PROTEIN: pollen-speci...    199   3e-51    
ref|XP_010431693.1|  PREDICTED: leucine-rich repeat extensin-like...    199   3e-51    
ref|XP_010251965.1|  PREDICTED: leucine-rich repeat extensin-like...    199   4e-51    
ref|XP_009608702.1|  PREDICTED: leucine-rich repeat extensin-like...    199   4e-51    
ref|XP_001767662.1|  predicted protein                                  191   4e-51    
ref|XP_010473463.1|  PREDICTED: leucine-rich repeat extensin-like...    198   4e-51    
ref|XP_010473462.1|  PREDICTED: leucine-rich repeat extensin-like...    199   5e-51    
ref|XP_008463374.1|  PREDICTED: leucine-rich repeat extensin-like...    199   5e-51    
ref|XP_008347715.1|  PREDICTED: leucine-rich repeat extensin-like...    192   5e-51    
ref|XP_009801066.1|  PREDICTED: pollen-specific leucine-rich repe...    195   5e-51    
ref|NP_176434.1|  leucine-rich repeat extensin-like protein 2           199   6e-51    
sp|O48809.1|LRX2_ARATH  RecName: Full=Leucine-rich repeat extensi...    198   6e-51    
ref|XP_009408506.1|  PREDICTED: leucine-rich repeat extensin-like...    192   7e-51    
ref|XP_006375015.1|  hypothetical protein POPTR_0014s03600g             194   9e-51    
ref|XP_009599187.1|  PREDICTED: pollen-specific leucine-rich repe...    196   9e-51    
ref|XP_010932003.1|  PREDICTED: pollen-specific leucine-rich repe...    197   9e-51    
ref|XP_002457818.1|  hypothetical protein SORBIDRAFT_03g014350          192   1e-50    
ref|XP_002308303.1|  hypothetical protein POPTR_0006s15750g             192   1e-50    
gb|EYU24926.1|  hypothetical protein MIMGU_mgv1a006719mg                192   1e-50    
ref|XP_004955608.1|  PREDICTED: leucine-rich repeat extensin-like...    192   1e-50    
ref|XP_010254179.1|  PREDICTED: leucine-rich repeat extensin-like...    197   1e-50    
ref|XP_010921838.1|  PREDICTED: pollen-specific leucine-rich repe...    193   1e-50    
ref|XP_006372265.1|  hypothetical protein POPTR_0018s14790g             192   1e-50    
gb|KFK36221.1|  hypothetical protein AALP_AA4G093700                    197   2e-50    
gb|EYU21900.1|  hypothetical protein MIMGU_mgv1a006829mg                192   2e-50    
dbj|BAF48663.1|  leucine-rich repeat/extensin                           197   2e-50    
ref|XP_008786172.1|  PREDICTED: leucine-rich repeat extensin-like...    196   2e-50    
ref|NP_001150408.1|  receptor-like protein kinase precursor             191   2e-50    
gb|ACL53978.1|  unknown                                                 191   2e-50    
gb|EEC70617.1|  hypothetical protein OsI_01869                          193   2e-50    
ref|XP_011007265.1|  PREDICTED: leucine-rich repeat extensin-like...    191   2e-50    
gb|EQB58412.1|  RAM signaling pathway protein                           188   2e-50    
gb|KHN21547.1|  Leucine-rich repeat extensin-like protein 5             195   2e-50    
ref|XP_007225572.1|  hypothetical protein PRUPE_ppa019759m1g            193   2e-50    
gb|EPS72402.1|  hypothetical protein M569_02357                         190   2e-50    
ref|XP_011005677.1|  PREDICTED: pollen-specific leucine-rich repe...    197   2e-50    
ref|XP_006394807.1|  hypothetical protein EUTSA_v10004209mg             191   3e-50    
ref|XP_011001177.1|  PREDICTED: pollen-specific leucine-rich repe...    197   3e-50    
ref|XP_008337109.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    192   3e-50    
ref|XP_009415697.1|  PREDICTED: leucine-rich repeat extensin-like...    195   3e-50    
ref|XP_001769850.1|  predicted protein                                  187   3e-50    
ref|XP_008794093.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    191   4e-50    
ref|XP_006286011.1|  hypothetical protein CARUB_v10007539mg             190   4e-50    
ref|XP_009417528.1|  PREDICTED: leucine-rich repeat extensin-like...    195   4e-50    
ref|XP_009409048.1|  PREDICTED: leucine-rich repeat extensin-like...    191   4e-50    
ref|XP_011030760.1|  PREDICTED: pollen-specific leucine-rich repe...    194   4e-50    
ref|XP_010914722.1|  PREDICTED: pollen-specific leucine-rich repe...    196   4e-50    
ref|XP_010259122.1|  PREDICTED: leucine-rich repeat extensin-like...    189   4e-50    
gb|KCW60691.1|  hypothetical protein EUGRSUZ_H03422                     187   5e-50    
ref|XP_006654107.1|  PREDICTED: leucine-rich repeat extensin-like...    188   6e-50    
ref|XP_006451344.1|  hypothetical protein CICLE_v10008452mg             189   6e-50    
ref|XP_002516600.1|  serine-threonine protein kinase, plant-type,...    192   6e-50    
ref|XP_001780811.1|  predicted protein                                  186   7e-50    
ref|XP_003524389.2|  PREDICTED: leucine-rich repeat extensin-like...    193   7e-50    
ref|XP_008357497.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    193   7e-50    
ref|XP_006379216.1|  hypothetical protein POPTR_0009s11130g             197   7e-50    
gb|EPS58069.1|  hypothetical protein M569_16746                         187   7e-50    
ref|XP_009795730.1|  PREDICTED: leucine-rich repeat extensin-like...    189   8e-50    
ref|XP_003566833.2|  PREDICTED: leucine-rich repeat extensin-like...    192   9e-50    
emb|CDY03339.1|  BnaC09g10090D                                          188   9e-50    
ref|NP_001043006.1|  Os01g0356900                                       191   9e-50    
ref|XP_009113078.1|  PREDICTED: leucine-rich repeat extensin-like...    194   9e-50    
ref|XP_010049719.1|  PREDICTED: leucine-rich repeat extensin-like...    194   9e-50    
emb|CDY12948.1|  BnaA09g13260D                                          194   9e-50    
ref|XP_010418239.1|  PREDICTED: leucine-rich repeat extensin-like...    194   1e-49    
ref|XP_004148723.1|  PREDICTED: leucine-rich repeat extensin-like...    194   1e-49    
ref|XP_010024229.1|  PREDICTED: leucine-rich repeat extensin-like...    188   1e-49    
gb|KGN65364.1|  hypothetical protein Csa_1G383520                       195   1e-49    
gb|KHM99821.1|  Leucine-rich repeat extensin-like protein 6             189   1e-49    
ref|XP_009113077.1|  PREDICTED: leucine-rich repeat extensin-like...    194   1e-49    
ref|XP_008229070.1|  PREDICTED: leucine-rich repeat extensin-like...    189   1e-49    
ref|XP_008378297.1|  PREDICTED: leucine-rich repeat extensin-like...    192   1e-49    
ref|XP_004170319.1|  PREDICTED: leucine-rich repeat extensin-like...    195   1e-49    
ref|XP_004290381.1|  PREDICTED: pollen-specific leucine-rich repe...    192   1e-49    
ref|XP_010688371.1|  PREDICTED: leucine-rich repeat extensin-like...    189   1e-49    
ref|XP_008798585.1|  PREDICTED: leucine-rich repeat extensin-like...    189   1e-49    
ref|XP_003532491.1|  PREDICTED: leucine-rich repeat extensin-like...    194   1e-49    
ref|XP_010050506.1|  PREDICTED: leucine-rich repeat extensin-like...    189   1e-49    
emb|CDY02276.1|  BnaA03g38910D                                          192   1e-49    
gb|EYU27248.1|  hypothetical protein MIMGU_mgv1a007527mg                188   1e-49    
ref|XP_003630813.1|  Extensin-like protein                              194   1e-49    
ref|NP_194567.1|  leucine-rich repeat (LRR) family protein              187   2e-49    
ref|XP_007160348.1|  hypothetical protein PHAVU_002G314200g             194   2e-49    
ref|XP_003525293.2|  PREDICTED: leucine-rich repeat extensin-like...    189   2e-49    
ref|XP_006412962.1|  hypothetical protein EUTSA_v10027136mg             187   2e-49    
ref|XP_010999749.1|  PREDICTED: pollen-specific leucine-rich repe...    196   2e-49    
gb|KDP40220.1|  hypothetical protein JCGZ_02218                         187   2e-49    
ref|XP_002867451.1|  leucine-rich repeat family protein                 187   3e-49    
ref|XP_007285579.1|  aldo/keto reductase, putative                      192   3e-49    
ref|XP_002314669.2|  hypothetical protein POPTR_0010s09310g             186   3e-49    
ref|XP_004173261.1|  PREDICTED: pollen-specific leucine-rich repe...    189   3e-49    
ref|XP_009336235.1|  PREDICTED: leucine-rich repeat extensin-like...    188   3e-49    
emb|CDY19550.1|  BnaC09g13530D                                          193   3e-49    
ref|XP_002455880.1|  hypothetical protein SORBIDRAFT_03g026730          192   3e-49    
ref|NP_001174255.1|  Os05g0188700                                       187   3e-49    
emb|CDX89681.1|  BnaC03g45950D                                          193   4e-49    
gb|KDO42769.1|  hypothetical protein CISIN_1g036320mg                   187   4e-49    
ref|XP_004503826.1|  PREDICTED: leucine-rich repeat extensin-like...    187   4e-49    
ref|XP_010433232.1|  PREDICTED: pollen-specific leucine-rich repe...    187   4e-49    
gb|KGN56949.1|  hypothetical protein Csa_3G146350                       187   4e-49    
dbj|BAF48665.1|  leucine-rich repeat/extensin 1                         192   4e-49    
ref|XP_008438627.1|  PREDICTED: leucine-rich repeat extensin-like...    186   4e-49    
ref|XP_007202178.1|  hypothetical protein PRUPE_ppa006630mg             187   4e-49    
ref|XP_004134434.1|  PREDICTED: leucine-rich repeat extensin-like...    186   4e-49    
ref|NP_194653.1|  leucine-rich repeat-containing protein                187   5e-49    
gb|EAY96831.1|  hypothetical protein OsI_18754                          187   5e-49    
ref|XP_010915366.1|  PREDICTED: leucine-rich repeat extensin-like...    187   5e-49    
ref|XP_006300291.1|  hypothetical protein CARUB_v100136950mg            186   5e-49    
ref|XP_002972291.1|  hypothetical protein SELMODRAFT_412903             186   6e-49    
ref|XP_010688564.1|  PREDICTED: leucine-rich repeat extensin-like...    191   6e-49    
ref|XP_006469927.1|  PREDICTED: pollen-specific leucine-rich repe...    187   6e-49    
ref|XP_009758506.1|  PREDICTED: leucine-rich repeat extensin-like...    192   6e-49    
ref|XP_009409368.1|  PREDICTED: leucine-rich repeat extensin-like...    187   6e-49    
gb|KDP27758.1|  hypothetical protein JCGZ_19787                         192   7e-49    
ref|XP_011019927.1|  PREDICTED: leucine-rich repeat extensin-like...    192   7e-49    
ref|XP_006447273.1|  hypothetical protein CICLE_v10018109mg             186   8e-49    
ref|XP_006289956.1|  hypothetical protein CARUB_v10003584mg             187   8e-49    
ref|XP_002984203.1|  hypothetical protein SELMODRAFT_423462             186   8e-49    
ref|XP_010533784.1|  PREDICTED: leucine-rich repeat extensin-like...    192   8e-49    
gb|KFK40601.1|  hypothetical protein AALP_AA2G016700                    192   9e-49    
ref|XP_010925512.1|  PREDICTED: leucine-rich repeat extensin-like...    186   9e-49    
ref|XP_010533785.1|  PREDICTED: leucine-rich repeat extensin-like...    192   1e-48    
gb|KCW82299.1|  hypothetical protein EUGRSUZ_C03706                     186   1e-48    
emb|CDP14813.1|  unnamed protein product                                186   1e-48    
emb|CDO99097.1|  unnamed protein product                                187   1e-48    
ref|XP_009348443.1|  PREDICTED: leucine-rich repeat extensin-like...    191   1e-48    
ref|XP_008800833.1|  PREDICTED: pollen-specific leucine-rich repe...    191   1e-48    
ref|XP_010256147.1|  PREDICTED: leucine-rich repeat extensin-like...    185   1e-48    
ref|XP_006409498.1|  hypothetical protein EUTSA_v10023190mg             188   1e-48    
ref|XP_009602497.1|  PREDICTED: leucine-rich repeat extensin-like...    186   1e-48    
ref|XP_004138582.1|  PREDICTED: pollen-specific leucine-rich repe...    190   1e-48    
ref|XP_010690992.1|  PREDICTED: pollen-specific leucine-rich repe...    190   1e-48    
ref|XP_010049599.1|  PREDICTED: leucine-rich repeat extensin-like...    187   1e-48    
ref|XP_009385615.1|  PREDICTED: leucine-rich repeat extensin-like...    190   1e-48    
ref|XP_007034837.1|  Leucine-rich repeat (LRR) family protein, pu...    185   1e-48    
ref|XP_006391867.1|  hypothetical protein EUTSA_v10023291mg             191   2e-48    
ref|XP_008371522.1|  PREDICTED: pollen-specific leucine-rich repe...    187   2e-48    
emb|CDY68356.1|  BnaA09g55960D                                          185   2e-48    
ref|XP_007042323.1|  Leucine-rich repeat family protein                 191   2e-48    
ref|XP_010447991.1|  PREDICTED: pollen-specific leucine-rich repe...    185   2e-48    
ref|XP_010438472.1|  PREDICTED: pollen-specific leucine-rich repe...    185   2e-48    
ref|NP_001043463.1|  Os01g0594300                                       189   2e-48    
gb|AGT16954.1|  hypothetical protein SHCRBa_149_L20_R_60                186   2e-48    
ref|XP_003556064.1|  PREDICTED: leucine-rich repeat extensin-like...    185   2e-48    
ref|NP_172668.1|  leucine-rich repeat extensin-like protein 1           191   2e-48    
ref|XP_008342893.1|  PREDICTED: leucine-rich repeat extensin-like...    186   2e-48    
ref|XP_007043626.1|  Leucine-rich repeat family protein                 185   2e-48    
ref|XP_002964014.1|  hypothetical protein SELMODRAFT_81544              185   2e-48    
dbj|BAO45886.1|  leucine-rich repeat extensin-like protein              186   2e-48    
emb|CDY47774.1|  BnaC07g41860D                                          185   2e-48    
ref|XP_004296668.1|  PREDICTED: leucine-rich repeat extensin-like...    184   2e-48    
ref|NP_195123.1|  pollen-specific leucine-rich repeat extensin-li...    190   3e-48    
ref|XP_010267100.1|  PREDICTED: leucine-rich repeat extensin-like...    185   3e-48    
ref|XP_006842252.1|  hypothetical protein AMTR_s00078p00197410          191   3e-48    



>ref|XP_009588943.1| PREDICTED: uncharacterized protein At4g06744-like [Nicotiana 
tomentosiformis]
Length=515

 Score =   377 bits (969),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 225/373 (60%), Positives = 275/373 (74%), Gaps = 16/373 (4%)
 Frame = -1

Query  1557  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  1378
             +RK IK I+ FKK+IT DP  +T++W GN++C   +KY GF CY      K  V  I FN
Sbjct  151   LRKVIKVIQNFKKTITSDPFGVTKTWVGNDIC---RKYVGFTCY------KNHVVAIDFN  201

Query  1377  gynfngnglslnSFVESFNDLVVIHVNSNNFTGA-PGIPVQKFPTLFELDLSNNKLAGAF  1201
             G+ FNG+ LSL  F+E    LV+IH+NSNNFTG+ P I  +  P LFELDLSNNKLAG F
Sbjct  202   GFRFNGSQLSLRKFIEEIKTLVIIHLNSNNFTGSVPEISTKTLPKLFELDLSNNKLAGPF  261

Query  1200  PTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLT  1021
             P AVL ATNLTYLD+RFN LTGPV PQVFTLDLD LFLNNN FSG +P+  G T   F+T
Sbjct  262   PKAVLGATNLTYLDVRFNQLTGPVDPQVFTLDLDVLFLNNNGFSGEIPETFGRTAALFIT  321

Query  1020  LANNQFSGPIPKTIGNA-SFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIP  844
             LANN+F+G IPK+IGNA   +LEVLFLNN+L GCLPYEIGLLK +TVFDAS+N+LTGPIP
Sbjct  322   LANNRFTGEIPKSIGNACRNILEVLFLNNQLYGCLPYEIGLLKLATVFDASVNKLTGPIP  381

Query  843   QSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLD  664
              SFGCL  +++LN++ NQLYG VPESLCKL  L++L+L  NYFTQ+GPECR L+++K+LD
Sbjct  382   HSFGCLRDMQLLNISYNQLYGPVPESLCKLSHLQKLTLKFNYFTQVGPECRKLIKEKILD  441

Query  663   IDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPCDIDE-SPRKAGphphphrpyk  487
             I  NC+LDL NQR  + C+ FFL  +KCPD +SL  VPC+IDE S R++           
Sbjct  442   ISMNCVLDLENQRKPEECEAFFLQPRKCPDMESLSKVPCNIDEFSSRQSS----GRAYRH  497

Query  486   khkRGSSTTYAAL  448
                R  STTYAA+
Sbjct  498   HRARAHSTTYAAI  510



>ref|XP_009793223.1| PREDICTED: uncharacterized protein At4g06744-like [Nicotiana 
sylvestris]
Length=511

 Score =   370 bits (951),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 227/378 (60%), Positives = 274/378 (72%), Gaps = 22/378 (6%)
 Frame = -1

Query  1569  LDPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  1390
             L   +R+ IK I+ FKK+IT DP  +T++W GN++C     Y+G+ CY      K  V  
Sbjct  147   LTAELREVIKVIQKFKKTITSDPFGVTRTWVGNDVCC----YKGYTCY------KNHVVA  196

Query  1389  iyfngynfngnglslnSFVESFNDLVVIHVNSNNFTG-APGIPVQKFPTLFELDLSNNKL  1213
             I FNG++ NGN L+LN+F+E    LVVIH+NSNNFT   P I  +  P LFE DLSNNKL
Sbjct  197   IDFNGFHLNGNQLALNNFIEKIKTLVVIHLNSNNFTSPVPEISTKTHPKLFEFDLSNNKL  256

Query  1212  AGAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPV  1033
             AG FP AVL ATNLTYLD+RFN LTGPV PQVFTLDLD LFLNNN FSG +P+  G T  
Sbjct  257   AGPFPKAVLGATNLTYLDVRFNQLTGPVDPQVFTLDLDVLFLNNNGFSGEIPETFGRTAA  316

Query  1032  FFLTLANNQFSGPIPKTIGNASF-LLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLT  856
              F+TLANN+F+G IPK+IGNA   +LEVLFLNN+LSGCLPYEIGLLK +TVFDAS+N+LT
Sbjct  317   LFITLANNRFTGQIPKSIGNACRNILEVLFLNNQLSGCLPYEIGLLKLATVFDASVNKLT  376

Query  855   GPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEK  676
             GPIP SFGCL  +E+LN++ NQLYG VPESLCKL  LE+L+L  NYFTQ+GPECR L+++
Sbjct  377   GPIPHSFGCLRDMELLNVSYNQLYGPVPESLCKLGHLEKLTLKFNYFTQVGPECRKLIKE  436

Query  675   KVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPCDIDE--SPRKAGphphp  502
             KVLDI  NCILDL NQR  + C+ FFL  +KCPD +SL  VPC+IDE  S R+       
Sbjct  437   KVLDISMNCILDLENQRKPEECESFFLQPRKCPDMESLSKVPCNIDEFSSGRRP------  490

Query  501   hrpykkhkRGSSTTYAAL  448
                     R  STTYAA+
Sbjct  491   --HRHLRARARSTTYAAI  506



>ref|XP_006360245.1| PREDICTED: uncharacterized protein At4g06744-like, partial [Solanum 
tuberosum]
Length=387

 Score =   359 bits (921),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 217/376 (58%), Positives = 264/376 (70%), Gaps = 13/376 (3%)
 Frame = -1

Query  1560  VIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyf  1381
             ++  +I  I+ F+K+IT DP  IT++WEGN++C +  KY GF C      +  +V  + F
Sbjct  17    LLASAISVIKRFRKTITSDPSGITKTWEGNDICKDPTKYIGFIC------NNNKVVAVNF  70

Query  1380  ngynfngnglslnSFVESFNDLVVIHVNSNNFTGA--PGIPVQKFPTLFELDLSNNKLAG  1207
             NG NF GN LSL  F+     L + H NSNNFTG     I  Q  P LFELDLSNNK  G
Sbjct  71    NGRNFKGNPLSLKDFINGIPTLEIFHSNSNNFTGEIPNNISTQSIPNLFELDLSNNKYVG  130

Query  1206  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFF  1027
              FP AVL AT LTYLDLRFN + GPV+PQVFTLDLD LFLNNN FSG +P+NLG T   +
Sbjct  131   FFPKAVLGATRLTYLDLRFNQIKGPVNPQVFTLDLDILFLNNNCFSGKIPENLGRTAALY  190

Query  1026  LTLANNQFSGPIPKTIGNASF-LLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGP  850
             LTLANN+F G IPK+IG+A   LLEVLF NN+L+GCLPYEIG+LK ++VFDAS N+LTGP
Sbjct  191   LTLANNKFIGEIPKSIGHAKGNLLEVLFFNNQLTGCLPYEIGMLKLASVFDASKNKLTGP  250

Query  849   IPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKV  670
             IPQSFGCLE++E+++L+ NQLYG VPE+LCK+  LEEL+L  NYFTQIGPECR L+E+ V
Sbjct  251   IPQSFGCLEQMEVMDLSYNQLYGEVPETLCKISSLEELTLKYNYFTQIGPECRKLVEENV  310

Query  669   LDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPCDI-DESPRKAGphphphrp  493
             LDI  NCI+DL NQR  + C+ FFL  + C D KSL YVPC I D S R +         
Sbjct  311   LDIGMNCIIDLKNQRKPEECETFFLQKRNCRDMKSLSYVPCKIHDFSSRNSSSGRAHTTG  370

Query  492   ykkhkRGSSTTYAALK  445
               +     STTYAALK
Sbjct  371   DART---RSTTYAALK  383



>emb|CDP02523.1| unnamed protein product [Coffea canephora]
Length=488

 Score =   357 bits (916),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 209/346 (60%), Positives = 247/346 (71%), Gaps = 4/346 (1%)
 Frame = -1

Query  1557  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  1378
             ++ +I+ I+ FK+ I YDP  IT++W G  +C +  KY+GF C      +K RV G+ FN
Sbjct  114   LKMAIQVIQRFKRRIKYDPFGITKTWTGKRICFDNSKYKGFVCDRSTKDNKFRVVGVNFN  173

Query  1377  gynfngng---lslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  1207
             GYNFNG     L    F+E   DLV+ HVNSNNFTG     + K P  FE DLSNNKL G
Sbjct  174   GYNFNGGPGCPLVATDFIEDLKDLVIFHVNSNNFTGDIPFGISKLPNFFEFDLSNNKLVG  233

Query  1206  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFF  1027
             AFP A L ATNLTYLD+RFN LTG + PQ FTLDLD LFLNNN FSG +P NLG TPV +
Sbjct  234   AFPAAALGATNLTYLDVRFNQLTGTIPPQAFTLDLDVLFLNNNAFSGKIPGNLGQTPVLY  293

Query  1026  LTLANNQFSGPIPKTIGNASF-LLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGP  850
             LT ANN+ +GPIP++IG  S  LLEVLFLNN LSGCLP EIG L  + + D SINQLTGP
Sbjct  294   LTFANNELTGPIPRSIGQTSRNLLEVLFLNNSLSGCLPCEIGFLNKTHIVDVSINQLTGP  353

Query  849   IPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKV  670
             IPQSFGCL+ ++ LNL+ NQ YG+VPESLC L DLE L L  NYFTQ+GPECR L+EKKV
Sbjct  354   IPQSFGCLKDIQQLNLSYNQFYGAVPESLCILGDLEVLDLKFNYFTQVGPECRKLIEKKV  413

Query  669   LDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPCDIDES  532
             L++  NCILDLP QRS + CK FF  +  CPD KSL YVPC I+ S
Sbjct  414   LNVTMNCILDLPCQRSPEECKAFFSKHWTCPDPKSLNYVPCGINVS  459



>gb|EYU44430.1| hypothetical protein MIMGU_mgv1a005057mg [Erythranthe guttata]
Length=498

 Score =   351 bits (900),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 201/347 (58%), Positives = 257/347 (74%), Gaps = 2/347 (1%)
 Frame = -1

Query  1569  LDPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  1390
             L P +  ++K I  F+++IT DP  +T++W+G  +C +K  Y+GF C       K RV  
Sbjct  123   LTPELLVAVKVIEKFRQTITKDPLGVTKTWKG-RICADKSAYRGFTCDTTISDGKVRVAL  181

Query  1389  iyfngynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  1210
             + FNG+NF+GN L+L +F++   DL+V HVN+NNF G     + K PTL+ELDLSNNKLA
Sbjct  182   VNFNGFNFSGNPLALTNFIDGLTDLIVFHVNTNNFAGQVPAGISKLPTLYELDLSNNKLA  241

Query  1209  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVF  1030
             G FP  VL ATNLT+LDLRFN LTG + P VFTLDLD LFLNNN F+G +P+ LG TPV 
Sbjct  242   GEFPKPVLAATNLTFLDLRFNQLTGKLPPAVFTLDLDVLFLNNNQFTGNIPETLGKTPVL  301

Query  1029  FLTLANNQFSGPIPKTIGNAS-FLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTG  853
             +LTLANN+F+G IP +IG+A+  L+E L LNN+LSGCLPYEIG LK ST+FDAS N+LTG
Sbjct  302   YLTLANNKFTGTIPHSIGDAANTLIESLLLNNQLSGCLPYEIGKLKKSTLFDASANRLTG  361

Query  852   PIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKK  673
             PIP SFGC+EKL  LN++ N L G VPESLC+L+DL+EL+L+ NYFTQ+GP CR L++  
Sbjct  362   PIPHSFGCMEKLRYLNVSYNHLSGEVPESLCRLRDLDELTLNHNYFTQVGPACRKLIKSG  421

Query  672   VLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPCDIDES  532
              LDI  NC+LDLP+QRSA  C+ FFL  Q CP+ +S+  VPC ID S
Sbjct  422   KLDIRVNCVLDLPSQRSAAECEAFFLKQQYCPNRESMNIVPCKIDYS  468



>ref|XP_004233445.1| PREDICTED: uncharacterized protein At4g06744-like [Solanum lycopersicum]
Length=464

 Score =   350 bits (897),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 212/378 (56%), Positives = 262/378 (69%), Gaps = 14/378 (4%)
 Frame = -1

Query  1566  DPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  1387
             + ++  +I  I+ FKK+IT DP  IT++W G ++C +  KY GF C      +K +V  +
Sbjct  93    NDLLTSAISVIQRFKKTITSDPSGITKTWVGKDICKDSTKYVGFIC------NKNKVVAV  146

Query  1386  yfngynfngnglslnSFVESFNDLVVIHVNSNNFTGA--PGIPVQKFPTLFELDLSNNKL  1213
              FNG NF GN LSL  F+     L + H NSNNFTG     I  Q  P LFELDLSNNK 
Sbjct  147   NFNGRNFKGNPLSLKDFINGIPTLEIFHSNSNNFTGEIPNNISTQSIPNLFELDLSNNKY  206

Query  1212  AGAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPV  1033
              G FP AVL AT LTYLDLRFN + GPV PQVFTLDLD LFLNNN FSG +P+N G T  
Sbjct  207   VGLFPRAVLGATRLTYLDLRFNQIEGPVDPQVFTLDLDILFLNNNQFSGKIPENFGRTAA  266

Query  1032  FFLTLANNQFSGPIPKTIGNASF-LLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLT  856
              +LTLANN+F G IPK+IG A   LLEVLF NN+L+GCLPYEIG+LK ++VFDAS N+LT
Sbjct  267   LYLTLANNKFIGEIPKSIGYAKGNLLEVLFFNNQLTGCLPYEIGMLKLASVFDASKNKLT  326

Query  855   GPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEK  676
             GPIPQSFGCL ++E+++L+ NQLYG VPE+LCK+  LEEL+L  NYFTQIGPECR L+E+
Sbjct  327   GPIPQSFGCLVQMEVMDLSYNQLYGEVPETLCKISSLEELTLKYNYFTQIGPECRKLVEE  386

Query  675   KVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPCDIDE-SPRKAGphphph  499
              VL+I  NCI+DL NQR  + C+ FFL  + C D KSL Y+PC + E S R +       
Sbjct  387   NVLNIGMNCIIDLENQRKPEECEAFFLQKRNCRDMKSLSYIPCKLHEFSSRNSS----AR  442

Query  498   rpykkhkRGSSTTYAALK  445
             R +    +  STTYAA+K
Sbjct  443   RAHTGDAKARSTTYAAVK  460



>ref|XP_011099103.1| PREDICTED: uncharacterized protein At4g06744-like [Sesamum indicum]
Length=487

 Score =   333 bits (854),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 196/349 (56%), Positives = 248/349 (71%), Gaps = 5/349 (1%)
 Frame = -1

Query  1557  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  1378
             ++ ++K I  F+++IT DP NIT++W G  +C +K  Y+GF C      +K  V  + FN
Sbjct  118   LQMAVKVIERFRRTITEDPFNITKTWTG-RICKDKHAYRGFACDTTIRDNKTVVAYVLFN  176

Query  1377  gynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFP  1198
             G+ F G  L L +F+    DL+V H N+N FTG     + K P+LFE DLSNN+L+G FP
Sbjct  177   GFRFKGKPLKLENFLGGLKDLIVFHANTNFFTGGVPSGISKIPSLFEFDLSNNRLSGGFP  236

Query  1197  TAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTL  1018
              AVL ATNLT+LDLRFN LTG + P+VF LDLD LFLNNN F G +P+ LG TPV +L  
Sbjct  237   RAVLAATNLTFLDLRFNQLTGKLPPEVFRLDLDVLFLNNNHFEGDIPETLGKTPVRYLIF  296

Query  1017  ANNQFSGPIPKTIGNAS-FLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQ  841
             ANN+F+G IPK+IG  S  L+EVLF NN+LSGCLP EIGLL+ +TVFDAS N LTGPIP 
Sbjct  297   ANNKFTGQIPKSIGQTSNTLVEVLFRNNQLSGCLPPEIGLLQKATVFDASANHLTGPIPH  356

Query  840   SFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDI  661
             SFGCL+ +   N++ NQLYG+VPE LC L  L EL+L  NYFTQ+GP+CR L+  K LDI
Sbjct  357   SFGCLKNMLFFNMSYNQLYGAVPEPLCNLGSLIELTLKFNYFTQVGPKCRKLIMSKKLDI  416

Query  660   DNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL-YVPCDID--ESPRK  523
               NCILDLP+QRSA  C+ FFL+ Q CPD +SL+ Y+PC ID  ESP +
Sbjct  417   SMNCILDLPSQRSAAECETFFLNQQSCPDPQSLINYMPCKIDNHESPEE  465



>gb|KDO59787.1| hypothetical protein CISIN_1g011101mg [Citrus sinensis]
Length=493

 Score =   333 bits (853),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 194/342 (57%), Positives = 237/342 (69%), Gaps = 3/342 (1%)
 Frame = -1

Query  1557  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  1378
             I+ + K I+ FKK ITYDPQ I  +W G ++C    KY+GF C V     KK V G+ FN
Sbjct  126   IQLAFKVIQRFKKRITYDPQGIANTWMGPDVC---NKYKGFVCDVRPDIKKKAVAGVDFN  182

Query  1377  gynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFP  1198
             GY FNG   SL+ F+E   DL + H NSNNFT +      K   L+ELD+SNNKL G FP
Sbjct  183   GYRFNGPDFSLSDFLEKLEDLAIFHANSNNFTKSIPKMTSKLKFLYELDVSNNKLFGGFP  242

Query  1197  TAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTL  1018
               V+   NLT+LDLRFN  +GPV  ++F LDLD LFLNNN FS  LP+N+GST   ++T 
Sbjct  243   MEVVNIKNLTFLDLRFNSFSGPVPAEIFYLDLDVLFLNNNKFSQNLPENIGSTGALYVTF  302

Query  1017  ANNQFSGPIPKTIGNASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQS  838
             ANN+F+GPIP +IG A +LLEVLFLNN  +GCLPYEIG L NSTVFD   N+LTGPIP S
Sbjct  303   ANNEFTGPIPSSIGRAKYLLEVLFLNNFFTGCLPYEIGFLSNSTVFDVGNNRLTGPIPHS  362

Query  837   FGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDID  658
             FGCL  ++ LNL  NQ YG VPE +C+L  L  LSLS NYFTQ+GPECR L+++KVLD+ 
Sbjct  363   FGCLSSMQYLNLAMNQFYGPVPEIVCQLPKLVNLSLSYNYFTQVGPECRKLIKRKVLDVR  422

Query  657   NNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPCDIDES  532
              NCILDLPNQRS + C  FF   +KCP+ +SL  VPC  + S
Sbjct  423   MNCILDLPNQRSREECGKFFSESKKCPNERSLTLVPCARNRS  464



>gb|AEI72268.1| leucine-rich repeat family protein [Citrus trifoliata]
Length=448

 Score =   331 bits (849),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 193/337 (57%), Positives = 236/337 (70%), Gaps = 3/337 (1%)
 Frame = -1

Query  1557  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  1378
             I+ + K I+ FKK ITYDPQ I ++W G ++C    KY+GF C V     KK V G+ FN
Sbjct  81    IQLAFKVIQRFKKRITYDPQGIAKTWVGPDVC---NKYKGFVCDVRPDIKKKAVAGVDFN  137

Query  1377  gynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFP  1198
             GY FNG   SL+ F+E   DL + H NSNNFT +      K   L+ELD+SNNKL G FP
Sbjct  138   GYRFNGPDFSLSDFLEKLEDLAIFHANSNNFTKSIPKMTSKLKFLYELDVSNNKLFGGFP  197

Query  1197  TAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTL  1018
               V+   NLT+LDLRFN  +GPV  ++F LDLD LFLNNN FS  LP+N+GST   ++T 
Sbjct  198   MEVVNIKNLTFLDLRFNSFSGPVPAEIFYLDLDVLFLNNNKFSQNLPENIGSTGALYVTF  257

Query  1017  ANNQFSGPIPKTIGNASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQS  838
             ANN+F+GPIP +IG A +LLEVLFLNN  +GCLPYEIG L NSTVFD   N+LTGPIP S
Sbjct  258   ANNEFTGPIPSSIGRAKYLLEVLFLNNFFTGCLPYEIGFLSNSTVFDVGNNRLTGPIPHS  317

Query  837   FGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDID  658
             FGCL  ++ LNL  NQ YG VPE +C+L  L  LSLS NYFTQ+GPECR L+++KVLD+ 
Sbjct  318   FGCLSGMQFLNLAMNQFYGPVPEIVCQLPKLVNLSLSYNYFTQVGPECRKLIKRKVLDVR  377

Query  657   NNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
              NCILDLPNQRS + C  FF   +KCP+ +SL  VPC
Sbjct  378   MNCILDLPNQRSPEECGKFFSESKKCPNERSLTLVPC  414



>ref|XP_006422961.1| hypothetical protein CICLE_v10028242mg [Citrus clementina]
 gb|ESR36201.1| hypothetical protein CICLE_v10028242mg [Citrus clementina]
Length=504

 Score =   331 bits (849),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 192/337 (57%), Positives = 235/337 (70%), Gaps = 3/337 (1%)
 Frame = -1

Query  1557  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  1378
             I+ + K I+ FKK ITYDPQ I ++W G ++C    KY+GF C V     KK V G+ FN
Sbjct  137   IQLAFKVIQRFKKRITYDPQGIAKTWVGPDVC---NKYKGFVCDVRPDIKKKAVAGVDFN  193

Query  1377  gynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFP  1198
             GY FNG   SL+ F+E   DL + H NSNNFT +      K   L+ELD+SNNKL G FP
Sbjct  194   GYRFNGPDFSLSDFLEKLEDLAIFHANSNNFTKSIPKMTSKLKYLYELDVSNNKLFGGFP  253

Query  1197  TAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTL  1018
                +   NLT+LDLRFN  +GPV  ++F LDLD LFLNNN FS  LP+N+GST   ++T 
Sbjct  254   LEAVNIKNLTFLDLRFNSFSGPVPAEIFYLDLDVLFLNNNKFSQNLPENIGSTGALYVTF  313

Query  1017  ANNQFSGPIPKTIGNASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQS  838
             ANN+F+GPIP +IG A +LLEVLFLNN  +GCLPYEIG L NSTVFD   N+LTGPIP S
Sbjct  314   ANNEFTGPIPSSIGRAKYLLEVLFLNNFFTGCLPYEIGFLSNSTVFDVGNNRLTGPIPHS  373

Query  837   FGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDID  658
             FGCL  ++ LNL  NQ YG VPE +C+L  L  LSLS NYFTQ+GPECR L+++KVLD+ 
Sbjct  374   FGCLSSMQYLNLAMNQFYGPVPEIVCQLPKLVNLSLSYNYFTQVGPECRKLIKRKVLDVR  433

Query  657   NNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
              NCILDLPNQRS + C  FF   +KCP+ +SL  VPC
Sbjct  434   MNCILDLPNQRSREECGKFFSESKKCPNERSLTLVPC  470



>gb|KDP47121.1| hypothetical protein JCGZ_22117 [Jatropha curcas]
Length=497

 Score =   328 bits (842),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 194/345 (56%), Positives = 236/345 (68%), Gaps = 7/345 (2%)
 Frame = -1

Query  1569  LDPVIRKSIKAIRTFKKSITYDPQNITQSWE--GNELCINKKKYQGFFCYVPRGGDKKRV  1396
             L P + +   AI+ F K IT DPQ I +SW+     +C   K Y+GFFC          V
Sbjct  118   LTPNLIRDYNAIQQFSKLITDDPQGIKKSWDPKNKNVC---KGYKGFFCDTRPDTSVFSV  174

Query  1395  ggiyfngynfngnglslnSFVESFNDLVVIHVNSNNFTGA--PGIPVQKFPTLFELDLSN  1222
                 FNGYNFNG  L +  F+    DL + H NSNNFTG    G+ +     L+E D+SN
Sbjct  175   AAADFNGYNFNGPKLKIEDFLGELKDLAIFHANSNNFTGKVPKGVSIDNINFLYEFDISN  234

Query  1221  NKLAGAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGS  1042
             NK +  FP+ +L+ATNLT+LD+RFN   GPV    F LDLD LFLNNN FS  LPDN+G+
Sbjct  235   NKYSDEFPSQILKATNLTFLDIRFNNFFGPVPAGAFNLDLDVLFLNNNKFSQQLPDNIGN  294

Query  1041  TPVFFLTLANNQFSGPIPKTIGNASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQ  862
             T   ++T ANN FSGPIPK+IGNA  L+EVLFLNN  +GCLPYEIG LK +TVFD S N+
Sbjct  295   TAALYVTFANNMFSGPIPKSIGNAKNLIEVLFLNNSFTGCLPYEIGNLKKATVFDVSRNK  354

Query  861   LTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLL  682
             LTGPIP SFGCL K+EILNL  N+ YG VPE +C+LK L+ LSLSGNYFTQ+GPECR L+
Sbjct  355   LTGPIPHSFGCLPKIEILNLATNEFYGPVPELVCELKTLQNLSLSGNYFTQVGPECRKLI  414

Query  681   EKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
             + K LD+  NCILDLP+QRSA  C+DFF   +KCP+ KSL  VPC
Sbjct  415   KAKRLDVRKNCILDLPDQRSAAQCRDFFSKNRKCPNEKSLTIVPC  459



>ref|XP_010555995.1| PREDICTED: uncharacterized protein At4g06744-like [Tarenaya hassleriana]
Length=481

 Score =   325 bits (832),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 182/338 (54%), Positives = 240/338 (71%), Gaps = 4/338 (1%)
 Frame = -1

Query  1557  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  1378
             IRK+I  I+ F+  I  DP++IT++W G ++C + K Y GF C +  G     V  + FN
Sbjct  110   IRKAIPVIQRFRGLIECDPKDITRTWNGTDVCADDK-YVGFDCAIYPGTKDLAVASVRFN  168

Query  1377  gynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAGAF  1201
              +NF+G  L L++F++   ++ + H NSN F G+  +P V+    LFELDLSNNKL+G F
Sbjct  169   EFNFSGKNLRLDNFLDKLEEVTIFHANSNQFVGS--VPRVENLKYLFELDLSNNKLSGEF  226

Query  1200  PTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLT  1021
             P++VL+A NLT+LDLRFN L+G V PQVF LD+D LF+NNN     LPDNLGS    +LT
Sbjct  227   PSSVLQAKNLTFLDLRFNSLSGSVPPQVFNLDVDVLFINNNNLVQRLPDNLGSITALYLT  286

Query  1020  LANNQFSGPIPKTIGNASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQ  841
              ANN+F+G IP +IGN  +L EVLFLNN L+GCLPYEIG L  +TVFD   NQLTGPIP 
Sbjct  287   FANNRFTGQIPSSIGNIKYLQEVLFLNNALTGCLPYEIGKLNQATVFDVGFNQLTGPIPY  346

Query  840   SFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDI  661
             SFGCL K+E LNL  N+ YG+VPE +C L  ++ LSLS NYFTQ+GP+CR L++K+VLD+
Sbjct  347   SFGCLGKMEQLNLARNKFYGAVPEIVCDLPRIQNLSLSYNYFTQVGPKCRELIKKRVLDV  406

Query  660   DNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
               NCILDLPNQRS   C  FF+  + CP+ +S+ ++PC
Sbjct  407   RMNCILDLPNQRSPDDCAKFFMRKESCPNPESVFWMPC  444



>ref|XP_011004883.1| PREDICTED: uncharacterized protein At4g06744-like, partial [Populus 
euphratica]
Length=394

 Score =   320 bits (820),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 192/349 (55%), Positives = 231/349 (66%), Gaps = 12/349 (3%)
 Frame = -1

Query  1557  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  1378
             I +    I+ FKK IT DP  I + W+G ++C     Y GF C          +    FN
Sbjct  24    IERDFHTIQRFKKLITIDPLGIKKKWKGTDVC----NYPGFKCATVPDQKVTALAAADFN  79

Query  1377  gynfngnglslnSFVESFNDLVVIHVNSNNFTGA--PGIPVQKFPTLFELDLSNNKLAGA  1204
             GY F G  L L  F++   DL + H NSNNFTG     I   +   LFE+DLSNNK +G 
Sbjct  80    GYFFGGRDLQLTGFLDQLPDLSIFHANSNNFTGPVPKSIGTSRVRYLFEVDLSNNKYSGG  139

Query  1203  FPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFL  1024
             FP +VL+ATNLT+LD+RFN  +G V  +VFTLDLD LF+NNN FS  LP NLGSTPV +L
Sbjct  140   FPMSVLQATNLTFLDIRFNSFSGSVPAEVFTLDLDVLFINNNKFSQQLPGNLGSTPVLYL  199

Query  1023  TLANNQFSGPIPKTIGNASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIP  844
             TLANN+FSGPIP++IGNA  LLEVLFLNN+L GCLPYEIG L  + VFD   N+LTGPIP
Sbjct  200   TLANNKFSGPIPRSIGNARNLLEVLFLNNELEGCLPYEIGKLDKTVVFDVGSNKLTGPIP  259

Query  843   QSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLD  664
              SF CLEK+EILNL  N+ YG VPE +C L  L  LSLS NYFTQ+G ECR L+ K++LD
Sbjct  260   LSFACLEKMEILNLAMNKFYGPVPEMVCDLPRLANLSLSYNYFTQVGHECRKLISKRILD  319

Query  663   IDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPCDIDESPRKAG  517
             +  NCILDLP QRSA  C  FF   + CP+ +SL Y+PC      RK G
Sbjct  320   VRMNCILDLPGQRSAADCAKFFSKQRTCPNERSLNYIPC------RKGG  362



>ref|XP_006406513.1| hypothetical protein EUTSA_v10020680mg [Eutrema salsugineum]
 gb|ESQ47966.1| hypothetical protein EUTSA_v10020680mg [Eutrema salsugineum]
Length=464

 Score =   321 bits (823),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 183/343 (53%), Positives = 235/343 (69%), Gaps = 4/343 (1%)
 Frame = -1

Query  1563  PVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiy  1384
             P+I K    I+ F+  I  DP+ I +SW G ++C + K Y G  C    G +   +  I 
Sbjct  93    PLIEKVYPVIKNFQNLIEDDPKKILKSWVGTDICADDK-YIGLECAKFPGTNNLALASIQ  151

Query  1383  fngynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAG  1207
             FN +N  G  L L++F+    ++ + H NSNNF G+  +P V     LFELDLSNNKL+G
Sbjct  152   FNQFNLGGKKLRLDNFLYKLEEVTIFHANSNNFVGS--VPKVSHLKYLFELDLSNNKLSG  209

Query  1206  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFF  1027
              FP++VL+ATNLT+LDLRFN  +G V PQVF LDLD LF+N+N     LP+NLGS    +
Sbjct  210   EFPSSVLKATNLTFLDLRFNSFSGSVPPQVFNLDLDVLFINDNNLVQRLPENLGSITALY  269

Query  1026  LTLANNQFSGPIPKTIGNASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPI  847
             LT ANN+F+GPIP +IGN   L EVLFLNNKL+GCLPY+IG L  +TVFD   NQLTGPI
Sbjct  270   LTFANNRFTGPIPGSIGNIKSLQEVLFLNNKLTGCLPYQIGKLNQATVFDVEFNQLTGPI  329

Query  846   PQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVL  667
             P SFGCLEK+E LNL  N  YG++PE +C+L  L+ +SLS NYFTQ+GP+CR L++KK+L
Sbjct  330   PYSFGCLEKMEQLNLARNNFYGTIPEMVCELSALKNVSLSFNYFTQVGPKCRKLIKKKIL  389

Query  666   DIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPCDID  538
             D+  NCILDLPNQR+   C  FF+  Q CP+ KS  Y+PC  D
Sbjct  390   DVRMNCILDLPNQRTPWECAKFFMRKQNCPNSKSFFYIPCGKD  432



>emb|CDX92324.1| BnaA05g20830D [Brassica napus]
Length=459

 Score =   319 bits (817),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 182/341 (53%), Positives = 237/341 (70%), Gaps = 4/341 (1%)
 Frame = -1

Query  1563  PVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiy  1384
             P+I K    I+ F+  +  DP+ I ++W G ++C  + KY G  C    G +   +  I 
Sbjct  88    PLIEKVYPVIKKFQNLVENDPKKILKTWVGTDICA-EDKYIGLECAKFPGTNDLALASIQ  146

Query  1383  fngynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAG  1207
             FN +NF G  L L++F+    ++ + H NSNNF GA  +P V     LFELDLSNNKL+G
Sbjct  147   FNQFNFGGKKLRLDNFLNKLEEVTIFHANSNNFVGA--VPEVSNLKYLFELDLSNNKLSG  204

Query  1206  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFF  1027
              FP++VL+ATNLT+LDLRFN  +G V PQVF LDLD LFLN+N     LP+NLGS    +
Sbjct  205   EFPSSVLKATNLTFLDLRFNSFSGSVPPQVFNLDLDVLFLNHNNLVQRLPENLGSITALY  264

Query  1026  LTLANNQFSGPIPKTIGNASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPI  847
             LT ANN+F+GPIP++IG+   L EVLFLNNKL+GCLPY+IG L  +TVFD   NQLTGPI
Sbjct  265   LTFANNRFTGPIPESIGDIKSLQEVLFLNNKLTGCLPYQIGKLNQATVFDVEFNQLTGPI  324

Query  846   PQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVL  667
             P SFGCL+K+E LNL  N+ YG++PE +C+L  L+ +SLS NYFTQ+GP+CR L++KK+L
Sbjct  325   PYSFGCLDKMEQLNLARNKFYGTIPEIVCELSALKNVSLSFNYFTQVGPKCRELIKKKIL  384

Query  666   DIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPCD  544
             D+  NCILDLP QR+   C  FF+  QKCP  KS  Y+PCD
Sbjct  385   DVRMNCILDLPYQRTPWECAKFFMRKQKCPKSKSFFYMPCD  425



>ref|XP_009145802.1| PREDICTED: uncharacterized protein At4g06744 [Brassica rapa]
Length=459

 Score =   319 bits (817),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 182/341 (53%), Positives = 237/341 (70%), Gaps = 4/341 (1%)
 Frame = -1

Query  1563  PVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiy  1384
             P+I K    I+ F+  +  DP+ I ++W G ++C  + KY G  C    G +   +  I 
Sbjct  88    PLIEKVYPVIKKFQNLVENDPKKILKTWVGTDICA-EDKYIGLECAKFPGTNDLALASIQ  146

Query  1383  fngynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAG  1207
             FN +NF G  L L++F+    ++ + H NSNNF GA  +P V     LFELDLSNNKL+G
Sbjct  147   FNQFNFGGKKLRLDNFLNKLEEVTIFHANSNNFVGA--VPEVSNLKYLFELDLSNNKLSG  204

Query  1206  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFF  1027
              FP++VL+ATNLT+LDLRFN  +G V PQVF LDLD LFLN+N     LP+NLGS    +
Sbjct  205   EFPSSVLKATNLTFLDLRFNSFSGSVPPQVFNLDLDVLFLNHNNLVQRLPENLGSITALY  264

Query  1026  LTLANNQFSGPIPKTIGNASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPI  847
             LT ANN+F+GPIP++IG+   L EVLFLNNKL+GCLPY+IG L  +TVFD   NQLTGPI
Sbjct  265   LTFANNRFTGPIPESIGDIKSLQEVLFLNNKLTGCLPYQIGKLNQATVFDVEFNQLTGPI  324

Query  846   PQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVL  667
             P SFGCL+K+E LNL  N+ YG++PE +C+L  L+ +SLS NYFTQ+GP+CR L++KK+L
Sbjct  325   PYSFGCLDKMEQLNLARNKFYGTIPEIVCELSALKNVSLSFNYFTQVGPKCRELIKKKIL  384

Query  666   DIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPCD  544
             D+  NCILDLP QR+   C  FF+  QKCP  KS  Y+PCD
Sbjct  385   DVRMNCILDLPYQRTPWECAKFFMRKQKCPKSKSFFYMPCD  425



>ref|XP_010519298.1| PREDICTED: uncharacterized protein At4g06744-like [Tarenaya hassleriana]
Length=451

 Score =   318 bits (816),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 180/342 (53%), Positives = 238/342 (70%), Gaps = 4/342 (1%)
 Frame = -1

Query  1569  LDPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  1390
             + P+I K    I+ F+K + YDP+N  ++WEG ++C  K KY G  C +  G +   V  
Sbjct  78    VSPLIEKVFPVIKRFQKLVEYDPKNKLKTWEGYDVCA-KDKYVGLECAIYPGTNYLAVAS  136

Query  1389  iyfngynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKL  1213
             + FN +N  G  L L++F++   ++ + H NSNNF G+  +P V K   L+ELD+S+NKL
Sbjct  137   VQFNEFNLAGKQLRLDNFLDKLEEVTIFHANSNNFVGS--VPRVDKLKYLYELDISSNKL  194

Query  1212  AGAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPV  1033
             +G FP++VL+A NLT+LDLRFN  +G V PQVF LDLD LF+NNN     LP+NLGS   
Sbjct  195   SGEFPSSVLQAKNLTFLDLRFNSFSGMVPPQVFNLDLDVLFINNNNLVQNLPENLGSITA  254

Query  1032  FFLTLANNQFSGPIPKTIGNASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTG  853
              +LT ANN+FSGPIP +IGN   L EVLFL+N+L+GCLPYEIG L  +TVFD   N LTG
Sbjct  255   LYLTFANNRFSGPIPSSIGNIKNLQEVLFLSNRLTGCLPYEIGKLNLATVFDVGSNLLTG  314

Query  852   PIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKK  673
             PIP SFGCL+K+E LNL  N  YG++PE++C L  ++ LSLS NYFT +GP+CR L++KK
Sbjct  315   PIPYSFGCLDKMEQLNLARNTFYGTIPETVCNLPRIQNLSLSYNYFTHVGPKCRELIKKK  374

Query  672   VLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
             VLD+  NCIL LPNQRSA  C  FF+  Q CP+ KS  ++PC
Sbjct  375   VLDVRMNCILGLPNQRSATECSKFFMRKQPCPNPKSFFWIPC  416



>ref|XP_011004900.1| PREDICTED: uncharacterized protein At4g06744-like [Populus euphratica]
Length=406

 Score =   317 bits (811),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 186/351 (53%), Positives = 233/351 (66%), Gaps = 17/351 (5%)
 Frame = -1

Query  1557  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  1378
             I +    I+ FK++I  DP  IT+ W GN++C     Y GF C    G D+K +     +
Sbjct  37    IERDYYTIQRFKETIK-DPLGITKKWVGNDVC----NYPGFKCAT--GPDQKVIALAAAD  89

Query  1377  gynfngn--glslnSFVESFNDLVVIHVNSNNFTGA--PGIPVQKFPTLFELDLSNNKLA  1210
                ++       L  F++   DL + H NSNNFTG     I   +   LFE+DLSNNK +
Sbjct  90    FNGYSFGGPDSQLTGFLDQLLDLSIFHANSNNFTGPVPKNIGTSRVRYLFEVDLSNNKYS  149

Query  1209  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVF  1030
             G FP +VL+ATNLT+LD+RFN  +G V  +VFTLDLD LF+NNN FS  LP NLGSTPV 
Sbjct  150   GGFPMSVLQATNLTFLDIRFNSFSGSVPAEVFTLDLDVLFINNNKFSQQLPGNLGSTPVL  209

Query  1029  FLTLANNQFSGPIPKTIGNASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGP  850
             +LTLANN+FSGPIP++IGNA  LLEVLFLNN+L GCLP+EIG L  + VFD   N+LTGP
Sbjct  210   YLTLANNKFSGPIPRSIGNARNLLEVLFLNNELEGCLPFEIGKLDKTVVFDVGSNKLTGP  269

Query  849   IPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKV  670
             IP SF CL+K+E LNL  N+ YG+VPE +C L  L  LSLS NYFTQ+GPECR L+ K++
Sbjct  270   IPHSFACLKKMENLNLAKNKFYGTVPEMVCDLPRLANLSLSYNYFTQVGPECRKLISKRI  329

Query  669   LDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPCDIDESPRKAG  517
             LD+  NCILDLP QRSA  C  FF   + CP+ +SL Y+PC      RK G
Sbjct  330   LDVRMNCILDLPGQRSAADCAKFFSKQRTCPNERSLSYIPC------RKGG  374



>emb|CDX99236.1| BnaC05g33510D [Brassica napus]
Length=458

 Score =   317 bits (812),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 178/341 (52%), Positives = 235/341 (69%), Gaps = 4/341 (1%)
 Frame = -1

Query  1563  PVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiy  1384
             P+I K    I+ F+  +  DP+ I ++W G ++C  + KY G  C    G +   +  I 
Sbjct  87    PLIEKVYPVIKKFQNLVENDPKKILKTWVGTDICA-EDKYIGLECAKFPGTNDLALASIQ  145

Query  1383  fngynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAG  1207
             FN +N  G  L L++F+    ++ + H NSNNF GA  +P V     LFELDLSNNKL+G
Sbjct  146   FNQFNLGGKKLRLDNFLNKLEEVTIFHANSNNFVGA--VPEVSNLKYLFELDLSNNKLSG  203

Query  1206  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFF  1027
              FP++VL+ATNLT+LDLRFN  +G V PQVF LD+D LF+N+N     LP+NLGS    +
Sbjct  204   EFPSSVLKATNLTFLDLRFNSFSGSVPPQVFNLDVDVLFINHNNLVQRLPENLGSITALY  263

Query  1026  LTLANNQFSGPIPKTIGNASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPI  847
             LT ANN+F+GPIP++IG+   L EVLFLNNKL+GCLPY+IG L  +TVFD   N LTGPI
Sbjct  264   LTFANNRFTGPIPESIGDIKSLQEVLFLNNKLTGCLPYQIGKLNQATVFDVEFNLLTGPI  323

Query  846   PQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVL  667
             P SFGCL+K+E LNL  N+ YG++PE +C+L  L+ +SLS NYFTQ+GP+CR L++KK+L
Sbjct  324   PYSFGCLDKMEQLNLARNKFYGTIPEIVCELSALKNISLSFNYFTQVGPKCRELIKKKIL  383

Query  666   DIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPCD  544
             D+  NCILDLP QR+   C  FF+  QKCP  KS  Y+PCD
Sbjct  384   DVRMNCILDLPYQRTPWECAKFFMRKQKCPKSKSFFYMPCD  424



>ref|XP_010028214.1| PREDICTED: uncharacterized protein At4g06744-like [Eucalyptus 
grandis]
Length=513

 Score =   318 bits (814),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 195/343 (57%), Positives = 240/343 (70%), Gaps = 12/343 (3%)
 Frame = -1

Query  1536  IRTFKKSITY---DPQNITQSWEGN--ELCINKKKYQGFFCYVPRGGDKKRVggiyfngy  1372
             I+ FKK I+    DP+ +T +W G   ++C     Y+GF C    G     + GI FNG+
Sbjct  146   IQDFKKLISKGNCDPKKVTATWNGTGEKIC----NYKGFTCATVPGYKMSGLAGIDFNGF  201

Query  1371  n--fngnglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFP  1198
                 +   L +++F+E   DLV  H NSNN TG     + K    +ELDLSNNKL GAFP
Sbjct  202   GFCNDKGQLPIDNFIEKLPDLVFFHTNSNNITGRIPSNLSKLKYFYELDLSNNKLRGAFP  261

Query  1197  TAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTL  1018
               VL ATNLT+LDLRFN LTGP+  QVFTLDL+ LFLNNN F+G +P+NLG TPV +LTL
Sbjct  262   LTVLGATNLTFLDLRFNNLTGPIPAQVFTLDLEVLFLNNNEFNGAIPENLGKTPVSYLTL  321

Query  1017  ANNQFSGPIPKTIGNAS-FLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQ  841
             ANN+F+GPIP++IG  S  LLEVLFLNN+LSGCLPYEIGLLK +T FDASINQLTGPIP 
Sbjct  322   ANNKFTGPIPRSIGQTSKSLLEVLFLNNQLSGCLPYEIGLLKKTTTFDASINQLTGPIPH  381

Query  840   SFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDI  661
             SFGCL+++  LNL+ N LYG VPE++C L  L  L+L+ NYFTQ+GPECR L+ KK LD+
Sbjct  382   SFGCLQQMNQLNLSCNHLYGPVPETVCVLPKLSALTLNNNYFTQVGPECRKLILKKKLDV  441

Query  660   DNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPCDIDES  532
               NCIL LP+QRS   C  FF    KCP+ KS+ YVPC I +S
Sbjct  442   RMNCILGLPSQRSPAECDAFFSKKVKCPNEKSMRYVPCKISQS  484



>ref|XP_007042489.1| Leucine-rich repeat family protein, putative [Theobroma cacao]
 gb|EOX98320.1| Leucine-rich repeat family protein, putative [Theobroma cacao]
Length=497

 Score =   317 bits (812),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 184/342 (54%), Positives = 228/342 (67%), Gaps = 7/342 (2%)
 Frame = -1

Query  1563  PVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiy  1384
             P+I K+   I+ FK  I  DP+   ++W+GN +C    KY+GF C        K V  + 
Sbjct  124   PLIAKAYPVIQNFKTQIFSDPKGYAKTWKGNNVC----KYKGFTCATRPDLKLKAVAAVD  179

Query  1383  fngynfngnglsl--nSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  1210
             FN     G+G  L  + F++  +DL + H NSNNFTG     V K   L+ELDLSNNK+ 
Sbjct  180   FNAALLAGHGSCLPLDGFIDKLDDLAIFHANSNNFTGTVPFGVSKIKYLYELDLSNNKIN  239

Query  1209  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVF  1030
             G FP  VL A+NLT+LD+RFN L G V  QVF LDLD LF+NNN     LPDNLG TPV 
Sbjct  240   GDFPMEVLGASNLTFLDIRFNSLKGEVPQQVFKLDLDVLFINNNNLEQTLPDNLGDTPVL  299

Query  1029  FLTLANNQFSGPIPKTIGNASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGP  850
             +LT ANN+F+GPIP +IG A  LLEVLFLNN+L+GCLPYEIG L  +TVFD   N+LTGP
Sbjct  300   YLTFANNKFTGPIPPSIGRARNLLEVLFLNNQLTGCLPYEIGYLSKATVFDVGSNKLTGP  359

Query  849   IPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKV  670
             IP SFGCL K+E+LNL NN+ YG+VPE +C+L  +E LSL+ NYFTQ+GP CR L+ KK 
Sbjct  360   IPNSFGCLRKIELLNLANNEFYGAVPEIVCQLPKIENLSLANNYFTQVGPACRKLIWKKK  419

Query  669   LDIDNNCILDLPNQRSAQVCKDFFLHYQ-KCPDHKSLLYVPC  547
             LD+ NNCILDLPNQ+S   C  FF      C   +S  +VPC
Sbjct  420   LDVRNNCILDLPNQKSKDECAKFFSRPPLGCERKESFKWVPC  461



>ref|XP_002282482.2| PREDICTED: uncharacterized protein At4g06744-like [Vitis vinifera]
Length=507

 Score =   317 bits (812),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 182/338 (54%), Positives = 233/338 (69%), Gaps = 5/338 (1%)
 Frame = -1

Query  1557  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  1378
             ++ ++KAIR F+  IT DP NI + W+GN  C    K++GF C      +   V G+ FN
Sbjct  147   LKIALKAIRIFQAKITVDPFNIAKGWKGNNPC----KFKGFVCSTVPDKNLNAVAGVDFN  202

Query  1377  gynfngnglslnSFVESFNDLVVIHVNSNNFTGA-PGIPVQKFPTLFELDLSNNKLAGAF  1201
             G+NF G  L+L+ F+    D+ + H NSN+F G  P I   K   L+ELDLSNNKL G F
Sbjct  203   GFNFGGPNLALDGFLNGLPDITIFHANSNDFNGRIPKIDTTKLRYLYELDLSNNKLHGEF  262

Query  1200  PTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLT  1021
             P  VL A  LT+LDLRFN  +G V P VF LD+D +F+N+N F   LP+N+G TP  +LT
Sbjct  263   PYEVLAAKQLTFLDLRFNSFSGVVPPHVFILDVDVIFINDNNFIQQLPENIGDTPALYLT  322

Query  1020  LANNQFSGPIPKTIGNASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQ  841
              ANN+F+GPIP++IG +  LLEVLFLNN+LSGCLPYEIG LK++TVFD   NQLTGPIP 
Sbjct  323   FANNKFTGPIPRSIGRSKNLLEVLFLNNQLSGCLPYEIGYLKDATVFDVGFNQLTGPIPH  382

Query  840   SFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDI  661
             SFGCL+ ++ILNL  NQ YG VPE+LC+L +L  LSLS NYFTQ+GP+CR L+ +K LD+
Sbjct  383   SFGCLDSIQILNLAANQFYGPVPETLCELPNLYNLSLSHNYFTQVGPKCRKLITEKKLDV  442

Query  660   DNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
               NCIL LP Q+    C  FF   ++CPD KS + VPC
Sbjct  443   RMNCILGLPQQKPEHACSHFFSQVRQCPDPKSFIKVPC  480



>gb|KDP47120.1| hypothetical protein JCGZ_22116 [Jatropha curcas]
Length=455

 Score =   315 bits (806),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 187/339 (55%), Positives = 229/339 (68%), Gaps = 4/339 (1%)
 Frame = -1

Query  1557  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  1378
             I +  K+I+ FK  ITYDP  +T+SW  N+   N   Y+GF C          V    FN
Sbjct  83    IVRDFKSIQQFKNQITYDPLEVTKSW--NQDNFNICTYKGFTCAHRPDSGVLSVAATDFN  140

Query  1377  gynfngnglslnSFVESFNDLVVIHVNSNNFTGA--PGIPVQKFPTLFELDLSNNKLAGA  1204
             GYNFNG  L +  F++   DL + H NSNNFTG     I +Q    L+E D+SNNK  G 
Sbjct  141   GYNFNGPNLEIKDFIDKLKDLTIFHANSNNFTGIVPNDISIQNINFLYEFDISNNKYTGG  200

Query  1203  FPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFL  1024
             FP  +L A NLT+LD+RFN  +GP+  +VF LDLDALFLNNN F+  LPDN+G+T   +L
Sbjct  201   FPFPLLSARNLTFLDIRFNQFSGPIPREVFMLDLDALFLNNNQFNQQLPDNVGNTSALYL  260

Query  1023  TLANNQFSGPIPKTIGNASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIP  844
             T ANN   GPIP +IGNA  LLEVLFL N+ +GCLPYEIG LK +TVFD S N LTGPIP
Sbjct  261   TFANNNLGGPIPSSIGNAKNLLEVLFLKNQFTGCLPYEIGNLKKATVFDVSCNMLTGPIP  320

Query  843   QSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLD  664
              SF CL K++ILNL NN  YG VPE +C+L +L+ LSLSGN+FTQ+GPECR L+  K +D
Sbjct  321   HSFACLAKIQILNLANNGFYGPVPEMVCQLPNLQNLSLSGNFFTQVGPECRKLIMLKRID  380

Query  663   IDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
             +  NCILDLP QRSA  CK+FF   + CP+ KSL YVPC
Sbjct  381   VGQNCILDLPYQRSADECKEFFSKRRTCPNEKSLTYVPC  419



>ref|NP_188563.1| leucine-rich repeat-containing protein [Arabidopsis thaliana]
 dbj|BAB02456.1| unnamed protein product [Arabidopsis thaliana]
 gb|AEE76223.1| leucine-rich repeat-containing protein [Arabidopsis thaliana]
Length=493

 Score =   316 bits (809),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 181/343 (53%), Positives = 237/343 (69%), Gaps = 4/343 (1%)
 Frame = -1

Query  1563  PVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiy  1384
             P+I+K    I+ F+  I  DP++I ++W G ++C  + KY G  C    G +   +  I 
Sbjct  122   PLIKKVYPVIKNFQTLIEDDPKSILKTWVGTDICA-QDKYIGLECAKLPGTNDLALASIQ  180

Query  1383  fngynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAG  1207
             FN +N  G  L L++F+    ++ + H NSNNF G+  +P   K   LFELDLSNNKL+G
Sbjct  181   FNNFNLGGKKLRLDNFLNKLEEVTIFHANSNNFVGS--VPNFSKLKYLFELDLSNNKLSG  238

Query  1206  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFF  1027
              FP++VL+ATNLT+LDLRFN  +G V PQVF LDLD LF+NNN     LP+NLGS    +
Sbjct  239   EFPSSVLKATNLTFLDLRFNSFSGSVPPQVFNLDLDVLFINNNNLVQRLPENLGSITALY  298

Query  1026  LTLANNQFSGPIPKTIGNASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPI  847
             LT ANN+F+GPIP +IG+   L EVLFLNNKL+GCLPY+IG L  +TVFD  +NQLTGPI
Sbjct  299   LTFANNRFTGPIPGSIGDIKSLQEVLFLNNKLTGCLPYQIGNLNRATVFDVELNQLTGPI  358

Query  846   PQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVL  667
             P SFGCL+K+E LNL  N  YG++PE +C+L  L+ LSLS NYFTQ+GP+CR L+++K+L
Sbjct  359   PYSFGCLKKMEQLNLARNNFYGTIPEIVCELSALKNLSLSYNYFTQVGPKCRTLIKRKIL  418

Query  666   DIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPCDID  538
             D+  NCILDL NQR+   C  FFL  Q CP+ KS  Y+PC  D
Sbjct  419   DVGMNCILDLTNQRTPWECAKFFLRKQSCPNFKSFFYLPCGKD  461



>ref|XP_011088225.1| PREDICTED: uncharacterized protein At4g06744-like [Sesamum indicum]
Length=460

 Score =   315 bits (806),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 196/371 (53%), Positives = 249/371 (67%), Gaps = 10/371 (3%)
 Frame = -1

Query  1539  AIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFC--YVPRGGDKKRVggiyfngynf  1366
              I+ FK+ I YDP  IT++W G ++C    KY+GF C   +P G  +K + G+ FNG+N 
Sbjct  96    VIQKFKQKIKYDPYGITKTWIGPDIC---NKYKGFICDTLIPLG--EKALAGVKFNGFNL  150

Query  1365  ngnglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVL  1186
             +G  L+L+SF++   D++V H NSNNF GA  + + K   L+ELDLSNNK +  FP  VL
Sbjct  151   DGPDLNLDSFIDELPDIMVFHANSNNFKGAFPLKISKIKYLYELDLSNNKYSCEFPYEVL  210

Query  1185  EATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTLANNQ  1006
              AT LT+LDLRFN   G + PQVF LD+D L+LNNN F+  LPDNLGSTP  +LTLA+N+
Sbjct  211   GATKLTFLDLRFNSFYGMLPPQVFMLDVDVLYLNNNNFTQKLPDNLGSTPALYLTLAHNK  270

Query  1005  FSGPIPKTIGNAS-FLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGC  829
             F+GPIPKTIG A   L EVL L+N+LSGCLP EIGLL+ +TVFDAS N LTGPIPQSF C
Sbjct  271   FTGPIPKTIGQAHKTLTEVLLLDNQLSGCLPCEIGLLEKATVFDASRNLLTGPIPQSFAC  330

Query  828   LEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNC  649
             L +++ILNL NNQLYG VPE +CKL +L  LSLS NYFT++GPECR L+ K VLD+  NC
Sbjct  331   LAQMQILNLANNQLYGPVPELVCKLANLGNLSLSYNYFTKVGPECRKLINKNVLDLTMNC  390

Query  648   ILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPCDIDESPRKAGphphphrpykkhkRGS  469
             I  LP QRS   C  FF   + CPD  S  ++PC+ +   R+               +  
Sbjct  391   IPGLPGQRSPAQCHAFFSKARSCPDEGSFSWMPCNANS--RRNSLELSDSVSTSTGSKEP  448

Query  468   STTYAALKVDR  436
             S +YAAL   R
Sbjct  449   SRSYAALHPHR  459



>ref|XP_006393218.1| hypothetical protein EUTSA_v10011424mg [Eutrema salsugineum]
 gb|ESQ30504.1| hypothetical protein EUTSA_v10011424mg [Eutrema salsugineum]
Length=496

 Score =   316 bits (809),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 175/339 (52%), Positives = 236/339 (70%), Gaps = 7/339 (2%)
 Frame = -1

Query  1560  VIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyf  1381
             ++ K+   ++ FK  +  DP+N+  SW G+++C    KY+G  C +  G     V  + F
Sbjct  126   LLEKAYPILQAFKNLVEDDPKNVLDSWNGSDIC----KYRGLECAIFPGTKDLAVASVQF  181

Query  1380  ngynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAGA  1204
             N +NF G  L L++F++    + + H NSNNF G+  +P V     LFELDLSNNKL G 
Sbjct  182   NEFNFAGKKLRLDNFLDKLETVTIFHANSNNFLGS--VPDVSNLKYLFELDLSNNKLTGD  239

Query  1203  FPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFL  1024
             FP +VL+A +LT+LDLRFN  +G V PQVF LDLD LF+NNN     LP NLGS    +L
Sbjct  240   FPASVLKAKDLTFLDLRFNTFSGSVPPQVFNLDLDVLFINNNNLVQQLPTNLGSITALYL  299

Query  1023  TLANNQFSGPIPKTIGNASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIP  844
             T ANN+F+GPIP +IGN  +L EVLFLNN+L+GCLPY+IG L  +TVFD   NQLTGPIP
Sbjct  300   TFANNRFTGPIPDSIGNIKYLQEVLFLNNQLTGCLPYQIGKLNRATVFDVGFNQLTGPIP  359

Query  843   QSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLD  664
              SFGCL+K+E LNL  N+ YG++PE +C++  L+ LSLS NYFTQ+GP+CR L+++ +LD
Sbjct  360   YSFGCLDKMEQLNLARNKFYGAIPEIVCEISCLKNLSLSYNYFTQVGPKCRQLIKRNILD  419

Query  663   IDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
             +  NCILDLPNQ+++Q C DFF+  Q CP+ KS+  +PC
Sbjct  420   VRMNCILDLPNQKTSQECADFFMRKQTCPNSKSMFRIPC  458



>ref|XP_006356575.1| PREDICTED: uncharacterized protein At4g06744-like [Solanum tuberosum]
Length=444

 Score =   313 bits (801),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 183/346 (53%), Positives = 236/346 (68%), Gaps = 5/346 (1%)
 Frame = -1

Query  1557  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  1378
             +  +   I+  K  ITYDP +IT++W G+++C    KY+GF C        K +  + FN
Sbjct  79    VEIAYHVIQKLKSKITYDPLHITKTWIGSDVC---NKYKGFRCATVPDLKVKALAAVDFN  135

Query  1377  gynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFP  1198
              Y F+G  L+++ F++   D+ + H N+NNF G     +     L+ELDLSNNK  G FP
Sbjct  136   QYQFDGPDLTIDGFLDELPDITIFHANTNNFKGTIPKKIANLRYLYELDLSNNKYNGEFP  195

Query  1197  -TAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLT  1021
                V  A  L +LDLRFN  +G V P+VF L+LD LF+NNN     LPDNLGSTPV +LT
Sbjct  196   KNIVFGAKKLYFLDLRFNSFSGLVPPEVFLLNLDVLFINNNNLIQKLPDNLGSTPVLYLT  255

Query  1020  LANNQFSGPIPKTIGNA-SFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIP  844
             LANN+F+GPIP++IG A   L EVLFLNN+L+GCLPYEIGLL  +TVFDAS NQLTG IP
Sbjct  256   LANNKFTGPIPRSIGQACKSLREVLFLNNQLTGCLPYEIGLLSKATVFDASKNQLTGKIP  315

Query  843   QSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLD  664
              SFGCL K+EILNL  NQ YG+VPE +CKL +L+ L+LS NYFT++GPEC+ L++KKVLD
Sbjct  316   HSFGCLAKMEILNLAQNQFYGAVPELVCKLCNLKNLTLSYNYFTEVGPECKKLIQKKVLD  375

Query  663   IDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPCDIDESPR  526
             +  NCI  LP QRSA+ C  FF   + CPD KS+ +VPC I  S +
Sbjct  376   VRMNCIPGLPMQRSAEECAAFFCKPRSCPDEKSMGFVPCSIGSSEQ  421



>gb|KFK39280.1| hypothetical protein AALP_AA3G224000 [Arabis alpina]
Length=480

 Score =   313 bits (803),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 181/340 (53%), Positives = 234/340 (69%), Gaps = 4/340 (1%)
 Frame = -1

Query  1563  PVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiy  1384
             P+I+K    I+ F+K I  DP+ I ++W G ++C  + KY G  C    G +   +  I 
Sbjct  109   PLIKKVYPVIKNFQKLIEDDPKKILKTWVGTDICA-EDKYIGLECAKFPGTNNLALASIQ  167

Query  1383  fngynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAG  1207
             FN +N  G  + L++F++   ++ + H NSNNF G+  +P V     LFELDLSNNKL+G
Sbjct  168   FNQFNLGGKKIRLDNFLDKLEEVTIFHANSNNFVGS--VPKVSNLKYLFELDLSNNKLSG  225

Query  1206  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFF  1027
              FP +VL+ATNLT+LDLRFN  +G V PQVF LDLDALF+NNN     LP+NLGS    +
Sbjct  226   EFPRSVLKATNLTFLDLRFNSFSGSVPPQVFNLDLDALFINNNNLVQRLPENLGSITALY  285

Query  1026  LTLANNQFSGPIPKTIGNASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPI  847
             LT ANN+F+GPIP +IGN   L EVLFLNNKL+GCLPY+IG L  +TVFD   N+LTGPI
Sbjct  286   LTFANNRFTGPIPGSIGNIKSLQEVLFLNNKLTGCLPYQIGKLNRATVFDVESNELTGPI  345

Query  846   PQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVL  667
             P SFGCLE +E LNL  N+ YG++PE +C+L  L+ LSLS NYFTQ+GP+CR L++ K+L
Sbjct  346   PYSFGCLENMEQLNLARNKFYGTIPEIVCELSALKNLSLSFNYFTQVGPKCRKLIKTKIL  405

Query  666   DIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
             D+  NCILDL NQRS   C  FFL  Q C + KS  Y+PC
Sbjct  406   DVRMNCILDLANQRSPWECAKFFLRKQNCHNFKSFFYIPC  445



>emb|CDY20865.1| BnaC05g26270D [Brassica napus]
Length=516

 Score =   313 bits (802),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 176/340 (52%), Positives = 238/340 (70%), Gaps = 6/340 (2%)
 Frame = -1

Query  1563  PVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiy  1384
             P+++K    ++ FKK +  DP+NI  SW G+++C    KY+G  C +  G   + V  + 
Sbjct  145   PLLKKVYPVLQAFKKLVEVDPKNILASWNGSDIC---GKYRGLECAIFPGTKYQAVASVQ  201

Query  1383  fngynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAG  1207
             FNG+NF+G  L L++F++    + + H NSNNF G+  +P V     LFELDLSNNKL G
Sbjct  202   FNGFNFSGKKLRLDNFLDKLETVTIFHANSNNFLGS--VPKVSNLNYLFELDLSNNKLTG  259

Query  1206  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFF  1027
              FP +VL+ATNLT+LDLRFN  +G V  QVF LDLD LF+NNN     LP NLGS    +
Sbjct  260   EFPASVLKATNLTFLDLRFNTFSGSVPRQVFNLDLDVLFINNNNLVQKLPHNLGSITALY  319

Query  1026  LTLANNQFSGPIPKTIGNASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPI  847
             LT ANN+F+GPIP +IGN  +L EVLFLNN+L+GCLPY+IG L  +TVFD   N LTGPI
Sbjct  320   LTFANNRFTGPIPASIGNIKYLQEVLFLNNQLTGCLPYQIGKLNRATVFDVGYNNLTGPI  379

Query  846   PQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVL  667
             P SFGCL+K+E LNL  N+ +G++PE +C++  L+ LSLS N+FTQ+GP+CRNL++K +L
Sbjct  380   PYSFGCLDKMEQLNLARNKFFGTIPEIVCEISSLKNLSLSYNFFTQVGPKCRNLIKKNIL  439

Query  666   DIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
             D+  NCILDLPNQ++   C +FF+    CP+ KS+  +PC
Sbjct  440   DVRMNCILDLPNQKTPLECANFFMQKHICPNSKSMFRIPC  479



>emb|CDY29337.1| BnaA05g16040D [Brassica napus]
Length=475

 Score =   311 bits (796),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 174/340 (51%), Positives = 238/340 (70%), Gaps = 6/340 (2%)
 Frame = -1

Query  1563  PVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiy  1384
             P+++K    ++ FKK +  DP+NI  SW G+++C    KY+G  C +  G   + V  + 
Sbjct  103   PLLKKVYPVLQAFKKLVEVDPKNILASWNGSDIC---GKYRGLECAMFPGTKYQAVASVQ  159

Query  1383  fngynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAG  1207
             FNG+NF+G  L L++F++  + + + H NSNNF G+  +P V     LFELDLSNNKL G
Sbjct  160   FNGFNFSGKNLRLDNFLDKLDTVTIFHANSNNFLGS--VPKVSNLKYLFELDLSNNKLTG  217

Query  1206  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFF  1027
              FP +VL+ATNLT+LDLRFN  +G V  QVF LDLD LF+NNN     LP NLGS    +
Sbjct  218   EFPASVLKATNLTFLDLRFNTFSGSVPRQVFNLDLDVLFINNNNLVQKLPHNLGSITALY  277

Query  1026  LTLANNQFSGPIPKTIGNASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPI  847
             LT ANN+F+GPIP +IGN  +L EVLFLNN+L+GCLPY+IG L  +TVFD   N LTGPI
Sbjct  278   LTFANNRFTGPIPASIGNIKYLQEVLFLNNQLTGCLPYQIGKLNRATVFDVGYNNLTGPI  337

Query  846   PQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVL  667
             P SFGCL+K+E  NL  N+ +G++PE +C++  L+ LSLS N+FTQ+GP+CRNL+++ +L
Sbjct  338   PYSFGCLDKMEQFNLARNKFFGTIPEIVCEISSLKNLSLSYNFFTQVGPKCRNLIKRNIL  397

Query  666   DIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
             D+  NCILDLPNQ++   C +FF+    CP+ KS+  +PC
Sbjct  398   DVRMNCILDLPNQKTPLECANFFMRKLTCPNSKSMFRIPC  437



>ref|XP_004248758.1| PREDICTED: uncharacterized protein At4g06744-like [Solanum lycopersicum]
Length=442

 Score =   309 bits (791),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 180/341 (53%), Positives = 231/341 (68%), Gaps = 5/341 (1%)
 Frame = -1

Query  1557  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  1378
             +  +   I+  K  IT+DP  IT++W G+++C    KY+GF C        K +  + FN
Sbjct  77    VEIAYHVIQKLKSKITHDPLGITKTWNGSDVC---NKYKGFRCATVPDLKVKALAAVDFN  133

Query  1377  gynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFP  1198
              Y F+G  L+++ F++   D+ + H N+NNF G     +     L+ELDLSNNK  G FP
Sbjct  134   QYKFDGPDLTIDGFIDELPDITIFHANTNNFKGTIPKKIANLRYLYELDLSNNKYNGEFP  193

Query  1197  T-AVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLT  1021
                V  A  L +LDLRFN  +G V PQ+F L+LD LF+NNN     LPDNLGSTPV +LT
Sbjct  194   NNIVFGAKKLYFLDLRFNSFSGLVSPQLFMLNLDVLFINNNNLIQKLPDNLGSTPVLYLT  253

Query  1020  LANNQFSGPIPKTIGNA-SFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIP  844
             LANN+F+GPIP++IG A   L EVLFLNN+L+GCLPYEIGLL  +TVFD S NQLTG IP
Sbjct  254   LANNKFTGPIPRSIGQACKSLREVLFLNNQLTGCLPYEIGLLSKATVFDVSKNQLTGKIP  313

Query  843   QSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLD  664
              SFGCL K+EILNL  NQ YG+VPE +CKL +L+ L+LS NYF ++GPEC+ L+EK+VLD
Sbjct  314   HSFGCLAKIEILNLAQNQFYGAVPELVCKLCNLKNLTLSYNYFNEVGPECKKLIEKRVLD  373

Query  663   IDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPCDI  541
             I  NCI  LP QRSA+ C  FF   + CPD KSL +VPC +
Sbjct  374   IKMNCIPGLPMQRSAEECAAFFCKPRSCPDEKSLGFVPCSV  414



>ref|XP_010263447.1| PREDICTED: uncharacterized protein At4g06744-like [Nelumbo nucifera]
Length=467

 Score =   309 bits (791),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 178/340 (52%), Positives = 224/340 (66%), Gaps = 10/340 (3%)
 Frame = -1

Query  1539  AIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfng  1360
              I  FKKSIT DP  IT +W G  +C     Y GF+C  P   +  R            G
Sbjct  100   VIHRFKKSITSDPHGITNTWVGPRIC----NYTGFYCDHPPDDNSLRALAGIDFNGYQLG  155

Query  1359  nglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEA  1180
                  + FV+   D+ + H N+NNF GA    + +   L+ELDLSNNK +G FP AVL  
Sbjct  156   APTLDD-FVDQLPDIAIFHANTNNFAGAISPKIAQLRYLYELDLSNNKFSGQFPMAVLGM  214

Query  1179  TNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTLANNQFS  1000
               L++LD+RFN  TG V  Q+FT  LD LF+NNN F   LP NLGSTPV +LT+ANN+F 
Sbjct  215   DGLSFLDIRFNSFTGTVPAQIFTQPLDVLFINNNNFMQTLPANLGSTPVRYLTIANNRFV  274

Query  999   GPIPKTIGNASF-LLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLE  823
             GPIP++IGNAS  L+EVL LNN+LSGCLPYEIGLL+++TVFDA  N LTGPIP SFGCLE
Sbjct  275   GPIPRSIGNASATLVEVLLLNNQLSGCLPYEIGLLRSATVFDAGNNLLTGPIPCSFGCLE  334

Query  822   KLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCIL  643
             K+E+LNL  NQLYG +PE++C L++L  LSLS NYFT +GP CRNL++  VL+++NNCI 
Sbjct  335   KMELLNLAGNQLYGQIPEAVCALRNLVNLSLSDNYFTSVGPTCRNLIKNGVLNVNNNCIH  394

Query  642   DLPNQRSAQVCKDFFLHYQKC--PDHKSLLYVPCDIDESP  529
              LPNQRS   C  F  H   C  P   S  ++PC++ +SP
Sbjct  395   GLPNQRSVGECSAF--HPGSCPYPPSYSFSFIPCELPQSP  432



>ref|XP_009145107.1| PREDICTED: uncharacterized protein At4g06744-like [Brassica rapa]
Length=555

 Score =   311 bits (797),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 174/340 (51%), Positives = 237/340 (70%), Gaps = 6/340 (2%)
 Frame = -1

Query  1563  PVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiy  1384
             P+++K    ++ FKK +  D +NI  SW G+++C    KY+G  C    G   + V  + 
Sbjct  183   PLLKKVYPVLQAFKKLVEVDSKNILASWNGSDIC---GKYRGLECATFPGTKYQAVASVQ  239

Query  1383  fngynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAG  1207
             FNG+NF+G  L L++F++  + + + H NSNNF G+  +P V     LFELDLSNNKL G
Sbjct  240   FNGFNFSGKNLRLDNFLDKLDTVTIFHANSNNFLGS--VPKVSNLKYLFELDLSNNKLTG  297

Query  1206  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFF  1027
              FP +VL+ATNLT+LDLRFN  +G V  QVF LDLD LF+NNN     LP NLGS    +
Sbjct  298   EFPASVLKATNLTFLDLRFNTFSGSVPRQVFNLDLDVLFINNNNLVQKLPHNLGSITALY  357

Query  1026  LTLANNQFSGPIPKTIGNASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPI  847
             LT ANN+F+GPIP +IGN  +L EVLFLNN+L+GCLPY+IG L  +TVFD   N LTGPI
Sbjct  358   LTFANNRFTGPIPASIGNIKYLQEVLFLNNQLTGCLPYQIGKLNRATVFDVEYNNLTGPI  417

Query  846   PQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVL  667
             P SFGCL+K+E LNL  N+ +G++PE +C++  L+ LSLS N+FTQ+GP+CRNL+++ +L
Sbjct  418   PYSFGCLDKMEQLNLARNKFFGTIPEIVCEISSLKNLSLSYNFFTQVGPKCRNLIKRNIL  477

Query  666   DIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
             D+  NCILDLPNQ++   C +FF+    CP+ KS+  +PC
Sbjct  478   DVRMNCILDLPNQKTPLECANFFMRKHTCPNSKSMFRIPC  517



>ref|XP_009762067.1| PREDICTED: uncharacterized protein At4g06744-like [Nicotiana 
sylvestris]
Length=462

 Score =   307 bits (787),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 187/372 (50%), Positives = 232/372 (62%), Gaps = 4/372 (1%)
 Frame = -1

Query  1557  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  1378
             I  +   I+ FK  I YDP  I  +W G ++C    KY+GF C +      + +  + FN
Sbjct  90    IEIAYNVIQKFKAKIKYDPLGIKNTWVGYDVC---NKYKGFHCAIVPDYKVQALAAVDFN  146

Query  1377  gynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFP  1198
              +NF G  L+LN F++   D+ + H NSN FTG     +     L+ELDLSNN   G FP
Sbjct  147   QFNFAGPDLTLNGFLDELPDITIFHANSNKFTGTIPKKIANLRYLYELDLSNNNYNGEFP  206

Query  1197  TAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTL  1018
               VL A NLT+LDLRFN  +G V PQVF L+LD LF+NNN     LPDNLGSTPV +LTL
Sbjct  207   NDVLGAKNLTFLDLRFNTFSGLVPPQVFMLNLDVLFINNNNLMQKLPDNLGSTPVLYLTL  266

Query  1017  ANNQFSGPIPKTIGNA-SFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQ  841
             ANN+F G IP++IG A   LLEVLFLNN+L+GCLPYEIGLL  + +FD S N+LTG IP 
Sbjct  267   ANNKFIGSIPRSIGQACKTLLEVLFLNNQLTGCLPYEIGLLTKARIFDVSKNKLTGKIPH  326

Query  840   SFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDI  661
             SFGCL  ++ILNL  NQ YG VPE +CKL +L+ LSLS NYFT++GPEC+ L+++KVLD+
Sbjct  327   SFGCLANMQILNLAQNQFYGPVPELVCKLSNLKNLSLSYNYFTEVGPECKKLIQRKVLDV  386

Query  660   DNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPCDIDESPRKAGphphphrpykkh  481
               NCI  LP QRSA  C  FF   + CPD KSL  VPC I                    
Sbjct  387   RMNCIPGLPMQRSAAECAAFFCKPRSCPDEKSLGIVPCTIGNLEHNELDSSTSSVSALND  446

Query  480   kRGSSTTYAALK  445
                +  TY ALK
Sbjct  447   PAPAPRTYGALK  458



>ref|XP_009622015.1| PREDICTED: uncharacterized protein At4g06744-like [Nicotiana 
tomentosiformis]
Length=466

 Score =   307 bits (786),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 182/340 (54%), Positives = 226/340 (66%), Gaps = 4/340 (1%)
 Frame = -1

Query  1557  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  1378
             I  +   I+ FK  I YDP  I  +W G ++C    KY+GF C +      + +  + FN
Sbjct  93    IEIAYNVIQKFKAKIKYDPLGIKNTWVGYDVC---NKYKGFHCAIVPNYKVQALAAVDFN  149

Query  1377  gynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFP  1198
              +NF G  L+LN F++   D+ + H NSN FTG     +     L+ELDLSNN   G FP
Sbjct  150   QFNFAGPDLTLNDFLDELPDITIFHANSNKFTGTIPKKIANLRYLYELDLSNNNYNGEFP  209

Query  1197  TAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTL  1018
               +L A NLT+LDLRFN  +G V PQVF L+LD LF+NNN     LPDNLGSTPV +LTL
Sbjct  210   YNILGAKNLTFLDLRFNTFSGLVPPQVFMLNLDVLFINNNNLMQKLPDNLGSTPVLYLTL  269

Query  1017  ANNQFSGPIPKTIGNA-SFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQ  841
             ANN+F G IP++IG A   LLEVLFLNN+L+GCLPYEIGLL  + +FD S N+LTG IP 
Sbjct  270   ANNKFVGSIPRSIGQACKTLLEVLFLNNQLTGCLPYEIGLLTKARIFDVSKNKLTGKIPH  329

Query  840   SFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDI  661
             SFGCL K++ILNL  NQ YG VPE +CKL +L+ LSLS NYFT++G EC+ L+E+KVLD+
Sbjct  330   SFGCLAKMQILNLAQNQFYGPVPELVCKLSNLKNLSLSYNYFTEVGSECKKLIERKVLDV  389

Query  660   DNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPCDI  541
               NCI  LP QRSA  C  FF   + CPD KSL  VPC I
Sbjct  390   RMNCIPGLPMQRSAAECAAFFCKPRSCPDEKSLEIVPCRI  429



>ref|XP_002885307.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61566.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=494

 Score =   306 bits (783),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 179/343 (52%), Positives = 231/343 (67%), Gaps = 8/343 (2%)
 Frame = -1

Query  1557  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  1378
             I+     I+ F+  I  DP+ I ++W G ++C  + KY G  C    G +   +  I FN
Sbjct  125   IKNVYSVIKNFQTLIENDPKKILRTWVGTDICA-QDKYIGLECAKFPGTNDLALASIQFN  183

Query  1377  gynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTL---FELDLSNNKLAG  1207
              +N  G  L L++F+    ++ + H NSN+F G+    V KF  L   FELDLSNNKL+G
Sbjct  184   NFNLGGKKLRLDNFLNKLEEVTIFHANSNSFVGS----VPKFSNLKYLFELDLSNNKLSG  239

Query  1206  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFF  1027
              FP++VL+ATNLT+LDLRFN  +G V PQVF LDLD LF+NNN     LP+NLGS    +
Sbjct  240   EFPSSVLKATNLTFLDLRFNSFSGSVPPQVFNLDLDVLFINNNNLVQRLPENLGSITALY  299

Query  1026  LTLANNQFSGPIPKTIGNASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPI  847
             LT ANN+F+GPIP +IG+   L EVLFLNNKL+GCLPY+IG L  +TVFD   NQLTG I
Sbjct  300   LTFANNRFTGPIPGSIGDIKSLQEVLFLNNKLTGCLPYQIGNLNRATVFDVESNQLTGLI  359

Query  846   PQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVL  667
             P SFGCL K+E LNL  N  YG++PE +C+L  L+ LSLS NYFTQ+GP+CR L+++K+L
Sbjct  360   PYSFGCLNKMEQLNLARNNFYGTIPEIVCELSALKNLSLSSNYFTQVGPKCRTLIKRKIL  419

Query  666   DIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPCDID  538
             D+  NCILDL NQR+   C  FFL  Q CP++KS  YVPC  D
Sbjct  420   DVGMNCILDLANQRAPWECAKFFLRKQSCPNYKSFFYVPCGKD  462



>ref|XP_007201703.1| hypothetical protein PRUPE_ppa004109mg [Prunus persica]
 gb|EMJ02902.1| hypothetical protein PRUPE_ppa004109mg [Prunus persica]
Length=529

 Score =   306 bits (784),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 177/340 (52%), Positives = 225/340 (66%), Gaps = 7/340 (2%)
 Frame = -1

Query  1557  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  1378
             I  +    + F+  IT DP++I +SW+G  +C    KY+G  C +     +K V G+  N
Sbjct  163   IELAYHVFQNFRPLITSDPKHIAKSWQGPHVC----KYKGVVCAMHPTYKQKAVAGLDIN  218

Query  1377  gynfngnglsl--nSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGA  1204
             G  F G+   L  + F++   DL   H NSNNFTG+    V K    +ELDLSNNKL G 
Sbjct  219   GALFGGDNAKLPLDGFLDKLEDLAFFHANSNNFTGSVPKDVSKLKFFYELDLSNNKLIGG  278

Query  1203  FPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFL  1024
             FP  VL ATNLT+LDLRFN   G V P+VF LD+D LFLNNN F+  +PDNLGS+P  + 
Sbjct  279   FPNEVLAATNLTFLDLRFNYFAGSVTPEVFKLDVDVLFLNNNNFNQKIPDNLGSSPAHYF  338

Query  1023  TLANNQFSGPIPKTIGNA-SFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPI  847
             T ANN+F+GPIP++IG A   L EVLFL NKL+GCLPYEIG L  +TVFD S N LTGPI
Sbjct  339   TFANNKFTGPIPRSIGQACKTLYEVLFLGNKLTGCLPYEIGYLNQATVFDVSSNLLTGPI  398

Query  846   PQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVL  667
             P SF CL K+E LNL +N+ YG VPE +C L +L   SL+ NYFT++GPECR L++KK+L
Sbjct  399   PHSFSCLAKIEYLNLASNRFYGPVPEQVCTLSNLGNFSLANNYFTEVGPECRKLMKKKLL  458

Query  666   DIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
             D+  NCIL  PNQ++   C  FF   +KCP+ K + YVPC
Sbjct  459   DVRQNCILGEPNQKTKAQCNAFFSKPRKCPNEKEMTYVPC  498



>ref|XP_006297641.1| hypothetical protein CARUB_v10013659mg [Capsella rubella]
 gb|EOA30539.1| hypothetical protein CARUB_v10013659mg [Capsella rubella]
Length=458

 Score =   304 bits (778),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 182/343 (53%), Positives = 237/343 (69%), Gaps = 4/343 (1%)
 Frame = -1

Query  1563  PVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiy  1384
             P+I+K    I+ F+  I  DP+ I ++W G ++C  K KY G  C    G +   +  I 
Sbjct  87    PLIKKVYPVIKNFQMLIEDDPKKILKTWVGTDICA-KDKYIGLECAKFPGTNHLALASIQ  145

Query  1383  fngynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAG  1207
             FN +N  G  L L++F+   +++ + H NSNNF G+  +P V     LFELDLSNNKL+G
Sbjct  146   FNNFNLGGKKLRLDNFLNKLDEVTIFHANSNNFVGS--VPKVSNLKYLFELDLSNNKLSG  203

Query  1206  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFF  1027
              FP++VL+ATNLT+LDLRFN  +G V PQVF LDLD LF+N+N     LP+NLGS    +
Sbjct  204   EFPSSVLKATNLTFLDLRFNSFSGSVPPQVFNLDLDVLFINDNNLVQSLPENLGSITALY  263

Query  1026  LTLANNQFSGPIPKTIGNASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPI  847
             LT ANN+F+GPIP +IG+   L EVLFLNNKL+GCLPY+IG L  +TVFD   N+LTGPI
Sbjct  264   LTFANNRFTGPIPGSIGDIKSLQEVLFLNNKLTGCLPYQIGNLNRATVFDVESNELTGPI  323

Query  846   PQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVL  667
             P SFGCL K+E LNL  N+ YG++PE LC+L  L+ LSLS NYFTQ+GP+CR L++KK+L
Sbjct  324   PYSFGCLNKMEQLNLARNKFYGTIPEILCELSSLKNLSLSSNYFTQVGPKCRTLIKKKIL  383

Query  666   DIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPCDID  538
             D+  NCILDL NQR+   C  FFL  QKCP+ K+  Y+PC  D
Sbjct  384   DVGMNCILDLANQRTPWECTKFFLRKQKCPNFKTFFYIPCGKD  426



>ref|XP_009107284.1| PREDICTED: uncharacterized protein At4g06744 [Brassica rapa]
Length=475

 Score =   304 bits (778),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 181/340 (53%), Positives = 237/340 (70%), Gaps = 4/340 (1%)
 Frame = -1

Query  1563  PVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiy  1384
             P+++K    ++ F+K +T DP +I ++WEG ++C NK KY G  C +      K +  I 
Sbjct  101   PLLKKVFPVLKAFQKLVTRDPMHILKTWEGTDIC-NKYKYLGLECAIFPNTTDKALASIQ  159

Query  1383  fngynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAG  1207
             FNG+NF G+ L L++F++  + + + H NSN+F G+  +P V     LFELDLSNNKL G
Sbjct  160   FNGFNFGGDKLVLHNFLDKLDTVTIFHANSNDFLGS--VPEVTNLKYLFELDLSNNKLTG  217

Query  1206  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFF  1027
              FP +VL+A NLT+LDLRFN  +G V PQVF LDLD LF+NNN     LP NLGS    +
Sbjct  218   DFPASVLKAKNLTFLDLRFNTFSGCVPPQVFNLDLDVLFINNNNLVQTLPSNLGSITALY  277

Query  1026  LTLANNQFSGPIPKTIGNASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPI  847
             LT ANN+F+GPIP +IGN  FL EVLFLNN L+GCLPY+IG L  +TVFD   NQLTG I
Sbjct  278   LTFANNRFTGPIPASIGNIKFLQEVLFLNNSLTGCLPYQIGKLNQATVFDVGFNQLTGLI  337

Query  846   PQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVL  667
             P SFGCL K+E LNL  N+ YG++PE +C+L  L+ LSLS NYFTQ GP+CR L+++ +L
Sbjct  338   PYSFGCLAKMEQLNLARNKFYGTIPEIVCELSSLKNLSLSYNYFTQAGPKCRELIKRNIL  397

Query  666   DIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
             D+  NCILDLPNQ++A  C  FF+  Q CPD KS+  +PC
Sbjct  398   DVRMNCILDLPNQKTASECSTFFMQRQTCPDPKSMYLIPC  437



>ref|XP_010107857.1| Uncharacterized protein L484_027444 [Morus notabilis]
 gb|EXC17257.1| Uncharacterized protein L484_027444 [Morus notabilis]
Length=420

 Score =   301 bits (770),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 166/341 (49%), Positives = 210/341 (62%), Gaps = 6/341 (2%)
 Frame = -1

Query  1536  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  1357
             I+TFK  IT DP  IT++W G++LC    KY GF+C  P   D   V             
Sbjct  60    IQTFKNIITSDPLGITKTWVGSDLC----KYAGFYCGTPPDNDTATVIASIDFNGFGLSA  115

Query  1356  glslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  1177
                   F++   DL + H NSNNFTG     +     LFELDLSNN L G FPTAVL  T
Sbjct  116   PTLDG-FLDQLPDLAIFHANSNNFTGTISPKIANLRYLFELDLSNNNLVGTFPTAVLSMT  174

Query  1176  NLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTLANNQFSG  997
             +L++LD+RFN   G V P +F   LD LFLN+N F+  LP  +GST   +LTLANN F+G
Sbjct  175   SLSFLDIRFNSFAGVVPPHIFMQTLDFLFLNDNNFAQTLPQTIGSTSAAYLTLANNMFTG  234

Query  996   PIPKTIGNA-SFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEK  820
             PIP++IGNA S L E+L LNN L+GCLPYE+GLLK + VFDA  N LTGP+P S GCL K
Sbjct  235   PIPRSIGNANSTLREILLLNNLLTGCLPYELGLLKEAVVFDAGNNLLTGPLPCSLGCLRK  294

Query  819   LEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILD  640
             +E+LN   N LYG +PE +C +  L   SL  NYFT +GPECR +++ +VLD+  NCI  
Sbjct  295   IEVLNFAGNLLYGKIPEQICAVGSLVNFSLFDNYFTSVGPECRKMIKSRVLDVRKNCIRG  354

Query  639   LPNQRSAQVCKDFFLHYQKCPDHKSLLYVPCDIDESPRKAG  517
             LP QRSA+ C  FFL  + C    S  ++PC++  S    G
Sbjct  355   LPEQRSAEECASFFLKPRSCSHPSSFTFMPCEVQPSSESDG  395



>emb|CDY16514.1| BnaA08g02530D [Brassica napus]
Length=475

 Score =   302 bits (773),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 182/340 (54%), Positives = 234/340 (69%), Gaps = 4/340 (1%)
 Frame = -1

Query  1563  PVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiy  1384
             P++ K    ++ FKK +T DP  I ++WEG ++C NK KY G  C +      K +  I 
Sbjct  101   PLLEKVFPVLKAFKKLVTRDPMLILKTWEGTDIC-NKYKYLGLECAIFPNTTDKALASIQ  159

Query  1383  fngynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAG  1207
             FNG+NF G+ L L++F++  + + + H NSN+F G+  +P V     LFELDLSNNKL G
Sbjct  160   FNGFNFGGDKLVLHNFLDKLDTVTIFHANSNDFLGS--VPEVTNLKYLFELDLSNNKLTG  217

Query  1206  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFF  1027
              FP +VL+A NLT+LDLRFN  +G V PQVF LDLD LF+NNN     LP NLGS    +
Sbjct  218   DFPASVLKAKNLTFLDLRFNTFSGCVPPQVFNLDLDVLFINNNNLVQTLPSNLGSITALY  277

Query  1026  LTLANNQFSGPIPKTIGNASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPI  847
             LT ANN+F+GPIP +IGN  FL EVLFLNN L+GCLPY+IG L  +TVFD   NQLTG I
Sbjct  278   LTFANNRFTGPIPASIGNIKFLQEVLFLNNSLTGCLPYQIGKLNRATVFDVGFNQLTGLI  337

Query  846   PQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVL  667
             P SFGCL K+E LNL  N+ YG++PE +C+L  L+ LSLS NYFTQ GP+CR L+++ +L
Sbjct  338   PYSFGCLAKMEQLNLARNKFYGTIPEIVCELSSLKNLSLSYNYFTQAGPKCRELIKRNIL  397

Query  666   DIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
             D+  NCILDLPNQ+ A  C  FF+  Q CPD KS+  +PC
Sbjct  398   DVRMNCILDLPNQKMASECSTFFMQRQTCPDPKSMYLIPC  437



>ref|XP_002518709.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
 gb|EEF43634.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
Length=510

 Score =   302 bits (774),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 179/339 (53%), Positives = 225/339 (66%), Gaps = 3/339 (1%)
 Frame = -1

Query  1557  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  1378
             I++    I+ FKK+IT+DP +IT SW+     +    Y+GF C +        V    FN
Sbjct  132   IKRDYFTIQKFKKTITHDPFHITDSWKEGVFNV-CATYKGFACDIRPDMGVLAVAAADFN  190

Query  1377  gynfngnglslnSFVESFNDLVVIHVNSNNFTGA--PGIPVQKFPTLFELDLSNNKLAGA  1204
             GYNFNG    +  F++   D+ + H NSNNFTG     I +     L+ELDLSNN   G 
Sbjct  191   GYNFNGPNFQIKGFLDKLEDVAIFHANSNNFTGIVPQNIDIMNINFLYELDLSNNNYTGG  250

Query  1203  FPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFL  1024
             FP  VL ATNLT+LD+RFN   G V  +VF LDLD LFLNNN F   LP+N+GST   +L
Sbjct  251   FPMNVLGATNLTFLDIRFNKFYGSVPKEVFNLDLDVLFLNNNQFDQQLPENIGSTSALYL  310

Query  1023  TLANNQFSGPIPKTIGNASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIP  844
             T ANN+F+G IP++IG A  LLEVLFLNN  +GCLPYEIG L  + VFD S N+LTGPIP
Sbjct  311   TFANNRFTGSIPRSIGRAKNLLEVLFLNNGFTGCLPYEIGFLTKTRVFDVSCNKLTGPIP  370

Query  843   QSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLD  664
              SFGCL  +EILNL  NQ YG VPE +CKL +L+ LSLSGNYFTQ+GPECR L+  + LD
Sbjct  371   HSFGCLSMIEILNLAKNQFYGPVPEIVCKLPNLQNLSLSGNYFTQVGPECRKLISLRRLD  430

Query  663   IDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
             + NNCIL LPNQR  + C +FF   ++C + +S+ Y+PC
Sbjct  431   VRNNCILGLPNQRPPKACTEFFSKPKQCANERSMNYIPC  469



>emb|CDY32853.1| BnaC08g02750D [Brassica napus]
Length=481

 Score =   300 bits (769),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 182/340 (54%), Positives = 233/340 (69%), Gaps = 6/340 (2%)
 Frame = -1

Query  1563  PVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiy  1384
             P++ K    ++ FKK +T+DP +I ++W G ++C    KY G  C +      K +  I 
Sbjct  109   PLLEKVFPVLQAFKKLVTHDPMHILKTWNGPDIC---NKYLGLECAIFPNTTDKALASIQ  165

Query  1383  fngynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAG  1207
             FNGYNF G  L L++F++  N + + H NSNNF G+  +P V     LFELDLS+NKL G
Sbjct  166   FNGYNFGGKKLVLHNFLDKLNTVTIFHANSNNFLGS--VPEVTNLKYLFELDLSHNKLTG  223

Query  1206  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFF  1027
              FP +VL+A NLT+LDLRFN  +G V PQVF LDLD LF+NNN     LP NLGS    +
Sbjct  224   DFPASVLKAKNLTFLDLRFNTFSGCVPPQVFNLDLDVLFINNNNLVQKLPSNLGSITALY  283

Query  1026  LTLANNQFSGPIPKTIGNASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPI  847
             LT ANN+F+GPIP +IGN  FL EVLFLNN L+GCLPY+IG L  +TVFD   NQLTG I
Sbjct  284   LTFANNRFTGPIPASIGNIKFLQEVLFLNNTLTGCLPYQIGKLNRATVFDVGFNQLTGLI  343

Query  846   PQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVL  667
             P SFGCL K+E LNL  N+ YG++PE +C+L  L+ LSLS NYFTQ GP+CR L+++ +L
Sbjct  344   PYSFGCLAKIEQLNLARNKFYGTIPEIVCELSSLKNLSLSYNYFTQAGPKCRELIKRSIL  403

Query  666   DIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
             D   NCI+ LPNQ++AQ C  FF+H Q CPD KS+  VPC
Sbjct  404   DARMNCIIGLPNQKTAQECATFFMHRQTCPDPKSMYLVPC  443



>ref|XP_008236576.1| PREDICTED: uncharacterized protein At4g06744-like [Prunus mume]
Length=481

 Score =   300 bits (769),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 174/340 (51%), Positives = 219/340 (64%), Gaps = 7/340 (2%)
 Frame = -1

Query  1557  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  1378
             I+ +    + F+  I  DP+N  +SW G ++C    KY+G  C +     ++ V G+  N
Sbjct  115   IKLAYYVFKNFRPLIKDDPKNYKKSWRGRDVC----KYKGVVCAIHPDYKQRAVAGLDIN  170

Query  1377  gynfngnglsl--nSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGA  1204
             G  F G    L  + F++   DL   H NSNNFTG     V K    +ELDLSNNKL G 
Sbjct  171   GALFGGYNAKLPLDGFLDKLEDLAFFHANSNNFTGFVPKDVYKLKFFYELDLSNNKLIGG  230

Query  1203  FPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFL  1024
             FP  VL ATNLT+LDLRFN   G V P+VF LD+D LFLNNN F+  +PDNLGS+P  + 
Sbjct  231   FPNEVLAATNLTFLDLRFNSFAGSVTPEVFKLDVDVLFLNNNNFNQKIPDNLGSSPAHYF  290

Query  1023  TLANNQFSGPIPKTIGNA-SFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPI  847
             T ANN+F+GPIP++IG A   L EVLFL N L+GCLPYEIG L  +TVFD S N LTGPI
Sbjct  291   TFANNKFTGPIPRSIGQACKTLFEVLFLGNSLTGCLPYEIGYLNQATVFDVSSNFLTGPI  350

Query  846   PQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVL  667
             P SF CL K++ LNL NN  YG VPE +C L +L    L+ NYFT++GPECR L++KKVL
Sbjct  351   PHSFSCLAKIDYLNLANNSFYGPVPEQVCTLSNLRNFYLANNYFTEVGPECRKLIKKKVL  410

Query  666   DIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
             D+  NCIL  PNQ++   C  FF   +KCP+ K + YVPC
Sbjct  411   DVRQNCILGQPNQKTKAQCTAFFSKPRKCPNEKEMTYVPC  450



>gb|KDP41695.1| hypothetical protein JCGZ_16102 [Jatropha curcas]
Length=424

 Score =   297 bits (761),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 175/331 (53%), Positives = 220/331 (66%), Gaps = 6/331 (2%)
 Frame = -1

Query  1536  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  1357
             I+ FK  IT DP  IT++W G++LC     Y+GF+C  P   +K  V     +   F   
Sbjct  82    IQKFKSIITSDPLGITKTWVGSDLC----NYKGFYCDNPPD-NKSAVAVASIDFNGFQLA  136

Query  1356  glslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  1177
               +L+ F++   D+ + H NSN F+G+    + K P L+ELD+SNN  +G FPTAVL   
Sbjct  137   APTLDGFLDQLPDIALFHANSNFFSGSISPNIAKLPYLYELDISNNLFSGLFPTAVLSMN  196

Query  1176  NLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTLANNQFSG  997
              LT+LD+RFN  +G + PQ+FT +LDALFLNNN F   LPDNLGST + +LTLANN+F G
Sbjct  197   GLTFLDIRFNFFSGSIPPQLFTKELDALFLNNNNFMTSLPDNLGSTHIIYLTLANNKFIG  256

Query  996   PIPKTIGNA-SFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEK  820
             PIP+ I  A S L EVL LNN+L+GCLPYEIGLLK +TVFDA  NQLTGP+P S  CLE 
Sbjct  257   PIPRNIFKAFSSLSEVLLLNNQLTGCLPYEIGLLKEATVFDAGNNQLTGPLPLSLACLEN  316

Query  819   LEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILD  640
             +E LN   N L+G VPE +C+L+ L  LSLS NYF  +GP CR L+EK V+DI NNCI D
Sbjct  317   VEQLNFAGNMLFGMVPELVCELQSLVNLSLSDNYFITVGPLCRILIEKGVVDIRNNCIPD  376

Query  639   LPNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
             LP QRS + C DFF H + CP   S  Y PC
Sbjct  377   LPFQRSVEECADFFAHPKFCPRMWSYTYSPC  407



>ref|XP_006346520.1| PREDICTED: uncharacterized protein At4g06744-like [Solanum tuberosum]
Length=397

 Score =   296 bits (759),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 162/339 (48%), Positives = 222/339 (65%), Gaps = 6/339 (2%)
 Frame = -1

Query  1536  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  1357
             I+ FK +IT DP  +T++W G ++C     Y+GF+C  P   +   +     +   F  +
Sbjct  43    IQNFKNTITLDPFGVTKTWTGPDIC----NYKGFYCDNPPN-NSSAISLASIDFNGFQLS  97

Query  1356  glslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  1177
               +L+ F++   DL + H N+NNF+G     +   P L+ELDLSNN+  G FP ++L   
Sbjct  98    APTLDGFIDQLPDLAIFHANTNNFSGIISSKISNLPYLYELDLSNNQFIGTFPMSILNIK  157

Query  1176  NLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTLANNQFSG  997
              LT+LD+R+N+LTG + PQ+F   LDA FLNNN F   LPDN+GSTP ++LTLANN+F G
Sbjct  158   TLTFLDIRYNLLTGIIPPQIFVQYLDAFFLNNNNFIQKLPDNIGSTPAYYLTLANNKFVG  217

Query  996   PIPKTIGNASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKL  817
             PIP++IG A  LLE+LFLNN L+GC+PYE+GLLK + V D   N LTGP+P+S GCLE +
Sbjct  218   PIPRSIGQAPNLLEILFLNNLLTGCIPYELGLLKKAIVIDVGFNTLTGPLPRSLGCLESV  277

Query  816   EILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDL  637
             E LN   N LYG VPE +C LK+L   +LS NYFT++GP CR L++  VL+++ NCI  L
Sbjct  278   EQLNFAGNLLYGQVPEVICSLKNLVNFTLSYNYFTKVGPLCRELIDNGVLNVEKNCINGL  337

Query  636   PNQRSAQVCKDFFLHYQKCPDHKSLLYVPCDIDE-SPRK  523
             PNQRS   C  F +  + CP  KSL  +PC+I   SP +
Sbjct  338   PNQRSILECVLFRMQIKLCPLQKSLRIIPCNISNFSPHR  376



>ref|XP_010507626.1| PREDICTED: uncharacterized protein At4g06744-like [Camelina sativa]
Length=458

 Score =   298 bits (762),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 180/342 (53%), Positives = 236/342 (69%), Gaps = 4/342 (1%)
 Frame = -1

Query  1560  VIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyf  1381
             +I+K    I+ F+K I  DP+ I ++W G ++C  + KY G  C    G +   +G I F
Sbjct  88    LIKKVFPVIKNFQKLIEDDPKKILKTWVGTDICA-QDKYIGLECAKFPGTNDDALGSIQF  146

Query  1380  ngynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAGA  1204
             N +NF G  L L++F++   ++ + H NSNNF G+  +P V     LFELDLSNNKL+G 
Sbjct  147   NNFNFRGKKLRLDNFLDKLEEVTIFHANSNNFLGS--VPKVSNLKYLFELDLSNNKLSGE  204

Query  1203  FPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFL  1024
             FP++VL+ATNLT+LDLRFN  +G V PQVF LDLD LF+N+N  +  LP+NLGS    +L
Sbjct  205   FPSSVLKATNLTFLDLRFNSFSGSVPPQVFYLDLDVLFINDNNLAQRLPENLGSITALYL  264

Query  1023  TLANNQFSGPIPKTIGNASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIP  844
             T ANN+FSGPIP +IG    L EVLFLNNKL+GCLPY+IG L  +TVFD   N+LTGPIP
Sbjct  265   TFANNRFSGPIPGSIGGIKSLQEVLFLNNKLTGCLPYQIGNLNRATVFDVESNELTGPIP  324

Query  843   QSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLD  664
              SFGCL K+E L L  N+ YG++PE LC+L  L+ LSLS NYFTQ+GP+CR L+++K+LD
Sbjct  325   YSFGCLNKMEQLILARNKFYGTIPEILCELSSLKNLSLSSNYFTQVGPKCRTLIKRKILD  384

Query  663   IDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPCDID  538
             +  NCI DL NQR+   C  FF+  Q CP+ KS  Y+PC  D
Sbjct  385   VGRNCIQDLANQRTWWECARFFMRRQNCPNSKSFFYIPCGKD  426



>gb|KDP24991.1| hypothetical protein JCGZ_23974 [Jatropha curcas]
Length=413

 Score =   296 bits (757),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 176/336 (52%), Positives = 224/336 (67%), Gaps = 7/336 (2%)
 Frame = -1

Query  1536  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  1357
             I+TFKK+IT DP NITQ+W G ++C     Y+GF C  P   +         +   F  +
Sbjct  60    IQTFKKAITSDPLNITQTWVGPDIC----NYKGFSCDHPPD-NISATPLAAIDFNGFRLS  114

Query  1356  glslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  1177
               SL+ F++   DL + H NSNNF+G     +   P L+ELDLSNN   G FP A+L  T
Sbjct  115   APSLDGFIDQLPDLAIFHANSNNFSGTISPKLADLPFLYELDLSNNFFFGNFPMAILSIT  174

Query  1176  NLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTLANNQFSG  997
              L++LD+RFN  TG V PQ+FT  LD LFLNNN F   LP+ LG+TPV +LTLANN+F+G
Sbjct  175   GLSFLDIRFNFFTGSVPPQIFTQRLDVLFLNNNNFMLKLPETLGATPVLYLTLANNKFTG  234

Query  996   PIPKTIGN-ASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEK  820
             PIP++I N +S L EVL LNN L+GC+PYE+G LK   +FDAS N LTGP+P S GCL K
Sbjct  235   PIPRSILNVSSTLTEVLLLNNLLTGCIPYELGFLKELVLFDASNNLLTGPLPCSLGCLTK  294

Query  819   LEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILD  640
             +E LNLT N LYG VPE +C L++L  LSLS NYFT++GP C  L++  VLDI  NCIL 
Sbjct  295   IEQLNLTGNLLYGQVPEVVCALENLANLSLSNNYFTKLGPLCWKLVKSGVLDIRQNCILG  354

Query  639   LPNQRSAQVCKDFFLHYQKCPDHKSLL-YVPCDIDE  535
             LPNQRS   C  FFLH + CP H +LL ++PC + +
Sbjct  355   LPNQRSFHECFIFFLHPRYCPYHPTLLNFIPCKVHQ  390



>ref|XP_006472980.1| PREDICTED: uncharacterized protein At4g06744-like [Citrus sinensis]
Length=429

 Score =   296 bits (757),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 170/332 (51%), Positives = 217/332 (65%), Gaps = 6/332 (2%)
 Frame = -1

Query  1539  AIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfng  1360
              I+ FK  IT DP  IT++W G+++C     Y+GF+C  P   +K  +     +   F  
Sbjct  91    VIQEFKSIITSDPLGITKTWVGSDIC----DYKGFYCESPPD-NKTAIAVASIDFNGFQL  145

Query  1359  nglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEA  1180
             +  +L+ F++   D+ + H NSNNF G     + K P L+ELD+SNNK +G FP AVL  
Sbjct  146   SAPTLDGFLDQLPDIALFHANSNNFAGTISSNIAKLPYLYELDISNNKFSGPFPAAVLGM  205

Query  1179  TNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTLANNQFS  1000
              NL +LD+RFN  TG V PQ+FT +LD LF+NNN F   LPDN+GST + FLTLANN+F 
Sbjct  206   NNLEFLDIRFNYFTGSVPPQIFTQNLDFLFINNNGFMIKLPDNIGSTHILFLTLANNKFI  265

Query  999   GPIPKTIGNA-SFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLE  823
             GP+P++I  A S L EVL +NN+L+GCLPYEIG LK + VFD   NQLTG +P S  CLE
Sbjct  266   GPLPRSIFKAFSELTEVLLVNNQLTGCLPYEIGYLKEAVVFDVGDNQLTGQLPFSLACLE  325

Query  822   KLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCIL  643
             K+E LN  NN L+G VPE++C L +L   SLS NYFT  GP CR L+EK VLD+ NNCI 
Sbjct  326   KVEQLNFANNLLFGMVPEAVCGLPNLLHFSLSDNYFTHAGPLCRFLIEKGVLDVRNNCIP  385

Query  642   DLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
             DLP QRS   C DFF H + CP   S  Y+PC
Sbjct  386   DLPFQRSVSECADFFAHPRFCPHMWSYTYIPC  417



>ref|XP_008236575.1| PREDICTED: uncharacterized protein At4g06744-like [Prunus mume]
Length=423

 Score =   295 bits (756),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 164/333 (49%), Positives = 221/333 (66%), Gaps = 6/333 (2%)
 Frame = -1

Query  1536  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  1357
             I  FK +IT DP  ITQ+W G+++C     Y+GF+C +P   +K  V     +   F  +
Sbjct  76    INAFKNTITSDPLGITQTWVGSDIC----TYKGFYCDIPPD-NKSAVALASIDFNGFQLS  130

Query  1356  glslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  1177
               S++ F++   DL + H NSNNF+G     +     L+ELD+SNN   G FPTAVL   
Sbjct  131   APSIDGFIDQLPDLALFHANSNNFSGIISPKIANLKYLYELDISNNNFFGTFPTAVLTMN  190

Query  1176  NLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTLANNQFSG  997
             +L++LD+RFN  TG V PQ+F   LD LF+NNN F+  LPDNLG+TP  +LTLANN+F+G
Sbjct  191   SLSFLDIRFNSFTGSVPPQIFKKSLDVLFINNNKFTLKLPDNLGATPARYLTLANNKFTG  250

Query  996   PIPKTIGNAS-FLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEK  820
             PIPK+IG+AS  L+E L +NN ++GC+PYE+G LK++T+FDA  NQLTGP+P S GCLEK
Sbjct  251   PIPKSIGSASSTLIEALLMNNLITGCIPYELGFLKDATLFDAGNNQLTGPLPCSLGCLEK  310

Query  819   LEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILD  640
             +E LN   N LYG VPE +C+L +L  LSLS NYFT +GP CR L++  VLD+  NCI D
Sbjct  311   IEQLNFAGNLLYGKVPEVVCELGNLANLSLSNNYFTMVGPICRKLIKSGVLDLRKNCIRD  370

Query  639   LPNQRSAQVCKDFFLHYQKCPDHKSLLYVPCDI  541
             L +QRS + C  F  H + C   +S   +PC +
Sbjct  371   LADQRSVEECASFSSHPRSCLHPESFSVMPCKV  403



>ref|NP_175397.1| leucine-rich repeat (LRR) family protein [Arabidopsis thaliana]
 gb|AAG13059.1|AC011807_18 Unknown protein [Arabidopsis thaliana]
 gb|AAS47632.1| At1g49750 [Arabidopsis thaliana]
 gb|AAS76756.1| At1g49750 [Arabidopsis thaliana]
 dbj|BAH19559.1| AT1G49750 [Arabidopsis thaliana]
 gb|AEE32471.1| leucine-rich repeat (LRR) family protein [Arabidopsis thaliana]
Length=494

 Score =   297 bits (760),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 172/343 (50%), Positives = 227/343 (66%), Gaps = 12/343 (3%)
 Frame = -1

Query  1560  VIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYV---PRGGDKKRVgg  1390
             +++K    ++ FK  +  D     +SWEG ++C    KY G  C +    +      V  
Sbjct  123   LLKKVYPVLQRFKDLVADDK---LKSWEGPDIC---NKYLGLKCAIFPKTKHLALASVQF  176

Query  1389  iyfngynfngnglslnSFVESFNDLVVIHVNSNNFTGA-PGIPVQKFPTLFELDLSNNKL  1213
                N     G  L L++F++   ++ + H NSN FTG+ P     KF  L+ELDLSNNKL
Sbjct  177   NGLNLRGKIGKILKLDNFLDKLEEVTIFHANSNGFTGSVPDFSNLKF--LYELDLSNNKL  234

Query  1212  AGAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPV  1033
              G FPT+VL+  NLT+LDLRFN  +G V PQVF LDLD LF+NNN     LP NLGS   
Sbjct  235   TGDFPTSVLKGNNLTFLDLRFNSFSGSVPPQVFNLDLDVLFINNNNLVQKLPLNLGSITA  294

Query  1032  FFLTLANNQFSGPIPKTIGNASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTG  853
              +LT ANN+F+GPIP++IGN  +L EVLFLNNKL+GCLPY+IG L  +TVFD   NQLTG
Sbjct  295   LYLTFANNRFTGPIPESIGNIKYLQEVLFLNNKLTGCLPYQIGNLTRATVFDVGFNQLTG  354

Query  852   PIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKK  673
             PIP SFGCLE +E LNL  N+ YG++PE +C++  L+ +SLS NYFTQ+GP+CR L+++K
Sbjct  355   PIPYSFGCLETMEQLNLAGNKFYGTIPEIVCEIACLQNVSLSNNYFTQVGPKCRKLIKRK  414

Query  672   VLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPCD  544
             ++D+  NCILDLPNQ++   C  FF+  Q CP+ KSL  VPCD
Sbjct  415   IMDVSMNCILDLPNQKTPSECAKFFMRKQTCPNSKSLFTVPCD  457



>ref|XP_004305945.1| PREDICTED: uncharacterized protein LOC101303150 [Fragaria vesca 
subsp. vesca]
Length=738

 Score =   303 bits (777),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 178/342 (52%), Positives = 218/342 (64%), Gaps = 12/342 (4%)
 Frame = -1

Query  1548  SIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngyn  1369
             +++ I+ F+K I  DP NIT +W G+  C    K+ GF C V    ++  V G+ FNG  
Sbjct  369   ALRVIKRFQKLIGVDPDNITGTWNGDNPC----KFTGFICGVVPVYNQNAVAGVNFNGRK  424

Query  1368  fngnglslnS------FVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  1207
               G      +      F++   DLV  H NSNNFTG   I   + P  +ELDLSNNKL G
Sbjct  425   LAGKWGGKETKLPLDGFLDQLPDLVFFHANSNNFTGQVPIGTSRLPYFYELDLSNNKLDG  484

Query  1206  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalf-lnnnfFSGPLPDNLGSTPVF  1030
              FP  VL A NLT+LDLRFN   G V  QVF      +  LNNN F+  +PD +GS+   
Sbjct  485   GFPYEVLSAPNLTFLDLRFNNYQGSVPSQVFLYKDIDVVFLNNNNFNEKIPDAIGSSTAH  544

Query  1029  FLTLANNQFSGPIPKTIGNAS-FLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTG  853
             +LT ANN+F GPIP+TIG AS  L EVLFLNN+LSGCLP EIG L  +T+FD S NQLTG
Sbjct  545   YLTFANNKFWGPIPRTIGKASKTLFEVLFLNNRLSGCLPMEIGKLNQATLFDVSYNQLTG  604

Query  852   PIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKK  673
             PIPQSF CL K+EIL L NNQ YG+VPE +CKL  L  LSL+ NYFTQ+GP CR L++K 
Sbjct  605   PIPQSFACLTKMEILVLDNNQFYGAVPELVCKLPSLMNLSLANNYFTQVGPACRKLIKKG  664

Query  672   VLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
              L +DNNCILDL  QR    C  FF   + CP+ +SLLY+PC
Sbjct  665   FLHVDNNCILDLKYQRPKSECASFFSKPRYCPNERSLLYIPC  706



>gb|KFK35980.1| hypothetical protein AALP_AA4G062700 [Arabis alpina]
Length=490

 Score =   296 bits (758),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 169/339 (50%), Positives = 233/339 (69%), Gaps = 7/339 (2%)
 Frame = -1

Query  1560  VIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyf  1381
             ++ K+   ++ FK ++  +P+ +  SW+G ++C    KY+G  C +  G ++  V    F
Sbjct  122   LVAKAYPVLQRFK-NLVEEPKGVFDSWKGGDIC---NKYRGLECAILPGKNQTAVVSYQF  177

Query  1380  ngynfngnglslnSFVESFNDLVVIHVNSNNFTGA-PGIPVQKFPTLFELDLSNNKLAGA  1204
             NG N +G  L L++F++   ++ + H NSNNF G+ P +   K+  L+ELDLSNNKL G 
Sbjct  178   NGLNLSGKNLRLDNFIDKLPEISIFHANSNNFLGSVPKLSHLKY--LYELDLSNNKLTGK  235

Query  1203  FPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFL  1024
             FPT V++A  LT+LDLRFN  +G V P+VF LD+DALF+NNN     +P  LGS    FL
Sbjct  236   FPTTVIDAKQLTFLDLRFNSFSGFVPPRVFNLDVDALFINNNNLVQNIPRTLGSITALFL  295

Query  1023  TLANNQFSGPIPKTIGNASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIP  844
             T ANN+F+GPIP TIG+  +L EVLFLNN+L+GCLPY+IG L  +TVFD  +NQLTGPIP
Sbjct  296   TFANNRFTGPIPDTIGDIKYLQEVLFLNNQLTGCLPYQIGNLNQATVFDVEVNQLTGPIP  355

Query  843   QSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLD  664
              SFGCL+K+E LNL  N+ YG++PE +C+L  L  LSLS NYFTQ+GP+CR L++  +LD
Sbjct  356   YSFGCLDKMEQLNLARNKFYGTIPEIVCELSCLMNLSLSYNYFTQVGPKCRTLIKSNILD  415

Query  663   IDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
             +  NCILDLPNQ++   C  FF+  Q CP+  S+  VPC
Sbjct  416   VRMNCILDLPNQKTPMECAKFFMKKQTCPNSHSMFLVPC  454



>ref|XP_007227115.1| hypothetical protein PRUPE_ppa025707mg, partial [Prunus persica]
 gb|EMJ28314.1| hypothetical protein PRUPE_ppa025707mg, partial [Prunus persica]
Length=482

 Score =   296 bits (757),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 174/342 (51%), Positives = 222/342 (65%), Gaps = 6/342 (2%)
 Frame = -1

Query  1569  LDPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  1390
             LD  +      I+ FK +IT DP  IT++W G+ +C     Y+GF+C  P   +   +  
Sbjct  74    LDQKLEIVYPIIQKFKSTITSDPLGITKTWVGSNIC----SYRGFYCDNPPN-NGSAIAL  128

Query  1389  iyfngynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  1210
                +   F     SL+ F++   D+ + H NSNNF+G     + K P L+ELDLSNN+ +
Sbjct  129   ASIDFNGFQLGASSLDGFLDQLPDIALFHANSNNFSGTISANIAKLPYLYELDLSNNQFS  188

Query  1209  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVF  1030
             G FP+ VL  ++LT+LD+RFN  TG V PQ+FT DLDALF+NNN F   LPDNLGS+ + 
Sbjct  189   GPFPSVVLGMSSLTFLDIRFNFFTGSVPPQIFTQDLDALFINNNNFMQKLPDNLGSSHIL  248

Query  1029  FLTLANNQFSGPIPKTIGNA-SFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTG  853
              LTLANN+F GPIP  I  A S L EVL LNN+L+GCLPYEIGLLK + VFDA  NQLTG
Sbjct  249   LLTLANNKFMGPIPPGISKAFSALTEVLLLNNQLTGCLPYEIGLLKEAIVFDAGNNQLTG  308

Query  852   PIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKK  673
             P+P S  CLE  E LN   N LYG VPE +C L++L +LSLS NYFT +GP CR L+ + 
Sbjct  309   PLPFSLACLENAEQLNFAGNLLYGMVPEVVCGLQNLVDLSLSDNYFTNVGPLCRMLIGRG  368

Query  672   VLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
             VLD+ NNCI DLP Q+S + C DFF H + CP   S  Y+PC
Sbjct  369   VLDVRNNCIPDLPFQKSIEECADFFAHPRFCPYMGSYTYIPC  410



>ref|XP_006433575.1| hypothetical protein CICLE_v10003526mg [Citrus clementina]
 gb|ESR46815.1| hypothetical protein CICLE_v10003526mg [Citrus clementina]
Length=429

 Score =   294 bits (753),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 171/340 (50%), Positives = 219/340 (64%), Gaps = 6/340 (2%)
 Frame = -1

Query  1536  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  1357
             I+ FK  IT DP  IT++W G+++C     Y+GF+C  P   ++  +     +   F  +
Sbjct  92    IQEFKSIITSDPLGITKTWVGSDIC----NYKGFYCESPPD-NETAIAVASIDFNGFQLS  146

Query  1356  glslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  1177
               +L+ F++   D+ + H NSNNF G     + K P L+ELD+SNNK +G FP AVL   
Sbjct  147   APTLDGFLDQLPDIALFHANSNNFAGTISSNIAKLPYLYELDISNNKFSGPFPAAVLGMN  206

Query  1176  NLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTLANNQFSG  997
             NL +LD+RFN  TG V PQ+FT +LD LF+NNN F   LPDN+GST + FLTLANN+F G
Sbjct  207   NLEFLDIRFNYFTGSVPPQIFTQNLDFLFINNNGFMIKLPDNIGSTHILFLTLANNKFIG  266

Query  996   PIPKTIGNA-SFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEK  820
             P+P++I  A S L EVL +NN+L+GCLPYEIG LK + VFD   NQLTG +P S  CLEK
Sbjct  267   PLPRSIFKAFSELTEVLLVNNQLTGCLPYEIGYLKEAVVFDVGDNQLTGQLPFSLACLEK  326

Query  819   LEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILD  640
             +E LN  NN L+G VPE++C L +L   SLS NYFT  GP CR L+EK VLD+ NNCI D
Sbjct  327   VEQLNFANNLLFGMVPEAVCGLPNLLHFSLSDNYFTHAGPLCRFLIEKGVLDVRNNCIPD  386

Query  639   LPNQRSAQVCKDFFLHYQKCPDHKSLLYVPCDIDESPRKA  520
             LP QRS   C DFF H + CP   S  Y+PC     P  A
Sbjct  387   LPFQRSVAECADFFAHPRFCPHMWSYTYIPCKPYYIPEMA  426



>ref|XP_006374888.1| hypothetical protein POPTR_0014s02430g [Populus trichocarpa]
 gb|ERP52685.1| hypothetical protein POPTR_0014s02430g [Populus trichocarpa]
Length=430

 Score =   294 bits (753),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 170/341 (50%), Positives = 220/341 (65%), Gaps = 9/341 (3%)
 Frame = -1

Query  1536  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  1357
             I+ FK  IT DP  IT++W G+++C     Y+GFFC  P   +         +   F   
Sbjct  88    IQKFKSLITSDPLGITKTWVGSDIC----NYKGFFCDSPPD-NNSATAVASIDFNGFQLA  142

Query  1356  glslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  1177
               +L+ F++   D+ + H NSNNF G     + + P L+ELD+SNN  +G+FPTAVL   
Sbjct  143   APTLDGFLDQLPDVALFHANSNNFAGTISSNIARLPYLYELDISNNLFSGSFPTAVLGMN  202

Query  1176  NLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTLANNQFSG  997
              LT+LD+RFN   G V PQ+FT +L+ LF+NNN F   LPDNLGST + +LTLANN+F G
Sbjct  203   GLTFLDIRFNFFAGAVPPQIFTQNLEVLFINNNNFLTTLPDNLGSTHILYLTLANNKFIG  262

Query  996   PIPKTIGNA-SFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEK  820
             PIP  I  A S L EVL  NN+L+GCLPYE+GLLK + VFDAS N+LTGP+P +  CLEK
Sbjct  263   PIPTGIFKAFSSLSEVLLSNNQLTGCLPYEVGLLKEAIVFDASNNKLTGPLPVALSCLEK  322

Query  819   LEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILD  640
             +E+LN T NQL+G VPE +C+L+ L   SLS NYFT +GP CR+L  K VLDI NNCI  
Sbjct  323   VELLNFTGNQLFGMVPEVVCELEKLRNFSLSANYFTTLGPMCRDLFYKGVLDITNNCIPG  382

Query  639   LPNQRSAQVCKDFFLHYQKCPDHKSLLYVPCDIDESPRKAG  517
             LP QRS   C DF  H + CP   S  ++PC+   SP  +G
Sbjct  383   LPFQRSVVECLDFIAHPKSCPRMWSYTFIPCN---SPFSSG  420



>ref|XP_006487027.1| PREDICTED: uncharacterized protein At4g06744-like [Citrus sinensis]
Length=418

 Score =   293 bits (750),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 170/342 (50%), Positives = 222/342 (65%), Gaps = 6/342 (2%)
 Frame = -1

Query  1569  LDPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  1390
             LD  +      I+TFK +IT DP NIT +W G+++C    KY+GF+C  P   +   +  
Sbjct  51    LDQRLAAIYPIIQTFKNTITSDPFNITSTWIGSDIC----KYKGFYCGHP-PDNLTAIAL  105

Query  1389  iyfngynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  1210
                +   F     +L+ F++   DL + H NSN F+G     + + P L+ELD+SNNK +
Sbjct  106   ASIDFNGFELAAPTLDGFIDQLPDLSLFHANSNKFSGTISPKLAQLPYLYELDISNNKFS  165

Query  1209  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVF  1030
             G FP A+L   +L++LD+RFN  TG V PQVF   LD LFLNNN F   LP NLGSTP  
Sbjct  166   GTFPVAILGKNDLSFLDIRFNFFTGSVPPQVFMQTLDVLFLNNNNFMQKLPQNLGSTPAL  225

Query  1029  FLTLANNQFSGPIPKTIGNASF-LLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTG  853
             +LT ANN+F+G IP++IG  SF L+EVLFLNN L+GCLPYE+G L+ + VFDAS N+LTG
Sbjct  226   YLTFANNKFTGSIPRSIGKLSFTLIEVLFLNNLLTGCLPYELGFLREARVFDASNNRLTG  285

Query  852   PIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKK  673
             P+P S GCLEK+E LNL+ N LYG VPE LC L +L  LSLS NYFT +GP CR L++  
Sbjct  286   PLPCSLGCLEKIERLNLSGNLLYGQVPEVLCALDNLVNLSLSNNYFTGVGPLCRKLIKNG  345

Query  672   VLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
             VLD++ NCI  LP+QRS   C  FFL  + C       ++PC
Sbjct  346   VLDVNRNCIHYLPDQRSTHECALFFLQPRFCFYPSWYNFIPC  387



>ref|XP_009592678.1| PREDICTED: uncharacterized protein At4g06744-like [Nicotiana 
tomentosiformis]
Length=425

 Score =   293 bits (749),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 165/343 (48%), Positives = 219/343 (64%), Gaps = 5/343 (1%)
 Frame = -1

Query  1569  LDPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  1390
             LD  +      I+ FK +IT DP  +TQSW G ++C     Y+GF+C  P   +   +  
Sbjct  60    LDQRLALIFPIIQNFKSTITLDPLGVTQSWTGPDIC----NYKGFYCDNPPY-NTSAISL  114

Query  1389  iyfngynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  1210
                +   F     +L+ F++   DL V H NSNNF+G     + + P L+ELDLSNNK  
Sbjct  115   ASIDFNGFQLTAPTLDGFIDQLPDLAVFHANSNNFSGIISSKITQLPYLYELDLSNNKFI  174

Query  1209  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVF  1030
             G FP ++L    LT+LD+R+N+ TG + PQ+FT +LDA FLNNN F   LPDNLGST   
Sbjct  175   GTFPLSILNIKTLTFLDIRYNLFTGIIPPQIFTQNLDAFFLNNNNFVQKLPDNLGSTSAL  234

Query  1029  FLTLANNQFSGPIPKTIGNASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGP  850
             +LTLANN+F GPIP++IG A+ LLE+LFLNN L+GC+PYE+GLLK +TV D   N LTGP
Sbjct  235   YLTLANNKFIGPIPRSIGQATNLLEILFLNNLLTGCIPYELGLLKKATVIDVGYNMLTGP  294

Query  849   IPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKV  670
             +P S GCLE +E LN   N LYG VPE +C L +L   +LS NYFT++GP CR L++K +
Sbjct  295   LPCSLGCLESVEQLNFAGNLLYGQVPEVVCSLTNLVNFTLSNNYFTKVGPLCRELIKKGI  354

Query  669   LDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPCDI  541
             L+++ NCI  LPNQRS   C  F    + CP  K+   +PC I
Sbjct  355   LNVEKNCIFGLPNQRSIVECLIFRGQIKLCPLQKTYSVIPCKI  397



>gb|KDO59786.1| hypothetical protein CISIN_1g048561mg, partial [Citrus sinensis]
Length=382

 Score =   291 bits (745),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 169/342 (49%), Positives = 222/342 (65%), Gaps = 6/342 (2%)
 Frame = -1

Query  1569  LDPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  1390
             LD  +      I+TFK +IT DP NIT +W G+++C    KY+GF+C  P   +   +  
Sbjct  15    LDQRLAAIYPIIQTFKNTITSDPFNITSTWIGSDIC----KYKGFYCGHPPD-NLTAIAL  69

Query  1389  iyfngynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  1210
                +   F     +L+ F++   DL + H NSN F+G     + + P L+ELD+SNNK +
Sbjct  70    ASIDFNGFELAAPTLDGFIDQLPDLSLFHANSNKFSGTISPKLAQLPYLYELDISNNKFS  129

Query  1209  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVF  1030
             G FP A+L   +L++LD+RFN  TG V PQVF   LD LFLNNN F   LP NLGSTP  
Sbjct  130   GTFPVAILGKNDLSFLDIRFNFFTGSVPPQVFMQTLDVLFLNNNNFMQKLPQNLGSTPAL  189

Query  1029  FLTLANNQFSGPIPKTIGN-ASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTG  853
             +LT ANN+F+G IP++IG  +S L+EVLFLNN L+GCLPYE+G L+ + VFDAS N+LTG
Sbjct  190   YLTFANNKFTGSIPRSIGKLSSTLIEVLFLNNLLTGCLPYELGFLREARVFDASNNRLTG  249

Query  852   PIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKK  673
             P+P S GCLEK+E LNL+ N LYG VPE LC L +L  LSLS NYFT +GP CR L++  
Sbjct  250   PLPCSLGCLEKIERLNLSGNLLYGQVPEVLCALDNLVNLSLSNNYFTGVGPLCRKLIKNG  309

Query  672   VLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
             VLD++ NCI  LP+QRS   C  FFL  + C       ++PC
Sbjct  310   VLDVNRNCIHYLPDQRSTHECALFFLQPRFCFYPSWYNFIPC  351



>ref|XP_010466072.1| PREDICTED: uncharacterized protein At4g06744-like [Camelina sativa]
Length=469

 Score =   293 bits (751),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 182/377 (48%), Positives = 245/377 (65%), Gaps = 10/377 (3%)
 Frame = -1

Query  1563  PVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiy  1384
             P+I+K    I+ F+K I  DP+ I ++W G ++C  + KY G  C    G +   +G I 
Sbjct  98    PLIKKVFPVIKNFQKLIEDDPKKILKTWVGTDICA-QDKYIGLECAKFPGTNDDALGSIQ  156

Query  1383  fngynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAG  1207
             FN +NF G  L L++F++   ++ + H NSNNF G+  +P +     LFELDLSNNKL+G
Sbjct  157   FNNFNFRGKKLRLDNFLDKLEEVTIFHANSNNFLGS--VPKLNNLKYLFELDLSNNKLSG  214

Query  1206  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFF  1027
              FP++VL+ATNLT+LDLRFN  +G V PQVF LDLD  F+N+N  +  LPDNLGS    +
Sbjct  215   EFPSSVLKATNLTFLDLRFNSFSGSVPPQVFNLDLDVFFINDNNLAQRLPDNLGSITALY  274

Query  1026  LTLANNQFSGPIPKTIGNASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPI  847
             LT ANN+F GPIP++IG+   L EVLFLNNKL+GCLPY+IG L  +TVFD   N+LTGP+
Sbjct  275   LTFANNRFRGPIPRSIGDIKSLQEVLFLNNKLTGCLPYQIGNLNQATVFDVESNELTGPV  334

Query  846   PQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVL  667
             P SFGCL K+E L L  N+ YG++PE LC+L  L+ LSLS NYFTQ+GP+CR L+++++L
Sbjct  335   PYSFGCLNKMEQLILARNKFYGAIPEILCELSSLKNLSLSSNYFTQVGPKCRTLIKRRIL  394

Query  666   DIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPCDIDESPRKAGphphphrpyk  487
             D+  NCI  L NQR+   C  FF+  Q CP+ KS   +PC  D    K        +   
Sbjct  395   DVGRNCIRGLANQRTWWECARFFMRRQNCPNSKSFFNIPCGKDLHRIKWD------QEGL  448

Query  486   khkRGSSTTYAALKVDR  436
               +   S +Y AL  DR
Sbjct  449   DGQASQSVSYGALNPDR  465



>ref|XP_010487869.1| PREDICTED: uncharacterized protein At4g06744-like [Camelina sativa]
Length=459

 Score =   293 bits (749),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 177/342 (52%), Positives = 235/342 (69%), Gaps = 4/342 (1%)
 Frame = -1

Query  1560  VIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyf  1381
             +I+K    I+ F+K I  DP+ I ++W G ++C  +  Y G  C    G +   +G I F
Sbjct  88    LIKKVFPVIKNFQKLIEDDPKKILKTWVGTDICA-QDTYIGLECAKFPGTNDDALGSIQF  146

Query  1380  ngynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAGA  1204
             N +NF G  L L++F++   ++ + H NSNNF G+  +P V     LFELDLSNNKL+G 
Sbjct  147   NNFNFRGKKLRLDNFLDKLEEVTIFHANSNNFLGS--VPKVSNLKYLFELDLSNNKLSGE  204

Query  1203  FPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFL  1024
             FP++VL+ATNLT+LDLRFN  +G V PQVF LDLD LF+N+N  +  LP+NLGS    +L
Sbjct  205   FPSSVLKATNLTFLDLRFNSFSGSVPPQVFNLDLDVLFINDNNLAQRLPENLGSITALYL  264

Query  1023  TLANNQFSGPIPKTIGNASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIP  844
             T ANN+F GPIP +IG+   L EVLFLNNKL+GCLPY+IG L  +TVFD   N+LTGPIP
Sbjct  265   TFANNRFRGPIPASIGDIKSLQEVLFLNNKLTGCLPYQIGNLNRATVFDVESNELTGPIP  324

Query  843   QSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLD  664
              SFGCL K+E LNL  N+ YG++PE LC+L  L+ LSLS NYFTQ+GP+CR L+++K+LD
Sbjct  325   YSFGCLNKMEQLNLARNKFYGTIPEILCELSSLKNLSLSSNYFTQVGPKCRTLIKRKILD  384

Query  663   IDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPCDID  538
             +  NCI  L NQR+   C  FF+  + CP+ KS  Y+PC  D
Sbjct  385   VGMNCIRGLANQRTWWECARFFMRRKNCPNSKSFFYIPCGKD  426



>ref|XP_008236564.1| PREDICTED: uncharacterized protein At4g06744-like [Prunus mume]
Length=416

 Score =   291 bits (745),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 177/340 (52%), Positives = 219/340 (64%), Gaps = 7/340 (2%)
 Frame = -1

Query  1557  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  1378
             +R +   I+ FK+ I  DP+N T +W GN +C    KY+GF C V     K  V G+ FN
Sbjct  37    LRNAFNVIQAFKRRIQSDPKNYTGTWVGNNVC----KYKGFTCAVVPDLKKLTVIGVSFN  92

Query  1377  gynfngnglsl--nSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGA  1204
             G  F G    L  N F++   DLV  H NSNNFTG       +    +ELDLSNNKL+G 
Sbjct  93    GALFGGFNNRLPLNGFIDKLEDLVFFHANSNNFTGTVPRGTARHRFFYELDLSNNKLSGG  152

Query  1203  FPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFL  1024
             FP   L ATNLT+LDLRFN     V P+VF LD+D LFLNNN F   LP NLGSTP  +L
Sbjct  153   FPNETLGATNLTFLDLRFNSFRATVPPKVFNLDVDLLFLNNNNFQQRLPANLGSTPAHYL  212

Query  1023  TLANNQFSGPIPKTIGNAS-FLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPI  847
             T ANN+F G IP++I  A   L EVLFL N+LSGCLPYEIG LK +TVFD S N LTGPI
Sbjct  213   TFANNKFVGSIPRSIRQAGKTLYEVLFLGNRLSGCLPYEIGYLKKATVFDVSSNILTGPI  272

Query  846   PQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVL  667
             P SF CL KLE L+L +NQ YG VP+++CK ++LE  S + NYFT+IGP C  L+ K++L
Sbjct  273   PNSFACLGKLEYLSLASNQFYGRVPDAVCKFRNLERFSAANNYFTRIGPACLALIRKRIL  332

Query  666   DIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
             D+  NCI  LPNQ++A  C  FF   + CP  ++L  +PC
Sbjct  333   DVRGNCIPGLPNQKTAAQCAAFFSIPRTCPRPRTLSIIPC  372



>ref|XP_002518710.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
 gb|EEF43635.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
Length=418

 Score =   291 bits (745),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 177/344 (51%), Positives = 220/344 (64%), Gaps = 6/344 (2%)
 Frame = -1

Query  1569  LDPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  1390
             LD  +      I++FK  +T DP NITQSW G+++C     Y+GF+C  P   +   +  
Sbjct  51    LDQRLATVYPIIQSFKAIVTSDPLNITQSWVGSDIC----NYRGFYCDNPPD-NLSAIAL  105

Query  1389  iyfngynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  1210
                +   F     SL+ F++   DL + H NSNNF+G     +     L+ELDLSNN  +
Sbjct  106   AAIDFNGFQLAAPSLDGFIDQLPDLAIFHANSNNFSGTISPKIANLQYLYELDLSNNNFS  165

Query  1209  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVF  1030
             G FPTAVL  T L +LD+RFN  TG V PQVF L LD LFLNNN F   LP+NLG+TPV 
Sbjct  166   GNFPTAVLSITGLFFLDIRFNFFTGSVPPQVFALRLDVLFLNNNNFMQKLPENLGTTPVP  225

Query  1029  FLTLANNQFSGPIPKTIGNASFLL-EVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTG  853
             +LTLANN+F+G IP++I NAS  L EVL LNN L+GC+PYEIG LK   +FDAS N LTG
Sbjct  226   YLTLANNKFTGQIPRSIFNASSTLKEVLLLNNLLTGCIPYEIGFLKELALFDASNNLLTG  285

Query  852   PIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKK  673
             P+P S GCL K+E LNL  N LYG VPE +C L +L  LSLS NYFT+IGP C  L++  
Sbjct  286   PLPCSLGCLAKIEQLNLAGNFLYGQVPEVVCALGNLANLSLSNNYFTKIGPLCWKLVKTG  345

Query  672   VLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPCDI  541
             VLDI NNCI  LP+QRS   C  FFLH + CP      ++PC I
Sbjct  346   VLDIRNNCIHGLPDQRSWHECFFFFLHPKYCPYPSFFHFIPCKI  389



>gb|KDP24986.1| hypothetical protein JCGZ_23969 [Jatropha curcas]
Length=413

 Score =   291 bits (744),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 173/336 (51%), Positives = 221/336 (66%), Gaps = 7/336 (2%)
 Frame = -1

Query  1536  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  1357
             I+TFK SIT DP NITQ+W G ++C     Y+GF+C  P   +         +   F  +
Sbjct  60    IQTFKNSITSDPFNITQTWVGPDIC----NYKGFYCDHP-PDNISATALAAIDFNGFRLS  114

Query  1356  glslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  1177
               SL+  ++   DL + H NSNNF+G     +   P L+ELDLSNN   G FP A+L  T
Sbjct  115   APSLDGLIDQLPDLAIFHANSNNFSGTISPKLADLPFLYELDLSNNFFFGNFPMAILSIT  174

Query  1176  NLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTLANNQFSG  997
              L++LD+RFN  TG V PQ+FT  LD LFLNNN F   LP+ LG+TPV +LTLA N+F+G
Sbjct  175   GLSFLDIRFNFFTGSVPPQIFTQRLDVLFLNNNNFMLKLPETLGATPVLYLTLAYNKFTG  234

Query  996   PIPKTIGN-ASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEK  820
             PIP++I N +S L EVL LNN L+GC+PYE+G LK   +FDAS N LTGP+P S GCL K
Sbjct  235   PIPRSILNVSSTLTEVLLLNNLLTGCIPYELGFLKELVLFDASNNLLTGPLPCSLGCLTK  294

Query  819   LEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILD  640
             +E LNLT N LYG VPE +C L++L  LSLS NYFT++GP C  L++  VLDI  NCIL 
Sbjct  295   IEQLNLTGNLLYGQVPEVVCALENLANLSLSNNYFTKVGPLCWKLVKSGVLDIRQNCILG  354

Query  639   LPNQRSAQVCKDFFLHYQKCPDHKSLL-YVPCDIDE  535
             LPNQRS   C  FFLH + CP H +L  ++PC + +
Sbjct  355   LPNQRSFHECFIFFLHPRYCPYHPTLFNFIPCKVHQ  390



>ref|XP_006307323.1| hypothetical protein CARUB_v10008944mg [Capsella rubella]
 gb|EOA40221.1| hypothetical protein CARUB_v10008944mg [Capsella rubella]
Length=496

 Score =   293 bits (751),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 177/340 (52%), Positives = 218/340 (64%), Gaps = 10/340 (3%)
 Frame = -1

Query  1563  PVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiy  1384
             P I K+   ++ FK S+  DP     SW G ++C    KY G  C    G +   V  + 
Sbjct  128   PFIAKAYPTLQRFKNSVD-DPLKKLVSWVGPDVC---NKYNGLSCATFPGSNHPAVASVL  183

Query  1383  fngynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAG  1207
             FNG+   G   +   F++    + + H NSNNF G   +P + K   LFELDLSNNK   
Sbjct  184   FNGFQLGGKLDN---FLDKLETVSIFHANSNNFNGT--VPDISKLKYLFELDLSNNKFTD  238

Query  1206  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFF  1027
              FPT VL+  NLT+LDLRFN   G V PQVF LDLD LF+NNN     LP NLGS    +
Sbjct  239   GFPTNVLQGVNLTFLDLRFNTFKGSVPPQVFNLDLDVLFINNNKLVQNLPTNLGSITALY  298

Query  1026  LTLANNQFSGPIPKTIGNASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPI  847
             LT ANN F+GPIP +IG+  +L EVLFLNN+L+GCLPY+IG LK +TVFD   NQLTGPI
Sbjct  299   LTFANNGFTGPIPASIGDIKYLQEVLFLNNQLTGCLPYQIGNLKQATVFDVGGNQLTGPI  358

Query  846   PQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVL  667
             P SFGCL+ +E LNL  N+ YG++PE +C++  L+ LSLS NYFTQ GP+CR L+E KVL
Sbjct  359   PYSFGCLDSMEQLNLARNKFYGTIPEIVCEIACLKNLSLSYNYFTQAGPKCRKLIESKVL  418

Query  666   DIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
             D+  NCILDLPNQ + Q C DFF   Q C D KSL  VPC
Sbjct  419   DVRMNCILDLPNQNTPQQCADFFKRRQTCADPKSLFIVPC  458



>gb|KDO37099.1| hypothetical protein CISIN_1g037101mg, partial [Citrus sinensis]
Length=395

 Score =   290 bits (742),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 168/330 (51%), Positives = 216/330 (65%), Gaps = 6/330 (2%)
 Frame = -1

Query  1536  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  1357
             I+ FK  IT DP  IT++W G+++C     Y+GF+C  P   ++  +     +   F  +
Sbjct  71    IQEFKSIITSDPLGITKTWVGSDIC----NYKGFYCESPPD-NETAIAVASIDFNGFQLS  125

Query  1356  glslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  1177
               +L+ F++   D+ + H NSNNF G     + K P L+ELD+SNNK +G FP AVL   
Sbjct  126   APTLDGFLDQLPDIALFHANSNNFAGTISSNIAKLPYLYELDISNNKFSGPFPAAVLGMN  185

Query  1176  NLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTLANNQFSG  997
             NL +LD+RFN  TG V PQ+FT +LD LF+NNN F   LPDN+GST + FLTLANN+F G
Sbjct  186   NLEFLDIRFNYFTGSVPPQIFTQNLDFLFINNNGFMIKLPDNIGSTHILFLTLANNKFIG  245

Query  996   PIPKTIGNA-SFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEK  820
             P+P++I  A S L EVL +NN+L+GCLPYEIG LK + VFD   NQLTG +P S  CLEK
Sbjct  246   PLPRSIFKAFSELTEVLLVNNQLTGCLPYEIGYLKEAVVFDVGDNQLTGQLPFSLACLEK  305

Query  819   LEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILD  640
             +E LN  NN L+G VPE++C L +L   SLS NYFT  GP CR L+EK VLD+ NNCI D
Sbjct  306   VEQLNFANNLLFGMVPEAVCGLPNLLHFSLSDNYFTHAGPLCRFLIEKGVLDVRNNCIPD  365

Query  639   LPNQRSAQVCKDFFLHYQKCPDHKSLLYVP  550
             LP QRS   C DFF H + CP   S  Y+P
Sbjct  366   LPFQRSVAECADFFAHPRFCPHMWSYTYIP  395



>ref|XP_009784047.1| PREDICTED: uncharacterized protein At4g06744-like [Nicotiana 
sylvestris]
Length=426

 Score =   291 bits (745),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 166/343 (48%), Positives = 218/343 (64%), Gaps = 5/343 (1%)
 Frame = -1

Query  1569  LDPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  1390
             LD  +      I+ FK +IT DP  +TQSW G  +C     Y+GF+C  P   +   +  
Sbjct  61    LDQRLALIFPIIQNFKNTITLDPLGVTQSWTGPNIC----NYKGFYCDNPPY-NTSAISL  115

Query  1389  iyfngynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  1210
                +   F     +L+ F++   DL + H NSNNF+G     + + P L+ELDLSNNK  
Sbjct  116   ASIDFNGFQLTAPTLDGFIDQLPDLAIFHANSNNFSGIISSKITQLPYLYELDLSNNKFI  175

Query  1209  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVF  1030
             G FP +VL    LT+LD+R+N+ TG + PQ+FT +LDA FLNNN F   LPDNLGST   
Sbjct  176   GTFPLSVLNIKTLTFLDIRYNLFTGIIPPQIFTQNLDAFFLNNNNFIQKLPDNLGSTTAL  235

Query  1029  FLTLANNQFSGPIPKTIGNASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGP  850
             +LTLANN+F GPIP++IG A  LLE+LFLNN L+GC+PYE+GLLK + V D   N LTGP
Sbjct  236   YLTLANNKFIGPIPRSIGQAPNLLEILFLNNLLTGCIPYELGLLKKAIVIDVGYNMLTGP  295

Query  849   IPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKV  670
             +P SFGCLE +E LN   N LYG VPE +C L +L   +LS NYFT++GP CR L++K +
Sbjct  296   LPCSFGCLESVEQLNFAGNLLYGQVPEVVCSLTNLVNFTLSYNYFTKVGPLCRELIKKGI  355

Query  669   LDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPCDI  541
             L+++ NCIL LPNQRS   C  F    + CP  K+   +PC I
Sbjct  356   LNVEKNCILGLPNQRSIVECLIFRGQIKLCPLQKTYNVIPCKI  398



>emb|CDO97205.1| unnamed protein product [Coffea canephora]
Length=446

 Score =   291 bits (746),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 183/332 (55%), Positives = 219/332 (66%), Gaps = 4/332 (1%)
 Frame = -1

Query  1539  AIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfng  1360
              I+  K  IT DP  IT+SW G ++C    KYQGF C        K +  + FNGYNF+G
Sbjct  89    VIQRLKAKITCDPLGITKSWVGPDIC---NKYQGFRCATVPDYGVKALADVQFNGYNFSG  145

Query  1359  nglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEA  1180
               L+L  F++   DL + H NSN F G     +     LFELDLSNN   G FP  VL A
Sbjct  146   PDLTLEGFIDELPDLSIFHGNSNKFAGNIPKKLSTIRYLFELDLSNNNFNGQFPYEVLGA  205

Query  1179  TNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTLANNQFS  1000
             T LT+LDLRFN  +G V PQVFTLDLD LF+NNN F   LPDNLGS PV FLTLANN+ +
Sbjct  206   TKLTFLDLRFNSFSGAVPPQVFTLDLDVLFINNNNFVQRLPDNLGSLPVLFLTLANNKLT  265

Query  999   GPIPKTIGNASFLL-EVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLE  823
             GPIP +IG AS  L EV+FLNN+L+GCLP EIGLL  +TVFD S N LTGPIP SF CL 
Sbjct  266   GPIPSSIGKASKTLDEVIFLNNQLTGCLPCEIGLLNKATVFDVSRNLLTGPIPWSFACLA  325

Query  822   KLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCIL  643
             K+EILNL  NQ +G VP+ +C+L +LE   LS NYFT +GPEC  L+++KVLD+  NCI 
Sbjct  326   KMEILNLAKNQFFGVVPDPICQLPNLESFDLSSNYFTGVGPECWKLIQRKVLDVTMNCIP  385

Query  642   DLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
              LPNQRS   C  FF   + C +  SL +VPC
Sbjct  386   GLPNQRSKAECDAFFCKPRSCSNQGSLTWVPC  417



>ref|XP_004304027.1| PREDICTED: uncharacterized protein At4g06744-like isoform 2 [Fragaria 
vesca subsp. vesca]
Length=411

 Score =   290 bits (742),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 164/331 (50%), Positives = 220/331 (66%), Gaps = 6/331 (2%)
 Frame = -1

Query  1536  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  1357
             I++FK  IT DP  IT++W G ++C     Y+GF+C +P   +         +   F  +
Sbjct  65    IQSFKNIITSDPLGITKTWVGADIC----NYKGFYCDIPPD-NATATAIASIDFNGFQLS  119

Query  1356  glslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  1177
               +L+ F++   DL + H NSNNF+G     +     L+ELD+SNN   G FPTAVL   
Sbjct  120   APTLDGFIDQLPDLALFHANSNNFSGILTPKIANLQYLYELDISNNNFFGPFPTAVLTMN  179

Query  1176  NLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTLANNQFSG  997
             +L++LD+R+N  TG + P++F   LD LFLNNN F   LPDNLG+T   +LTLANN+F+G
Sbjct  180   SLSFLDIRYNSFTGSIPPEIFKQTLDVLFLNNNNFMQSLPDNLGATSALYLTLANNKFTG  239

Query  996   PIPKTIGNAS-FLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEK  820
              IPK+IG+AS  L+E L LNN L+GC+PYE+G L+++TVFDA  NQLTGP+P S GCL+K
Sbjct  240   SIPKSIGSASPTLVEALLLNNLLTGCIPYELGFLRDATVFDAGNNQLTGPLPCSLGCLDK  299

Query  819   LEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILD  640
             +E LN  +N LYG VPE LC+L +L  LSLS NYFT +G  CR L+EK VLDI NNCI D
Sbjct  300   IEQLNFADNFLYGRVPEVLCELGNLANLSLSNNYFTGVGTACRKLIEKGVLDIRNNCIQD  359

Query  639   LPNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
             L +QRSA+ C  FFLH + C   ++   +PC
Sbjct  360   LADQRSAEECALFFLHPKSCLHPETYSLIPC  390



>ref|XP_008220262.1| PREDICTED: uncharacterized protein At4g06744-like [Prunus mume]
Length=464

 Score =   291 bits (746),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 169/331 (51%), Positives = 217/331 (66%), Gaps = 6/331 (2%)
 Frame = -1

Query  1536  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  1357
             I+ FK +IT DP  IT++W G+ +C     Y+GF+C  P   +   +     +   F   
Sbjct  120   IQKFKSTITSDPLGITKTWVGSNIC----SYRGFYCDNPPN-NSSAIALASIDFNGFQLG  174

Query  1356  glslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  1177
               SL+ F++   D+ + H NSNNF+G     + K P L+ELDLSNN+ +G FP+ VL  +
Sbjct  175   ASSLDGFLDQLPDIALFHANSNNFSGTISANIAKLPYLYELDLSNNQFSGPFPSVVLGMS  234

Query  1176  NLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTLANNQFSG  997
             +LT+LD+RFN  TG V PQ+FT DLDALF+NNN F   LPDNLGS+ +  LTLANN+F G
Sbjct  235   SLTFLDIRFNFFTGSVPPQIFTQDLDALFINNNNFMQKLPDNLGSSHILLLTLANNKFMG  294

Query  996   PIPKTIGNA-SFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEK  820
             PIP  I    S L EVL LNN+L+GCLPYEIGLLK + VFDA  NQLTGP+P S  CLE 
Sbjct  295   PIPPGISKVFSALTEVLLLNNQLTGCLPYEIGLLKEAIVFDAGNNQLTGPLPFSLACLES  354

Query  819   LEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILD  640
             +E LN   N  YG VPE +C L++L  LSLS NYFT +GP CR L+ + VLD+ NNCI D
Sbjct  355   VEQLNFAGNLFYGMVPEVVCGLQNLVNLSLSDNYFTNVGPLCRMLIGRGVLDVRNNCIPD  414

Query  639   LPNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
             LP Q+S + C DFF   + CP   S +Y+PC
Sbjct  415   LPFQKSIEECADFFARPRLCPYMGSYIYIPC  445



>ref|XP_010270768.1| PREDICTED: uncharacterized protein At4g06744-like [Nelumbo nucifera]
Length=475

 Score =   292 bits (747),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 169/340 (50%), Positives = 216/340 (64%), Gaps = 10/340 (3%)
 Frame = -1

Query  1536  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  1357
             I++FK  IT DP  IT +W G+++C     Y+GF+C  P      R              
Sbjct  109   IQSFKNIITSDPLGITSTWVGSDIC----NYRGFYCDNPPDDPSVRALAGIDFNGYQLAA  164

Query  1356  glslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  1177
                   F++   DL + H N+NNFTG     + +   L+ELD+SNN  +G FPTAVL   
Sbjct  165   PTLDG-FIDLLPDLAIFHANTNNFTGIISPKIAQLRYLYELDISNNLFSGQFPTAVLGMN  223

Query  1176  NLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTLANNQFSG  997
              L++LD+RFN  +G V  Q+FT  LD LF+NNN F   LP+NLG+TPV +LT ANN F G
Sbjct  224   GLSFLDIRFNSFSGSVPAQIFTQPLDVLFINNNNFMQTLPNNLGNTPVRYLTFANNNFVG  283

Query  996   PIPKTIGNASF-LLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEK  820
              IP++IGNAS  L+EVLFLNNKLSGCLPYEIGLL ++TVFD   N LTGPIP SF CLEK
Sbjct  284   SIPRSIGNASATLVEVLFLNNKLSGCLPYEIGLLTSATVFDVGNNFLTGPIPCSFACLEK  343

Query  819   LEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILD  640
             +E+L L  NQ YG +PE +C L +L  LSLS NYF  +GP CR+L+++ VLD+ NNCI  
Sbjct  344   MEVLKLAGNQFYGKIPEEVCGLGNLANLSLSDNYFRYLGPTCRSLIKRGVLDVSNNCIHG  403

Query  639   LPNQRSAQVCKDF-FLHYQKCPD---HKSLLYVPCDIDES  532
             LPNQR A  C DF + H + CP      +   VPC+I+ S
Sbjct  404   LPNQRPAAECWDFYYFHLKHCPSSLPRYNANVVPCNINHS  443



>ref|XP_011000139.1| PREDICTED: uncharacterized protein At4g06744-like [Populus euphratica]
Length=421

 Score =   290 bits (742),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 172/350 (49%), Positives = 219/350 (63%), Gaps = 6/350 (2%)
 Frame = -1

Query  1569  LDPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  1390
             LD  +      I+ FK +IT DP NITQ+W G ++C     Y+GF+C  P   +   V  
Sbjct  53    LDQRLASVYPIIQVFKDTITSDPFNITQTWVGPDIC----NYEGFYCTSPPDNNSA-VAV  107

Query  1389  iyfngynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  1210
                +   F  +  +L+ F++   DL + H NSN F+G     + K P L+ELD+SNN   
Sbjct  108   ASIDFNGFQLSAPTLDGFIDQLPDLALFHANSNKFSGTISPKITKLPFLYELDISNNNFH  167

Query  1209  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVF  1030
             G+FP  +L    L++LD+RFN  TG V PQVFT  LD LFLNNN F   LP+NLGST V 
Sbjct  168   GSFPMEILGIPGLSFLDIRFNFFTGTVPPQVFTQGLDVLFLNNNNFIQELPENLGSTTVL  227

Query  1029  FLTLANNQFSGPIPKTIGNASFLL-EVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTG  853
             +LTLANN+F GPIP++I  AS  L E LFLNN L+GCLPYE+G L+   +FDA  N LTG
Sbjct  228   YLTLANNKFIGPIPRSITKASKTLKEALFLNNLLTGCLPYELGFLRELVLFDAGNNLLTG  287

Query  852   PIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKK  673
             P+P S GCL KLE  NLT N LYG VPE +C L  L  LSLS NYFT++GP CR L++  
Sbjct  288   PLPCSLGCLAKLEQFNLTGNLLYGQVPEVVCALGKLVNLSLSSNYFTELGPTCRKLVDSG  347

Query  672   VLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPCDIDESPRK  523
             VLDI  NCI DLP+QRS   C+ F L  + CP+ +S   +PC +  SP  
Sbjct  348   VLDIKKNCIHDLPDQRSVLECEAFSLQRRYCPNPESFNLIPCKVPSSPSH  397



>ref|XP_002300228.2| hypothetical protein POPTR_0001s30990g [Populus trichocarpa]
 gb|EEE85033.2| hypothetical protein POPTR_0001s30990g [Populus trichocarpa]
Length=421

 Score =   289 bits (739),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 173/350 (49%), Positives = 216/350 (62%), Gaps = 6/350 (2%)
 Frame = -1

Query  1569  LDPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  1390
             LD  +      I+ FK +IT DP NITQ+W G ++C     Y+GF+C  P   +   V  
Sbjct  53    LDQRLASVFPIIQVFKDTITSDPFNITQTWVGPDIC----NYKGFYCTSPPD-NNSAVAL  107

Query  1389  iyfngynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  1210
                +   F  +  +L+ F++   DL + H NSN F+G     + K P L+ELD+SNN   
Sbjct  108   ASIDFNGFQLSAPTLDGFIDQLPDLALFHANSNKFSGTISPKITKLPFLYELDISNNNFL  167

Query  1209  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVF  1030
             G FP  +L    L++LD+RFN  TG V P+VFT  LD LFLNNN F   LP+NLGST V 
Sbjct  168   GNFPMEILGIPGLSFLDIRFNFFTGTVPPEVFTQGLDVLFLNNNNFIQKLPENLGSTTVL  227

Query  1029  FLTLANNQFSGPIPKTIGNASFLL-EVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTG  853
             +LTLANN+F GPIP++I  AS  L EVLFLNN L+GCLPYE+G L    +FDA  N LTG
Sbjct  228   YLTLANNKFIGPIPRSISKASATLKEVLFLNNLLAGCLPYELGFLSELVLFDAGNNLLTG  287

Query  852   PIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKK  673
             P+P S GCL KLE  NLT N LYG VPE +C L  L  LSLS NYFT++GP CR L+   
Sbjct  288   PLPCSLGCLAKLEQFNLTGNLLYGQVPEVVCALGKLVNLSLSSNYFTELGPTCRKLVNSG  347

Query  672   VLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPCDIDESPRK  523
             VLDI  NCI DLP+QRS   C  F LH + CP+  S   +PC +  SP  
Sbjct  348   VLDIKKNCIHDLPDQRSVLECDAFSLHPRYCPNPASFNLIPCKVPSSPSH  397



>ref|XP_007201495.1| hypothetical protein PRUPE_ppa014775mg [Prunus persica]
 gb|EMJ02694.1| hypothetical protein PRUPE_ppa014775mg [Prunus persica]
Length=427

 Score =   289 bits (739),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 177/340 (52%), Positives = 216/340 (64%), Gaps = 7/340 (2%)
 Frame = -1

Query  1557  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  1378
             +R +   I+ FK+ I  DP+N T +W GN +C    KY+GF C V     K  V G+ FN
Sbjct  48    LRNAFNVIQAFKRRIQSDPKNYTGTWVGNNVC----KYKGFTCAVVPDLKKLTVIGVSFN  103

Query  1377  gynfngnglsl--nSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGA  1204
             G  F G    L  N F++   DLV  H NSNNFTG       +    +ELDLSNNKL G 
Sbjct  104   GALFGGFNNRLPLNGFIDRLEDLVFFHANSNNFTGTVPRGTARHRFFYELDLSNNKLTGG  163

Query  1203  FPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFL  1024
             FP   L ATNLT+LDLRFN     V P+VF LD+D LFLNNN F   LP NLGST   +L
Sbjct  164   FPNETLAATNLTFLDLRFNSFNATVPPKVFNLDVDLLFLNNNNFQQRLPGNLGSTRAHYL  223

Query  1023  TLANNQFSGPIPKTIGNA-SFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPI  847
             T ANN+F G IP++I NA + L EVLFL N+LSGCLPYEIG LK +TVFD S N LTGPI
Sbjct  224   TFANNKFVGSIPRSIRNARNTLYEVLFLGNRLSGCLPYEIGYLKQATVFDVSSNILTGPI  283

Query  846   PQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVL  667
             P SF CL KLE L+L +NQ YG VPE++C L+ LE  + + NYFT+IGP C  L+ KK+L
Sbjct  284   PNSFACLGKLEYLSLASNQFYGRVPEAVCGLRHLERFNAANNYFTRIGPACMTLIRKKIL  343

Query  666   DIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
             D+  NC+  LPNQ++A  C  FF   + CP    L  +PC
Sbjct  344   DVRGNCLPGLPNQKTAAQCAAFFSIPRTCPRRTRLSIIPC  383



>ref|XP_007160878.1| hypothetical protein PHAVU_001G024400g [Phaseolus vulgaris]
 gb|ESW32872.1| hypothetical protein PHAVU_001G024400g [Phaseolus vulgaris]
Length=427

 Score =   289 bits (739),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 163/334 (49%), Positives = 220/334 (66%), Gaps = 7/334 (2%)
 Frame = -1

Query  1536  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  1357
             I+ FK +IT DP  +T +W G+++C     Y+GF+C  P   +         +   F   
Sbjct  92    IQKFKSTITSDPLGVTNTWVGSDIC----SYKGFYCDTPPD-NTSATALASIDFNGFQLA  146

Query  1356  glslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  1177
               +L+ F+++  D+ + H NSNNF G     + K P L+ELD+SNN+L+G FP+AVL  +
Sbjct  147   ASTLDGFIDNLPDIALFHANSNNFGGTISPQIAKLPYLYELDVSNNQLSGPFPSAVLGLS  206

Query  1176  NLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTLANNQFSG  997
              LT+LDLRFN  +GPV PQ+F  +L  LF+NNN F+  LPDNL +T +  LTLANN+F G
Sbjct  207   TLTFLDLRFNFFSGPVPPQIFIQNLQVLFINNNIFTQGLPDNLATTQILLLTLANNKFMG  266

Query  996   PIPKTIGNA-SFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEK  820
             PIP+++  A + L EVLFLNN+L+GCLPYEIG L+ +TVFDA  NQLTGP+P S  CLEK
Sbjct  267   PIPRSLPKALATLSEVLFLNNQLTGCLPYEIGFLEEATVFDAGNNQLTGPLPLSLSCLEK  326

Query  819   LEILNLTNNQLYGSVPESLCK-LKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCIL  643
             +E+LNL  N LYG VPE +C  L +L   SLS NYFT +GP CR L+++ VLD+ NNCI 
Sbjct  327   VEVLNLGGNLLYGMVPEVVCAGLVNLVNFSLSDNYFTHVGPLCRILIQRGVLDVRNNCIP  386

Query  642   DLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPCDI  541
             DLP QRS   C +FF   + CP      ++PC +
Sbjct  387   DLPFQRSVIECAEFFATPRMCPFMWFYSFIPCKL  420



>ref|XP_010932202.1| PREDICTED: uncharacterized protein At4g06744-like [Elaeis guineensis]
Length=465

 Score =   290 bits (742),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 175/345 (51%), Positives = 220/345 (64%), Gaps = 14/345 (4%)
 Frame = -1

Query  1560  VIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyf  1381
             ++ ++ K I+ FK +IT DPQ IT SW+G  +C     Y GFFC +P      R      
Sbjct  88    LLYRAYKVIQKFKSTITCDPQGITNSWQGYNIC---STYNGFFCGIPPSRTTMR-NVASI  143

Query  1380  ngynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAGA  1204
             +   +N    ++N FV+   DL + H NSNNF+G   +P + K P  +ELDLSNN L G+
Sbjct  144   DFNGYNLAAPTINGFVDQMPDLAIFHANSNNFSGT--VPDLTKLPFFYELDLSNNILMGS  201

Query  1203  FPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFL  1024
             FPT VL   NLT+LDLRFN  +G V P VF + LD LF+NNN  + PLP  LG T   +L
Sbjct  202   FPTTVLPLANLTFLDLRFNQFSGCVPPGVFDIKLDVLFINNNNLNQPLPAELGRTTAAYL  261

Query  1023  TLANNQFSGPIPKTIGNA-SFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPI  847
             TLANN+F+GPIP +IG A + L+EVLFLNN LSGCLP+EIGLL  +TVFDA  NQ+TGPI
Sbjct  262   TLANNRFTGPIPSSIGQACNTLIEVLFLNNLLSGCLPHEIGLLSKATVFDAGTNQITGPI  321

Query  846   PQSFGCLEKLEILNLTNNQLYGSVPESLCKLKD---LEELSLSGNYFTQIGPECRNLLEK  676
             P SFGCL K+E LNL  N LYG VP+ +C L D   L  LSLS NYFT +G  C  L+E+
Sbjct  322   PLSFGCLMKVEQLNLAQNLLYGEVPDVVCLLADFGKLANLSLSSNYFTSLGKSCWKLIER  381

Query  675   KVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPCDI  541
              +LD+  NCI  LPNQRS + C  F    + CP      Y+PC I
Sbjct  382   GILDVRRNCIPWLPNQRSPEECGWFLKQRKYCPVSP---YIPCHI  423



>ref|XP_011029410.1| PREDICTED: uncharacterized protein At4g06744-like [Populus euphratica]
Length=430

 Score =   289 bits (739),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 165/333 (50%), Positives = 217/333 (65%), Gaps = 6/333 (2%)
 Frame = -1

Query  1536  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  1357
             I+ FK  IT DP  IT++W G+++C     Y+GFFC  P   +         +   F+  
Sbjct  88    IQKFKSLITSDPLGITKTWVGSDIC----NYKGFFCDSPPD-NNSATAVASIDFNGFHLA  142

Query  1356  glslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  1177
               +L+ F++   D+ + H NSNNF G     + + P L+ELD+SNN  +G+FPTAVL   
Sbjct  143   APTLDGFLDQLPDVALFHANSNNFAGTLSSNIARLPYLYELDISNNLFSGSFPTAVLGMD  202

Query  1176  NLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTLANNQFSG  997
              LT+LD+RFN  +G V PQ+FT +L+ LF+NNN F   LPDNLGST + +LTLANN+F G
Sbjct  203   GLTFLDIRFNFFSGAVPPQIFTQNLEVLFINNNNFMTTLPDNLGSTHILYLTLANNKFIG  262

Query  996   PIPKTIGNA-SFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEK  820
             PIP  I  A S L EVL  NN+L+GCLPYE+GLLK + VFDAS N+LTGP+P +  CLEK
Sbjct  263   PIPTGIFKAFSSLSEVLLSNNQLTGCLPYEVGLLKEAIVFDASNNELTGPLPVALSCLEK  322

Query  819   LEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILD  640
             +E+L+ T NQL+G VPE +C+LK L   SLS NYFT +GP CR L  + VLD+ NNCI  
Sbjct  323   VELLSFTCNQLFGMVPEVICELKKLRNFSLSDNYFTALGPVCRELFYEGVLDVTNNCIPG  382

Query  639   LPNQRSAQVCKDFFLHYQKCPDHKSLLYVPCDI  541
             LP QRS   C DF  H + CP   S  ++PC +
Sbjct  383   LPFQRSVVECLDFIAHPKSCPWMWSYTFIPCKL  415



>ref|XP_002894215.1| hypothetical protein ARALYDRAFT_474107 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70474.1| hypothetical protein ARALYDRAFT_474107 [Arabidopsis lyrata subsp. 
lyrata]
Length=478

 Score =   290 bits (743),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 169/342 (49%), Positives = 222/342 (65%), Gaps = 12/342 (4%)
 Frame = -1

Query  1560  VIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDK---KRVgg  1390
             +I+K    ++ FK  +  D     +SWEG ++C    KY G  C    G        V  
Sbjct  107   LIKKVYPVLQRFKGLVADDK---LKSWEGPDIC---NKYLGLKCATFPGTTDLALASVKF  160

Query  1389  iyfngynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKL  1213
                      G  L L++F++   ++ + H NSN+F G+  +P + K   LFELDLSNNKL
Sbjct  161   NGLKLRGKRGKKLLLDNFLDKLEEVTIFHANSNDFIGS--VPDISKLTYLFELDLSNNKL  218

Query  1212  AGAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPV  1033
              G FPT VL   NLT+LDLRFN  +G V PQVF LDLD LF+NNN     LP NLGS   
Sbjct  219   TGDFPTNVLMKNNLTFLDLRFNQFSGSVPPQVFNLDLDVLFINNNNLVQKLPSNLGSITA  278

Query  1032  FFLTLANNQFSGPIPKTIGNASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTG  853
              +LT ANN+F+G IP +IGN  +L EVLFLNN+L+GCLPY+IG L  +TVFD   NQLTG
Sbjct  279   LYLTFANNRFTGSIPASIGNIKYLQEVLFLNNQLTGCLPYQIGNLTRATVFDVGFNQLTG  338

Query  852   PIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKK  673
             PIP SFGCLE +E LNL  N+ YG++PE +C++  L+ +SLS NYFTQ+GP+CRNL+++K
Sbjct  339   PIPYSFGCLETMEQLNLAGNKFYGTIPEIVCEIACLKNVSLSYNYFTQVGPKCRNLIKRK  398

Query  672   VLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
             ++D+  NCILDLPNQ++   C +FF+  Q C + KSL  VPC
Sbjct  399   IMDVSMNCILDLPNQKTPSECANFFMRKQTCLNSKSLFTVPC  440



>ref|XP_010479447.1| PREDICTED: leucine-rich repeat extensin-like protein 3 [Camelina 
sativa]
Length=502

 Score =   291 bits (744),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 177/350 (51%), Positives = 228/350 (65%), Gaps = 11/350 (3%)
 Frame = -1

Query  1563  PVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiy  1384
             P ++K+   +  FKKS+  DP N   +W G ++C     Y G  C +  G    R   + 
Sbjct  135   PFLKKAYPILLEFKKSVK-DPLNKLYNWGGPDVC----SYNGLKCAMFPG---TRDLAVA  186

Query  1383  fngynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAG  1207
                +N    G  L+SF+   + + + H NSNNF G+  +P V K   LFELDLSNNKL G
Sbjct  187   SFQFNGFQLGGKLDSFLGKLDTVSIFHANSNNFIGS--VPDVSKLNFLFELDLSNNKLTG  244

Query  1206  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFF  1027
              FPT VL+ TNLT+LDLRFN  +G V PQVF LDLD LF+NNN     LP NLGS    +
Sbjct  245   DFPTNVLKGTNLTFLDLRFNTFSGSVPPQVFNLDLDVLFINNNNLVQNLPSNLGSITALY  304

Query  1026  LTLANNQFSGPIPKTIGNASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPI  847
             LT ANN+F+G IP++IGN  +L EVLFLNN+L+GCLPY+IG L  +TVFD   N+LTGPI
Sbjct  305   LTFANNRFTGSIPESIGNIKYLQEVLFLNNQLTGCLPYQIGNLNRATVFDVESNRLTGPI  364

Query  846   PQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVL  667
             P SFGCL+K+E L+L  N  YG++PE +C++  L+ LSLS NYFTQ GP+CR L+E+K+L
Sbjct  365   PYSFGCLDKMEQLSLARNNFYGTIPEIVCEIACLKNLSLSYNYFTQAGPKCRKLIERKIL  424

Query  666   DIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPCDIDESPRKAG  517
             D+  NCILDLPNQ+  + C  FF   Q C D KSL  VPC  + +  K G
Sbjct  425   DVRMNCILDLPNQKRPEECAVFFKRKQTCSDPKSLFIVPCGKNPNRLKPG  474



>ref|XP_010461823.1| PREDICTED: uncharacterized protein At4g06744-like [Camelina sativa]
Length=490

 Score =   290 bits (741),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 172/340 (51%), Positives = 224/340 (66%), Gaps = 10/340 (3%)
 Frame = -1

Query  1563  PVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiy  1384
             P ++K+   +  FKKS+  DP N   +W G ++C     Y G  C +    + + +    
Sbjct  122   PFLKKAYPILLEFKKSVK-DPLNKLYNWGGPDVC----NYNGLKCAI--FPNSRHLAVAS  174

Query  1383  fngynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAG  1207
                  F   G++L++F+   +   + H NSNNF G+  +P V K   LFELDLSNNKL G
Sbjct  175   VQFNGFQLGGITLDNFLGKLDTFSIFHANSNNFIGS--VPDVSKLNFLFELDLSNNKLTG  232

Query  1206  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFF  1027
              FPT VL+ TNLT+LDLRFN  +G V PQVF LDLD LF+NNN     LP NLGS    +
Sbjct  233   DFPTNVLKGTNLTFLDLRFNTFSGSVPPQVFNLDLDVLFINNNNLVQNLPSNLGSITALY  292

Query  1026  LTLANNQFSGPIPKTIGNASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPI  847
             LT ANN+F+G IP++IGN  +L EVLFLNN+L+GCLPY+IG L  +TVFD   N+LTGPI
Sbjct  293   LTFANNRFTGSIPESIGNIKYLQEVLFLNNQLTGCLPYQIGNLNQATVFDVESNRLTGPI  352

Query  846   PQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVL  667
             P SFGCL+K+E L+L  N  YG++PE +C++  L+ LSLS NYFTQ GP+CR L+E+K+L
Sbjct  353   PYSFGCLDKMEQLSLARNNFYGTIPEIVCEIACLKNLSLSYNYFTQAGPKCRKLIERKIL  412

Query  666   DIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
             D+  NCILDLPNQ+  + C  FF   Q C D KSL  VPC
Sbjct  413   DVRMNCILDLPNQKRPEECAVFFKRKQTCSDPKSLFIVPC  452



>emb|CDP01296.1| unnamed protein product [Coffea canephora]
Length=418

 Score =   286 bits (733),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 167/348 (48%), Positives = 220/348 (63%), Gaps = 12/348 (3%)
 Frame = -1

Query  1569  LDPVIRKSIK------AIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGD  1408
             L+P+I   ++       I  FKK I  DP  IT+SW G ++C     Y GF+C  P   +
Sbjct  56    LEPLIFADLRLAVVYPIILKFKKIINSDPLGITKSWVGADIC----NYTGFYCTSPPD-N  110

Query  1407  KKRVggiyfngynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDL  1228
                +     +   F  +  +L+ F++   DL + H NSNNF+G     + K P L+ELD+
Sbjct  111   CSAIALASIDFNGFRLSAPTLDGFLDQLPDLALFHANSNNFSGTVSADISKLPYLYELDI  170

Query  1227  SNNKLAGAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNL  1048
             SNN+ +G FPTAVL   +L++LD+RFN  TG V PQ+FT   DA+FLNNN F   LP+N+
Sbjct  171   SNNQFSGPFPTAVLGMNSLSFLDIRFNFFTGSVPPQLFTQAFDAIFLNNNNFMQRLPENI  230

Query  1047  GSTPVFFLTLANNQFSGPIPKTIGNA-SFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDAS  871
             G+T  F+LTLANN+F GPIP+ +  A + L EVL L+N L+GCLPYE+G LK + VFDA 
Sbjct  231   GNTRAFYLTLANNKFFGPIPRGLFRAMASLTEVLLLDNLLTGCLPYELGFLKEAVVFDAG  290

Query  870   INQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECR  691
              NQLTGPIP S GCL+K+E+LN   N LYG VPE +C L +L  LSLS NYFT +GP C 
Sbjct  291   NNQLTGPIPFSLGCLKKVEVLNFAGNYLYGMVPEVVCALGNLANLSLSDNYFTTVGPICW  350

Query  690   NLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
             NL++K VLD+  NCI  LP QRS   C  FF   + CP   +  Y+PC
Sbjct  351   NLIKKGVLDVRKNCIAGLPFQRSVWECAHFFARPRYCPYWAAFTYIPC  398



>gb|KHN22492.1| Hypothetical protein glysoja_041167 [Glycine soja]
Length=410

 Score =   286 bits (732),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 164/334 (49%), Positives = 221/334 (66%), Gaps = 7/334 (2%)
 Frame = -1

Query  1536  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  1357
             I+ FK +IT DP  +T++W G+++C     Y+GF+C +P   +         +   F  +
Sbjct  74    IQKFKSTITSDPLGVTKTWVGSDIC----SYKGFYCDIPPD-NSSATALASIDLNGFQLS  128

Query  1356  glslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  1177
               +L+ F+++  D+ + H NSNNF G     + K P L+ELD+SNN+L+G FPTAVL   
Sbjct  129   ASTLDGFIDNLPDIALFHANSNNFGGTISPQIAKLPYLYELDVSNNQLSGPFPTAVLGMN  188

Query  1176  NLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTLANNQFSG  997
             +LT+LDLRFN  +G V PQ+FT +L  LF+NNN F+  LPDNL ST +  LTLANN+F G
Sbjct  189   SLTFLDLRFNSFSGEVPPQIFTQNLQVLFINNNIFTQGLPDNLASTHILLLTLANNKFMG  248

Query  996   PIPKTIGNA-SFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEK  820
             PIP+++  A + L EVL LNN+L+GCLPYEIG L+ +TVFDA  NQLTGP+P S  CLEK
Sbjct  249   PIPRSLPKALATLSEVLLLNNQLTGCLPYEIGFLEEATVFDAGNNQLTGPLPLSLSCLEK  308

Query  819   LEILNLTNNQLYGSVPESLC-KLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCIL  643
             +E+LNL  N LYG VPE +C  L +L   SLS NYFT +GP CR L+++ VLD+ NNCI 
Sbjct  309   VEVLNLGGNMLYGMVPEVVCVGLVNLVNFSLSDNYFTHVGPLCRMLIQRGVLDVRNNCIP  368

Query  642   DLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPCDI  541
             DLP QRS   C +FF   + CP       +PC +
Sbjct  369   DLPFQRSVMECAEFFATPRMCPFMWFHGLIPCKL  402



>ref|XP_006422962.1| hypothetical protein CICLE_v10028712mg [Citrus clementina]
 gb|ESR36202.1| hypothetical protein CICLE_v10028712mg [Citrus clementina]
Length=360

 Score =   284 bits (727),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 164/327 (50%), Positives = 215/327 (66%), Gaps = 6/327 (2%)
 Frame = -1

Query  1524  KKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngnglsl  1345
             K +IT DP NIT +W G+++C    KY+GF+C  P   +   +     +   F     +L
Sbjct  8     KNTITSDPFNITSTWIGSDIC----KYKGFYCGHPPD-NLTAIALASIDFNGFELAAPTL  62

Query  1344  nSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEATNLTY  1165
             + F++   DL + H NSN F+G     + + P L+ELD+SNNK +G FP A+L   +L++
Sbjct  63    DGFIDQLPDLSLFHANSNKFSGTISPRLAQLPYLYELDISNNKFSGTFPVAILGKNDLSF  122

Query  1164  LDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTLANNQFSGPIPK  985
             LD+RFN  TG V PQVF   LD LFLNNN F   LP NLGSTP  +LT ANN+F+G IP+
Sbjct  123   LDIRFNFFTGSVPPQVFMQTLDVLFLNNNNFMQKLPQNLGSTPALYLTFANNKFTGSIPR  182

Query  984   TIGN-ASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEIL  808
             +IG  +S L+EVLFLNN L+GCLPYE+G L+ + VFDAS N+LTGP+P S GCLEK+E L
Sbjct  183   SIGKLSSTLIEVLFLNNLLTGCLPYELGFLREARVFDASNNRLTGPLPCSLGCLEKIERL  242

Query  807   NLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQ  628
             NL+ N LYG VPE LC L +L  LSLS NYFT +GP CR L++  VLD++ NCI  LP+Q
Sbjct  243   NLSGNLLYGQVPEVLCALDNLVNLSLSNNYFTGVGPLCRKLIKNGVLDVNRNCIHYLPDQ  302

Query  627   RSAQVCKDFFLHYQKCPDHKSLLYVPC  547
             RS   C  FFL  + C       ++PC
Sbjct  303   RSTHECALFFLQPRFCFYPSWYNFIPC  329



>ref|XP_003545325.1| PREDICTED: uncharacterized protein At4g06744-like [Glycine max]
Length=435

 Score =   286 bits (733),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 164/334 (49%), Positives = 221/334 (66%), Gaps = 7/334 (2%)
 Frame = -1

Query  1536  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  1357
             I+ FK +IT DP  +T++W G+++C     Y+GF+C +P   +         +   F  +
Sbjct  99    IQKFKSTITSDPLGVTKTWVGSDIC----SYKGFYCDIPPD-NSSATALASIDLNGFQLS  153

Query  1356  glslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  1177
               +L+ F+++  D+ + H NSNNF G     + K P L+ELD+SNN+L+G FPTAVL   
Sbjct  154   ASTLDGFIDNLPDIALFHANSNNFGGTISPQIAKLPYLYELDVSNNQLSGPFPTAVLGMN  213

Query  1176  NLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTLANNQFSG  997
             +LT+LDLRFN  +G V PQ+FT +L  LF+NNN F+  LPDNL ST +  LTLANN+F G
Sbjct  214   SLTFLDLRFNSFSGEVPPQIFTQNLQVLFINNNIFTQGLPDNLASTHILLLTLANNKFMG  273

Query  996   PIPKTIGNA-SFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEK  820
             PIP+++  A + L EVL LNN+L+GCLPYEIG L+ +TVFDA  NQLTGP+P S  CLEK
Sbjct  274   PIPRSLPKALATLSEVLLLNNQLTGCLPYEIGFLEEATVFDAGNNQLTGPLPLSLSCLEK  333

Query  819   LEILNLTNNQLYGSVPESLC-KLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCIL  643
             +E+LNL  N LYG VPE +C  L +L   SLS NYFT +GP CR L+++ VLD+ NNCI 
Sbjct  334   VEVLNLGGNMLYGMVPEVVCVGLVNLVNFSLSDNYFTHVGPLCRMLIQRGVLDVRNNCIP  393

Query  642   DLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPCDI  541
             DLP QRS   C +FF   + CP       +PC +
Sbjct  394   DLPFQRSVMECAEFFATPRMCPFMWFHGLIPCKL  427



>ref|XP_011000899.1| PREDICTED: uncharacterized protein At4g06744-like [Populus euphratica]
Length=423

 Score =   286 bits (731),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 174/347 (50%), Positives = 219/347 (63%), Gaps = 6/347 (2%)
 Frame = -1

Query  1569  LDPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  1390
             LD  +      I+ FK +IT DP NITQ+W G ++C     Y+GF+C  P   D   +  
Sbjct  53    LDQRLALVYPIIQDFKNTITSDPLNITQTWVGADIC----NYRGFYCTSPPDNDSA-ITL  107

Query  1389  iyfngynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  1210
                +   F  +  +L+ F++   DL + H NSN F+GA    + K   L+ELD+SNN   
Sbjct  108   ASIDFNGFQLSAPTLDGFIDQLPDLALFHANSNKFSGAISPKITKLQFLYELDISNNNFF  167

Query  1209  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVF  1030
             G+FP  VL    L++LD+RFN  TG V PQVFT  LD LFLNNN F   LP NLGSTPV 
Sbjct  168   GSFPMEVLGIPALSFLDIRFNFFTGTVPPQVFTQRLDVLFLNNNNFMQRLPQNLGSTPVL  227

Query  1029  FLTLANNQFSGPIPKTIGNASFLL-EVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTG  853
             +LTLANN+F GPIP++I  AS  L EVLF +N L+GCLPYE+G L+N  +FDAS N LTG
Sbjct  228   YLTLANNKFIGPIPRSIIEASATLTEVLFSHNLLTGCLPYELGFLRNLVLFDASNNFLTG  287

Query  852   PIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKK  673
              +P S GCL KLE  NL +N LYG VPE LC L  L  LSLS NYFT++GP+C  L ++ 
Sbjct  288   HLPCSLGCLAKLEQFNLASNLLYGQVPEVLCALGKLVNLSLSSNYFTKLGPKCGELEKRG  347

Query  672   VLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPCDIDES  532
             VLDI  NCI DLP QRSA+ C  F LH + C +  S  Y+PC +  S
Sbjct  348   VLDIRKNCIPDLPGQRSARECAAFSLHPRYCSNPASFNYIPCKVPSS  394



>ref|XP_010263446.1| PREDICTED: uncharacterized protein At4g06744-like [Nelumbo nucifera]
Length=474

 Score =   287 bits (735),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 171/343 (50%), Positives = 227/343 (66%), Gaps = 8/343 (2%)
 Frame = -1

Query  1536  IRTFKKSITY-DPQNITQSWEGNELCINKKKYQGFFC-YVPRGGDKKRVggiyfngynfn  1363
             I   +K + Y DP+   +SW+G  +C    K++G +C  VP    K   G  +       
Sbjct  112   IVELRKRLEYHDPKGKLKSWKGTNIC----KFEGLYCETVPDFKVKALAGIDFNGFNFGL  167

Query  1362  gnglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLE  1183
             G+ +SL   +E+ +DL + H NSN FTG     + K   L+ELDLSNNK  G+FP  VL 
Sbjct  168   GSNVSLEGIIENLSDLAIFHANSNFFTGKIVSQIGKLRFLYELDLSNNKYTGSFPMPVLN  227

Query  1182  ATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTLANNQF  1003
             A NL++LDLRFN   G + P VFTL+LD LF+NNN F GP+P NLGSTP  ++T A+N+F
Sbjct  228   AKNLSFLDLRFNSFCGYLPPDVFTLNLDVLFVNNNQFDGPIPYNLGSTPARYITFAHNRF  287

Query  1002  SGPIPKTIGNAS-FLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCL  826
             SG IP++IG A+  L EVLFLNN+LSGCLPYEIGLLK +TVFDA  N LTGPIP SFGCL
Sbjct  288   SGSIPRSIGKAAGTLTEVLFLNNQLSGCLPYEIGLLKKATVFDAGNNHLTGPIPYSFGCL  347

Query  825   EKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCI  646
             +++++L+   N+LYG VPE +C L  L  LSLS NYFTQ+GP+CR+L++K  L ++NNCI
Sbjct  348   KRMQLLSFAGNKLYGQVPEVVCALPKLANLSLSDNYFTQVGPKCRHLIKKGRLHLENNCI  407

Query  645   LDLPNQRSAQVCKDFF-LHYQKCPDHKSLLYVPCDIDESPRKA  520
             LDL +QRS   C+ FF    + C   K+   +PC +    +KA
Sbjct  408   LDLKSQRSPAECEKFFSSSMEYCSYEKTFNVIPCKLRHHSKKA  450



>ref|XP_010061722.1| PREDICTED: uncharacterized protein At4g06744-like [Eucalyptus 
grandis]
Length=455

 Score =   286 bits (732),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 173/335 (52%), Positives = 213/335 (64%), Gaps = 9/335 (3%)
 Frame = -1

Query  1539  AIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfng  1360
              I+ FK +IT DP  IT SW G ++C    KY+GF+C  P   +K        +   F  
Sbjct  110   VIQLFKSTITSDPLGITNSWVGGDIC----KYKGFYCDSPPD-NKSATALASIDFNGFGL  164

Query  1359  nglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEA  1180
             +  SL+ F++   D+ + H NSN F G     + K   L+ELDLSNNKL+G FPT VL  
Sbjct  165   SAPSLDGFLDQLPDIALFHANSNKFAGTISPNIAKLRYLYELDLSNNKLSGPFPTVVLGM  224

Query  1179  TNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTLANNQFS  1000
             T+L +LDLRFN  +G V  Q+FT DL  LFLNNN F   LPDNLG+T V +LTLANN+F+
Sbjct  225   TDLIFLDLRFNSFSGAVPAQIFTRDLYVLFLNNNAFDQTLPDNLGNTHVLYLTLANNKFT  284

Query  999   GPIPKTIGNA-SFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLE  823
             GPIP++I  A S L EVLFLNN+ SGCLPYEIGLL  + V DA  NQLTGP+P S  CLE
Sbjct  285   GPIPRSIAGAPSTLTEVLFLNNRFSGCLPYEIGLLDETVVLDAGNNQLTGPLPLSLFCLE  344

Query  822   KLEILNLTNNQLYGSVPESLCKL---KDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNN  652
             K+E LNL  N  YG VPE +C L   ++L  LSLS NYF  +GP CR L+EK +L++ NN
Sbjct  345   KVEQLNLGGNLFYGMVPEPICWLGLNRNLVNLSLSDNYFQHVGPWCRALIEKGILNVRNN  404

Query  651   CILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
             CI DLP QR    C  FF   + CP   S  YVPC
Sbjct  405   CIPDLPFQRPVADCARFFAQPRPCPRMWSYSYVPC  439



>ref|XP_009417193.1| PREDICTED: uncharacterized protein At4g06744-like [Musa acuminata 
subsp. malaccensis]
Length=456

 Score =   285 bits (730),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 170/352 (48%), Positives = 220/352 (63%), Gaps = 15/352 (4%)
 Frame = -1

Query  1551  KSIKAIRTFKKSITYDPQNITQSWEGNELCINKKK-YQGFFCYVPRGGDKKRVggiyfng  1375
             ++   I+ FK+++T DP+N T SW G  +C N  + YQGF+C  P G    R        
Sbjct  77    RAYFVIQRFKQTVTCDPKNKTGSWTGFRICNNDGRGYQGFYCETPPGLSNMRTIASVDFN  136

Query  1374  ynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAGAFP  1198
                         FV+   DL + H NSN+F G   +P +   P  +ELDLSNN+L+G FP
Sbjct  137   GFTLSAPTVCG-FVDQLPDLALFHANSNSFGGT--VPALASLPFFYELDLSNNRLSGGFP  193

Query  1197  TAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTL  1018
              +VL   +L +LDLR+N   GPV P VF +  D LFLNNN F+  +P NLGST   +LTL
Sbjct  194   ASVLPLVDLAFLDLRYNGYAGPVPPAVFLIRTDVLFLNNNGFTQNIPANLGSTTAAYLTL  253

Query  1017  ANNQFSGPIPKTIGNA-SFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQ  841
             ANN F+GPIP +IG A   L+EVLFL N+LSGCLPYE GLLK +TVFDA  NQ+TGPIP 
Sbjct  254   ANNDFTGPIPSSIGKACDTLIEVLFLGNRLSGCLPYETGLLKRATVFDAGSNQITGPIPL  313

Query  840   SFGCLEKLEILNLTNNQLYGSVPESLCKLK---DLEELSLSGNYFTQIGPECRNLLEKKV  670
             SFGCL+K+E LNL  N LYG VP+ +C+L     L  LSLS NYFT + P C  L+++KV
Sbjct  314   SFGCLQKVEQLNLAGNLLYGEVPDVVCQLAKYGHLANLSLSDNYFTSVAPSCAGLIQQKV  373

Query  669   LDIDNNCILDLPNQRSAQVCKDFFLHYQK--CPDHKSLLYVPCDIDESPRKA  520
             LD+  NCI  LPNQR  + C  +FL+  K  CP+ +   Y+PC +  + R A
Sbjct  374   LDVRKNCIPGLPNQRPPEACA-WFLNRPKITCPNAQ---YIPCHLPWAGRDA  421



>ref|XP_003528523.1| PREDICTED: uncharacterized protein At4g06744-like [Glycine max]
 gb|KHN43048.1| Hypothetical protein glysoja_007578 [Glycine soja]
Length=417

 Score =   284 bits (726),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 169/352 (48%), Positives = 223/352 (63%), Gaps = 10/352 (3%)
 Frame = -1

Query  1569  LDPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  1390
             +D  + +    I+TFK +IT DP+ +T +W G  +C     Y GF+C  P   +      
Sbjct  49    IDQRLAQVFPIIQTFKNTITSDPRGVTSTWVGPNIC----NYTGFYCDNPPD-NLTATTI  103

Query  1389  iyfngynfngnglslnSFVESFNDLVVIHVNSNNFTG--APGIPVQKFPTLFELDLSNNK  1216
                +   F     +L+ F++   DL + H NSN F+G  +P I   KF  L+ELDLSNN 
Sbjct  104   ASIDFNGFQLTAPTLDGFIDQLPDLALFHANSNKFSGIVSPKIAGLKF--LYELDLSNNL  161

Query  1215  LAGAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTP  1036
              +GAFPT+VL    L++LD+RFN  +G + PQ+F   LD LFLN+N F   LP+NLG+ P
Sbjct  162   FSGAFPTSVLNIPTLSFLDIRFNSFSGTLPPQIFMQTLDVLFLNDNNFMLTLPNNLGNAP  221

Query  1035  VFFLTLANNQFSGPIPKTIGNAS-FLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQL  859
             V +LTLANN+F+GPIP++IG AS  L+EVL LNN L+GCLPYEIG LKN T+FD   N L
Sbjct  222   VVYLTLANNKFTGPIPRSIGKASSTLIEVLLLNNLLTGCLPYEIGFLKNLTLFDVGGNLL  281

Query  858   TGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLE  679
             TGPIP SFGCL+K+E LNL  N LYG VPE +C L +L   SLS NYFT++GP C+ L++
Sbjct  282   TGPIPWSFGCLKKVEQLNLARNFLYGQVPEVVCALGNLANFSLSYNYFTKVGPLCKMLIQ  341

Query  678   KKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPCDIDESPRK  523
             + VLD+  NCI  LP+QRS + C  FFL  + C       +VPC I     K
Sbjct  342   RGVLDVRKNCIFGLPDQRSVRECMAFFLIPKSCSHPALFNFVPCQIQHHWTK  393



>ref|XP_004170987.1| PREDICTED: uncharacterized protein At4g06744-like, partial [Cucumis 
sativus]
Length=357

 Score =   282 bits (721),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 155/330 (47%), Positives = 214/330 (65%), Gaps = 14/330 (4%)
 Frame = -1

Query  1515  ITYDPQNITQSWEGNELCINKKKYQGFFC-YVPRGGDKKRVggiyfngynfngnglslnS  1339
             +  DPQN  ++W+G ++C    KY+G  C  VP   D K +     +   +  +G  L  
Sbjct  1     VELDPQNKLKTWKGPDVC----KYEGIGCDKVP---DYKTIAASGVSINGYGWSGSKLTL  53

Query  1338  --FVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEATNLTY  1165
               F++   D+   H NSNNF+G     +      +ELDLSNNK +G FP  VL AT LT+
Sbjct  54    NGFIDQLPDIAYFHANSNNFSGTIPELISDLRFFYELDLSNNKFSGDFPKQVLGATKLTF  113

Query  1164  LDLRFNMLTGPVHPQVftldldalflnnnfF-SGPLPDNLGSTPVFFLTLANNQFSGPIP  988
             LD+RFN  +GPV  ++F +D+      N+   +  +P NLG+TP  +LT  +N+F+GPIP
Sbjct  114   LDIRFNTFSGPVPGKLFDMDIITAIFLNDNKFNNCIPANLGNTPARYLTFTSNEFTGPIP  173

Query  987   KTIG---NASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKL  817
             K+IG     + L+EVLF +NKLSGCLP EIGLL+N+ +FDAS N LTGPIP SF CL K+
Sbjct  174   KSIGIGKTKTNLIEVLFSDNKLSGCLPMEIGLLENTILFDASKNSLTGPIPFSFSCLAKM  233

Query  816   EILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDL  637
             ++LN  NN LYG+VPE +CKL D+++L+L  N+ TQ+GP CR+L+ KKVLD+  NCIL L
Sbjct  234   QVLNFANNTLYGAVPEGVCKLPDIQQLTLRNNFITQVGPICRSLISKKVLDVSGNCILGL  293

Query  636   PNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
             P Q+S + C  FF H + CPD KS+ Y+PC
Sbjct  294   PEQKSEEECTHFFTHVELCPDEKSMKYIPC  323



>ref|XP_010691719.1| PREDICTED: uncharacterized protein At4g06744-like [Beta vulgaris 
subsp. vulgaris]
Length=463

 Score =   285 bits (729),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 159/266 (60%), Positives = 190/266 (71%), Gaps = 4/266 (2%)
 Frame = -1

Query  1338  FVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAGAFPTAVLEATNLTYL  1162
             F+    ++ V H NSNNF G   IP +   P LFELDLSNNK  G FP  VL AT LTYL
Sbjct  168   FINKLPEVSVFHANSNNFNGK--IPNLSHLPYLFELDLSNNKYEGKFPLNVLTATQLTYL  225

Query  1161  DLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTLANNQFSGPIPKT  982
             DLRFN   GP+ PQ+F L + ALF+NNN F   LP NLGSTP  FLT A+N+F+GPIPK+
Sbjct  226   DLRFNSFVGPIPPQLFDLQVLALFINNNNFEQDLPSNLGSTPAAFLTFASNKFTGPIPKS  285

Query  981   IGNAS-FLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILN  805
             I  AS  LLEVLFLNN LSGCLPYEIG LK + VFD S N LTGPIP+SFGCLEK++ L 
Sbjct  286   IKQASNTLLEVLFLNNHLSGCLPYEIGYLKKARVFDVSTNYLTGPIPRSFGCLEKMQNLV  345

Query  804   LTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQR  625
             + NN+ +G+VPE +C L  L++LSL  NYFTQ+GPEC  L+ K VLD+ NNCIL LPNQ+
Sbjct  346   MANNEFFGAVPEEVCMLPHLKQLSLCNNYFTQVGPECMKLVHKGVLDVTNNCILGLPNQK  405

Query  624   SAQVCKDFFLHYQKCPDHKSLLYVPC  547
             S ++C  FF   + C + KSL  VPC
Sbjct  406   SKEMCASFFKRPKTCGEEKSLTIVPC  431



>ref|XP_010500525.1| PREDICTED: leucine-rich repeat extensin-like protein 3 [Camelina 
sativa]
Length=504

 Score =   286 bits (732),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 176/340 (52%), Positives = 222/340 (65%), Gaps = 11/340 (3%)
 Frame = -1

Query  1563  PVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiy  1384
             P ++K+   +  FKKS+  DP N   +W G ++C     Y G  C +        V  I 
Sbjct  137   PFLKKAYPILLEFKKSVK-DPLNKLYNWGGPDVC----NYNGLKCAIFPNSKNLAVANIQ  191

Query  1383  fngynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAG  1207
             FNG+   G   S   F+   + + + H NSNNF G+  +P V K   LFELDLSNNKL G
Sbjct  192   FNGFQLGGKLDS---FLGKLDTVSIFHANSNNFIGS--VPDVSKLNFLFELDLSNNKLTG  246

Query  1206  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFF  1027
              FPT VL  TNLT+LDLRFN  +G V PQVF LDLD LF+NNN     LP NLGS    +
Sbjct  247   DFPTNVLTGTNLTFLDLRFNTFSGSVPPQVFNLDLDVLFINNNNLVQNLPRNLGSITALY  306

Query  1026  LTLANNQFSGPIPKTIGNASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPI  847
             LT ANN+F+G IP++IGN  +L EVLFLNN+L+GCLPY+IG L  +TVFD   N+LTGPI
Sbjct  307   LTFANNRFTGSIPESIGNIKYLQEVLFLNNQLTGCLPYQIGNLNRATVFDVESNRLTGPI  366

Query  846   PQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVL  667
             P SFGCL+K+E L+L  N  YG++PE +C++  L+ LSLS NYFTQ GP+CR L+E+K+L
Sbjct  367   PYSFGCLDKMEQLSLARNNFYGTIPEIVCEIACLKNLSLSYNYFTQAGPKCRKLIERKIL  426

Query  666   DIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
             D+  NCILDLPNQ+  + C  FF   Q C D KSL  VPC
Sbjct  427   DVRMNCILDLPNQKRPEECAVFFKRKQTCSDPKSLFIVPC  466



>ref|XP_010927582.1| PREDICTED: uncharacterized protein At4g06744-like [Elaeis guineensis]
Length=469

 Score =   285 bits (729),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 184/386 (48%), Positives = 233/386 (60%), Gaps = 26/386 (7%)
 Frame = -1

Query  1554  RKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfng  1375
             R++ K I+ FKK+IT DP  I+++W G ++C    KY+GF+C  P    K        + 
Sbjct  95    RQAYKVIQRFKKTITCDPMRISRTWNGAKVC----KYKGFYCETP-PNRKNTPTIASVDF  149

Query  1374  ynfngnglslnSFVESFNDLVVIHVNSNNFTGA-PGIPVQKFPTLFELDLSNNKLAGAFP  1198
               F+    ++++F+    D+ + H NSNNF+G  P +   +F  L+ELD+SNN   G FP
Sbjct  150   NIFHLCAPTVDNFINKLPDVALFHANSNNFSGTVPDLTGLQF--LYELDVSNNNQTGFFP  207

Query  1197  TAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTL  1018
             T VL   NLT+LDLRFN   G V P VF + LD LFLNNN FS  LPDNLG T   +LTL
Sbjct  208   TNVLPLLNLTFLDLRFNHFLGTVPPDVFDIKLDVLFLNNNNFSERLPDNLGRTTAAYLTL  267

Query  1017  ANNQFSGPIPKTIGNAS-FLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQ  841
             ANN F+GPIP++IG AS  LLEVLFLNN+LSGCLPYE+GLLK +TVFDA  N +TGPIP 
Sbjct  268   ANNHFTGPIPRSIGRASNTLLEVLFLNNELSGCLPYEVGLLKKATVFDAGTNHITGPIPL  327

Query  840   SFGCLEKLEILNLTNNQLYGSVPESLCKLKD---LEELSLSGNYFTQIGPECRNLLEKKV  670
             SFGCL+K+E LNL  N LYG VP+ +C+L D   L  LSLS NYFT +G  C  LLE+ +
Sbjct  328   SFGCLKKVEQLNLAQNFLYGEVPDVVCRLADVGHLANLSLSSNYFTWLGTSCWRLLERGI  387

Query  669   LDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPCDIDESPRKAGphphphrpy  490
             LD+  NCI  LP+QRS   C  F    + CP      ++PC +   P K G   H     
Sbjct  388   LDVRKNCIRGLPDQRSPAECFWFLKQPKYCP---YFPHIPCRL---PWKDGGAVHSAAAM  441

Query  489   kkhkRGSS--------TTYAALKVDR  436
                  G          TTY AL   R
Sbjct  442   LPAVGGGRDKAPASRYTTYTALHNRR  467



>gb|KGN43906.1| hypothetical protein Csa_7G073420 [Cucumis sativus]
Length=488

 Score =   285 bits (729),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 157/344 (46%), Positives = 220/344 (64%), Gaps = 14/344 (4%)
 Frame = -1

Query  1557  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFC-YVPRGGDKKRVggiyf  1381
             ++ +   I+ F   +  DPQN  ++W+G ++C    KY+G  C  VP   D K +     
Sbjct  118   LKIAFNTIQKFLPRVELDPQNKLKTWKGPDVC----KYEGIGCDKVP---DYKTIAASGV  170

Query  1380  ngynfngnglslnS--FVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  1207
             +   +  +G  L    F++   D+   H NSNNF+G     +      +ELDLSNNK +G
Sbjct  171   SINGYGWSGSKLTLNGFIDQLPDIAYFHANSNNFSGTIPELISDLRFFYELDLSNNKFSG  230

Query  1206  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfF-SGPLPDNLGSTPVF  1030
              FP  VL AT LT+LD+RFN  +GPV  ++F +D+      N+   +  +P NLG+TP  
Sbjct  231   DFPKQVLGATKLTFLDIRFNTFSGPVPGKLFDMDIITAIFLNDNKFNNCIPANLGNTPAR  290

Query  1029  FLTLANNQFSGPIPKTIG---NASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQL  859
             +LT  +N+F+GPIPK+IG     + L+EVLF +NKLSGCLP EIGLL+N+ +FDAS N L
Sbjct  291   YLTFTSNEFTGPIPKSIGIGKTKTNLIEVLFSDNKLSGCLPMEIGLLENTILFDASKNSL  350

Query  858   TGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLE  679
             TGPIP SF CL K+++LN  NN LYG+VPE +CKL D+++L+L  N+ TQ+GP CR+L+ 
Sbjct  351   TGPIPFSFSCLAKMQVLNFANNTLYGAVPEGVCKLPDIQQLTLRNNFITQVGPICRSLIS  410

Query  678   KKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
             KKVLD+  NCIL LP Q+S + C  FF H + CPD KS+ Y+PC
Sbjct  411   KKVLDVSGNCILGLPEQKSEEECTHFFTHVELCPDEKSMKYIPC  454



>ref|XP_008798694.1| PREDICTED: uncharacterized protein At4g06744-like [Phoenix dactylifera]
Length=469

 Score =   284 bits (727),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 167/352 (47%), Positives = 216/352 (61%), Gaps = 17/352 (5%)
 Frame = -1

Query  1554  RKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfng  1375
             R++   I+ FKK+IT DP+ +T++W G ++C    KY+GFFC  P    KK       + 
Sbjct  87    RRAYYVIQRFKKTITSDPRGVTRTWRGAKVC----KYKGFFCETP-PNRKKMPTIASVDF  141

Query  1374  ynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIPV-QKFPTLFELDLSNNKLAGAFP  1198
               F     S+  FV+   DL + H NSNN +    IP+  K    +ELD+SNN + G+FP
Sbjct  142   NTFRLAAPSVKKFVDQLPDLALFHANSNNLSARDTIPLLSKLRFFYELDVSNNNIPGSFP  201

Query  1197  TAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfF-SGPLPDNLGSTPVFFLT  1021
               VL   N+T+LDLRFN  +GP+ P VF L L  +   NN      LPD LG T   +LT
Sbjct  202   INVLPLQNVTFLDLRFNKFSGPLPPAVFDLKLIQVLFLNNNNFYQRLPDALGRTTAAYLT  261

Query  1020  LANNQFSGPIPKTIGNAS-FLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIP  844
              ANN+F+GPIP++IG     L+EVLFLNN+LSGCLPYE+GLLK +TVFDA  N +TGPIP
Sbjct  262   FANNRFTGPIPRSIGRTRKTLIEVLFLNNQLSGCLPYEVGLLKKATVFDAGTNYITGPIP  321

Query  843   QSFGCLEKLEILNLTNNQLYGSVPESLCKLKD---LEELSLSGNYFTQIGPECRNLLEKK  673
              SFGCL+K+E LNL  N LYG VP+ LC+L D   L  LSLS NYFT +G  C  L+++ 
Sbjct  322   LSFGCLKKVEQLNLAQNLLYGEVPDVLCRLADVGHLANLSLSSNYFTWVGTSCWQLIKRG  381

Query  672   VLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPCDIDESPRKAG  517
             +LD+  NCI  LP QRS   C  F    + CP    L ++PC I   PRK G
Sbjct  382   ILDVRKNCIRGLPEQRSPAECAQFLKQPKYCP---YLPHIPCRI---PRKDG  427



>ref|XP_002510174.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
 gb|EEF52361.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
Length=437

 Score =   283 bits (724),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 166/331 (50%), Positives = 218/331 (66%), Gaps = 6/331 (2%)
 Frame = -1

Query  1536  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  1357
             I+ FK  IT DP  IT++W G+++C     Y+GFFC  P   +K  +     +   F  +
Sbjct  97    IQKFKSIITSDPLGITKTWVGSDIC----SYKGFFCDNPPD-NKSAIAVASIDFNGFQLS  151

Query  1356  glslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  1177
               +L+ F++   D+ + H NSN F+G     + K P L+ELD+SNN  +G FPTAVL   
Sbjct  152   AATLDGFLDQLPDIALFHANSNFFSGTISPDIAKLPYLYELDISNNLFSGPFPTAVLGMN  211

Query  1176  NLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTLANNQFSG  997
              LT+LD+RFN  +G + PQ+FT +LDALFLNNN F   LPDN+ +T + +LTLANN+F G
Sbjct  212   GLTFLDIRFNFFSGAIPPQLFTQELDALFLNNNNFMTNLPDNIVNTHILYLTLANNKFIG  271

Query  996   PIPKTIGNA-SFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEK  820
             P+P  I  A S L EVL LNN+L+GCLPYEIGLLK + VFDA  N+LTG +P S  CL+K
Sbjct  272   PLPGGIFKAFSSLTEVLLLNNQLTGCLPYEIGLLKEAVVFDAGNNRLTGSLPLSLACLQK  331

Query  819   LEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILD  640
             +E LN   N L+G VPE +CK+++L  LSLS NYFT +GP CR L+ K VLD+ NNCI D
Sbjct  332   VEQLNFAGNLLFGMVPELVCKMENLVNLSLSDNYFTTVGPWCRILIAKGVLDVRNNCIPD  391

Query  639   LPNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
             LP QRS   C +FF H + CP   S  Y+PC
Sbjct  392   LPFQRSIMECANFFAHPRFCPHMWSYTYIPC  422



>ref|XP_002313863.2| hypothetical protein POPTR_0009s10140g [Populus trichocarpa]
 gb|EEE87818.2| hypothetical protein POPTR_0009s10140g [Populus trichocarpa]
Length=424

 Score =   283 bits (723),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 169/344 (49%), Positives = 216/344 (63%), Gaps = 6/344 (2%)
 Frame = -1

Query  1569  LDPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  1390
             LD  +      I+ FK +IT DP +ITQ+W G ++C     Y+GF+C  P   D   +  
Sbjct  53    LDQRLALVYPIIQDFKNTITSDPLDITQTWVGADIC----NYKGFYCTSPPDNDSA-ITL  107

Query  1389  iyfngynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  1210
                +   F  +  +L+ F++   DL + H NSN F+G     + K P L+ELD+SNN   
Sbjct  108   ASIDFNGFQLSAPTLDGFIDQLPDLALFHANSNKFSGTISPKITKLPFLYELDISNNNFF  167

Query  1209  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVF  1030
             G+FP  VL    L++LD+RFN  TG V PQVFT  LD LFLNNN F   LP+NLGSTPV 
Sbjct  168   GSFPMEVLAIPALSFLDIRFNFFTGTVPPQVFTQRLDVLFLNNNNFMQGLPENLGSTPVL  227

Query  1029  FLTLANNQFSGPIPKTIGNASFLL-EVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTG  853
             +LTLA N+F GPIP++I  AS  L EVLF +N L+GCLPYE+G L+   +FDAS N LTG
Sbjct  228   YLTLAYNKFIGPIPRSIIKASATLTEVLFSHNLLTGCLPYELGFLRKLVLFDASYNFLTG  287

Query  852   PIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKK  673
             P+P S GCL KLE  NL +N LYG VPE +C L  L  LSLS NYFT++GP+C  L    
Sbjct  288   PLPCSLGCLAKLEQFNLASNLLYGQVPEVVCALGKLVNLSLSSNYFTKLGPKCTKLERSG  347

Query  672   VLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPCDI  541
             VLDI  NCI DLP QRSA+ C  F LH + C +  S  ++PC +
Sbjct  348   VLDIRKNCIPDLPGQRSARECAAFSLHRRYCSNPASFNFIPCKV  391



>ref|XP_010270780.1| PREDICTED: uncharacterized protein At4g06744-like [Nelumbo nucifera]
Length=495

 Score =   285 bits (728),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 171/336 (51%), Positives = 220/336 (65%), Gaps = 8/336 (2%)
 Frame = -1

Query  1536  IRTFKKSITYDPQNITQSWEGN-ELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfng  1360
             I   +K IT DP++I ++W+ + ++C    +Y G +C       ++ + GI FN YN +G
Sbjct  134   IEKLRKRITGDPKHILRTWKKDGDIC----QYTGLYCEKVPDYKEQALAGIDFNSYNLSG  189

Query  1359  nglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEA  1180
               L+L+  +E+  DL + H NSN F G     ++     +ELDLSNN   G FP AVL A
Sbjct  190   PNLTLDGIIENLVDLAIFHANSNRFLGEILSKIRNLRYFYELDLSNNNYKGEFPKAVLTA  249

Query  1179  TNLTYLDLRFNMLTGPVHPQVftldldalflnnnfF-SGPLPDNLGSTPVFFLTLANNQF  1003
              NL++LDLRFN   G + PQVF L    +   NN +  GP+P NLGSTP  +LT ANNQF
Sbjct  250   ANLSFLDLRFNKFHGYLPPQVFNLGKIDVLFVNNNYFYGPIPYNLGSTPARYLTFANNQF  309

Query  1002  SGPIPKTIGNA-SFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCL  826
             SG IP +IG A   L+EVLFLNN+LSGCLPYEIG LK +TVFDA  N LTGPIP SFGCL
Sbjct  310   SGSIPPSIGKAKDTLVEVLFLNNQLSGCLPYEIGFLKKATVFDAGNNHLTGPIPYSFGCL  369

Query  825   EKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCI  646
             E++++LN T N+LYG VPE +C L  L   SLS NYFTQ+GP+CR L++K  LDI NNCI
Sbjct  370   ERMQLLNFTGNKLYGPVPEVVCGLPSLANFSLSDNYFTQVGPKCRELIKKGKLDIRNNCI  429

Query  645   LDLPNQRSAQVCKDFFLHYQK-CPDHKSLLYVPCDI  541
             LDLP+QR A  C+ FF    K C D K+   +PC +
Sbjct  430   LDLPSQRPADHCEKFFSSNPKYCSDLKTNTMIPCRL  465



>dbj|BAH19934.1| AT1G49750 [Arabidopsis thaliana]
Length=275

 Score =   277 bits (708),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 151/270 (56%), Positives = 192/270 (71%), Gaps = 3/270 (1%)
 Frame = -1

Query  1245  LFELDLSNNKLAGAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSG  1066
             L+ELDLSNNKL G FPT+VL+  NLT+LDLRFN  +G V PQVF LDLD LF+NNN    
Sbjct  5     LYELDLSNNKLTGDFPTSVLKGNNLTFLDLRFNSFSGSVPPQVFNLDLDVLFINNNNLVQ  64

Query  1065  PLPDNLGSTPVFFLTLANNQFSGPIPKTIGNASFLLEVLFLNNKLSGCLPYEIGLLKNST  886
              LP NLGS    +LT ANN+F+GPIP++IGN  +L EVLFLNNKL+GCLPY+IG L  +T
Sbjct  65    KLPLNLGSITALYLTFANNRFTGPIPESIGNIKYLQEVLFLNNKLTGCLPYQIGNLTRAT  124

Query  885   VFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQI  706
             VFD   NQLTGPIP SFGCLE +E LNL  N+ YG++PE +C++  L+ +SLS NYFTQ+
Sbjct  125   VFDVGFNQLTGPIPYSFGCLETMEQLNLAGNKFYGTIPEIVCEIACLQNVSLSNNYFTQV  184

Query  705   GPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPCDIDESPR  526
             GP+CR L+++K++D+  NCILDLPNQ++   C  FF+  Q CP+ KSL  VPC  D++P 
Sbjct  185   GPKCRKLIKRKIMDVSMNCILDLPNQKTPSECAKFFMRKQTCPNSKSLFTVPC--DKNPN  242

Query  525   KAGphphphrpykkhkRGSSTTYAALKVDR  436
             + G         +K +     TY  L  DR
Sbjct  243   R-GKPDQERLEEEKAQVSHPVTYNTLNPDR  271



>ref|XP_003538630.1| PREDICTED: uncharacterized protein At4g06744-like [Glycine max]
Length=437

 Score =   282 bits (722),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 169/347 (49%), Positives = 217/347 (63%), Gaps = 15/347 (4%)
 Frame = -1

Query  1557  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKK--RVggiy  1384
             + ++ +A+  F + +  DP   T +W+G++ C    K++G  C     G +    +    
Sbjct  68    LERARRALEKFTRLVD-DPNGYTSNWKGSDAC----KFRGVRCAKYPDGQQAVAGLDLNG  122

Query  1383  fngynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGA  1204
                       L L+  ++   +L   HVNSNNF+GA    + K+   FELDLSNNKL G 
Sbjct  123   AGLSGKKCTALMLSGLLDRIPELTFFHVNSNNFSGAIPTDITKYKFFFELDLSNNKLEGE  182

Query  1203  FPTAVLEA----TNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTP  1036
             FP  VL+       L +LDLRFN L+GP+ PQ+F LDLD +F+NNN F+G LPDN GSTP
Sbjct  183   FPKEVLQPKPKDQQLVFLDLRFNRLSGPIPPQLFDLDLDVIFINNNEFTGNLPDNFGSTP  242

Query  1035  VFFLTLANNQFSGPIPKTIGNAS-FLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQL  859
               +LT ANNQ +GPIP +IG AS  L EVLFL N   GCLP++IG L  +TVFD S N L
Sbjct  243   ARYLTFANNQLTGPIPPSIGKASKTLTEVLFLGNHFQGCLPFQIGYLVKATVFDVSKNSL  302

Query  858   TGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLE---ELSLSGNYFTQIGPECRN  688
             TGPIP SF CL  ++ LNL +NQ YG VPE LC+L  L     LSLS NYFTQ+GP CRN
Sbjct  303   TGPIPHSFACLASIQFLNLEHNQFYGEVPEMLCQLPGLRNNGSLSLSDNYFTQVGPACRN  362

Query  687   LLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
             L++ KVLD+ NNCIL LPNQR    C +FF   + CP+ K+L YVPC
Sbjct  363   LIKNKVLDVSNNCILGLPNQRPHGQCTEFFSKIKPCPNPKNLHYVPC  409



>gb|KHN05611.1| Hypothetical protein glysoja_047056 [Glycine soja]
Length=418

 Score =   281 bits (720),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 169/347 (49%), Positives = 216/347 (62%), Gaps = 15/347 (4%)
 Frame = -1

Query  1557  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKK--RVggiy  1384
             + ++ +A+  F + +  DP   T +W+G++ C    K++G  C     G +    +    
Sbjct  49    LERARRALEKFTRLVD-DPNGYTSNWKGSDAC----KFRGVRCAKYPDGQQAVAGLDLNG  103

Query  1383  fngynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGA  1204
                       L L+  ++   +L   HVNSNNF+GA    + K+   FELDLSNNKL G 
Sbjct  104   AGLSGKKCTALMLSGLLDRIPELTFFHVNSNNFSGAIPTDITKYKFFFELDLSNNKLEGE  163

Query  1203  FPTAVLEA----TNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTP  1036
             FP  VL+       L +LDLRFN L+GP+ PQ+F LDLD +F+NNN F+G LPDN GSTP
Sbjct  164   FPKEVLQPKPKDQQLVFLDLRFNRLSGPIPPQLFDLDLDVIFINNNEFTGNLPDNFGSTP  223

Query  1035  VFFLTLANNQFSGPIPKTIGNAS-FLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQL  859
               +LT ANNQ +GPIP +IG AS  L EVLFL N   GCLP++IG L  +TVFD S N L
Sbjct  224   ARYLTFANNQLTGPIPPSIGKASKTLTEVLFLGNHFQGCLPFQIGYLVKATVFDVSKNSL  283

Query  858   TGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLE---ELSLSGNYFTQIGPECRN  688
             TGPIP SF CL  ++ LNL  NQ YG VPE LC+L  L     LSLS NYFTQ+GP CRN
Sbjct  284   TGPIPHSFACLASIQFLNLERNQFYGEVPEMLCQLPGLRNNGSLSLSDNYFTQVGPACRN  343

Query  687   LLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
             L++ KVLD+ NNCIL LPNQR    C +FF   + CP+ K+L YVPC
Sbjct  344   LIKNKVLDVSNNCILGLPNQRPHGQCTEFFSKIKPCPNPKNLHYVPC  390



>ref|XP_003550327.1| PREDICTED: uncharacterized protein At4g06744-like [Glycine max]
Length=443

 Score =   282 bits (721),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 161/335 (48%), Positives = 217/335 (65%), Gaps = 7/335 (2%)
 Frame = -1

Query  1539  AIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfng  1360
              ++ FK +IT DP  +T++W G+++C     Y+GF+C  P   +         +   F  
Sbjct  106   TVQKFKSTITSDPLGVTKTWVGSDIC----SYKGFYCDTPPD-NSSATALASIDLNGFQL  160

Query  1359  nglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEA  1180
             +  +L+ F+++  D+ + H NSNNF G     + K   L+ELD+SNN+L+G FPTAVL  
Sbjct  161   SASTLDGFIDNLPDIALFHANSNNFGGTISPQIAKLSYLYELDVSNNQLSGPFPTAVLGM  220

Query  1179  TNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTLANNQFS  1000
             + LT+LDLRFN  +G V PQ+FT +L  LF+NNN  +  LPDNL ST +  LTLANN+F 
Sbjct  221   STLTFLDLRFNFFSGAVPPQIFTQNLQVLFINNNILTQGLPDNLASTHILLLTLANNKFM  280

Query  999   GPIPKTIGNA-SFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLE  823
             GPIP+++  A S L EVL LNN+L+GCLPYEIG L+ +TVFDA  NQLTGP+P S  CLE
Sbjct  281   GPIPRSLPKALSTLSEVLLLNNQLTGCLPYEIGFLEEATVFDAGNNQLTGPLPLSLSCLE  340

Query  822   KLEILNLTNNQLYGSVPESLC-KLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCI  646
             K+E+LN   N LYG VPE +C  L +L   SLS NYFT +GP CR L+++ VLD+ NNCI
Sbjct  341   KVEVLNFGGNLLYGMVPEVVCVGLVNLVNFSLSDNYFTHVGPFCRMLIQRGVLDVRNNCI  400

Query  645   LDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPCDI  541
              DLP QRS   C +FF   + CP       +PC +
Sbjct  401   PDLPFQRSVMECAEFFATPRMCPFMWFHGLIPCKL  435



>ref|XP_008454973.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis melo]
Length=520

 Score =   284 bits (727),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 160/341 (47%), Positives = 222/341 (65%), Gaps = 8/341 (2%)
 Frame = -1

Query  1557  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  1378
             ++ +   I+ F   +  DP+   ++W+G ++C    KY+G  C      + K   G+  N
Sbjct  150   LKIAFNTIQKFLPRVEVDPKKKLKTWKGPDVC----KYEGIGCDKVPDLNTKAASGVSLN  205

Query  1377  gynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFP  1198
             GY ++G+ L+LN F++   D+   H NSNNFTG     +      +ELDLSNNK +G FP
Sbjct  206   GYGWSGSKLTLNGFIDQLPDIAYFHANSNNFTGTIPELISDLRFFYELDLSNNKFSGDFP  265

Query  1197  TAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfF-SGPLPDNLGSTPVFFLT  1021
               VL AT LT+LD+RFN  +GPV  ++F +D+      NN   +  +P NLG+TP  +LT
Sbjct  266   KQVLGATKLTFLDIRFNTFSGPVPEKLFDMDILTAIFLNNNKFNHYIPANLGNTPARYLT  325

Query  1020  LANNQFSGPIPKTIG---NASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGP  850
               +N+F+GPIPK+IG       L+EVLF NNKLSGCLP EIGLL+N+ +FDAS N LTGP
Sbjct  326   FTSNEFTGPIPKSIGIGKTKKNLIEVLFSNNKLSGCLPMEIGLLENTILFDASNNSLTGP  385

Query  849   IPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKV  670
             IP SF CL K+++LN  +N LYG+VPE +CKL +++ L+L  N+ TQ+GP CR+L+ KKV
Sbjct  386   IPYSFACLAKIQLLNFADNTLYGAVPEGVCKLPNIQNLTLRNNFITQVGPVCRSLISKKV  445

Query  669   LDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
             LD+  NCIL LP QRS + C  FF H + CPD KS+ Y+PC
Sbjct  446   LDVSGNCILGLPEQRSEEECTHFFTHVELCPDEKSMKYIPC  486



>ref|XP_004137107.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis sativus]
Length=459

 Score =   282 bits (721),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 155/330 (47%), Positives = 214/330 (65%), Gaps = 14/330 (4%)
 Frame = -1

Query  1515  ITYDPQNITQSWEGNELCINKKKYQGFFC-YVPRGGDKKRVggiyfngynfngnglslnS  1339
             +  DPQN  ++W+G ++C    KY+G  C  VP   D K +     +   +  +G  L  
Sbjct  103   VELDPQNKLKTWKGPDVC----KYEGIGCDKVP---DYKTIAASGVSINGYGWSGSKLTL  155

Query  1338  --FVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEATNLTY  1165
               F++   D+   H NSNNF+G     +      +ELDLSNNK +G FP  VL AT LT+
Sbjct  156   NGFIDQLPDIAYFHANSNNFSGTIPELISDLRFFYELDLSNNKFSGDFPKQVLGATKLTF  215

Query  1164  LDLRFNMLTGPVHPQVftldldalflnnnfF-SGPLPDNLGSTPVFFLTLANNQFSGPIP  988
             LD+RFN  +GPV  ++F +D+      N+   +  +P NLG+TP  +LT  +N+F+GPIP
Sbjct  216   LDIRFNTFSGPVPGKLFDMDIITAIFLNDNKFNNCIPANLGNTPARYLTFTSNEFTGPIP  275

Query  987   KTIG---NASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKL  817
             K+IG     + L+EVLF +NKLSGCLP EIGLL+N+ +FDAS N LTGPIP SF CL K+
Sbjct  276   KSIGIGKTKTNLIEVLFSDNKLSGCLPMEIGLLENTILFDASKNSLTGPIPFSFSCLAKM  335

Query  816   EILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDL  637
             ++LN  NN LYG+VPE +CKL D+++L+L  N+ TQ+GP CR+L+ KKVLD+  NCIL L
Sbjct  336   QVLNFANNTLYGAVPEGVCKLPDIQQLTLRNNFITQVGPICRSLISKKVLDVSGNCILGL  395

Query  636   PNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
             P Q+S + C  FF H + CPD KS+ Y+PC
Sbjct  396   PEQKSEEECTHFFTHVELCPDEKSMKYIPC  425



>ref|XP_004291077.1| PREDICTED: uncharacterized protein At4g06744-like isoform 1 [Fragaria 
vesca subsp. vesca]
Length=430

 Score =   281 bits (719),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 166/333 (50%), Positives = 219/333 (66%), Gaps = 7/333 (2%)
 Frame = -1

Query  1539  AIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfng  1360
              I+ FK  IT DP NIT+SW G+++C     Y+GF+C  P   +   +     +   F  
Sbjct  87    VIQKFKSIITSDPLNITKSWVGSDIC----NYKGFYCDNPPY-NSSAIALASIDFNGFQL  141

Query  1359  nglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEA  1180
                SL+ F++   D+ + H NSNNF+G     +   P L+ELD+SNN  +G+FPTAVL  
Sbjct  142   GASSLDGFLDQLPDIALFHANSNNFSGTISSKIANLPYLYELDISNNLFSGSFPTAVLGM  201

Query  1179  TNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTLANNQFS  1000
              +L++LDLRFN  TG V PQ+FT DLDALFLNNN F   LPDNLGS+ +  LTLANN F+
Sbjct  202   NSLSFLDLRFNFFTGSVPPQIFTQDLDALFLNNNNFMQSLPDNLGSSHIILLTLANNNFN  261

Query  999   GPIPKTIGNA-SFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLE  823
             GPIP +I  A S L EVL LNN+L+GCLPYE+GLLK + V DAS NQLTGP+P S  CL+
Sbjct  262   GPIPTSIAAALSSLTEVLLLNNQLTGCLPYELGLLKEAIVLDASNNQLTGPLPFSLACLD  321

Query  822   KLEILNLTNNQLYGSVPESLCK-LKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCI  646
             K+E L+   N L+G VP+ +C+ L +L   SLS NYF  +GP C+ L+++ +LD+ NNCI
Sbjct  322   KVEQLSFAGNLLFGLVPDVICELLVNLANFSLSDNYFIHVGPICQRLIQRGLLDVTNNCI  381

Query  645   LDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
               LP QRS + C  FF H + CP+  S  Y+PC
Sbjct  382   PGLPFQRSVEECAGFFAHPRFCPNMWSYTYIPC  414



>ref|XP_011074595.1| PREDICTED: uncharacterized protein At4g06744-like [Sesamum indicum]
Length=411

 Score =   280 bits (716),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 166/332 (50%), Positives = 212/332 (64%), Gaps = 6/332 (2%)
 Frame = -1

Query  1539  AIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfng  1360
              I+ FK  IT DP NIT SW G ++C    KY+GF+C  P   +K  +     +   F  
Sbjct  68    VIQRFKNLITSDPLNITSSWIGTDIC----KYKGFYCESPPD-NKSAIALASIDFNGFQL  122

Query  1359  nglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEA  1180
             +  +L  F++   DL + H NSNNF G     + K P L+ELD+SNN+ +G FPTA+L  
Sbjct  123   SSPTLVGFLDLLPDLALFHANSNNFAGTIPGNIVKLPYLYELDISNNRFSGPFPTAILAM  182

Query  1179  TNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTLANNQFS  1000
               L++LD+R+N  +G V P++F  DLDALFLNNN F   LPD++G+T V +LTLANN+F 
Sbjct  183   EGLSFLDIRYNFFSGSVPPELFAKDLDALFLNNNNFMTRLPDDIGATHVEYLTLANNKFF  242

Query  999   GPIPKTIGNA-SFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLE  823
             GPIP+ I  A S L E+L L+N LSGCLPYE+GLLK + VFDA  N LTGP+P S GCLE
Sbjct  243   GPIPRGIAKALSGLSEILLLDNMLSGCLPYELGLLKEAVVFDAGNNNLTGPLPFSLGCLE  302

Query  822   KLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCIL  643
             KLE+LN   N LYGSVP+ LC L++L  LSLS NY TQ GP C  L++  VLD+  NCI 
Sbjct  303   KLEVLNFAGNLLYGSVPDVLCGLRNLMNLSLSDNYLTQAGPSCMRLIKNGVLDVRKNCIP  362

Query  642   DLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
               P QRS   C  FF   + CP   +   VPC
Sbjct  363   GQPFQRSVAECAAFFARPRNCPYMDTYSQVPC  394



>ref|XP_008342943.1| PREDICTED: uncharacterized protein At4g06744-like [Malus domestica]
Length=424

 Score =   280 bits (717),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 158/333 (47%), Positives = 216/333 (65%), Gaps = 6/333 (2%)
 Frame = -1

Query  1536  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  1357
             I TF+  I  DP  ITQ+W G+++C     Y+GF+C  P   +K        +   F  +
Sbjct  79    IMTFRNMIISDPLGITQTWVGSDIC----NYKGFYCDNPPD-NKSATTLASIDFNGFQLS  133

Query  1356  glslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  1177
               +L+ F++   DL + H NSNNF+G     +     L+ELD+SNN  +G FPTAVL   
Sbjct  134   APTLDGFIDQLPDLALFHANSNNFSGIVSPKIANLQYLYELDISNNNFSGPFPTAVLTMN  193

Query  1176  NLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTLANNQFSG  997
             +L++LD+R+N  TG V PQ+F   LD LF+NNN F   LPDNLG+T   +LTLANN+F+G
Sbjct  194   SLSFLDIRYNSFTGSVPPQIFKQTLDVLFINNNNFIQKLPDNLGATRALYLTLANNRFTG  253

Query  996   PIPKTIGNASFLL-EVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEK  820
             PIPK+IG+AS  L EVL LNN ++GC+PYE+G L+++T+FDA  N LTGP+P S GCL+K
Sbjct  254   PIPKSIGSASSSLKEVLLLNNLITGCIPYELGFLRDATLFDAGNNXLTGPLPCSLGCLDK  313

Query  819   LEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILD  640
             +E LN   N LYG  PE +C+L +L  LSLS NYFT +GP CR L++  VLD+  NCI  
Sbjct  314   MEELNFAGNLLYGKXPEVVCELGNLVNLSLSNNYFTSVGPICRQLIKNGVLDLRKNCIQH  373

Query  639   LPNQRSAQVCKDFFLHYQKCPDHKSLLYVPCDI  541
             L +QRS + C  FF+  + CPD  +   +PC +
Sbjct  374   LADQRSVEECALFFVKPRSCPDPSTFSLLPCKV  406



>ref|XP_010688602.1| PREDICTED: uncharacterized protein At4g06744 [Beta vulgaris subsp. 
vulgaris]
Length=461

 Score =   281 bits (720),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 155/331 (47%), Positives = 217/331 (66%), Gaps = 6/331 (2%)
 Frame = -1

Query  1536  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  1357
             I+ FK  IT DP  IT++W G+++C     Y+GFFC VP   +   +     +   +  +
Sbjct  131   IQNFKNIITSDPLGITKTWVGSDIC----SYKGFFCDVPPN-NASAIAVASIDFNGYGLS  185

Query  1356  glslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  1177
               +L+ F++   DL + H NSNNFTG     + K P L+ELD+SNNK  G FP AV+   
Sbjct  186   APTLDGFIDQLPDLALFHANSNNFTGTLSSNIAKLPYLYELDISNNKFTGPFPLAVVGMD  245

Query  1176  NLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTLANNQFSG  997
             +L +LD+RFN+ +G + P +FT +LD LFLN+N F   LP +LG+T + +LTLA+N+ +G
Sbjct  246   SLIFLDIRFNLFSGSIPPAIFTQNLDVLFLNDNNFVSSLPQSLGNTHILYLTLADNKITG  305

Query  996   PIPKTIGNA-SFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEK  820
             P+P  I  A S L EVL +NN+L+GCLPYE+G LK  TVFD S NQLTGP+P S  CLE+
Sbjct  306   PLPSDIAKALSALTEVLLMNNQLTGCLPYELGFLKQVTVFDISRNQLTGPLPFSLACLER  365

Query  819   LEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILD  640
             + +L+++ N LYG VP+ LC+L +L +L LS NYFTQ+GP CRNL+ + +LD+ NNC+ D
Sbjct  366   VALLDVSENLLYGMVPDMLCQLPNLGKLDLSDNYFTQVGPACRNLISRGILDVKNNCVPD  425

Query  639   LPNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
             LP QRS   C  FF   + CP   +   +PC
Sbjct  426   LPYQRSVFECASFFAVPKNCPYMDTFKIIPC  456



>ref|XP_007199295.1| hypothetical protein PRUPE_ppa023082mg, partial [Prunus persica]
 gb|EMJ00494.1| hypothetical protein PRUPE_ppa023082mg, partial [Prunus persica]
Length=398

 Score =   279 bits (714),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 157/310 (51%), Positives = 208/310 (67%), Gaps = 6/310 (2%)
 Frame = -1

Query  1536  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  1357
             I  FK +IT DP  ITQ+W G+++C     Y+GF+C  P   ++        +   F  +
Sbjct  42    INAFKNTITSDPLGITQTWVGSDICT----YKGFYCDRPPD-NQSAFALASIDFNGFQLS  96

Query  1356  glslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  1177
               S++ F++   DL + H NSNNF+G     +     L+ELD+SNN   G FPTAVL   
Sbjct  97    APSIDGFIDQLPDLALFHANSNNFSGIISPKIANLKYLYELDISNNNFFGPFPTAVLTMN  156

Query  1176  NLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTLANNQFSG  997
             NL++LD+RFN  TG V PQ+F   LD LF+NNN F   LPDNLG+TP  +LTLANN+F+G
Sbjct  157   NLSFLDIRFNSFTGSVPPQIFKKTLDVLFINNNKFIQKLPDNLGATPARYLTLANNKFTG  216

Query  996   PIPKTIGNAS-FLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEK  820
             PIPK+IG+AS  L+E L +NN ++GC+PYE+G LK++T+FDA  NQLTGP+P S GCLEK
Sbjct  217   PIPKSIGSASSTLIEALLMNNLITGCIPYELGFLKDATLFDAGNNQLTGPLPCSLGCLEK  276

Query  819   LEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILD  640
             +E LN   N LYG VPE +C+L +L  LSLS NYFT +GP CR L++  VLD+  NCI D
Sbjct  277   IEQLNFAGNFLYGKVPEVVCELGNLANLSLSNNYFTMVGPICRKLIKSGVLDLRKNCIRD  336

Query  639   LPNQRSAQVC  610
             L +QRS + C
Sbjct  337   LADQRSVEEC  346



>ref|XP_007017157.1| Leucine-rich repeat family protein [Theobroma cacao]
 gb|EOY14382.1| Leucine-rich repeat family protein [Theobroma cacao]
Length=441

 Score =   280 bits (717),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 162/332 (49%), Positives = 216/332 (65%), Gaps = 6/332 (2%)
 Frame = -1

Query  1539  AIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfng  1360
              I+ FK  IT DP  IT++W G+++C     Y+GF+C  P   +K  +     +   F  
Sbjct  99    VIQKFKSIITSDPLGITETWLGSDVC----SYKGFYCDNPPD-NKSAIAVASIDFNGFQL  153

Query  1359  nglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEA  1180
                +L+ F++   D  + H NSNNF G     + K   L+ELD+SNN+ +G FP AV++ 
Sbjct  154   AAPTLDGFLDKLPDTALFHANSNNFGGTLSPNIAKLRYLYELDISNNQFSGPFPAAVVDM  213

Query  1179  TNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTLANNQFS  1000
             + LT+LD+RFN  TG V  Q+FT +LDALF+NNN     LPD++GST + +LTLANN+F+
Sbjct  214   SGLTFLDIRFNFFTGSVPAQIFTQNLDALFINNNNLMIQLPDSIGSTHILYLTLANNKFN  273

Query  999   GPIPKTIGNA-SFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLE  823
             GP+P+ I  A   L EVL LN++L+GC+PYEIGLLK + VFDA  NQLTGP+P S  CLE
Sbjct  274   GPLPRGIFKAFPSLAEVLLLNDQLTGCIPYEIGLLKEAVVFDAGNNQLTGPLPFSLACLE  333

Query  822   KLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCIL  643
              LE LNL  N L+G+VPE LC+L  L  LSLS NYF  +GP CR L+E++VLD+ NNCI 
Sbjct  334   NLEQLNLAGNLLFGTVPEVLCELGKLVNLSLSDNYFIHVGPLCRILIERRVLDVRNNCIP  393

Query  642   DLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
              LP QRS   C +FF H   CP   S  ++PC
Sbjct  394   GLPFQRSIVECANFFAHPMFCPRMWSYTFIPC  425



>ref|XP_008393778.1| PREDICTED: uncharacterized protein At4g06744-like [Malus domestica]
Length=463

 Score =   280 bits (717),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 165/332 (50%), Positives = 215/332 (65%), Gaps = 7/332 (2%)
 Frame = -1

Query  1536  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  1357
             I+ FK  IT DP NIT++W G+ +C     Y+GF+C  P   +   +     +   F   
Sbjct  121   IQNFKSLITSDPLNITKTWVGSNIC----XYKGFYCDSPPN-NSSAIALASIDFNGFQLG  175

Query  1356  glslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  1177
               SL+ F++   D+ + H NSNNF+G     +   P L+ELD+SNN+ +GAFP+AVL   
Sbjct  176   APSLDGFLDQLPDIALFHANSNNFSGTVSPAIANLPYLYELDISNNQFSGAFPSAVLGMN  235

Query  1176  NLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTLANNQFSG  997
              L +LD+RFN  TG V P++FT +LDALFLNNN F   LPDNLGS+ +  LTLANN+F+G
Sbjct  236   TLGFLDIRFNFFTGAVPPEIFTQELDALFLNNNNFMQNLPDNLGSSHILLLTLANNKFTG  295

Query  996   PIPKTIGNA-SFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEK  820
              IP  I  A + L EVL LNN+L+GCLPYEIGLLK + V D   NQLTGP+P S  CLE 
Sbjct  296   SIPSGISKAFAALTEVLLLNNQLTGCLPYEIGLLKQALVLDVGNNQLTGPLPFSLACLEN  355

Query  819   LEILNLTNNQLYGSVPESLC-KLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCIL  643
             +E LN   N L+G VPE +C +L+ LE  SLS NYFT +GP CR+L+ K VLD+ NNC+ 
Sbjct  356   VEQLNFAGNLLHGMVPEVVCHELQSLENFSLSDNYFTNVGPICRSLIGKGVLDVTNNCVP  415

Query  642   DLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
             DLP QR  + C DFF H + CP   +  Y+PC
Sbjct  416   DLPFQRPVEECADFFAHPRFCPFMWTYTYIPC  447



>ref|XP_007157235.1| hypothetical protein PHAVU_002G054000g [Phaseolus vulgaris]
 gb|ESW29229.1| hypothetical protein PHAVU_002G054000g [Phaseolus vulgaris]
Length=433

 Score =   279 bits (713),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 160/348 (46%), Positives = 210/348 (60%), Gaps = 14/348 (4%)
 Frame = -1

Query  1566  DPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKK----R  1399
             +P + +  K +  F  ++  D       W G+  C    K++G  C      +K+     
Sbjct  61    EPRLERGRKTLVGFTGAV--DKNKYIGDWRGSNPC----KFKGIRCAKYPDSEKQLAIAG  114

Query  1398  VggiyfngynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNN  1219
             +          N   L L+  ++   +L   HVNSNNFTGA    + ++   FELDLSNN
Sbjct  115   IDLNGAGLSGKNRAPLLLSGILDRIPELTFFHVNSNNFTGAIPPQITQYEYFFELDLSNN  174

Query  1218  KLAGAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfF-SGPLPDNLGS  1042
             +L G FP  VL+++ L +LDLRFN L G +  Q+F L    +   NN   +G LPD+ GS
Sbjct  175   RLKGEFPKEVLQSSQLVFLDLRFNSLYGSIPSQLFHLKYLDVIFINNNQFTGNLPDDFGS  234

Query  1041  TPVFFLTLANNQFSGPIPKTIGNASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQ  862
             TP  +LT ANNQ +GPIP ++G A  L+EVLFL N   GCLPY+IGLL  +TVFD S N 
Sbjct  235   TPARYLTFANNQLTGPIPASVGAAKNLVEVLFLGNHFQGCLPYQIGLLNKATVFDVSKNW  294

Query  861   LTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLE---ELSLSGNYFTQIGPECR  691
             LTGPIP+SFGCLE +  LNL  NQ+YG VPE++C+L  L     LSLS NYFTQ+GP CR
Sbjct  295   LTGPIPRSFGCLESIRYLNLEQNQMYGEVPETVCELPGLRNRGNLSLSDNYFTQVGPACR  354

Query  690   NLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
              L+E  VLD+ NNCIL LPNQR+ + C  FF + + CP+ KSL YVPC
Sbjct  355   RLIEANVLDVRNNCILGLPNQRTHEQCSQFFSNLKPCPNPKSLNYVPC  402



>ref|XP_007042487.1| Leucine-rich repeat family protein, putative [Theobroma cacao]
 gb|EOX98318.1| Leucine-rich repeat family protein, putative [Theobroma cacao]
Length=415

 Score =   278 bits (710),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 161/333 (48%), Positives = 214/333 (64%), Gaps = 10/333 (3%)
 Frame = -1

Query  1536  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  1357
             I+ FK +IT DP N T +W G ++C     Y GFFC  P   ++  +     +   F   
Sbjct  61    IQAFKGTITGDPLNKTGNWVGCDIC----NYTGFFCDNPPD-NESALALAGIDFNGFLLT  115

Query  1356  glslnSFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAGAFPTAVLEA  1180
               +L  F++   DL + H NSN FTG+  +P V   P  +ELD+SNN  +G FPT VL  
Sbjct  116   APTLEGFIDMLPDLAIFHANSNKFTGS--VPDVSNLPYFYELDISNNIFSGTFPTTVLGI  173

Query  1179  TNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTLANNQFS  1000
              +L++LD+RFN   G V PQ+F   L+ LF+N+N F+  LP+N GSTPV +LTLANN+ +
Sbjct  174   KDLSFLDIRFNSFAGTVPPQIFNQALEVLFINDNDFTATLPENFGSTPVLYLTLANNKLT  233

Query  999   GPIPKTIGNA-SFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLE  823
             GPIP++IGN  S L EVL LNNKLSGCLPYE+G LK   VFD   N LTGP+P S  CLE
Sbjct  234   GPIPRSIGNLNSTLTEVLLLNNKLSGCLPYELGFLKELEVFDVENNLLTGPLPWSLACLE  293

Query  822   KLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCIL  643
             K+++LN  +N LY  VPE LC L +LE LSLS NYFT++GP CR L++  VL++  NCI 
Sbjct  294   KIKLLNFASNLLYWEVPELLCALGNLENLSLSDNYFTKVGPICRKLIKNGVLNVRQNCIH  353

Query  642   DLPNQRSAQVCKDFFLHYQK-CPDHKSLLYVPC  547
             DLP+Q+S   C +F+L Y + CP   +   +PC
Sbjct  354   DLPDQKSLHECAEFYLKYIRLCPYPATYKIIPC  386



>ref|XP_004304026.1| PREDICTED: uncharacterized protein At4g06744-like isoform 1 [Fragaria 
vesca subsp. vesca]
Length=451

 Score =   278 bits (712),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 169/371 (46%), Positives = 225/371 (61%), Gaps = 46/371 (12%)
 Frame = -1

Query  1536  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  1357
             I++FK  IT DP  IT++W G ++C     Y+GF+C +P   +         +   F  +
Sbjct  65    IQSFKNIITSDPLGITKTWVGADIC----NYKGFYCDIPPD-NATATAIASIDFNGFQLS  119

Query  1356  glslnSFVESFNDLVVIHVNSNNFTGAPGIP--VQKF-----------------------  1252
               +L+ F++   DL + H NSNNF+G+ GI   VQ F                       
Sbjct  120   APTLDGFIDQLPDLALFHANSNNFSGSLGIVIVVQSFIELISDRYLYFKSSTYILTWMFN  179

Query  1251  ---------------PTLFELDLSNNKLAGAFPTAVLEATNLTYLDLRFNMLTGPVHPQV  1117
                              L+ELD+SNN   G FPTAVL   +L++LD+R+N  TG + P++
Sbjct  180   MFTYSGILTPKIANLQYLYELDISNNNFFGPFPTAVLTMNSLSFLDIRYNSFTGSIPPEI  239

Query  1116  ftldldalflnnnfFSGPLPDNLGSTPVFFLTLANNQFSGPIPKTIGNAS-FLLEVLFLN  940
             F   LD LFLNNN F   LPDNLG+T   +LTLANN+F+G IPK+IG+AS  L+E L LN
Sbjct  240   FKQTLDVLFLNNNNFMQSLPDNLGATSALYLTLANNKFTGSIPKSIGSASPTLVEALLLN  299

Query  939   NKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLC  760
             N L+GC+PYE+G L+++TVFDA  NQLTGP+P S GCL+K+E LN  +N LYG VPE LC
Sbjct  300   NLLTGCIPYELGFLRDATVFDAGNNQLTGPLPCSLGCLDKIEQLNFADNFLYGRVPEVLC  359

Query  759   KLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKC  580
             +L +L  LSLS NYFT +G  CR L+EK VLDI NNCI DL +QRSA+ C  FFLH + C
Sbjct  360   ELGNLANLSLSNNYFTGVGTACRKLIEKGVLDIRNNCIQDLADQRSAEECALFFLHPKSC  419

Query  579   PDHKSLLYVPC  547
                ++   +PC
Sbjct  420   LHPETYSLIPC  430



>ref|XP_009345138.1| PREDICTED: uncharacterized protein At4g06744-like [Pyrus x bretschneideri]
Length=426

 Score =   277 bits (709),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 157/333 (47%), Positives = 215/333 (65%), Gaps = 6/333 (2%)
 Frame = -1

Query  1536  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  1357
             I +F+ +I  DP  IT +W G+++C     Y+GF+C  P   +K        +   F  +
Sbjct  79    IMSFRNTIISDPLGITNTWVGSDIC----NYKGFYCDNPPD-NKSATTLASIDFNGFQLS  133

Query  1356  glslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  1177
               +L+ F++   DL + H NSNNF+G     +     L+ELD+SNN  +G FPTAVL   
Sbjct  134   APTLDGFIDQLPDLALFHANSNNFSGIVSPKIANLQYLYELDISNNNFSGPFPTAVLTMN  193

Query  1176  NLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTLANNQFSG  997
             +L +LD+R+N  TG V PQ+F   L+ LF+NNN F   LPDNLG+T   +LTLANN+F+G
Sbjct  194   SLLFLDIRYNSFTGSVPPQIFEQTLEVLFINNNNFIQKLPDNLGATRALYLTLANNRFTG  253

Query  996   PIPKTIGNASFLL-EVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEK  820
             PIPK+IG AS  L EVL LNN ++GC+PYE+G L+++T+FDA  N LTGP+P S GCL+K
Sbjct  254   PIPKSIGTASSSLKEVLLLNNLITGCIPYELGFLRDATLFDAGNNLLTGPLPCSLGCLDK  313

Query  819   LEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILD  640
             +E LN   N LYG +PE LC+L +L  LSLS NYFT +GP CR L+E  VLD+  NCI  
Sbjct  314   MEELNFAGNLLYGKLPEVLCELGNLVNLSLSNNYFTSVGPMCRKLIENGVLDLRKNCIQH  373

Query  639   LPNQRSAQVCKDFFLHYQKCPDHKSLLYVPCDI  541
             L +QRSA+ C  FF + + CP   +   +PC +
Sbjct  374   LADQRSAEECALFFGNPRSCPHPATFSLLPCKV  406



>ref|XP_009395500.1| PREDICTED: uncharacterized protein At4g06744-like [Musa acuminata 
subsp. malaccensis]
Length=448

 Score =   277 bits (708),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 170/342 (50%), Positives = 211/342 (62%), Gaps = 13/342 (4%)
 Frame = -1

Query  1536  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  1357
             I+ FK+SIT DP  + Q+W G   C     YQGF+C  P                     
Sbjct  93    IQRFKRSITCDPNGVIQTWVGYRPC----TYQGFYCAAPPDSPDTPTIASVDFNGFRLCA  148

Query  1356  glslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  1177
                   FV+   D+ + H NSNNF+G P   +   P L+ELD+SNN  +G FP  VL  +
Sbjct  149   PTVAG-FVDQLPDVALFHANSNNFSG-PIPDLTGLPYLYELDVSNNLHSGPFPADVLALS  206

Query  1176  NLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTLANNQFSG  997
             NL +LDLR+N+  G V   VF LDLD LFLNNN F  PLP +LGS+PV +LTLANN F+G
Sbjct  207   NLIFLDLRYNLFAGSVPASVFALDLDVLFLNNNNFFRPLPADLGSSPVAYLTLANNGFTG  266

Query  996   PIPKTIGNAS-FLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEK  820
             PIP++I NAS  L+EVLFLNNKLSGCLPYEIGLL  +TVFDA  NQ+TGPIP SFGCL K
Sbjct  267   PIPRSICNASKTLVEVLFLNNKLSGCLPYEIGLLSIATVFDAGFNQVTGPIPWSFGCLLK  326

Query  819   LEILNLTNNQLYGSVPESLCKLK---DLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNC  649
             +E LNL  N LYG VP+ +C+L    +L  LSLSGNYFT +G  C +L++ KVLD+ +NC
Sbjct  327   VEQLNLAGNLLYGEVPDVVCRLAKDGNLANLSLSGNYFTSLGLSCWDLVKSKVLDVRHNC  386

Query  648   ILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPCDIDESPRK  523
             I+ LP QR    C  F    + CP      Y+PC +     K
Sbjct  387   IVGLPEQRPPSECSKFLWRPKHCPVSH---YIPCSLSNCSVK  425



>ref|XP_009359966.1| PREDICTED: uncharacterized protein At4g06744-like [Pyrus x bretschneideri]
Length=468

 Score =   278 bits (710),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 165/334 (49%), Positives = 214/334 (64%), Gaps = 7/334 (2%)
 Frame = -1

Query  1536  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  1357
             I+ FK  IT DP NIT++W G+ +C     Y+GF+C  P   +   +     +   F   
Sbjct  126   IQNFKSLITSDPLNITKTWVGSNIC----SYKGFYCDSPPN-NSSAIALASIDFNGFQLG  180

Query  1356  glslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  1177
               SL+ F++   D+ + H NSNNF+G     +   P L+ELD+SNN+ +GAFP+AVL   
Sbjct  181   APSLDGFLDQLPDIALFHANSNNFSGTVSPAIANLPYLYELDISNNQFSGAFPSAVLGMN  240

Query  1176  NLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTLANNQFSG  997
              L +LD+RFN  TG V PQ+FT +LDALFLNNN F   LPDNLGS+ +  LTLANN+F+G
Sbjct  241   TLGFLDIRFNFFTGAVPPQIFTQELDALFLNNNNFMQNLPDNLGSSHILLLTLANNKFTG  300

Query  996   PIPKTIGNA-SFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEK  820
              IP  I  A + L EVL LNN+L+GCLPYEIGLLK + V D   NQLTGP+P S  CLE 
Sbjct  301   SIPSGISKAFAALTEVLLLNNQLTGCLPYEIGLLKQAVVLDFGNNQLTGPLPFSLACLEN  360

Query  819   LEILNLTNNQLYGSVPESLC-KLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCIL  643
             +E LN   N L+G VPE LC +L+ L   SLS NYFT +GP CR+L+ K VLD+ NNC+ 
Sbjct  361   VEQLNFAGNLLHGMVPEVLCHELQSLANFSLSDNYFTNVGPICRSLIGKGVLDVTNNCVP  420

Query  642   DLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPCDI  541
             DL  QR  + C DFF H + CP   +  Y+PC +
Sbjct  421   DLLFQRPVEECADFFAHPRFCPFMWTYTYIPCKL  454



>ref|XP_004499033.1| PREDICTED: uncharacterized protein At4g06744-like [Cicer arietinum]
Length=382

 Score =   275 bits (702),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 161/348 (46%), Positives = 219/348 (63%), Gaps = 11/348 (3%)
 Frame = -1

Query  1566  DPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  1387
             D  + K    I+ FK  IT DP  +T+SW G+ +C     Y+GF+C  P   +   +   
Sbjct  29    DQRLAKVYPVIQKFKSLITSDPLGVTKSWVGSNIC----NYKGFYCDNPPDNNSA-IALA  83

Query  1386  yfngynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  1207
               +   F  +  +L+ F++   D+ + H NSNNF G+    ++  P L+ELDLSNNKL+G
Sbjct  84    SIDFNGFQLSASTLDGFIDKLPDIALFHANSNNFVGSITPLIRNLPYLYELDLSNNKLSG  143

Query  1206  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTP---  1036
              FP +VL   +LT+LDLRFN  +G V PQ+FT +L+ LF+NNN  +  LPDN  +T    
Sbjct  144   PFPNSVLGMNSLTFLDLRFNFFSGGVPPQIFTENLEVLFINNNLLTQNLPDNFDTTKSGN  203

Query  1035  -VFFLTLANNQFSGPIPKTIGNA-SFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQ  862
              +F LTLANN+FSGPIP+ +  A S L EV+ LNN L+GCLPYEIG L+ + VFD   NQ
Sbjct  204   HIFLLTLANNKFSGPIPRNLPKALSTLAEVVLLNNDLTGCLPYEIGYLEEAIVFDVGNNQ  263

Query  861   LTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCK-LKDLEELSLSGNYFTQIGPECRNL  685
             LTGP+P S  CLEK+E++NL  N  YG VP+ LC+ L++L   SL  NYFT +GP CR L
Sbjct  264   LTGPLPLSLSCLEKVEVVNLAGNMFYGMVPDVLCEGLENLVNFSLYDNYFTHVGPFCRML  323

Query  684   LEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPCDI  541
             +E+ +LD+  NCILDLP QRS   C DFF   + CP      + PC++
Sbjct  324   IERGILDVGKNCILDLPFQRSVIECADFFSRPKMCPFMWFHSFFPCNV  371



>ref|XP_008796513.1| PREDICTED: uncharacterized protein At4g06744-like, partial [Phoenix 
dactylifera]
Length=402

 Score =   275 bits (704),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 168/348 (48%), Positives = 225/348 (65%), Gaps = 14/348 (4%)
 Frame = -1

Query  1560  VIRKSIKAIRTFKKSITYDPQNITQSWEGNELC--INKKKYQGFFCYVPRGGDKKRVggi  1387
             ++ ++   I+ F+K+IT DP+ I++SW G ++C    +  Y+GFFC +P      R    
Sbjct  19    LLYRAYFVIQRFRKTITDDPKGISKSWRGYDICHKYTQDTYKGFFCGIPPTRKTMR-NVA  77

Query  1386  yfngynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLA  1210
               +   +N    +L  F++   DL + H NSNNF+G   +P + K   L+ELD SNNKL 
Sbjct  78    SIDFNGYNLGAETLQGFIDRMPDLAIFHANSNNFSGT--VPDLSKLRFLYELDFSNNKLT  135

Query  1209  GAFPTAVLEA-TNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPV  1033
             G+FP  VL    N+++LDLRFN   G V P VF + LD LF+NNN F+  LPD+LGST  
Sbjct  136   GSFPINVLPLLANISFLDLRFNQFFGTVPPSVFGIKLDVLFINNNNFTQALPDDLGSTNA  195

Query  1032  FFLTLANNQFSGPIPKTIGNA-SFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLT  856
              +LTLANN F+GPIP +IG A + L+EVL LNN LSGCLPY++GLLK +TVFDA  NQ+T
Sbjct  196   SYLTLANNGFTGPIPASIGKACNTLMEVLLLNNSLSGCLPYQVGLLKKATVFDAGTNQIT  255

Query  855   GPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKD---LEELSLSGNYFTQIGPECRNL  685
             GPIP SFGCL K+E LNL  N LYG VP+ +C+L D   L  LSLS NYFT +G  C  L
Sbjct  256   GPIPLSFGCLLKVEQLNLARNLLYGKVPDVVCRLADYGHLANLSLSSNYFTLLGFSCWEL  315

Query  684   LEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPCDI  541
             +++ +LD+ +NCI  LP+QRS + C  F    + CP    L Y+PC I
Sbjct  316   IDRGILDVRHNCIPGLPDQRSPEECAWFLKQPKYCP---VLPYIPCYI  360



>ref|XP_010928365.1| PREDICTED: uncharacterized protein At4g06744-like [Elaeis guineensis]
Length=457

 Score =   277 bits (708),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 175/343 (51%), Positives = 213/343 (62%), Gaps = 17/343 (5%)
 Frame = -1

Query  1536  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  1357
             I+ FKK+IT DP N+TQ+W G   C     YQGF+C  P                     
Sbjct  94    IQLFKKTITCDPNNVTQTWVGYRPC----TYQGFYCEAPPDSPDTPTIASIDFNGFHLCA  149

Query  1356  glslnSFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAGAFPTAVLEA  1180
                   F++   DL + H NSNNFTG   IP +      +ELD+SNN ++G FP  VL  
Sbjct  150   PTIAG-FIDKLPDLALFHANSNNFTGT--IPDLTGLQYFYELDVSNNNMSGPFPNDVLPL  206

Query  1179  TNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTLANNQFS  1000
              NLT+LDLRFN+  G V P +F+LDLD LFLNNNFF+  LP NLGST V +LTLANN F+
Sbjct  207   ANLTFLDLRFNLFAGAVPPSIFSLDLDVLFLNNNFFNQSLPFNLGSTQVAYLTLANNGFT  266

Query  999   GPIPKTIGNA-SFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLE  823
             GPIP++I NA S L EVLFLNN+LSGCLPYEIGLL  +TVFDA  NQ+TGPIP SFGCL+
Sbjct  267   GPIPRSISNAGSTLREVLFLNNRLSGCLPYEIGLLSEATVFDAGFNQITGPIPLSFGCLQ  326

Query  822   KLEILNLTNNQLYGSVPESLCKLK---DLEELSLSGNYFTQIGPECRNLLEKKVLDIDNN  652
             K+E LNL  N LYG+VP+ +C+L     L  LSLSGNYFT IG  C  L++  VLD+  N
Sbjct  327   KVEQLNLAGNLLYGNVPDVVCRLAKTGQLANLSLSGNYFTSIGYSCWELIKSGVLDVRQN  386

Query  651   CILDLPNQRSAQVCKDFFLH--YQKCPDHKSLLYVPCDIDESP  529
             CI   P+QR    C  FF H  +  CP      Y+PC    +P
Sbjct  387   CIPGFPDQRRPDECWWFFTHPRHYFCPFFH---YIPCKCPVAP  426



>gb|KHN30415.1| Hypothetical protein glysoja_033153 [Glycine soja]
Length=384

 Score =   274 bits (700),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 171/348 (49%), Positives = 211/348 (61%), Gaps = 16/348 (5%)
 Frame = -1

Query  1557  IRKSIKAIRTFKKSITYDPQNITQSW-EGNELCINKKKYQGFFCYVPRGGDKK--RVggi  1387
             + ++ KA+  F + +  DP   T +W EG + C    +++G  C     G +    +   
Sbjct  13    LERARKALIKFTRLVD-DPNGYTSNWKEGRDTC----EFRGVRCAKYPDGQQAVAGLDLN  67

Query  1386  yfngynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  1207
                        L L   ++S  +L   HVNSNNF+GA    + K+   FELDLSNNKL G
Sbjct  68    GAGLSGKKCTALMLTGILDSIPELTFFHVNSNNFSGAIPTDITKYKFFFELDLSNNKLEG  127

Query  1206  AFPTAVLEA----TNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGST  1039
              FP  VL+       L +LDLRFN L GP+ PQ+F LDLD +F+NNN FSG LPDN GST
Sbjct  128   EFPKEVLQPKPKDQQLVFLDLRFNSLCGPIPPQLFDLDLDVIFINNNKFSGHLPDNFGST  187

Query  1038  PVFFLTLANNQFSGPIPKTIGNAS-FLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQ  862
             P  +LT ANNQ +GPIP +IG AS  L EVLFL N   GCLPY+IG L  +TVFD S N 
Sbjct  188   PARYLTFANNQLTGPIPASIGKASKTLTEVLFLGNHFQGCLPYQIGYLDKATVFDVSKNS  247

Query  861   LTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLE---ELSLSGNYFTQIGPECR  691
             LTGPIP SF CL+ ++ LNL  NQ YG VPE LC L  L     LSLS NYFTQ+GP CR
Sbjct  248   LTGPIPHSFACLQSIQYLNLDRNQFYGEVPEMLCLLPGLRNNGNLSLSDNYFTQVGPACR  307

Query  690   NLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
             NL++  VLD+  NCIL LPNQR    C +FF   + CP+ K L YVPC
Sbjct  308   NLIKTNVLDVSYNCILGLPNQRPHGQCTEFFSKIKPCPNPKYLHYVPC  355



>ref|XP_010094651.1| Uncharacterized protein L484_008883 [Morus notabilis]
 gb|EXB56502.1| Uncharacterized protein L484_008883 [Morus notabilis]
Length=437

 Score =   275 bits (703),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 160/332 (48%), Positives = 213/332 (64%), Gaps = 5/332 (2%)
 Frame = -1

Query  1524  KKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngnglsl  1345
             K++ITYDP N T +W GN  C+    ++G++C      +   +  I FNG  F G  L+ 
Sbjct  81    KRNITYDPFNYTGTWVGNNYCL----FKGYYCDTVPDLNITGLASIDFNGARFGGRFLNF  136

Query  1344  nSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEATNLTY  1165
               +  +  D+ + H NSNNF+G     + +   L+ELDLSNN+  GAFP  VL ATNLT+
Sbjct  137   YRYSRNLPDIALFHANSNNFSGVINRNINQLRYLYELDLSNNRFLGAFPFYVLGATNLTF  196

Query  1164  LDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTLANNQFSGPIPK  985
             +DLRFN   G V  Q+F +D D LF+NNN F+  +P N G+TP  +LTLANN FSG IP 
Sbjct  197   VDLRFNRYAGGVPTQLFNIDTDVLFINNNGFANTIPTNFGNTPASYLTLANNNFSGTIPT  256

Query  984   TIGNA-SFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEIL  808
             +IG A + L EV+FLNN+L+GCLPYEIG L  +TVFD   N LTGPIPQSFGCL  L+ L
Sbjct  257   SIGRAWNTLKEVVFLNNRLTGCLPYEIGFLGQATVFDVGGNLLTGPIPQSFGCLRNLQYL  316

Query  807   NLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQ  628
             NL +NQLYG +PESLC+L +    +LS N+FTQ+G +CR L+    L++  NCIL LP+Q
Sbjct  317   NLAHNQLYGLIPESLCRLPNAYNFTLSYNFFTQVGVQCRRLIRAGTLNVRRNCILGLPDQ  376

Query  627   RSAQVCKDFFLHYQKCPDHKSLLYVPCDIDES  532
             +S   C  FF   + CP   +   V C+I  +
Sbjct  377   KSTAECGRFFSRARTCPRENTFSIVTCNISAT  408



>ref|XP_011069732.1| PREDICTED: uncharacterized protein At4g06744-like [Sesamum indicum]
Length=424

 Score =   274 bits (701),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 164/331 (50%), Positives = 210/331 (63%), Gaps = 6/331 (2%)
 Frame = -1

Query  1536  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  1357
             I+ FK  IT DP NIT SW G ++C     Y+GF+C  P   +K  +     +   F  +
Sbjct  79    IQKFKNLITSDPLNITGSWVGADIC----NYRGFYCESPPD-NKSAIALASIDFNGFQLS  133

Query  1356  glslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  1177
               SLN F++   D+ + H NSNNF GA    + K   L+ELD+SNN  +G FPTA+L   
Sbjct  134   APSLNGFLDQLPDIALFHANSNNFAGAISPNIAKLQYLYELDISNNNFSGPFPTALLGMD  193

Query  1176  NLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTLANNQFSG  997
             +L++LD+RFN  +G V  Q+F+ DLDALF+NNN F   LPD +GS  + +LTLANN+F G
Sbjct  194   SLSFLDVRFNSFSGAVPQQLFSKDLDALFINNNNFMTRLPDTIGSGRILYLTLANNKFFG  253

Query  996   PIPKTIGNA-SFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEK  820
             PIP+ I  A   L E+L LNN LSGCLPYE+GLLK + VFDA  N LTGP+P S  CLEK
Sbjct  254   PIPRGIAKALENLSEILLLNNLLSGCLPYELGLLKQAVVFDAGNNYLTGPLPFSLACLEK  313

Query  819   LEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILD  640
             LE+LN   N LYG +PE LC L +L  LSLS NYFT +GP C  L++  VLD+  NCI  
Sbjct  314   LEVLNFAGNLLYGHIPEVLCGLGNLANLSLSDNYFTGVGPVCWRLIKNGVLDVKKNCIPG  373

Query  639   LPNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
             LP QRS   C  FF H + CP   +  ++PC
Sbjct  374   LPFQRSVAECAAFFAHPRYCPYMPTYAHIPC  404



>ref|XP_004141388.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis sativus]
 ref|XP_004172481.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis sativus]
 gb|KGN55219.1| hypothetical protein Csa_4G641530 [Cucumis sativus]
Length=433

 Score =   274 bits (701),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 164/332 (49%), Positives = 209/332 (63%), Gaps = 6/332 (2%)
 Frame = -1

Query  1539  AIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfng  1360
              I+ FK  IT DP  IT++W G+++C     Y+GF+C  P   +K        +   F  
Sbjct  87    VIQKFKSIITSDPLGITKTWVGSDIC----NYKGFYCDNPPD-NKSATAVASIDFNGFQL  141

Query  1359  nglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEA  1180
             +  SL+ F++   D+ V H NSNNF+G     + K P L+ELD+SNN+L+G FPTAV+  
Sbjct  142   SAPSLDGFLDQLPDIAVFHANSNNFSGTISTNIAKLPYLYELDVSNNRLSGPFPTAVIGM  201

Query  1179  TNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTLANNQFS  1000
              +LT+LDLRFN  TG V PQVF  DLD L +NNN F   LPD+L  T + +LTLANN+FS
Sbjct  202   NSLTFLDLRFNFFTGSVPPQVFVQDLDFLLINNNNFMQSLPDSLSITHILYLTLANNRFS  261

Query  999   GPIPKTIGNA-SFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLE  823
             GPIP  I  A + L EVL LNN L+GCLPYE+G L  + VFDA  NQLTGP+P S GCL+
Sbjct  262   GPIPGGIVKALTSLTEVLLLNNSLTGCLPYELGSLDEAIVFDAGHNQLTGPLPLSLGCLK  321

Query  822   KLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCIL  643
              +E LN   N LYG VPE +C L+ L  L+LS NYFT +GP CR L+ + VL+I NNCI 
Sbjct  322   SVEQLNFAGNLLYGMVPEMVCALRHLVNLTLSDNYFTVVGPLCRILIGRGVLNIRNNCIP  381

Query  642   DLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
             DLP QR    C  F    + CP   S   +PC
Sbjct  382   DLPFQRPIIECAKFLAFPRICPRMWSYTLMPC  413



>ref|XP_003516778.2| PREDICTED: uncharacterized protein At4g06744-like [Glycine max]
Length=463

 Score =   275 bits (703),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 171/348 (49%), Positives = 211/348 (61%), Gaps = 16/348 (5%)
 Frame = -1

Query  1557  IRKSIKAIRTFKKSITYDPQNITQSW-EGNELCINKKKYQGFFCYVPRGGDKK--RVggi  1387
             + ++ KA+  F + +  DP   T +W EG + C    +++G  C     G +    +   
Sbjct  92    LERARKALIKFTRLVD-DPNGYTSNWKEGRDTC----EFRGVRCAKYPDGQQAVAGLDLN  146

Query  1386  yfngynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  1207
                        L L   ++S  +L   HVNSNNF+GA    + K+   FELDLSNNKL G
Sbjct  147   GAGLSGKKCTALMLTGILDSIPELTFFHVNSNNFSGAIPTDITKYKFFFELDLSNNKLEG  206

Query  1206  AFPTAVLE----ATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGST  1039
              FP  VL+       L +LDLRFN L GP+ PQ+F LDLD +F+NNN FSG LPDN GST
Sbjct  207   EFPKEVLQPKPKDQQLVFLDLRFNSLCGPIPPQLFDLDLDVIFINNNKFSGHLPDNFGST  266

Query  1038  PVFFLTLANNQFSGPIPKTIGNAS-FLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQ  862
             P  +LT ANNQ +GPIP +IG AS  L EVLFL N   GCLPY+IG L  +TVFD S N 
Sbjct  267   PARYLTFANNQLTGPIPASIGKASKTLTEVLFLGNHFQGCLPYQIGYLDKATVFDVSKNS  326

Query  861   LTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLE---ELSLSGNYFTQIGPECR  691
             LTGPIP SF CL+ ++ LNL  NQ YG VPE LC L  L     LSLS NYFTQ+GP CR
Sbjct  327   LTGPIPHSFACLQSIQYLNLDRNQFYGEVPEMLCLLPGLRNNGNLSLSDNYFTQVGPACR  386

Query  690   NLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
             NL++  VLD+  NCIL LPNQR    C +FF   + CP+ K L YVPC
Sbjct  387   NLIKTNVLDVSYNCILGLPNQRPHGQCTEFFSKIKPCPNPKYLHYVPC  434



>ref|XP_008799889.1| PREDICTED: uncharacterized protein At4g06744-like [Phoenix dactylifera]
Length=447

 Score =   274 bits (701),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 174/339 (51%), Positives = 211/339 (62%), Gaps = 22/339 (6%)
 Frame = -1

Query  1536  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  1357
             I+ FKK+IT DP N+T +W GN  C     YQGF+C  P                     
Sbjct  85    IQRFKKTITCDPNNVTGTWVGNLPC----TYQGFYCEAPPDSPNTPTIASVDFNGFHLCA  140

Query  1356  glslnSFVESFNDLVVIHVNSNNFTGA-PGI-PVQKFPTLFELDLSNNKLAGAFPTAVLE  1183
                   F++   DL + H NSNNFTG  P + P+Q F   +ELD+SNN ++G+FP  VL 
Sbjct  141   PTIAG-FIDQLPDLALFHANSNNFTGTIPDLTPLQYF---YELDVSNNNMSGSFPGNVLP  196

Query  1182  ATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTLANNQF  1003
               NLT+LDLRFN+  G V   +F + LD LFLNNN F+ PLP NLG T V +LTLANN F
Sbjct  197   LANLTFLDLRFNLFAGTVPSSIFNIALDVLFLNNNNFNQPLPANLGYTTVAYLTLANNGF  256

Query  1002  SGPIPKTIGNA-SFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCL  826
             +GPIPK+I  A S LLEVLFLNN+LSGCLPYEIGLL  +TVFDA  NQ+TGPIP SFGCL
Sbjct  257   TGPIPKSISKAGSTLLEVLFLNNRLSGCLPYEIGLLSEATVFDAGFNQITGPIPLSFGCL  316

Query  825   EKLEILNLTNNQLYGSVPESLCKLK---DLEELSLSGNYFTQIGPECRNLLEKKVLDIDN  655
             +K+E LNL  N LYG+VP+ +C+L     L  LSLSGNYFT IG  C  L++  VLD+  
Sbjct  317   QKVEQLNLAGNFLYGNVPDVVCRLAKTGQLANLSLSGNYFTWIGHSCWELVKSGVLDVRQ  376

Query  654   NCILDLPNQRSAQVCKDFFL---HYQKCPDHKSLLYVPC  547
             NCI   P QR    C  FF    HY  CP    L ++PC
Sbjct  377   NCIPGFPEQRHPDECWWFFAQPKHY--CP---FLHFIPC  410



>ref|XP_007157716.1| hypothetical protein PHAVU_002G092300g [Phaseolus vulgaris]
 gb|ESW29710.1| hypothetical protein PHAVU_002G092300g [Phaseolus vulgaris]
Length=413

 Score =   273 bits (697),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 162/340 (48%), Positives = 215/340 (63%), Gaps = 7/340 (2%)
 Frame = -1

Query  1536  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  1357
             I+ FK +I  DP  IT +W G  LC     Y GF+C  P   +         +   F   
Sbjct  60    IQAFKNTIISDPLGITATWVGPNLC----NYTGFYCDHPLD-NLTATTIASIDFNGFQLT  114

Query  1356  glslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  1177
               +L+ F++   DL + H NSN F+G     +     L+ELDLSNN  +G FP++V+   
Sbjct  115   APTLDGFIDQLPDLALFHANSNKFSGTISPKIAGLKFLYELDLSNNLFSGLFPSSVINIP  174

Query  1176  NLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTLANNQFSG  997
              L++LD+R+N  TG + PQ+F   LDALFLNNN F   LP+NLG TPV +LTLANN+F+G
Sbjct  175   TLSFLDIRYNFFTGTLPPQIFMQTLDALFLNNNNFMLTLPNNLGDTPVVYLTLANNKFTG  234

Query  996   PIPKTIGNAS-FLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEK  820
             PIP++I  AS  L+EVL LNN L+GCLPY+IG L N  + D   N LTGPIP SFGCL+K
Sbjct  235   PIPRSIRKASSTLIEVLLLNNLLTGCLPYDIGFLGNVRLLDVGGNLLTGPIPWSFGCLKK  294

Query  819   LEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILD  640
             +E LNL  N LYG VPE +C L +L  LSLS NYFT++GP C++L+++ VLD+ NNCI+ 
Sbjct  295   VEQLNLARNFLYGQVPEVVCALGNLANLSLSYNYFTKVGPSCKSLIQRGVLDVRNNCIVG  354

Query  639   LPNQRSAQVCKDFFLHYQKCPDHKSLLYVPCDIDES-PRK  523
             LP+QRSA+ C  FF   + C    S   +PC I  + PR+
Sbjct  355   LPDQRSAKECMAFFSIPRSCLHPASFNIIPCQIHWTKPRE  394



>ref|XP_008456145.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis melo]
Length=424

 Score =   273 bits (697),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 168/352 (48%), Positives = 219/352 (62%), Gaps = 6/352 (2%)
 Frame = -1

Query  1569  LDPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  1390
             LD  +  +   I+TFK  IT DP N+TQ+W G+++C    KYQGF+C  P   +K  V  
Sbjct  57    LDQRLAVAYPIIQTFKALITSDPLNVTQTWVGSDIC----KYQGFYCDNPPD-NKSAVAI  111

Query  1389  iyfngynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  1210
                +   F     +L+ F++S  DL + H NSNNF+G     +   P L+ELDLSNN+L+
Sbjct  112   AGIDFNGFQLTASTLDGFIDSLPDLAIFHANSNNFSGTITPKIASLPYLYELDLSNNQLS  171

Query  1209  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVF  1030
             G FP A+L  T+L++ D+RFN  TG V  Q+F    D LFLNNN F   LP N GST   
Sbjct  172   GTFPVAILSVTDLSFFDIRFNFFTGFVPQQLFVKSFDFLFLNNNNFGMKLPINFGSTTTS  231

Query  1029  FLTLANNQFSGPIPKTIGNASF-LLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTG  853
             ++TLANN+F+GPIP++IG AS  L E+L LNN+L+GC+PYE+G LK + VFDA  N LTG
Sbjct  232   YITLANNKFTGPIPRSIGKASASLTEILLLNNQLTGCIPYEVGFLKTAIVFDAGENLLTG  291

Query  852   PIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKK  673
             P+P S GCLEK+E LN   N LYG VPE +C+L +L  LSLS NY T+IGP CR L+   
Sbjct  292   PLPCSLGCLEKIEQLNFAGNFLYGQVPEVVCELGNLLNLSLSDNYLTKIGPSCRKLVRNG  351

Query  672   VLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPCDIDESPRKAG  517
             VLD+  NCI  LP+QRS   C    L    CP   +  +VPC   +     G
Sbjct  352   VLDLRKNCIRGLPDQRSPLDCFFSSLFRYPCPFPATYGFVPCQKSKGIHSFG  403



>ref|XP_008452581.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis melo]
Length=433

 Score =   273 bits (697),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 164/332 (49%), Positives = 209/332 (63%), Gaps = 6/332 (2%)
 Frame = -1

Query  1539  AIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfng  1360
              I+ FK  IT DP  IT++W G+++C     Y+GF+C  P   +K        +   F  
Sbjct  87    VIQKFKSIITSDPLGITKTWVGSDIC----NYKGFYCDNPPD-NKSATAVASIDFNGFQL  141

Query  1359  nglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEA  1180
             +  SL+ F++   D+ V H NSNNF+G     + K P L+ELD+SNN+L+G FPTAV+  
Sbjct  142   SAPSLDGFLDQLPDIAVFHANSNNFSGTISTNIAKLPYLYELDVSNNQLSGPFPTAVIGM  201

Query  1179  TNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTLANNQFS  1000
              +LT+LDLRFN  TG V PQVF  DLD L +NNN F   LPD+L  T + +LTLANN+FS
Sbjct  202   NSLTFLDLRFNFFTGSVPPQVFVQDLDFLLINNNNFMQSLPDSLSITHILYLTLANNKFS  261

Query  999   GPIPKTIGNA-SFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLE  823
             GPIP  I  A + L EVL LNN L+GCLPYE+G L  + VFDA  NQLTGP+P S GCL+
Sbjct  262   GPIPGGIVKALTSLTEVLLLNNSLTGCLPYELGSLDEAIVFDAGNNQLTGPLPLSLGCLK  321

Query  822   KLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCIL  643
              +E LN   N LYG VPE +C L+ L  L+LS NYFT +GP CR L+ + VL+I NNCI 
Sbjct  322   SVEQLNFAGNLLYGMVPEVVCALRHLVNLTLSDNYFTVVGPLCRILIGRGVLNIRNNCIP  381

Query  642   DLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
             DLP QR    C  F    + CP   S   +PC
Sbjct  382   DLPFQRPIIECAKFLAFPRICPRMWSYTLMPC  413



>gb|EYU37650.1| hypothetical protein MIMGU_mgv11b016249mg [Erythranthe guttata]
Length=440

 Score =   273 bits (697),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 177/341 (52%), Positives = 227/341 (67%), Gaps = 9/341 (3%)
 Frame = -1

Query  1539  AIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGG-DKKRVggiyfngynfn  1363
              I+ FK+ IT DP NIT +W G ++C N   Y+GFFC    G  +   + G+ FNG+NF+
Sbjct  76    VIQKFKQKITSDPYNITNTWVGPDICNN---YKGFFCDTLLGDYNSVALAGVTFNGFNFD  132

Query  1362  gnglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLE  1183
             G  LSL  F++   D++V H NSNNF G     + K   L+ELDLSNNK    FP  +L 
Sbjct  133   GPDLSLAGFIDELPDIIVFHANSNNFKGPFPSNISKIKYLYELDLSNNKYTCEFPHEIL-  191

Query  1182  ATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTLANNQF  1003
              + LT+LDLR+N  +G V PQVFTLD+D LF+NNN F   LPDNLGSTP  ++TLANN+F
Sbjct  192   GSQLTFLDLRYNTFSGAVPPQVFTLDVDVLFINNNNFMQKLPDNLGSTPALYVTLANNRF  251

Query  1002  SGPIPKTIGNAS-FLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCL  826
             +GPIP +IG A   L+E++ LNN LSGCLP EIGLL+ +TVFDAS N LTG IP SF CL
Sbjct  252   TGPIPTSIGRAGKTLIEIILLNNGLSGCLPCEIGLLEKATVFDASRNYLTGRIPLSFTCL  311

Query  825   EKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCI  646
               +EIL+L +NQLYG VPE +C+L +L  LSLS NYFT IGP+C  L+EK VL +  NCI
Sbjct  312   GMIEILDLADNQLYGHVPELVCELPNLVTLSLSYNYFTGIGPKCLELVEKNVLHLRMNCI  371

Query  645   LDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPCDIDESPRK  523
               LP+QR+   C+ FF   + CP      ++PC      R+
Sbjct  372   PGLPDQRTRAQCRAFFSTAKGCPRSN---WIPCSSGGVIRR  409



>ref|XP_004142874.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis sativus]
 ref|XP_004156371.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis sativus]
 gb|KGN62484.1| hypothetical protein Csa_2G356090 [Cucumis sativus]
Length=438

 Score =   272 bits (696),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 164/365 (45%), Positives = 222/365 (61%), Gaps = 6/365 (2%)
 Frame = -1

Query  1524  KKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngnglsl  1345
             K++ITYDP+  T++W GN  C+    ++GFFC V    +   +  I F+G  F G  L+ 
Sbjct  75    KRNITYDPKGYTKTWVGNNYCL----FKGFFCDVVPDLNITGLSSIDFSGARFGGPFLNF  130

Query  1344  nSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEATNLTY  1165
               F+ +  D+ + H NSNNFTG     + K   L+ELDLSNNK  G FP  +L A  L++
Sbjct  131   YRFIRNLPDIALFHANSNNFTGVINRNINKLRYLYELDLSNNKFLGGFPGYILGANKLSF  190

Query  1164  LDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPD-NLGSTPVFFLTLANNQFSGPIP  988
             +D RFN   G V  ++F +D D LF+NNN F+G +P    G+TP  ++TLA N+F+GPIP
Sbjct  191   VDFRFNTYNGSVPYRLFNIDTDVLFINNNGFTGRIPQATFGNTPANYITLAGNKFTGPIP  250

Query  987   KTIGNA-SFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEI  811
              TIG A   L EVLFL N+L+GCLP+EIG L  +TVFDA+ N LTGPIPQSFGCL  L+I
Sbjct  251   STIGRAWRTLTEVLFLKNRLTGCLPFEIGYLVKATVFDANTNILTGPIPQSFGCLFSLQI  310

Query  810   LNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPN  631
             LNL NNQ YG++PES+C+L D+  ++LS NYFT+IGP CR L+  + L I  NCI     
Sbjct  311   LNLANNQFYGTIPESICRLPDIYNITLSNNYFTRIGPVCRKLVIAQRLHIQGNCIPGFRL  370

Query  630   QRSAQVCKDFFLHYQKCPDHKSLLYVPCDIDESPRKAGphphphrpykkhkRGSSTTYAA  451
             Q++   C  FF   + CP   +  YVPC +  +                    S  +YAA
Sbjct  371   QKTQSQCAAFFAKPRTCPRANTFSYVPCVLPTAAEAVQLDKAKVTSVDDMVPPSPRSYAA  430

Query  450   LKVDR  436
             L++ R
Sbjct  431   LEMPR  435



>ref|XP_009605357.1| PREDICTED: uncharacterized protein At4g06744-like [Nicotiana 
tomentosiformis]
Length=382

 Score =   270 bits (689),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 158/332 (48%), Positives = 208/332 (63%), Gaps = 7/332 (2%)
 Frame = -1

Query  1536  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  1357
             I+ FK  IT DP  +T+SW G  +C     Y GF+C  P   +K  +     +   F   
Sbjct  39    IQKFKNIITSDPLGVTKSWVGPNIC----NYTGFYCESPPD-NKSAIALASIDFNGFQLT  93

Query  1356  glslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  1177
               +L  F++   D+ + H NSNNF+G     +   P L+ELD+SNN+  G FP+A+L   
Sbjct  94    APTLVGFLDQLPDIAIFHANSNNFSGTLSPKIANLPYLYELDISNNQFFGPFPSAILGMN  153

Query  1176  NLTYLDLRFNMLTGPVHPQVftldld-alflnnnfFSGPLPDNLGSTPVFFLTLANNQFS  1000
             +L+ LD+RFN  TG V PQ+FT D   ALF+NNN F    PDN+ S+ V +LTLANN+F 
Sbjct  154   SLSILDIRFNSFTGSVPPQLFTKDQLDALFINNNNFMQRFPDNIASSHVIYLTLANNKFF  213

Query  999   GPIPKTIGNA-SFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLE  823
             GPIP+ I    S L E+L LNN LSGCLPYE+G LK + VFDA  N+LTGP+P S GCLE
Sbjct  214   GPIPRGISKILSSLTEILLLNNLLSGCLPYELGFLKQAVVFDAGNNRLTGPLPFSLGCLE  273

Query  822   KLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCIL  643
             K+E+LN   N+LYG VP+ +C L +L  LSLS NYFT +GP C +L+   VLD+ NNCI 
Sbjct  274   KVEVLNFAGNKLYGIVPDVICALGNLANLSLSDNYFTGVGPICLSLIRNGVLDLKNNCIP  333

Query  642   DLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
              LP QRS   C +FF + + CP   +  Y+PC
Sbjct  334   GLPFQRSFAECVEFFAYPRYCPHMATYSYIPC  365



>ref|XP_009396708.1| PREDICTED: uncharacterized protein At4g06744-like [Musa acuminata 
subsp. malaccensis]
Length=441

 Score =   271 bits (694),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 169/344 (49%), Positives = 210/344 (61%), Gaps = 17/344 (5%)
 Frame = -1

Query  1536  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  1357
             I+ FK+SIT DP  +TQ+W G   C     Y+GF+C  P                     
Sbjct  86    IQRFKQSITCDPGGVTQTWVGYRPC----TYEGFYCAAPPDSPDTPTIASVDFNGFGLCA  141

Query  1356  glslnSFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAGAFPTAVLEA  1180
                +  FV+   DL + H NSN F+G   IP +   P L+ELD+S+N   GAFPT VL  
Sbjct  142   PTIVG-FVDQLPDLALFHANSNYFSGT--IPDLTGLPYLYELDVSSNLHFGAFPTKVLPL  198

Query  1179  TNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTLANNQFS  1000
             +NL +LDLRFN   G V   VF  +LD LF NNN F+ PLP  LG +PV +LTLANN F+
Sbjct  199   SNLIFLDLRFNFFAGAVPASVFAFNLDVLFFNNNNFNEPLPAELGRSPVAYLTLANNGFT  258

Query  999   GPIPKTIGNAS-FLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLE  823
             G IP +I NAS  L+EVLFLNN+LSGCLPYEIG L  +TVFDA  NQ+TGPIP SFGCL 
Sbjct  259   GSIPPSIYNASNTLVEVLFLNNRLSGCLPYEIGFLSIATVFDAGFNQMTGPIPWSFGCLL  318

Query  822   KLEILNLTNNQLYGSVPESLCKLK---DLEELSLSGNYFTQIGPECRNLLEKKVLDIDNN  652
             KLE LNL  N LYG VP+ +C+L    +L  LSLSGNYFT +G  C +L++ KVLD+  N
Sbjct  319   KLEQLNLAGNLLYGEVPDVVCRLAKDGNLANLSLSGNYFTWLGHSCWDLVKTKVLDVRQN  378

Query  651   CILDLPNQRSAQVCKDFFLHYQKC-PDHKSLLYVPCDIDESPRK  523
             CI  LP QRS   C  F+   ++C P H     +PC + + P K
Sbjct  379   CIPGLPEQRSPAECSTFWWGPKQCLPSHD----IPCSLPKGPTK  418



>ref|XP_004231393.1| PREDICTED: uncharacterized protein At4g06744 [Solanum lycopersicum]
Length=394

 Score =   270 bits (689),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 161/339 (47%), Positives = 218/339 (64%), Gaps = 6/339 (2%)
 Frame = -1

Query  1536  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  1357
             I+ FK +IT DP  +T++W G ++C     Y+GF+C  P   +   +     +   F  +
Sbjct  43    IQNFKNTITLDPFGVTKTWTGPDIC----NYKGFYCDNPPN-NSSAISLASIDFNGFQLS  97

Query  1356  glslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  1177
               +L+ F++   DL + H N+NNF+G     +   P L+ELDLSNN+  G FP ++L   
Sbjct  98    APTLDGFIDQLPDLAIFHANTNNFSGIISSKISNLPYLYELDLSNNQFIGTFPMSILNIK  157

Query  1176  NLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTLANNQFSG  997
              LT+LD+R+N+LTG + PQ+F   LDA FLNNN F   LPD++GST  F+LTLANN+F G
Sbjct  158   TLTFLDIRYNLLTGIIPPQIFLQYLDAFFLNNNNFIQKLPDSIGSTSAFYLTLANNKFVG  217

Query  996   PIPKTIGNASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKL  817
             PIP TIG A  LLE+L LNN L+GC+PYE+GLLK + V D   N LTGP+P S GCLE +
Sbjct  218   PIPPTIGQAPNLLEILLLNNLLTGCIPYELGLLKKAIVIDVGFNTLTGPLPCSLGCLENV  277

Query  816   EILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDL  637
             E LN   N LYG VPE +C LK+L   +LS NYFT++GP CR L+E  VL+++ NCI  L
Sbjct  278   EQLNFAGNLLYGQVPEVICSLKNLVNFTLSYNYFTKVGPLCRELIENGVLNVEKNCINGL  337

Query  636   PNQRSAQVCKDFFLHYQKCPDHKSLLYVPCDIDE-SPRK  523
             PNQR    C  F +  + CP  KSL  +PC+I + SP +
Sbjct  338   PNQRPILECVLFRMRIKLCPLQKSLRIIPCNISKFSPHR  376



>ref|XP_006653860.1| PREDICTED: uncharacterized protein At4g06744-like [Oryza brachyantha]
Length=448

 Score =   271 bits (692),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 170/345 (49%), Positives = 212/345 (61%), Gaps = 18/345 (5%)
 Frame = -1

Query  1536  IRTFKKSITYDPQNITQSWEGNELC---INKKKYQGFFC-YVPRGG---DKKRVggiyfn  1378
             I+ FKK+IT DP+ +T SW G  LC        Y+GF+C Y P  G   D   +     +
Sbjct  87    IQAFKKTITCDPRGVTASWVGPNLCDSHFGGMAYKGFYCDYPPVTGAPQDNTTLTVASID  146

Query  1377  gynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAGAF  1201
                F     S+  FV++F DL + H NSNN +G   +P +   P  +ELDLSNN  +GAF
Sbjct  147   FNGFGLCAPSIAGFVDAFPDLALFHANSNNLSGE--VPDLTGLPYFYELDLSNNNFSGAF  204

Query  1200  PTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLT  1021
             P  V+    L +LDLRFN   G V P +F L + ALFLNNN F G +PDN GST   +L 
Sbjct  205   PANVVPLGGLLFLDLRFNRFVGTVPPPIFDLSVVALFLNNNGFYGQIPDNFGSTTAEYLV  264

Query  1020  LANNQFSGPIPKTIGNASF-LLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIP  844
             +ANNQF+GPIP++I N S  L EVLFLNNKLSGCLPYEIGL++  TVFDA  N +TGPIP
Sbjct  265   VANNQFTGPIPRSIYNTSANLSEVLFLNNKLSGCLPYEIGLVEGLTVFDAGGNDITGPIP  324

Query  843   QSFGCLEKLEILNLTNNQLYGSVPESLC---KLKDLEELSLSGNYFTQIGPECRNLLEKK  673
              SFGCL K+E LNL  NQLYG +P+ LC   K   L+ LSLS NYF  +G  C  L   +
Sbjct  325   LSFGCLGKVEELNLAGNQLYGHIPDVLCILAKTGKLQNLSLSDNYFHSVGHHCLELARSR  384

Query  672   VLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL-YVPCDI  541
             VLD+  NCIL+ PNQR A  C  F   Y   P H   + ++PCD+
Sbjct  385   VLDVRLNCILNFPNQRPALECARF---YADPPQHCPFVPHIPCDL  426



>ref|XP_004167460.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis sativus]
 gb|KGN57510.1| hypothetical protein Csa_3G200700 [Cucumis sativus]
Length=429

 Score =   270 bits (689),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 170/370 (46%), Positives = 220/370 (59%), Gaps = 6/370 (2%)
 Frame = -1

Query  1569  LDPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  1390
             LD  +      I+TFK  IT DP  +TQ+W G+++C    KYQGF+C  P   +K  V  
Sbjct  62    LDQRLAVVYPIIQTFKALITSDPLGVTQTWVGSDIC----KYQGFYCDHPPD-NKSAVTI  116

Query  1389  iyfngynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  1210
                +   F     +L+ F++   DL + H NSNNF G     +   P L+ELDLSNN+L+
Sbjct  117   AAIDFNGFQLTASTLDGFIDGLPDLAIFHANSNNFFGTITPKIASLPYLYELDLSNNQLS  176

Query  1209  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVF  1030
             G FP A+L  T+L++ D+RFN  TG V  Q+F    D LFLNNN F   LP N GST   
Sbjct  177   GTFPVAILSVTDLSFFDIRFNFFTGFVPQQLFVKSFDFLFLNNNNFGMKLPINFGSTTTP  236

Query  1029  FLTLANNQFSGPIPKTIGNASF-LLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTG  853
             ++TLANN+F+GPIP++IG AS  L E+L LNN+L+GC+PYE+G LK + VFDA  N LTG
Sbjct  237   YITLANNKFTGPIPRSIGKASANLTEILLLNNQLTGCIPYEVGFLKKAIVFDAGENLLTG  296

Query  852   PIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKK  673
             P+P S  CLEK+E LN   N LYG VPE +C L +L  LSLS NYFT+IGP CR L+   
Sbjct  297   PLPCSLSCLEKIEQLNFAGNFLYGQVPEVVCDLGNLLNLSLSDNYFTKIGPSCRKLVRNG  356

Query  672   VLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPCDIDESPRKAGphphphrp  493
             VLD+  NCI  LP+QRS   C   +L    CP   +  +VPC   +S    G        
Sbjct  357   VLDLRKNCIRGLPDQRSPLDCFFSYLFQYPCPFPATYGFVPCQKSKSIHSFGTGQQKRSY  416

Query  492   ykkhkRGSST  463
                   G+ST
Sbjct  417   VPIANGGNST  426



>gb|ADN33724.1| LRR-family protein [Cucumis melo subsp. melo]
Length=439

 Score =   269 bits (688),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 157/328 (48%), Positives = 210/328 (64%), Gaps = 6/328 (2%)
 Frame = -1

Query  1524  KKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngnglsl  1345
             K++ITYDP+  T++W GN  C+    ++GFFC V    +   +  I F+G  F G  L+ 
Sbjct  75    KRNITYDPKGYTKTWVGNNYCL----FKGFFCDVVPDLNITGLSSIDFSGARFGGPFLNF  130

Query  1344  nSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEATNLTY  1165
               F+ +  D+ + H NSNNFTG     + K   L+ELDLSNNK  G FP  +L A  L++
Sbjct  131   YRFIRNLPDIALFHANSNNFTGVINRNINKLRYLYELDLSNNKFLGGFPGYILGANKLSF  190

Query  1164  LDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPD-NLGSTPVFFLTLANNQFSGPIP  988
             +D RFN   G V  ++F +D D LF+NNN F+G +P    G+TP  ++TLA N F+GPIP
Sbjct  191   VDFRFNTYNGSVPYRLFNIDTDVLFINNNGFTGRIPQATFGNTPALYITLAGNNFTGPIP  250

Query  987   KTIGNA-SFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEI  811
              TIG A   L EVLFL N+L+GCLP+EIG L  +TVFDA+ N LTGPIPQSFGCL  L+I
Sbjct  251   PTIGRAWRTLTEVLFLKNRLTGCLPFEIGYLVKATVFDANTNILTGPIPQSFGCLFSLQI  310

Query  810   LNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPN  631
             LNL +NQ YG++PES+C+L D+  ++LS NYFT+IGP CR L+  + L I  NCI     
Sbjct  311   LNLADNQFYGTIPESICRLPDIYNITLSNNYFTRIGPVCRKLVTAQRLHIQGNCIPGFRL  370

Query  630   QRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
             Q++   C  FF   + CP   +  YVPC
Sbjct  371   QKTQSQCAAFFAKPRTCPRANTFSYVPC  398



>ref|XP_009413340.1| PREDICTED: uncharacterized protein At4g06744-like [Musa acuminata 
subsp. malaccensis]
Length=464

 Score =   270 bits (690),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 176/387 (45%), Positives = 222/387 (57%), Gaps = 21/387 (5%)
 Frame = -1

Query  1551  KSIKAIRTFKKSITYDPQNITQSWEGNELCINKKK-YQGFFCYVPRGGDKKRVggiyfng  1375
             ++   I+ FK++IT DP N T +W G +LC N    YQGF+C  P      R        
Sbjct  85    RAYFVIQRFKRTITCDPLNKTDTWSGFKLCNNDGDGYQGFYCETPPNRKNMRTIASVDFN  144

Query  1374  ynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAGAFP  1198
                 G       FV+   DL + H NSNN  G   +P ++  P  +ELDLSNN  +G FP
Sbjct  145   GFKLGAPTVSR-FVDQLPDLALFHANSNNLGGT--VPYIRTLPFFYELDLSNNDFSGGFP  201

Query  1197  TAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTL  1018
               VL   NL++LDLR+N    P+ P VF +    LFLNNN F   +PDNLGSTP  ++T 
Sbjct  202   VNVLPLVNLSFLDLRYNGFASPLPPSVFLIQTQVLFLNNNKFYQHIPDNLGSTPAAYITF  261

Query  1017  ANNQFSGPIPKTIGNA-SFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQ  841
             A N F+GPIP +IG A   L+E+LFL N+LSGCLP+E+GLLK +TVFDA  NQLTGPIP 
Sbjct  262   AYNDFTGPIPSSIGKACETLIEILFLGNRLSGCLPFEVGLLKKATVFDAGSNQLTGPIPL  321

Query  840   SFGCLEKLEILNLTNNQLYGSVPESLCKLK---DLEELSLSGNYFTQIGPECRNLLEKKV  670
             SFGCLEK+E LNL  NQL G VP+ +C+L     L  LSLS NYFT + P C +L+   V
Sbjct  322   SFGCLEKVEQLNLAGNQLCGEVPDVVCRLAKYGKLVNLSLSDNYFTSLAPSCISLIHSNV  381

Query  669   LDIDNNCILDLPNQRSAQVCKDFFLHYQK--CPDHKSLLYVPCDI-----DESPRKAGph  511
             LD+  NCI  LP+QRS + C  +FL   K  CP+     Y+PC +     DE    A   
Sbjct  382   LDVRKNCIPWLPHQRSPEECA-WFLKLPKVFCPNAH---YIPCHLPWEGRDELDSSASSS  437

Query  510   phphrpykkhkRGSSTTYAAL-KVDRP  433
             P       K      TTY AL   D+P
Sbjct  438   PAVDGGRDKSPASGYTTYQALHHHDKP  464



>ref|XP_010094650.1| Uncharacterized protein L484_008882 [Morus notabilis]
 gb|EXB56501.1| Uncharacterized protein L484_008882 [Morus notabilis]
Length=415

 Score =   268 bits (686),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 158/344 (46%), Positives = 212/344 (62%), Gaps = 11/344 (3%)
 Frame = -1

Query  1539  AIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfng  1360
              I+ FK  IT DP NIT+SW G+++C     Y GF+C  P   +   +     +   F  
Sbjct  63    VIQKFKSIITSDPLNITKSWVGSDIC----NYTGFYCESP-PDNASAMAVASVDFNGFQL  117

Query  1359  nglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEA  1180
             +  +L+ F++   D+ + H NSNNF+G     + K   L+ELD+SNNKL+G+FP AVL  
Sbjct  118   SAPTLDGFLDQLPDIALFHANSNNFSGTLSPNIAKLKYLYELDVSNNKLSGSFPNAVLGM  177

Query  1179  TNLTYLDLRFNMLTGPVHPQVftldldalflnnnf--FSGPLPDNL-GSTPVFFLTLANN  1009
              +L++LD+RFN+ TG V PQ+F          NN       LPD+L  S+ + +LTLANN
Sbjct  178   ESLSFLDIRFNLFTGSVPPQIFLQINLEALFINNNNFTQIKLPDDLRTSSHIIYLTLANN  237

Query  1008  QFSGPIPKTIGNA-SFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFG  832
             +F GPIP +I    S + EVL LNN+L+GCLPYEIG LK + VFD   N+LTGP+P S  
Sbjct  238   KFIGPIPPSIAKLFSSVTEVLLLNNELTGCLPYEIGFLKEAVVFDVGNNRLTGPLPFSLA  297

Query  831   CLEKLEILNLTNNQLYGSVPESLC-KLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDN  655
             CLEK+E LN   N LYG VPE +C +LK+L   SLS NYFT +GP CR L+E+ VLD+  
Sbjct  298   CLEKVEQLNFAGNLLYGMVPEVVCDELKNLANFSLSDNYFTYVGPLCRRLIERGVLDVRR  357

Query  654   NCILDLPNQRSAQVCKDFFLHYQK-CPDHKSLLYVPCDIDESPR  526
             NCI DLP QRS + C  FF + ++ CP   S  ++PC     PR
Sbjct  358   NCIPDLPYQRSMEECGAFFSYPRRFCPYMWSYNHIPCQPPHYPR  401



>ref|XP_004137106.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis sativus]
Length=398

 Score =   268 bits (684),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 159/342 (46%), Positives = 215/342 (63%), Gaps = 9/342 (3%)
 Frame = -1

Query  1557  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFC-YVPRGGDKKRVggiyf  1381
             IR +   I+ +K  I  DP  + ++W G ++C     Y GF C  VP  G ++ V G+ F
Sbjct  33    IRIAYFVIKDYKSRIENDPLQVKKTWVGTDVC----HYTGFSCDVVPNYGKQRGVSGLSF  88

Query  1380  ngynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAF  1201
             N +NF+G  LSL+  VE   DL   H NSN F       +      +ELDLSNNK  G F
Sbjct  89    NNFNFSGRRLSLDGLVEKLPDLTFFHANSNFFFSTIPKLISTVNFFYELDLSNNKFTGPF  148

Query  1200  PTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfF-SGPLPDNLGSTPVFFL  1024
             P+ VL A NLT+LD+RFN   GP+  ++F +D+      NN   +  +P NLG+TP  +L
Sbjct  149   PSEVLGAVNLTFLDIRFNNYYGPIRSELFDMDIITAIFLNNNKFNQDIPANLGNTPARYL  208

Query  1023  TLANNQFSGPIPKTIG---NASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTG  853
             T  +N+ +GPIPK+IG       L+EVLF +NKLSGCLP EIGLL+N+ +F+AS N LTG
Sbjct  209   TFTSNELTGPIPKSIGIGKTKKNLIEVLFSDNKLSGCLPMEIGLLENTVLFNASKNCLTG  268

Query  852   PIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKK  673
             PIP SF CL K+EILN   N LYG++PE +CKL +L++ +LS N+ TQ+GP CR+L+ K 
Sbjct  269   PIPYSFCCLTKMEILNFFGNNLYGAIPEDVCKLPNLQKFNLSNNFITQVGPVCRSLIWKN  328

Query  672   VLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
             +LD+  NCIL LP QR  + C +FF     CPD KS+  +PC
Sbjct  329   ILDVSGNCILGLPKQRPEKECTNFFSKAHSCPDEKSMKIIPC  370



>ref|XP_006653579.1| PREDICTED: uncharacterized protein At4g06744-like [Oryza brachyantha]
Length=456

 Score =   269 bits (688),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 168/355 (47%), Positives = 223/355 (63%), Gaps = 34/355 (10%)
 Frame = -1

Query  1557  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  1378
             + ++ K I+ F++++T DPQNI QSW G +LC     Y+GFFC  P     + +  + FN
Sbjct  88    LYRAYKVIQKFRRTVTCDPQNIIQSWSGTDLC---GSYKGFFCERPPNVSDRTIASVDFN  144

Query  1377  gynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLA-GA  1204
             GYN   + +    FV++  DL + H NSNNF GA  +P +      +ELDLSNNKLA   
Sbjct  145   GYNLQSSSIKD--FVDALPDLALFHANSNNFGGA--VPDLSGLQYFYELDLSNNKLAPNP  200

Query  1203  FPTAVLEATNLTYLDLRFNMLTGPV-------HPQVftldldalflnnnfFSGPLPDNLG  1045
             FPT VL+  N T++D+RFN   G +        PQV  + ++         SG LPDN+G
Sbjct  201   FPTDVLKLRNATFVDIRFNSFYGELPGGVFCSFPQVQAIFVNNNQF-----SGNLPDNIG  255

Query  1044  STPVFFLTLANNQFSGPIPKTIGN-ASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASI  868
              +PV +L+LANN+F+G IPK+I   A+ LLEVLFLNNKLSGCLPYE+GLL  +TV DA  
Sbjct  256   DSPVNYLSLANNKFTGEIPKSITRMANTLLEVLFLNNKLSGCLPYELGLLAKATVIDAGT  315

Query  867   NQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLK-----DLEELSLSGNYFTQIG  703
             NQLTGPIP SF CL K+E LNL +N LYG VP++LCKL       L+ L+LS NYFT +G
Sbjct  316   NQLTGPIPASFACLHKVEQLNLADNLLYGEVPDALCKLAFAWTGRLKNLTLSNNYFTSLG  375

Query  702   PECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQK---CPDHKSLLYVPC  547
               C +L+++  L+++ NCI   PNQRS + C  FF H  K   CP +    YVPC
Sbjct  376   SCCWDLIKEGKLNVERNCIPWAPNQRSHEECAAFF-HRTKTSACPVNS---YVPC  426



>gb|AES90113.2| Serine/Threonine kinase, plant-type protein, putative [Medicago 
truncatula]
Length=460

 Score =   269 bits (688),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 163/344 (47%), Positives = 216/344 (63%), Gaps = 11/344 (3%)
 Frame = -1

Query  1557  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYV-PRGGDKK--RVggi  1387
             + ++ + +  FK +I YDP   T +W  N    N   + G  C + P   D+    +   
Sbjct  87    LDRARRVLLKFKSNI-YDPTGYTSNWNENTDTCN---FHGILCGIFPNTNDRAVAGLDFN  142

Query  1386  yfngynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  1207
                    N + + L   ++   +L   HVNSN+F G+    +  +   +ELDLSNNKL G
Sbjct  143   QKKFQGKNCDTIPLKGILDQIEELTFFHVNSNSFYGSIPKEITNYKYFYELDLSNNKLVG  202

Query  1206  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFF  1027
              FP  VL++  L +LDLRFN LTG V  Q+F  DLD +F+NNN FS  LP+N GSTP  +
Sbjct  203   EFPKEVLDSKQLVFLDLRFNQLTGSVPSQLFKKDLDVIFINNNKFSQCLPENFGSTPARY  262

Query  1026  LTLANNQFSGPIPKTIGNAS-FLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGP  850
             LT A+N F G IP++IGNA+  L EVLFL NK  GCLPYEIG LK +TVFD S N LTGP
Sbjct  263   LTFAHNNFVGEIPRSIGNANKTLTEVLFLGNKFEGCLPYEIGYLKKATVFDVSQNSLTGP  322

Query  849   IPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLE---ELSLSGNYFTQIGPECRNLLE  679
             IP SFGCLEK++ LNL +N+ YG+VPES+C L  ++    LSL+GNYFT++ P C +LL+
Sbjct  323   IPASFGCLEKIQFLNLAHNKFYGTVPESVCVLSGIKNNGNLSLAGNYFTKLEPACWSLLK  382

Query  678   KKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
              K+LD+ NNCI  LPNQRS Q C +F    + C + +SL YVPC
Sbjct  383   SKILDVSNNCIPGLPNQRSKQECYEFQCKIKPCSNPQSLSYVPC  426



>ref|XP_009768848.1| PREDICTED: uncharacterized protein At4g06744-like [Nicotiana 
sylvestris]
Length=408

 Score =   267 bits (683),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 152/333 (46%), Positives = 206/333 (62%), Gaps = 8/333 (2%)
 Frame = -1

Query  1536  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  1357
             I+ FK  IT DP  +T+SW G  +C     Y GF+C  P   DK  +     +   F  +
Sbjct  67    IQKFKNIITSDPLGVTKSWVGPNIC----NYTGFYCDTPPD-DKSAIAVASIDFNGFQLS  121

Query  1356  glslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  1177
               +L+ F++   D+ + H NSNNF+G     +   P L+ELD+SNN+ +G FP A+L   
Sbjct  122   APNLDGFLDQLPDIALFHANSNNFSGTLSANIANLPYLYELDISNNQFSGPFPPAILGMN  181

Query  1176  NLTYLDLRFNMLTGPVHPQVftldldalflnnnfF-SGPLPDNLGSTP-VFFLTLANNQF  1003
             +L++LD+RFN  TG V PQ+FT D       NN       PDNLGS+  V +LTLANN+F
Sbjct  182   SLSFLDIRFNSFTGSVPPQLFTKDQLDALFINNNNFMQKFPDNLGSSSHVLYLTLANNRF  241

Query  1002  SGPIPKTIGNA-SFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCL  826
              GPIP++I    + L E+L LNN LSGCLPYE+GLL  + VFDA  N+LTGP+P S GCL
Sbjct  242   FGPIPRSISKILASLSEILLLNNLLSGCLPYELGLLNEAVVFDAGNNRLTGPLPFSLGCL  301

Query  825   EKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCI  646
             E +E+LN   NQLYG VPE +C L +L  LSLS N+F  +GP C +L+++ V+D+  NCI
Sbjct  302   ENMEVLNFAGNQLYGMVPEVICSLGNLANLSLSHNFFIGVGPICLSLIKEGVVDVRKNCI  361

Query  645   LDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
               LP+QRS   C  FF   + CP  ++  Y+PC
Sbjct  362   PGLPSQRSTAECVAFFAQPRYCPYMETYSYIPC  394



>ref|XP_003555862.1| PREDICTED: uncharacterized protein At4g06744-like [Glycine max]
 gb|KHN32258.1| Hypothetical protein glysoja_039284 [Glycine soja]
Length=454

 Score =   269 bits (687),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 159/346 (46%), Positives = 215/346 (62%), Gaps = 14/346 (4%)
 Frame = -1

Query  1557  IRKSIKAIRTFKKSITYDPQNITQSW-EGNELCINKKKYQGFFCYVPRGGDKKRVggiyf  1381
             + K+ + +  FK ++ YDP   TQSW E  + C     + G  C      ++K V G+  
Sbjct  83    LEKARRVLLKFK-TLIYDPDCYTQSWNENTDTC----DFNGVRCATYPNSEEKAVAGLDL  137

Query  1380  ngynfngnglsl---nSFVESFNDLVVIHVNSNNFTGAPGIP--VQKFPTLFELDLSNNK  1216
             NG   +            V+S  +L   HVNSNNF+   G P  +  FP  FELDLSNNK
Sbjct  138   NGAKLSTKDGCNLPLTGLVDSIPELTFFHVNSNNFSFTGGFPNNITTFPFFFELDLSNNK  197

Query  1215  LAGAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTP  1036
             ++G FPT  ++   L +LDLRFN LTGP+ P++F  DLD +F+N+N F+G LP+N GSTP
Sbjct  198   VSGQFPTQAIQNNQLVFLDLRFNQLTGPIDPKLFQRDLDVIFVNDNQFTGCLPENFGSTP  257

Query  1035  VFFLTLANNQFSGPIPKTIGNASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLT  856
               +LT ANN+ SG +PK++G A  L EVLFL N   GCLP+EIG LK   VFD S N LT
Sbjct  258   ARYLTFANNRLSGSLPKSLGYAPSLTEVLFLGNHFEGCLPFEIGYLKKVVVFDVSKNLLT  317

Query  855   GPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLE---ELSLSGNYFTQIGPECRNL  685
             GPIP SFGCL+ ++ LNL  N+LYG VP++LC++  +     LSL+ NYF +IGP C +L
Sbjct  318   GPIPLSFGCLKSIQFLNLAQNKLYGCVPDNLCQIPSIRNNGNLSLADNYFKEIGPSCWSL  377

Query  684   LEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
             ++ KVLD+  NCI  LP+Q+S + C  F+   + CP+  S  YVPC
Sbjct  378   IKSKVLDVSRNCIPGLPDQKSPKECYQFYKTKKTCPNQNSFYYVPC  423



>ref|XP_008454972.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis melo]
Length=428

 Score =   268 bits (685),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 160/342 (47%), Positives = 214/342 (63%), Gaps = 9/342 (3%)
 Frame = -1

Query  1557  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFC-YVPRGGDKKRVggiyf  1381
             I+ +   I+ +K  I  DP  I ++W G  +C     Y GF C  VP  G ++ V G+ F
Sbjct  64    IKIAYYVIKNYKSRIENDPLQIKKTWVGTNVC----NYTGFSCEVVPNYGKQRGVSGLSF  119

Query  1380  ngynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAF  1201
             N +NF+G  LSL+  VE   DL   H NSN F       +      +ELDLSNN   G F
Sbjct  120   NNFNFSGRRLSLDGLVEKLPDLTFFHANSNFFFSTIPKLISTVNFFYELDLSNNNFTGPF  179

Query  1200  PTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfF-SGPLPDNLGSTPVFFL  1024
             P+ VL A NLT+LD+RFN   GP+  ++F +D+      NN   +  +P NLG+TP  +L
Sbjct  180   PSEVLGAVNLTFLDIRFNQYYGPIRSELFDMDIITAIFLNNNKFNQDIPANLGNTPARYL  239

Query  1023  TLANNQFSGPIPKTIG---NASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTG  853
             T  +N+F+GPIPK+IG       L+EVLF +NKLSGCLP EIGLL+N+ +F+AS N LTG
Sbjct  240   TFTSNEFTGPIPKSIGIGKTKKNLIEVLFSDNKLSGCLPMEIGLLENTVLFNASKNSLTG  299

Query  852   PIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKK  673
             PIP SF CL K++ILN ++N LYG+VPE +CKL +L+  +L  N+FTQ+GP CR+L+ K 
Sbjct  300   PIPYSFCCLTKMQILNFSDNNLYGAVPEDVCKLPNLQRFNLRNNFFTQVGPICRSLIWKD  359

Query  672   VLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
             VLD+  NCIL LP QR  + C  FF     CPD KS+  +PC
Sbjct  360   VLDVSGNCILGLPKQRPEKECTYFFSKPHSCPDDKSMKIIPC  401



>ref|XP_003589141.1| hypothetical protein MTR_1g018910 [Medicago truncatula]
 gb|ABD32635.1| Leucine-rich repeat, plant specific [Medicago truncatula]
 gb|ACJ86225.1| unknown [Medicago truncatula]
 gb|AES59392.1| Serine/Threonine kinase, plant-type protein, putative [Medicago 
truncatula]
 gb|AFK35532.1| unknown [Medicago truncatula]
Length=378

 Score =   266 bits (680),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 154/334 (46%), Positives = 210/334 (63%), Gaps = 7/334 (2%)
 Frame = -1

Query  1539  AIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfng  1360
              I+ FK  IT DP  +T+SW G+++C     Y+GF+C  P   +   +     +   F  
Sbjct  38    VIQKFKSLITSDPLGVTKSWIGSDIC----NYKGFYCDHPPD-NNSAIALASIDFNGFQL  92

Query  1359  nglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEA  1180
             +  +LN F++   D+ + H NSNNF G     + K P L+ELDLSNNK +G FP AVL  
Sbjct  93    SASTLNGFIDKLPDIALFHANSNNFIGTITSQISKLPYLYELDLSNNKFSGPFPMAVLGM  152

Query  1179  TNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTLANNQFS  1000
               LT+LD+RFN  +G V  Q+FT +L+ LF+NNN  +  LPDNL ++ +F LTLANN+F 
Sbjct  153   NTLTFLDIRFNSFSGGVPQQIFTQNLEVLFINNNLLTQNLPDNLATSSIFLLTLANNKFI  212

Query  999   GPIPKTIGNA-SFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLE  823
             G IP+ +  A S L EV+ LNN+L+GCLP+EIG  + + VFD   NQLTGP+P S  CLE
Sbjct  213   GSIPRNLPKALSSLTEVVLLNNELTGCLPHEIGYFQEAVVFDVGNNQLTGPLPMSLSCLE  272

Query  822   KLEILNLTNNQLYGSVPESLCK-LKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCI  646
             K+E++NL  N  YG VP+ +C  L++L   SLS NYFT +GP CR L+++ VLD+  NCI
Sbjct  273   KVEVVNLAGNMFYGMVPDFVCAGLENLVNFSLSDNYFTHVGPFCRMLIQRGVLDVGKNCI  332

Query  645   LDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPCD  544
              DLP QRS   C DFF   + CP      + PC+
Sbjct  333   HDLPFQRSLIECADFFTRPKICPFTWFHGFYPCN  366



>ref|XP_004171357.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis sativus]
Length=466

 Score =   268 bits (686),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 159/342 (46%), Positives = 216/342 (63%), Gaps = 9/342 (3%)
 Frame = -1

Query  1557  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFC-YVPRGGDKKRVggiyf  1381
             IR +   I+ +K  I  DP  + ++W G ++C     Y+GF C  VP  G ++ V G+ F
Sbjct  101   IRIAYFVIKDYKSRIENDPLQVKKTWVGTDVC----NYKGFNCDVVPNYGKQRGVSGLSF  156

Query  1380  ngynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAF  1201
             N +NF+G  LSL+  VE   DL   H NSN F       +      +ELDLSNNK  G F
Sbjct  157   NNFNFSGRRLSLDGLVEKLPDLTFFHANSNFFFSTIPKLISTVNFFYELDLSNNKFTGPF  216

Query  1200  PTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfF-SGPLPDNLGSTPVFFL  1024
             P+ VL A NLT+LD+RFN   GP+  ++F +D+      NN   +  +P NLG+TP  +L
Sbjct  217   PSEVLGAVNLTFLDIRFNNYYGPIRSELFDMDIITAIFLNNNKFNQDIPANLGNTPARYL  276

Query  1023  TLANNQFSGPIPKTIG---NASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTG  853
             T  +N+ +GPIPK+IG       L+EVLF +NKLSGCLP EIGLL+N+ +F+AS N LTG
Sbjct  277   TFTSNELTGPIPKSIGIGKTKKNLIEVLFSDNKLSGCLPMEIGLLENTVLFNASKNCLTG  336

Query  852   PIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKK  673
             PIP SF CL K+EILN   N LYG++PE +CKL +L++ +LS N+ TQ+GP CR+L+ K 
Sbjct  337   PIPYSFCCLTKMEILNFFGNNLYGAIPEDVCKLPNLQKFNLSNNFITQVGPVCRSLIWKN  396

Query  672   VLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
             +LD+  NCIL LP QR  + C +FF     CPD KS+  +PC
Sbjct  397   ILDVSGNCILGLPKQRPEKECTNFFSKAHSCPDEKSMKIIPC  438



>emb|CAE02949.1| OSJNBa0014K14.21 [Oryza sativa Japonica Group]
 emb|CAE05560.1| OSJNBb0116K07.13 [Oryza sativa Japonica Group]
 gb|EAY94774.1| hypothetical protein OsI_16554 [Oryza sativa Indica Group]
 dbj|BAG90092.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97019.1| unnamed protein product [Oryza sativa Japonica Group]
Length=454

 Score =   268 bits (685),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 166/352 (47%), Positives = 216/352 (61%), Gaps = 28/352 (8%)
 Frame = -1

Query  1557  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  1378
             + K+ K I+ F++++T DPQNI  SW G +LC     Y+GFFC  P     + +  + FN
Sbjct  84    LYKAYKVIQKFRRTVTCDPQNIISSWSGADLC---STYKGFFCERPPNITDRTIASVDFN  140

Query  1377  gynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAGA-  1204
             GYN   + L    FV++  DL + H NSNNF GA  +P + +    +ELDLSNNKL+ A 
Sbjct  141   GYNLQASSLKE--FVDALPDLALFHANSNNFGGA--VPDLSRLQYFYELDLSNNKLSPAT  196

Query  1203  FPTAVLEATNLTYLDLRFNMLTGPV-------HPQVftldldalflnnnfFSGPLPDNLG  1045
             FPT VL+  N T++D+RFN   G +        PQV  + ++         SG LPDN+G
Sbjct  197   FPTDVLKLKNATFVDIRFNSFYGELPGGVFCSFPQVQAIFVNNNQF-----SGSLPDNIG  251

Query  1044  STPVFFLTLANNQFSGPIPKTIGN-ASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASI  868
              +PV +L+LANN F+G IPK+I   A+ L EVLFLNNKLSGCLPYE+GLL  +TV DA  
Sbjct  252   DSPVNYLSLANNNFTGEIPKSIARMANTLFEVLFLNNKLSGCLPYELGLLAKATVIDAGT  311

Query  867   NQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLK-----DLEELSLSGNYFTQIG  703
             NQLTGPIP SF CL K+E LNL +N LYG VP +LC+L       L  L+LS NYFT +G
Sbjct  312   NQLTGPIPASFACLRKVEQLNLADNLLYGEVPNALCELAFSWSGRLRNLTLSNNYFTSLG  371

Query  702   PECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
               C +L+++  L++D NCI   PNQRS   C  FF H  K        YVPC
Sbjct  372   SCCWDLIKEGKLNVDRNCIPYAPNQRSHDECAAFF-HRTKTSACPCNTYVPC  422



>ref|XP_008444596.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis melo]
Length=507

 Score =   270 bits (689),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 157/328 (48%), Positives = 210/328 (64%), Gaps = 6/328 (2%)
 Frame = -1

Query  1524  KKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngnglsl  1345
             K++ITYDP+  T++W GN  C+    ++GFFC V    +   +  I F+G  F G  L+ 
Sbjct  147   KRNITYDPKGYTKTWVGNNYCL----FKGFFCDVVPDLNITGLSSIDFSGARFGGPFLNF  202

Query  1344  nSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEATNLTY  1165
               F+ +  D+ + H NSNNFTG     + K   L+ELDLSNNK  G FP  +L A  L++
Sbjct  203   YRFIRNLPDIALFHANSNNFTGVINRNINKLRYLYELDLSNNKFLGGFPGYILGANKLSF  262

Query  1164  LDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPD-NLGSTPVFFLTLANNQFSGPIP  988
             +D RFN   G V  ++F +D D LF+NNN F+G +P    G+TP  ++TLA N F+GPIP
Sbjct  263   VDFRFNTYNGSVPYRLFNIDTDVLFINNNGFTGRIPQATFGNTPALYITLAGNNFTGPIP  322

Query  987   KTIGNA-SFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEI  811
              TIG A   L EVLFL N+L+GCLP+EIG L  +TVFDA+ N LTGPIPQSFGCL  L+I
Sbjct  323   PTIGRAWRTLTEVLFLKNRLTGCLPFEIGYLVKATVFDANTNILTGPIPQSFGCLFSLQI  382

Query  810   LNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPN  631
             LNL +NQ YG++PES+C+L D+  ++LS NYFT+IGP CR L+  + L I  NCI     
Sbjct  383   LNLADNQFYGTIPESICRLPDIYNITLSNNYFTRIGPVCRKLVTAQRLHIQGNCIPGFRL  442

Query  630   QRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
             Q++   C  FF   + CP   +  YVPC
Sbjct  443   QKTQSQCAAFFAKPRTCPRANTFSYVPC  470



>ref|XP_004505255.1| PREDICTED: uncharacterized protein At4g06744-like [Cicer arietinum]
Length=407

 Score =   266 bits (681),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 157/331 (47%), Positives = 211/331 (64%), Gaps = 6/331 (2%)
 Frame = -1

Query  1536  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  1357
             I+TFK +IT DP  IT +W G  +C     Y+GF+C  P   +         +   F+  
Sbjct  56    IQTFKNTITSDPLGITTTWVGPNIC----NYKGFYCDNPPD-NLTATTVASIDFNGFHLA  110

Query  1356  glslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  1177
               SL+ F++   DL + H NSNNF+G     +     L+ELDLSNN L+G FP ++L   
Sbjct  111   APSLDGFIDQLPDLALFHANSNNFSGTISSKLASLKYLYELDLSNNFLSGTFPISILNIP  170

Query  1176  NLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTLANNQFSG  997
              L++LD+R+N+ TG V  Q+FT  LDA+FLNNN F   LPDNLG T   ++TLANN+F+G
Sbjct  171   TLSFLDIRYNLFTGTVPQQIFTQTLDAIFLNNNNFILTLPDNLGDTKASYITLANNKFTG  230

Query  996   PIPKTIGNASF-LLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEK  820
              IP TIG AS  L+EVL LNN L GCLPYEIG L+N  +FDA  N+LTGP+P SFGCL+ 
Sbjct  231   AIPSTIGKASSNLIEVLLLNNLLDGCLPYEIGFLENVKLFDAGSNRLTGPLPFSFGCLKN  290

Query  819   LEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILD  640
             +E LN  +N LYG VPE +C L +L  LSLS NYF ++GP C+ L+   V+D+ NNCILD
Sbjct  291   VEQLNFASNMLYGQVPEVVCALGNLANLSLSYNYFNRVGPICKKLIRSGVVDVRNNCILD  350

Query  639   LPNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
             +P+QR  + C  F+   + C   ++   +PC
Sbjct  351   VPDQRPLKECVAFYSVPRTCLRSRTFSIIPC  381



>gb|KGN43905.1| hypothetical protein Csa_7G073410 [Cucumis sativus]
Length=468

 Score =   268 bits (685),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 159/342 (46%), Positives = 215/342 (63%), Gaps = 9/342 (3%)
 Frame = -1

Query  1557  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFC-YVPRGGDKKRVggiyf  1381
             IR +   I+ +K  I  DP  + ++W G ++C     Y GF C  VP  G ++ V G+ F
Sbjct  103   IRIAYFVIKDYKSRIENDPLQVKKTWVGTDVC----HYTGFSCDVVPNYGKQRGVSGLSF  158

Query  1380  ngynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAF  1201
             N +NF+G  LSL+  VE   DL   H NSN F       +      +ELDLSNNK  G F
Sbjct  159   NNFNFSGRRLSLDGLVEKLPDLTFFHANSNFFFSTIPKLISTVNFFYELDLSNNKFTGPF  218

Query  1200  PTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfF-SGPLPDNLGSTPVFFL  1024
             P+ VL A NLT+LD+RFN   GP+  ++F +D+      NN   +  +P NLG+TP  +L
Sbjct  219   PSEVLGAVNLTFLDIRFNNYYGPIRSELFDMDIITAIFLNNNKFNQDIPANLGNTPARYL  278

Query  1023  TLANNQFSGPIPKTIG---NASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTG  853
             T  +N+ +GPIPK+IG       L+EVLF +NKLSGCLP EIGLL+N+ +F+AS N LTG
Sbjct  279   TFTSNELTGPIPKSIGIGKTKKNLIEVLFSDNKLSGCLPMEIGLLENTVLFNASKNCLTG  338

Query  852   PIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKK  673
             PIP SF CL K+EILN   N LYG++PE +CKL +L++ +LS N+ TQ+GP CR+L+ K 
Sbjct  339   PIPYSFCCLTKMEILNFFGNNLYGAIPEDVCKLPNLQKFNLSNNFITQVGPVCRSLIWKN  398

Query  672   VLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
             +LD+  NCIL LP QR  + C +FF     CPD KS+  +PC
Sbjct  399   ILDVSGNCILGLPKQRPEKECTNFFSKAHSCPDEKSMKIIPC  440



>ref|XP_004960235.1| PREDICTED: uncharacterized protein At4g06744-like [Setaria italica]
Length=512

 Score =   270 bits (689),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 163/341 (48%), Positives = 213/341 (62%), Gaps = 15/341 (4%)
 Frame = -1

Query  1536  IRTFKKSITYDPQNITQSWEGNELC---INKKKYQGFFCYVPRGGDKKRVggiyfngynf  1366
             I+ FKK+IT DP  +T +WEG +LC    N  KY+GF+C  P   +   +     +   F
Sbjct  156   IQAFKKTITCDPLGVTATWEGPDLCSSFFNGTKYRGFYCEYPPNANAT-LTVASIDFNGF  214

Query  1365  ngnglslnSFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAGAFPTAV  1189
                  SL  FV+ F DL + H NSNNF+G   +P +   P  +ELDLSNN  +G+FP AV
Sbjct  215   GLCAPSLVGFVDQFPDLALFHANSNNFSG--DVPDLTHLPFFYELDLSNNNFSGSFPDAV  272

Query  1188  LEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTLANN  1009
             +    L +LDLRFN   G V P VF L ++AL LNNN F G +PD+ GST   +L +ANN
Sbjct  273   VPLGGLLFLDLRFNRYAGAVPPAVFALTVEALLLNNNGFDGRIPDSFGSTGAKYLVVANN  332

Query  1008  QFSGPIPKTIGNASFLL-EVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFG  832
             QF+GPIP++I N S  L EVLFLNN+LSGCLPYEIGL++   VFDA  N++ GPIP SFG
Sbjct  333   QFTGPIPRSIYNTSATLSEVLFLNNRLSGCLPYEIGLVEGLAVFDAGGNEIAGPIPLSFG  392

Query  831   CLEKLEILNLTNNQLYGSVPESLC---KLKDLEELSLSGNYFTQIGPECRNLLEKKVLDI  661
             CL  +E +NL  NQLYG VP+ +C   K   L+ LSLS N+F  +G  C  L+  +VLD+
Sbjct  393   CLRDVEEINLAGNQLYGQVPDVVCLLAKTGKLQNLSLSDNFFHSVGHHCMELVRSRVLDV  452

Query  660   DNNCILDLPNQRSAQVCKDFFLHYQK-CPDHKSLLYVPCDI  541
               NCIL  P+QR A  C  F+    K CP    + ++PCD+
Sbjct  453   RRNCILGFPDQRPALECAAFYADPTKHCP---FIPHIPCDL  490



>ref|XP_007017156.1| LRR-family protein [Theobroma cacao]
 gb|EOY14381.1| LRR-family protein [Theobroma cacao]
Length=441

 Score =   267 bits (682),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 154/331 (47%), Positives = 209/331 (63%), Gaps = 10/331 (3%)
 Frame = -1

Query  1524  KKSITYDPQNITQSWEGNELCINKKKYQGFFC-YVPRGGDKKRVggiyfngynfngngls  1348
             K++IT+DPQN T +W GN  C+    ++G+ C  VP   D+   G    +       G  
Sbjct  87    KRNITFDPQNYTGTWVGNNYCL----FKGYICDTVP---DRNITGLAGIDFNGARFGGNL  139

Query  1347  l-nSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEATNL  1171
                 F+ +  D+ + H NSNNF+G     +      +E+DLSNNK  G FP+ VL ATNL
Sbjct  140   NFYRFITNLPDIAIFHANSNNFSGVINQGLNGLRYFYEIDLSNNKFMGGFPSNVLGATNL  199

Query  1170  TYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTLANNQFSGPI  991
             T++DLRFN   GPV   +F  D D LF+NNN FS  +P N G+TP  +LTLANN F+G I
Sbjct  200   TFVDLRFNKYLGPVPRSLFNFDTDVLFINNNVFSRTIPPNFGNTPALYLTLANNNFTGTI  259

Query  990   PKTIGNA-SFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLE  814
             P++IG A   + EVLFL NKLSGCLP+EIG L  +TVFD   N+LTGPIPQSFGC+ +L+
Sbjct  260   PRSIGAAWETMTEVLFLGNKLSGCLPFEIGYLNRTTVFDVGSNRLTGPIPQSFGCMARLQ  319

Query  813   ILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLP  634
             +LN+ +N+ YG +PE LC+L      +LS NYFTQ+GP+CR L+  + L+++ NCI+ LP
Sbjct  320   LLNMAHNKFYGPIPEVLCRLPRAFNFTLSNNYFTQVGPQCRRLIRLRRLNVNRNCIMGLP  379

Query  633   NQRSAQVCKDFFLHYQKCPDHKSLLYVPCDI  541
             NQRSA  C  FF   + C    +   +PC +
Sbjct  380   NQRSAADCGRFFARPRTCARESTFSIIPCRL  410



>gb|EMT03089.1| hypothetical protein F775_11041 [Aegilops tauschii]
Length=447

 Score =   267 bits (682),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 170/348 (49%), Positives = 220/348 (63%), Gaps = 21/348 (6%)
 Frame = -1

Query  1557  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  1378
             + ++   I+ F+K++  DP+ +T +W G +LC     Y+GFFC  P     + V  +  N
Sbjct  80    LYRAYLVIQKFRKTVICDPKGVTATWAGTDLC---GSYKGFFCGRPINVSDRTVASVDLN  136

Query  1377  gynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAGA-  1204
             G+N   + L    FV+   DL + H NSNNF GA  +P ++     +ELDLSNNKLA A 
Sbjct  137   GFNLRSDSLQG--FVDGLPDLALFHANSNNFGGA--VPNLRGLQYFYELDLSNNKLAPAP  192

Query  1203  FPTAVLEATNLTYLDLRFNMLTG--PVHPQVftldldalflnnnfFSGPLPDNLGSTPVF  1030
             FPT VL  TN T++D+RFN   G  P        +++A+F+NNN FSG LPDNLG +PV 
Sbjct  193   FPTDVLGLTNCTFIDIRFNSFFGELPAGLFSSFPEVEAIFVNNNHFSGQLPDNLGDSPVN  252

Query  1029  FLTLANNQFSGPIPKTIGNAS-FLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTG  853
             +L+LANN F+GPIP +IG A+  LLEVLFLNN LSGCLPYEIGLL  +TV DA  N LTG
Sbjct  253   YLSLANNDFTGPIPSSIGRAADTLLEVLFLNNSLSGCLPYEIGLLARATVIDAGTNHLTG  312

Query  852   PIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLK---DLEELSLSGNYFTQIGPECRNLL  682
              IP S+ CL  +E LNL +N LYG V +SLC+L     L  L+LSGNYFT +GP C +L+
Sbjct  313   TIPLSYACLRSVEQLNLADNLLYGVVHDSLCRLAYDGRLANLTLSGNYFTWLGPCCWDLI  372

Query  681   EKKVLDIDNNCILDLPNQRSAQVCKDFF---LHYQKCPDHKSLLYVPC  547
              +  L++D NCIL  PNQRS Q C +FF        CP  K   YVPC
Sbjct  373   REGKLNVDRNCILWAPNQRSFQECAEFFHDNWARMTCPVSK---YVPC  417



>ref|XP_009617390.1| PREDICTED: uncharacterized protein At4g06744-like [Nicotiana 
tomentosiformis]
Length=420

 Score =   265 bits (678),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 148/332 (45%), Positives = 205/332 (62%), Gaps = 7/332 (2%)
 Frame = -1

Query  1536  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  1357
             I+ FK  IT DP  +T+SW G  +C     Y GF+C  P   +K  +     +   F  +
Sbjct  70    IQKFKNIITSDPLGVTKSWVGPNIC----NYTGFYCETPPD-NKSAIAVASIDFNGFQLS  124

Query  1356  glslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  1177
               +L+ F++   D+ + H NSNNF+G     +   P L+ELD+SNN+ +G FP A+L   
Sbjct  125   APNLDGFLDQLPDIALFHANSNNFSGTLSANIANLPYLYELDISNNQFSGPFPPAILGMN  184

Query  1176  NLTYLDLRFNMLTGPVHPQVftldldalflnnnfF-SGPLPDNLGSTPVFFLTLANNQFS  1000
             +L++LD+RFN  TG V PQ+FT D       NN       PDN+GS+ V +LTLANN+F 
Sbjct  185   SLSFLDIRFNSFTGSVPPQLFTKDQLDAIFINNNNFMQKFPDNIGSSHVLYLTLANNRFF  244

Query  999   GPIPKTIGNA-SFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLE  823
             GPIP +I    + L E+L LNN LSGC PYE+GLL  + VFDA  N+LTGP+P S GCLE
Sbjct  245   GPIPCSISKILASLSEILLLNNLLSGCFPYELGLLNEAVVFDAGNNRLTGPLPFSLGCLE  304

Query  822   KLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCIL  643
              +E+LN   NQLYG VPE +C L++L  LSLS N+F  +GP C +L+++ V+D+  NCI 
Sbjct  305   NMEVLNFAGNQLYGMVPEVVCSLRNLANLSLSNNFFIGVGPICLSLIKEGVVDVRKNCIP  364

Query  642   DLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
              LP+QRS   C  +F   + CP  ++  Y+PC
Sbjct  365   GLPSQRSTAECVAYFAQPRYCPYMETYSYIPC  396



>ref|XP_009394537.1| PREDICTED: uncharacterized protein At4g06744-like [Musa acuminata 
subsp. malaccensis]
Length=438

 Score =   265 bits (678),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 163/336 (49%), Positives = 206/336 (61%), Gaps = 13/336 (4%)
 Frame = -1

Query  1536  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  1357
             I+ FK+++T DP  +T +W G   C     Y+GF+C  P                     
Sbjct  85    IQQFKQTVTCDPDGVTATWVGYRPC----TYRGFYCDTPPDSPGTPTIASVDFNGFRLCA  140

Query  1356  glslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  1177
                   FV+   DL + H NSNNF+G P   +   P L+ELD+SNN  +G FP AVL  +
Sbjct  141   PTVAG-FVDQLPDLALFHANSNNFSG-PIPDLTGLPYLYELDVSNNIHSGPFPVAVLPLS  198

Query  1176  NLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTLANNQFSG  997
             NL +LDLR+N+  G V   +F LDLD LFLNNN F+  LP NLGS+PV +LTLANN F+G
Sbjct  199   NLVFLDLRYNLFAGTVPASIFFLDLDVLFLNNNNFNQQLPANLGSSPVAYLTLANNGFTG  258

Query  996   PIPKTIGNAS-FLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEK  820
             P+P++I NAS  L+EVLFLNNK SGCLPYEIG L  +TVFD   NQ TGPIP SFGCL K
Sbjct  259   PLPRSIFNASRTLVEVLFLNNKFSGCLPYEIGSLTTATVFDVGFNQFTGPIPWSFGCLLK  318

Query  819   LEILNLTNNQLYGSVPESLCKLK---DLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNC  649
             +E LNL  N LYG VP+ +C+L    +L  LSLSGNYFT +G  C +L+++KVLD+  NC
Sbjct  319   VEQLNLAGNLLYGEVPDVVCRLAKDGNLANLSLSGNYFTSLGHSCWDLIKRKVLDVRQNC  378

Query  648   ILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPCDI  541
             I   P QR    C  F  H + CP      Y+PC +
Sbjct  379   IPWFPEQRRPVECWRFLWHRKFCPFFH---YIPCGL  411



>ref|XP_010523006.1| PREDICTED: uncharacterized protein At4g06744-like [Tarenaya hassleriana]
Length=423

 Score =   265 bits (676),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 154/332 (46%), Positives = 211/332 (64%), Gaps = 6/332 (2%)
 Frame = -1

Query  1539  AIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfng  1360
             AI+ FK  I+ DP N+T +W G+++C     Y+GFFC  P   +   +     +   F  
Sbjct  70    AIQKFKSLISSDPFNVTGTWVGSDIC----SYRGFFCDNPPD-NGSAIAVASIDFNGFQL  124

Query  1359  nglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEA  1180
             +  S++ F++   DL + H N+NNF G     + +   L+E D+SNN+ +G FPTAVL  
Sbjct  125   SAPSIDGFLDQLPDLAIFHANTNNFGGVVPPKIAELKYLYEFDISNNRFSGPFPTAVLGM  184

Query  1179  TNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTLANNQFS  1000
               LT+LD+RFN  TG V PQ+FT +LD LF+N+N F+  LP+ LG T + FLTLANN+F+
Sbjct  185   PGLTFLDIRFNRFTGSVPPQIFTQNLDVLFINDNEFTANLPETLGETHIQFLTLANNKFN  244

Query  999   GPIPKTIGNA-SFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLE  823
             GPIP+ I  A S + EVLFLNN+L+GCLPYE+G LK + V D   N+LTG +P S  CLE
Sbjct  245   GPIPRGILRAMSTVTEVLFLNNELTGCLPYELGFLKEARVLDVGQNRLTGRLPMSLTCLE  304

Query  822   KLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCIL  643
             K E LN   N L+G+VPE++C L++L   SLS NYFT +GP CR L+E+ VLD+ NNCI 
Sbjct  305   KAEQLNFAGNFLFGAVPETVCMLQNLANFSLSDNYFTHVGPFCRILIERGVLDVRNNCIP  364

Query  642   DLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
              LPNQR  + C  F    + C       ++PC
Sbjct  365   FLPNQRPFKECLGFLARPKYCSHMWFHSFIPC  396



>gb|KEH30896.1| Serine/Threonine kinase, plant-type protein, putative [Medicago 
truncatula]
Length=413

 Score =   264 bits (675),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 160/349 (46%), Positives = 214/349 (61%), Gaps = 6/349 (2%)
 Frame = -1

Query  1569  LDPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  1390
             LD  +      I+ FK +IT DP  IT +W G  +C     Y+GF+C  P   +      
Sbjct  50    LDQRLAIVFPIIQAFKNTITSDPLGITLTWVGPNIC----NYKGFYCDNPPD-NLSATTV  104

Query  1389  iyfngynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  1210
                +   F  +  SL+ F++   DL + H NSNNF+G     +     L+ELDLSNN L+
Sbjct  105   ASIDFNGFQLSAPSLDDFIDQLPDLALFHANSNNFSGTISPKIASLKYLYELDLSNNLLS  164

Query  1209  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVF  1030
             G FP+++L    L++LD+R+N+ TG V  Q+F  +L A+FLNNN F   LP+N+G T   
Sbjct  165   GTFPSSILNMPTLSFLDIRYNLFTGTVPQQIFIKELSAIFLNNNNFLLTLPNNIGETTAS  224

Query  1029  FLTLANNQFSGPIPKTIGNAS-FLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTG  853
             +LT ANN+F+G IP TIG AS  LLEVL LNN+L+GCLPYEIG LKN  +FDA  N LTG
Sbjct  225   YLTFANNKFTGSIPSTIGKASSTLLEVLLLNNQLTGCLPYEIGFLKNLQLFDAGNNLLTG  284

Query  852   PIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKK  673
             P+P S GCL+K+E LN   N LYG VPE +C L +LE L+LS NYF ++GP CR L++  
Sbjct  285   PLPFSLGCLKKVEQLNFARNMLYGQVPEVVCSLGNLENLTLSYNYFNRVGPLCRKLIKSG  344

Query  672   VLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPCDIDESPR  526
             VLD+  NCI DLP+QR  + C  F+   + C    S   +PC +   PR
Sbjct  345   VLDVKKNCIFDLPDQRPMEDCVKFYAVPRTCLGSGSFTVIPCQLPMKPR  393



>ref|XP_008663372.1| PREDICTED: uncharacterized protein At4g06744-like [Zea mays]
 gb|AFW58791.1| leucine-rich repeat (LRR) family protein [Zea mays]
Length=548

 Score =   268 bits (685),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 165/342 (48%), Positives = 222/342 (65%), Gaps = 18/342 (5%)
 Frame = -1

Query  1551  KSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngy  1372
             ++   I+ F+ +++ DP ++T+SW G +LC     Y+GF+C  P     + +  + FNGY
Sbjct  185   RAYLVIQQFRSAVSCDPMDVTRSWSGTDLC----GYKGFYCERPPNETDRTIASVDFNGY  240

Query  1371  nfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAGA-FP  1198
                 + L    FV S  DL + H NSN+F GA  +P +   P L+ELDLSNN+LA A FP
Sbjct  241   MLRADSLQG--FVNSLPDLALFHANSNDFGGA--VPALAALPFLYELDLSNNRLAPATFP  296

Query  1197  TAVLEATNLTYLDLRFNMLTGPVHPQVftl--dldalflnnnfFSGPLPDNLGSTPVFFL  1024
             T VL  TN T++D+RFN   G +   VF     + A+F+NNN FSG LPDN+G +PV +L
Sbjct  297   TDVLALTNATFIDIRFNSFYGELPAGVFCRFPRVQAIFVNNNQFSGSLPDNIGQSPVNYL  356

Query  1023  TLANNQFSGPIPKTIG-NASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPI  847
             +LANN+F+G IPK+I  NA  LLEVLFLNN LSGCLPYE+GLL  +TV DA  N+LTG I
Sbjct  357   SLANNRFTGEIPKSIARNAGTLLEVLFLNNSLSGCLPYELGLLAKATVIDAGTNRLTGTI  416

Query  846   PQSFGCLEKLEILNLTNNQLYGSVPESLCKL--KDLEELSLSGNYFTQIGPECRNLLEKK  673
             P SF CL K+E LNL +N LYG VP++LC+L    L+ L+LS NYFT +G  C +L+++ 
Sbjct  417   PASFACLRKVEQLNLADNLLYGEVPDALCRLAFSHLKNLTLSDNYFTSLGSCCWDLIKEG  476

Query  672   VLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
              L++D NCI   PNQRS + C  F    + CP +    YVPC
Sbjct  477   RLNVDRNCIQWAPNQRSHEECARFLRKPKTCPVNN---YVPC  515



>ref|XP_010066095.1| PREDICTED: uncharacterized protein At4g06744-like [Eucalyptus 
grandis]
 gb|KCW63891.1| hypothetical protein EUGRSUZ_G01566 [Eucalyptus grandis]
Length=382

 Score =   263 bits (672),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 157/351 (45%), Positives = 208/351 (59%), Gaps = 11/351 (3%)
 Frame = -1

Query  1569  LDPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  1390
             LD  +      I+ FK +IT DP  IT SW G  +C     Y GF+C  P   +      
Sbjct  14    LDQRLAAVYPVIQQFKNTITADPSGITNSWVGPGIC----NYTGFYCDNPPD-NLTATAL  68

Query  1389  iyfngynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  1210
                +   ++    +L  F++   DL + H NSNNF+G     + + P  +ELD+SNN  +
Sbjct  69    AGIDFNGYHLGAPTLEGFLDQLPDLAIFHANSNNFSGVIPQKIAQLPYFYELDVSNNNFS  128

Query  1209  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVF  1030
             GAFP AV    NL++LD+RFN  TG V PQVF   LD L++NNN F   +P + GST V 
Sbjct  129   GAFPAAVF-GVNLSFLDIRFNSFTGSVPPQVFKQALDVLYINNNKFMQKIPIDFGSTRVL  187

Query  1029  FLTLANNQFSGPIPKTIGNAS-FLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTG  853
             +LTLANN+F+G IP++I NAS  L+EVLFLNN+L GC+PYEIG L+ +TVFDA  N LTG
Sbjct  188   YLTLANNKFTGLIPRSIANASSTLIEVLFLNNQLMGCIPYEIGFLRKATVFDAGDNYLTG  247

Query  852   PIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKK  673
              +P S GCL+ +E LN   N LY ++PE +C +  L  LSLS NYF  IGP C  L+++ 
Sbjct  248   QLPCSLGCLDMIEQLNFAGNFLYDAIPEVVCSMPKLSNLSLSDNYFNHIGPLCWKLVKRG  307

Query  672   VLDIDNNCILDLPNQRSAQVCKDFFLH----YQKCPDHKSLLYVPCDIDES  532
             VLD+  NCI  LPNQR    C  F+ H       CP    +  +PC I+ S
Sbjct  308   VLDVRMNCIFGLPNQRPHYECVKFYFHSFWFRWVCPWQYLMSAIPCKINSS  358



>dbj|BAJ86461.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=444

 Score =   265 bits (677),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 170/348 (49%), Positives = 222/348 (64%), Gaps = 21/348 (6%)
 Frame = -1

Query  1557  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  1378
             + ++   I+ F+K++  DP+ +T +W G +LC     Y+GFFC  P     + V  +  N
Sbjct  77    LYRAYLVIQKFRKTVICDPKGVTTTWAGTDLC---GSYKGFFCGRPINVSDRTVASVDLN  133

Query  1377  gynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAGA-  1204
             GYN   + L    FV+   DL + H NSNNF GA  +P ++     +ELDLSNNKLA A 
Sbjct  134   GYNLRSDSLQG--FVDGLPDLALFHANSNNFGGA--VPNLRGLQYFYELDLSNNKLAPAP  189

Query  1203  FPTAVLEATNLTYLDLRFNMLTGPVHPQVftl--dldalflnnnfFSGPLPDNLGSTPVF  1030
             FPT VL  TN T++D+RFN   G +   +F+   +++A+F+NNN FSG LPDNLG +PV 
Sbjct  190   FPTDVLGLTNCTFIDIRFNSFFGELPAGLFSSFPEVEAIFVNNNRFSGQLPDNLGDSPVN  249

Query  1029  FLTLANNQFSGPIPKTIGNAS-FLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTG  853
             +L+LANN F+GPIP +IG A+  L EVLFLNN LSGCLPYEIGLL  +TV DA  N LTG
Sbjct  250   YLSLANNDFTGPIPSSIGRAADTLQEVLFLNNSLSGCLPYEIGLLARATVIDAGTNHLTG  309

Query  852   PIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLK---DLEELSLSGNYFTQIGPECRNLL  682
              IP S+ CL  +E LNL +N LYG V +SLC+L     L  L+LSGNYFT +GP C +L+
Sbjct  310   TIPLSYACLRSVEQLNLADNLLYGVVHDSLCRLAYDGRLANLTLSGNYFTWLGPCCWDLI  369

Query  681   EKKVLDIDNNCILDLPNQRSAQVCKDFF---LHYQKCPDHKSLLYVPC  547
              +  L++D NCIL  PNQRS Q C +FF        CP  K   YVPC
Sbjct  370   REGKLNVDRNCILWAPNQRSFQECAEFFHENWARMTCPVSK---YVPC  414



>gb|AEV41070.1| uncharacterized protein At4g06744 precursor [Oryza minuta]
Length=455

 Score =   265 bits (677),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 179/391 (46%), Positives = 228/391 (58%), Gaps = 24/391 (6%)
 Frame = -1

Query  1674  GEEESKETSPPASLVYNVDCGCYVpppppppcppPLDPVIRKSIKAIRTFKKSITYDPQN  1495
             GE +    SPP+       CGC   P P P     L+  +R     I+ FK+ IT D + 
Sbjct  51    GEGKGSAPSPPSLDT----CGC--GPAPAPAPSEFLNEKLRSLYPVIQAFKQRITSDLRG  104

Query  1494  ITQSWEGNELC---INKKKYQGFFCYVPRGGDKKR----VggiyfngynfngnglslnSF  1336
             +T SW G  LC        Y+GF+C  P   D  +    +     +   +     SL  F
Sbjct  105   VTASWVGPNLCDSYFGGNMYKGFYCDHPPVNDAPQDDTTLTIASIDFNGYGLAAPSLAGF  164

Query  1335  VESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAGAFPTAVLEATNLTYLD  1159
             V++F +L + H NSNNF+G   +P +   P  +ELDLSNN  +GAFP  V+    L +LD
Sbjct  165   VDAFPELALFHANSNNFSGE--VPDLTALPYFYELDLSNNNFSGAFPANVVPLGRLLFLD  222

Query  1158  LRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTLANNQFSGPIPKTI  979
             LRFN   G V P VF L + ALFLNNN F G +PDN GST   +L +ANNQF+GPIP++I
Sbjct  223   LRFNHFVGTVPPPVFDLSVVALFLNNNGFYGRIPDNFGSTTAEYLVVANNQFTGPIPRSI  282

Query  978   GNASF-LLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNL  802
              N S  L EVLFLNN+LSGCLPYEIGL++  TVFDA  N +TGPIP SFGCL  +E LNL
Sbjct  283   YNTSANLSEVLFLNNQLSGCLPYEIGLVEGLTVFDAGGNDITGPIPLSFGCLGLVEELNL  342

Query  801   TNNQLYGSVPESLC---KLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPN  631
               NQLYG++P+ LC   K   L+ LSLS NYF  +G  C  L+  KVLD+  NCIL+ PN
Sbjct  343   AGNQLYGNIPDVLCMLAKTGKLQNLSLSDNYFHSVGHHCLELVRSKVLDVRLNCILNFPN  402

Query  630   QRSAQVCKDFFLHYQKCPDHKSLL-YVPCDI  541
             QR A  C  F   Y   P H   + ++PCD+
Sbjct  403   QRPALECARF---YADPPQHCPFVPHIPCDL  430



>ref|XP_010065987.1| PREDICTED: uncharacterized protein At4g06744-like [Eucalyptus 
grandis]
Length=418

 Score =   263 bits (673),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 156/351 (44%), Positives = 208/351 (59%), Gaps = 11/351 (3%)
 Frame = -1

Query  1569  LDPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  1390
             LD  +      I+ FK ++T DP  IT SW G  +C     Y GF+C  P   +      
Sbjct  50    LDQRLAAVYPVIQQFKNTVTADPSGITNSWVGPGIC----NYTGFYCDNPPD-NLTATAL  104

Query  1389  iyfngynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  1210
                +   ++    +L  F++   DL + H NSNNF+G     + + P  +ELD+SNN  +
Sbjct  105   AGIDFNGYHLGAPTLEGFLDQLPDLAIFHANSNNFSGVIPQKIAQLPYFYELDVSNNNFS  164

Query  1209  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVF  1030
             GAFP AV    NL++LD+RFN  TG V PQVF   LD L++NNN F   +P + GST V 
Sbjct  165   GAFPAAVF-GVNLSFLDIRFNSFTGSVPPQVFKQALDVLYINNNKFMQKIPIDFGSTRVL  223

Query  1029  FLTLANNQFSGPIPKTIGNAS-FLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTG  853
             +LTLANN+F+G IP++I NAS  L+EVLFLNN+L GC+PYEIG L+ +TVFDA  N LTG
Sbjct  224   YLTLANNRFTGLIPRSIANASSTLIEVLFLNNQLMGCIPYEIGFLRKATVFDAGDNYLTG  283

Query  852   PIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKK  673
              +P S GCL+ +E LN   N LY ++PE +C +  L  LSLS NYF  IGP C  L+++ 
Sbjct  284   QLPCSLGCLDMIEQLNFAGNFLYDAIPEVVCSMPKLSNLSLSDNYFNHIGPLCWKLVKRG  343

Query  672   VLDIDNNCILDLPNQRSAQVCKDFFLH----YQKCPDHKSLLYVPCDIDES  532
             VLD+  NCI  LPNQR    C  F+ H       CP    +  +PC I+ S
Sbjct  344   VLDVRMNCIFGLPNQRPHYECVKFYFHSFWFRWVCPWQYLMSAIPCKINSS  394



>gb|ACG34018.1| protein binding protein [Zea mays]
 tpg|DAA37048.1| TPA: leucine-rich repeat (LRR) family protein [Zea mays]
Length=442

 Score =   264 bits (675),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 163/344 (47%), Positives = 221/344 (64%), Gaps = 18/344 (5%)
 Frame = -1

Query  1557  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  1378
             + ++   I+ F+ ++T DP  +TQSW G ++C     Y+GFFC  P     + +  + FN
Sbjct  82    LYRAYLVIQQFRSTVTCDPMGVTQSWSGTDVC----SYKGFFCERPPNVTDRAIASVDFN  137

Query  1377  gynfngnglslnSFVESFNDLVVIHVNSNNFTGA-PGIPVQKFPTLFELDLSNNKLA-GA  1204
             GY      L    FV+S  DL + H NSN+F GA P +   ++   +ELDLSNNKLA  A
Sbjct  138   GYMLQAGSLRG--FVDSLPDLALFHANSNDFGGAVPALGGLQY--FYELDLSNNKLAPAA  193

Query  1203  FPTAVLEATNLTYLDLRFNMLTGPVHPQVftl--dldalflnnnfFSGPLPDNLGSTPVF  1030
             FP  VL  TN T++D+RFN   G +   VF     + A+F+NNN FSG LPDN+G +PV 
Sbjct  194   FPADVLGLTNATFVDIRFNSFYGELPAGVFCKLPRVQAIFVNNNRFSGALPDNIGQSPVN  253

Query  1029  FLTLANNQFSGPIPKTIG-NASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTG  853
             +L+LANN+F+G IP++I  NA  LLEVLFLNN LSGCLP+E+GLL+ +TV DA  N+LTG
Sbjct  254   YLSLANNRFTGEIPRSIARNAGTLLEVLFLNNSLSGCLPHELGLLEKATVIDAGANRLTG  313

Query  852   PIPQSFGCLEKLEILNLTNNQLYGSVPESLCKL--KDLEELSLSGNYFTQIGPECRNLLE  679
              IP SF CL K+E LNL  N LYG VP++LC+L   +L+ L+LS NYFT +G  C +L++
Sbjct  314   TIPASFACLRKVEQLNLAGNLLYGEVPDALCRLAFSNLKNLTLSDNYFTSLGSCCWDLIK  373

Query  678   KKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
             +  L++D NCI   PNQRS + C  F    + CP +    YVPC
Sbjct  374   EGRLNVDRNCIQWAPNQRSHEDCAKFLRQPKSCPVNN---YVPC  414



>gb|AEV41116.1| uncharacterized protein At4g06744 precursor [Oryza officinalis]
Length=462

 Score =   265 bits (676),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 179/391 (46%), Positives = 228/391 (58%), Gaps = 24/391 (6%)
 Frame = -1

Query  1674  GEEESKETSPPASLVYNVDCGCYVpppppppcppPLDPVIRKSIKAIRTFKKSITYDPQN  1495
             GE +    SPP+       CGC   P P P     L+  +R     I+ FK+ IT D + 
Sbjct  51    GEGKGSAPSPPSLDT----CGC--GPAPAPAPSEFLNEKLRSLYPVIQAFKQRITSDLRG  104

Query  1494  ITQSWEGNELC---INKKKYQGFFCYVPRGGDKKR----VggiyfngynfngnglslnSF  1336
             +T SW G  LC        Y+GF+C  P   D  +    +     +   +     SL  F
Sbjct  105   VTASWVGPNLCDSYFGGNMYKGFYCDHPPVNDAPQDNTTLTIASIDFNGYGLAAPSLAGF  164

Query  1335  VESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAGAFPTAVLEATNLTYLD  1159
             V++F +L + H NSNNF+G   +P +   P  +ELDLSNN  +GAFP  V+    L +LD
Sbjct  165   VDAFPELALFHANSNNFSGE--VPDLTALPYFYELDLSNNNFSGAFPANVVPLGRLLFLD  222

Query  1158  LRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTLANNQFSGPIPKTI  979
             LRFN   G V P VF L + ALFLNNN F G +PDN GST   +L +ANNQF+GPIP++I
Sbjct  223   LRFNHFVGTVPPPVFDLSVVALFLNNNGFYGRIPDNFGSTTAEYLVVANNQFTGPIPRSI  282

Query  978   GNASF-LLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNL  802
              N S  L EVLFLNN+LSGCLPYEIGL++  TVFDA  N +TGPIP SFGCL  +E LNL
Sbjct  283   YNTSANLSEVLFLNNQLSGCLPYEIGLVEGLTVFDAGGNDITGPIPLSFGCLGLVEELNL  342

Query  801   TNNQLYGSVPESLC---KLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPN  631
               NQLYG++P+ LC   K   L+ LSLS NYF  +G  C  L+  KVLD+  NCIL+ PN
Sbjct  343   AGNQLYGNIPDVLCMLAKTGKLQNLSLSDNYFHSVGHHCLELVRSKVLDVRLNCILNFPN  402

Query  630   QRSAQVCKDFFLHYQKCPDHKSLL-YVPCDI  541
             QR A  C  F   Y   P H   + ++PCD+
Sbjct  403   QRPALECARF---YADPPQHCPFVPHIPCDL  430



>ref|NP_849339.1| Leucine-rich repeat-containing protein [Arabidopsis thaliana]
 sp|Q8W3M4.1|Y4744_ARATH RecName: Full=Uncharacterized protein At4g06744; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAB83614.1| extensin-like protein [Arabidopsis thaliana]
 gb|AEE82560.1| Leucine-rich repeat-containing protein [Arabidopsis thaliana]
Length=404

 Score =   262 bits (670),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 154/338 (46%), Positives = 214/338 (63%), Gaps = 12/338 (4%)
 Frame = -1

Query  1569  LDPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  1390
             LD  +      I+ FK  IT DP N+T++W G+++C     Y+GF C  P   +K  V  
Sbjct  41    LDQRLAVVYPVIQRFKSLITLDPYNVTKTWIGSDIC----SYRGFHCDNPPH-NKTAVTV  95

Query  1389  iyfngynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  1210
                +   F  +  S+  F++ F DL + HVNSNNF G     +     L+ELD+SNN+  
Sbjct  96    ASIDFNGFQLSAPSIEGFIDQFADLALFHVNSNNFGGTVPSKIVNLRYLYELDISNNRFT  155

Query  1209  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPD--NLGSTP  1036
             G FPTAV+  + LT++D+RFN  +G + PQ+   +L+ LF+N+N F+  LP+    G+T 
Sbjct  156   GQFPTAVVGMSGLTFIDIRFNSFSGSIPPQILGQNLEVLFINDNGFTASLPEIPGDGTTH  215

Query  1035  VFFLTLANNQFSGPIPKTI-GNASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQL  859
             + FLTLANN+F+GP+P++I  + S L EVLFLNN  +GC+P+EIG L  ++V D   N+L
Sbjct  216   ILFLTLANNKFNGPLPRSILRSMSTLTEVLFLNNDFTGCIPHEIGFLTGASVIDIGGNKL  275

Query  858   TGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKL--KDLEELSLSGNYFTQIGPECRNL  685
             TGP+P S  CLEK+E LN   N L+G+VPE++C L   +L  LSLS NYFT +GP CR L
Sbjct  276   TGPLPLSLMCLEKVEQLNFAGNLLFGAVPEAVCMLLRDNLVNLSLSDNYFTHVGPWCRGL  335

Query  684   LEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQK--CP  577
             LEK VLD+ NNCI   P QRS Q C +FF+  +K  CP
Sbjct  336   LEKGVLDVGNNCIPFFPGQRSMQECAEFFVKPKKYYCP  373



>ref|XP_004976154.1| PREDICTED: uncharacterized protein At4g06744-like [Setaria italica]
Length=458

 Score =   264 bits (674),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 165/344 (48%), Positives = 222/344 (65%), Gaps = 17/344 (5%)
 Frame = -1

Query  1557  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  1378
             + ++   I+ F++++T DP  IT SW G +LC     Y+GFFC  P     + +  + FN
Sbjct  87    LYRAYLVIQQFRQTVTCDPMGITPSWSGTDLC---SSYKGFFCERPPNVTDRTIASVDFN  143

Query  1377  gynfngnglslnSFVESFNDLVVIHVNSNNFTGA-PGIPVQKFPTLFELDLSNNKLAGA-  1204
             GY    + L    F+ S  DL + H NSN+F GA P +   ++   +ELDLSNN+LA A 
Sbjct  144   GYMLRSDSLQG--FINSLPDLALFHANSNDFGGAVPALGGLQY--FYELDLSNNRLAPAP  199

Query  1203  FPTAVLEATNLTYLDLRFNMLTGPVHPQVftl--dldalflnnnfFSGPLPDNLGSTPVF  1030
             FPT VL  TN T++D+RFN   G +   VF     + A+F+NNN FSG LPDN+G +PV 
Sbjct  200   FPTDVLGLTNATFIDIRFNSFYGELPAGVFCRFPRIQAIFVNNNQFSGSLPDNIGQSPVN  259

Query  1029  FLTLANNQFSGPIPKTIG-NASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTG  853
             +L+LANN+F+G IP +I  NA  LLEVLFLNN LSGCLPYE+GLL+ +TV DA  NQLTG
Sbjct  260   YLSLANNRFTGEIPTSISRNAGTLLEVLFLNNSLSGCLPYELGLLEKATVIDAGTNQLTG  319

Query  852   PIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLK--DLEELSLSGNYFTQIGPECRNLLE  679
              IP SF CL K+E LNL +N LYG VP++LC+L    L+ L+LSGNYFT +G  C +L++
Sbjct  320   TIPASFACLRKVEQLNLADNLLYGEVPDALCRLAFGRLKNLTLSGNYFTSLGSCCWDLIK  379

Query  678   KKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
             +  L++D NCI   PNQRS + C  F    + CP +    Y+PC
Sbjct  380   EGRLNVDRNCIQWAPNQRSHEECAKFQRQTKSCPVNS---YLPC  420



>ref|XP_002446758.1| hypothetical protein SORBIDRAFT_06g021870 [Sorghum bicolor]
 gb|EES11086.1| hypothetical protein SORBIDRAFT_06g021870 [Sorghum bicolor]
Length=455

 Score =   263 bits (673),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 164/342 (48%), Positives = 222/342 (65%), Gaps = 17/342 (5%)
 Frame = -1

Query  1551  KSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngy  1372
             ++   I+ F+ ++T DP ++T+SW G +LC     Y+GFFC  P     + +  + FNGY
Sbjct  90    RAYLVIQQFRSTVTCDPMDVTRSWSGTDLC---GGYKGFFCERPPNVTDRTIASVDFNGY  146

Query  1371  nfngnglslnSFVESFNDLVVIHVNSNNFTGA-PGIPVQKFPTLFELDLSNNKLAGA-FP  1198
                 + L    F+ +  DL + H NSN+F GA P +   ++   +ELDLSNNKLA A FP
Sbjct  147   MLRADSLQG--FINNLPDLALFHANSNDFGGAVPSLGSLQY--FYELDLSNNKLAPAPFP  202

Query  1197  TAVLEATNLTYLDLRFNMLTGPVHPQVftl--dldalflnnnfFSGPLPDNLGSTPVFFL  1024
             T VL  TN T++D+RFN   G +   VF     + A+F+NNN FSG LPDN+G +PV +L
Sbjct  203   TDVLGLTNATFIDIRFNSFYGELPAGVFCRFPRVQAIFVNNNQFSGSLPDNIGQSPVNYL  262

Query  1023  TLANNQFSGPIPKTIG-NASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPI  847
             +LANN+F+G IPK+I  NA  LLEVLFLNN LSGCLPYE+GLL+ +TV DA  N+LTG I
Sbjct  263   SLANNRFTGEIPKSIARNAGTLLEVLFLNNSLSGCLPYELGLLEKATVIDAGTNRLTGTI  322

Query  846   PQSFGCLEKLEILNLTNNQLYGSVPESLCKL--KDLEELSLSGNYFTQIGPECRNLLEKK  673
             P SF CL K+E LNL +N LYG VP++LC+L    L+ L+LSGNYFT +G  C +L+++ 
Sbjct  323   PASFACLRKVEQLNLADNLLYGEVPDALCRLAFSHLKNLTLSGNYFTSLGSCCWDLIKEG  382

Query  672   VLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
              L++D NCI   PNQRS   C  F    + CP +    Y+PC
Sbjct  383   RLNVDRNCIQWAPNQRSHDECAKFLRKPKTCPVNN---YLPC  421



>gb|AEV40972.1| uncharacterized protein At4g06744 precursor [Oryza punctata]
Length=457

 Score =   263 bits (673),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 168/356 (47%), Positives = 213/356 (60%), Gaps = 18/356 (5%)
 Frame = -1

Query  1569  LDPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELC---INKKKYQGFFCYVP--RGG--  1411
             L+  +R     I+ FK +IT DP+ +T SW G  LC        Y+GF+C  P  +G   
Sbjct  78    LNEKLRTLYPVIQAFKTTITSDPRGVTASWVGPNLCDSYFGGNMYKGFYCDHPPVKGAPQ  137

Query  1410  DKKRVggiyfngynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFEL  1234
             D   +     +   +     SL  F+++F DL + H NSNNF+G   +P +   P  +EL
Sbjct  138   DDTTLTIASIDFNGYGLGAPSLAGFIDAFPDLALFHANSNNFSGD--VPDLTGLPYFYEL  195

Query  1233  DLSNNKLAGAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPD  1054
             DLSNN  +G FP  V+    L +LDLRFN   G V P VF L + ALFLNNN F G +PD
Sbjct  196   DLSNNNFSGVFPANVVPLGGLLFLDLRFNRFVGTVPPPVFDLSVVALFLNNNGFYGRIPD  255

Query  1053  NLGSTPVFFLTLANNQFSGPIPKTIGNASF-LLEVLFLNNKLSGCLPYEIGLLKNSTVFD  877
             N GST   +L +ANNQF+GPIP++I N S  L EVLFLNN LSGCLPYEIGL++  TVFD
Sbjct  256   NFGSTTAEYLVVANNQFTGPIPRSIYNTSANLSEVLFLNNHLSGCLPYEIGLVEGLTVFD  315

Query  876   ASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLC---KLKDLEELSLSGNYFTQI  706
             A  N +TGPIP S GCL  +E LNL  NQLYG +P+ LC   K   L+ LSLS NYF  +
Sbjct  316   AGGNDITGPIPLSLGCLGLVEELNLAGNQLYGHIPDVLCMLAKTGKLQNLSLSDNYFHSV  375

Query  705   GPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL-YVPCDI  541
             G  C  L+  KVLD+  NCIL+ PNQR A  C  F   Y   P H   + ++PCD+
Sbjct  376   GHHCLELVRSKVLDVRLNCILNFPNQRPALECARF---YADPPQHCPFVPHIPCDL  428



>gb|EPS58531.1| hypothetical protein M569_16282, partial [Genlisea aurea]
Length=344

 Score =   259 bits (662),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 151/334 (45%), Positives = 201/334 (60%), Gaps = 6/334 (2%)
 Frame = -1

Query  1539  AIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfng  1360
             AI+ FK  ++ DP+N+T SW G ++C    +Y+GF+C  P   +   V     +   F+ 
Sbjct  14    AIQKFKSLVSSDPRNVTVSWVGADVC----RYRGFYCDSPPD-NSSAVAVASVDFNGFHL  68

Query  1359  nglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEA  1180
                +L  F++   D+ + H NSN F+G   + + + P L+ELDLSNN L+G FP  +L  
Sbjct  69    TAPTLAGFIDQLPDIAIFHANSNFFSGGVPVGIARLPYLYELDLSNNLLSGDFPAEILAM  128

Query  1179  TNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTLANNQFS  1000
                + LD+RFN  TG V P +F  +L+ LF+NNN F   LP+   S  + FLTLANN+  
Sbjct  129   GGFSLLDIRFNFFTGAVPPAIFAGNLNFLFINNNDFITTLPEISVSAHLLFLTLANNRLF  188

Query  999   GPIPKTIGNA-SFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLE  823
             GPIP +IG   S + E+L  NN L+GCLPY++GLLK   V DA+ NQLTGP+P S  CLE
Sbjct  189   GPIPASIGVIFSGVSEILLQNNSLTGCLPYQLGLLKEVVVIDAAENQLTGPLPTSIACLE  248

Query  822   KLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCIL  643
             K+EILNL  N+LYGSVP+ LC+L  L  LSLS NYFT  G  C  L+   VLD+ NNCI 
Sbjct  249   KVEILNLAGNRLYGSVPDLLCRLSKLTNLSLSDNYFTVAGDSCMGLIRSGVLDLTNNCIP  308

Query  642   DLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPCDI  541
              LP QR    C  FF     CP+      +PC I
Sbjct  309   GLPFQRPPMECAAFFAGQPSCPNQYIFSKIPCRI  342



>ref|XP_010455221.1| PREDICTED: uncharacterized protein At4g06744-like [Camelina sativa]
Length=407

 Score =   261 bits (666),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 156/348 (45%), Positives = 216/348 (62%), Gaps = 12/348 (3%)
 Frame = -1

Query  1569  LDPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  1390
             LD  +      I+ FK  IT DP  +TQ+W G+++C     Y+GF C  P   +K  V  
Sbjct  44    LDQRLAVVYPVIQRFKSLITLDPYKVTQTWTGSDIC----SYRGFHCDNPPD-NKTAVTV  98

Query  1389  iyfngynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  1210
                +   F  +  S+  F++ F DL + HVNSNNF G     +     L+ELD+SNN+  
Sbjct  99    ASIDFNGFQLSAPSIEGFIDQFPDLALFHVNSNNFGGTVPSQIVNLKYLYELDISNNRFT  158

Query  1209  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPD--NLGSTP  1036
             G FPTAV+  + LT+LD+RFN  +G V PQ+   +LD LF+N+N F+  LP+    G+T 
Sbjct  159   GQFPTAVVGMSGLTFLDIRFNSFSGSVPPQILGQNLDVLFINDNGFTASLPEVPGDGTTH  218

Query  1035  VFFLTLANNQFSGPIPKTI-GNASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQL  859
             + +LTLANN+F+GP+P++I  + S L EVLFLNN  +GC+PYEIG L  ++V D   N+L
Sbjct  219   ILYLTLANNKFNGPLPRSILRSMSTLTEVLFLNNDFTGCIPYEIGFLTGASVIDIGGNKL  278

Query  858   TGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCK-LKD-LEELSLSGNYFTQIGPECRNL  685
             TGP+P S  CLEK+E LN   N L+G++PE++C  L+D L  LSLS NYFT +GP CR L
Sbjct  279   TGPLPLSLMCLEKVEQLNFAGNLLFGAIPEAVCMVLRDNLVNLSLSDNYFTHVGPWCRGL  338

Query  684   LEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQK--CPDHKSLLYVPC  547
             L++ VLD+ NNCI   P QRS Q C +FF+  +K  CP      +  C
Sbjct  339   LDRGVLDVSNNCIPFFPGQRSMQECAEFFVKPKKYYCPHMWYHSFFSC  386



>ref|XP_010664552.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein At4g06744-like 
[Vitis vinifera]
Length=459

 Score =   262 bits (670),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 158/326 (48%), Positives = 203/326 (62%), Gaps = 6/326 (2%)
 Frame = -1

Query  1539  AIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfng  1360
              I+ FK  IT  P  I +SW+G ++C  K    GF+C  P   +K  +     +   F  
Sbjct  107   VIQKFKAIITSVPLGIAKSWQGLDICSCK----GFYCDNPPD-NKTAIALASIDFNGFQL  161

Query  1359  nglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEA  1180
                +L+ F+    D+ + H NSNNF G     + K P L+ELD+SNNKL+G+FP A+L  
Sbjct  162   GAPTLDGFINQLTDIALFHANSNNFAGTNPPDIAKLPCLYELDISNNKLSGSFPRAILGI  221

Query  1179  TNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTLANNQFS  1000
              +LT+LD+RFN+ TG V  Q+F+ +LD LF+ +N F   LPDNLG+T V  L LANN+F 
Sbjct  222   KSLTFLDIRFNLFTGSVPSQLFSQNLDVLFIKDNNFRQTLPDNLGNTHVLCLILANNRFM  281

Query  999   GPIPKTIGNA-SFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLE  823
             GPIP++I    S L EVLFLNN L+GCLP EIG LK + VFD   N+LTGPIP S GCLE
Sbjct  282   GPIPRSINKTLSTLTEVLFLNNMLTGCLPLEIGFLKEARVFDVGNNRLTGPIPFSLGCLE  341

Query  822   KLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCIL  643
             K+E LN      YG VPE LC+L +L  LSL  NYF Q+G  CR+L+ K +LDI  NCI 
Sbjct  342   KVEELNFAGKLFYGMVPEVLCQLPNLLNLSLYDNYFMQVGLACRSLIWKGLLDIRKNCIP  401

Query  642   DLPNQRSAQVCKDFFLHYQKCPDHKS  565
             DLP QRS   C D F + + CP   S
Sbjct  402   DLPFQRSVAECADLFQYPRFCPYMNS  427



>ref|XP_003529407.1| PREDICTED: uncharacterized protein At4g06744-like [Glycine max]
Length=449

 Score =   261 bits (668),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 156/347 (45%), Positives = 214/347 (62%), Gaps = 16/347 (5%)
 Frame = -1

Query  1557  IRKSIKAIRTFKKSITYDPQNITQSW-EGNELCINKKKYQGFFCYVPRGGDKKRVggiyf  1381
             + K+ + +  FK +I  DP   TQ+W +  + C    K+ G  C      D++R      
Sbjct  79    LEKAKRVLLKFKTTID-DPNCYTQNWSQDTDAC----KFNGVRC-ANFPDDQQRAVAGLD  132

Query  1380  ngynfngngls----lnSFVESFNDLVVIHVNSNNFTGAPGIP--VQKFPTLFELDLSNN  1219
                            L   ++S  +L   HVNSNNF+   G P  + +F   FELDLSNN
Sbjct  133   LNGAKLATKNGGNLPLTGLLDSIPELTFFHVNSNNFSFVGGFPNNITRFRFFFELDLSNN  192

Query  1218  KLAGAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGST  1039
             K++G FPT  ++   L +LDLRFN LTGP+ P++F  DLD +F+NNN F+G LP+N GST
Sbjct  193   KVSGKFPTQAIQNNQLVFLDLRFNQLTGPIDPKLFERDLDVIFVNNNKFTGYLPENFGST  252

Query  1038  PVFFLTLANNQFSGPIPKTIGNASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQL  859
             P  +LT A+N  SG +PK++G A  L EVLFL N+  GCLP+EIG LK + VFD S N L
Sbjct  253   PARYLTFAHNSLSGSLPKSVGYAPNLTEVLFLKNQFEGCLPFEIGYLKKAVVFDISENLL  312

Query  858   TGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLE---ELSLSGNYFTQIGPECRN  688
             TGPIP SFGCL+K++ LNL +N+LYG VP++LC++  +     LSL+ NYF +IGP C +
Sbjct  313   TGPIPLSFGCLKKIQFLNLAHNKLYGCVPDNLCQIPSIRNNGNLSLANNYFNEIGPSCWS  372

Query  687   LLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
             L++ KVLD+  NCI  LPNQ+S + C  F+   + CP+  S  YVPC
Sbjct  373   LIKSKVLDVSGNCIPGLPNQKSPKECYQFYKTKKTCPNPNSFYYVPC  419



>gb|EMT04546.1| hypothetical protein F775_44003 [Aegilops tauschii]
Length=384

 Score =   259 bits (663),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 166/343 (48%), Positives = 219/343 (64%), Gaps = 22/343 (6%)
 Frame = -1

Query  1536  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  1357
             I+ FK++IT DPQ IT++W G  +C +   Y GFFC  P   +++ +  + FNG+     
Sbjct  22    IQRFKQTITCDPQGITKTWTGTAIC-SDTSYLGFFCEKPPNVNERALASVDFNGFKLEAP  80

Query  1356  glslnSFVESFNDLVVIHVNSNNFTGAPGIPV-QKFPTLFELDLSNNKLAG-AFPTAVLE  1183
              +    FV++  DL + H NSN+F G   +P+ +     +ELD+SNNKLA  AFPT VL 
Sbjct  81    TVEG--FVDALPDLALFHANSNDFGGV--VPILRSLQYFYELDVSNNKLARCAFPTDVLG  136

Query  1182  ATNLTYLDLRFNMLTGPVHPQVftl--dldalflnnnfFSGPLPDNLGSTPVFFLTLANN  1009
              TN T++D+RFN   G V   +F     ++A+F+NNN FSG +P NLG +PV +L LANN
Sbjct  137   ITNATFVDIRFNQFYGEVPAGLFRSFPIVEAIFVNNNQFSGKIPSNLGDSPVNYLALANN  196

Query  1008  QFSGPIPKTIGNAS-FLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFG  832
             QF+GPIP +IG A+  LLEVLFLNNKLSGCLPYE+GLL  +TV DA  NQLTG IP S+ 
Sbjct  197   QFTGPIPSSIGRAANTLLEVLFLNNKLSGCLPYELGLLAKATVIDAGTNQLTGTIPASYA  256

Query  831   CLEKLEILNLTNNQLYGSVPESLCKLK------DLEELSLSGNYFTQIGPECRNLLEKKV  670
             CL K+E LNL +N LYG VP++LC+L        L  L+LS NYFT +G  C  L+++  
Sbjct  257   CLRKVEQLNLADNLLYGEVPDALCRLAYPSSGGHLANLTLSDNYFTSLGSCCWALIKQGK  316

Query  669   LDIDNNCILDLPNQRSAQVCKDFFLHYQK--CPDHKSLLYVPC  547
             L++  NCI   PNQRS + C  FF H  K  CP      YVPC
Sbjct  317   LNVARNCIPYAPNQRSHEECAGFF-HRTKTYCPVST---YVPC  355



>gb|KDP41694.1| hypothetical protein JCGZ_16101 [Jatropha curcas]
Length=438

 Score =   260 bits (665),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 149/337 (44%), Positives = 205/337 (61%), Gaps = 10/337 (3%)
 Frame = -1

Query  1524  KKSITYDPQNITQSWEGNELCINKKKYQGFFC-YVPRGGDKKRVggiyfngynfngngls  1348
             K++IT DP+N T +W GN  C+    ++G+FC  VP   D+   G    +       G  
Sbjct  85    KRNITSDPRNYTGTWVGNNYCL----FRGYFCDTVP---DRNITGLAAIDFNGARFGGNL  137

Query  1347  l-nSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEATNL  1171
                 F+ +  D+ + H N+NNF+G     + +    +ELDLSNNK  G FPT VL    L
Sbjct  138   NFYRFIMNLPDIAIFHANTNNFSGPINQNLNQLRFFYELDLSNNKFLGGFPTNVLAVQKL  197

Query  1170  TYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTLANNQFSGPI  991
              ++D+RFN   GPV  Q F +D D LF+NNN F+  +P N G+TP  +LT+ANN+ +GPI
Sbjct  198   QFVDIRFNGYLGPVPAQAFNIDTDVLFINNNQFNRTIPANFGNTPALYLTVANNKLTGPI  257

Query  990   PKTIGNA-SFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLE  814
             P++IG A + L E LFL N+L+GCLP+EIG L+ +TV D   N LTGPIPQSFGCL KL+
Sbjct  258   PRSIGRAWNTLTEALFLGNRLTGCLPFEIGYLQKATVLDFGTNLLTGPIPQSFGCLAKLQ  317

Query  813   ILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLP  634
             ILNL +N  YG +PE LC+L +    +L+ NYFTQ+GP+CR L+  + L+++ NCI  L 
Sbjct  318   ILNLAHNMFYGPIPEVLCRLPNAFNFTLTYNYFTQVGPQCRRLIRARRLNVNRNCIFGLT  377

Query  633   NQRSAQVCKDFFLHYQKCPDHKSLLYVPCDIDESPRK  523
              QR A  C  FF   + C    S   +PC +  S  K
Sbjct  378   GQRPAAECARFFARPRTCARESSFSLIPCSLPASSMK  414



>ref|XP_004505256.1| PREDICTED: uncharacterized protein At4g06744-like [Cicer arietinum]
Length=470

 Score =   261 bits (668),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 143/276 (52%), Positives = 189/276 (68%), Gaps = 4/276 (1%)
 Frame = -1

Query  1335  VESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEATNLTYLDL  1156
             ++S  +L   HVNSNNF+G+    +  +   +ELDLSNN L G FP  V+++  L +LDL
Sbjct  169   LDSIQELTFFHVNSNNFSGSIPKQITNYLYFYELDLSNNNLIGEFPNEVIQSKQLVFLDL  228

Query  1155  RFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTLANNQFSGPIPKTIG  976
             RFN L G +  Q+F  DLD +F+NNN F+  LP+N GSTP  +LT A+NQF+G IPK+IG
Sbjct  229   RFNHLYGSIPSQLFEKDLDVIFINNNQFTQCLPENFGSTPARYLTFAHNQFTGQIPKSIG  288

Query  975   NA-SFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLT  799
             NA   L EVLFL NK  GCLP+EIG LK +TVFD S N LTGPIP SFGCLEK++ LNL 
Sbjct  289   NAFKTLTEVLFLGNKFEGCLPFEIGYLKKATVFDVSQNLLTGPIPASFGCLEKIQFLNLA  348

Query  798   NNQLYGSVPESLCKLKDLE---ELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQ  628
             +N+ YG+VPES+C L  +     LSLS NYFT IGP C +L++ ++LD+  NCI  +PNQ
Sbjct  349   SNKFYGTVPESVCVLPGIRNNGNLSLSDNYFTSIGPACWSLIKYRILDVSKNCIPGIPNQ  408

Query  627   RSAQVCKDFFLHYQKCPDHKSLLYVPCDIDESPRKA  520
             RS + C +F    + C +H+SL YVPC      +++
Sbjct  409   RSPRECYEFQCKKKACSNHESLSYVPCKTHWGNKQS  444



>ref|XP_004140710.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis sativus]
 gb|KGN57507.1| hypothetical protein Csa_3G200180 [Cucumis sativus]
Length=450

 Score =   260 bits (665),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 155/339 (46%), Positives = 216/339 (64%), Gaps = 6/339 (2%)
 Frame = -1

Query  1557  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  1378
             +RK+   IR  K  I     ++ ++W+GN++C    +Y GF C       ++ +  + FN
Sbjct  83    LRKAFFVIRRLKSKIKSGRLDVVRTWQGNDVC----QYVGFRCDPLLVEKERSISAVMFN  138

Query  1377  gynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFP  1198
             G+ F G  L L  F++  +D+ V H NSN F G     + +    +E+DLSNNKL G FP
Sbjct  139   GFRFGGPELFLEGFMDELDDIAVFHANSNFFRGPIPKKIDRQRFFYEMDLSNNKLPGGFP  198

Query  1197  TAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfF-SGPLPDNLGSTPVFFLT  1021
             T VL A+ LT+LDLR+N   GP+  Q+F +D+ +    NN   S  LPDNLG TP  +LT
Sbjct  199   TNVLGASELTFLDLRYNNYCGPIPEQIFDMDIISAIYINNNQFSSNLPDNLGKTPAKYLT  258

Query  1020  LANNQFSGPIPKTIGNASFLLE-VLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIP  844
              A+NQFSG IPK+IG+A   +E ++F +N+L GCLP+EIG L+N+ +FDA  N+LTGPIP
Sbjct  259   FAHNQFSGSIPKSIGDAKKTMEEIVFFDNQLEGCLPFEIGSLENAVLFDAGKNRLTGPIP  318

Query  843   QSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLD  664
              SF CL K E+L L +NQLYG VPE +CKL +L   +L  N+FTQ+G EC+ L++KK+LD
Sbjct  319   LSFACLAKAELLYLADNQLYGPVPEEICKLPNLGNFTLRNNFFTQVGAECKKLIKKKILD  378

Query  663   IDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
             + NNCI  LP QRS + C  F    + C + KS  Y+PC
Sbjct  379   VSNNCIPGLPKQRSKEECLQFAYRPKYCGNDKSFTYIPC  417



>ref|XP_010438766.1| PREDICTED: uncharacterized protein At4g06744 [Camelina sativa]
Length=407

 Score =   259 bits (661),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 155/348 (45%), Positives = 216/348 (62%), Gaps = 12/348 (3%)
 Frame = -1

Query  1569  LDPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  1390
             LD  +      I+ FK  IT DP  +TQ+W G+++C     Y+GF C  P   +K  V  
Sbjct  44    LDQRLAVVYPVIQRFKSLITLDPYKVTQTWTGSDIC----SYRGFHCDNPPD-NKTAVTV  98

Query  1389  iyfngynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  1210
                +   F  +  S+  F++ F DL + HVNSNNF G     +     L+ELD+SNN+  
Sbjct  99    ASIDFNGFQLSAPSIEGFIDQFPDLALFHVNSNNFGGTVPSKIVNLKYLYELDISNNRFT  158

Query  1209  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPD--NLGSTP  1036
             G FPTAV+  + LT+LD+RFN  +G V PQ+   +LD LF+N+N F+  LP+  + G+  
Sbjct  159   GQFPTAVVGMSGLTFLDIRFNSFSGSVPPQILGQNLDVLFINDNGFTASLPEVPSDGTAH  218

Query  1035  VFFLTLANNQFSGPIPKTI-GNASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQL  859
             + +LTLANN+F+GP+P++I  + S L EVLFLNN  +GC+PYEIG L  ++V D   N+L
Sbjct  219   ILYLTLANNKFNGPLPRSILRSMSTLTEVLFLNNDFTGCIPYEIGFLTGASVIDIGGNKL  278

Query  858   TGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCK-LKD-LEELSLSGNYFTQIGPECRNL  685
             TGP+P S  CLEK+E LN   N L+G++PE++C  L+D L  LSLS NYFT +GP CR L
Sbjct  279   TGPLPLSLMCLEKVEQLNFAGNLLFGAIPEAVCMVLRDNLVNLSLSDNYFTHVGPWCRGL  338

Query  684   LEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQK--CPDHKSLLYVPC  547
             L++ VLD+ NNCI   P QRS Q C +FF+  +K  CP      +  C
Sbjct  339   LDRGVLDVSNNCIPFFPGQRSMQECAEFFVKPKKYYCPHMWYHSFFSC  386



>ref|XP_003580786.1| PREDICTED: uncharacterized protein At4g06744 [Brachypodium distachyon]
Length=443

 Score =   260 bits (664),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 162/342 (47%), Positives = 212/342 (62%), Gaps = 15/342 (4%)
 Frame = -1

Query  1536  IRTFKKSITYDPQNITQSWEGNELCI---NKKKYQGFFCYVPRGGDKKRVggiyfngynf  1366
             I+TFK++IT DP  +T +W G ++C    N   Y+GFFC  P             +   F
Sbjct  78    IQTFKRTITSDPLGVTSTWVGTKICDSADNGTAYKGFFCDHPPDSPPGTRTVASIDFNGF  137

Query  1365  ngnglslnSFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAGAFPTAV  1189
             +    +L  F+++F DL + H NSN+F+G   +P +   P  +ELDLSNN  +G+FP  V
Sbjct  138   HLRAPTLAGFIDAFPDLALFHANSNSFSG--NVPDLTGLPYFYELDLSNNAFSGSFPDTV  195

Query  1188  LEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDN-LGSTPVFFLTLAN  1012
             +   NL +LDLRFN  +G V   VF L ++ALFLNNN FSG +PD+  GST   +L +AN
Sbjct  196   VPLGNLLFLDLRFNGFSGSVPAPVFALSVEALFLNNNGFSGDIPDSAFGSTTAEYLVVAN  255

Query  1011  NQFSGPIPKTIGNASFLL-EVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSF  835
             NQF+GPIP++I N S  L EVLFLNN+ SGCLPYEIGL++  TVFDA  N++ GPIP SF
Sbjct  256   NQFTGPIPRSIFNVSGTLSEVLFLNNRFSGCLPYEIGLVEGLTVFDAGGNEIKGPIPLSF  315

Query  834   GCLEKLEILNLTNNQLYGSVPESLCKLK---DLEELSLSGNYFTQIGPECRNLLEKKVLD  664
             GCL  +E LNL  NQLYG VP+ LC L     L  LSLS NYF  +G  C  L+  +VLD
Sbjct  316   GCLSDVEQLNLAGNQLYGHVPDVLCALAKTGKLGNLSLSDNYFHSVGRLCMELVRSRVLD  375

Query  663   IDNNCILDLPNQRSAQVCKDFFLHYQK-CPDHKSLLYVPCDI  541
             +  NCIL  P QR A  C  F+    K CP    + ++PCD+
Sbjct  376   VKKNCILGFPRQRPAMECAAFYADPSKHCP---FIPHIPCDL  414



>gb|AEV41023.1| uncharacterized protein At4g06744 precursor [Oryza minuta]
Length=472

 Score =   261 bits (666),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 165/345 (48%), Positives = 207/345 (60%), Gaps = 18/345 (5%)
 Frame = -1

Query  1536  IRTFKKSITYDPQNITQSWEGNELC---INKKKYQGFFCYVP----RGGDKKRVggiyfn  1378
             I+ FK +IT DP+ +T SW G  LC        Y+GF+C  P       D   +     +
Sbjct  104   IQAFKTTITSDPRGVTASWVGPNLCDSYFGGNMYKGFYCDHPPVKDAPQDDTTLTIASID  163

Query  1377  gynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAGAF  1201
                +     SL  F+++F DL + H NSNNF+G   +P +   P  +ELDLSNN  +G F
Sbjct  164   FNGYGLGAPSLAGFIDAFPDLALFHANSNNFSGD--VPDLTGLPYFYELDLSNNNFSGVF  221

Query  1200  PTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLT  1021
             P  V+    L +LDLRFN   G V P VF L + ALFLNNN F G +PDN GST   +L 
Sbjct  222   PANVVPLGGLLFLDLRFNRFVGTVPPPVFDLSVVALFLNNNGFYGQIPDNFGSTTAEYLV  281

Query  1020  LANNQFSGPIPKTIGNASF-LLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIP  844
             +ANNQF+GPIP++I N S  L EVLFLNN LSGCLPYEIGL++  TVFDA  N +TGPIP
Sbjct  282   VANNQFTGPIPRSIYNTSANLSEVLFLNNHLSGCLPYEIGLVEGLTVFDAGGNDITGPIP  341

Query  843   QSFGCLEKLEILNLTNNQLYGSVPESLC---KLKDLEELSLSGNYFTQIGPECRNLLEKK  673
              S GCL  +E LNL  NQLYG +P+ LC   K   L+ LSLS NYF  +G  C  L+  K
Sbjct  342   LSLGCLGLVEELNLAGNQLYGHIPDVLCMLAKTGKLQNLSLSDNYFHSVGHHCLELVRSK  401

Query  672   VLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL-YVPCDI  541
             VLD+  NCIL+ PNQR A  C  F   Y   P H   + ++PCD+
Sbjct  402   VLDVRLNCILNFPNQRPALECARF---YADPPQHCPFVPHIPCDL  443



>dbj|BAJ86489.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=452

 Score =   260 bits (664),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 165/349 (47%), Positives = 217/349 (62%), Gaps = 20/349 (6%)
 Frame = -1

Query  1557  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  1378
             + ++   I+ FKK+IT DPQ +T++W G ++C +K  Y GFFC  P   + K       +
Sbjct  86    LYRAYLVIQRFKKTITCDPQGVTKTWTGTDIC-SKTCYLGFFCEAPP--NIKERALASVD  142

Query  1377  gynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA-GAF  1201
                F     ++  FV++  DL + H NSN+F G   I ++     +ELD+SNNKLA  AF
Sbjct  143   FNGFKLEAPTVEGFVDALPDLALYHANSNDFGGVVPI-LRSLQYFYELDVSNNKLAPCAF  201

Query  1200  PTAVLEATNLTYLDLRFNMLTGPVHPQVftl--dldalflnnnfFSGPLPDNLGSTPVFF  1027
             PT VL  TN T++D+RFN   G V   +F     ++A+F+NNN FSG +P NLG +PV +
Sbjct  202   PTDVLGITNATFVDIRFNRFFGEVPAGLFCSFPIVEAIFVNNNQFSGKIPSNLGDSPVNY  261

Query  1026  LTLANNQFSGPIPKTIGNAS-FLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGP  850
             L LANNQF+GPIP +IG A+  LLEVLFLNNKL GCLPYE+GLL  +TV DA  NQLTG 
Sbjct  262   LALANNQFTGPIPSSIGRAANTLLEVLFLNNKLCGCLPYELGLLAKATVIDAGTNQLTGT  321

Query  849   IPQSFGCLEKLEILNLTNNQLYGSVPESLCKLK------DLEELSLSGNYFTQIGPECRN  688
             IP S+ CL K+E LNL  N LYG VP++LC+L        L  L+LS NYFT +G  C  
Sbjct  322   IPASYACLRKVEQLNLAGNLLYGEVPDALCRLAYPSSGGHLANLTLSDNYFTSLGSCCWA  381

Query  687   LLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQK--CPDHKSLLYVPC  547
             L+++  L++  NCI   PNQRS + C  FF H  K  CP      YVPC
Sbjct  382   LIKQGKLNVARNCIPYAPNQRSHEECAGFF-HRTKTTCPVST---YVPC  426



>ref|XP_010421726.1| PREDICTED: uncharacterized protein At4g06744 [Camelina sativa]
Length=407

 Score =   258 bits (660),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 155/348 (45%), Positives = 215/348 (62%), Gaps = 12/348 (3%)
 Frame = -1

Query  1569  LDPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  1390
             LD  +      I+ FK  IT DP  +TQ+W G+++C     Y+GF C  P   +K  V  
Sbjct  44    LDQRLAVVYPVIQRFKSLITLDPYKVTQTWTGSDIC----SYRGFHCDNPPD-NKTAVTV  98

Query  1389  iyfngynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  1210
                +   F  +  S+  F++ F DL + HVNSNNF G     +     L+ELD+SNN+  
Sbjct  99    ASIDFNGFQLSAPSIEGFIDQFPDLALFHVNSNNFGGTVPSKIVNLKYLYELDISNNRFT  158

Query  1209  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPD--NLGSTP  1036
             G FPTAV+  + L +LD+RFN  +G V PQ+   +LD LF+N+N F+  LP+    G+T 
Sbjct  159   GQFPTAVVGMSGLKFLDIRFNSFSGSVPPQILGQNLDVLFINDNGFTASLPEVPGDGTTH  218

Query  1035  VFFLTLANNQFSGPIPKTI-GNASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQL  859
             + +LTLANN+F+GP+P++I  + S L EVLFLNN  +GC+PYEIG L  ++V D   N+L
Sbjct  219   ILYLTLANNKFNGPLPRSILRSMSTLTEVLFLNNDFTGCIPYEIGFLMGASVIDIGGNKL  278

Query  858   TGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCK-LKD-LEELSLSGNYFTQIGPECRNL  685
             TGP+P S  CLEK+E LN   N L+G++PE++C  L+D L  LSLS NYFT +GP CR L
Sbjct  279   TGPLPLSLMCLEKVEQLNFAGNLLFGAIPEAVCMVLRDNLVNLSLSDNYFTHVGPWCRGL  338

Query  684   LEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQK--CPDHKSLLYVPC  547
             L++ VLD+ NNCI   P QRS Q C +FF+  +K  CP      +  C
Sbjct  339   LDRGVLDVSNNCIPFFPGQRSMQECAEFFVKPKKYYCPHMWYHSFFSC  386



>gb|EMS59107.1| hypothetical protein TRIUR3_04108 [Triticum urartu]
Length=442

 Score =   259 bits (663),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 162/353 (46%), Positives = 217/353 (61%), Gaps = 18/353 (5%)
 Frame = -1

Query  1560  VIRKSIKAIR---TFKKSITYDPQNITQSWEGNELCINKK---KYQGFFCYVPRGGDKKR  1399
             V+R  + A R    FK++IT DP N+T +W G  +C + K    Y+GF+C  P     K 
Sbjct  57    VVRDHVPASRVSVAFKRTITSDPLNVTATWVGANICDSAKGGGAYKGFYCDTPPDDANKT  116

Query  1398  VggiyfngynfngnglslnSFVESFNDLVVIHVNSNNFTGA-PGIPVQKFPTLFELDLSN  1222
             +     +   F+    +L  F+++F DL + H NSNNF+G  P +   ++   +ELDLSN
Sbjct  117   LTVASIDFNGFHLCAPTLAGFIDAFPDLALFHANSNNFSGVLPELTSLRY--FYELDLSN  174

Query  1221  NKLAGAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDN-LG  1045
             N  +GAFP AV     L +LDLRFN   G V P VF + +DALFLNNN F+G +P++  G
Sbjct  175   NAFSGAFPAAVPPLGRLAFLDLRFNGFAGEVPPSVFGISVDALFLNNNAFTGVIPESTFG  234

Query  1044  STPVFFLTLANNQFSGPIPKTIGNASFLL-EVLFLNNKLSGCLPYEIGLLKNSTVFDASI  868
             ++   ++ +ANN+F+GPIP++I NAS  L E+LFLNN LSGCLPYEIGL++  TVFDA  
Sbjct  235   TSRAEYIVVANNRFTGPIPRSIFNASGTLSEILFLNNDLSGCLPYEIGLVEGLTVFDAGG  294

Query  867   NQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLC---KLKDLEELSLSGNYFTQIGPE  697
             NQ+ GPIP SFGCL  +E LNL  NQLYG VP+ LC   K   L  LSLS NYF  +G  
Sbjct  295   NQIRGPIPLSFGCLADVEELNLARNQLYGHVPDVLCLLAKTGKLTNLSLSDNYFHSVGYH  354

Query  696   CRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQK-CPDHKSLLYVPCDI  541
             C  L+  +VLD+  NCIL  P QR    C  F+    K CP    + ++PCD+
Sbjct  355   CMELVRSRVLDVRRNCILGFPGQRPHIECVMFYADPTKHCP---FIPHIPCDL  404



>ref|XP_004168435.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis sativus]
Length=453

 Score =   260 bits (664),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 155/339 (46%), Positives = 216/339 (64%), Gaps = 6/339 (2%)
 Frame = -1

Query  1557  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  1378
             +RK+   IR  K  I     ++ ++W+GN++C    +Y GF C       ++ +  + FN
Sbjct  83    LRKAFFVIRRLKSKIKSGRLDVVRTWQGNDVC----QYVGFRCDPLLVEKERSISAVMFN  138

Query  1377  gynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFP  1198
             G+ F G  L L  F++  +D+ V H NSN F G     + +    +E+DLSNNKL G FP
Sbjct  139   GFRFGGPELFLEGFMDELDDIAVFHANSNFFRGPIPKKIDRQRFFYEMDLSNNKLPGGFP  198

Query  1197  TAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfF-SGPLPDNLGSTPVFFLT  1021
             T VL A+ LT+LDLR+N   GP+  Q+F +D+ +    NN   S  LPDNLG TP  +LT
Sbjct  199   TNVLGASELTFLDLRYNNYCGPIPEQIFDMDIISAIYINNNQFSSNLPDNLGKTPAKYLT  258

Query  1020  LANNQFSGPIPKTIGNASFLLE-VLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIP  844
              A+NQFSG IPK+IG+A   +E ++F +N+L GCLP+EIG L+N+ +FDA  N+LTGPIP
Sbjct  259   FAHNQFSGSIPKSIGDAKKTMEEIVFFDNQLEGCLPFEIGSLENAVLFDAGKNRLTGPIP  318

Query  843   QSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLD  664
              SF CL K E+L L +NQLYG VPE +CKL +L   +L  N+FTQ+G EC+ L++KK+LD
Sbjct  319   LSFACLAKAELLYLADNQLYGPVPEEICKLPNLGNFTLRNNFFTQVGAECKKLIKKKILD  378

Query  663   IDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
             + NNCI  LP QRS + C  F    + C + KS  Y+PC
Sbjct  379   VSNNCIPGLPKQRSKEECLQFAYRPKYCGNDKSFTYIPC  417



>ref|XP_010664550.1| PREDICTED: uncharacterized protein At4g06744 isoform X2 [Vitis 
vinifera]
Length=425

 Score =   259 bits (661),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 151/330 (46%), Positives = 200/330 (61%), Gaps = 10/330 (3%)
 Frame = -1

Query  1524  KKSITYDPQNITQSWEGNELCINKKKYQGFFC-YVPRGGDKKRVggiyfngynfngngls  1348
             K++IT DPQN T SW G   C+    ++GF+C  VP   DK   G    +       G  
Sbjct  70    KRNITSDPQNYTGSWVGRNYCL----FKGFYCDTVP---DKNITGLAGIDFNGARFGGNL  122

Query  1347  l-nSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEATNL  1171
                 F+    D+ + H NSNNF+G     + K    +E+DLSNN   G FP +V+ A  L
Sbjct  123   NFYRFIRFLPDIAIFHANSNNFSGVIRPNINKLRYFYEIDLSNNGFQGGFPVSVIGALQL  182

Query  1170  TYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTLANNQFSGPI  991
             T++D+RFN   GPV P+VF++  D LF+NNN F+  +P   G+T   ++TLANN F G I
Sbjct  183   TFVDVRFNTYNGPVPPRVFSIQTDVLFINNNNFAQRIPSAFGNTTARYITLANNGFIGSI  242

Query  990   PKTIGNA-SFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLE  814
             P++IG     L EVLFL N+LSGCLPYEIG L+ +TVFDA  N LTGPIPQSF CL+KL+
Sbjct  243   PQSIGRTWQTLTEVLFLKNRLSGCLPYEIGFLQMATVFDAGFNTLTGPIPQSFACLKKLQ  302

Query  813   ILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLP  634
             +L+L +NQ YG +P+SLC+L +    +LS NYF  IGP C+ L+    LD+  NCI  LP
Sbjct  303   LLSLAHNQFYGRIPDSLCRLPNAYNFTLSYNYFNSIGPYCKRLVNIGRLDVRRNCITGLP  362

Query  633   NQRSAQVCKDFFLHYQKCPDHKSLLYVPCD  544
             NQRSA  C  F+   + CP   S   + C 
Sbjct  363   NQRSAAECTAFYSVSRTCPRPGSFNVITCS  392



>gb|EMS61305.1| hypothetical protein TRIUR3_11917 [Triticum urartu]
Length=414

 Score =   258 bits (659),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 165/349 (47%), Positives = 215/349 (62%), Gaps = 20/349 (6%)
 Frame = -1

Query  1557  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  1378
             + ++   I+ FK++IT DPQ IT +W G  +C N   Y GFFC  P   + K       +
Sbjct  45    LYRAYLVIQRFKQTITCDPQGITNTWTGTAICSNTS-YLGFFCEAPP--NVKERALASVD  101

Query  1377  gynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG-AF  1201
                F     ++  FV++  DL + H NSN+F G   I ++     +ELD+SNNKLA  AF
Sbjct  102   FNGFKLEAPTVEGFVDALPDLALFHANSNDFGGVVPI-LRSLQYFYELDVSNNKLARCAF  160

Query  1200  PTAVLEATNLTYLDLRFNMLTGPVHPQVftl--dldalflnnnfFSGPLPDNLGSTPVFF  1027
             P  VL  TN T++D+RFN   G V   +F     ++A+F+NNN FSG +P NLG +PV +
Sbjct  161   PADVLGITNATFVDIRFNQFYGEVPAGLFRSFPIVEAIFVNNNQFSGNIPSNLGDSPVNY  220

Query  1026  LTLANNQFSGPIPKTIGNA-SFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGP  850
             L LANNQF+GPIP +IG A + LLEVLFLNNKLSGCLPYE+GLL  +TV DA  NQLTG 
Sbjct  221   LALANNQFTGPIPSSIGRAGNTLLEVLFLNNKLSGCLPYELGLLAKATVIDAGTNQLTGT  280

Query  849   IPQSFGCLEKLEILNLTNNQLYGSVPESLCKLK------DLEELSLSGNYFTQIGPECRN  688
             IP S+ CL K+E LNL +N LYG VP++LC+L        L  L+LS NYFT +G  C  
Sbjct  281   IPASYACLRKVEQLNLADNLLYGEVPDALCRLAYKSSGGHLANLTLSDNYFTSLGACCWA  340

Query  687   LLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQK--CPDHKSLLYVPC  547
             L+++  L++  NCI   PNQRS + C  FF H  K  CP      YVPC
Sbjct  341   LIKQGKLNVARNCIPYAPNQRSHEECAGFF-HGTKTYCPVST---YVPC  385



>gb|KHN43047.1| Hypothetical protein glysoja_007577 [Glycine soja]
Length=456

 Score =   259 bits (662),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 157/354 (44%), Positives = 216/354 (61%), Gaps = 23/354 (6%)
 Frame = -1

Query  1557  IRKSIKAIRTFKKSITYDPQNITQSW-EGNELCINKKKYQGFFCYVPRGGDKKRVggiyf  1381
             + K+ + +  FK +I  DP   TQ+W +  + C    K+ G  C      D++R      
Sbjct  79    LEKAKRVLLKFKTTID-DPNCYTQNWSQDTDAC----KFNGVRC-ANFPDDQQRAVAGLD  132

Query  1380  ngynfngngls----lnSFVESFNDLVVIHVNSNNFTGAPGIP--VQKFPTLFELDLSNN  1219
                            L   ++S  +L   HVNSNNF+   G P  + +F   FELDLSNN
Sbjct  133   LNGAKLATKNGGNLPLTGLLDSIPELTFFHVNSNNFSFVGGFPNNITRFRFFFELDLSNN  192

Query  1218  KLAGAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGST  1039
             K++G FPT  ++   L +LDLRFN LTGP+ P++F  DLD +F+NNN F+G LP+N GST
Sbjct  193   KVSGKFPTQAIQNNQLVFLDLRFNQLTGPIDPKLFERDLDVIFVNNNKFTGYLPENFGST  252

Query  1038  PVFFLTLANNQFSGPIPKTIGNAS-------FLLEVLFLNNKLSGCLPYEIGLLKNSTVF  880
             P  +LT ANN+ SG +PK++G A        +L EVLFL N+  GCLP+EIG LK + VF
Sbjct  253   PARYLTFANNRLSGSLPKSLGYAPSLTEVLFYLTEVLFLKNQFEGCLPFEIGYLKKAVVF  312

Query  879   DASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLE---ELSLSGNYFTQ  709
             D S N LTGPIP SFGCL+K++ LNL +N+LYG VP++LC++  +     LSL+ NYF +
Sbjct  313   DISENLLTGPIPLSFGCLKKIQFLNLAHNKLYGCVPDNLCQIPSIRNNGNLSLANNYFNE  372

Query  708   IGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
             IGP C +L++ KVLD+  NCI  LPNQ+S + C  F+   + CP+  S  YVPC
Sbjct  373   IGPSCWSLIKSKVLDVSGNCIPGLPNQKSPKECYQFYKTKKTCPNPNSFYYVPC  426



>ref|XP_002284965.1| PREDICTED: uncharacterized protein At4g06744 isoform X1 [Vitis 
vinifera]
 emb|CAN61024.1| hypothetical protein VITISV_001144 [Vitis vinifera]
 emb|CBI19481.3| unnamed protein product [Vitis vinifera]
Length=437

 Score =   258 bits (659),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 151/330 (46%), Positives = 200/330 (61%), Gaps = 10/330 (3%)
 Frame = -1

Query  1524  KKSITYDPQNITQSWEGNELCINKKKYQGFFC-YVPRGGDKKRVggiyfngynfngngls  1348
             K++IT DPQN T SW G   C+    ++GF+C  VP   DK   G    +       G  
Sbjct  82    KRNITSDPQNYTGSWVGRNYCL----FKGFYCDTVP---DKNITGLAGIDFNGARFGGNL  134

Query  1347  l-nSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEATNL  1171
                 F+    D+ + H NSNNF+G     + K    +E+DLSNN   G FP +V+ A  L
Sbjct  135   NFYRFIRFLPDIAIFHANSNNFSGVIRPNINKLRYFYEIDLSNNGFQGGFPVSVIGALQL  194

Query  1170  TYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTLANNQFSGPI  991
             T++D+RFN   GPV P+VF++  D LF+NNN F+  +P   G+T   ++TLANN F G I
Sbjct  195   TFVDVRFNTYNGPVPPRVFSIQTDVLFINNNNFAQRIPSAFGNTTARYITLANNGFIGSI  254

Query  990   PKTIGNA-SFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLE  814
             P++IG     L EVLFL N+LSGCLPYEIG L+ +TVFDA  N LTGPIPQSF CL+KL+
Sbjct  255   PQSIGRTWQTLTEVLFLKNRLSGCLPYEIGFLQMATVFDAGFNTLTGPIPQSFACLKKLQ  314

Query  813   ILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLP  634
             +L+L +NQ YG +P+SLC+L +    +LS NYF  IGP C+ L+    LD+  NCI  LP
Sbjct  315   LLSLAHNQFYGRIPDSLCRLPNAYNFTLSYNYFNSIGPYCKRLVNIGRLDVRRNCITGLP  374

Query  633   NQRSAQVCKDFFLHYQKCPDHKSLLYVPCD  544
             NQRSA  C  F+   + CP   S   + C 
Sbjct  375   NQRSAAECTAFYSVSRTCPRPGSFNVITCS  404



>ref|XP_007157715.1| hypothetical protein PHAVU_002G092200g [Phaseolus vulgaris]
 gb|ESW29709.1| hypothetical protein PHAVU_002G092200g [Phaseolus vulgaris]
Length=449

 Score =   258 bits (658),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 157/344 (46%), Positives = 204/344 (59%), Gaps = 13/344 (4%)
 Frame = -1

Query  1521  KSITYDPQNITQSW-EGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngng---  1354
             K++  DP   TQ+W E  + C     ++G  C      +++ V G+  NG    G     
Sbjct  92    KTLILDPTCYTQNWNENTDTC----DFRGVRCASYPNSEERAVAGLDLNGARVTGQNGCP  147

Query  1353  --lslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEA  1180
               +S    V    +L   HVNSN+F G+    + KFP  FELDLSNNK+ G FP   + +
Sbjct  148   LPVSSLLGVNQIPELTFFHVNSNSFAGSVPTDITKFPFFFELDLSNNKIKGQFPIDAITS  207

Query  1179  TNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTLANNQFS  1000
               L +LDLRFN LTGP+ PQ+F  DLD +F+NNN F+  LP N G TP  +LT ANN  +
Sbjct  208   KVLVFLDLRFNQLTGPIPPQLFLKDLDVIFINNNQFTQCLPQNFGYTPARYLTFANNNLT  267

Query  999   GPIPKTIGNASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEK  820
             GPIPK++G A  L EVLFL NK  GCLP EIG LK + VFD S N LTGPIP SFGCL+ 
Sbjct  268   GPIPKSVGYAPNLTEVLFLGNKFDGCLPVEIGNLKRAVVFDVSKNLLTGPIPHSFGCLKS  327

Query  819   LEILNLTNNQLYGSVPESLCKLKDLE---ELSLSGNYFTQIGPECRNLLEKKVLDIDNNC  649
             ++ LNL  N+ YG VP+++C++  L     LSL+ NYF  +GP C +L++ KVLD+  NC
Sbjct  328   IQYLNLAQNKFYGCVPDNVCQISSLRNNGNLSLADNYFNDVGPSCWSLIKSKVLDVSKNC  387

Query  648   ILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPCDIDESPRKAG  517
             I  LPNQRS   C  F+     CP+  S  YVPC  + S    G
Sbjct  388   IRGLPNQRSPYECSQFYKRKTTCPNPSSFYYVPCRGNPSSETTG  431



>gb|KFK39606.1| hypothetical protein AALP_AA3G265800 [Arabis alpina]
Length=403

 Score =   256 bits (653),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 153/347 (44%), Positives = 213/347 (61%), Gaps = 11/347 (3%)
 Frame = -1

Query  1569  LDPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  1390
             LD  +      I+ F+  IT DP  IT +W G+++C     Y+GF+C  P   +K  +  
Sbjct  41    LDQRLAVVYPIIQRFRLLITLDPFKITHTWTGSDIC----SYRGFYCDNPPD-NKTALTV  95

Query  1389  iyfngynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  1210
                +   +  +  S+  FV+   DL + HVNSNNF G     +     L+ELD+SNN+  
Sbjct  96    ASIDFNGYQLSAPSIEGFVDQLPDLGLFHVNSNNFGGTVPSKIVNLKYLYELDISNNRFT  155

Query  1209  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPD---NLGST  1039
             G FPTAVL+   LTYLD+RFN  +G + PQ+F+ +LD LF+N+N F+  LPD   + G  
Sbjct  156   GQFPTAVLDMPGLTYLDIRFNSFSGSIPPQIFSKNLDVLFVNDNGFTASLPDIPEDDGRA  215

Query  1038  PVFFLTLANNQFSGPIPKTI-GNASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQ  862
              + FLTLANN+F+GP+P++I  + S L EVLFLNN  +GC+PYEIG L+ ++V D   N+
Sbjct  216   HILFLTLANNRFNGPLPRSILKSMSSLTEVLFLNNDFTGCVPYEIGFLRGASVIDIGGNK  275

Query  861   LTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKL--KDLEELSLSGNYFTQIGPECRN  688
             LTG +P S  CLEK+E LN   N L+G +PES+C L   +L   SLS NYFT +GP CR+
Sbjct  276   LTGHLPLSLTCLEKVEQLNFAGNLLFGVIPESVCMLLRVNLVNFSLSDNYFTHMGPWCRS  335

Query  687   LLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
             L E  VLD+ NNC+  LP QRS + C +FF   + CP      ++PC
Sbjct  336   LFEIGVLDVRNNCLPFLPGQRSMKECAEFFFKPKYCPYRWFHSFIPC  382



>ref|NP_001141186.1| leucine-rich repeat (LRR) family protein precursor [Zea mays]
 gb|ACF85658.1| unknown [Zea mays]
 gb|AFW59826.1| leucine-rich repeat (LRR) family protein [Zea mays]
Length=431

 Score =   256 bits (655),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 164/353 (46%), Positives = 218/353 (62%), Gaps = 21/353 (6%)
 Frame = -1

Query  1557  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCIN-------KKKYQGFFCYVPRGGDKKR  1399
             +R     I+ FK++IT DP  +T +W G ELC +          Y+GF+C  P   D   
Sbjct  69    LRALYPVIQAFKQTITCDPLGVTATWTGTELCDSFFNNGSTTTYYRGFYCDYPP--DAPG  126

Query  1398  Vggiyfngynfngngl-slnSFVESFNDLVVIHVNSNNFTG-APGIPVQKFPTLFELDLS  1225
             V  +    +N  G    SL  F+++F DL + H NSNNF+G  P +   ++   +ELDLS
Sbjct  127   VLTVASIDFNGFGLCAPSLAGFIDAFPDLALFHANSNNFSGDVPDLTQLRY--FYELDLS  184

Query  1224  NNKLAGAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLG  1045
             NN  +GAFP AV+    L +LDLRFN   G V   VF L ++ALFLNNN F G +PD LG
Sbjct  185   NNNFSGAFPEAVVPLGGLLFLDLRFNRYAGEVPAPVFALTVEALFLNNNGFGGRIPDTLG  244

Query  1044  STPVFFLTLANNQFSGPIPKTIGNASFLL-EVLFLNNKLSGCLPYEIGLLKNSTVFDASI  868
             ST   +L +ANNQF+GPIP++I NAS  L EVLFLNN+LSGCLPYEIGL++   VFDA  
Sbjct  245   STGAQYLVVANNQFTGPIPRSIYNASATLSEVLFLNNRLSGCLPYEIGLVEGLAVFDAGG  304

Query  867   NQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLK---DLEELSLSGNYFTQIGPE  697
             N++TGP+P SFGCL  +E LNL  NQLYG VP+ +C L     L+ LSLS N+F  +G  
Sbjct  305   NEITGPVPLSFGCLRDVEELNLAGNQLYGQVPDVVCLLARTGKLQNLSLSDNFFHSVGHH  364

Query  696   CRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQK-CPDHKSLLYVPCDI  541
             C  L+  +VLD+  NCIL  P+QR    C  F++   K CP    + ++PC++
Sbjct  365   CMELVRSRVLDVRRNCILGFPDQRPPLECAAFYVDPSKHCP---FIPHIPCEL  414



>gb|ACG42798.1| leucine-rich repeat, plant specific [Zea mays]
Length=431

 Score =   256 bits (653),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 164/353 (46%), Positives = 218/353 (62%), Gaps = 21/353 (6%)
 Frame = -1

Query  1557  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCIN-------KKKYQGFFCYVPRGGDKKR  1399
             +R     I+ FK++IT DP  +T +W G ELC +          Y+GF+C  P   D   
Sbjct  69    LRALYPVIQAFKQTITCDPLGVTATWTGTELCDSFFNNGSTTTYYRGFYCDYPP--DAPG  126

Query  1398  Vggiyfngynfngngl-slnSFVESFNDLVVIHVNSNNFTG-APGIPVQKFPTLFELDLS  1225
             V  +    +N  G    SL  F+++F DL + H NSNNF+G  P +   ++   +ELDLS
Sbjct  127   VLTVASIDFNGFGLCAPSLAGFIDAFPDLALFHANSNNFSGDVPDLTQLRY--FYELDLS  184

Query  1224  NNKLAGAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLG  1045
             NN  +GAFP AV+    L +LDLRFN   G V   VF L ++ALFLNNN F G +PD LG
Sbjct  185   NNNFSGAFPEAVVPLGGLLFLDLRFNRYAGEVPAPVFALTVEALFLNNNGFGGRIPDTLG  244

Query  1044  STPVFFLTLANNQFSGPIPKTIGNASFLL-EVLFLNNKLSGCLPYEIGLLKNSTVFDASI  868
             ST   +L +ANNQF+GPIP++I NAS  L EVLFLNN+LSGCLPYEIGL++   VFDA  
Sbjct  245   STGAQYLVVANNQFTGPIPRSIYNASATLSEVLFLNNRLSGCLPYEIGLVEGLAVFDAGG  304

Query  867   NQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLK---DLEELSLSGNYFTQIGPE  697
             N++TGP+P SFGCL  +E LNL  NQLYG VP+ +C L     L+ LSLS N+F  +G  
Sbjct  305   NEITGPVPLSFGCLRDVEELNLAGNQLYGQVPDVVCLLARTGKLQNLSLSDNFFHSVGHH  364

Query  696   CRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQK-CPDHKSLLYVPCDI  541
             C  L+  +VLD+  NCIL  P+QR    C  F++   K CP    + ++PC++
Sbjct  365   CMELVRSRVLDVRRNCILGFPDQRPPLECAAFYVDPSKHCP---FIPHIPCEL  414



>ref|XP_006397360.1| hypothetical protein EUTSA_v10028721mg [Eutrema salsugineum]
 gb|ESQ38813.1| hypothetical protein EUTSA_v10028721mg [Eutrema salsugineum]
Length=391

 Score =   254 bits (649),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 153/345 (44%), Positives = 214/345 (62%), Gaps = 9/345 (3%)
 Frame = -1

Query  1569  LDPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  1390
             LD  +      I+ FK  IT DP  +TQ+W G+++C     Y+GF C  P   +K  V  
Sbjct  31    LDQRLAVVYPVIQRFKSLITLDPFKVTQTWFGSDIC----SYRGFHCDNPPD-NKTAVTV  85

Query  1389  iyfngynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  1210
                +  +F  +  S+  F++ F DL + HVNSNNF G     +     L+ELD+SNNK  
Sbjct  86    ASIDFNDFQLSAPSIEGFIDQFPDLALFHVNSNNFGGTVPSKIVNLKYLYELDISNNKFT  145

Query  1209  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVF  1030
             G FPTAV+    LT+LD+RFN  +G V PQ+F  +L+ LF+N+N F+  LP+  G + + 
Sbjct  146   GPFPTAVVGMPGLTFLDIRFNSFSGSVPPQIFGQNLEVLFINDNTFTASLPEIPGDSHIL  205

Query  1029  FLTLANNQFSGPIPKTI-GNASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTG  853
             FLTLA+N+F+GP+P +I  + S L EVLFLNN  +GC+PYEIG LK ++V D S N+LTG
Sbjct  206   FLTLADNKFNGPLPISILRSMSTLTEVLFLNNDFTGCIPYEIGFLKGASVIDISGNKLTG  265

Query  852   PIPQSFGCLEKLEILNLTNNQLYGSVPESLCKL--KDLEELSLSGNYFTQIGPECRNLLE  679
              +P S  CLEK+E LN   N L+G++PE++C L   ++  LSLS NYFT +GP C+ L E
Sbjct  266   LLPLSLMCLEKVEQLNFAGNLLFGAIPEAVCMLLWDNIVNLSLSDNYFTHVGPWCKGLFE  325

Query  678   KKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ-KCPDHKSLLYVPC  547
             + VLD+ NNCI   P QRS   C +FF+  +  CP      ++PC
Sbjct  326   RGVLDVTNNCIPFFPGQRSIDECAEFFVKPKYYCPHPWFHRFLPC  370



>ref|XP_004140807.1| PREDICTED: uncharacterized protein LOC101203557 [Cucumis sativus]
Length=1406

 Score =   269 bits (688),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 165/341 (48%), Positives = 213/341 (62%), Gaps = 6/341 (2%)
 Frame = -1

Query  1536  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  1357
             I+TFK  IT DP  +TQ+W G+++C    KYQGF+C  P   +K  V     +   F   
Sbjct  716   IQTFKALITSDPLGVTQTWVGSDIC----KYQGFYCDHP-PDNKSAVTIAAIDFNGFQLT  770

Query  1356  glslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  1177
               +L+ F++   DL + H NSNNF G     +   P L+ELDLSNN+L+G FP A+L  T
Sbjct  771   ASTLDGFIDGLPDLAIFHANSNNFFGTITPKIASLPYLYELDLSNNQLSGTFPVAILSVT  830

Query  1176  NLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTLANNQFSG  997
             +L++ D+RFN  TG V  Q+F    D LFLNNN F   LP N GST   ++TLANN+F+G
Sbjct  831   DLSFFDIRFNFFTGFVPQQLFVKSFDFLFLNNNNFGMKLPINFGSTTTPYITLANNKFTG  890

Query  996   PIPKTIGNASF-LLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEK  820
             PIP++IG AS  L E+L LNN+L+GC+PYE+G LK + VFDA  N LTGP+P S  CLEK
Sbjct  891   PIPRSIGKASANLTEILLLNNQLTGCIPYEVGFLKKAIVFDAGENLLTGPLPCSLSCLEK  950

Query  819   LEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILD  640
             +E LN   N LYG VPE +C L +L  LSLS NYFT+IGP CR L+   VLD+  NCI  
Sbjct  951   IEQLNFAGNFLYGQVPEVVCDLGNLLNLSLSDNYFTKIGPSCRKLVRNGVLDLRKNCIRG  1010

Query  639   LPNQRSAQVCKDFFLHYQKCPDHKSLLYVPCDIDESPRKAG  517
             LP+QRS   C   +L    CP   +  +VPC   +S    G
Sbjct  1011  LPDQRSPLDCFFSYLFQYPCPFPATYGFVPCQKSKSIHSFG  1051



>ref|XP_002874478.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50737.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=409

 Score =   254 bits (649),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 148/340 (44%), Positives = 210/340 (62%), Gaps = 14/340 (4%)
 Frame = -1

Query  1539  AIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfng  1360
              I+ FK  IT DP N+T++W G+++C     Y+GF C  P   +   V     +   F  
Sbjct  54    VIQRFKSLITLDPYNVTKTWIGSDIC----SYRGFHCDNPPD-NTTAVTVASIDFNGFQL  108

Query  1359  nglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEA  1180
             +  S+  F++ F DL + HVNSNNF G     +     L+ELD+SNN+  G FPTAV+  
Sbjct  109   SAPSIEGFIDQFPDLALFHVNSNNFGGTVPSKIVNLRYLYELDISNNRFTGQFPTAVVGM  168

Query  1179  TNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLP----DNLGSTPVFFLTLAN  1012
             + LT+LD+RFN  +G + PQ+   +L+ LF+N+N F+  LP    D   +T + FLT AN
Sbjct  169   SGLTFLDIRFNSFSGSIPPQILGQNLEVLFINDNGFTASLPEIPGDGTSTTHILFLTFAN  228

Query  1011  NQFSGPIPKTI-GNASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSF  835
             N+F+GP+P++I  + S L EVLFLNN  +GC+P+EIG L  ++V D   N+LTGP+P S 
Sbjct  229   NKFNGPLPRSILRSMSTLTEVLFLNNDFTGCIPHEIGFLTGASVIDIGGNKLTGPLPLSL  288

Query  834   GCLEKLEILNLTNNQLYGSVPESLCKL--KDLEELSLSGNYFTQIGPECRNLLEKKVLDI  661
              CLEK+E +N   N L+G++PE++C L   +L  LSLS NYFT +GP CR LL++ VLD+
Sbjct  289   MCLEKVEQVNFAGNLLFGAIPEAVCMLLRDNLVNLSLSNNYFTHVGPWCRGLLDRGVLDV  348

Query  660   DNNCILDLPNQRSAQVCKDFFLHYQK--CPDHKSLLYVPC  547
              NNCI   P QRS Q C +FF+  +K  CP      +  C
Sbjct  349   SNNCIPFFPGQRSMQECAEFFVKPKKYYCPHMWFHSFFSC  388



>ref|XP_009141268.1| PREDICTED: uncharacterized protein At4g06744 isoform X1 [Brassica 
rapa]
Length=391

 Score =   253 bits (647),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 150/345 (43%), Positives = 213/345 (62%), Gaps = 9/345 (3%)
 Frame = -1

Query  1569  LDPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  1390
             +D  +      I+ FK  IT DP  +TQ+W G+E+C     Y+GF C  P   +K  V  
Sbjct  31    IDKRLEVVYPVIQGFKSLITLDPFKVTQTWIGSEIC----SYRGFHCDNPPD-NKTAVTV  85

Query  1389  iyfngynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  1210
                +   F     S+  F++   DL + H NSNNF G     +     L+ELD+SNNK  
Sbjct  86    ASIDFNGFQLFAPSIEGFIDQLPDLALFHANSNNFGGTVPSKIVNLKYLYELDISNNKFT  145

Query  1209  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVF  1030
             G FPTAV+    LT+LD+RFN  +G + PQ+F  +LD LF+N+N F+  LP+  G + + 
Sbjct  146   GQFPTAVVGMPGLTFLDIRFNSFSGSIPPQIFGQNLDVLFINDNTFTASLPEIPGDSHIL  205

Query  1029  FLTLANNQFSGPIPKTI-GNASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTG  853
             FLTLA+N+F+GP+P++I  + + L EVLFLNN  +GC+PYEIGLLK ++V D S N+LTG
Sbjct  206   FLTLADNKFNGPLPRSILRSMTTLTEVLFLNNDFTGCIPYEIGLLKGASVIDISGNKLTG  265

Query  852   PIPQSFGCLEKLEILNLTNNQLYGSVPESLCKL--KDLEELSLSGNYFTQIGPECRNLLE  679
             P+P S  CLEK+E LN   N L+G++P+++C    ++L   SLS NYFT +GP C+ L+E
Sbjct  266   PLPLSLMCLEKVEQLNFAGNLLFGAIPDAVCMFLRENLVNFSLSDNYFTHVGPWCKILVE  325

Query  678   KKVLDIDNNCILDLPNQRSAQVCKDFFLH-YQKCPDHKSLLYVPC  547
             + VLD+ NNCI   P QRS + C +FF+     CP      ++PC
Sbjct  326   RGVLDVRNNCIPFFPGQRSIEECAEFFVKPNYYCPHAWFHSFLPC  370



>ref|XP_002447298.1| hypothetical protein SORBIDRAFT_06g032310 [Sorghum bicolor]
 gb|EES11626.1| hypothetical protein SORBIDRAFT_06g032310 [Sorghum bicolor]
Length=449

 Score =   254 bits (649),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 164/354 (46%), Positives = 216/354 (61%), Gaps = 18/354 (5%)
 Frame = -1

Query  1569  LDPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCIN----KKKYQGFFCYVPRGGDKK  1402
             L+  +R     I+ FK++IT DP  +T +W G ELC +       Y+GF+C  P   D  
Sbjct  73    LNEKLRSLYPVIQAFKQTITCDPLGVTATWTGTELCDSFFNGTTYYKGFYCDYPP--DAP  130

Query  1401  RVggiyfngynfngn-glslnSFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDL  1228
              V  +    +N  G    SL  F+++F DL + H NSNNF+G   +P +      +ELDL
Sbjct  131   GVLTVASIDFNGFGLCAPSLAGFIDAFPDLALFHANSNNFSGD--VPDLTHLQYFYELDL  188

Query  1227  SNNKLAGAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNL  1048
             SNN  +GAFP +V+    L +LDLRFN   G V   VF L ++ALFLNNN F G +PD  
Sbjct  189   SNNNFSGAFPDSVVPLGGLLFLDLRFNRYAGTVPAPVFALTVEALFLNNNGFGGRIPDTF  248

Query  1047  GSTPVFFLTLANNQFSGPIPKTIGNASFLL-EVLFLNNKLSGCLPYEIGLLKNSTVFDAS  871
             GST   +L +ANNQF+GPIP++I N S  L EVLFLNN+LSGCLPYE+GL++   VFDA 
Sbjct  249   GSTGAQYLVVANNQFTGPIPRSIYNTSATLSEVLFLNNRLSGCLPYEVGLVEGLAVFDAG  308

Query  870   INQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLK---DLEELSLSGNYFTQIGP  700
              N++TGPIP SFGCL  +E LNL +NQLYG VP+ LC L     L  LSLS N+F  +G 
Sbjct  309   GNEITGPIPLSFGCLRDVEELNLASNQLYGQVPDVLCLLARNGKLGNLSLSENFFHSVGH  368

Query  699   ECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQK-CPDHKSLLYVPCDI  541
              C  L+  +VLD+  NCIL  P+QR    C  F+    K CP    + ++PCD+
Sbjct  369   HCMELVRSRVLDVRRNCILGFPDQRPPLECAAFYADPTKHCP---FIPHIPCDL  419



>ref|XP_002282474.2| PREDICTED: uncharacterized protein At4g06744 [Vitis vinifera]
 emb|CBI32376.3| unnamed protein product [Vitis vinifera]
Length=445

 Score =   254 bits (648),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 151/316 (48%), Positives = 200/316 (63%), Gaps = 6/316 (2%)
 Frame = -1

Query  1539  AIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfng  1360
              I+ FK SIT DP  IT +W G ++C    KY+GF+C  P   +   +     +   F  
Sbjct  89    VIQKFKASITSDPLGITSTWVGGDIC----KYKGFYCDNPPD-NSTSLALAGIDFNGFQL  143

Query  1359  nglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEA  1180
                SL+ F+++  DL + H N+N F+G     + K P  +ELDLSNNK +G FP  VL  
Sbjct  144   AAPSLDGFIDALPDLAIFHANTNFFSGNITPKIAKLPYFYELDLSNNKFSGEFPPTVLAI  203

Query  1179  TNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTLANNQFS  1000
               L++LD+R+N  +G V PQVF  +LD LF+NNN F+  +PD+ G+TP  ++T ANN+F+
Sbjct  204   PGLSFLDIRYNSFSGSVPPQVFVQNLDVLFINNNNFNQKIPDDFGNTPARYITFANNKFT  263

Query  999   GPIPKTIGNAS-FLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLE  823
             G IP++IGN+S  L E+LFLNN L GCLP EIG LK  TVFD   N LTG +P S GCL 
Sbjct  264   GLIPRSIGNSSSTLTEILFLNNFLFGCLPIEIGSLKELTVFDVGHNLLTGLLPCSLGCLH  323

Query  822   KLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCIL  643
               E LN   N  YG VPE LC LK+L+ L+LS NYFT+IGP CR+L+    +D+ NNCI 
Sbjct  324   NAEQLNFAGNFFYGRVPEELCALKNLQNLTLSDNYFTKIGPNCRDLIPTGKIDLRNNCIR  383

Query  642   DLPNQRSAQVCKDFFL  595
             +LP+QR    C  FFL
Sbjct  384   NLPDQRPRSDCLAFFL  399



>ref|XP_006289202.1| hypothetical protein CARUB_v10002650mg [Capsella rubella]
 gb|EOA22100.1| hypothetical protein CARUB_v10002650mg [Capsella rubella]
Length=407

 Score =   252 bits (644),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 151/338 (45%), Positives = 210/338 (62%), Gaps = 12/338 (4%)
 Frame = -1

Query  1569  LDPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  1390
             LD  +      I+ FK  IT DP N+T++W G+++C     Y+GF C  P   +   V  
Sbjct  44    LDQRLAVVYPVIQRFKSLITLDPYNVTKTWTGSDIC----SYRGFHCDNPPD-NNTAVTV  98

Query  1389  iyfngynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  1210
                +   F  +  S+  F++ F DL + HVNSNNF G     +     L+ELD+SNN+  
Sbjct  99    ASIDFNGFQLSAPSIEGFIDQFPDLALFHVNSNNFGGTVPSKIVNLKYLYELDISNNRFT  158

Query  1209  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPD--NLGSTP  1036
             G FPTAV+  + LT+LD+RFN  +G V PQ+   +LD LF+N+N F+  LP+    G+T 
Sbjct  159   GQFPTAVVGMSGLTFLDIRFNFFSGSVPPQILGQNLDVLFINDNGFTASLPEIPGDGTTH  218

Query  1035  VFFLTLANNQFSGPIPKTI-GNASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQL  859
             + +LTLANN+F+GP+P++I  + S L EVLFLNN  +GC+P EIG L  ++V D   N+L
Sbjct  219   ILYLTLANNKFNGPLPRSILRSMSTLTEVLFLNNDFTGCIPNEIGFLTGASVIDIGGNKL  278

Query  858   TGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKL--KDLEELSLSGNYFTQIGPECRNL  685
             TGP+P S  CL+K+E LN   N L+G +PE +C L   +L  LSLS NYFT +GP CR L
Sbjct  279   TGPLPLSLMCLDKVEQLNFAGNLLFGGIPEPVCMLLRDNLLNLSLSDNYFTHVGPWCRGL  338

Query  684   LEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQK--CP  577
             L++ VLD+ NNCI  L  QRS Q C +FF+  +K  CP
Sbjct  339   LDRGVLDVSNNCIPFLQGQRSMQECAEFFVRPKKYYCP  376



>gb|EMT08852.1| hypothetical protein F775_11606 [Aegilops tauschii]
Length=518

 Score =   255 bits (651),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 156/342 (46%), Positives = 213/342 (62%), Gaps = 15/342 (4%)
 Frame = -1

Query  1536  IRTFKKSITYDPQNITQSWEGNELCINKK---KYQGFFCYVPRGGDKKRVggiyfngynf  1366
             I+ FK++IT DP N+T +W G ++C + K    Y+GF+C  P     K +     +   F
Sbjct  147   IQAFKRTITSDPLNVTATWVGTKICDSSKGGSAYKGFYCDTPPDDANKTLTVASIDFNGF  206

Query  1365  ngnglslnSFVESFNDLVVIHVNSNNFTGA-PGIPVQKFPTLFELDLSNNKLAGAFPTAV  1189
             +    +L  F+++F DL + H NSNNF+G  P +   ++   +ELDLSNN  +G+FP AV
Sbjct  207   HLCAPTLAGFIDAFPDLALFHANSNNFSGVLPELTSLRY--FYELDLSNNAFSGSFPAAV  264

Query  1188  LEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDN-LGSTPVFFLTLAN  1012
                  L +LDLRFN   G V P VF + ++ALFLNNN F+G +P++  G++   ++ +AN
Sbjct  265   PPLGRLAFLDLRFNGFAGEVPPSVFGISVEALFLNNNGFTGVIPESTFGTSRAEYIVVAN  324

Query  1011  NQFSGPIPKTIGNASFLL-EVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSF  835
             N+F+GPIP+ I NAS  L E+LFLNN LSGCLPYEIGL++  TVFDA  N++ GPIP SF
Sbjct  325   NRFTGPIPRPIFNASGTLSEILFLNNDLSGCLPYEIGLVEGLTVFDAGGNEIRGPIPLSF  384

Query  834   GCLEKLEILNLTNNQLYGSVPESLC---KLKDLEELSLSGNYFTQIGPECRNLLEKKVLD  664
             GCL  +E LNL  NQLYG VP+ LC   K   L  LSLS NYF  +G  C  L+  +VLD
Sbjct  385   GCLADVEELNLAGNQLYGHVPDVLCLLAKTGKLTNLSLSDNYFHSVGYHCMELVRSRVLD  444

Query  663   IDNNCILDLPNQRSAQVCKDFFLHYQK-CPDHKSLLYVPCDI  541
             +  NCIL  P QR    C  F+    K CP    + ++PCD+
Sbjct  445   VRRNCILGFPGQRPHIECAMFYADPTKHCP---FIPHIPCDL  483



>ref|NP_001054210.2| Os04g0670100 [Oryza sativa Japonica Group]
 emb|CAE02822.1| OSJNBa0043A12.27 [Oryza sativa Japonica Group]
 dbj|BAF16124.2| Os04g0670100 [Oryza sativa Japonica Group]
Length=446

 Score =   252 bits (644),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 164/349 (47%), Positives = 207/349 (59%), Gaps = 22/349 (6%)
 Frame = -1

Query  1536  IRTFKKSITYDPQNITQSWEGNELC---INKKKYQGFFC-------YVPRGGDKKRVggi  1387
             I+ FK +IT DP+ +T SW G  LC        Y+GF+C             D   +   
Sbjct  76    IQAFKATITSDPRGVTASWVGPNLCDSYFGGDMYKGFYCEHPPAPPGATTPKDNTTLTIA  135

Query  1386  yfngynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLA  1210
               +   +     SL+ FV++F DL + H NSNNF+G   +P +   P  +ELDLSNN  +
Sbjct  136   SIDFNGYGLGAPSLSGFVDAFPDLALFHANSNNFSGE--VPDLTGLPYFYELDLSNNNFS  193

Query  1209  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVF  1030
             GAFP  V+    L +LDLRFN   G V P VF L + ALFLNNN F G +PDN GST   
Sbjct  194   GAFPATVVPLGRLLFLDLRFNRFVGTVPPPVFDLTVVALFLNNNGFYGNIPDNFGSTTAE  253

Query  1029  FLTLANNQFSGPIPKTIGNASF-LLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTG  853
             +L +ANNQF+GPIP++I N S  L EVLFLNN LSGCLPYEIGL++  TVFDA  N +TG
Sbjct  254   YLVVANNQFTGPIPRSIYNTSANLSEVLFLNNHLSGCLPYEIGLVEGLTVFDAGGNDITG  313

Query  852   PIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLK---DLEELSLSGNYFTQIG-PECRNL  685
             PIP S GCL  +E LNL  NQLYG +P+ LC L     L+ LSLS NYF  +G   C  L
Sbjct  314   PIPLSLGCLGLVEELNLAGNQLYGHIPDVLCALAKTGKLQNLSLSDNYFHSVGRRHCLEL  373

Query  684   LEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL-YVPCDI  541
             +  KVLD+  NCI + P+QR A  C  F   Y   P H   + ++PCD+
Sbjct  374   VRSKVLDVRLNCIPNFPHQRPALECARF---YADPPQHCPFVPHIPCDL  419



>gb|EAZ32358.1| hypothetical protein OsJ_16568 [Oryza sativa Japonica Group]
Length=480

 Score =   252 bits (644),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 164/349 (47%), Positives = 207/349 (59%), Gaps = 22/349 (6%)
 Frame = -1

Query  1536  IRTFKKSITYDPQNITQSWEGNELC---INKKKYQGFFC-------YVPRGGDKKRVggi  1387
             I+ FK +IT DP+ +T SW G  LC        Y+GF+C             D   +   
Sbjct  110   IQAFKATITSDPRGVTASWVGPNLCDSYFGGDMYKGFYCEHPPAPPGATTPKDNTTLTIA  169

Query  1386  yfngynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLA  1210
               +   +     SL+ FV++F DL + H NSNNF+G   +P +   P  +ELDLSNN  +
Sbjct  170   SIDFNGYGLGAPSLSGFVDAFPDLALFHANSNNFSGE--VPDLTGLPYFYELDLSNNNFS  227

Query  1209  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVF  1030
             GAFP  V+    L +LDLRFN   G V P VF L + ALFLNNN F G +PDN GST   
Sbjct  228   GAFPATVVPLGRLLFLDLRFNRFVGTVPPPVFDLTVVALFLNNNGFYGNIPDNFGSTTAE  287

Query  1029  FLTLANNQFSGPIPKTIGNASF-LLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTG  853
             +L +ANNQF+GPIP++I N S  L EVLFLNN LSGCLPYEIGL++  TVFDA  N +TG
Sbjct  288   YLVVANNQFTGPIPRSIYNTSANLSEVLFLNNHLSGCLPYEIGLVEGLTVFDAGGNDITG  347

Query  852   PIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLK---DLEELSLSGNYFTQIG-PECRNL  685
             PIP S GCL  +E LNL  NQLYG +P+ LC L     L+ LSLS NYF  +G   C  L
Sbjct  348   PIPLSLGCLGLVEELNLAGNQLYGHIPDVLCALAKTGKLQNLSLSDNYFHSVGRRHCLEL  407

Query  684   LEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL-YVPCDI  541
             +  KVLD+  NCI + P+QR A  C  F   Y   P H   + ++PCD+
Sbjct  408   VRSKVLDVRLNCIPNFPHQRPALECARF---YADPPQHCPFVPHIPCDL  453



>emb|CAJ86091.1| H0818H01.13 [Oryza sativa Indica Group]
Length=480

 Score =   252 bits (644),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 164/349 (47%), Positives = 207/349 (59%), Gaps = 22/349 (6%)
 Frame = -1

Query  1536  IRTFKKSITYDPQNITQSWEGNELC---INKKKYQGFFC-------YVPRGGDKKRVggi  1387
             I+ FK +IT DP+ +T SW G  LC        Y+GF+C             D   +   
Sbjct  110   IQAFKATITSDPRGVTASWVGPNLCDSYFGGDMYKGFYCEHPPAPPGATTPKDNTTLTIA  169

Query  1386  yfngynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLA  1210
               +   +     SL+ FV++F DL + H NSNNF+G   +P +   P  +ELDLSNN  +
Sbjct  170   SIDFNGYGLGAPSLSGFVDAFPDLALFHANSNNFSGE--VPDLTGLPYFYELDLSNNNFS  227

Query  1209  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVF  1030
             GAFP  V+    L +LDLRFN   G V P VF L + ALFLNNN F G +PDN GST   
Sbjct  228   GAFPATVVPLGRLLFLDLRFNRFVGTVPPPVFDLTVVALFLNNNGFYGNIPDNFGSTTAE  287

Query  1029  FLTLANNQFSGPIPKTIGNASF-LLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTG  853
             +L +ANNQF+GPIP++I N S  L EVLFLNN LSGCLPYEIGL++  TVFDA  N +TG
Sbjct  288   YLVVANNQFTGPIPRSIYNTSANLSEVLFLNNHLSGCLPYEIGLVEGLTVFDAGGNDITG  347

Query  852   PIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLK---DLEELSLSGNYFTQIG-PECRNL  685
             PIP S GCL  +E LNL  NQLYG +P+ LC L     L+ LSLS NYF  +G   C  L
Sbjct  348   PIPLSLGCLGLVEELNLAGNQLYGHIPDVLCALAKTGKLQNLSLSDNYFHSVGRRHCLEL  407

Query  684   LEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL-YVPCDI  541
             +  KVLD+  NCI + P+QR A  C  F   Y   P H   + ++PCD+
Sbjct  408   VRSKVLDVRLNCIPNFPHQRPALECARF---YADPPQHCPFVPHIPCDL  453



>gb|AIE88270.1| hypothetical protein OG_BBa0063K01.1 [Oryza glaberrima]
Length=484

 Score =   252 bits (643),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 164/349 (47%), Positives = 206/349 (59%), Gaps = 22/349 (6%)
 Frame = -1

Query  1536  IRTFKKSITYDPQNITQSWEGNELC---INKKKYQGFFC-------YVPRGGDKKRVggi  1387
             I+ FK +IT DP+ +T SW G  LC        Y+GF+C             D   +   
Sbjct  114   IQAFKATITSDPRGVTASWVGPNLCDSYFGGDMYKGFYCEHPPAPPGATPPKDNTTLTIA  173

Query  1386  yfngynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLA  1210
               +   +     SL  FV++F DL + H NSNNF+G   +P +   P  +ELDLSNN  +
Sbjct  174   SIDFNGYGLGAPSLAGFVDAFPDLALFHANSNNFSGE--VPDLTGLPYFYELDLSNNNFS  231

Query  1209  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVF  1030
             GAFP  V+    L +LDLRFN   G V P VF L + ALFLNNN F G +PDN GST   
Sbjct  232   GAFPATVVPLGRLLFLDLRFNRFVGTVPPPVFDLTVVALFLNNNGFYGNIPDNFGSTTAE  291

Query  1029  FLTLANNQFSGPIPKTIGNASF-LLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTG  853
             +L +ANNQF+GPIP++I N S  L EVLFLNN LSGCLPYEIGL++  TVFDA  N +TG
Sbjct  292   YLVVANNQFTGPIPRSIYNTSANLSEVLFLNNHLSGCLPYEIGLVEGLTVFDAGGNDITG  351

Query  852   PIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLK---DLEELSLSGNYFTQIG-PECRNL  685
             PIP S GCL  +E LNL  NQLYG +P+ LC L     L+ LSLS NYF  +G   C  L
Sbjct  352   PIPLSLGCLGLVEELNLAGNQLYGHIPDVLCALAKTGKLQNLSLSDNYFHSVGRRHCLEL  411

Query  684   LEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL-YVPCDI  541
             +  KVLD+  NCI + P+QR A  C  F   Y   P H   + ++PCD+
Sbjct  412   VRSKVLDVRLNCIPNFPHQRPALECARF---YADPPQHCPFVPHIPCDL  457



>dbj|BAJ91151.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96549.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=541

 Score =   253 bits (647),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 155/342 (45%), Positives = 212/342 (62%), Gaps = 15/342 (4%)
 Frame = -1

Query  1536  IRTFKKSITYDPQNITQSWEGNELCINKK---KYQGFFCYVPRGGDKKRVggiyfngynf  1366
             I+ FK++IT DP N+T +W G ++C + K    Y+GF+C  P     K +     +   F
Sbjct  164   IQAFKRTITSDPLNVTATWVGTKICDSAKGGGAYKGFYCDTPPDDANKTLTVASIDFNGF  223

Query  1365  ngnglslnSFVESFNDLVVIHVNSNNFTGA-PGIPVQKFPTLFELDLSNNKLAGAFPTAV  1189
             +    +L  F+++F DL + H NSNNF+G  P +   ++   +ELDLSNN  +GAFP AV
Sbjct  224   HLCAPTLAGFIDAFPDLALFHANSNNFSGDLPDLTSLRY--FYELDLSNNGFSGAFPAAV  281

Query  1188  LEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDN-LGSTPVFFLTLAN  1012
                  L +LDLRFN   G V P VF + ++ALFLNNN F+G +P++  G++   ++ +AN
Sbjct  282   PPLGRLAFLDLRFNGFAGEVPPSVFGISVEALFLNNNAFTGVIPESTFGTSRAEYIVVAN  341

Query  1011  NQFSGPIPKTIGNASFLL-EVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSF  835
             N+F+GPIP++I N S  L E+LFLNN LSGCLPYEIGL++  TVFDA  NQ+ GPIP S 
Sbjct  342   NRFTGPIPRSIFNVSGTLSEILFLNNDLSGCLPYEIGLVEGLTVFDAGGNQIRGPIPLSL  401

Query  834   GCLEKLEILNLTNNQLYGSVPESLC---KLKDLEELSLSGNYFTQIGPECRNLLEKKVLD  664
             GCL  ++ LNL  NQLYG VP+ LC   K   L  LSLS NYF  +G  C  L+  +VLD
Sbjct  402   GCLADVQELNLARNQLYGHVPDVLCLLAKTGKLTNLSLSDNYFHSVGYHCMELVRSRVLD  461

Query  663   IDNNCILDLPNQRSAQVCKDFFLHYQK-CPDHKSLLYVPCDI  541
             +  NCIL  P QR    C  F+    K CP    + ++PCD+
Sbjct  462   VRRNCILGFPGQRPHIECAMFYADPTKHCP---FIPHIPCDL  500



>ref|XP_010227187.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Brachypodium distachyon]
Length=1492

 Score =   263 bits (671),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 163/350 (47%), Positives = 223/350 (64%), Gaps = 19/350 (5%)
 Frame = -1

Query  1557  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  1378
             + ++   I+ FKK++  DPQNI  SW G ++C     Y+GF+C  P     + V  + FN
Sbjct  79    LYRAYLVIQKFKKTVICDPQNIAGSWSGTDIC-GTSSYKGFYCDRPYKVTDRTVASVDFN  137

Query  1377  gynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLA-GA  1204
             GY    + +    FV+   DL + H NSNNF GA  +P ++     +ELDLSNNKLA  A
Sbjct  138   GYGLQADSVQG--FVDGLPDLALFHANSNNFGGA--VPNLKSLQYFYELDLSNNKLAPAA  193

Query  1203  FPTAVLEATNLTYLDLRFNMLTGPVHPQVftl--dldalflnnnfFSGPLPDNLGSTPVF  1030
             FP  VL  TN T++D+RFN   G +   +F+    ++A+F+NNN FSGPLPDNLG +PV 
Sbjct  194   FPLEVLAITNATFIDIRFNSFYGELPAGLFSSFPVIEAIFVNNNQFSGPLPDNLGDSPVN  253

Query  1029  FLTLANNQFSGPIPKTIGNAS-FLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTG  853
             +L+LANN+F+GPIP +I  A   LLEVLFLNN+LSGC+PYE+GLL  +TV DA  N LTG
Sbjct  254   YLSLANNKFTGPIPASIARAGDTLLEVLFLNNRLSGCIPYELGLLGKATVIDAGTNMLTG  313

Query  852   PIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKD----LEELSLSGNYFTQIGPECRNL  685
              IP S+ CL  +E LNL +N LYG VP++LC+L      L  L+LSGNYFT +G  C +L
Sbjct  314   TIPASYACLRSVEQLNLADNLLYGVVPDALCQLASSGGRLVNLTLSGNYFTWLGACCWDL  373

Query  684   LEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSL---LYVPCD  544
             + +  L++D NCI   PNQRS + C  FF  ++K   H +    ++ PC+
Sbjct  374   INEGKLNVDRNCIPWAPNQRSHEECARFF--FRKIESHATCPISVHAPCE  421


 Score = 74.7 bits (182),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 88/316 (28%), Positives = 130/316 (41%), Gaps = 29/316 (9%)
 Frame = -1

Query  1527  FKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngngls  1348
             FK++IT D +    SW  +   I+   +QG  C + +      +     +        L 
Sbjct  518   FKRAITEDSKGALSSWNAS---IHFCNWQGVKCSLTQHERVAMLDLSEQSLVGQISPSLG  574

Query  1347  lnSFVESFN-----------------DLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNN  1219
               S++ S N                 +L  + ++ N+  G   + +     L  LDLS N
Sbjct  575   NMSYLASLNLSRSMFSGQIPLLGHLQELKFLDLSYNSLQGIIPVALTNCSNLSVLDLSRN  634

Query  1218  KLAGAFPTAVLEATNLTYLDLRFNMLTGPVHPQV-ftldldalflnnnfFSGPLPDNLGS  1042
              L G  P  +   +NLT L L +N LTG + P +     L+ + L  N   G +PD  G 
Sbjct  635   LLVGEIPQEIALLSNLTRLWLPYNKLTGVIPPGLGNITSLEHIILMYNQLEGSIPDEFGK  694

Query  1041  -TPVFFLTLANNQFSGPIPKTIGNASFLLEVLFLNNKLSGCLPYEIG-LLKNSTVFDASI  868
              + +  L L  N  S  +P  I N S L ++    N LSG LP  +G  L N        
Sbjct  695   LSKMSNLLLGENMLSSRVPDAIFNLSLLNQMALELNMLSGTLPSHMGNTLPNLQRLFLGG  754

Query  867   NQLTGPIPQSFGCLEKLEILNLT-NNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECR  691
             N L G IP S G    L+ ++L  N+   G +P SL KL  L +L L  N       E  
Sbjct  755   NMLEGFIPDSLGNASDLQHISLAYNHGFRGQIPSSLGKLMKLRKLGLDTNNL-----EAN  809

Query  690   NLLEKKVLDIDNNCIL  643
             +    + LD  +NC L
Sbjct  810   DSQSWEFLDSLSNCTL  825


 Score = 69.7 bits (169),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 62/202 (31%), Positives = 92/202 (46%), Gaps = 26/202 (13%)
 Frame = -1

Query  1248  TLFE-LDLSNNKLAGAFPTAVLE-ATNLTYLDLRFNMLTGPVHPQVftldldalflnnnf  1075
             TL E L L +N L G  P +V   ++NL  L    NML G                    
Sbjct  824   TLLEMLSLHSNMLQGVLPNSVGNLSSNLDNLVFGRNMLYGL-------------------  864

Query  1074  FSGPLPDNLGSTPVFF-LTLANNQFSGPIPKTIGNASFLLEVLFLNNKLSGCLPYEIGLL  898
                 LP ++G+      L L  N F+GPI + IGN   L  +    N+ +G +P  IG +
Sbjct  865   ----LPSSIGNLHRLTKLGLEGNNFTGPIDEWIGNLPNLQGLYLEENRFTGTIPTSIGNI  920

Query  897   KNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNY  718
                TV   + NQ  GPIP S   L++L  L+L+ N L  ++PE + ++  + + +LS N 
Sbjct  921   TKLTVLFLANNQFHGPIPSSLENLQQLGFLDLSYNNLQDNIPEEVFRVATIIQCALSHNS  980

Query  717   FTQIGPECRNLLEKKVLDIDNN  652
                  P   NL +   LD+ +N
Sbjct  981   LEGQIPCISNLQQLNYLDLSSN  1002


 Score = 58.9 bits (141),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 50/188 (27%), Positives = 81/188 (43%), Gaps = 23/188 (12%)
 Frame = -1

Query  1335  VESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEATNLTYLDL  1156
             + + + L  + +  NNFTG     +   P L  L L  N+  G  PT++   T LT L L
Sbjct  869   IGNLHRLTKLGLEGNNFTGPIDEWIGNLPNLQGLYLEENRFTGTIPTSIGNITKLTVLFL  928

Query  1155  RFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTLANNQFSGPIPKTIG  976
               N   GP+   +                    +NL    + FL L+ N     IP+ + 
Sbjct  929   ANNQFHGPIPSSL--------------------ENL--QQLGFLDLSYNNLQDNIPEEVF  966

Query  975   NASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTN  796
               + +++    +N L G +P  I  L+     D S N+LTG IP +    ++L+ + +  
Sbjct  967   RVATIIQCALSHNSLEGQIPC-ISNLQQLNYLDLSSNKLTGEIPPTLPTCQQLQTIKMDQ  1025

Query  795   NQLYGSVP  772
             N L GS+P
Sbjct  1026  NFLSGSIP  1033



>ref|XP_008456159.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis melo]
Length=315

 Score =   244 bits (622),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 134/266 (50%), Positives = 181/266 (68%), Gaps = 2/266 (1%)
 Frame = -1

Query  1338  FVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEATNLTYLD  1159
             F++  +D+ V H NSN F G     + +    +E+DLSNNKL G FPT VL A+ LT+LD
Sbjct  17    FMDELDDIAVFHANSNLFRGPIPKKINRQRFFYEMDLSNNKLPGGFPTNVLGASELTFLD  76

Query  1158  LRFNMLTGPVHPQVftldldalflnnnfF-SGPLPDNLGSTPVFFLTLANNQFSGPIPKT  982
             LR+N   GP+  Q+F +D+ +    NN   S  +P NLG TP  +LT A+N+FSGPIPK+
Sbjct  77    LRYNNYCGPIPEQIFDMDIISAIYINNNQFSSNIPHNLGKTPAKYLTFAHNKFSGPIPKS  136

Query  981   IGNASFLLE-VLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILN  805
             IG+A   +E ++F +N+L GCLPYEIG L+N+ +FDA  N+LTGPIP SF CL K E+L 
Sbjct  137   IGDAKKTMEEIVFFDNQLEGCLPYEIGSLENAVLFDAGKNRLTGPIPLSFACLAKAELLY  196

Query  804   LTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQR  625
             L +NQLYG VPE +CKL +L   +L  N+FTQ+GPEC+ L++KK+LD+ NNCI  LP QR
Sbjct  197   LADNQLYGPVPEEICKLPNLGNFTLRNNFFTQVGPECKKLIKKKILDVSNNCIPGLPKQR  256

Query  624   SAQVCKDFFLHYQKCPDHKSLLYVPC  547
             S   C +F    + C + KS  Y+PC
Sbjct  257   SKTECLEFAYRPKYCGNDKSFTYIPC  282



>ref|XP_010554992.1| PREDICTED: uncharacterized protein At4g06744 [Tarenaya hassleriana]
Length=392

 Score =   243 bits (620),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 136/273 (50%), Positives = 181/273 (66%), Gaps = 8/273 (3%)
 Frame = -1

Query  1338  FVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEATNLTYLD  1159
             F++   D+ + H NSNNF G     + +   L+E D+SNN+ +G FPTAVL    LT+LD
Sbjct  108   FLDQLPDVALFHANSNNFGGIVPPKIAELKYLYEFDISNNRFSGPFPTAVLGMPGLTFLD  167

Query  1158  LRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTLANNQFSGPIPKTI  979
             +RFN  +G + PQ+F  DLD LF+N+N F+  LP+ +G T + +LTLANN+F+GPIP+ I
Sbjct  168   IRFNQFSGSIPPQIFAQDLDVLFINDNEFTATLPETIGETHIQYLTLANNKFNGPIPRGI  227

Query  978   -GNASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNL  802
                 S + E+LFLNN L+GCLPYEIG LK + VFD   N+LTGP+P S  CLEK E LN 
Sbjct  228   LRTMSKVTEILFLNNDLTGCLPYEIGFLKEARVFDVGQNRLTGPLPTSLTCLEKAEQLNF  287

Query  801   TNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRS  622
               N L+G+VPE+ C L++L   SLS NYFT++GP CR L+ K VLD+ NNCI  LPNQRS
Sbjct  288   AGNSLFGTVPETACVLRNLANFSLSDNYFTRVGPFCRILIRKGVLDVRNNCIPLLPNQRS  347

Query  621   AQVCKDFFLHYQKCPDHKSLLYVPCDIDESPRK  523
              + C DF    + C    S ++ P  +   PRK
Sbjct  348   VKECVDFLAKPKYC----SHMWFPSSV---PRK  373



>gb|KCW68710.1| hypothetical protein EUGRSUZ_F02313 [Eucalyptus grandis]
Length=362

 Score =   241 bits (615),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 141/237 (59%), Positives = 166/237 (70%), Gaps = 4/237 (2%)
 Frame = -1

Query  1245  LFELDLSNNKLAGAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSG  1066
             L+ELDLSNNKL+G FPT VL  T+L +LDLRFN  +G V  Q+FT DL  LFLNNN F  
Sbjct  110   LYELDLSNNKLSGPFPTVVLGMTDLIFLDLRFNSFSGAVPAQIFTRDLYVLFLNNNAFDQ  169

Query  1065  PLPDNLGSTPVFFLTLANNQFSGPIPKTIGNA-SFLLEVLFLNNKLSGCLPYEIGLLKNS  889
              LPDNLG+T V +LTLANN+F+GPIP++I  A S L EVLFLNN+ SGCLPYEIGLL  +
Sbjct  170   TLPDNLGNTHVLYLTLANNKFTGPIPRSIAGAPSTLTEVLFLNNRFSGCLPYEIGLLDET  229

Query  888   TVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKL---KDLEELSLSGNY  718
              V DA  NQLTGP+P S  CLEK+E LNL  N  YG VPE +C L   ++L  LSLS NY
Sbjct  230   VVLDAGNNQLTGPLPLSLFCLEKVEQLNLGGNLFYGMVPEPICWLGLNRNLVNLSLSDNY  289

Query  717   FTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
             F  +GP CR L+EK +L++ NNCI DLP QR    C  FF   + CP   S  YVPC
Sbjct  290   FQHVGPWCRALIEKGILNVRNNCIPDLPFQRPVADCARFFAQPRPCPRMWSYSYVPC  346



>gb|EYU25462.1| hypothetical protein MIMGU_mgv1a024676mg, partial [Erythranthe 
guttata]
Length=400

 Score =   242 bits (618),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 148/335 (44%), Positives = 193/335 (58%), Gaps = 17/335 (5%)
 Frame = -1

Query  1536  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  1357
             I+ FK  I  DP NIT +W G+++C     Y+GF+C  P   +K        +   F   
Sbjct  43    IQKFKNIIISDPFNITVTWVGSDIC----SYRGFYCESPPD-NKSATALASIDFNGFQLT  97

Query  1356  glslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTA-VLEA  1180
               +L  F++S  DL + H NSNNF GA    +     L+ELDLSNNK  GAFP A VL  
Sbjct  98    APTLVGFLDSLPDLALFHANSNNFAGAISPAIGNLKYLYELDLSNNKFTGAFPAAAVLGM  157

Query  1179  TNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSG-----PLPDNLGSTP-----VF  1030
             T L +LDLRFN  +G V PQ+F     AL L+  F +        PD           + 
Sbjct  158   TGLFFLDLRFNFFSGSVPPQLFFNTKFALGLDALFLNNNNFLTRFPDAAAGGGGGGGHIA  217

Query  1029  FLTLANNQFSGPIPKTIGNA-SFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTG  853
             FLTLANN+F GPIP+++  + S + E+L +NN LSGCLP+E+GLL ++ VFD   N+LTG
Sbjct  218   FLTLANNKFFGPIPRSVSRSLSNISEILLINNMLSGCLPHELGLLTDAVVFDGGGNRLTG  277

Query  852   PIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKK  673
              +P S GCL KLE++N   N LYGSVPE LC +  L  LSLS NYFT++GP C  L++  
Sbjct  278   LLPVSLGCLRKLEVMNFAGNLLYGSVPEVLCGIGSLANLSLSDNYFTRVGPVCLGLIKSG  337

Query  672   VLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHK  568
             VLD+  NC+  LP QRS   C  FF   + C  H 
Sbjct  338   VLDLRKNCVPGLPLQRSWAECGAFFARPRYCVAHA  372



>ref|XP_006354850.1| PREDICTED: uncharacterized protein At4g06744-like [Solanum tuberosum]
Length=384

 Score =   241 bits (616),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 152/332 (46%), Positives = 200/332 (60%), Gaps = 7/332 (2%)
 Frame = -1

Query  1536  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  1357
             I+ FK  I+ DP  IT++W G  +C     Y GF+C  P   +   +     +   F  +
Sbjct  41    IQKFKNIISADPLGITKTWVGPNIC----NYTGFYCESPPD-NNSAIALASIDFNGFQLS  95

Query  1356  glslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  1177
              L+L+ F++   D+ + H NSNNF G     +   P L+ELD+SNN+  G FP+ +L   
Sbjct  96    ALTLDGFLDQLPDIAIFHANSNNFGGTLSPKIANLPYLYELDISNNQFFGPFPSPILGMN  155

Query  1176  NLTYLDLRFNMLTGPVHPQVftldld-alflnnnfFSGPLPDNLGSTPVFFLTLANNQFS  1000
             +L  LD+RFN  TG V PQ+FT D   ALF+NNN F   LPDN+ ++ V +LTLANN+F 
Sbjct  156   SLNILDIRFNSFTGSVPPQLFTKDQLDALFINNNNFMQMLPDNIVTSHVTYLTLANNRFF  215

Query  999   GPIPKTIGNASFLLEVLFL-NNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLE  823
             GPIP +I      L  + L NN LSGCLPYEIG L  + VFDA  N+LTGP+P S GCLE
Sbjct  216   GPIPHSISKILSSLSEVLLLNNLLSGCLPYEIGFLNEAIVFDAGNNRLTGPLPFSLGCLE  275

Query  822   KLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCIL  643
              +E+LN   NQ+YG VP+ +C L +L  LSLS NYFT  GP C  L+E  VLD+ NNCI 
Sbjct  276   NVEMLNFARNQMYGIVPDVICALGNLANLSLSDNYFTGFGPICLRLIENGVLDLRNNCIP  335

Query  642   DLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
               P QRS   C  FF + + CP   +  Y+PC
Sbjct  336   GFPFQRSIAECVAFFAYPRYCPHMATYTYIPC  367



>ref|XP_004291078.1| PREDICTED: uncharacterized protein At4g06744-like isoform 2 [Fragaria 
vesca subsp. vesca]
Length=406

 Score =   239 bits (611),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 151/333 (45%), Positives = 201/333 (60%), Gaps = 31/333 (9%)
 Frame = -1

Query  1539  AIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfng  1360
              I+ FK  IT DP NIT+SW G+++C     Y+GF+C  P   +   +     +   F  
Sbjct  87    VIQKFKSIITSDPLNITKSWVGSDIC----NYKGFYCDNPPY-NSSAIALASIDFNGFQL  141

Query  1359  nglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEA  1180
                SL+ F++   D+ + H NSNNF+G     +   P L+ELD+SNN  +G+ P      
Sbjct  142   GASSLDGFLDQLPDIALFHANSNNFSGTISSKIANLPYLYELDISNNLFSGSVP------  195

Query  1179  TNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTLANNQFS  1000
                               PQ+FT DLDALFLNNN F   LPDNLGS+ +  LTLANN F+
Sbjct  196   ------------------PQIFTQDLDALFLNNNNFMQSLPDNLGSSHIILLTLANNNFN  237

Query  999   GPIPKTIGNA-SFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLE  823
             GPIP +I  A S L EVL LNN+L+GCLPYE+GLLK + V DAS NQLTGP+P S  CL+
Sbjct  238   GPIPTSIAAALSSLTEVLLLNNQLTGCLPYELGLLKEAIVLDASNNQLTGPLPFSLACLD  297

Query  822   KLEILNLTNNQLYGSVPESLCK-LKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCI  646
             K+E L+   N L+G VP+ +C+ L +L   SLS NYF  +GP C+ L+++ +LD+ NNCI
Sbjct  298   KVEQLSFAGNLLFGLVPDVICELLVNLANFSLSDNYFIHVGPICQRLIQRGLLDVTNNCI  357

Query  645   LDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
               LP QRS + C  FF H + CP+  S  Y+PC
Sbjct  358   PGLPFQRSVEECAGFFAHPRFCPNMWSYTYIPC  390



>gb|EEC78222.1| hypothetical protein OsI_17861 [Oryza sativa Indica Group]
Length=408

 Score =   231 bits (590),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 144/273 (53%), Positives = 177/273 (65%), Gaps = 12/273 (4%)
 Frame = -1

Query  1338  FVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAGAFPTAVLEATNLTYL  1162
             FV++F DL + H NSNNF+G   +P +   P  +ELDLSNN  +GAFP  V+    L +L
Sbjct  114   FVDAFPDLALFHANSNNFSGE--VPDLTGLPYFYELDLSNNNFSGAFPATVVPLGRLLFL  171

Query  1161  DLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTLANNQFSGPIPKT  982
             DLRFN   G V P VF L + ALFLNNN F G +PDN GST   +L +ANNQF+GPIP++
Sbjct  172   DLRFNRFVGTVPPPVFDLTVVALFLNNNGFYGNIPDNFGSTTAEYLVVANNQFTGPIPRS  231

Query  981   IGNASF-LLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILN  805
             I N S  L EVLFLNN LSGCLPYEIGL++  TVFDA  N +TGPIP S GCL  +E LN
Sbjct  232   IYNTSANLSEVLFLNNHLSGCLPYEIGLVEGLTVFDAGGNDITGPIPLSLGCLGLVEELN  291

Query  804   LTNNQLYGSVPESLCKLK---DLEELSLSGNYFTQIG-PECRNLLEKKVLDIDNNCILDL  637
             L  NQLYG +P+ LC L     L+ LSLS NYF  +G   C  L+  KVLD+  NCI + 
Sbjct  292   LAGNQLYGHIPDVLCALAKTGKLQNLSLSDNYFHSVGRRHCLELVRSKVLDVRLNCIPNF  351

Query  636   PNQRSAQVCKDFFLHYQKCPDHKSLL-YVPCDI  541
             P+QR A  C  F   Y   P H   + ++PCD+
Sbjct  352   PHQRPALECARF---YADPPQHCPFVPHIPCDL  381



>ref|XP_004238131.2| PREDICTED: probable inactive receptor kinase At5g67200 [Solanum 
lycopersicum]
Length=1206

 Score =   239 bits (610),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 145/332 (44%), Positives = 194/332 (58%), Gaps = 7/332 (2%)
 Frame = -1

Query  1536  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  1357
             I+ FK  I+ DP  IT++W G  +C     Y GF+C  P   +   +     +   F  +
Sbjct  41    IQKFKNIISADPLGITKTWVGPNIC----NYTGFYCESP-PDNSSAIALASIDFNGFQLS  95

Query  1356  glslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  1177
              L+L+ F++   D+ + H NSNNF G     +     L+ELD+SNN+ +G FP+ +L   
Sbjct  96    ALTLDGFLDQLPDIAIFHANSNNFGGTLSPKIANLFYLYELDISNNQFSGPFPSPILGMN  155

Query  1176  NLTYLDLRFNMLTGPVHPQVftldldalflnnnfF-SGPLPDNLGSTPVFFLTLANNQFS  1000
             +L  LD+RFN  TG + PQ+FT D       NN      LPDN+  + V +LTLANN+F 
Sbjct  156   SLNILDIRFNSFTGSIPPQLFTKDQLDALFINNNNFMQMLPDNIAISHVTYLTLANNRFF  215

Query  999   GPIPKTIGNASFLLEVLFL-NNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLE  823
             GPIP +I      L  + L NN L+GCLPYEIG L  + VFDA  N+LTGP+P S GCLE
Sbjct  216   GPIPHSISKILSSLSEILLLNNLLTGCLPYEIGFLNEAVVFDAGNNRLTGPLPFSLGCLE  275

Query  822   KLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCIL  643
              +E+LN   NQ+YG VP+ +C L++L  LSLS NYFT  GP C  L+E  VLD+ NNCI 
Sbjct  276   NIEMLNFAGNQMYGMVPDVICALENLANLSLSDNYFTGFGPICLRLIENGVLDLRNNCIP  335

Query  642   DLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
               P QRS   C  FF + + CP   S  Y+PC
Sbjct  336   GFPFQRSIAECVAFFAYPRYCPHMASYTYIPC  367


 Score = 58.9 bits (141),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 59/105 (56%), Gaps = 6/105 (6%)
 Frame = -1

Query  1026  LTLANNQFSGPIPKTIGNASFLLEVLFLN-NKLSGCLPYEIGLLKNSTVFDASINQLTGP  850
             L+L NN  +GPIP    +A F L+VLFL+ N  +G +P  I  L      D S N+LTG 
Sbjct  632   LSLQNNSLTGPIPDL--SALFNLKVLFLDHNSFTGSIPASIFTLHRLKTLDLSYNKLTGS  689

Query  849   IPQSFGCLEKLEILNLTNNQLYGSVP---ESLCKLKDLEELSLSG  724
             IP +   L +L  L L +N++ GS+P   +S   + ++   +LSG
Sbjct  690   IPVAIKGLNRLYYLRLDSNRINGSIPALNQSTLHVFNISHNALSG  734



>ref|XP_006855188.1| hypothetical protein AMTR_s00051p00142580 [Amborella trichopoda]
 gb|ERN16655.1| hypothetical protein AMTR_s00051p00142580 [Amborella trichopoda]
Length=449

 Score =   229 bits (583),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 141/319 (44%), Positives = 178/319 (56%), Gaps = 7/319 (2%)
 Frame = -1

Query  1548  SIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngyn  1369
             + + I+ FK +IT DP+ IT SW G ++C    KYQGF C  P   +K  +     +   
Sbjct  94    AYRTIQRFKTTITSDPKGITNSWTGPDVC---NKYQGFACDNPPY-NKSALTLSTVDFNG  149

Query  1368  fngnglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAV  1189
             FN    S+   VE   DL  +H NSN F G       K   L++LD SNN L+G FP  +
Sbjct  150   FNLGADSIEMLVE-LEDLAFVHANSNRFRGTVPDSFSKLTLLYQLDFSNNLLSGGFPPVL  208

Query  1188  LEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfF-SGPLPDNLGSTPVFFLTLAN  1012
                  L +LDLRFN  +G + P +F L    +   NN      LP NLG      LT AN
Sbjct  209   TRMKGLEFLDLRFNDFSGSIPPGIFELLRLGVIFINNNRFEQSLPANLGHASAALLTFAN  268

Query  1011  NQFSGPIPKTIGNAS-FLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSF  835
             N F GPIP +    S  L EVLFLNN+ SGCLPYE+G LK + VFD S N L+G +P+S 
Sbjct  269   NAFCGPIPSSFCELSETLREVLFLNNRFSGCLPYEVGKLKETLVFDVSKNMLSGELPESL  328

Query  834   GCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDN  655
             GC+ KLE+LNL +N   GS+PES+C L  L  L++SGNY   +GP CR L  K  LD   
Sbjct  329   GCMAKLELLNLADNYFGGSLPESVCVLGQLMNLTVSGNYLRSLGPACRQLARKGKLDDRL  388

Query  654   NCILDLPNQRSAQVCKDFF  598
             NCI   PNQR A  C  F+
Sbjct  389   NCITGRPNQRPAADCAAFY  407



>gb|KCW54907.1| hypothetical protein EUGRSUZ_I00886 [Eucalyptus grandis]
Length=240

 Score =   221 bits (563),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 109/179 (61%), Positives = 137/179 (77%), Gaps = 2/179 (1%)
 Frame = -1

Query  1068  GPLPDNLGSTPVFFLTLANNQFSGPIPKTIGNAS-FLLEVLFLNNKLSGCLPYEIGLLKN  892
             G +P+NLG TPV +LTLAN +F+ PIP++IG  S  LLEVLFLNN+LSGCLPYEIGLLK 
Sbjct  33    GTIPENLGKTPVSYLTLAN-KFTCPIPRSIGQTSESLLEVLFLNNQLSGCLPYEIGLLKK  91

Query  891   STVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFT  712
             +T FDASINQLTGPIP SFGCL+++  LNL+ + LYG VPE++C L  L  L+L+ NYFT
Sbjct  92    TTTFDASINQLTGPIPHSFGCLQQMNQLNLSYSHLYGPVPETVCMLPKLSALTLNNNYFT  151

Query  711   QIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPCDIDE  535
             Q+GPECR L+ KK L++  NCIL LP+QRS   C  FF    KCP+ +S+ Y+PC I +
Sbjct  152   QVGPECRKLILKKKLNVRMNCILGLPSQRSPAECDAFFSKKVKCPNERSMRYLPCKISQ  210



>gb|EEE61292.1| hypothetical protein OsJ_15379 [Oryza sativa Japonica Group]
Length=432

 Score =   224 bits (570),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 154/352 (44%), Positives = 202/352 (57%), Gaps = 50/352 (14%)
 Frame = -1

Query  1557  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  1378
             + K+ K I+ F++++T DPQNI  SW G +LC     Y+GFFC  P     + +     +
Sbjct  84    LYKAYKVIQKFRRTVTCDPQNIISSWSGADLC---STYKGFFCERPPNITDRTI--ASVD  138

Query  1377  gynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAGA-  1204
                +N    SL  FV++  DL + H NSNNF GA  +P + +    +ELDLSNNKL+ A 
Sbjct  139   FNGYNLQASSLKEFVDALPDLALFHANSNNFGGA--VPDLSRLQYFYELDLSNNKLSPAT  196

Query  1203  FPTAVLEATNLTYLDLRFNMLTGPV-------HPQVftldldalflnnnfFSGPLPDNLG  1045
             FPT VL+  N T++D+RFN   G +        PQV      A+F+NNN FSG LPDN+G
Sbjct  197   FPTDVLKLKNATFVDIRFNSFYGELPGGVFCSFPQV-----QAIFVNNNQFSGSLPDNIG  251

Query  1044  STPVFFLTLANNQFSGPIPKTIGN-ASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASI  868
              +PV +L+LANN F+G IPK+I   A+ L EVLFLNNKLSGCLPYE+GLL  +TV     
Sbjct  252   DSPVNYLSLANNNFTGEIPKSIARMANTLFEVLFLNNKLSGCLPYELGLLAKATV-----  306

Query  867   NQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLK-----DLEELSLSGNYFTQIG  703
                              E LNL +N LYG VP +LC+L       L  L+LS NYFT +G
Sbjct  307   -----------------EQLNLADNLLYGEVPNALCELAFSWSGRLRNLTLSNNYFTSLG  349

Query  702   PECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
               C +L+++  L++D NCI   PNQRS   C  FF H  K        YVPC
Sbjct  350   SCCWDLIKEGKLNVDRNCIPYAPNQRSHDECAAFF-HRTKTSACPCNTYVPC  400



>gb|KCW54905.1| hypothetical protein EUGRSUZ_I00883 [Eucalyptus grandis]
Length=469

 Score =   223 bits (568),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 157/342 (46%), Positives = 199/342 (58%), Gaps = 54/342 (16%)
 Frame = -1

Query  1536  IRTFKKSITY---DPQNITQSWEGN--ELCINKKKYQGFFCYVPRGGDKKRVggiyfngy  1372
             I+ FKK I+    DP+ +T +W G   ++C     Y+GF C    G     + GI FNG+
Sbjct  146   IQDFKKLISKGNCDPKKVTATWNGTGEKIC----NYKGFTCATVPGYKMSGLAGIDFNGF  201

Query  1371  n--fngnglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFP  1198
                 +   L +++F+E   DLV  H NSNN TG     + K    +ELDLSNNKL GAFP
Sbjct  202   GFCNDKGQLPIDNFIEKLPDLVFFHTNSNNITGRIPSNLSKLKYFYELDLSNNKLRGAFP  261

Query  1197  TAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTL  1018
               VL ATNLT+LDLRFN LTGP+  QVFTLDL+ LFLNNN F+G +P+NLG TPV +LTL
Sbjct  262   LTVLGATNLTFLDLRFNNLTGPIPAQVFTLDLEVLFLNNNEFNGAIPENLGKTPVSYLTL  321

Query  1017  ANNQFSGPIPKTIGNASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQS  838
             ANN+F+GPIP++IG  S  L                                        
Sbjct  322   ANNKFTGPIPRSIGQTSKSL----------------------------------------  341

Query  837   FGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDID  658
                LE++  LNL+ N LYG VPE++C L  L  L+L+ NYFTQ+GPECR L+ KK LD+ 
Sbjct  342   ---LEQMNQLNLSCNHLYGPVPETVCVLPKLSALTLNNNYFTQVGPECRKLILKKKLDVR  398

Query  657   NNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPCDIDES  532
              NCIL LP+QRS   C  FF    KCP+ KS+ YVPC I +S
Sbjct  399   MNCILGLPSQRSPAECDAFFSKKVKCPNEKSMRYVPCKISQS  440



>ref|NP_001148637.1| LOC100282253 [Zea mays]
 gb|ACG32331.1| protein binding protein [Zea mays]
Length=445

 Score =   219 bits (557),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 145/359 (40%), Positives = 194/359 (54%), Gaps = 28/359 (8%)
 Frame = -1

Query  1557  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  1378
             + ++   I+ FK ++T DP+N+T +W G++LC  +  Y GF+C  P GGDK  V G+  N
Sbjct  62    LYRAYLVIQRFKSTVTSDPKNVTATWIGHDLC-GETTYVGFYCGSPAGGDKLTVIGVILN  120

Query  1377  gynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFEL-----------  1234
             GY  +   L    FV    DL + H  SNNF G   IP +     +++L           
Sbjct  121   GYRLHAPTLEG--FVNQLPDLSLFHAASNNFGG--DIPQLTGLGYMYQLSVADKDLQLQA  176

Query  1233  ----DLSNNKLAGAFPTAVLEATNLTYLDLRFNMLTG--PVHPQVftldldalflnnnfF  1072
                 D+ N+ + G             + D  F+   G    H         AL LN+N  
Sbjct  177   QQKRDVPNDSIVGGGGNIHATGGGCLFADFNFSFNVGINKGHKFPGFTQSKALLLNHNNL  236

Query  1071  SGPLPDNLGSTPVFFLTLANNQFSGPIPKTIGN-ASFLLEVLFLNNKLSGCLPYEIGLLK  895
             SGPLP NLG + + +L LANN+ +GPIP +I N    L EVL LNN+LSGCLP+E+G+L 
Sbjct  237   SGPLPSNLGFSKLSYLALANNKLTGPIPPSISNLEDSLFEVLLLNNQLSGCLPHELGMLT  296

Query  894   NSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKD----LEELSLS  727
              + V DA +NQLTGPIP SF CL  +E LNL  N+LYG VP++LCKL      L  L+LS
Sbjct  297   KAAVIDAGMNQLTGPIPSSFSCLSSVEQLNLAGNRLYGQVPDALCKLAGPAGRLANLTLS  356

Query  726   GNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVP  550
             GNYFT  GP C  L++  VLD+ NNCI  L NQR    C  F    + CP   + +  P
Sbjct  357   GNYFTSAGPACAALIKDGVLDVKNNCIPGLTNQRRPAECAAFQSQPKTCPAASTQVTCP  415



>ref|XP_006647518.1| PREDICTED: uncharacterized protein At4g06744-like [Oryza brachyantha]
Length=427

 Score =   218 bits (555),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 137/361 (38%), Positives = 197/361 (55%), Gaps = 28/361 (8%)
 Frame = -1

Query  1557  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  1378
             + ++   I+ FK +IT DP+N T +W GN++C  +  Y GF C  P  G  K++      
Sbjct  47    LYRAYLVIQRFKSTITSDPKNATATWTGNDIC-GETTYLGFHCSTP--GRDKKLTVTAVI  103

Query  1377  gynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKL-----  1213
                +     +L+ F++   DL   H  SNNF GA    V+    L++++++NN       
Sbjct  104   LNGYELRAPTLHGFIDELPDLAFFHAASNNF-GADIPRVEGLEYLYKVNVNNNDFPIHPN  162

Query  1212  AGAFPTAVLEATNLTY-----LDLRF-----NMLTGPVHPQVftldldalflnnnfFSGP  1063
             +G      + A    Y     ++LRF     N   G + P V       L  N+   SGP
Sbjct  163   SGPMVMGQIGAKGDVYCVKGTINLRFFLGTNNKKGGGIIPGVTDAKAVLLNSNSL--SGP  220

Query  1062  LPDNLGSTPVFFLTLANNQFSGPIPKTIGN-ASFLLEVLFLNNKLSGCLPYEIGLLKNST  886
              P+N+G + + +L +ANN+ +GPIP +I +    LLEVL LNN+LSGCLP+EIG+L  + 
Sbjct  221   FPENIGFSKLSYLAVANNKLTGPIPPSISHLQDSLLEVLLLNNQLSGCLPHEIGMLTKAA  280

Query  885   VFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLK-----DLEELSLSGN  721
             V DAS+NQL GPIP SF CL  +E LNL +N LYG +P++LCKL       L  L+LS N
Sbjct  281   VIDASMNQLAGPIPSSFSCLTSVEQLNLGSNSLYGEIPDALCKLAAGPAGRLANLTLSSN  340

Query  720   YFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPCDI  541
             YFT +GP C  L++  VL++ NNCI  L NQR    C  F    + CP   S  +V C +
Sbjct  341   YFTSVGPSCLPLIKDGVLNVKNNCIPGLANQRQPAECASFLSQPKTCPP-ASAAHVACPV  399

Query  540   D  538
             +
Sbjct  400   E  400



>gb|ACF84038.1| unknown [Zea mays]
 gb|AFW62991.1| leucine-rich repeat (LRR) family protein [Zea mays]
Length=435

 Score =   218 bits (555),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 142/336 (42%), Positives = 189/336 (56%), Gaps = 16/336 (5%)
 Frame = -1

Query  1536  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  1357
             I+ FK +I  DP+N+T +W G++LC  +  Y GF+C  P GGDKK +         +N +
Sbjct  79    IQRFKNTIISDPKNVTATWIGHDLC-GETTYVGFYCGSPAGGDKK-LTVTGVILNGYNLH  136

Query  1356  glslnSFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLA-GAFPTAVLE  1183
               +L  FV    DL + H  SNNF G   IP +     ++EL ++   L   A P   + 
Sbjct  137   APTLEGFVNQLPDLALFHAASNNFGG--DIPQLTGLGYMYELSVAVKDLQLQARPKRDIP  194

Query  1182  ATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTLANNQF  1003
               +   L    +      H  +   D  AL LN+N  SGPLP NLG + + +L LANN+ 
Sbjct  195   PDSTVGLGGNTHG-----HGHLGFTDAKALLLNHNNLSGPLPSNLGFSKLSYLALANNKL  249

Query  1002  SGPIPKTIGN-ASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCL  826
             +GPIP +I N    L EVL LNN+LSGCLP+E+G+L  + V DA +NQLTGPIP SF CL
Sbjct  250   TGPIPPSISNLEDSLFEVLLLNNQLSGCLPHELGMLTKAAVIDAGMNQLTGPIPSSFSCL  309

Query  825   EKLEILNLTNNQLYGSVPESLCKLKD----LEELSLSGNYFTQIGPECRNLLEKKVLDID  658
               +E LNL  N+LYG VP++LCKL      L  L+LSGNYFT  GP C  L++  VLD+ 
Sbjct  310   ISVEQLNLAGNRLYGQVPDALCKLAGPAGRLANLTLSGNYFTSAGPACAALIKDGVLDVK  369

Query  657   NNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVP  550
             NNCI  L NQR    C  F    + CP   + +  P
Sbjct  370   NNCIPGLTNQRRPAECAAFQSQPKTCPAASTQVTCP  405



>ref|XP_004953107.1| PREDICTED: uncharacterized protein At4g06744-like [Setaria italica]
Length=404

 Score =   216 bits (550),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 130/336 (39%), Positives = 183/336 (54%), Gaps = 36/336 (11%)
 Frame = -1

Query  1557  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  1378
             + ++   I+ FK +IT DP+N+T +W G++LC  +  Y GF+C  P GGDKK +      
Sbjct  57    LYRAYLVIQRFKSTITSDPKNVTATWTGHDLC-GETTYIGFYCGSPTGGDKK-LTVTGVI  114

Query  1377  gynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNK---LA  1210
                ++ +  +L  FV+   DL + H  SNNF G   IP +     ++ L +S +      
Sbjct  115   LNGYSLHAPTLQGFVDQLPDLALFHAASNNFGG--DIPRLAGLEYMYRLSVSTDPPMYTP  172

Query  1209  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVF  1030
             G     +   T+   L L  N ++                       GPLP NLG + + 
Sbjct  173   GGKGGNIPGVTDSKALLLNHNNIS-----------------------GPLPSNLGLSKLS  209

Query  1029  FLTLANNQFSGPIPKTIGN-ASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTG  853
             +L +ANN+ +GPIP +I      LLEVL LNN+LSGCLP+E+G+L  ++V +  +NQLTG
Sbjct  210   YLAVANNRLTGPIPTSIEQLQDSLLEVLLLNNQLSGCLPHELGMLHKASVINVGMNQLTG  269

Query  852   PIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKD----LEELSLSGNYFTQIGPECRNL  685
             PIP SF CL  +E LNL  N+LYG VP++LCKL      L  L+L GNYFT +GP C  L
Sbjct  270   PIPSSFSCLSSVEQLNLGGNRLYGQVPDALCKLAGPAGRLANLTLPGNYFTSVGPACAAL  329

Query  684   LEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCP  577
             ++  VLD+ NNCI  L NQR    C  F    + CP
Sbjct  330   IKDGVLDVKNNCIPGLANQRHPAECAAFHSQPKTCP  365



>ref|XP_008677766.1| PREDICTED: uncharacterized protein LOC100856884 isoform X1 [Zea 
mays]
Length=467

 Score =   217 bits (553),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 142/336 (42%), Positives = 189/336 (56%), Gaps = 16/336 (5%)
 Frame = -1

Query  1536  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  1357
             I+ FK +I  DP+N+T +W G++LC  +  Y GF+C  P GGDKK +         +N +
Sbjct  111   IQRFKNTIISDPKNVTATWIGHDLC-GETTYVGFYCGSPAGGDKK-LTVTGVILNGYNLH  168

Query  1356  glslnSFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLA-GAFPTAVLE  1183
               +L  FV    DL + H  SNNF G   IP +     ++EL ++   L   A P   + 
Sbjct  169   APTLEGFVNQLPDLALFHAASNNFGG--DIPQLTGLGYMYELSVAVKDLQLQARPKRDIP  226

Query  1182  ATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTLANNQF  1003
               +   L    +      H  +   D  AL LN+N  SGPLP NLG + + +L LANN+ 
Sbjct  227   PDSTVGLGGNTHG-----HGHLGFTDAKALLLNHNNLSGPLPSNLGFSKLSYLALANNKL  281

Query  1002  SGPIPKTIGN-ASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCL  826
             +GPIP +I N    L EVL LNN+LSGCLP+E+G+L  + V DA +NQLTGPIP SF CL
Sbjct  282   TGPIPPSISNLEDSLFEVLLLNNQLSGCLPHELGMLTKAAVIDAGMNQLTGPIPSSFSCL  341

Query  825   EKLEILNLTNNQLYGSVPESLCKLKD----LEELSLSGNYFTQIGPECRNLLEKKVLDID  658
               +E LNL  N+LYG VP++LCKL      L  L+LSGNYFT  GP C  L++  VLD+ 
Sbjct  342   ISVEQLNLAGNRLYGQVPDALCKLAGPAGRLANLTLSGNYFTSAGPACAALIKDGVLDVK  401

Query  657   NNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVP  550
             NNCI  L NQR    C  F    + CP   + +  P
Sbjct  402   NNCIPGLTNQRRPAECAAFQSQPKTCPAASTQVTCP  437



>gb|ACF79045.1| unknown [Zea mays]
 gb|ACF86020.1| unknown [Zea mays]
 gb|AFW62992.1| leucine-rich repeat (LRR) family protein [Zea mays]
Length=458

 Score =   217 bits (552),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 143/354 (40%), Positives = 189/354 (53%), Gaps = 29/354 (8%)
 Frame = -1

Query  1536  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  1357
             I+ FK +I  DP+N+T +W G++LC  +  Y GF+C  P GGDKK +         +N +
Sbjct  79    IQRFKNTIISDPKNVTATWIGHDLC-GETTYVGFYCGSPAGGDKK-LTVTGVILNGYNLH  136

Query  1356  glslnSFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKL-----------  1213
               +L  FV    DL + H  SNNF G   IP +     ++EL ++   L           
Sbjct  137   APTLEGFVNQLPDLALFHAASNNFGG--DIPQLTGLGYMYELSVAVKDLQLQARPKRDIP  194

Query  1212  --------AGAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLP  1057
                             L    +   +  FN+  G  H      D  AL LN+N  SGPLP
Sbjct  195   PDSTVGLGGNTHGHGHLGNCIIADFNFSFNVGIGKGHKFPGFTDAKALLLNHNNLSGPLP  254

Query  1056  DNLGSTPVFFLTLANNQFSGPIPKTIGN-ASFLLEVLFLNNKLSGCLPYEIGLLKNSTVF  880
              NLG + + +L LANN+ +GPIP +I N    L EVL LNN+LSGCLP+E+G+L  + V 
Sbjct  255   SNLGFSKLSYLALANNKLTGPIPPSISNLEDSLFEVLLLNNQLSGCLPHELGMLTKAAVI  314

Query  879   DASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKD----LEELSLSGNYFT  712
             DA +NQLTGPIP SF CL  +E LNL  N+LYG VP++LCKL      L  L+LSGNYFT
Sbjct  315   DAGMNQLTGPIPSSFSCLISVEQLNLAGNRLYGQVPDALCKLAGPAGRLANLTLSGNYFT  374

Query  711   QIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVP  550
               GP C  L++  VLD+ NNCI  L NQR    C  F    + CP   + +  P
Sbjct  375   SAGPACAALIKDGVLDVKNNCIPGLTNQRRPAECAAFQSQPKTCPAASTQVTCP  428



>ref|NP_001241706.1| uncharacterized protein LOC100856884 [Zea mays]
 gb|ACF85236.1| unknown [Zea mays]
Length=458

 Score =   217 bits (552),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 143/354 (40%), Positives = 189/354 (53%), Gaps = 29/354 (8%)
 Frame = -1

Query  1536  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  1357
             I+ FK +I  DP+N+T +W G++LC  +  Y GF+C  P GGDKK +         +N +
Sbjct  79    IQRFKNTIISDPKNVTATWIGHDLC-GETTYVGFYCGSPAGGDKK-LTVTGVILNGYNLH  136

Query  1356  glslnSFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKL-----------  1213
               +L  FV    DL + H  SNNF G   IP +     ++EL ++   L           
Sbjct  137   APTLEGFVNQLPDLALSHAASNNFGG--DIPQLTGLGYMYELSVAVKDLQLQARPKRDIP  194

Query  1212  --------AGAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLP  1057
                             L    +   +  FN+  G  H      D  AL LN+N  SGPLP
Sbjct  195   PDSTVGLGGNTHGHGHLGNCIIADFNFSFNVGIGKGHKFPGFTDAKALLLNHNNLSGPLP  254

Query  1056  DNLGSTPVFFLTLANNQFSGPIPKTIGN-ASFLLEVLFLNNKLSGCLPYEIGLLKNSTVF  880
              NLG + + +L LANN+ +GPIP +I N    L EVL LNN+LSGCLP+E+G+L  + V 
Sbjct  255   SNLGFSKLSYLALANNKLTGPIPPSISNLEDSLFEVLLLNNQLSGCLPHELGMLTKAAVI  314

Query  879   DASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKD----LEELSLSGNYFT  712
             DA +NQLTGPIP SF CL  +E LNL  N+LYG VP++LCKL      L  L+LSGNYFT
Sbjct  315   DAGMNQLTGPIPSSFSCLISVEQLNLAGNRLYGQVPDALCKLAGPAGRLANLTLSGNYFT  374

Query  711   QIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVP  550
               GP C  L++  VLD+ NNCI  L NQR    C  F    + CP   + +  P
Sbjct  375   SAGPACAALIKDGVLDVKNNCIPGLTNQRRPAECAAFQSQPKTCPAASTQVTCP  428



>ref|XP_002452450.1| hypothetical protein SORBIDRAFT_04g026020 [Sorghum bicolor]
 gb|EES05426.1| hypothetical protein SORBIDRAFT_04g026020 [Sorghum bicolor]
Length=433

 Score =   216 bits (550),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 138/339 (41%), Positives = 192/339 (57%), Gaps = 23/339 (7%)
 Frame = -1

Query  1536  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  1357
             I+ FK +IT DP+NIT +W G+++C  K  Y GF+C    G D K +         +N +
Sbjct  60    IQRFKNTITGDPKNITATWTGHDIC-GKTSYVGFYCGALPGRDNK-LTVTAVILNGYNLH  117

Query  1356  glslnSFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNK----------LA  1210
                L+ FV+   DL + H  SNNF G   +P +     ++++ +SN+             
Sbjct  118   APRLHGFVDQLPDLALFHAASNNFGG--DVPRLAGLGYMYDISVSNDHPIHTLIDTYGAQ  175

Query  1209  GAFPTAVLEATNLTYLDLRFNM-LTGPVHPQ--VftldldalflnnnfFSGPLPDNLGST  1039
             GA    V+       ++  F++ + G    +      D  AL LN+N  SGPLP N+G +
Sbjct  176   GAGSINVVSQCVTATINFNFHLGIPGSKEGKHSTGATDAKALLLNHNNLSGPLPSNIGFS  235

Query  1038  PVFFLTLANNQFSGPIPKTIGN-ASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQ  862
              + +L LANN+ +GPIP +I +    L EVL LNN+LSGCLP+E+G+L  + V DA +NQ
Sbjct  236   KLSYLALANNKLTGPIPSSIIHLQDSLFEVLLLNNQLSGCLPHELGMLTKAAVIDAGMNQ  295

Query  861   LTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKD----LEELSLSGNYFTQIGPEC  694
             LTGPIP SF CL  +E LNL  N+LYG VP++LCKL      L  L+LSGNYFT +GP C
Sbjct  296   LTGPIPSSFSCLSSVEQLNLAGNRLYGQVPDALCKLAGPAGRLANLTLSGNYFTSVGPAC  355

Query  693   RNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCP  577
               L++  VLD+ NNCI  L NQR A  C  F    + CP
Sbjct  356   ATLIKDGVLDVKNNCIPGLANQRRAAECAAFQSQPKTCP  394



>gb|KHN12808.1| Hypothetical protein glysoja_008771 [Glycine soja]
Length=224

 Score =   208 bits (529),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 119/215 (55%), Positives = 149/215 (69%), Gaps = 2/215 (1%)
 Frame = -1

Query  1179  TNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTLANNQFS  1000
             + LT+LDLRFN  +G V PQ+FT +L  LF+NNN  +  LPDNL ST +  LTLANN+F 
Sbjct  2     STLTFLDLRFNFFSGAVPPQIFTQNLQVLFINNNILTQGLPDNLASTHILLLTLANNKFM  61

Query  999   GPIPKTIGNA-SFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQSFGCLE  823
             GPIP+++  A S L EVL LNN+L+GCLPYEIG L+ +TVFDA  NQLTGP+P S  CLE
Sbjct  62    GPIPRSLPKALSTLSEVLLLNNQLTGCLPYEIGFLEEATVFDAGNNQLTGPLPLSLSCLE  121

Query  822   KLEILNLTNNQLYGSVPESLC-KLKDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCI  646
             K+E+LN   N LYG VPE +C  L +L   SLS NYFT +GP CR L+++ VLD+ NNCI
Sbjct  122   KVEVLNFGGNLLYGMVPEVVCVGLVNLVNFSLSDNYFTHVGPFCRMLIQRGVLDVRNNCI  181

Query  645   LDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPCDI  541
              DLP QRS   C +FF   + CP       +PC +
Sbjct  182   PDLPFQRSVMECAEFFATPRMCPFMWFHGLIPCKL  216



>ref|XP_006476103.1| PREDICTED: leucine-rich repeat extensin-like protein 3-like [Citrus 
sinensis]
Length=700

 Score =   220 bits (561),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 138/339 (41%), Positives = 191/339 (56%), Gaps = 9/339 (3%)
 Frame = -1

Query  1566  DPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  1387
             +P IR +  A++ +K++I  DP N+T  W G+ +C     Y G FC      D KR+  +
Sbjct  81    NPRIRNAYIALQAWKQAILSDPYNLTADWVGSAVC----SYTGVFC--APAPDNKRIRTV  134

Query  1386  yfngynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  1207
                  N       L   +    DL + H+NSN F G      +    LFELDLSNN+ AG
Sbjct  135   AGIDLNHGDIAGYLPEELGLLTDLALFHINSNRFCGTVPHKFENLKLLFELDLSNNRFAG  194

Query  1206  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFF  1027
              FP  +L    L +LDLR+N   G V  ++F  DLDA+F+NNN F   +PDN G++PV  
Sbjct  195   KFPKVLLRLPQLKFLDLRYNEFEGTVPRELFDKDLDAIFINNNRFRFEIPDNFGNSPVSV  254

Query  1026  LTLANNQFSGPIPKTIGNASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPI  847
             + LANN+F G +P ++GN S L E++ LNN L  CLP EIG+LKN TVFD S NQL GP+
Sbjct  255   IVLANNKFHGCVPSSLGNMSRLNEIILLNNGLRSCLPPEIGMLKNVTVFDVSFNQLLGPL  314

Query  846   PQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVL  667
             P + G +  LE LN+ +N L G++P S+C+L +L+  + S N+FT   P C +L   +  
Sbjct  315   PDTIGRMVSLEQLNVAHNMLSGTIPASICRLPNLQNFTFSYNFFTGEPPVCLSL---QAF  371

Query  666   DIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVP  550
             D   NC+   P QRS+  CK F      C   K   +VP
Sbjct  372   DDRRNCLPARPAQRSSAQCKSFLSKRVDCSSFKCKPFVP  410



>emb|CDX94809.1| BnaC03g43790D [Brassica napus]
Length=530

 Score =   216 bits (551),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 134/323 (41%), Positives = 185/323 (57%), Gaps = 9/323 (3%)
 Frame = -1

Query  1566  DPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  1387
             +P +R +  A++ +K++I  DP NIT +W G+ +C     Y G FC   R  D +R+  +
Sbjct  68    NPRLRSAYIALQAWKQAILSDPNNITLNWIGSNVC----SYTGVFCS--RAPDNRRIRTV  121

Query  1386  yfngynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  1207
                  N       L   +    DL + HVNSN F G      +    LFELDLSNN+ AG
Sbjct  122   AGIDLNHADIAGYLPEELGLLTDLALFHVNSNRFCGTVPHKFKHLKLLFELDLSNNRFAG  181

Query  1206  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFF  1027
              FP  VL+  +L +LDLRFN   G V  ++F+  LDA+F+N+N F   LPDN G +PV  
Sbjct  182   KFPAVVLDLPSLKFLDLRFNEFEGTVPKELFSKPLDAIFINHNRFRFELPDNFGDSPVSV  241

Query  1026  LTLANNQFSGPIPKTIGNASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPI  847
             + LANN+F G IP +      L E++F+NN L+ CLP +IG LKN TVFD S N+L GP+
Sbjct  242   VVLANNRFHGCIPSSFVEMENLNEIIFMNNGLNSCLPADIGRLKNVTVFDVSFNELVGPL  301

Query  846   PQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVL  667
             P+S G +  +E LN+ +NQL G +P S+C+L  LE  + S N+FT   P C  L E    
Sbjct  302   PESVGGMVSVEQLNVAHNQLSGKIPASICQLPKLENFTYSYNFFTGEAPVCLRLPE---F  358

Query  666   DIDNNCILDLPNQRSAQVCKDFF  598
             D   NC+   P QRS++ C  F 
Sbjct  359   DDRRNCLPSRPAQRSSEQCAAFL  381



>ref|XP_003575361.1| PREDICTED: uncharacterized protein At4g06744-like [Brachypodium 
distachyon]
Length=436

 Score =   214 bits (544),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 136/365 (37%), Positives = 191/365 (52%), Gaps = 25/365 (7%)
 Frame = -1

Query  1557  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  1378
             + ++   I+ FK +IT DP+N T +W G ++C N   Y GFFC  P  G  + +      
Sbjct  54    LYRAYHVIQRFKSTITADPKNTTATWTGYDICGN-TTYLGFFCLTPT-GRAEDLTVAGII  111

Query  1377  gynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAGAF  1201
                +     +L  F++   DL   H  SN FTG   +P +   P L+ LD+    +    
Sbjct  112   WNGYGLRAPTLQGFIDKLPDLAFFHSASNYFTG--DVPHLDSLPYLYNLDVDKEDIP-VH  168

Query  1200  PTAVLEATNLTY----------LDLRFNMLTGPVHPQ-------VftldldalflnnnfF  1072
             P +    T+ T           + LR N+   P   +              AL LN N  
Sbjct  169   PNSANFYTDSTIHGGGRCINGDIHLRINVTLDPHMKRWGWGMIPAGATSARALLLNYNDL  228

Query  1071  SGPLPDNLGSTPVFFLTLANNQFSGPIPKTIGNA-SFLLEVLFLNNKLSGCLPYEIGLLK  895
             SG LP N+G + + +  LANN+ +GPIP +IG A   L E+L LNN+LSGCLP+E+G+L 
Sbjct  229   SGALPANIGFSKLSYFALANNKLTGPIPSSIGQAKDTLFELLLLNNQLSGCLPHELGMLT  288

Query  894   NSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYF  715
              +TV DA  NQLTGPIP SF CL  +E LNL  N+LYG VP++LCKL  L  L+L+GNYF
Sbjct  289   KTTVIDAGKNQLTGPIPPSFSCLSSVEQLNLGENRLYGQVPDALCKLGRLANLTLAGNYF  348

Query  714   TQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLH-YQKCPDHKSLLYVPCDID  538
             + +GP C  L+++ VLD+  NCI  L NQR+   C  F       CP   + +  P +  
Sbjct  349   SSVGPACSALIKEGVLDVKRNCIPGLANQRAPAECTSFMSQPKASCPAASAPVSCPAEAA  408

Query  537   ESPRK  523
                +K
Sbjct  409   ADAKK  413



>gb|EAY86685.1| hypothetical protein OsI_08067 [Oryza sativa Indica Group]
Length=428

 Score =   213 bits (542),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 138/341 (40%), Positives = 183/341 (54%), Gaps = 26/341 (8%)
 Frame = -1

Query  1536  IRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  1357
             I+ FK +IT DP+NIT +W GNE+C  K  Y GFFC  P  G  K +         +  +
Sbjct  54    IQRFKSTITSDPKNITSTWSGNEIC-GKTAYLGFFCDTP--GQAKILTVTAVILNGYELH  110

Query  1356  glslnSFVESFNDLVVIHVNSNNF-TGAPGIPVQKFPTLFELDLSNNKL-------AGAF  1201
               +L  F++   DL   H  SNNF T  P +    +  +++L +  N +       A   
Sbjct  111   APTLKGFIDQLPDLAFFHAASNNFGTDVPHLAGLTY--MYKLSVVANDIQPQVYGSAETH  168

Query  1200  PTAVLEATNLTYLDLRFNMLTGPVHPQVf-------tldldalflnnnfFSGPLPDNLGS  1042
              TA         +D  F   T P + +           D  AL LN N  SG LP NLG 
Sbjct  169   GTATAGRCLKATIDFHFYFDTDPKNKKKKGCCTVPGATDSKALLLNYNNLSGQLPSNLGF  228

Query  1041  TPVFFLTLANNQFSGPIPKTIGN-ASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASIN  865
             +   +L LANN+ +GPIP +I N    LLEVL LNN+LSGCLP+E+G+L  + V DA +N
Sbjct  229   SKFSYLALANNKLTGPIPSSISNLQDSLLEVLLLNNQLSGCLPHELGMLTKAAVIDAGMN  288

Query  864   QLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKD-----LEELSLSGNYFTQIGP  700
             QLTGPIP SF CL  +E LNL  N+LYG +P++LCKL       L  L+LS NYFT +GP
Sbjct  289   QLTGPIPSSFSCLTSVEQLNLGGNRLYGEIPDALCKLATGPAGRLANLTLSSNYFTSVGP  348

Query  699   ECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCP  577
              C +L++  VL++ NNCI    NQR    C  F    + CP
Sbjct  349   ACLSLIKDGVLNVKNNCIPGFANQRRPAECASFHSQPKTCP  389



>ref|XP_006300268.1| hypothetical protein CARUB_v100163570mg, partial [Capsella rubella]
 gb|EOA33166.1| hypothetical protein CARUB_v100163570mg, partial [Capsella rubella]
Length=457

 Score =   213 bits (543),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 133/323 (41%), Positives = 187/323 (58%), Gaps = 9/323 (3%)
 Frame = -1

Query  1566  DPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  1387
             +P +R +  A++ +K++I  DP NIT +W G+ +C     Y G FC   R  D +R+  +
Sbjct  73    NPRLRSAYIALQAWKQAILSDPNNITLNWIGSNVC----SYTGVFC--SRALDNRRIRTV  126

Query  1386  yfngynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  1207
                  N       L   +    DL + HVNSN F G       +   LFELDLSNN+ AG
Sbjct  127   AGIDLNHGDIAGYLPLELGLLTDLALFHVNSNRFCGTVPRTFNQLKLLFELDLSNNRFAG  186

Query  1206  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFF  1027
              FPT VL+  +L +LDLRFN   G V  ++F+ DLDA+F+N+N F   LP+NLG +PV  
Sbjct  187   KFPTVVLQLPSLKFLDLRFNEFEGTVPKELFSKDLDAIFINHNRFRFELPENLGDSPVSV  246

Query  1026  LTLANNQFSGPIPKTIGNASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPI  847
             + +ANN F G +P ++     L E++ +NN L+ CLP +IG LKN TVFD S N+L GP+
Sbjct  247   IVIANNHFHGCVPTSLVEMKNLNEIILMNNHLNSCLPADIGRLKNVTVFDVSFNELVGPL  306

Query  846   PQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVL  667
             P+S G L ++E LN+ +N L G +P S+C+L  LE  + S N+FT   P C  L E    
Sbjct  307   PESVGGLVEVEQLNVAHNLLSGKIPASICQLPKLENFTYSYNFFTGEAPVCLRLSE---F  363

Query  666   DIDNNCILDLPNQRSAQVCKDFF  598
             D   NC+   P QRS++ C  F 
Sbjct  364   DDRRNCLPGRPAQRSSRQCSAFL  386



>emb|CDX93014.1| BnaA03g37360D [Brassica napus]
Length=456

 Score =   213 bits (543),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 132/323 (41%), Positives = 185/323 (57%), Gaps = 9/323 (3%)
 Frame = -1

Query  1566  DPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  1387
             +P +R +  A++ +K++I  DP NIT +W G+ +C     Y G FC   R  D +R+  +
Sbjct  70    NPRLRSAYIALQAWKQAILSDPNNITLNWIGSNVCT----YTGVFC--SRAPDNRRIRTV  123

Query  1386  yfngynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  1207
                  N       L   +    DL + HVN+N F G      +    LFELDLSNN+ AG
Sbjct  124   AGIDLNHADIAGYLPEELGLLTDLALFHVNTNRFCGTVPHKFKHLKLLFELDLSNNRFAG  183

Query  1206  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFF  1027
              FP  VL+  +L +LDLRFN   G V  ++F+  LDA+F+N+N F   LPDN G +PV  
Sbjct  184   KFPAVVLDLPSLKFLDLRFNEFEGTVPKELFSKPLDAIFINHNRFRFELPDNFGDSPVSV  243

Query  1026  LTLANNQFSGPIPKTIGNASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPI  847
             + LANN+F G IP +      L E++F+NN L+ CLP +IG LKN TVFD S N+L GP+
Sbjct  244   VVLANNRFHGCIPSSFVEMKNLNEIIFMNNGLNSCLPADIGRLKNVTVFDVSFNELVGPL  303

Query  846   PQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVL  667
             P+S G +  +E LN+ +N+L G +P S+C+L  LE  + S N+FT   P C  L E    
Sbjct  304   PESVGGMVSVEQLNVAHNRLSGKIPASICQLPKLENFTYSYNFFTGEAPVCLRLPE---F  360

Query  666   DIDNNCILDLPNQRSAQVCKDFF  598
             D   NC+   P QRS++ C  F 
Sbjct  361   DDRRNCLPSRPAQRSSEQCAAFL  383



>ref|NP_001150111.1| protein binding protein precursor [Zea mays]
 gb|ACG37876.1| protein binding protein [Zea mays]
Length=424

 Score =   212 bits (540),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 143/340 (42%), Positives = 192/340 (56%), Gaps = 29/340 (9%)
 Frame = -1

Query  1557  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYV-PRGGDKKRVggiyf  1381
             + +S   I+ FK +IT DP+N+T SW GN++C  +  Y GF+C V P  G+K  V  +  
Sbjct  46    LYRSYLVIQRFKSTITSDPKNVTASWIGNDIC-GEATYVGFYCGVLPGRGNKLTVTAVIL  104

Query  1380  ngynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDL-------S  1225
             NGY  +   L    FV+   DL + H  SNNF G   IP V     L++L++       +
Sbjct  105   NGYRLHAPKLQG--FVDEIPDLALFHAASNNFGG--DIPRVVGLGYLYKLNVGVDLPLHT  160

Query  1224  NNKLAG---AFPT----AVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSG  1066
               +L G   A P+     V    N T+ D+  +   G   P V       L  N+   SG
Sbjct  161   QARLGGRVGASPSLSAWCVTTTLNFTF-DIGADTGKGRKFPGVTDAKALLLNHNSL--SG  217

Query  1065  PLPDNLGSTPVFFLTLANNQFSGPIPKTIGN-ASFLLEVLFLNNKLSGCLPYEIGLLKNS  889
             PLP +LG + V +L LANN+ +GPIP++IG+    L E+L LNN+LSGCLP+E+G+L  +
Sbjct  218   PLPADLGYSKVSYLALANNRLTGPIPQSIGHLQDSLFEMLLLNNQLSGCLPHELGMLTKA  277

Query  888   TVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKD----LEELSLSGN  721
              V DA +NQLTGPIP SF CL  +E LNL  N+LYG VPE+LC L      L  L+LS N
Sbjct  278   AVIDAGMNQLTGPIPSSFSCLTSVEQLNLAGNRLYGQVPEALCMLAGPAGRLTNLTLSSN  337

Query  720   YFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDF  601
             YFT + P C  L++  VLD+ NNCI  L NQR    C  F
Sbjct  338   YFTSVAPACAALIKDGVLDVKNNCIPGLANQRRPAECAAF  377



>ref|XP_009627507.1| PREDICTED: leucine-rich repeat extensin-like protein 4 isoform 
X2 [Nicotiana tomentosiformis]
Length=555

 Score =   215 bits (547),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 139/330 (42%), Positives = 184/330 (56%), Gaps = 9/330 (3%)
 Frame = -1

Query  1557  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  1378
             I+ +  A++ +K++I  DP N+T +W G  +C     Y G FC      D  ++  +   
Sbjct  83    IKNAYIALQAWKQAIISDPFNLTANWVGPNVC----NYTGIFC--APALDNPKIRTVAGI  136

Query  1377  gynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFP  1198
               N       L   +    DL + H+NSN F G      +    LFELDLSNN+ AG FP
Sbjct  137   DLNHGDIAGYLPEELGLLVDLGIFHINSNRFCGTIPKKFKNLKILFELDLSNNRFAGKFP  196

Query  1197  TAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTL  1018
               VL    L +LD+RFN   G V  Q+F    DA+F+N+N FS  LPDN G++PV  + L
Sbjct  197   YVVLSLHKLIFLDIRFNEFEGNVPSQLFDRPFDAIFINHNRFSFELPDNFGNSPVSVIVL  256

Query  1017  ANNQFSGPIPKTIGNASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQS  838
             ANN+F G +P +IGN S L EV+ +NN L  CLP EIG+LKN TVFD S NQL GP+P+ 
Sbjct  257   ANNRFHGCLPASIGNMSNLEEVIMMNNGLRSCLPTEIGMLKNLTVFDVSFNQLMGPLPEK  316

Query  837   FGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDID  658
             FG L  LE LN+ +N L GS+P+S+C+L  LE  + S N+FT   P C  L E    D  
Sbjct  317   FGELVNLEQLNVAHNMLTGSIPKSICQLPKLENFTYSYNFFTGEPPVCLRLAE---FDDQ  373

Query  657   NNCILDLPNQRSAQVCKDFFLHYQKCPDHK  568
              NC+ + P QRS   CK F      C   K
Sbjct  374   RNCLPNRPVQRSPAQCKAFLSKRIHCDAFK  403



>ref|XP_011078360.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Sesamum 
indicum]
Length=494

 Score =   213 bits (542),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 137/339 (40%), Positives = 187/339 (55%), Gaps = 9/339 (3%)
 Frame = -1

Query  1566  DPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  1387
             +P +R +  A++ +KK+I  DP N+T  W G+++C     Y G FC      D   +  +
Sbjct  84    NPRLRSAYVALQAWKKAILSDPHNLTVDWVGSDVC----NYTGVFC--APALDNPSIRTV  137

Query  1386  yfngynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  1207
                  N       L   +    DL + H+NSN F G      +    LFELDLSNN+ AG
Sbjct  138   AGIDLNHGDIAGYLPEELGLLTDLGLFHINSNRFCGTVPKKFKNLKILFELDLSNNRFAG  197

Query  1206  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFF  1027
              FP  VL    L YLDLRFN   GPV  ++F   LDA+F+N+N F+  LPDN G++PV  
Sbjct  198   KFPYVVLRLPKLKYLDLRFNEFEGPVPSELFDKPLDAIFINHNRFAFELPDNFGNSPVSV  257

Query  1026  LTLANNQFSGPIPKTIGNASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPI  847
             + LANN+F G +P ++GN S L E++ +NN L  CLP EIGLL+N TVFD S N L GP+
Sbjct  258   IVLANNKFHGCVPASLGNMSNLNEIILMNNGLRSCLPPEIGLLRNLTVFDVSHNGLMGPL  317

Query  846   PQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVL  667
             P S G +  LE LN+  N L G++P+S+C L  LE  + S N+FT   P C  L +    
Sbjct  318   PDSVGGMVSLEQLNVAYNMLSGAIPQSICTLPRLENFTFSYNFFTGEPPVCLALPD---F  374

Query  666   DIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVP  550
             D   NC+ + P QRSA  CK        C   +   ++P
Sbjct  375   DDRRNCLPNRPAQRSAAQCKAVLSKKIHCGAFRCHRFIP  413



>ref|XP_010488556.1| PREDICTED: leucine-rich repeat extensin-like protein 4, partial 
[Camelina sativa]
Length=444

 Score =   212 bits (539),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 132/323 (41%), Positives = 185/323 (57%), Gaps = 9/323 (3%)
 Frame = -1

Query  1566  DPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  1387
             +P +R +  A++ +K++I  DP NIT  W G+ +C     Y G FC   R  D +R+  +
Sbjct  73    NPRLRSAYIALQAWKQAILSDPNNITLDWIGSNVC----SYTGVFC--SRALDNRRIRTV  126

Query  1386  yfngynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  1207
                  N       L   +    DL + HVNSN F G      ++   LFELDLSNN+ AG
Sbjct  127   AGIDLNHADIAGYLPEELGLLTDLALFHVNSNRFCGTVPRKFKQLKLLFELDLSNNRFAG  186

Query  1206  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFF  1027
              FPT VL+  +L +LDLRFN   G V  ++F+  LDA+F+N+N F   LP NLG +PV  
Sbjct  187   KFPTVVLQLPSLKFLDLRFNEFEGTVPKELFSKPLDAIFINHNRFRFELPGNLGDSPVSV  246

Query  1026  LTLANNQFSGPIPKTIGNASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPI  847
             + LANN F G +P ++     L E++ +NN L+ CLP +IG LKN TVFD S N+L GP+
Sbjct  247   IVLANNHFHGCVPTSLVEMKNLNEIILMNNHLNSCLPADIGRLKNVTVFDVSFNELVGPL  306

Query  846   PQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVL  667
             P+S G L ++E LN+ +N L G +P S+C+L  LE  + S N+FT   P C  L +    
Sbjct  307   PKSVGGLVEVEQLNVAHNLLSGKIPASVCQLPKLENFTYSYNFFTGEAPVCLRLSQ---F  363

Query  666   DIDNNCILDLPNQRSAQVCKDFF  598
             D   NC+   P QRS++ C  F 
Sbjct  364   DDRRNCLPGRPAQRSSRQCSAFL  386



>ref|XP_009144429.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3 [Brassica rapa]
Length=410

 Score =   210 bits (535),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 137/349 (39%), Positives = 194/349 (56%), Gaps = 11/349 (3%)
 Frame = -1

Query  1557  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  1378
             ++K+ +A++ +KK I  DP+N+T  W G  +C     Y G FC  P   D+  +     +
Sbjct  59    LQKAYRALQAWKKVIYSDPKNLTGDWIGPSVC----SYTGIFC-APSPSDQNTLVVAGID  113

Query  1377  gynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFP  1198
               + +  G      +   +DL +IH+NSN F G     + +   L+ELDLSNN+  G FP
Sbjct  114   LNHGDIAGFLPEP-IGLLSDLALIHLNSNRFCGILPRSLSQLSLLYELDLSNNRFVGPFP  172

Query  1197  TAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTL  1018
               VL   +L YLDLR+N   GP+ P++F+  LDA+F+NNN  +  +P +   T    +  
Sbjct  173   DVVLSLPSLKYLDLRYNEFEGPLPPKLFSNPLDAIFVNNNRLTSLIPRDFTGTTASVVVF  232

Query  1017  ANNQFSGPIPKTIGN-ASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQ  841
             ANN FSG +P TI + A  L E+L +N+ LSGCLP E+G L    V D S N L GP+P 
Sbjct  233   ANNDFSGCLPPTIAHFADTLEELLLINSSLSGCLPPEVGYLYKLRVLDMSYNSLVGPVPY  292

Query  840   SFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKK-VLD  664
             S   L  LE+LNL +N   G+VP  +C L  L+ L++S NYF++    CRNL  +  V D
Sbjct  293   SLAGLGHLELLNLDHNMFTGAVPLGVCVLPSLQNLTVSDNYFSEEEGTCRNLTSRGIVFD  352

Query  663   IDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPCDIDESPRKAG  517
               NNC+ D P+QRS +VC+D   H   C DH+     P     SP  AG
Sbjct  353   DSNNCLPDKPHQRSHKVCEDVLDHPVDCYDHECSAVAP---QASPFAAG  398



>ref|XP_006389336.1| hypothetical protein POPTR_0028s00200g, partial [Populus trichocarpa]
 gb|ERP48250.1| hypothetical protein POPTR_0028s00200g, partial [Populus trichocarpa]
Length=500

 Score =   212 bits (540),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 134/322 (42%), Positives = 188/322 (58%), Gaps = 9/322 (3%)
 Frame = -1

Query  1566  DPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  1387
             +P ++ +  A++ +K++I  DP N+T +W G+++C     Y+G FC   R  D K +  +
Sbjct  32    NPRLKNAYMALQAWKQAIFSDPLNLTANWVGSQVC----NYEGVFC--SRAPDNKTIRTV  85

Query  1386  yfngynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  1207
                  N       L   +    DL + H+NSN F G      +K   LFELDLSNN+ AG
Sbjct  86    AGIDLNHGDIAGYLPEELGFLVDLALFHINSNRFCGTIPHKFKKLRLLFELDLSNNRFAG  145

Query  1206  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFF  1027
              FP  VL+  +L +LDLRFN   G V  ++F  DLDA+F+N+N F   LP N G++PV  
Sbjct  146   KFPQVVLKLPSLKFLDLRFNEFEGTVPKELFDKDLDAIFINHNRFVFDLPVNFGNSPVSV  205

Query  1026  LTLANNQFSGPIPKTIGNASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPI  847
             + LANN+F G +P ++GN S L E++ +NN    CLP EIGLLKN TVFD S NQL GP+
Sbjct  206   IVLANNKFHGCVPSSLGNMSNLNEIILMNNGFRSCLPAEIGLLKNLTVFDVSFNQLIGPL  265

Query  846   PQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVL  667
             P + G +  LE LN+ +N L G +P S+C+L +LE  + S N+FT   P C +L +    
Sbjct  266   PDTVGGMVSLEQLNVAHNMLSGKIPASICQLPNLENFTFSYNFFTGEPPVCLSLPD---F  322

Query  666   DIDNNCILDLPNQRSAQVCKDF  601
                 NC+   P QRSA  CK F
Sbjct  323   SDRRNCLPGRPEQRSAAQCKAF  344



>ref|XP_002885650.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61909.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=492

 Score =   212 bits (539),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 132/323 (41%), Positives = 186/323 (58%), Gaps = 9/323 (3%)
 Frame = -1

Query  1566  DPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  1387
             +P +R +  A++ +K++I  DP NIT +W G+ +C     Y G FC   R  D +++  +
Sbjct  71    NPRLRSAYIALQAWKQAILSDPNNITVNWIGSNVC----NYTGVFC--SRALDNRKIRTV  124

Query  1386  yfngynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  1207
                  N       L   +    DL + HVNSN F G      ++   LFELDLSNN+ AG
Sbjct  125   AGIDLNHADIAGYLPEELGLLTDLALFHVNSNRFCGTVPHKFKQLKLLFELDLSNNRFAG  184

Query  1206  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFF  1027
              FPT VL   +L +LDLRFN   G V  ++F+ +LDA+F+N+N F   LP+N G +PV  
Sbjct  185   KFPTVVLHLPSLKFLDLRFNEFEGTVPKELFSKNLDAIFINHNRFRFELPENFGDSPVSV  244

Query  1026  LTLANNQFSGPIPKTIGNASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPI  847
             + LANN F G IP ++     L E++F+NN L+ CLP +IG LKN TVFD S N+L GP+
Sbjct  245   IVLANNHFHGCIPTSLVEMKNLNEIIFMNNGLNSCLPADIGSLKNVTVFDVSFNELVGPL  304

Query  846   PQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVL  667
             P+S G +  +E LN+ +N L G +P S+C+L  LE  + S N+FT   P C  L E    
Sbjct  305   PESVGGMVAVEQLNVAHNLLSGKIPASICQLPKLENFTYSYNFFTGEAPVCLRLPE---F  361

Query  666   DIDNNCILDLPNQRSAQVCKDFF  598
             D   NC+   P QRS++ C  F 
Sbjct  362   DDRRNCLPGRPAQRSSRQCSAFL  384



>ref|XP_009627506.1| PREDICTED: leucine-rich repeat extensin-like protein 4 isoform 
X1 [Nicotiana tomentosiformis]
Length=605

 Score =   214 bits (545),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 139/330 (42%), Positives = 184/330 (56%), Gaps = 9/330 (3%)
 Frame = -1

Query  1557  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  1378
             I+ +  A++ +K++I  DP N+T +W G  +C     Y G FC      D  ++  +   
Sbjct  83    IKNAYIALQAWKQAIISDPFNLTANWVGPNVC----NYTGIFC--APALDNPKIRTVAGI  136

Query  1377  gynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFP  1198
               N       L   +    DL + H+NSN F G      +    LFELDLSNN+ AG FP
Sbjct  137   DLNHGDIAGYLPEELGLLVDLGIFHINSNRFCGTIPKKFKNLKILFELDLSNNRFAGKFP  196

Query  1197  TAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTL  1018
               VL    L +LD+RFN   G V  Q+F    DA+F+N+N FS  LPDN G++PV  + L
Sbjct  197   YVVLSLHKLIFLDIRFNEFEGNVPSQLFDRPFDAIFINHNRFSFELPDNFGNSPVSVIVL  256

Query  1017  ANNQFSGPIPKTIGNASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQS  838
             ANN+F G +P +IGN S L EV+ +NN L  CLP EIG+LKN TVFD S NQL GP+P+ 
Sbjct  257   ANNRFHGCLPASIGNMSNLEEVIMMNNGLRSCLPTEIGMLKNLTVFDVSFNQLMGPLPEK  316

Query  837   FGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDID  658
             FG L  LE LN+ +N L GS+P+S+C+L  LE  + S N+FT   P C  L E    D  
Sbjct  317   FGELVNLEQLNVAHNMLTGSIPKSICQLPKLENFTYSYNFFTGEPPVCLRLAE---FDDQ  373

Query  657   NNCILDLPNQRSAQVCKDFFLHYQKCPDHK  568
              NC+ + P QRS   CK F      C   K
Sbjct  374   RNCLPNRPVQRSPAQCKAFLSKRIHCDAFK  403



>ref|NP_189091.1| leucine-rich repeat extensin-like protein 4 [Arabidopsis thaliana]
 sp|Q9LHF1.1|LRX4_ARATH RecName: Full=Leucine-rich repeat extensin-like protein 4; Short=AtLRX4; 
Short=LRR/EXTENSIN4; AltName: Full=Cell wall hydroxyproline-rich 
glycoprotein; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB01951.1| extensin-like protein [Arabidopsis thaliana]
 gb|AEE76902.1| leucine-rich repeat extensin-like protein 4 [Arabidopsis thaliana]
Length=494

 Score =   211 bits (538),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 131/323 (41%), Positives = 187/323 (58%), Gaps = 9/323 (3%)
 Frame = -1

Query  1566  DPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  1387
             +P +R +  A++ +K++I  DP NIT +W G+ +C     Y G FC   +  D +++  +
Sbjct  71    NPRLRSAYIALQAWKQAILSDPNNITVNWIGSNVC----NYTGVFC--SKALDNRKIRTV  124

Query  1386  yfngynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  1207
                  N       L   +    DL + HVNSN F G      ++   LFELDLSNN+ AG
Sbjct  125   AGIDLNHADIAGYLPEELGLLTDLALFHVNSNRFCGTVPHKFKQLKLLFELDLSNNRFAG  184

Query  1206  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFF  1027
              FPT VL   +L +LDLRFN   G V  ++F+ +LDA+F+N+N F   LP+N G +PV  
Sbjct  185   KFPTVVLHLPSLKFLDLRFNEFEGTVPKELFSKNLDAIFINHNRFRFELPENFGDSPVSV  244

Query  1026  LTLANNQFSGPIPKTIGNASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPI  847
             + LANN F G IP ++     L E++F+NN L+ CLP +IG LKN TVFD S N+L GP+
Sbjct  245   IVLANNHFHGCIPTSLVEMKNLNEIIFMNNGLNSCLPADIGRLKNVTVFDVSFNELVGPL  304

Query  846   PQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVL  667
             P+S G + ++E LN+ +N L G +P S+C+L  LE  + S N+FT   P C  L E    
Sbjct  305   PESVGGMVEVEQLNVAHNLLSGKIPASICQLPKLENFTYSYNFFTGEAPVCLRLSE---F  361

Query  666   DIDNNCILDLPNQRSAQVCKDFF  598
             D   NC+   P QRS++ C  F 
Sbjct  362   DDRRNCLPGRPAQRSSRQCSAFL  384



>emb|CDY72552.1| BnaCnng78240D [Brassica napus]
Length=390

 Score =   209 bits (531),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 137/349 (39%), Positives = 193/349 (55%), Gaps = 11/349 (3%)
 Frame = -1

Query  1557  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  1378
             ++K+ +A++ +KK I  DP+N+T  W G  +C     Y G FC  P   D   +     +
Sbjct  39    LQKAYRALQAWKKVIYSDPKNLTGDWVGPSVC----SYTGIFC-APSPSDPNTLVVAGID  93

Query  1377  gynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFP  1198
               + +  G      +   +DL +IH+NSN F G     + +   L+ELDLSNN+  G FP
Sbjct  94    LNHGDIAGFLPEP-IGLLSDLALIHLNSNRFCGILPRSLSQLSLLYELDLSNNRFVGPFP  152

Query  1197  TAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTL  1018
               VL   +L YLDLR+N   GP+ P++F+  LDA+F+NNN  +  +P +   T    +  
Sbjct  153   DVVLSLPSLKYLDLRYNEFEGPLPPKLFSNPLDAIFVNNNRLTSLIPRDFTGTTASVVVF  212

Query  1017  ANNQFSGPIPKTIGN-ASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQ  841
             ANN FSG +P TI + A  L E+L +N+ LSGCLP E+G L    V D S N L GP+P 
Sbjct  213   ANNDFSGCLPPTIAHFADTLEELLLINSSLSGCLPPEVGYLYKLRVLDMSYNSLVGPVPY  272

Query  840   SFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKK-VLD  664
             S   L  LE+LNL +N   G+VP  +C L  L+ L++S NYF++    CRNL  +  V D
Sbjct  273   SLAGLGHLELLNLDHNMFTGAVPLGVCVLPSLQNLTVSDNYFSEEEGICRNLTSRGIVFD  332

Query  663   IDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPCDIDESPRKAG  517
               NNC+ D P+QRS +VC+D   H   C DH+     P     SP  AG
Sbjct  333   DSNNCLPDKPHQRSHKVCEDVLDHPVDCYDHECSAVAP---QASPFAAG  378



>ref|NP_001141180.1| uncharacterized protein LOC100273267 precursor [Zea mays]
 gb|ACF85643.1| unknown [Zea mays]
Length=437

 Score =   210 bits (534),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 135/346 (39%), Positives = 190/346 (55%), Gaps = 24/346 (7%)
 Frame = -1

Query  1557  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  1378
             + ++  AI++FK +IT DP+NIT +W GN++C  +K Y GF+C  P     K +      
Sbjct  58    LYRAYHAIQSFKSTITSDPKNITGTWAGNDIC-GEKSYVGFYCATPTS-RAKELTVTAVV  115

Query  1377  gynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNN---KLA  1210
                F      L  FV+   D+ + H  SNNF G  GIP +      ++L + +N   ++ 
Sbjct  116   LNGFGLRAPKLQGFVDQLPDVALFHAASNNF-GNGGIPRLTGLEYSYDLSVDDNTDLQVQ  174

Query  1209  GAFPTAVLEATNL----TYLDLRFNMLTGP-----VHPQVftldldalflnnnfFSGPLP  1057
                        N+      ++ RF + TGP     + P V       L  N+   SG LP
Sbjct  175   DYSEVTGRARANIHCVAAMIEFRFRLGTGPDKGGGIIPGVADGKALLLNYNDL--SGQLP  232

Query  1056  DNLGSTPVFFLTLANNQFSGPIPKTIGN-ASFLLEVLFLNNKLSGCLPYEIGLLKNSTVF  880
              +LG + + FL LANN+ +GPIP ++ +    LLEVL LNN+LSGCL  E+G+L  + V 
Sbjct  233   ADLGFSKLSFLALANNRLTGPIPPSVAHLKDSLLEVLLLNNQLSGCLAPELGMLAKAAVI  292

Query  879   DASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKD----LEELSLSGNYFT  712
             DA +NQLTGPIP SF CL  +E LNL  N+LYG VP++LC+L      L  L+LSGNYFT
Sbjct  293   DAGMNQLTGPIPSSFSCLISVEQLNLAGNRLYGHVPDALCRLAGPTGRLANLTLSGNYFT  352

Query  711   QIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQK-CP  577
              +GP C  L++  VL++ +NCI  L NQR  + C  F     K CP
Sbjct  353   SVGPACAALIKDGVLNVKSNCIPGLANQRRPEECAAFIQSRPKTCP  398



>emb|CDY18974.1| BnaC01g20940D [Brassica napus]
Length=390

 Score =   208 bits (530),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 137/349 (39%), Positives = 193/349 (55%), Gaps = 11/349 (3%)
 Frame = -1

Query  1557  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  1378
             ++K+ +A++ +KK I  DP+N+T  W G  +C     Y G FC  P   D   +     +
Sbjct  39    LQKAYRALQAWKKVIYSDPKNLTGDWVGPSVC----SYTGIFC-APSPSDPNTLVVAGID  93

Query  1377  gynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFP  1198
               + +  G      +   +DL +IH+NSN F G     + +   L+ELDLSNN+  G FP
Sbjct  94    LNHGDIAGFLPEP-IGLLSDLALIHLNSNRFCGILPRSLSQLSLLYELDLSNNRFVGPFP  152

Query  1197  TAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTL  1018
               VL   +L YLDLR+N   GP+ P++F+  LDA+F+NNN  +  +P +   T    +  
Sbjct  153   DVVLSLPSLKYLDLRYNEFEGPLPPKLFSNPLDAIFVNNNRLTSLIPRDFTGTTASVVVF  212

Query  1017  ANNQFSGPIPKTIGN-ASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQ  841
             ANN FSG +P TI + A  L E+L +N+ LSGCLP E+G L    V D S N L GP+P 
Sbjct  213   ANNDFSGCLPPTIAHFADTLEELLLINSSLSGCLPPEVGYLYKLRVLDMSYNSLVGPVPY  272

Query  840   SFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKK-VLD  664
             S   L  LE+LNL +N   G+VP  +C L  L+ L++S NYF++    CRNL  +  V D
Sbjct  273   SLAGLGHLELLNLDHNMFTGAVPLGVCVLPSLQNLTVSDNYFSEEEGICRNLTSRGIVFD  332

Query  663   IDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPCDIDESPRKAG  517
               NNC+ D P+QRS +VC+D   H   C DH+     P     SP  AG
Sbjct  333   DSNNCLPDKPHQRSHKVCEDVLDHPVDCYDHECSAVAP---QASPFAAG  378



>gb|EPS61338.1| hypothetical protein M569_13456, partial [Genlisea aurea]
Length=387

 Score =   208 bits (530),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 137/335 (41%), Positives = 185/335 (55%), Gaps = 9/335 (3%)
 Frame = -1

Query  1557  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  1378
             +R +  A++ +K++I  DP N+T  W G+++C     Y G FC   +  D   V  +   
Sbjct  34    LRSAYIALQAWKEAILSDPYNLTADWVGSDVC----GYTGVFC--AQAIDDPEVRTVAGI  87

Query  1377  gynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFP  1198
               N       L   +    DL + H+NSN F G      +   TLFELDLSNN+ AG FP
Sbjct  88    DLNHGDIAGYLPEELGLLVDLGLFHINSNRFCGKIPTKFRNLKTLFELDLSNNRFAGKFP  147

Query  1197  TAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTL  1018
               VL    L YLD+R+N   G V P++F   LDA+F+NNN F+  LPDN G++PV  + +
Sbjct  148   RVVLSLPKLVYLDIRYNEFEGTVPPELFDKPLDAIFINNNRFAFELPDNFGNSPVSVIVV  207

Query  1017  ANNQFSGPIPKTIGNASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQS  838
             ANN F G +P ++GN + L E+LFLNN L  CLP EIG L N TVFD S NQL GP+P++
Sbjct  208   ANNHFHGCVPASLGNMTRLNEILFLNNGLRSCLPEEIGRLVNLTVFDVSFNQLLGPLPEN  267

Query  837   FGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVLDID  658
                L KLE LN+ +N L G +P S+C+L +L+  + S N+FT   P C   L        
Sbjct  268   LEGLVKLEQLNVAHNFLSGKIPASICELPNLKNFTFSYNFFTGEPPSC---LALPASSDR  324

Query  657   NNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYV  553
              NC+   P QRSA  CK F      C   K   +V
Sbjct  325   RNCLSGRPAQRSAAQCKGFLSKKIHCSAIKCKRFV  359



>ref|XP_006389464.1| hypothetical protein POPTR_0024s00730g [Populus trichocarpa]
 gb|ERP48378.1| hypothetical protein POPTR_0024s00730g [Populus trichocarpa]
Length=569

 Score =   213 bits (541),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 134/322 (42%), Positives = 188/322 (58%), Gaps = 9/322 (3%)
 Frame = -1

Query  1566  DPVIRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  1387
             +P ++ +  A++ +K++I  DP N+T +W G+++C     Y+G FC   R  D K +  +
Sbjct  78    NPRLKNAYMALQAWKQAIFSDPLNLTANWVGSQVC----NYEGVFC--SRAPDNKTIRTV  131

Query  1386  yfngynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  1207
                  N       L   +    DL + H+NSN F G      +K   LFELDLSNN+ AG
Sbjct  132   AGIDLNHGDIAGYLPEELGFLVDLALFHINSNRFCGTIPHKFKKLRLLFELDLSNNRFAG  191

Query  1206  AFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFF  1027
              FP  VL+  +L +LDLRFN   G V  ++F  DLDA+F+N+N F   LP N G++PV  
Sbjct  192   KFPQVVLKLPSLKFLDLRFNEFEGTVPKELFDKDLDAIFINHNRFVFDLPVNFGNSPVSV  251

Query  1026  LTLANNQFSGPIPKTIGNASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPI  847
             + LANN+F G +P ++GN S L E++ +NN    CLP EIGLLKN TVFD S NQL GP+
Sbjct  252   IVLANNKFHGCVPSSLGNMSNLNEIILMNNGFRSCLPAEIGLLKNLTVFDVSFNQLIGPL  311

Query  846   PQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKKVL  667
             P + G +  LE LN+ +N L G +P S+C+L +LE  + S N+FT   P C +L +    
Sbjct  312   PDTVGGMVSLEQLNVAHNMLSGKIPASICQLPNLENFTFSYNFFTGEPPVCLSLPD---F  368

Query  666   DIDNNCILDLPNQRSAQVCKDF  601
                 NC+   P QRSA  CK F
Sbjct  369   SDRRNCLPGRPEQRSAAQCKAF  390



>ref|XP_003607916.1| Receptor protein kinase [Medicago truncatula]
Length=366

 Score =   206 bits (524),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 103/176 (59%), Positives = 129/176 (73%), Gaps = 4/176 (2%)
 Frame = -1

Query  1062  LPDNLGSTPVFFLTLANNQFSGPIPKTIGNAS-FLLEVLFLNNKLSGCLPYEIGLLKNST  886
             LP+N GSTP  +LT A+N F G IP++IGNA+  L EVLFL NK  GCLPYEIG LK +T
Sbjct  157   LPENFGSTPARYLTFAHNNFVGEIPRSIGNANKTLTEVLFLGNKFEGCLPYEIGYLKKAT  216

Query  885   VFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLE---ELSLSGNYF  715
             VFD S N LTGPIP SFGCLEK++ LNL +N+ YG+VPES+C L  ++    LSL+GNYF
Sbjct  217   VFDVSQNSLTGPIPASFGCLEKIQFLNLAHNKFYGTVPESVCVLSGIKNNGNLSLAGNYF  276

Query  714   TQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPC  547
             T++ P C +LL+ K+LD+ NNCI  LPNQRS Q C +F    + C + +SL YVPC
Sbjct  277   TKLEPACWSLLKSKILDVSNNCIPGLPNQRSKQECYEFQCKIKPCSNPQSLSYVPC  332



>gb|EAY86686.1| hypothetical protein OsI_08068 [Oryza sativa Indica Group]
Length=426

 Score =   207 bits (528),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 131/349 (38%), Positives = 183/349 (52%), Gaps = 26/349 (7%)
 Frame = -1

Query  1557  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  1378
             + ++   I+ FK +IT DP+N+T SW G+++C  +K Y GF+C  P  G    +      
Sbjct  43    LYRAYLVIQRFKSTITSDPKNVTASWTGHDIC-GEKSYLGFYCATPT-GRSDDLTVTGII  100

Query  1377  gynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAGAF  1201
                +      L  F++   DL + H  SN F     IP +   P L+ L++  + LA   
Sbjct  101   WNGYGMRAPKLQGFLDQLPDLALFHAASNYF--GSDIPRLNAVPYLYNLNVDRDALAHPQ  158

Query  1200  PTAVLEATNLTY---------------LDLRFNMLTGPVHPQVftldldalflnnnfFSG  1066
                 L   +  +                DL      G         +  AL LN N  SG
Sbjct  159   AEGKLTGDSRIHTPCINGEIHFIIKVITDLPKKKWGGWGKTPAGATNARALLLNYNSLSG  218

Query  1065  PLPDNLGSTPVFFLTLANNQFSGPIPKTIGNAS-FLLEVLFLNNKLSGCLPYEIGLLKNS  889
             PLP NLG++ + +L LANN+ +G IP +I  A   LLE+L LNN+LSGCLP+E+G+L  +
Sbjct  219   PLPANLGASKLSYLALANNELTGSIPPSIAQAQDSLLEMLLLNNQLSGCLPHELGMLTKA  278

Query  888   TVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLK-----DLEELSLSG  724
              V DA +NQLTGPIP SF CL  +E LNL  N+LYG +P++LCKL       L  L+LS 
Sbjct  279   AVIDAGMNQLTGPIPSSFSCLTSVEQLNLGGNRLYGEIPDALCKLAVGPAGRLANLTLSS  338

Query  723   NYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCP  577
             NYFT +GP C +L++  VL++ NNCI    NQR    C  F    + CP
Sbjct  339   NYFTSVGPACLSLIKDGVLNVKNNCIPGFTNQRRPAECASFHSQPKTCP  387



>emb|CDY49661.1| BnaC09g41390D [Brassica napus]
Length=394

 Score =   206 bits (525),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 132/332 (40%), Positives = 188/332 (57%), Gaps = 8/332 (2%)
 Frame = -1

Query  1557  IRKSIKAIRTFKKSITYDPQNITQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  1378
             ++K+ +A++ +KK I  DP+N+T  W G  +C     Y G FC  P   D   +     +
Sbjct  39    LQKAYRALQAWKKVIYSDPKNLTGDWIGPSVC----SYTGIFC-APSPSDPNTLVVAGID  93

Query  1377  gynfngnglslnSFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFP  1198
               + +  G      +   +DL +IH+NSN F G     + +   L+ELDLSNN+  G FP
Sbjct  94    LNHGDIAGFLPEP-IGLLSDLALIHLNSNRFCGILPRSLSQLSLLYELDLSNNRFVGPFP  152

Query  1197  TAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnfFSGPLPDNLGSTPVFFLTL  1018
               VL   +L YLDLR+N   GP+ P++F+  LDA+F+NNN  +  +P +   T    +  
Sbjct  153   DVVLSLPSLKYLDLRYNEFEGPLPPKLFSNPLDAIFVNNNRLTSLIPRDFTGTTASVVVF  212

Query  1017  ANNQFSGPIPKTIGN-ASFLLEVLFLNNKLSGCLPYEIGLLKNSTVFDASINQLTGPIPQ  841
             ANN FSG +P TI + A  L E+L +N+ LSGCLP E+G L    V D S N L GP+P 
Sbjct  213   ANNDFSGCLPPTIAHFADTLEELLLINSSLSGCLPPEVGYLYKLRVLDMSYNSLVGPVPY  272

Query  840   SFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIGPECRNLLEKK-VLD  664
             S   L  LE+LNL +N   G+VP  +C L  L+ L++S NYF++    CRNL  +  V D
Sbjct  273   SLAGLGHLELLNLDHNMFTGAVPLGVCVLPSLQNLTVSDNYFSEEEGICRNLTSRGIVFD  332

Query  663   IDNNCILDLPNQRSAQVCKDFFLHYQKCPDHK  568
               NNC+ D P+QRS +VC+D   H   C DH+
Sbjct  333   DSNNCLPDKPHQRSHKVCEDVLDHPVDCYDHE  364



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5670177943056