BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c10873_g1_i1 len=768 path=[879:0-393 1272:394-767]

Length=768
                                                                      Score     E

ref|XP_009782728.1|  PREDICTED: cyclin-U2-2-like                        342   2e-115   
ref|XP_009604946.1|  PREDICTED: cyclin-U2-2-like                        342   2e-115   
ref|XP_004229782.1|  PREDICTED: cyclin-U2-1-like                        330   9e-111   
ref|XP_006347912.1|  PREDICTED: cyclin-U2-2-like                        330   1e-110   
ref|XP_011090176.1|  PREDICTED: cyclin-U2-1-like                        328   4e-110   
emb|CDP09478.1|  unnamed protein product                                325   9e-109   
ref|XP_007052178.1|  Cyclin p3,2                                        325   1e-108   
ref|XP_002301262.1|  hypothetical protein POPTR_0002s14440g             323   4e-108   Populus trichocarpa [western balsam poplar]
ref|XP_011017452.1|  PREDICTED: cyclin-U2-1-like                        323   6e-108   
ref|XP_002320709.1|  hypothetical protein POPTR_0014s06180g             322   2e-107   Populus trichocarpa [western balsam poplar]
ref|XP_007221195.1|  hypothetical protein PRUPE_ppa024897mg             322   3e-107   
ref|XP_008232567.1|  PREDICTED: cyclin-U2-1                             322   3e-107   
ref|XP_011033883.1|  PREDICTED: cyclin-U2-2-like                        320   7e-107   
ref|XP_004306960.1|  PREDICTED: cyclin-U2-1-like                        320   8e-107   
ref|XP_009344074.1|  PREDICTED: cyclin-U2-1-like isoform X1             320   1e-106   
ref|XP_006445331.1|  hypothetical protein CICLE_v10024289mg             320   1e-106   
ref|XP_010544609.1|  PREDICTED: cyclin-U2-1-like                        318   9e-106   
gb|KHG29326.1|  Cyclin-U2-1 -like protein                               318   9e-106   
ref|XP_008375805.1|  PREDICTED: cyclin-U2-1-like isoform X1             317   2e-105   
gb|KHG04231.1|  Cyclin-U2-2 -like protein                               315   1e-104   
gb|KDP28804.1|  hypothetical protein JCGZ_14575                         315   1e-104   
ref|XP_002511648.1|  Nuc-1 negative regulatory protein preg, puta...    314   2e-104   Ricinus communis
ref|XP_010089246.1|  hypothetical protein L484_021775                   312   2e-103   
ref|XP_006397689.1|  hypothetical protein EUTSA_v10001623mg             310   8e-103   
gb|EYU31943.1|  hypothetical protein MIMGU_mgv1a013240mg                310   1e-102   
ref|XP_004514236.1|  PREDICTED: cyclin-U2-2-like                        308   3e-102   
ref|XP_007140811.1|  hypothetical protein PHAVU_008G144200g             308   4e-102   
ref|XP_002876566.1|  CYCP3_2                                            308   4e-102   
ref|XP_002275585.1|  PREDICTED: cyclin-U2-1                             308   5e-102   Vitis vinifera
ref|XP_006294970.1|  hypothetical protein CARUB_v10024026mg             308   6e-102   
ref|XP_011081410.1|  PREDICTED: LOW QUALITY PROTEIN: cyclin-U2-1-...    307   7e-102   
ref|XP_009116735.1|  PREDICTED: cyclin-U2-2                             307   2e-101   
gb|KFK37301.1|  hypothetical protein AALP_AA4G239500                    306   4e-101   
gb|KHN05788.1|  Cyclin-U2-1                                             305   5e-101   
emb|CDY18953.1|  BnaC04g03970D                                          305   5e-101   
ref|XP_009143100.1|  PREDICTED: cyclin-U2-1                             305   6e-101   
gb|ACJ84839.1|  unknown                                                 304   2e-100   Medicago truncatula
gb|KFK35259.1|  hypothetical protein AALP_AA5G262100                    305   2e-100   
ref|XP_009344075.1|  PREDICTED: cyclin-U2-1-like isoform X2             303   3e-100   
emb|CDY41156.1|  BnaA09g38590D                                          304   3e-100   
ref|NP_191614.1|  cyclin p3;2                                           303   5e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010508213.1|  PREDICTED: cyclin-U2-1-like                        302   1e-99    
ref|XP_010258919.1|  PREDICTED: cyclin-U2-1-like                        302   1e-99    
ref|XP_010056430.1|  PREDICTED: cyclin-U2-1-like                        301   2e-99    
ref|XP_010506446.1|  PREDICTED: cyclin-U2-1                             301   2e-99    
ref|XP_006291787.1|  hypothetical protein CARUB_v10017957mg             301   3e-99    
emb|CDX71800.1|  BnaC08g30740D                                          301   4e-99    
ref|XP_002880155.1|  CYCP3_1                                            300   4e-99    
ref|XP_008375806.1|  PREDICTED: cyclin-U2-1-like isoform X2             300   6e-99    
ref|NP_182034.1|  cyclin p3;1                                           300   9e-99    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009104271.1|  PREDICTED: cyclin-U2-2-like                        300   1e-98    
emb|CDX67834.1|  BnaA07g18740D                                          299   2e-98    
ref|XP_010518122.1|  PREDICTED: cyclin-U2-1-like                        298   3e-98    
emb|CDX98427.1|  BnaC06g17880D                                          298   4e-98    
ref|XP_009133697.1|  PREDICTED: cyclin-U2-1-like                        298   5e-98    
ref|XP_010524404.1|  PREDICTED: cyclin-U2-2                             297   9e-98    
ref|XP_010692155.1|  PREDICTED: cyclin-U2-1                             296   2e-97    
emb|CDX95626.1|  BnaC03g25070D                                          296   2e-97    
ref|XP_004140492.1|  PREDICTED: cyclin-U2-1-like                        296   2e-97    
ref|XP_004164976.1|  PREDICTED: LOW QUALITY PROTEIN: cyclin-U2-1-...    295   7e-97    
ref|XP_010469167.1|  PREDICTED: cyclin-U2-2-like                        294   2e-96    
ref|XP_010512385.1|  PREDICTED: cyclin-U2-2                             293   5e-96    
ref|XP_010413544.1|  PREDICTED: cyclin-U2-2-like                        293   5e-96    
ref|XP_003517014.1|  PREDICTED: cyclin-U2-1-like                        292   9e-96    
ref|XP_007134728.1|  hypothetical protein PHAVU_010G070800g             288   5e-94    
ref|XP_004504529.1|  PREDICTED: cyclin-U2-1-like                        287   9e-94    
ref|XP_010264309.1|  PREDICTED: cyclin-U2-1-like                        285   5e-93    
ref|XP_006402570.1|  hypothetical protein EUTSA_v10006220mg             285   7e-93    
gb|KHM99414.1|  Cyclin-U2-1                                             284   2e-92    
ref|XP_008459728.1|  PREDICTED: cyclin-U2-1                             285   4e-92    
ref|XP_010258918.1|  PREDICTED: cyclin-U2-1                             281   3e-91    
ref|XP_010264310.1|  PREDICTED: cyclin-U2-2-like isoform X1             275   4e-89    
gb|ACU13246.1|  unknown                                                 272   9e-88    Glycine max [soybeans]
ref|XP_003605284.1|  Cyclin-U2-1                                        269   9e-87    
gb|ACJ85224.1|  unknown                                                 266   2e-85    Medicago truncatula
ref|XP_010264311.1|  PREDICTED: cyclin-U2-2-like isoform X2             263   2e-84    
ref|XP_010919573.1|  PREDICTED: cyclin-U2-2-like                        249   8e-79    
ref|XP_008802822.1|  PREDICTED: cyclin-U2-2-like                        247   4e-78    
ref|XP_009398116.1|  PREDICTED: cyclin-P2-1-like                        243   2e-76    
ref|XP_006838178.1|  hypothetical protein AMTR_s00106p00124350          239   6e-75    
ref|NP_001053503.1|  Os04g0552300                                       178   3e-51    Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ86100.1|  predicted protein                                      174   7e-50    
gb|AFK44464.1|  unknown                                                 171   1e-49    
emb|CDM81206.1|  unnamed protein product                                171   2e-48    
gb|KHG28555.1|  Cyclin-U2-1 -like protein                               167   4e-48    
ref|XP_002985239.1|  hypothetical protein SELMODRAFT_48560              167   7e-48    
ref|XP_004976447.1|  PREDICTED: cyclin-P2-1-like                        169   7e-48    
ref|XP_006652616.1|  PREDICTED: cyclin-P2-1-like                        168   2e-47    
ref|XP_002310464.1|  cyclin family protein                              166   1e-46    Populus trichocarpa [western balsam poplar]
ref|XP_011003213.1|  PREDICTED: cyclin-U1-1                             166   2e-46    
ref|XP_003580288.1|  PREDICTED: cyclin-P2-1-like                        166   3e-46    
ref|XP_002966846.1|  hypothetical protein SELMODRAFT_68732              163   3e-46    
ref|XP_002994358.1|  hypothetical protein SELMODRAFT_48686              162   5e-46    
ref|XP_010552777.1|  PREDICTED: cyclin-U3-1                             162   2e-45    
ref|XP_001763676.1|  predicted protein                                  159   7e-45    
ref|XP_002515728.1|  Nuc-1 negative regulatory protein preg, puta...    161   1e-44    Ricinus communis
ref|XP_006349677.1|  PREDICTED: cyclin-P3-1-like isoform X1             160   2e-44    
ref|XP_006349678.1|  PREDICTED: cyclin-P3-1-like isoform X2             160   2e-44    
gb|ABK22429.1|  unknown                                                 160   3e-44    Picea sitchensis
gb|EYU40342.1|  hypothetical protein MIMGU_mgv1a013920mg                159   5e-44    
ref|XP_008230100.1|  PREDICTED: cyclin-U1-1                             159   6e-44    
ref|XP_009804077.1|  PREDICTED: cyclin-P3-1                             158   1e-43    
ref|XP_006490025.1|  PREDICTED: cyclin-U4-1-like                        158   1e-43    
ref|XP_009627788.1|  PREDICTED: cyclin-P3-1                             157   2e-43    
ref|XP_001760666.1|  predicted protein                                  155   3e-43    
ref|XP_004247165.1|  PREDICTED: cyclin-P3-1                             157   3e-43    
ref|XP_004289157.1|  PREDICTED: cyclin-U1-1-like                        157   3e-43    
ref|XP_007215945.1|  hypothetical protein PRUPE_ppa011252mg             157   3e-43    
ref|XP_001784038.1|  predicted protein                                  155   3e-43    
ref|XP_008794908.1|  PREDICTED: cyclin-P4-1                             156   4e-43    
ref|XP_010258734.1|  PREDICTED: cyclin-U4-1-like                        155   6e-43    
ref|XP_006851148.1|  hypothetical protein AMTR_s00043p00103760          155   9e-43    
ref|XP_007038242.1|  Cyclin p4,1                                        155   9e-43    
ref|XP_001784037.1|  predicted protein                                  154   1e-42    
gb|KDP25867.1|  hypothetical protein JCGZ_22897                         155   1e-42    
gb|AAC32127.1|  PREG-like protein                                       157   2e-42    Picea mariana [black spruce]
ref|XP_010109140.1|  hypothetical protein L484_017079                   154   2e-42    
ref|XP_010919767.1|  PREDICTED: cyclin-P4-1                             154   2e-42    
ref|XP_010035608.1|  PREDICTED: cyclin-U1-1-like                        155   3e-42    
gb|KHG11686.1|  Cyclin-U4-1 -like protein                               154   4e-42    
ref|XP_007139676.1|  hypothetical protein PHAVU_008G049600g             154   4e-42    
ref|XP_002511026.1|  cyclin-dependent protein kinase, putative          153   5e-42    Ricinus communis
ref|XP_006851092.1|  hypothetical protein AMTR_s00025p00245040          154   6e-42    
ref|XP_006375171.1|  cyclin family protein                              153   7e-42    
ref|XP_008245770.1|  PREDICTED: cyclin-U4-1-like                        153   8e-42    
gb|KDP22483.1|  hypothetical protein JCGZ_26314                         153   9e-42    
ref|XP_011032483.1|  PREDICTED: cyclin-U4-1                             152   1e-41    
ref|XP_006421507.1|  hypothetical protein CICLE_v10005725mg             154   1e-41    
ref|XP_010089785.1|  hypothetical protein L484_008035                   152   2e-41    
ref|XP_011085729.1|  PREDICTED: cyclin-U4-1                             152   3e-41    
ref|XP_009800863.1|  PREDICTED: cyclin-U4-1                             152   3e-41    
ref|XP_002973135.1|  hypothetical protein SELMODRAFT_413599             153   3e-41    
ref|XP_002271136.1|  PREDICTED: cyclin-U4-1                             151   3e-41    Vitis vinifera
ref|XP_010246095.1|  PREDICTED: cyclin-U4-1-like                        151   4e-41    
ref|XP_002976722.1|  hypothetical protein SELMODRAFT_416667             153   4e-41    
gb|KDP21459.1|  hypothetical protein JCGZ_21930                         152   4e-41    
ref|XP_002446908.1|  hypothetical protein SORBIDRAFT_06g024670          152   5e-41    Sorghum bicolor [broomcorn]
ref|XP_006433309.1|  hypothetical protein CICLE_v10002472mg             151   6e-41    
ref|XP_002526473.1|  cyclin-dependent protein kinase, putative          150   6e-41    Ricinus communis
ref|XP_004492903.1|  PREDICTED: cyclin-U4-1-like                        150   8e-41    
ref|XP_003624270.1|  Cyclin-dependent protein kinase regulator Pho80    150   8e-41    
ref|XP_002520742.1|  cyclin-dependent protein kinase, putative          150   9e-41    Ricinus communis
ref|XP_008669050.1|  PREDICTED: cyclin-P2-1                             151   9e-41    
ref|XP_007218436.1|  hypothetical protein PRUPE_ppa011642mg             150   9e-41    
ref|XP_001753286.1|  predicted protein                                  149   1e-40    
ref|XP_009592904.1|  PREDICTED: cyclin-U4-1                             150   1e-40    
ref|XP_007134401.1|  hypothetical protein PHAVU_010G044800g             149   2e-40    
gb|KCW58844.1|  hypothetical protein EUGRSUZ_H01477                     149   2e-40    
gb|KHN22156.1|  Cyclin-U4-1                                             149   2e-40    
gb|KDP28881.1|  hypothetical protein JCGZ_14652                         149   2e-40    
ref|XP_008235285.1|  PREDICTED: cyclin-P3-1                             149   3e-40    
gb|KHN12243.1|  Cyclin-U4-1                                             149   3e-40    
gb|AFK41945.1|  unknown                                                 149   4e-40    
ref|XP_010692026.1|  PREDICTED: cyclin-U4-1                             149   4e-40    
ref|XP_008232383.1|  PREDICTED: cyclin-U4-1-like                        148   4e-40    
ref|XP_007205921.1|  hypothetical protein PRUPE_ppa011614mg             148   5e-40    
ref|XP_009375368.1|  PREDICTED: cyclin-U4-1                             148   5e-40    
ref|XP_002278426.1|  PREDICTED: cyclin-U4-1                             148   5e-40    Vitis vinifera
ref|XP_003552477.1|  PREDICTED: cyclin-U4-1-like                        148   5e-40    
gb|KHN40524.1|  Cyclin-U4-1                                             148   6e-40    
ref|XP_006388184.1|  hypothetical protein POPTR_0296s00210g             148   7e-40    
ref|XP_009400236.1|  PREDICTED: cyclin-P4-1-like                        148   7e-40    
ref|XP_003529016.1|  PREDICTED: cyclin-U4-1-like                        148   7e-40    
ref|XP_004515319.1|  PREDICTED: cyclin-U4-1-like                        148   8e-40    
ref|XP_002274682.1|  PREDICTED: cyclin-P3-1 isoform X1                  148   8e-40    Vitis vinifera
ref|XP_009760207.1|  PREDICTED: cyclin-P3-1-like isoform X5             148   8e-40    
ref|XP_011040341.1|  PREDICTED: cyclin-U4-1-like isoform X1             147   8e-40    
ref|XP_010652114.1|  PREDICTED: cyclin-P3-1 isoform X2                  148   8e-40    
ref|XP_010070213.1|  PREDICTED: cyclin-P3-1 isoform X2                  148   9e-40    
ref|XP_006445448.1|  hypothetical protein CICLE_v10022279mg             147   9e-40    
ref|XP_009342256.1|  PREDICTED: cyclin-U1-1-like                        149   1e-39    
ref|NP_196362.1|  cyclin p4;3                                           148   1e-39    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009600659.1|  PREDICTED: cyclin-P3-1-like                        148   1e-39    
ref|XP_010070212.1|  PREDICTED: cyclin-P3-1 isoform X1                  148   1e-39    
gb|EMS61422.1|  hypothetical protein TRIUR3_30801                       149   1e-39    
emb|CDY30482.1|  BnaA04g25830D                                          147   1e-39    
ref|XP_009760204.1|  PREDICTED: cyclin-P3-1-like isoform X3             149   2e-39    
emb|CDX74684.1|  BnaA05g04300D                                          147   2e-39    
gb|EYU20163.1|  hypothetical protein MIMGU_mgv1a024090mg                147   2e-39    
ref|XP_004229728.1|  PREDICTED: cyclin-U4-1                             147   2e-39    
ref|XP_006374594.1|  hypothetical protein POPTR_0015s12380g             147   2e-39    
ref|XP_008455834.1|  PREDICTED: cyclin-U1-1                             147   2e-39    
ref|XP_009760205.1|  PREDICTED: cyclin-P3-1-like isoform X4             148   2e-39    
ref|XP_007218421.1|  hypothetical protein PRUPE_ppa011572mg             147   2e-39    
ref|XP_009143062.1|  PREDICTED: LOW QUALITY PROTEIN: cyclin-U4-1        146   2e-39    
ref|XP_006347995.1|  PREDICTED: cyclin-U4-1-like                        147   2e-39    
gb|KHN31107.1|  Cyclin-U4-1                                             147   2e-39    
ref|XP_004307245.1|  PREDICTED: cyclin-U4-1-like                        146   3e-39    
ref|XP_006397655.1|  hypothetical protein EUTSA_v10001641mg             146   3e-39    
tpg|DAA46330.1|  TPA: hypothetical protein ZEAMMB73_464167              147   3e-39    
ref|XP_009760203.1|  PREDICTED: cyclin-P3-1-like isoform X2             148   3e-39    
ref|XP_009142278.1|  PREDICTED: cyclin-U4-1                             146   3e-39    
ref|XP_009760202.1|  PREDICTED: cyclin-P3-1-like isoform X1             148   3e-39    
ref|XP_010277841.1|  PREDICTED: cyclin-P3-1-like                        147   3e-39    
ref|XP_003572092.2|  PREDICTED: cyclin-P4-1-like                        146   4e-39    
ref|NP_001235331.1|  uncharacterized protein LOC100305689               146   4e-39    
ref|XP_009370411.1|  PREDICTED: cyclin-U4-1                             146   4e-39    
ref|XP_009387832.1|  PREDICTED: cyclin-P3-1-like                        146   5e-39    
ref|XP_010056382.1|  PREDICTED: cyclin-U4-1                             145   5e-39    
ref|XP_006376963.1|  hypothetical protein POPTR_0012s11610g             146   5e-39    
ref|XP_008246475.1|  PREDICTED: cyclin-P3-1                             145   5e-39    
ref|XP_004307773.1|  PREDICTED: cyclin-U4-1-like                        145   5e-39    
ref|XP_010255964.1|  PREDICTED: cyclin-P3-1-like isoform X2             146   6e-39    
gb|ACU24636.1|  unknown                                                 145   6e-39    Glycine max [soybeans]
ref|XP_006591586.1|  PREDICTED: cyclin-U2-1-like                        143   7e-39    
ref|XP_003636176.1|  Cyclin-U4-1                                        145   8e-39    
ref|XP_010255963.1|  PREDICTED: cyclin-P3-1-like isoform X1             146   9e-39    
ref|XP_007200546.1|  hypothetical protein PRUPE_ppa011715mg             145   9e-39    
ref|XP_008362758.1|  PREDICTED: cyclin-U4-1-like                        145   9e-39    
ref|XP_004290653.1|  PREDICTED: cyclin-P3-1-like                        145   9e-39    
emb|CDP09417.1|  unnamed protein product                                145   9e-39    
ref|XP_009760376.1|  PREDICTED: cyclin-U4-1-like                        145   1e-38    
ref|XP_009122338.1|  PREDICTED: cyclin-U4-2                             145   1e-38    
ref|XP_011003554.1|  PREDICTED: cyclin-U4-1-like                        145   1e-38    
ref|XP_004151930.1|  PREDICTED: cyclin-U1-1-like                        145   1e-38    
ref|XP_006444072.1|  hypothetical protein CICLE_v10021982mg             145   1e-38    
ref|XP_002873308.1|  CYCP4_3                                            145   1e-38    
ref|XP_007050616.1|  Cyclin p1,1 isoform 1                              145   2e-38    
ref|XP_004230189.1|  PREDICTED: cyclin-P3-1 isoform X1                  145   2e-38    
ref|XP_006444071.1|  hypothetical protein CICLE_v10021982mg             145   2e-38    
emb|CDX70040.1|  BnaA10g23890D                                          145   2e-38    
ref|XP_006295023.1|  hypothetical protein CARUB_v10024094mg             144   2e-38    
ref|XP_009613666.1|  PREDICTED: cyclin-U4-1-like                        144   2e-38    
ref|XP_008386497.1|  PREDICTED: cyclin-P3-1-like                        144   2e-38    
ref|XP_006361848.1|  PREDICTED: cyclin-P3-1-like                        145   2e-38    
ref|XP_008343752.1|  PREDICTED: cyclin-U4-1-like                        144   2e-38    
ref|XP_009363720.1|  PREDICTED: cyclin-U4-1-like                        144   2e-38    
gb|KHG00595.1|  Cyclin-P3-1                                             144   3e-38    
ref|XP_004493668.1|  PREDICTED: cyclin-P3-1-like                        144   3e-38    
ref|XP_009389264.1|  PREDICTED: cyclin-P4-1                             143   3e-38    
emb|CDY48257.1|  BnaC04g05160D                                          143   4e-38    
ref|XP_007208184.1|  hypothetical protein PRUPE_ppa020960mg             142   4e-38    
ref|XP_004172662.1|  PREDICTED: LOW QUALITY PROTEIN: cyclin-U1-1-...    144   4e-38    
ref|XP_006838523.1|  hypothetical protein AMTR_s00002p00190080          144   4e-38    
ref|XP_008343655.1|  PREDICTED: cyclin-U4-1-like                        143   4e-38    
ref|XP_011032712.1|  PREDICTED: cyclin-P3-1-like isoform X2             144   4e-38    
ref|XP_009389583.1|  PREDICTED: cyclin-P4-1-like                        143   5e-38    
gb|KHG14991.1|  Cyclin-U4-1 -like protein                               143   5e-38    
ref|XP_002512374.1|  cyclin-dependent protein kinase, putative          144   5e-38    Ricinus communis
ref|XP_008453846.1|  PREDICTED: cyclin-U4-1-like                        143   6e-38    
ref|XP_011032710.1|  PREDICTED: cyclin-P3-1-like isoform X1             144   6e-38    
ref|XP_006366726.1|  PREDICTED: cyclin-U4-1-like                        143   6e-38    
ref|XP_010508257.1|  PREDICTED: cyclin-U4-1                             142   7e-38    
ref|XP_002306774.1|  cyclin family protein                              143   8e-38    Populus trichocarpa [western balsam poplar]
ref|XP_010518078.1|  PREDICTED: cyclin-U4-1-like                        142   8e-38    
ref|XP_008368850.1|  PREDICTED: cyclin-P3-1-like                        143   9e-38    
ref|XP_011079855.1|  PREDICTED: cyclin-P3-1-like                        143   9e-38    
ref|XP_010674759.1|  PREDICTED: cyclin-P3-1 isoform X1                  143   9e-38    
ref|XP_010506407.1|  PREDICTED: cyclin-U4-1-like                        142   9e-38    
ref|XP_010934125.1|  PREDICTED: cyclin-P4-1                             142   9e-38    
emb|CDY65234.1|  BnaC09g47870D                                          142   1e-37    
gb|EMT31645.1|  hypothetical protein F775_30140                         143   1e-37    
ref|XP_010674760.1|  PREDICTED: cyclin-P3-1 isoform X2                  143   1e-37    
gb|EYU46584.1|  hypothetical protein MIMGU_mgv1a013898mg                142   1e-37    
ref|XP_006386267.1|  hypothetical protein POPTR_0002s05370g             142   1e-37    
ref|XP_002862353.1|  CYCP4_2                                            142   1e-37    
ref|XP_010934119.1|  PREDICTED: cyclin-P4-1-like                        141   2e-37    
ref|XP_006386269.1|  hypothetical protein POPTR_0002s05370g             142   2e-37    
ref|XP_002302113.2|  hypothetical protein POPTR_0002s05370g             142   2e-37    Populus trichocarpa [western balsam poplar]
ref|XP_004235192.1|  PREDICTED: cyclin-U4-1                             141   2e-37    
ref|XP_010423207.1|  PREDICTED: cyclin-U4-2-like                        142   3e-37    
gb|EYU43110.1|  hypothetical protein MIMGU_mgv1a013764mg                141   3e-37    
ref|NP_001065406.1|  Os10g0563900                                       141   4e-37    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008375750.1|  PREDICTED: cyclin-U4-1                             141   4e-37    
ref|XP_004148894.1|  PREDICTED: cyclin-P3-1-like                        141   4e-37    
ref|XP_007030853.1|  Cyclin family protein, putative isoform 2          140   4e-37    
ref|XP_010452710.1|  PREDICTED: cyclin-U4-2-like                        141   4e-37    
ref|XP_008454704.1|  PREDICTED: cyclin-P3-1                             141   5e-37    
ref|XP_009355462.1|  PREDICTED: cyclin-P3-1-like                        141   5e-37    
gb|EMT04744.1|  hypothetical protein F775_06753                         141   6e-37    
gb|EPS72561.1|  hypothetical protein M569_02197                         139   6e-37    
ref|XP_004133942.1|  PREDICTED: cyclin-U4-1-like                        140   6e-37    
ref|XP_008451358.1|  PREDICTED: cyclin-P3-1                             140   6e-37    
ref|XP_010544563.1|  PREDICTED: cyclin-U4-1-like                        140   6e-37    
ref|XP_010532486.1|  PREDICTED: cyclin-U1-1                             140   7e-37    
ref|XP_006288646.1|  hypothetical protein CARUB_v10001951mg             140   7e-37    
ref|XP_010524444.1|  PREDICTED: cyclin-U4-1                             139   9e-37    
gb|KFK37277.1|  hypothetical protein AALP_AA4G236200                    140   9e-37    
ref|XP_010523281.1|  PREDICTED: cyclin-U4-2-like                        140   9e-37    
ref|XP_004158916.1|  PREDICTED: cyclin-P3-1-like isoform 1              141   9e-37    
ref|NP_182002.1|  cyclin p4;1                                           139   1e-36    
emb|CDX83419.1|  BnaA03g20870D                                          139   1e-36    
ref|XP_007052360.1|  Cyclin p4,1                                        139   1e-36    
ref|XP_009362721.1|  PREDICTED: cyclin-U4-1-like                        139   2e-36    
gb|KHG18521.1|  Cyclin-U4-1 -like protein                               139   2e-36    
ref|XP_009133684.1|  PREDICTED: cyclin-U4-1-like                        139   2e-36    
ref|XP_002467475.1|  hypothetical protein SORBIDRAFT_01g028810          140   2e-36    
ref|XP_002881978.1|  CYCP4_1                                            139   2e-36    
gb|KHG19596.1|  Cyclin-U4-1 -like protein                               139   2e-36    
ref|XP_004983624.1|  PREDICTED: cyclin-P4-1-like                        139   2e-36    
ref|XP_004139180.1|  PREDICTED: cyclin-P3-1-like                        139   2e-36    
ref|XP_004156423.1|  PREDICTED: cyclin-P3-1-like                        139   3e-36    
ref|NP_200973.1|  CYCLIN P4;2                                           139   4e-36    
gb|KHG29431.1|  Cyclin-U4-1 -like protein                               137   4e-36    
ref|XP_008438223.1|  PREDICTED: cyclin-U4-1                             138   4e-36    
ref|XP_010491362.1|  PREDICTED: cyclin-U4-2-like                        139   4e-36    
ref|XP_010457595.1|  PREDICTED: cyclin-U4-3                             138   5e-36    
dbj|BAJ87584.1|  predicted protein                                      140   5e-36    
ref|XP_004167894.1|  PREDICTED: cyclin-U4-1-like                        137   5e-36    
emb|CDX95612.1|  BnaC03g24930D                                          137   5e-36    
ref|XP_004146934.1|  PREDICTED: cyclin-U4-1-like                        137   6e-36    
gb|EMS49132.1|  hypothetical protein TRIUR3_24170                       142   7e-36    
gb|AAM64958.1|  unknown                                                 138   7e-36    
emb|CDP03631.1|  unnamed protein product                                137   8e-36    
dbj|BAJ86315.1|  predicted protein                                      138   9e-36    
ref|XP_007162425.1|  hypothetical protein PHAVU_001G151100g             137   9e-36    
ref|XP_002878497.1|  hypothetical protein ARALYDRAFT_486815             137   1e-35    
ref|XP_010938791.1|  PREDICTED: cyclin-P3-1-like isoform X2             138   1e-35    
ref|XP_004145018.1|  PREDICTED: cyclin-U4-1-like                        137   1e-35    
ref|XP_010684268.1|  PREDICTED: cyclin-P3-1-like                        138   1e-35    
gb|KHF97746.1|  Cyclin-P3-1                                             139   1e-35    
ref|XP_004160682.1|  PREDICTED: cyclin-U4-1-like                        137   1e-35    
ref|XP_011076450.1|  PREDICTED: cyclin-U4-1-like                        137   1e-35    
ref|XP_006382603.1|  hypothetical protein POPTR_0005s03660g             137   1e-35    
ref|NP_191871.1|  cyclin p1;1                                           137   1e-35    
gb|ABK92673.1|  unknown                                                 135   1e-35    
gb|KFK39504.1|  hypothetical protein AALP_AA3G252300                    137   1e-35    
ref|XP_010938790.1|  PREDICTED: cyclin-P3-1-like isoform X1             138   2e-35    
ref|XP_011082555.1|  PREDICTED: cyclin-P3-1                             137   2e-35    
ref|XP_003570865.1|  PREDICTED: cyclin-P4-1-like                        138   2e-35    
ref|XP_002280596.1|  PREDICTED: cyclin-U1-1                             136   3e-35    
ref|XP_011023596.1|  PREDICTED: cyclin-P3-1-like                        135   3e-35    
ref|XP_006576896.1|  PREDICTED: cyclin-P3-1-like isoform X1             136   3e-35    
ref|NP_188825.1|  cyclin p2;1                                           135   4e-35    
ref|XP_003568501.1|  PREDICTED: cyclin-P3-1                             136   5e-35    
ref|XP_010091558.1|  hypothetical protein L484_000801                   135   5e-35    
ref|XP_004487375.1|  PREDICTED: cyclin-U1-1-like                        135   6e-35    
ref|NP_001235448.1|  uncharacterized protein LOC100527137               135   7e-35    
ref|XP_006447491.1|  hypothetical protein CICLE_v10016515mg             135   8e-35    
ref|XP_006368127.1|  PREDICTED: cyclin-P3-1-like                        133   1e-34    
dbj|BAJ91153.1|  predicted protein                                      137   1e-34    
ref|XP_007030852.1|  Cyclin family protein, putative isoform 1          135   1e-34    
gb|EEC79180.1|  hypothetical protein OsI_19875                          135   1e-34    
ref|XP_010510760.1|  PREDICTED: cyclin-U1-1                             134   1e-34    
gb|EEE63644.1|  hypothetical protein OsJ_18461                          135   1e-34    
ref|XP_006654367.1|  PREDICTED: cyclin-P3-1-like                        135   1e-34    
ref|XP_006291814.1|  hypothetical protein CARUB_v10017991mg             134   1e-34    
sp|Q75HV0.1|CCP31_ORYSJ  RecName: Full=Cyclin-P3-1; Short=CycP3;1       135   2e-34    
ref|XP_006375761.1|  hypothetical protein POPTR_0013s02390g             134   2e-34    
gb|AFK44207.1|  unknown                                                 134   2e-34    
ref|XP_006394483.1|  hypothetical protein EUTSA_v10005388mg             134   2e-34    
gb|AFK40008.1|  unknown                                                 134   2e-34    
gb|AFK44566.1|  unknown                                                 134   2e-34    
ref|XP_003540320.1|  PREDICTED: cyclin-U1-1-like                        134   2e-34    
ref|XP_008786194.1|  PREDICTED: cyclin-P4-1                             133   2e-34    
gb|AFK40409.1|  unknown                                                 134   3e-34    
gb|ACU23185.1|  unknown                                                 134   3e-34    
ref|XP_010468884.1|  PREDICTED: cyclin-U3-1                             134   3e-34    
gb|ACJ84821.1|  unknown                                                 134   3e-34    
ref|XP_011026170.1|  PREDICTED: cyclin-P3-1                             134   3e-34    
ref|XP_006279771.1|  hypothetical protein CARUB_v10027784mg             133   4e-34    
ref|XP_010466452.1|  PREDICTED: cyclin-U1-1-like                        133   4e-34    
gb|KEH23760.1|  cyclin p4                                               134   4e-34    
ref|XP_003554251.1|  PREDICTED: cyclin-P3-1-like                        134   5e-34    
ref|XP_010942426.1|  PREDICTED: cyclin-P3-1-like                        133   5e-34    
ref|XP_002885474.1|  CYCP2_1                                            133   5e-34    
ref|XP_006406231.1|  hypothetical protein EUTSA_v10021524mg             132   5e-34    
ref|XP_006662071.1|  PREDICTED: cyclin-P4-1-like                        133   6e-34    
emb|CDX76682.1|  BnaC08g32680D                                          132   7e-34    
ref|XP_009116978.1|  PREDICTED: cyclin-U3-1                             133   7e-34    
ref|XP_007149955.1|  hypothetical protein PHAVU_005G113500g             133   8e-34    
ref|XP_006402307.1|  hypothetical protein EUTSA_v10006204mg             133   8e-34    
ref|XP_004304998.1|  PREDICTED: cyclin-P3-1-like                        132   9e-34    
ref|XP_010413196.1|  PREDICTED: cyclin-U3-1-like                        132   9e-34    
ref|XP_010488211.1|  PREDICTED: cyclin-U1-1-like                        132   1e-33    
emb|CDY38647.1|  BnaA05g19400D                                          132   1e-33    
emb|CDY54190.1|  BnaCnng26370D                                          132   1e-33    
ref|XP_009145444.1|  PREDICTED: cyclin-U1-1                             131   2e-33    
gb|KDP23522.1|  hypothetical protein JCGZ_23355                         131   3e-33    
ref|XP_008669070.1|  PREDICTED: cyclin-P4-1-like                        130   4e-33    
ref|XP_007147054.1|  hypothetical protein PHAVU_006G092300g             129   4e-33    
ref|XP_010109538.1|  hypothetical protein L484_018273                   131   4e-33    
ref|XP_011084761.1|  PREDICTED: cyclin-U4-1-like isoform X1             130   5e-33    
ref|XP_003597030.1|  Cyclin-U1-1                                        130   5e-33    
ref|XP_004962162.1|  PREDICTED: cyclin-P3-1-like                        130   5e-33    
ref|XP_007043344.1|  Cyclin p2,1 isoform 1                              130   7e-33    
emb|CDP15519.1|  unnamed protein product                                130   7e-33    
emb|CDP05394.1|  unnamed protein product                                129   7e-33    
ref|XP_010483846.1|  PREDICTED: cyclin-U4-3-like                        130   9e-33    
ref|XP_003553729.1|  PREDICTED: cyclin-P3-1-like                        129   9e-33    
ref|XP_010443988.1|  PREDICTED: cyclin-U4-3-like                        130   9e-33    
emb|CBI36766.3|  unnamed protein product                                128   1e-32    
ref|XP_008460076.1|  PREDICTED: cyclin-U4-1-like                        132   1e-32    
gb|ABX10779.1|  putative cyclin-dependent protein kinase                128   2e-32    
ref|XP_006298586.1|  hypothetical protein CARUB_v10014669mg             128   2e-32    
ref|XP_008812796.1|  PREDICTED: cyclin-P3-1-like                        129   2e-32    
ref|XP_002280845.2|  PREDICTED: cyclin-P3-1                             129   3e-32    
ref|XP_010546693.1|  PREDICTED: cyclin-P3-1                             128   3e-32    
gb|KHN36553.1|  Cyclin-U1-1                                             127   6e-32    
emb|CDY08862.1|  BnaA06g23620D                                          127   9e-32    
ref|XP_010043088.1|  PREDICTED: cyclin-P3-1-like isoform X2             127   1e-31    
gb|ACG36976.1|  PREG-like protein                                       127   1e-31    
ref|XP_011079017.1|  PREDICTED: cyclin-U1-1                             127   1e-31    
ref|NP_001149845.1|  LOC100283473                                       127   1e-31    
ref|XP_010666788.1|  PREDICTED: cyclin-U1-1                             126   2e-31    
ref|XP_010043087.1|  PREDICTED: cyclin-P3-1-like isoform X1             127   2e-31    
gb|KHG13275.1|  Cyclin-U1-1 -like protein                               126   3e-31    
ref|XP_010546128.1|  PREDICTED: cyclin-U4-3-like                        124   7e-31    
ref|XP_002441059.1|  hypothetical protein SORBIDRAFT_09g019600          125   7e-31    
gb|KDO56332.1|  hypothetical protein CISIN_1g045984mg                   122   8e-31    
ref|XP_010240959.1|  PREDICTED: cyclin-U1-1                             124   1e-30    
ref|XP_009136505.1|  PREDICTED: LOW QUALITY PROTEIN: cyclin-U4-3        123   2e-30    
ref|XP_010512719.1|  PREDICTED: cyclin-U3-1-like                        123   2e-30    
ref|XP_002448263.1|  hypothetical protein SORBIDRAFT_06g024180          123   3e-30    
gb|KDO39778.1|  hypothetical protein CISIN_1g039330mg                   122   8e-30    
gb|EMT32586.1|  hypothetical protein F775_21459                         121   8e-30    
ref|XP_010485974.1|  PREDICTED: cyclin-P3-1-like isoform X2             121   1e-29    
ref|XP_010464054.1|  PREDICTED: cyclin-P3-1-like                        121   2e-29    
emb|CDY18769.1|  BnaAnng02340D                                          120   2e-29    
gb|EMT12283.1|  hypothetical protein F775_15957                         120   5e-29    
ref|XP_004952051.1|  PREDICTED: cyclin-P4-1-like                        121   5e-29    
gb|EPS61803.1|  hypothetical protein M569_12990                         117   9e-29    
ref|XP_009124077.1|  PREDICTED: cyclin-P3-1-like isoform X2             119   1e-28    
ref|XP_008379611.1|  PREDICTED: cyclin-U1-1                             119   1e-28    
emb|CDY27777.1|  BnaA05g31860D                                          118   2e-28    
ref|NP_001053459.1|  Os04g0544200                                       118   2e-28    
ref|XP_009147251.1|  PREDICTED: cyclin-P3-1-like                        118   2e-28    
ref|XP_009124076.1|  PREDICTED: cyclin-P3-1-like isoform X1             118   2e-28    
dbj|BAK01932.1|  predicted protein                                      117   2e-28    
emb|CDY18791.1|  BnaAnng02560D                                          118   3e-28    
ref|XP_006408089.1|  hypothetical protein EUTSA_v10021509mg             117   5e-28    
gb|ACG23927.1|  nuc-1 negative regulatory protein preg                  117   5e-28    
gb|EMS63928.1|  hypothetical protein TRIUR3_31342                       119   6e-28    
ref|XP_009353246.1|  PREDICTED: cyclin-U1-1                             117   6e-28    
ref|XP_010312651.1|  PREDICTED: cyclin-P3-1 isoform X2                  115   6e-28    
ref|XP_002884502.1|  hypothetical protein ARALYDRAFT_477821             116   9e-28    
ref|XP_009601525.1|  PREDICTED: cyclin-U1-1                             116   1e-27    
gb|AFW69940.1|  nuc-1 negative regulatory protein preg                  116   1e-27    
ref|XP_009782196.1|  PREDICTED: cyclin-U1-1                             116   2e-27    
ref|XP_004243454.1|  PREDICTED: cyclin-U1-1                             116   2e-27    
emb|CDP11817.1|  unnamed protein product                                116   2e-27    
gb|KFK37958.1|  hypothetical protein AALP_AA3G051800                    115   3e-27    
dbj|BAD08008.1|  PREG-like protein                                      116   3e-27    
ref|XP_005831237.1|  hypothetical protein GUITHDRAFT_43885              112   3e-27    
ref|XP_642680.1|  cyclin-related 2 family protein                       120   4e-27    
ref|XP_010906680.1|  PREDICTED: cyclin-U1-1                             115   5e-27    
ref|XP_004956426.1|  PREDICTED: cyclin-P4-1-like                        114   9e-27    
dbj|BAJ89972.1|  predicted protein                                      113   1e-26    
ref|XP_010485972.1|  PREDICTED: cyclin-P3-1-like isoform X1             113   1e-26    
ref|XP_003569998.1|  PREDICTED: cyclin-P4-1-like                        113   2e-26    
ref|NP_001030642.1|  cyclin family protein                              112   3e-26    
gb|EEC78069.1|  hypothetical protein OsI_17535                          112   6e-26    
sp|Q0J9W0.2|CCP11_ORYSJ  RecName: Full=Cyclin-P1-1; Short=CycP1;1       112   8e-26    
ref|XP_002186459.1|  predicted protein                                  109   1e-25    
emb|CDH53319.1|  cyclin-domain-containing protein                       112   1e-25    
ref|XP_003293250.1|  hypothetical protein DICPUDRAFT_99601              115   1e-25    
ref|XP_007043345.1|  Cyclin p2,1 isoform 2                              111   2e-25    
ref|XP_006653792.1|  PREDICTED: cyclin-P1-1-like                        111   3e-25    
ref|XP_006298431.1|  hypothetical protein CARUB_v10014501mg             109   7e-25    
emb|CDS12150.1|  hypothetical protein LRAMOSA04345                      109   1e-24    
ref|XP_004037104.1|  hypothetical protein IMG5_061170                   107   1e-24    
ref|XP_004953300.1|  PREDICTED: cyclin-P4-1-like                        107   2e-24    
ref|XP_006648892.1|  PREDICTED: cyclin-P4-1-like                        106   2e-24    
ref|XP_002452825.1|  hypothetical protein SORBIDRAFT_04g033250          107   2e-24    
gb|EFW47511.2|  cyclin                                                  112   4e-24    
ref|XP_004346122.1|  cyclin                                             112   4e-24    
ref|XP_743964.1|  cyclin2 related protein                               106   5e-24    
ref|XP_008623573.1|  hypothetical protein YYE_01673                     106   5e-24    
ref|XP_003580261.1|  PREDICTED: cyclin-P4-1-like                        106   5e-24    
gb|EUD72343.1|  hypothetical protein YYG_02244                          106   6e-24    
emb|CDO63062.1|  cyclin                                                 106   8e-24    
gb|AFW72776.1|  hypothetical protein ZEAMMB73_097402                    105   9e-24    
ref|XP_730602.1|  cyclin                                                105   9e-24    
ref|XP_001351741.1|  cyclin                                             105   1e-23    
emb|CDS49555.1|  cyclin, putative                                       105   2e-23    
ref|XP_009385065.1|  PREDICTED: cyclin-U1-1                             105   3e-23    
ref|XP_009039561.1|  hypothetical protein AURANDRAFT_54525              103   3e-23    
gb|KFG29715.1|  cyclin2 related protein                                 108   4e-23    
ref|XP_008887683.1|  cyclin2 related protein                            108   5e-23    
gb|ESS33416.1|  cyclin2 related protein                                 108   5e-23    
ref|XP_002368826.1|  cyclin, N-terminal domain-containing protein       108   5e-23    
gb|EPR57281.1|  cyclin2 related protein                                 108   5e-23    
ref|XP_003880818.1|  hypothetical protein NCLIV_038600                  108   6e-23    
ref|XP_004976902.1|  PREDICTED: cyclin-P1-1-like                        103   9e-23    
ref|NP_001047597.1|  Os02g0652000                                       102   1e-22    
emb|CAC39033.1|  PREG-like protein                                      102   1e-22    
ref|XP_002447148.1|  hypothetical protein SORBIDRAFT_06g029420          104   1e-22    
ref|XP_002259631.1|  cyclin2 related protein                            103   1e-22    
dbj|BAJ89048.1|  predicted protein                                      103   1e-22    
emb|CBN76823.1|  conserved unknown protein                              102   1e-22    
gb|EJK44168.1|  hypothetical protein THAOC_37318                        105   1e-22    
gb|KFH13723.1|  cyclin2 related protein                                 103   1e-22    
emb|CDY05158.1|  BnaC05g46450D                                          103   2e-22    
ref|XP_005819531.1|  hypothetical protein GUITHDRAFT_82190              103   2e-22    
ref|XP_004359059.1|  cyclin-related 2 family protein                    106   2e-22    
ref|XP_008875754.1|  hypothetical protein H310_11003                    102   3e-22    
emb|CAJ86211.1|  H0323C08.1                                             102   3e-22    
ref|XP_004027597.1|  hypothetical protein IMG5_180520                   100   4e-22    
ref|XP_001613773.1|  cyclin2 related protein                            101   4e-22    
ref|XP_004037383.1|  n-terminal domain protein                          100   4e-22    
ref|XP_009829187.1|  hypothetical protein H257_05876                    102   5e-22    
ref|XP_008815154.1|  hypothetical protein C922_01326                    101   5e-22    
ref|XP_010425982.1|  PREDICTED: cyclin-P3-1                           99.0    5e-22    
emb|CCI49379.1|  unnamed protein product                                101   6e-22    
gb|EEC72391.1|  hypothetical protein OsI_05672                          100   1e-21    
gb|EPB85030.1|  hypothetical protein HMPREF1544_08234                 99.8    1e-21    
emb|CEG63804.1|  Putative Cyclin-domain-containing protein              100   2e-21    
ref|XP_679099.1|  cyclin2 related protein                             97.8    2e-21    
emb|CDS05231.1|  hypothetical protein LRAMOSA07760                      100   2e-21    
gb|AAF27039.1|AC009177_29  hypothetical protein                         103   2e-21    



>ref|XP_009782728.1| PREDICTED: cyclin-U2-2-like [Nicotiana sylvestris]
Length=225

 Score =   342 bits (878),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 163/212 (77%), Positives = 186/212 (88%), Gaps = 1/212 (0%)
 Frame = -1

Query  768  LRDDLYLYAYQEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEA  589
            LRDDLY Y+YQ+ S+ PLVISVLASLI R + RNQRIA+N   A+  NV  T+VF+C+E 
Sbjct  15   LRDDLYFYSYQQDSNIPLVISVLASLIERNLARNQRIAKNCTWALSKNV-RTRVFDCHET  73

Query  588  PDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASK  409
            PDMTI+SYLER+FRYT AGPSVYVVAYVY+DRFCQL+P+FRI P NVHRLLITTIMVASK
Sbjct  74   PDMTIQSYLERIFRYTRAGPSVYVVAYVYIDRFCQLYPEFRISPRNVHRLLITTIMVASK  133

Query  408  YVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGG  229
            YVEDMNYRNSYFARVGGLTT EMNKLE+EFLF+M FK HVNVSVF SYCCHLEREV IGG
Sbjct  134  YVEDMNYRNSYFARVGGLTTNEMNKLEMEFLFMMGFKFHVNVSVFESYCCHLEREVSIGG  193

Query  228  GYQIERTLRCAQDIKSKQREDTTFTQVTSLLL  133
            GY+IERTLRCA++IKSKQRE+   +Q+T +LL
Sbjct  194  GYEIERTLRCAEEIKSKQREERRCSQITRVLL  225



>ref|XP_009604946.1| PREDICTED: cyclin-U2-2-like [Nicotiana tomentosiformis]
Length=225

 Score =   342 bits (878),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 162/212 (76%), Positives = 186/212 (88%), Gaps = 1/212 (0%)
 Frame = -1

Query  768  LRDDLYLYAYQEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEA  589
            LRDDLY Y+YQ+ S+ PLVISVLASLI R + RNQRIA+N   A+  N+  T+VF+C+E 
Sbjct  15   LRDDLYFYSYQQDSNIPLVISVLASLIERNLARNQRIAKNCTWALSKNI-RTRVFDCHET  73

Query  588  PDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASK  409
            PDMTI+SYLER+FRYT AGPSVYVVAYVY+DRFCQL+P+FRI P NVHRLLITTIMVASK
Sbjct  74   PDMTIQSYLERIFRYTRAGPSVYVVAYVYIDRFCQLYPEFRINPRNVHRLLITTIMVASK  133

Query  408  YVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGG  229
            YVEDMNYRNSYFARVGGLTT EMNKLE+EFLF+M FK HVNVSVF SYCCHLEREV IGG
Sbjct  134  YVEDMNYRNSYFARVGGLTTNEMNKLEMEFLFMMGFKFHVNVSVFESYCCHLEREVSIGG  193

Query  228  GYQIERTLRCAQDIKSKQREDTTFTQVTSLLL  133
            GY+IERTLRCA++IKSKQRE+   +Q+T +LL
Sbjct  194  GYEIERTLRCAEEIKSKQREERRCSQITRVLL  225



>ref|XP_004229782.1| PREDICTED: cyclin-U2-1-like [Solanum lycopersicum]
Length=220

 Score =   330 bits (846),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 159/213 (75%), Positives = 185/213 (87%), Gaps = 2/213 (1%)
 Frame = -1

Query  768  LRDDLYLYAYQEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEA  589
            LRDDLY Y+Y++ S+ PLVISVLASLI R + RN+RIA+N   A+  NV  T+VF+C+E 
Sbjct  9    LRDDLYCYSYEQDSNIPLVISVLASLIERNLARNERIAKNCTWALSKNV-RTRVFDCHET  67

Query  588  PDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASK  409
            PDMTI+SYLER+FRYT AGPSVYVVAYVY+DRFCQL+P FRI P NVHRLLITTIMVASK
Sbjct  68   PDMTIQSYLERIFRYTRAGPSVYVVAYVYIDRFCQLYPHFRISPRNVHRLLITTIMVASK  127

Query  408  YVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGG  229
            YVEDMNYRNSYFARVGGLTT EMNKLE+EF+F+M FK HVNVSVF SYCCHLEREV IGG
Sbjct  128  YVEDMNYRNSYFARVGGLTTNEMNKLEMEFVFMMGFKFHVNVSVFESYCCHLEREVSIGG  187

Query  228  GYQIERTLRCAQDIKSKQRED-TTFTQVTSLLL  133
            GY+IERTLRCA++IKSKQ E+ +  +Q+T +LL
Sbjct  188  GYEIERTLRCAEEIKSKQIEERSCCSQITRVLL  220



>ref|XP_006347912.1| PREDICTED: cyclin-U2-2-like [Solanum tuberosum]
Length=220

 Score =   330 bits (845),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 161/213 (76%), Positives = 185/213 (87%), Gaps = 2/213 (1%)
 Frame = -1

Query  768  LRDDLYLYAYQEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEA  589
            LRDDLY Y+YQ+ SS PLVISVLASLI R + RN+RIA+N   A+  NV  T+VF+C+E 
Sbjct  9    LRDDLYCYSYQQDSSLPLVISVLASLIERNLARNERIAKNCTWALSKNV-RTRVFDCHET  67

Query  588  PDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASK  409
            PDMTI+SYLER+FRYT AGPSVYVVAYVY+DRFCQL+P+FRI P NVHRLLITTIMVASK
Sbjct  68   PDMTIQSYLERIFRYTRAGPSVYVVAYVYIDRFCQLYPEFRISPRNVHRLLITTIMVASK  127

Query  408  YVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGG  229
            YVEDMNYRNSYFARVGGLTT EMNKLE+EFLF+M FK HVNVSVF SYC HLEREV IGG
Sbjct  128  YVEDMNYRNSYFARVGGLTTNEMNKLEMEFLFMMGFKFHVNVSVFESYCRHLEREVSIGG  187

Query  228  GYQIERTLRCAQDIKSKQRED-TTFTQVTSLLL  133
            GY+IERTLRCA++IKSKQ E+ +  +Q+T +LL
Sbjct  188  GYEIERTLRCAEEIKSKQIEERSCCSQITRVLL  220



>ref|XP_011090176.1| PREDICTED: cyclin-U2-1-like [Sesamum indicum]
Length=220

 Score =   328 bits (842),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 160/214 (75%), Positives = 183/214 (86%), Gaps = 4/214 (2%)
 Frame = -1

Query  768  LRDDLYLYAYQEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEA  589
            LR DLY Y+YQE S+TPLVISVLASLI RT+ RN+RIA+ +  +    V  T+VF+CNE 
Sbjct  9    LRYDLYSYSYQENSNTPLVISVLASLIERTMARNERIAKKY--SKWTGVSKTRVFDCNET  66

Query  588  PDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASK  409
            PDMTI+SYLER+FRYT AGPSVYVVAYVY+DRFCQ +P+FRIG  NVHRLLITTIMVASK
Sbjct  67   PDMTIQSYLERIFRYTRAGPSVYVVAYVYIDRFCQFYPEFRIGARNVHRLLITTIMVASK  126

Query  408  YVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGG  229
            YVEDMNYRNSYFARVGGLTT E+NKLEVEFLFLM+FKLHVNVSV+ SYCCHLEREV IGG
Sbjct  127  YVEDMNYRNSYFARVGGLTTNELNKLEVEFLFLMKFKLHVNVSVYESYCCHLEREVSIGG  186

Query  228  GYQIERTLRCAQDIKSKQ--REDTTFTQVTSLLL  133
            GYQIERTLRCA++IK++Q  +E     Q+  LLL
Sbjct  187  GYQIERTLRCAEEIKTRQTVQERRYDDQIARLLL  220



>emb|CDP09478.1| unnamed protein product [Coffea canephora]
Length=227

 Score =   325 bits (834),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 156/217 (72%), Positives = 185/217 (85%), Gaps = 8/217 (4%)
 Frame = -1

Query  768  LRDDLYLYAYQEQSSTPLVISVLASLIGRTVTRNQRIARNFRG-----AMDINVGSTKVF  604
            LR+DLY ++YQE S+ PLVISVL+SLI RT+ RN+RIA+         + D+    T+VF
Sbjct  14   LRNDLYSHSYQEDSNIPLVISVLSSLIERTLARNERIAKKCTWTSTTLSKDVR---TRVF  70

Query  603  ECNEAPDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTI  424
            +C+E+PDMTI+SYLER+FRYT AGPSVYVVAYVY+DRFCQL+ +FRI P NVHRLLITTI
Sbjct  71   DCHESPDMTIQSYLERIFRYTRAGPSVYVVAYVYIDRFCQLYSEFRISPRNVHRLLITTI  130

Query  423  MVASKYVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLERE  244
            +VASKYVEDMNYRNSYFARVGGLTT E+NKLE+EFLFLM FKLHVNVSVF SYCCHLERE
Sbjct  131  LVASKYVEDMNYRNSYFARVGGLTTKEINKLELEFLFLMGFKLHVNVSVFESYCCHLERE  190

Query  243  VGIGGGYQIERTLRCAQDIKSKQREDTTFTQVTSLLL  133
            V IGGGYQIERT+RCA++IKSKQRE   ++Q+  +LL
Sbjct  191  VSIGGGYQIERTIRCAEEIKSKQREQRGYSQIARVLL  227



>ref|XP_007052178.1| Cyclin p3,2 [Theobroma cacao]
 gb|EOX96335.1| Cyclin p3,2 [Theobroma cacao]
Length=224

 Score =   325 bits (832),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 154/212 (73%), Positives = 181/212 (85%), Gaps = 1/212 (0%)
 Frame = -1

Query  768  LRDDLYLYAYQEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEA  589
            LR DLY Y+YQ  ++TPLVISVLASLI RT+TRN+RIA+N + ++  +  S +VF+C+E 
Sbjct  14   LRSDLYCYSYQNDANTPLVISVLASLIERTMTRNERIAKNCKWSLTKDYRS-RVFDCHET  72

Query  588  PDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASK  409
            PDMTI+SYLER+FRYT AGPSVYVVAYVY+DRFCQ +P FRI   NVHRLLITTIMVASK
Sbjct  73   PDMTIQSYLERIFRYTKAGPSVYVVAYVYIDRFCQANPGFRINARNVHRLLITTIMVASK  132

Query  408  YVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGG  229
            YVEDMNYRNSYFARVGGLTT E+N LE+EFLFLM FKLHVNVSVF SYCCHLEREV IGG
Sbjct  133  YVEDMNYRNSYFARVGGLTTNELNNLELEFLFLMGFKLHVNVSVFESYCCHLEREVSIGG  192

Query  228  GYQIERTLRCAQDIKSKQREDTTFTQVTSLLL  133
            GY IERTLRCA++IKS+Q E+  + Q+  ++L
Sbjct  193  GYHIERTLRCAEEIKSRQNEERRYNQIARIML  224



>ref|XP_002301262.1| hypothetical protein POPTR_0002s14440g [Populus trichocarpa]
 ref|XP_006386562.1| cyclin family protein [Populus trichocarpa]
 gb|EEE80535.1| hypothetical protein POPTR_0002s14440g [Populus trichocarpa]
 gb|ERP64359.1| cyclin family protein [Populus trichocarpa]
Length=223

 Score =   323 bits (829),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 154/212 (73%), Positives = 181/212 (85%), Gaps = 1/212 (0%)
 Frame = -1

Query  768  LRDDLYLYAYQEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEA  589
            LR DLY Y+YQ  S+TPLVISVLASLI RT+ RN+RI +N   A+  ++  T+VF+C+E 
Sbjct  13   LRSDLYSYSYQNDSNTPLVISVLASLIERTMARNERIVKNCTWALSKDI-RTRVFDCHET  71

Query  588  PDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASK  409
            PD+TI+SYLERVFRYT AGPSVYVVAYVY+DRFCQ +P FRI   NVHRLLITTIMVASK
Sbjct  72   PDLTIQSYLERVFRYTRAGPSVYVVAYVYIDRFCQANPGFRINSRNVHRLLITTIMVASK  131

Query  408  YVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGG  229
            YVEDMNYRNSYFARVGGLTT E+NKLE+EF+FLM FKLHVNVSVF SYCCHLEREVGIGG
Sbjct  132  YVEDMNYRNSYFARVGGLTTNELNKLELEFVFLMGFKLHVNVSVFESYCCHLEREVGIGG  191

Query  228  GYQIERTLRCAQDIKSKQREDTTFTQVTSLLL  133
            GY IE+TLRCA++IKS Q+E+  + Q+  ++L
Sbjct  192  GYHIEKTLRCAEEIKSGQQEEKRYNQIARIML  223



>ref|XP_011017452.1| PREDICTED: cyclin-U2-1-like [Populus euphratica]
Length=223

 Score =   323 bits (828),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 152/212 (72%), Positives = 181/212 (85%), Gaps = 1/212 (0%)
 Frame = -1

Query  768  LRDDLYLYAYQEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEA  589
            LR DLY Y+YQ  S+TPLVISVLASLI RT+ RN+RI +N + A+  ++  T+VF+C+E 
Sbjct  13   LRSDLYSYSYQNDSNTPLVISVLASLIERTMARNERIVKNCKWALSKDI-RTRVFDCHET  71

Query  588  PDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASK  409
            PD+TI+SYLER+FRYT AGPSVYVVAYVY+DRFCQ +P FRI   NVHRLL+TTIMVASK
Sbjct  72   PDLTIQSYLERIFRYTRAGPSVYVVAYVYIDRFCQANPGFRINSRNVHRLLVTTIMVASK  131

Query  408  YVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGG  229
            YVEDMNYRNSYFARVGGLTT E+N LE+EF+FLM FKLHVNVSVF SYCCHLEREVGIGG
Sbjct  132  YVEDMNYRNSYFARVGGLTTNELNNLELEFVFLMGFKLHVNVSVFESYCCHLEREVGIGG  191

Query  228  GYQIERTLRCAQDIKSKQREDTTFTQVTSLLL  133
            GY IERTLRCA++IKS Q+E+  + Q+  ++L
Sbjct  192  GYHIERTLRCAEEIKSGQQEEKRYNQIARIML  223



>ref|XP_002320709.1| hypothetical protein POPTR_0014s06180g [Populus trichocarpa]
 gb|EEE99024.1| hypothetical protein POPTR_0014s06180g [Populus trichocarpa]
Length=223

 Score =   322 bits (824),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 151/212 (71%), Positives = 180/212 (85%), Gaps = 1/212 (0%)
 Frame = -1

Query  768  LRDDLYLYAYQEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEA  589
            LR DLY Y+YQ  S+TPLVI+VLASLI RT+ RN+RI +N   A+  +   T+VF+C+E 
Sbjct  13   LRSDLYSYSYQNDSNTPLVIAVLASLIERTMARNERIVKNCTWALSKDT-RTRVFDCHET  71

Query  588  PDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASK  409
            PD+TI+SYLER+FRYT AGPSVYVVAYVY+DRFCQ +P+FRI   NVHRLLITTIMVASK
Sbjct  72   PDLTIQSYLERIFRYTRAGPSVYVVAYVYIDRFCQANPEFRINARNVHRLLITTIMVASK  131

Query  408  YVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGG  229
            YVEDMNYRNSYFARVGGLT   MNK+E+EFLFLM FKLHVNVSVF SYCCHLEREVGIGG
Sbjct  132  YVEDMNYRNSYFARVGGLTANVMNKMELEFLFLMGFKLHVNVSVFESYCCHLEREVGIGG  191

Query  228  GYQIERTLRCAQDIKSKQREDTTFTQVTSLLL  133
            GY IE+TLRCA++IKS+Q+E+  + Q+  ++L
Sbjct  192  GYHIEKTLRCAEEIKSRQQEEKGYNQIARIML  223



>ref|XP_007221195.1| hypothetical protein PRUPE_ppa024897mg [Prunus persica]
 gb|EMJ22394.1| hypothetical protein PRUPE_ppa024897mg [Prunus persica]
Length=230

 Score =   322 bits (824),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 154/214 (72%), Positives = 180/214 (84%), Gaps = 2/214 (1%)
 Frame = -1

Query  768  LRDDLYLYAYQEQSSTPLVISVLASLIGRTVTRNQRIARNFRGA--MDINVGSTKVFECN  595
            LR DLY Y+YQE S+TPLV++VLASLI R++ RNQRIA++      M  ++  T++FEC+
Sbjct  17   LRSDLYSYSYQEDSTTPLVVNVLASLIERSMARNQRIAKSCSSPWYMSKDMKKTRIFECH  76

Query  594  EAPDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVA  415
            E PDMTI+SYLER+FRYT AGPSVYVVAYVY+DRFCQ +P F+I  TNVHRLLITTIMVA
Sbjct  77   ETPDMTIQSYLERIFRYTRAGPSVYVVAYVYIDRFCQNNPGFKINVTNVHRLLITTIMVA  136

Query  414  SKYVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGI  235
            SKYVEDMNYRNSYFARVGGLTT E+NKLE+EFLFLM FKLHVNVSVF SYCCHLEREV I
Sbjct  137  SKYVEDMNYRNSYFARVGGLTTNELNKLELEFLFLMGFKLHVNVSVFESYCCHLEREVSI  196

Query  234  GGGYQIERTLRCAQDIKSKQREDTTFTQVTSLLL  133
            GGGY IE TLRCA++IK++Q E+  + Q   LLL
Sbjct  197  GGGYHIESTLRCAEEIKTRQNEERRYNQFAGLLL  230



>ref|XP_008232567.1| PREDICTED: cyclin-U2-1 [Prunus mume]
Length=230

 Score =   322 bits (824),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 154/214 (72%), Positives = 180/214 (84%), Gaps = 2/214 (1%)
 Frame = -1

Query  768  LRDDLYLYAYQEQSSTPLVISVLASLIGRTVTRNQRIARNFRGA--MDINVGSTKVFECN  595
            LR DLY Y+YQE S+TPLV++VLASLI R++ RNQRIA++      M  ++  T++FEC+
Sbjct  17   LRSDLYSYSYQEDSTTPLVVNVLASLIERSMARNQRIAKSCSSPWYMSKDMKKTRIFECH  76

Query  594  EAPDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVA  415
            E PDMTI+SYLER+FRYT AGPSVYVVAYVY+DRFCQ +P F+I  TNVHRLLITTIMVA
Sbjct  77   ETPDMTIQSYLERIFRYTRAGPSVYVVAYVYIDRFCQNNPGFKINVTNVHRLLITTIMVA  136

Query  414  SKYVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGI  235
            SKYVEDMNYRNSYFARVGGLTT E+NKLE+EFLFLM FKLHVNVSVF SYCCHLEREV I
Sbjct  137  SKYVEDMNYRNSYFARVGGLTTNELNKLELEFLFLMGFKLHVNVSVFESYCCHLEREVSI  196

Query  234  GGGYQIERTLRCAQDIKSKQREDTTFTQVTSLLL  133
            GGGY IE TLRCA++IK++Q E+  + Q   LLL
Sbjct  197  GGGYHIESTLRCAEEIKNRQNEERRYNQFAGLLL  230



>ref|XP_011033883.1| PREDICTED: cyclin-U2-2-like [Populus euphratica]
Length=223

 Score =   320 bits (821),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 151/212 (71%), Positives = 179/212 (84%), Gaps = 1/212 (0%)
 Frame = -1

Query  768  LRDDLYLYAYQEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEA  589
            LR DLY Y+YQ  S+TPLVI+VLASLI RT+ RN+RI +N   A+  +   T+VF+C+E 
Sbjct  13   LRSDLYSYSYQNDSNTPLVIAVLASLIERTMARNERIVKNCSWALSKDT-RTRVFDCHET  71

Query  588  PDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASK  409
            PD+TI+SYLER+FRYT AGPSVYVVAYVY+DRFCQ +P+FRI   NVHRLLITTIMVASK
Sbjct  72   PDLTIQSYLERIFRYTRAGPSVYVVAYVYIDRFCQANPEFRIDARNVHRLLITTIMVASK  131

Query  408  YVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGG  229
            YVEDMNYRNSYFARVGGLT   MNKLE+EFLFLM FKLHVNVSVF SYCCHLEREV IGG
Sbjct  132  YVEDMNYRNSYFARVGGLTANVMNKLELEFLFLMGFKLHVNVSVFESYCCHLEREVSIGG  191

Query  228  GYQIERTLRCAQDIKSKQREDTTFTQVTSLLL  133
            GY IE+TLRCA++IKS+Q+E+  + Q+  ++L
Sbjct  192  GYHIEKTLRCAEEIKSRQQEEKRYNQIARIML  223



>ref|XP_004306960.1| PREDICTED: cyclin-U2-1-like [Fragaria vesca subsp. vesca]
Length=227

 Score =   320 bits (821),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 154/214 (72%), Positives = 177/214 (83%), Gaps = 2/214 (1%)
 Frame = -1

Query  768  LRDDLYLYAYQEQSSTPLVISVLASLIGRTVTRNQRIARNFRGA--MDINVGSTKVFECN  595
             R DLY Y YQ  S+TPLV++VLASLI R + RNQRI++N      +  ++  T++FEC+
Sbjct  14   FRSDLYSYPYQADSNTPLVVNVLASLIERNMARNQRISKNCSSPWYLSKDMKKTRIFECH  73

Query  594  EAPDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVA  415
            E PDMTI+SYLER+FRYT AGPSVYVVAYVY+DRFCQ +P FRI  TNVHRLLITTIMVA
Sbjct  74   ETPDMTIQSYLERIFRYTRAGPSVYVVAYVYIDRFCQNNPGFRINVTNVHRLLITTIMVA  133

Query  414  SKYVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGI  235
            SKYVEDMNYRNSYFARVGGLTT E+NKLE+EFLFLM FKLHVNVSVF SYCCHLEREV I
Sbjct  134  SKYVEDMNYRNSYFARVGGLTTNELNKLELEFLFLMGFKLHVNVSVFESYCCHLEREVSI  193

Query  234  GGGYQIERTLRCAQDIKSKQREDTTFTQVTSLLL  133
            GGGYQIE TLRCA++IK++Q ED  + Q   LLL
Sbjct  194  GGGYQIESTLRCAEEIKTRQDEDRRYNQCAGLLL  227



>ref|XP_009344074.1| PREDICTED: cyclin-U2-1-like isoform X1 [Pyrus x bretschneideri]
Length=230

 Score =   320 bits (820),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 153/214 (71%), Positives = 177/214 (83%), Gaps = 2/214 (1%)
 Frame = -1

Query  768  LRDDLYLYAYQEQSSTPLVISVLASLIGRTVTRNQRIARNFRGA--MDINVGSTKVFECN  595
            LR DLY Y+YQ+ S TPLV++VLASLI R + RNQRIA+N      M  ++  T++FEC+
Sbjct  17   LRSDLYSYSYQDDSETPLVVNVLASLIERNMARNQRIAKNCSSPWYMSKDMKKTRIFECH  76

Query  594  EAPDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVA  415
            E PD+TI+SYLER+FRYT AGPSVYVVAYVY+DRFCQ +P FRI  TNVHRLLITTIMVA
Sbjct  77   ETPDLTIQSYLERIFRYTRAGPSVYVVAYVYIDRFCQNNPAFRINVTNVHRLLITTIMVA  136

Query  414  SKYVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGI  235
            SKYVEDMNYRNSYFARVGGLTT E+NKLE+EFLFLM FKLHVNVSVF SYCCHLEREV I
Sbjct  137  SKYVEDMNYRNSYFARVGGLTTNELNKLELEFLFLMGFKLHVNVSVFESYCCHLEREVSI  196

Query  234  GGGYQIERTLRCAQDIKSKQREDTTFTQVTSLLL  133
            GGGY IE TLRCA++IK +Q E+  + Q   +LL
Sbjct  197  GGGYHIESTLRCAEEIKRRQNEERRYNQFAGVLL  230



>ref|XP_006445331.1| hypothetical protein CICLE_v10024289mg [Citrus clementina]
 ref|XP_006491451.1| PREDICTED: cyclin-U2-2-like [Citrus sinensis]
 gb|ESR58571.1| hypothetical protein CICLE_v10024289mg [Citrus clementina]
 gb|KDO85693.1| hypothetical protein CISIN_1g041949mg [Citrus sinensis]
Length=225

 Score =   320 bits (819),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 153/212 (72%), Positives = 178/212 (84%), Gaps = 1/212 (0%)
 Frame = -1

Query  768  LRDDLYLYAYQEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEA  589
            LR D+Y Y+Y+  S+TPLVISVLASLI RT+ RN+RIARN R A+  +   ++VF+ +E 
Sbjct  15   LRSDVYSYSYENDSNTPLVISVLASLIERTMARNERIARNCRRALSKD-SRSRVFDSHEI  73

Query  588  PDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASK  409
            PDMTI+SYLER+FRYT AGPSVYVVAYVY+DRFCQ +P FRI  TNVHRLLITTIMVASK
Sbjct  74   PDMTIQSYLERIFRYTKAGPSVYVVAYVYIDRFCQANPGFRIHATNVHRLLITTIMVASK  133

Query  408  YVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGG  229
            YVED+NYRNSYFARVGGL T E+NKLE++FLFLM FK+HVNVSVF SYCCHLEREV IGG
Sbjct  134  YVEDLNYRNSYFARVGGLETNELNKLELDFLFLMGFKMHVNVSVFESYCCHLEREVSIGG  193

Query  228  GYQIERTLRCAQDIKSKQREDTTFTQVTSLLL  133
            GY IERTLRCA++IKS+Q ED  F  +  L L
Sbjct  194  GYHIERTLRCAEEIKSRQTEDRIFNHIARLTL  225



>ref|XP_010544609.1| PREDICTED: cyclin-U2-1-like [Tarenaya hassleriana]
Length=224

 Score =   318 bits (814),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 152/198 (77%), Positives = 171/198 (86%), Gaps = 2/198 (1%)
 Frame = -1

Query  768  LRDDLYLYAYQEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEA  589
            LR DLY Y+YQ+ S  PLVISVL+SLI RT+ RN+RIAR+ R    I  G T+VF+C E 
Sbjct  14   LRSDLYSYSYQDDSDMPLVISVLSSLIERTLARNERIARSCRWPSRI--GKTRVFDCREV  71

Query  588  PDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASK  409
            PDMTI+SYLER+FRYT AGPSVYVVAYVY+DRFCQ +P FRI PTNVHRLLITTIMVASK
Sbjct  72   PDMTIQSYLERIFRYTKAGPSVYVVAYVYIDRFCQTNPGFRISPTNVHRLLITTIMVASK  131

Query  408  YVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGG  229
            YVEDMNYRNSY+A+VGGL T +MN+LEVEFLFLM FKLHVNVSVF SYCCHLEREV IGG
Sbjct  132  YVEDMNYRNSYYAKVGGLETEDMNRLEVEFLFLMGFKLHVNVSVFESYCCHLEREVSIGG  191

Query  228  GYQIERTLRCAQDIKSKQ  175
            GYQIER LRCA++IKS+Q
Sbjct  192  GYQIERALRCAEEIKSRQ  209



>gb|KHG29326.1| Cyclin-U2-1 -like protein [Gossypium arboreum]
Length=224

 Score =   318 bits (814),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 150/212 (71%), Positives = 177/212 (83%), Gaps = 0/212 (0%)
 Frame = -1

Query  768  LRDDLYLYAYQEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEA  589
            LR DLY Y+YQ  ++TPLVISVLASLI RT+ RN+RI +N + A+      ++VF+C+E 
Sbjct  13   LRSDLYCYSYQRDANTPLVISVLASLIERTMARNERIVKNCKWALTRKDFRSRVFDCHET  72

Query  588  PDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASK  409
            PDMTI+SYLER+FRYT AGPSVYVVAYVY+DRFCQ +P FRI   NVHRLLITTIMVASK
Sbjct  73   PDMTIQSYLERIFRYTKAGPSVYVVAYVYIDRFCQANPGFRINARNVHRLLITTIMVASK  132

Query  408  YVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGG  229
            YVEDMNYRNSYFARVGGLTT E+N LE+EFLFLM FKLHVNVSVF SYC HLEREV IGG
Sbjct  133  YVEDMNYRNSYFARVGGLTTNELNNLELEFLFLMGFKLHVNVSVFESYCSHLEREVSIGG  192

Query  228  GYQIERTLRCAQDIKSKQREDTTFTQVTSLLL  133
            GY IE+TLRCA++IKS+Q E+  + Q+  ++L
Sbjct  193  GYHIEKTLRCAEEIKSRQIEERRYNQIARIML  224



>ref|XP_008375805.1| PREDICTED: cyclin-U2-1-like isoform X1 [Malus domestica]
Length=230

 Score =   317 bits (812),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 151/214 (71%), Positives = 176/214 (82%), Gaps = 2/214 (1%)
 Frame = -1

Query  768  LRDDLYLYAYQEQSSTPLVISVLASLIGRTVTRNQRIARNFRGA--MDINVGSTKVFECN  595
            LR DLY Y+YQ+ S TPLV++VLASLI R + RNQRIA+N      M  ++  T++FEC+
Sbjct  17   LRSDLYSYSYQDDSETPLVVNVLASLIERNMARNQRIAKNCSSPWYMSKDMKKTRIFECH  76

Query  594  EAPDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVA  415
            E PD+TI+SYLER+FRYT AGPSVYVVAYVY+DRFCQ +P F+I  TNVHRLLITTIMVA
Sbjct  77   EXPDLTIQSYLERIFRYTRAGPSVYVVAYVYIDRFCQNNPAFKINVTNVHRLLITTIMVA  136

Query  414  SKYVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGI  235
            SKYVEDMNYRNSYFARVGG TT E+NKLE+EFLFLM FKLHVNVSVF SYCCHLEREV I
Sbjct  137  SKYVEDMNYRNSYFARVGGXTTNELNKLELEFLFLMGFKLHVNVSVFESYCCHLEREVSI  196

Query  234  GGGYQIERTLRCAQDIKSKQREDTTFTQVTSLLL  133
            GGGY IE TLRCA++IK +Q E+  + Q   +LL
Sbjct  197  GGGYHIESTLRCAEEIKRRQNEERRYNQFAGVLL  230



>gb|KHG04231.1| Cyclin-U2-2 -like protein [Gossypium arboreum]
Length=225

 Score =   315 bits (807),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 153/212 (72%), Positives = 172/212 (81%), Gaps = 1/212 (0%)
 Frame = -1

Query  768  LRDDLYLYAYQEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEA  589
            LR DLY Y+YQ  + TPLV+SVLASLI RT+ RN+RIA+N   A+  +  S +VFEC E 
Sbjct  15   LRSDLYSYSYQNDAKTPLVMSVLASLIERTMARNERIAKNCEWALAKDCNS-RVFECQET  73

Query  588  PDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASK  409
            PDMTI+SYLER+FRYT AGPSVYVVAYVY+DRF Q +P FRI   NVHRLLIT IMVASK
Sbjct  74   PDMTIQSYLERIFRYTKAGPSVYVVAYVYMDRFRQANPGFRINARNVHRLLITIIMVASK  133

Query  408  YVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGG  229
            YVEDMNYRNSYFARVGGLTT E+NKLEVEFLF+M FKLHVNV VF SYC HLEREV IGG
Sbjct  134  YVEDMNYRNSYFARVGGLTTKELNKLEVEFLFMMGFKLHVNVRVFESYCSHLEREVSIGG  193

Query  228  GYQIERTLRCAQDIKSKQREDTTFTQVTSLLL  133
            GY IERTLRCA+DIKSKQ E   +  +  +LL
Sbjct  194  GYHIERTLRCAEDIKSKQVEQKRYNSIARILL  225



>gb|KDP28804.1| hypothetical protein JCGZ_14575 [Jatropha curcas]
Length=224

 Score =   315 bits (806),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 153/213 (72%), Positives = 176/213 (83%), Gaps = 2/213 (1%)
 Frame = -1

Query  768  LRDDLYLYAYQEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEA  589
            LR DLY Y+YQ  S+TPLVISVL+SLI RT+ RN+RIAR+   A+  ++ S  VF+C E 
Sbjct  13   LRSDLYAYSYQNDSNTPLVISVLSSLIERTMARNERIARSCSWALSKDIRSG-VFDCYET  71

Query  588  PDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASK  409
            PDMTI+SYLER+FRYT AGPSVYVVAYVY+DRFCQ +P FRI   NVHRLLITTIMVASK
Sbjct  72   PDMTIQSYLERIFRYTKAGPSVYVVAYVYIDRFCQANPGFRINARNVHRLLITTIMVASK  131

Query  408  YVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGG  229
            YVED NYRNSYFARVGGL T E+NKLEVEFLFLM FKLHVNVSVF SYCCHLEREV IGG
Sbjct  132  YVEDRNYRNSYFARVGGLNTKELNKLEVEFLFLMGFKLHVNVSVFESYCCHLEREVSIGG  191

Query  228  GYQIERTLRCAQDIKSKQREDTTF-TQVTSLLL  133
            GY IE+TLRCA++IKS+Q E   +  Q+  ++L
Sbjct  192  GYHIEKTLRCAEEIKSRQNEHKRYINQIARIML  224



>ref|XP_002511648.1| Nuc-1 negative regulatory protein preg, putative [Ricinus communis]
 gb|EEF50317.1| Nuc-1 negative regulatory protein preg, putative [Ricinus communis]
Length=224

 Score =   314 bits (805),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 151/213 (71%), Positives = 176/213 (83%), Gaps = 2/213 (1%)
 Frame = -1

Query  768  LRDDLYLYAYQEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEA  589
            LR DLY Y+YQ  SS PLVISVLASLI RT+ RN+RIA+N   A+  ++  T+VF+C E 
Sbjct  13   LRSDLYSYSYQNDSSIPLVISVLASLIERTMARNERIAKNCSWALSKDI-KTRVFDCYET  71

Query  588  PDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASK  409
            PDMTI+SYLER+FRYT  GPSVYVVAYVY+DRFCQ +P FRI   NVHRLLITT+MVASK
Sbjct  72   PDMTIQSYLERIFRYTRTGPSVYVVAYVYIDRFCQANPGFRISARNVHRLLITTVMVASK  131

Query  408  YVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGG  229
            YVEDMNYRNSYFARVGGLTT E+NKLE+EFLF+M FK+HVNVSVF SYC HLEREV IGG
Sbjct  132  YVEDMNYRNSYFARVGGLTTNELNKLELEFLFMMGFKMHVNVSVFESYCSHLEREVSIGG  191

Query  228  GYQIERTLRCAQDIKSKQREDTTF-TQVTSLLL  133
            GY IE+TLRCA++IKS Q ED  +  Q+  ++L
Sbjct  192  GYHIEKTLRCAEEIKSGQTEDKRYINQIARIML  224



>ref|XP_010089246.1| hypothetical protein L484_021775 [Morus notabilis]
 gb|EXB37571.1| hypothetical protein L484_021775 [Morus notabilis]
Length=233

 Score =   312 bits (800),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 149/204 (73%), Positives = 174/204 (85%), Gaps = 3/204 (1%)
 Frame = -1

Query  768  LRDDLYLYAYQEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGS---TKVFEC  598
            LR DLY Y+YQ+ S+ PLV+SVLASLI R++ RNQRI++N  G+    + +   T++F+C
Sbjct  17   LRSDLYSYSYQDDSNIPLVVSVLASLIERSMARNQRISKNICGSKLYYLSNDIRTRIFDC  76

Query  597  NEAPDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMV  418
            NE PDMTI+SYLER+FRYT AGPSVYVVAYVY+DRFCQ +P FRI   NVHRLL+TTIMV
Sbjct  77   NETPDMTIQSYLERIFRYTRAGPSVYVVAYVYIDRFCQTNPGFRINGRNVHRLLVTTIMV  136

Query  417  ASKYVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVG  238
            ASKYVEDMNYRNSYFARVGGLTT E+NKLE+EFLFLM FKLHVNVSVF SYCCHLEREV 
Sbjct  137  ASKYVEDMNYRNSYFARVGGLTTKELNKLELEFLFLMGFKLHVNVSVFESYCCHLEREVS  196

Query  237  IGGGYQIERTLRCAQDIKSKQRED  166
            IGGGY IERTLRCA++IKS+Q  +
Sbjct  197  IGGGYHIERTLRCAEEIKSRQSHE  220



>ref|XP_006397689.1| hypothetical protein EUTSA_v10001623mg [Eutrema salsugineum]
 gb|ESQ39142.1| hypothetical protein EUTSA_v10001623mg [Eutrema salsugineum]
Length=221

 Score =   310 bits (794),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 151/213 (71%), Positives = 178/213 (84%), Gaps = 6/213 (3%)
 Frame = -1

Query  768  LRDDLYLYAYQEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEA  589
            LR DLY Y+YQ+ S+TPLVISVL+SLI RT+ RN+RI+R++ G      G T+VF+C E 
Sbjct  14   LRSDLYSYSYQDDSNTPLVISVLSSLIERTLARNERISRSYGG-----FGKTRVFDCREI  68

Query  588  PDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASK  409
            PDMTI+SYLER+FRYT AGPSVYVVAYVY+DRFCQ +  FRI  TNVHRLLITTIM+ASK
Sbjct  69   PDMTIQSYLERIFRYTKAGPSVYVVAYVYIDRFCQNNQGFRISLTNVHRLLITTIMIASK  128

Query  408  YVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGG  229
            YVEDMNYRNSYFA+VGGL T ++NKLE+EFLFLM FKLHVNVSVF SYCCHLEREV IGG
Sbjct  129  YVEDMNYRNSYFAKVGGLETEDLNKLELEFLFLMGFKLHVNVSVFESYCCHLEREVSIGG  188

Query  228  GYQIERTLRCAQDIKSKQ-REDTTFTQVTSLLL  133
            GYQIE+ LRCA++IKS+Q  +D    Q + +LL
Sbjct  189  GYQIEKALRCAEEIKSRQIVQDPKHHQFSRILL  221



>gb|EYU31943.1| hypothetical protein MIMGU_mgv1a013240mg [Erythranthe guttata]
Length=226

 Score =   310 bits (793),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 148/197 (75%), Positives = 174/197 (88%), Gaps = 2/197 (1%)
 Frame = -1

Query  768  LRDDLYLYAYQEQSS-TPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNE  592
            LR DLY Y+Y+E+S+ TPLVISVLASLI RT+ RN+RIA+N R  +   +  T+VF+ +E
Sbjct  9    LRYDLYSYSYEEESNNTPLVISVLASLIERTLARNERIAKNCR-VISHKLSKTRVFDSDE  67

Query  591  APDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVAS  412
            APD+TI+SYLER+FRYT AGPSVYVVAYVY+DR CQ +P+FRIGP NVHRLLITTIMVAS
Sbjct  68   APDLTIQSYLERIFRYTRAGPSVYVVAYVYIDRLCQFYPEFRIGPRNVHRLLITTIMVAS  127

Query  411  KYVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIG  232
            K+VEDMNYRNSYFARVGG+T  EMNKLE EF+F+M+FKLHVNVSV+ SYCCHLEREV IG
Sbjct  128  KFVEDMNYRNSYFARVGGITREEMNKLEFEFIFMMKFKLHVNVSVYESYCCHLEREVSIG  187

Query  231  GGYQIERTLRCAQDIKS  181
            GGYQIERTLRCAQ+IK+
Sbjct  188  GGYQIERTLRCAQEIKA  204



>ref|XP_004514236.1| PREDICTED: cyclin-U2-2-like [Cicer arietinum]
Length=224

 Score =   308 bits (790),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 146/213 (69%), Positives = 178/213 (84%), Gaps = 2/213 (1%)
 Frame = -1

Query  768  LRDDLYLYAYQEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEA  589
            LR DLY ++YQ+ SSTPLVI+VLASLI R++ R +RI +N   ++   + ST +F+C E 
Sbjct  13   LRSDLYSFSYQQDSSTPLVINVLASLIERSMARTKRIVKNCSSSLSKAI-STNIFDCREI  71

Query  588  PDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASK  409
            PDMTI+SYLER+FRYT AGPSVYVVAYVY+DRFCQ++P FRI   NVHRLLITTIMVASK
Sbjct  72   PDMTIQSYLERIFRYTKAGPSVYVVAYVYIDRFCQINPGFRINARNVHRLLITTIMVASK  131

Query  408  YVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGG  229
            YVED+NYRNSYF RVGGLTT E+NKLE+EFLF+M FKLHVNVSVF SYC HLEREVGIGG
Sbjct  132  YVEDLNYRNSYFGRVGGLTTSELNKLELEFLFMMGFKLHVNVSVFESYCSHLEREVGIGG  191

Query  228  GYQIERTLRCAQDIKSKQREDT-TFTQVTSLLL  133
            GY IE+TLRCA++IK++ +E+   +TQ+  + L
Sbjct  192  GYHIEKTLRCAEEIKARHKEEIRGYTQIPRVTL  224



>ref|XP_007140811.1| hypothetical protein PHAVU_008G144200g [Phaseolus vulgaris]
 gb|ESW12805.1| hypothetical protein PHAVU_008G144200g [Phaseolus vulgaris]
Length=225

 Score =   308 bits (790),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 148/213 (69%), Positives = 174/213 (82%), Gaps = 3/213 (1%)
 Frame = -1

Query  768  LRDDLYLYAYQEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVG-STKVFECNE  592
            LR DLY Y+YQE SSTPLVI+VLASLI R++ R +RI +N  G+  ++   ST +F C +
Sbjct  15   LRSDLYSYSYQEDSSTPLVINVLASLIERSMARTERIVKN--GSWSLSKALSTNIFYCRD  72

Query  591  APDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVAS  412
             PDMTI+SYLER+FRYT A PSVYVVAYVY+DRFC  +P FRI P NVHRLLITTIM AS
Sbjct  73   IPDMTIQSYLERIFRYTRAIPSVYVVAYVYIDRFCHNNPGFRINPRNVHRLLITTIMCAS  132

Query  411  KYVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIG  232
            KYVEDMNYRNSYF +VGGLTT E+NKLE++FLFLM FKLHVNVSVF SYCCHLEREV IG
Sbjct  133  KYVEDMNYRNSYFGKVGGLTTNELNKLELDFLFLMDFKLHVNVSVFESYCCHLEREVSIG  192

Query  231  GGYQIERTLRCAQDIKSKQREDTTFTQVTSLLL  133
            GGY IERTLRCA++IK++ RED  F  +  ++L
Sbjct  193  GGYHIERTLRCAEEIKARHREDKGFRNIARVML  225



>ref|XP_002876566.1| CYCP3_2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52825.1| CYCP3_2 [Arabidopsis lyrata subsp. lyrata]
Length=227

 Score =   308 bits (790),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 146/198 (74%), Positives = 169/198 (85%), Gaps = 1/198 (1%)
 Frame = -1

Query  768  LRDDLYLYAYQEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEA  589
            LR DLY Y+YQ  S TPLVISVL+SLI RT+TRN+RI+R    +     G T++F+C E 
Sbjct  14   LRSDLYSYSYQNNSETPLVISVLSSLIDRTLTRNERISRRALPSSGAG-GKTQIFDCREI  72

Query  588  PDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASK  409
            PDMTI+SYLER+FRYT AGPSVYVVAYVY+DRFCQ +P FRI  TNVHRLLITTIM+ASK
Sbjct  73   PDMTIQSYLERIFRYTKAGPSVYVVAYVYIDRFCQTNPSFRISLTNVHRLLITTIMIASK  132

Query  408  YVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGG  229
            YVED+NYRNSYFA+VGGL T ++NKLE+EFLFLM FKLHVNV+VF SYCCHLEREV IGG
Sbjct  133  YVEDLNYRNSYFAKVGGLETEDLNKLELEFLFLMGFKLHVNVTVFESYCCHLEREVSIGG  192

Query  228  GYQIERTLRCAQDIKSKQ  175
            GYQIE+ LRCA++IKSKQ
Sbjct  193  GYQIEKALRCAEEIKSKQ  210



>ref|XP_002275585.1| PREDICTED: cyclin-U2-1 [Vitis vinifera]
 emb|CBI16591.3| unnamed protein product [Vitis vinifera]
Length=229

 Score =   308 bits (790),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 151/212 (71%), Positives = 177/212 (83%), Gaps = 1/212 (0%)
 Frame = -1

Query  768  LRDDLYLYAYQEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEA  589
            LR DLY Y+YQE S+TPLVISVLASLI RT+ RN+RIA+N    +   +  T VF+C+E 
Sbjct  19   LRTDLYSYSYQEDSNTPLVISVLASLIERTMARNERIAKNSPRGLSRYL-RTGVFDCHET  77

Query  588  PDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASK  409
            PDMTI+SYLER+FRYT AGPSVYVVAYVY+DRFCQ++P FRI  +NVH LLITTIMVASK
Sbjct  78   PDMTIQSYLERIFRYTRAGPSVYVVAYVYIDRFCQINPGFRISASNVHGLLITTIMVASK  137

Query  408  YVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGG  229
            YVEDMNYRNSY+ARVGGLTT EMN+LEVEFLFLM FKLHVNVSVF SYC HLEREV IGG
Sbjct  138  YVEDMNYRNSYYARVGGLTTNEMNELEVEFLFLMGFKLHVNVSVFESYCSHLEREVSIGG  197

Query  228  GYQIERTLRCAQDIKSKQREDTTFTQVTSLLL  133
            GY IE+TLRCA++IKS+Q  +  + ++  + L
Sbjct  198  GYHIEKTLRCAEEIKSRQIVERRYNRIARVTL  229



>ref|XP_006294970.1| hypothetical protein CARUB_v10024026mg [Capsella rubella]
 gb|EOA27868.1| hypothetical protein CARUB_v10024026mg [Capsella rubella]
Length=220

 Score =   308 bits (788),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 149/213 (70%), Positives = 177/213 (83%), Gaps = 6/213 (3%)
 Frame = -1

Query  768  LRDDLYLYAYQEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEA  589
            LR DLY Y+YQ+ S+TPLVISVL+SLI RT+ RN+RI+R++ G      G T+VF+C E 
Sbjct  13   LRSDLYSYSYQDDSNTPLVISVLSSLIERTLARNERISRSYGG-----FGKTRVFDCREI  67

Query  588  PDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASK  409
            PDMTI+SYLER+FRYT AGPSVYVVAYVY+DRFCQ +  FR+  TNVHRLLITTIM+ASK
Sbjct  68   PDMTIQSYLERIFRYTKAGPSVYVVAYVYIDRFCQNNQGFRLSLTNVHRLLITTIMIASK  127

Query  408  YVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGG  229
            YVEDMNYRNSYFA+VGGL T ++N LE+EFLFLM FKLHVNVSVF SYCCHLEREV IGG
Sbjct  128  YVEDMNYRNSYFAKVGGLETEDLNNLEIEFLFLMGFKLHVNVSVFESYCCHLEREVSIGG  187

Query  228  GYQIERTLRCAQDIKSKQ-REDTTFTQVTSLLL  133
            GYQIE+ LRCA++IKS+Q  +D    Q + +LL
Sbjct  188  GYQIEKALRCAEEIKSRQIVQDPKHHQFSRILL  220



>ref|XP_011081410.1| PREDICTED: LOW QUALITY PROTEIN: cyclin-U2-1-like [Sesamum indicum]
Length=203

 Score =   307 bits (786),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 147/197 (75%), Positives = 169/197 (86%), Gaps = 2/197 (1%)
 Frame = -1

Query  768  LRDDLYLYAYQEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEA  589
            LR DLY Y+YQE S+TPLVIS+LASLI RT+ RN+RIA+ +  +    V  T+V +CNE 
Sbjct  9    LRYDLYSYSYQENSNTPLVISILASLIERTLARNERIAKKY--SKWTGVSKTRVXDCNET  66

Query  588  PDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASK  409
            PDMTI+SYLER+FRYT AGP VYVVAYVY+DRFCQ +P+FRIG  NVHRLLITTIMVASK
Sbjct  67   PDMTIQSYLERIFRYTRAGPPVYVVAYVYIDRFCQFYPEFRIGARNVHRLLITTIMVASK  126

Query  408  YVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGG  229
            YVEDMNY NSYFA VGGLTT E+NKLEVEFLFLM+FKLHVN+SV+ SYCCHLEREV I G
Sbjct  127  YVEDMNYINSYFAHVGGLTTNELNKLEVEFLFLMKFKLHVNMSVYESYCCHLEREVSISG  186

Query  228  GYQIERTLRCAQDIKSK  178
            GYQIERTLR A++IK+K
Sbjct  187  GYQIERTLRYAEEIKTK  203



>ref|XP_009116735.1| PREDICTED: cyclin-U2-2 [Brassica rapa]
Length=233

 Score =   307 bits (786),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 145/200 (73%), Positives = 169/200 (85%), Gaps = 2/200 (1%)
 Frame = -1

Query  768  LRDDLYLYAYQEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDIN--VGSTKVFECN  595
            LR DLY Y+ Q+ + TPLVISVL+SLI RT+TRNQRI+R    A   +   G T++F+C 
Sbjct  14   LRSDLYSYSNQDNTKTPLVISVLSSLIDRTLTRNQRISRRASPASSTSGRSGKTQIFDCR  73

Query  594  EAPDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVA  415
            E PDMTI+SYLER+FRYT AGPSVYVVAYVY+DRFCQL+P FRI   NVHRLLITTIM+A
Sbjct  74   EIPDMTIQSYLERIFRYTKAGPSVYVVAYVYIDRFCQLNPGFRISLANVHRLLITTIMIA  133

Query  414  SKYVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGI  235
            SKYVED+NYRNSYFA+VGGL T ++NKLE+EFLFLM FKLHVNVSVF SYCCHLEREV  
Sbjct  134  SKYVEDLNYRNSYFAKVGGLETEDLNKLELEFLFLMGFKLHVNVSVFESYCCHLEREVSF  193

Query  234  GGGYQIERTLRCAQDIKSKQ  175
            GGGYQIE+ LRCA++IKS+Q
Sbjct  194  GGGYQIEKALRCAEEIKSRQ  213



>gb|KFK37301.1| hypothetical protein AALP_AA4G239500 [Arabis alpina]
Length=225

 Score =   306 bits (783),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 146/198 (74%), Positives = 169/198 (85%), Gaps = 5/198 (3%)
 Frame = -1

Query  768  LRDDLYLYAYQEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEA  589
            LR DLY Y+YQE S TPLVISVL+SLI RT+ RN+RI++++ G      G T+VF+C E 
Sbjct  13   LRSDLYSYSYQEDSKTPLVISVLSSLIERTLARNERISKSYGG-----FGKTRVFDCREI  67

Query  588  PDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASK  409
            PDMTI+SYLER+FRYT AGPSVYVVAYVY+DRFCQ +  FRI  TNVHRLLITTIM+ASK
Sbjct  68   PDMTIQSYLERIFRYTKAGPSVYVVAYVYIDRFCQNNQGFRISLTNVHRLLITTIMIASK  127

Query  408  YVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGG  229
            YVEDMNYRNSYFA+VGGL T ++N LE+EFLFLM FKLHVNVSVF SYCCHLEREV IGG
Sbjct  128  YVEDMNYRNSYFAKVGGLETEDLNNLELEFLFLMGFKLHVNVSVFESYCCHLEREVSIGG  187

Query  228  GYQIERTLRCAQDIKSKQ  175
            GYQIE+ LRCA++IKS+Q
Sbjct  188  GYQIEKALRCAEEIKSRQ  205



>gb|KHN05788.1| Cyclin-U2-1 [Glycine soja]
Length=223

 Score =   305 bits (782),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 149/213 (70%), Positives = 175/213 (82%), Gaps = 2/213 (1%)
 Frame = -1

Query  768  LRDDLYLYAYQEQS-STPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNE  592
            LR DLY Y+YQE   STPLVI+VLASLI R++ R +RI +N   ++   + ST +F+C E
Sbjct  12   LRSDLYSYSYQEDHYSTPLVINVLASLIERSMARTERIVKNGSRSLSKAI-STNIFDCRE  70

Query  591  APDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVAS  412
              DMTI+SYLER+FRYT AGPSVYVVAYVY+DRFCQ +P FRI   NVHRLLITTIM+AS
Sbjct  71   ILDMTIQSYLERIFRYTRAGPSVYVVAYVYIDRFCQNNPGFRINARNVHRLLITTIMLAS  130

Query  411  KYVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIG  232
            KYVEDMNYRNSYF RVGGLTT E+NKLE+EFLFLM FKLHVNVSVF SYCCHLEREV IG
Sbjct  131  KYVEDMNYRNSYFGRVGGLTTDELNKLELEFLFLMDFKLHVNVSVFESYCCHLEREVSIG  190

Query  231  GGYQIERTLRCAQDIKSKQREDTTFTQVTSLLL  133
            GGY IERTLRCA++IK+K RE+  +T +  ++L
Sbjct  191  GGYHIERTLRCAEEIKAKHREERGYTHIARVML  223



>emb|CDY18953.1| BnaC04g03970D [Brassica napus]
Length=222

 Score =   305 bits (782),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 147/198 (74%), Positives = 170/198 (86%), Gaps = 5/198 (3%)
 Frame = -1

Query  768  LRDDLYLYAYQEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEA  589
            LR DLY Y+YQ+ SSTPLVISVL+SLI RT+ RN+RI+R++ G      G T+VF+C E 
Sbjct  14   LRSDLYSYSYQDGSSTPLVISVLSSLIERTLARNERISRSYGG-----FGKTRVFDCLEI  68

Query  588  PDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASK  409
            PDMTI+SYLER+FRYT AGPSVYVVAYVY+DRFCQ +  FRI  TNVHRLLITTIMVASK
Sbjct  69   PDMTIQSYLERIFRYTKAGPSVYVVAYVYIDRFCQSNQGFRISLTNVHRLLITTIMVASK  128

Query  408  YVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGG  229
            YVEDMNY+NSYFA+VGGL T ++N LE+EFLFLM FKLHVNVSVF SYCCHLEREV IGG
Sbjct  129  YVEDMNYKNSYFAKVGGLETEDLNNLELEFLFLMGFKLHVNVSVFESYCCHLEREVSIGG  188

Query  228  GYQIERTLRCAQDIKSKQ  175
            GYQIE+ LRCA++IKS+Q
Sbjct  189  GYQIEKALRCAEEIKSRQ  206



>ref|XP_009143100.1| PREDICTED: cyclin-U2-1 [Brassica rapa]
 emb|CDX74709.1| BnaA05g04550D [Brassica napus]
Length=222

 Score =   305 bits (782),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 147/198 (74%), Positives = 170/198 (86%), Gaps = 5/198 (3%)
 Frame = -1

Query  768  LRDDLYLYAYQEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEA  589
            LR DLY Y+YQ+ SSTPLVISVL+SLI RT+ RN+RI+R++ G      G T+VF+C E 
Sbjct  14   LRSDLYSYSYQDGSSTPLVISVLSSLIERTLARNERISRSYGG-----FGKTRVFDCLEI  68

Query  588  PDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASK  409
            PDMTI+SYLER+FRYT AGPSVYVVAYVY+DRFCQ +  FRI  TNVHRLLITTIMVASK
Sbjct  69   PDMTIQSYLERIFRYTKAGPSVYVVAYVYIDRFCQNNQGFRISLTNVHRLLITTIMVASK  128

Query  408  YVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGG  229
            YVEDMNY+NSYFA+VGGL T ++N LE+EFLFLM FKLHVNVSVF SYCCHLEREV IGG
Sbjct  129  YVEDMNYKNSYFAKVGGLETEDLNNLELEFLFLMGFKLHVNVSVFESYCCHLEREVSIGG  188

Query  228  GYQIERTLRCAQDIKSKQ  175
            GYQIE+ LRCA++IKS+Q
Sbjct  189  GYQIEKALRCAEEIKSRQ  206



>gb|ACJ84839.1| unknown [Medicago truncatula]
 gb|AFK49335.1| unknown [Medicago truncatula]
Length=224

 Score =   304 bits (779),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 144/213 (68%), Positives = 177/213 (83%), Gaps = 2/213 (1%)
 Frame = -1

Query  768  LRDDLYLYAYQEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEA  589
            LR D+Y ++YQ+ SSTPLVI+VLASLI R + R +RI +N   ++   + ST +F+C E 
Sbjct  13   LRSDVYSFSYQQDSSTPLVINVLASLIERNMARTKRIVKNCSRSLSKAI-STNIFDCREI  71

Query  588  PDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASK  409
            PD+TI+SYLER+FRYT AGPSVYVVAYVY+DRFCQ++P FRI   NVHRLLITTIMVASK
Sbjct  72   PDLTIQSYLERIFRYTKAGPSVYVVAYVYIDRFCQINPGFRINARNVHRLLITTIMVASK  131

Query  408  YVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGG  229
            YVED+NYRNSYF RVGGLTT E+NKLE+EFLF+M FKLHVNVSVF SYC HLEREVGIGG
Sbjct  132  YVEDLNYRNSYFGRVGGLTTSEINKLELEFLFMMGFKLHVNVSVFESYCSHLEREVGIGG  191

Query  228  GYQIERTLRCAQDIKSKQREDT-TFTQVTSLLL  133
            GY IE+TLRCA++IK++ RE+   + Q+  ++L
Sbjct  192  GYHIEKTLRCAEEIKARHREEIRGYAQIPRVML  224



>gb|KFK35259.1| hypothetical protein AALP_AA5G262100 [Arabis alpina]
Length=232

 Score =   305 bits (780),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 145/199 (73%), Positives = 169/199 (85%), Gaps = 1/199 (1%)
 Frame = -1

Query  768  LRDDLYLYAYQEQSSTPLVISVLASLIGRTVTRNQRIARNFRG-AMDINVGSTKVFECNE  592
            LR DLY Y+YQ+ S TPLVISVL+SLI RT+TRNQRI+R     +     G T++F+C E
Sbjct  14   LRSDLYSYSYQDNSKTPLVISVLSSLIDRTLTRNQRISRRASPLSSSGGGGKTQIFDCRE  73

Query  591  APDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVAS  412
             PDMTI+SYLER+F+YT AGPSVYVVAYVY+DRFCQ +P FRI  TNVHRLLITTIM+AS
Sbjct  74   IPDMTIQSYLERIFKYTKAGPSVYVVAYVYIDRFCQTNPGFRISLTNVHRLLITTIMIAS  133

Query  411  KYVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIG  232
            KYVED+NYRNSYFA+VGGL T ++NKLE+EFLFLM FKLHVNVSVF SYCCHLEREV  G
Sbjct  134  KYVEDLNYRNSYFAKVGGLETEDLNKLELEFLFLMGFKLHVNVSVFESYCCHLEREVSFG  193

Query  231  GGYQIERTLRCAQDIKSKQ  175
            GGYQIE+ LRCA++IKS+Q
Sbjct  194  GGYQIEKALRCAEEIKSRQ  212



>ref|XP_009344075.1| PREDICTED: cyclin-U2-1-like isoform X2 [Pyrus x bretschneideri]
Length=225

 Score =   303 bits (777),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 148/214 (69%), Positives = 172/214 (80%), Gaps = 7/214 (3%)
 Frame = -1

Query  768  LRDDLYLYAYQEQSSTPLVISVLASLIGRTVTRNQRIARNFRGA--MDINVGSTKVFECN  595
            LR DLY Y+YQ+ S TPLV++VLASLI R + RNQRIA+N      M  ++  T++FEC+
Sbjct  17   LRSDLYSYSYQDDSETPLVVNVLASLIERNMARNQRIAKNCSSPWYMSKDMKKTRIFECH  76

Query  594  EAPDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVA  415
            E PD+TI+SYLER+FRYT AGPSVYVVAYVY+DRFCQ +P FRI  TNVHRLLITTIMVA
Sbjct  77   ETPDLTIQSYLERIFRYTRAGPSVYVVAYVYIDRFCQNNPAFRINVTNVHRLLITTIMVA  136

Query  414  SKYVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGI  235
            SK     NYRNSYFARVGGLTT E+NKLE+EFLFLM FKLHVNVSVF SYCCHLEREV I
Sbjct  137  SK-----NYRNSYFARVGGLTTNELNKLELEFLFLMGFKLHVNVSVFESYCCHLEREVSI  191

Query  234  GGGYQIERTLRCAQDIKSKQREDTTFTQVTSLLL  133
            GGGY IE TLRCA++IK +Q E+  + Q   +LL
Sbjct  192  GGGYHIESTLRCAEEIKRRQNEERRYNQFAGVLL  225



>emb|CDY41156.1| BnaA09g38590D [Brassica napus]
Length=233

 Score =   304 bits (778),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 144/200 (72%), Positives = 168/200 (84%), Gaps = 2/200 (1%)
 Frame = -1

Query  768  LRDDLYLYAYQEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDIN--VGSTKVFECN  595
            LR DLY Y+  + + TPLVISVL+SLI RT+TRNQRI+R    A   +   G T++F+C 
Sbjct  14   LRSDLYSYSNHDNTKTPLVISVLSSLIDRTLTRNQRISRRASPASSTSGRSGKTQIFDCR  73

Query  594  EAPDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVA  415
            E PDMTI+SYLER+FRYT AGPSVYVVAYVY+DRFCQL+P FRI   NVHRLLITTIM+A
Sbjct  74   EIPDMTIQSYLERIFRYTKAGPSVYVVAYVYIDRFCQLNPGFRISLANVHRLLITTIMIA  133

Query  414  SKYVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGI  235
            SKYVED+NYRNSYFA+VGGL T ++NKLE+EFLFLM FKLHVNVSVF SYCCHLEREV  
Sbjct  134  SKYVEDLNYRNSYFAKVGGLETEDLNKLELEFLFLMGFKLHVNVSVFESYCCHLEREVSF  193

Query  234  GGGYQIERTLRCAQDIKSKQ  175
            GGGYQIE+ LRCA++IKS+Q
Sbjct  194  GGGYQIEKALRCAEEIKSRQ  213



>ref|NP_191614.1| cyclin p3;2 [Arabidopsis thaliana]
 sp|Q9M205.1|CCU22_ARATH RecName: Full=Cyclin-U2-2; Short=CycU2;2; AltName: Full=Cyclin-P3.2; 
Short=CycP3;2 [Arabidopsis thaliana]
 emb|CAB81841.1| regulatory protein-like [Arabidopsis thaliana]
 gb|AAS77482.1| At3g60550 [Arabidopsis thaliana]
 gb|AEE80078.1| cyclin p3;2 [Arabidopsis thaliana]
Length=230

 Score =   303 bits (776),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 144/198 (73%), Positives = 167/198 (84%), Gaps = 1/198 (1%)
 Frame = -1

Query  768  LRDDLYLYAYQEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEA  589
            LR DLY Y+YQ  S TPLVISVL+SLI RT+TRN+RI+R    +     G T++F+C E 
Sbjct  14   LRSDLYSYSYQNNSKTPLVISVLSSLIDRTLTRNERISRRALPSSGAG-GKTQIFDCREI  72

Query  588  PDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASK  409
            PDMTI+SYL R+FRYT AGPSVYVVAYVY+DRFCQ +P FRI  TNVHRLLITTIM+ASK
Sbjct  73   PDMTIQSYLGRIFRYTKAGPSVYVVAYVYIDRFCQTNPGFRISLTNVHRLLITTIMIASK  132

Query  408  YVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGG  229
            YVED+NYRNSYFA+VGGL T ++NKLE+EFLFLM FKLHVNVSVF SYCCHLEREV  GG
Sbjct  133  YVEDLNYRNSYFAKVGGLETEDLNKLELEFLFLMGFKLHVNVSVFESYCCHLEREVSFGG  192

Query  228  GYQIERTLRCAQDIKSKQ  175
            GYQIE+ LRCA++IKS+Q
Sbjct  193  GYQIEKALRCAEEIKSRQ  210



>ref|XP_010508213.1| PREDICTED: cyclin-U2-1-like [Camelina sativa]
Length=220

 Score =   302 bits (773),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 149/215 (69%), Positives = 176/215 (82%), Gaps = 8/215 (4%)
 Frame = -1

Query  768  LRDDLYLYAYQE--QSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECN  595
            LR DLY Y+YQ+   S+TPLVISVL+SLI RT+ RN+RI+R++ G      G T+VF+C 
Sbjct  11   LRSDLYSYSYQDDSNSNTPLVISVLSSLIERTLARNERISRSYGG-----FGKTRVFDCR  65

Query  594  EAPDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVA  415
            E PDMTI+SYLER+FRYT AGPSVYVVAYVY+DRFCQ +  FRI  TNVHRLLITTIM+A
Sbjct  66   EIPDMTIQSYLERIFRYTKAGPSVYVVAYVYIDRFCQNNQGFRISLTNVHRLLITTIMIA  125

Query  414  SKYVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGI  235
            SKYVEDMNYRNSYFA+VGGL T ++N LE+EFLFLM FKLHVNVSVF SYC HLEREV I
Sbjct  126  SKYVEDMNYRNSYFAKVGGLETEDLNNLEIEFLFLMGFKLHVNVSVFESYCSHLEREVSI  185

Query  234  GGGYQIERTLRCAQDIKSKQR-EDTTFTQVTSLLL  133
            GGGYQIE+ LRCA++IKS+Q  +D    Q + +LL
Sbjct  186  GGGYQIEKALRCAEEIKSRQTVQDPKLHQFSRILL  220



>ref|XP_010258919.1| PREDICTED: cyclin-U2-1-like [Nelumbo nucifera]
Length=230

 Score =   302 bits (773),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 143/208 (69%), Positives = 172/208 (83%), Gaps = 3/208 (1%)
 Frame = -1

Query  768  LRDDLYLYAYQEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEA  589
            LR DLY +AYQ++S++PLVISVLASL+ RT+TRN+RI       +  +    +VF+C++ 
Sbjct  13   LRSDLYSFAYQDESNSPLVISVLASLMDRTMTRNERITGKCNWVLSKD-SRIRVFDCHQV  71

Query  588  PDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASK  409
            PDMT++S+LER+FRYT  GP VYVVAYVY+DR CQ+HPQFRI P+NVHRLLITTIMVASK
Sbjct  72   PDMTVQSFLERIFRYTRVGPPVYVVAYVYIDRLCQMHPQFRITPSNVHRLLITTIMVASK  131

Query  408  YVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGG  229
            ++EDMNYRNSYFA+VGGLTT EMNKLE++FLFLM FKLHVNVSVF SYCCHLEREV IGG
Sbjct  132  FIEDMNYRNSYFAKVGGLTTREMNKLEMDFLFLMGFKLHVNVSVFESYCCHLEREVSIGG  191

Query  228  GYQIERTLR--CAQDIKSKQREDTTFTQ  151
            GY IERTLR  C  +IK+K RE+  F  
Sbjct  192  GYHIERTLRLMCCGEIKAKHREEDGFNN  219



>ref|XP_010056430.1| PREDICTED: cyclin-U2-1-like [Eucalyptus grandis]
 gb|KCW73156.1| hypothetical protein EUGRSUZ_E01610 [Eucalyptus grandis]
Length=228

 Score =   301 bits (772),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 147/200 (74%), Positives = 172/200 (86%), Gaps = 2/200 (1%)
 Frame = -1

Query  768  LRDDLYLYAYQEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEA  589
            LR DLY + Y++ S TPLV+SVLASLI RT++RN+RI R+   A+  +V  T+VF+C+E+
Sbjct  14   LRSDLYSFTYRQDSKTPLVVSVLASLIERTMSRNERITRSCSWALSKDV-KTRVFDCHES  72

Query  588  PDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASK  409
            PDMTI+SYLER+FRYT AGPSVYVVAYVY+DRFCQ +P FRI   NVHRLLITTIMVASK
Sbjct  73   PDMTIQSYLERIFRYTKAGPSVYVVAYVYIDRFCQANPGFRINARNVHRLLITTIMVASK  132

Query  408  YVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGG  229
            YVEDMNYRNSYFARVGGL T E+N+LE+EFLFLM FKLHVN+SVF SY CHLEREV IGG
Sbjct  133  YVEDMNYRNSYFARVGGLGTEEINRLELEFLFLMGFKLHVNLSVFESYICHLEREVSIGG  192

Query  228  GYQIERTLRCAQDIK-SKQR  172
            GYQIER LRCA++IK S+QR
Sbjct  193  GYQIERALRCAEEIKFSRQR  212



>ref|XP_010506446.1| PREDICTED: cyclin-U2-1 [Camelina sativa]
Length=220

 Score =   301 bits (771),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 149/215 (69%), Positives = 176/215 (82%), Gaps = 8/215 (4%)
 Frame = -1

Query  768  LRDDLYLYAYQE--QSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECN  595
            LR DLY Y+YQ+   S+TPLVISVL+SLI RT+ RN+RI+R++ G      G T+VF+C 
Sbjct  11   LRSDLYSYSYQDDSNSNTPLVISVLSSLIERTLARNERISRSYGG-----FGKTRVFDCR  65

Query  594  EAPDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVA  415
            E PDMTI+SYLER+FRYT AGPSVYVVAYVY+DRFCQ +  FRI  TNVHRLLITTIM+A
Sbjct  66   EIPDMTIQSYLERIFRYTKAGPSVYVVAYVYIDRFCQNNQGFRISLTNVHRLLITTIMIA  125

Query  414  SKYVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGI  235
            SKYVEDMNYRNSYFA+VGGL T ++N LE+EFLFLM FKLHVNVSVF SYC HLEREV I
Sbjct  126  SKYVEDMNYRNSYFAKVGGLETEDLNNLEIEFLFLMGFKLHVNVSVFESYCSHLEREVSI  185

Query  234  GGGYQIERTLRCAQDIKSKQR-EDTTFTQVTSLLL  133
            GGGYQIE+ LRCA++IKS+Q  +D    Q + +LL
Sbjct  186  GGGYQIEKALRCAEEIKSRQTVQDPKHHQFSRILL  220



>ref|XP_006291787.1| hypothetical protein CARUB_v10017957mg [Capsella rubella]
 gb|EOA24685.1| hypothetical protein CARUB_v10017957mg [Capsella rubella]
Length=235

 Score =   301 bits (772),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 145/201 (72%), Positives = 168/201 (84%), Gaps = 3/201 (1%)
 Frame = -1

Query  768  LRDDLYLYAY-QEQSSTPLVISVLASLIGRTVTRNQRIA--RNFRGAMDINVGSTKVFEC  598
            LR DLY Y+  Q  S TPLVISVL+SLI RT+ RNQRI+  R F  +   + G T++F+C
Sbjct  14   LRSDLYSYSNNQSNSETPLVISVLSSLIERTLARNQRISSRRAFPTSPSSSTGKTQIFDC  73

Query  597  NEAPDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMV  418
             E PDMTI+SYLER+FRYT AGPSVYVVAYVY+DRFCQ +P FRI  TNVHRLLITTIM+
Sbjct  74   REVPDMTIQSYLERIFRYTKAGPSVYVVAYVYIDRFCQTNPGFRISLTNVHRLLITTIMI  133

Query  417  ASKYVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVG  238
            ASKYVED+NYRNSYFA+VGGL T E+NKLE+EFLFL+ FKLHVNVSVF SYCCHLEREV 
Sbjct  134  ASKYVEDLNYRNSYFAKVGGLETEELNKLELEFLFLVGFKLHVNVSVFESYCCHLEREVS  193

Query  237  IGGGYQIERTLRCAQDIKSKQ  175
             GGGYQIE+ LRCA++IKS+Q
Sbjct  194  FGGGYQIEKALRCAEEIKSRQ  214



>emb|CDX71800.1| BnaC08g30740D [Brassica napus]
Length=235

 Score =   301 bits (771),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 143/200 (72%), Positives = 166/200 (83%), Gaps = 2/200 (1%)
 Frame = -1

Query  768  LRDDLYLYAYQEQSSTPLVISVLASLIGRTVTRNQRIARN--FRGAMDINVGSTKVFECN  595
            LR DLY Y+ Q  + TPLVISVL+SLI RT+TRNQRI+R      +     G T++F+C 
Sbjct  14   LRSDLYSYSNQNNTKTPLVISVLSSLIDRTLTRNQRISRKASPASSTSSRSGKTQIFDCR  73

Query  594  EAPDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVA  415
            E PDMTI+SYLER+FRYT AGPSVYVVAYVY+DRFCQL+P FRI   NVH LLITTIM+A
Sbjct  74   EIPDMTIQSYLERIFRYTKAGPSVYVVAYVYIDRFCQLNPGFRISLANVHSLLITTIMIA  133

Query  414  SKYVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGI  235
            SKYVED+NYRNSYFA+VGGL T ++NKLE+EFLFLM FKLHVNVSVF SYCCHLEREV  
Sbjct  134  SKYVEDLNYRNSYFAKVGGLETEDLNKLELEFLFLMGFKLHVNVSVFESYCCHLEREVSF  193

Query  234  GGGYQIERTLRCAQDIKSKQ  175
            GGGYQIE+ LRCA++IKS+Q
Sbjct  194  GGGYQIEKALRCAEEIKSRQ  213



>ref|XP_002880155.1| CYCP3_1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56414.1| CYCP3_1 [Arabidopsis lyrata subsp. lyrata]
Length=222

 Score =   300 bits (769),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 146/199 (73%), Positives = 170/199 (85%), Gaps = 6/199 (3%)
 Frame = -1

Query  768  LRDDLYLYAYQEQSST-PLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNE  592
            LR DLY Y+YQ+ S+T PLVISVL+SLI RT+ RN+RI+R++ G      G T+VF+C E
Sbjct  11   LRSDLYSYSYQDDSNTVPLVISVLSSLIERTLARNERISRSYGG-----FGKTRVFDCRE  65

Query  591  APDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVAS  412
             PDMTI+SYLER+FRYT AGPSVYVVAYVY+DRFCQ +  FRI  TNVHRLLITTIM+AS
Sbjct  66   IPDMTIQSYLERIFRYTKAGPSVYVVAYVYIDRFCQNNQGFRISLTNVHRLLITTIMIAS  125

Query  411  KYVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIG  232
            KYVEDMNYRNSYFA+VGGL T ++N LE+EFLFLM FKLHVNVSVF SYCCHLEREV IG
Sbjct  126  KYVEDMNYRNSYFAKVGGLETEDLNNLELEFLFLMGFKLHVNVSVFESYCCHLEREVSIG  185

Query  231  GGYQIERTLRCAQDIKSKQ  175
            GGYQIE+ LRCA++IKS+Q
Sbjct  186  GGYQIEKALRCAEEIKSRQ  204



>ref|XP_008375806.1| PREDICTED: cyclin-U2-1-like isoform X2 [Malus domestica]
Length=225

 Score =   300 bits (769),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 146/214 (68%), Positives = 171/214 (80%), Gaps = 7/214 (3%)
 Frame = -1

Query  768  LRDDLYLYAYQEQSSTPLVISVLASLIGRTVTRNQRIARNFRGA--MDINVGSTKVFECN  595
            LR DLY Y+YQ+ S TPLV++VLASLI R + RNQRIA+N      M  ++  T++FEC+
Sbjct  17   LRSDLYSYSYQDDSETPLVVNVLASLIERNMARNQRIAKNCSSPWYMSKDMKKTRIFECH  76

Query  594  EAPDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVA  415
            E PD+TI+SYLER+FRYT AGPSVYVVAYVY+DRFCQ +P F+I  TNVHRLLITTIMVA
Sbjct  77   EXPDLTIQSYLERIFRYTRAGPSVYVVAYVYIDRFCQNNPAFKINVTNVHRLLITTIMVA  136

Query  414  SKYVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGI  235
            SK     NYRNSYFARVGG TT E+NKLE+EFLFLM FKLHVNVSVF SYCCHLEREV I
Sbjct  137  SK-----NYRNSYFARVGGXTTNELNKLELEFLFLMGFKLHVNVSVFESYCCHLEREVSI  191

Query  234  GGGYQIERTLRCAQDIKSKQREDTTFTQVTSLLL  133
            GGGY IE TLRCA++IK +Q E+  + Q   +LL
Sbjct  192  GGGYHIESTLRCAEEIKRRQNEERRYNQFAGVLL  225



>ref|NP_182034.1| cyclin p3;1 [Arabidopsis thaliana]
 sp|Q9SHD3.1|CCU21_ARATH RecName: Full=Cyclin-U2-1; Short=CycU2;1; AltName: Full=Cyclin-P3.1; 
Short=CycP3;1 [Arabidopsis thaliana]
 gb|AAL69466.1| At2g45080/T14P1.11 [Arabidopsis thaliana]
 gb|AEC10506.1| cyclin p3;1 [Arabidopsis thaliana]
Length=222

 Score =   300 bits (767),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 145/199 (73%), Positives = 170/199 (85%), Gaps = 6/199 (3%)
 Frame = -1

Query  768  LRDDLYLYAYQEQSST-PLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNE  592
            LR DLY Y+YQ+ S+T PLVISVL+SLI RT+ RN+RI+R++ G      G T+VF+C E
Sbjct  11   LRSDLYSYSYQDDSNTVPLVISVLSSLIERTLARNERISRSYGG-----FGKTRVFDCRE  65

Query  591  APDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVAS  412
             PDMTI+SYLER+FRYT AGPSVYVVAYVY+DRFCQ +  FRI  TNVHRLLITTIM+AS
Sbjct  66   IPDMTIQSYLERIFRYTKAGPSVYVVAYVYIDRFCQNNQGFRISLTNVHRLLITTIMIAS  125

Query  411  KYVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIG  232
            KYVEDMNY+NSYFA+VGGL T ++N LE+EFLFLM FKLHVNVSVF SYCCHLEREV IG
Sbjct  126  KYVEDMNYKNSYFAKVGGLETEDLNNLELEFLFLMGFKLHVNVSVFESYCCHLEREVSIG  185

Query  231  GGYQIERTLRCAQDIKSKQ  175
            GGYQIE+ LRCA++IKS+Q
Sbjct  186  GGYQIEKALRCAEEIKSRQ  204



>ref|XP_009104271.1| PREDICTED: cyclin-U2-2-like [Brassica rapa]
Length=220

 Score =   300 bits (767),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 142/200 (71%), Positives = 168/200 (84%), Gaps = 2/200 (1%)
 Frame = -1

Query  768  LRDDLYLYAYQEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAM--DINVGSTKVFECN  595
            LR DLY Y+YQ+ S TPLVIS+L+SLI RT+TRNQRI+R    A       G T +F+C 
Sbjct  14   LRSDLYSYSYQDNSKTPLVISLLSSLIDRTLTRNQRISRRASPACYSSCGGGKTHIFDCR  73

Query  594  EAPDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVA  415
            E PD+TI+SYLER+FRYT AGPSVYVVAYVY+DRFCQ++P F+I  TNVHRLLITTIM+A
Sbjct  74   EIPDLTIQSYLERIFRYTKAGPSVYVVAYVYIDRFCQINPGFKISLTNVHRLLITTIMIA  133

Query  414  SKYVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGI  235
            SKYVED+NYRNSYFA+VGGL T ++N+LE+EFLFLM FKLHVNVSVF SYCCHLEREV  
Sbjct  134  SKYVEDLNYRNSYFAKVGGLETEDLNRLELEFLFLMGFKLHVNVSVFESYCCHLEREVSF  193

Query  234  GGGYQIERTLRCAQDIKSKQ  175
            GGGY+IE+ LRCA++IKS Q
Sbjct  194  GGGYRIEKALRCAEEIKSGQ  213



>emb|CDX67834.1| BnaA07g18740D [Brassica napus]
Length=231

 Score =   299 bits (765),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 142/200 (71%), Positives = 168/200 (84%), Gaps = 2/200 (1%)
 Frame = -1

Query  768  LRDDLYLYAYQEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAM--DINVGSTKVFECN  595
            LR DLY Y+YQ+ S TPLVIS+L+SLI RT+TRNQRI+R    A       G T +F+C 
Sbjct  14   LRSDLYSYSYQDNSKTPLVISLLSSLIDRTLTRNQRISRRASPACYSSCGGGKTHIFDCR  73

Query  594  EAPDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVA  415
            E PD+TI+SYLER+FRYT AGPSVYVVAYVY+DRFCQ++P F+I  TNVHRLLITTIM+A
Sbjct  74   EIPDLTIQSYLERIFRYTKAGPSVYVVAYVYIDRFCQINPGFKISLTNVHRLLITTIMIA  133

Query  414  SKYVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGI  235
            SKYVED+NYRNSYFA+VGGL T ++N+LE+EFLFLM FKLHVNVSVF SYCCHLEREV  
Sbjct  134  SKYVEDLNYRNSYFAKVGGLETEDLNRLELEFLFLMGFKLHVNVSVFESYCCHLEREVSF  193

Query  234  GGGYQIERTLRCAQDIKSKQ  175
            GGGY+IE+ LRCA++IKS Q
Sbjct  194  GGGYRIEKALRCAEEIKSGQ  213



>ref|XP_010518122.1| PREDICTED: cyclin-U2-1-like [Camelina sativa]
Length=220

 Score =   298 bits (764),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 148/215 (69%), Positives = 175/215 (81%), Gaps = 8/215 (4%)
 Frame = -1

Query  768  LRDDLYLYAYQE--QSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECN  595
            LR DLY Y+YQ+   S+TPLVISVL+SLI RT+  N+RI+R++ G      G T+VF+C 
Sbjct  11   LRSDLYSYSYQDDSNSNTPLVISVLSSLIERTLAWNERISRSYGG-----FGKTRVFDCR  65

Query  594  EAPDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVA  415
            E PDMTI+SYLER+FRYT AGPSVYVVAYVY+DRFCQ +  FRI  TNVHRLLITTIM+A
Sbjct  66   EIPDMTIQSYLERIFRYTKAGPSVYVVAYVYIDRFCQNNQGFRISLTNVHRLLITTIMIA  125

Query  414  SKYVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGI  235
            SKYVEDMNYRNSYFA+VGGL T ++N LE+EFLFLM FKLHVNVSVF SYC HLEREV I
Sbjct  126  SKYVEDMNYRNSYFAKVGGLETEDLNNLEIEFLFLMGFKLHVNVSVFESYCSHLEREVSI  185

Query  234  GGGYQIERTLRCAQDIKSKQR-EDTTFTQVTSLLL  133
            GGGYQIE+ LRCA++IKS+Q  +D    Q + +LL
Sbjct  186  GGGYQIEKALRCAEEIKSRQTVQDPKHHQFSRILL  220



>emb|CDX98427.1| BnaC06g17880D [Brassica napus]
Length=232

 Score =   298 bits (764),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 140/200 (70%), Positives = 167/200 (84%), Gaps = 2/200 (1%)
 Frame = -1

Query  768  LRDDLYLYAYQEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAM--DINVGSTKVFECN  595
            LR DLY Y+YQ+ S TPLVIS+L+SLI RT+TRNQRI+R    A       G T +F+C 
Sbjct  14   LRSDLYSYSYQDNSKTPLVISLLSSLIDRTLTRNQRISRKASPASYSSCGGGKTHIFDCR  73

Query  594  EAPDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVA  415
            E PD+TI+SYLER+FRYT AGPS+YVVAYVY+DRFCQ +P F+I  TNVHRLLITTIM+A
Sbjct  74   EIPDLTIQSYLERIFRYTKAGPSIYVVAYVYIDRFCQFNPGFKISLTNVHRLLITTIMIA  133

Query  414  SKYVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGI  235
            SKYVE++NY+NSYFA+VGGL T ++N+LE+EFLFLM FKLHVNVSVF SYCCHLEREV  
Sbjct  134  SKYVENLNYKNSYFAKVGGLETEDLNRLELEFLFLMGFKLHVNVSVFESYCCHLEREVSF  193

Query  234  GGGYQIERTLRCAQDIKSKQ  175
            GGGYQIE+ LRCA++IKS Q
Sbjct  194  GGGYQIEKALRCAEEIKSGQ  213



>ref|XP_009133697.1| PREDICTED: cyclin-U2-1-like [Brassica rapa]
Length=224

 Score =   298 bits (762),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 144/198 (73%), Positives = 168/198 (85%), Gaps = 5/198 (3%)
 Frame = -1

Query  768  LRDDLYLYAYQEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEA  589
            LR DLY Y+Y++ S+TPLVISVL+S+I RTV RN+RI+ ++ G      G T VF+C E 
Sbjct  14   LRSDLYSYSYRDGSNTPLVISVLSSVIERTVARNERISPSYGG-----FGKTCVFDCMEV  68

Query  588  PDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASK  409
            PDMTI+SYLER+FRYT AGPSVYVVAYVY+DRFCQ +  FRI  TNVHRLLITTIM+ASK
Sbjct  69   PDMTIQSYLERIFRYTKAGPSVYVVAYVYIDRFCQNNQGFRISLTNVHRLLITTIMIASK  128

Query  408  YVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGG  229
            YVEDMNYRNSYFA+VGGL T ++N +E+EFLFLM FKLHVNVSVF SYCCHLEREV IGG
Sbjct  129  YVEDMNYRNSYFAKVGGLETEDLNNMELEFLFLMGFKLHVNVSVFESYCCHLEREVSIGG  188

Query  228  GYQIERTLRCAQDIKSKQ  175
            GYQIE+ LRCA++IKSKQ
Sbjct  189  GYQIEKALRCAEEIKSKQ  206



>ref|XP_010524404.1| PREDICTED: cyclin-U2-2 [Tarenaya hassleriana]
Length=221

 Score =   297 bits (760),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 142/198 (72%), Positives = 164/198 (83%), Gaps = 2/198 (1%)
 Frame = -1

Query  768  LRDDLYLYAYQEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEA  589
            LR DLY  +YQ+    PLVISVL+SLI RT+ RN+RI  + R A     G T+VF+C E 
Sbjct  14   LRSDLYSRSYQDDQDMPLVISVLSSLIERTLARNERITGSCRWAS--RDGKTRVFDCREV  71

Query  588  PDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASK  409
            PDMTI+SYLER+FRYT AGPSVYVVAYVY+DRFCQ +P FRI P NVHRLLITTIMV+SK
Sbjct  72   PDMTIQSYLERIFRYTKAGPSVYVVAYVYIDRFCQTNPGFRISPRNVHRLLITTIMVSSK  131

Query  408  YVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGG  229
            YVEDMNYRNSY A+VGGL T ++N++EVEFLFLM FKLHVNVSVF SYCCHLEREV  GG
Sbjct  132  YVEDMNYRNSYMAKVGGLETEDLNRMEVEFLFLMGFKLHVNVSVFESYCCHLEREVSFGG  191

Query  228  GYQIERTLRCAQDIKSKQ  175
            G+QIER LRCA++IKS+Q
Sbjct  192  GFQIERALRCAEEIKSRQ  209



>ref|XP_010692155.1| PREDICTED: cyclin-U2-1 [Beta vulgaris subsp. vulgaris]
Length=221

 Score =   296 bits (759),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 144/212 (68%), Positives = 170/212 (80%), Gaps = 2/212 (1%)
 Frame = -1

Query  768  LRDDLYLYAYQEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEA  589
            LR DLY  +YQ+    PLV+SVL++LI R + RN+RI+RN +  +      T+VF+  EA
Sbjct  12   LRSDLY--SYQDIPDMPLVVSVLSALIERHMARNERISRNCKRVIMSKDTRTRVFDAYEA  69

Query  588  PDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASK  409
            PDMTI+S+LER+FRYT AGPSVYVVAYVY+DR CQ +P F+I P+NVHRLLITTIMVASK
Sbjct  70   PDMTIQSFLERIFRYTKAGPSVYVVAYVYIDRLCQNYPGFKISPSNVHRLLITTIMVASK  129

Query  408  YVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGG  229
            YVEDMNYRNSYFARVGGLTT EMNKLEV+FLFLM FKLHVNVSVF SYCCHLEREV IGG
Sbjct  130  YVEDMNYRNSYFARVGGLTTKEMNKLEVDFLFLMGFKLHVNVSVFESYCCHLEREVSIGG  189

Query  228  GYQIERTLRCAQDIKSKQREDTTFTQVTSLLL  133
            GY IE+ LRCA++IK  Q  D  + Q+  + L
Sbjct  190  GYHIEKALRCAEEIKIGQCVDKRYGQIARITL  221



>emb|CDX95626.1| BnaC03g25070D [Brassica napus]
 emb|CDX83405.1| BnaA03g21010D [Brassica napus]
Length=224

 Score =   296 bits (759),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 143/198 (72%), Positives = 168/198 (85%), Gaps = 5/198 (3%)
 Frame = -1

Query  768  LRDDLYLYAYQEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEA  589
            LR DLY Y+Y++ S+TPLVISVL+S+I RTV RN+RI+ ++ G      G T VF+C E 
Sbjct  14   LRSDLYSYSYRDGSNTPLVISVLSSVIERTVARNERISPSYGG-----FGKTCVFDCMEV  68

Query  588  PDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASK  409
            PDMTI+SYLER+FRYT AGPSVYVVAYVY+DRFCQ +  FRI  TNVHRLLITTIM+ASK
Sbjct  69   PDMTIQSYLERIFRYTKAGPSVYVVAYVYIDRFCQNNQGFRISLTNVHRLLITTIMIASK  128

Query  408  YVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGG  229
            YVEDMNYRNSYFA+VGGL T ++N +E+EFLFLM FKLHVN+SVF SYCCHLEREV IGG
Sbjct  129  YVEDMNYRNSYFAKVGGLETEDLNNMELEFLFLMGFKLHVNLSVFESYCCHLEREVSIGG  188

Query  228  GYQIERTLRCAQDIKSKQ  175
            GYQIE+ LRCA++IKSKQ
Sbjct  189  GYQIEKALRCAEEIKSKQ  206



>ref|XP_004140492.1| PREDICTED: cyclin-U2-1-like [Cucumis sativus]
 gb|KGN46558.1| hypothetical protein Csa_6G108560 [Cucumis sativus]
Length=226

 Score =   296 bits (758),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 147/218 (67%), Positives = 175/218 (80%), Gaps = 14/218 (6%)
 Frame = -1

Query  768  LRDDLYLYAYQEQ-SSTPLVISVLASLIGRTVTRNQRIARNF---RGAMDINVGSTKVFE  601
            LR DLY Y++ E  S  PLVISV+ASLI R + RN RIARN+   +GA+        VF+
Sbjct  17   LRSDLYSYSHSEDYSKIPLVISVVASLIERNMARNHRIARNYTSSKGAV--------VFD  68

Query  600  C-NEAPDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTI  424
            C +EAPDM+I+ YLER+FRYT A P VYVVAYVY+DRFCQ +P FRI   NVHRLLITT+
Sbjct  69   CRDEAPDMSIQCYLERIFRYTKAAPCVYVVAYVYIDRFCQQNPSFRITLRNVHRLLITTV  128

Query  423  MVASKYVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLERE  244
            MVASKYVEDMNYRNSY+ARVGGLTT EMN+LE++FLFLMRFK HVN+SVF SYCCHLERE
Sbjct  129  MVASKYVEDMNYRNSYYARVGGLTTKEMNQLEMDFLFLMRFKCHVNLSVFESYCCHLERE  188

Query  243  VGIGGGYQIERTLRCAQDIKSKQREDTTF-TQVTSLLL  133
            V IGGGY IERTLRCA+++KSKQ + TT+  Q+  ++L
Sbjct  189  VSIGGGYHIERTLRCAEELKSKQNQQTTYINQIARIML  226



>ref|XP_004164976.1| PREDICTED: LOW QUALITY PROTEIN: cyclin-U2-1-like [Cucumis sativus]
Length=226

 Score =   295 bits (755),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 147/218 (67%), Positives = 174/218 (80%), Gaps = 14/218 (6%)
 Frame = -1

Query  768  LRDDLYLYAYQEQ-SSTPLVISVLASLIGRTVTRNQRIARNF---RGAMDINVGSTKVFE  601
            LR DLY Y++ E  S  PLVISV+ASLI R + RN RIARN+   +GA+        VF+
Sbjct  17   LRSDLYSYSHSEDYSKIPLVISVVASLIERNMARNHRIARNYTSSKGAV--------VFD  68

Query  600  C-NEAPDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTI  424
            C +EAPDM+I+ YLER+FRYT A P VYVVAYVY+DRFCQ +P FRI   NVHRLLITT+
Sbjct  69   CRDEAPDMSIQCYLERIFRYTKAAPCVYVVAYVYIDRFCQQNPSFRITLRNVHRLLITTV  128

Query  423  MVASKYVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLERE  244
            MVASKYVEDMNYRNSY+ARVGGLTT EMN+LE+ FLFLMRFK HVN+SVF SYCCHLERE
Sbjct  129  MVASKYVEDMNYRNSYYARVGGLTTKEMNQLEMXFLFLMRFKCHVNLSVFESYCCHLERE  188

Query  243  VGIGGGYQIERTLRCAQDIKSKQREDTTF-TQVTSLLL  133
            V IGGGY IERTLRCA+++KSKQ + TT+  Q+  ++L
Sbjct  189  VSIGGGYHIERTLRCAEELKSKQNQQTTYINQIARIML  226



>ref|XP_010469167.1| PREDICTED: cyclin-U2-2-like [Camelina sativa]
Length=231

 Score =   294 bits (752),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 143/199 (72%), Positives = 164/199 (82%), Gaps = 2/199 (1%)
 Frame = -1

Query  768  LRDDLYLYAY-QEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNE  592
            LR DLY Y+  Q  S TPLVISVL+SLI RT+TRNQRI+   R     +   T++F+  E
Sbjct  14   LRSDLYSYSNNQNNSETPLVISVLSSLIERTLTRNQRISSR-RTVPASSSSKTQIFDSRE  72

Query  591  APDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVAS  412
             PDMTI+SYLER+FRYT AGPSVYVVAYVY+DRFCQ +P FRI  TNVHRLLITTIM+AS
Sbjct  73   IPDMTIQSYLERIFRYTKAGPSVYVVAYVYIDRFCQTNPGFRISLTNVHRLLITTIMIAS  132

Query  411  KYVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIG  232
            KYVED+NYRNSYFA+VGGL T E+NKLE+EFLF M FKLHVNVSVF SYCCHLEREV  G
Sbjct  133  KYVEDLNYRNSYFAKVGGLETEELNKLELEFLFSMGFKLHVNVSVFESYCCHLEREVSFG  192

Query  231  GGYQIERTLRCAQDIKSKQ  175
            GGYQIE+ LRCA++IKS+Q
Sbjct  193  GGYQIEKALRCAEEIKSRQ  211



>ref|XP_010512385.1| PREDICTED: cyclin-U2-2 [Camelina sativa]
Length=229

 Score =   293 bits (750),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 141/199 (71%), Positives = 163/199 (82%), Gaps = 1/199 (1%)
 Frame = -1

Query  768  LRDDLYLYAY-QEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNE  592
            LR DLY Y+  Q  S TPLVISVL+SLI RT+TRNQRI+         +   T++F+  E
Sbjct  14   LRSDLYSYSNNQNNSETPLVISVLSSLIERTLTRNQRISSRRTVPASSSSSKTQIFDSRE  73

Query  591  APDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVAS  412
             PDMTI+SYLER+FRYT AGPSVYVVAYVY+DRFCQ +P FRI  TNVHRLLITTIM+AS
Sbjct  74   IPDMTIQSYLERIFRYTKAGPSVYVVAYVYIDRFCQTNPGFRISLTNVHRLLITTIMIAS  133

Query  411  KYVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIG  232
            KYVED+NYRNSY+A+VGGL T E+NKLE+EFLF M FKLHVNVSVF SYCCHLEREV  G
Sbjct  134  KYVEDLNYRNSYYAKVGGLETEELNKLELEFLFSMGFKLHVNVSVFESYCCHLEREVSFG  193

Query  231  GGYQIERTLRCAQDIKSKQ  175
            GGYQIE+ LRCA++IKS+Q
Sbjct  194  GGYQIEKALRCAEEIKSRQ  212



>ref|XP_010413544.1| PREDICTED: cyclin-U2-2-like [Camelina sativa]
Length=228

 Score =   293 bits (749),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 143/199 (72%), Positives = 164/199 (82%), Gaps = 2/199 (1%)
 Frame = -1

Query  768  LRDDLYLYAY-QEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNE  592
            LR DLY Y+  Q  S TPLVISVL+SLI RT+TRNQRI+   R     +   T++F+  E
Sbjct  14   LRSDLYSYSNNQNNSETPLVISVLSSLIERTLTRNQRISSR-RTVPASSSSKTQIFDSRE  72

Query  591  APDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVAS  412
             PDMTI+SYLER+FRYT AGPSVYVVAYVY+DRFCQ +P FRI  TNVHRLLITTIM+AS
Sbjct  73   IPDMTIQSYLERIFRYTKAGPSVYVVAYVYIDRFCQTNPGFRISLTNVHRLLITTIMIAS  132

Query  411  KYVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIG  232
            KYVED+NYRNSYFA+VGGL T E+NKLE+EFLF M FKLHVNVSVF SYCCHLEREV  G
Sbjct  133  KYVEDLNYRNSYFAKVGGLETEELNKLELEFLFSMGFKLHVNVSVFESYCCHLEREVSFG  192

Query  231  GGYQIERTLRCAQDIKSKQ  175
            GGYQIE+ LRCA++IKS+Q
Sbjct  193  GGYQIEKALRCAEEIKSRQ  211



>ref|XP_003517014.1| PREDICTED: cyclin-U2-1-like [Glycine max]
 gb|KHN11865.1| Cyclin-U2-1 [Glycine soja]
Length=224

 Score =   292 bits (747),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 153/212 (72%), Positives = 178/212 (84%), Gaps = 1/212 (0%)
 Frame = -1

Query  768  LRDDLYLYAYQEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEA  589
            LR DLY Y+Y+E S+TPLVI+VLASLI R++ R QRI +N   A+   V ST +F+C E 
Sbjct  14   LRYDLYSYSYKEDSNTPLVINVLASLIERSMARTQRIVKNCSNALS-KVISTNIFDCREI  72

Query  588  PDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASK  409
            PDMTIESYLER+FRYT AGPSVYVVAYVY+DRFCQ +P FRI   NVHRLLITTIMVASK
Sbjct  73   PDMTIESYLERIFRYTRAGPSVYVVAYVYIDRFCQNNPGFRINTRNVHRLLITTIMVASK  132

Query  408  YVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGG  229
            YVEDMN+RNSYFARVGGL T E+N+LE+EFLFLM FKLHVNVSVF SYCCHLEREV IGG
Sbjct  133  YVEDMNFRNSYFARVGGLRTNELNELELEFLFLMGFKLHVNVSVFESYCCHLEREVSIGG  192

Query  228  GYQIERTLRCAQDIKSKQREDTTFTQVTSLLL  133
            GY IERTLRCA++IK+K  E+  +TQ+T ++L
Sbjct  193  GYHIERTLRCAEEIKAKNIEERGYTQITRVML  224



>ref|XP_007134728.1| hypothetical protein PHAVU_010G070800g [Phaseolus vulgaris]
 gb|ESW06722.1| hypothetical protein PHAVU_010G070800g [Phaseolus vulgaris]
Length=224

 Score =   288 bits (736),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 150/212 (71%), Positives = 179/212 (84%), Gaps = 1/212 (0%)
 Frame = -1

Query  768  LRDDLYLYAYQEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEA  589
            LR DLY Y+Y+E S+TPLVI+VLASLI R++ R QRI +N   A+   + ST +F+C E 
Sbjct  14   LRYDLYSYSYKEDSNTPLVINVLASLIERSMARTQRIVKNCSSALSKAI-STNIFDCREI  72

Query  588  PDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASK  409
            PDMTI+SYLER+FRYT AGPSVYVVAYVY+DRFCQ +P FRI   NVHRLLITTIMVASK
Sbjct  73   PDMTIQSYLERIFRYTRAGPSVYVVAYVYIDRFCQNNPGFRINARNVHRLLITTIMVASK  132

Query  408  YVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGG  229
            YVEDMN+RNSYFARVGGLTT E+N+LE+EFLF+M FKLHVNVSVF SYCCHLEREV IGG
Sbjct  133  YVEDMNFRNSYFARVGGLTTNELNELELEFLFMMGFKLHVNVSVFESYCCHLEREVSIGG  192

Query  228  GYQIERTLRCAQDIKSKQREDTTFTQVTSLLL  133
            GY IERTLRCA++IK++  E+  +TQ+T ++L
Sbjct  193  GYHIERTLRCAEEIKARHTEERGYTQITRVML  224



>ref|XP_004504529.1| PREDICTED: cyclin-U2-1-like [Cicer arietinum]
Length=224

 Score =   287 bits (734),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 146/212 (69%), Positives = 177/212 (83%), Gaps = 0/212 (0%)
 Frame = -1

Query  768  LRDDLYLYAYQEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEA  589
            LR DLY Y+Y+E S+ PLVI+VLASLI R + R QRI +N   A+   + +  +F+C E 
Sbjct  13   LRYDLYSYSYKEDSNIPLVINVLASLIERNMARTQRIVKNCSRALSKAISTNNIFDCREI  72

Query  588  PDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASK  409
            PDMTI+SYLER+FRYT AGPSVYVVAYVY+DRFCQ +P FRI   NVHRLLITTIMVASK
Sbjct  73   PDMTIQSYLERIFRYTRAGPSVYVVAYVYIDRFCQNNPGFRINSRNVHRLLITTIMVASK  132

Query  408  YVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGG  229
            YVEDMN+RNSYFA+VGGLTT E+N+LE+EFLF+M FKLHVN+SVF SYCCHLEREV IGG
Sbjct  133  YVEDMNFRNSYFAKVGGLTTNELNELELEFLFMMSFKLHVNLSVFESYCCHLEREVSIGG  192

Query  228  GYQIERTLRCAQDIKSKQREDTTFTQVTSLLL  133
            GY IE+TLRCA++IK +QRE+  +TQ+T ++L
Sbjct  193  GYHIEKTLRCAEEIKGRQREERGYTQITHVML  224



>ref|XP_010264309.1| PREDICTED: cyclin-U2-1-like [Nelumbo nucifera]
Length=229

 Score =   285 bits (730),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 136/213 (64%), Positives = 171/213 (80%), Gaps = 3/213 (1%)
 Frame = -1

Query  768  LRDDLYLYAYQEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEA  589
            LR DLY ++YQ++S++PLVISVLASLI R++ RN+R +R     +  +    + F C + 
Sbjct  13   LRSDLYSFSYQDESNSPLVISVLASLIERSMARNERTSRRSSWMLPKD-PRIREFYCYQV  71

Query  588  PDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASK  409
            PDMTI+S+LER+FRYT  GP VYVVAY Y+DR CQ+HP+FRI  +NV+RLL+TTIMVASK
Sbjct  72   PDMTIQSFLERIFRYTRVGPPVYVVAYAYIDRLCQMHPEFRITSSNVYRLLVTTIMVASK  131

Query  408  YVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGG  229
            +VEDMNYRNSYFA+VGGLTT E+N+LEV+FLFLM FKLHVNVSVF SYCCHLEREV IGG
Sbjct  132  FVEDMNYRNSYFAKVGGLTTKELNRLEVDFLFLMGFKLHVNVSVFESYCCHLEREVSIGG  191

Query  228  GYQIERTLR--CAQDIKSKQREDTTFTQVTSLL  136
            GY IERTLR  CA +I SK R++  F ++  ++
Sbjct  192  GYHIERTLRFMCAGEINSKHRDEHDFNKLARIV  224



>ref|XP_006402570.1| hypothetical protein EUTSA_v10006220mg [Eutrema salsugineum]
 gb|ESQ44023.1| hypothetical protein EUTSA_v10006220mg [Eutrema salsugineum]
Length=232

 Score =   285 bits (729),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 140/200 (70%), Positives = 166/200 (83%), Gaps = 2/200 (1%)
 Frame = -1

Query  768  LRDDLYLYAYQEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVG--STKVFECN  595
            LR DLY Y+ Q+    PLVISVL+SLI RT+TRNQRI+R    +   +     T++F+C 
Sbjct  14   LRSDLYSYSNQDNPEIPLVISVLSSLIDRTLTRNQRISRRASPSSSSSAAGCKTQIFDCR  73

Query  594  EAPDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVA  415
            E PDMTI+SYLER+FRYT AGPSVYVVAYVY+DRFCQ +P FRI  TNVHRLLITTIM+A
Sbjct  74   EIPDMTIQSYLERIFRYTKAGPSVYVVAYVYIDRFCQTNPGFRISLTNVHRLLITTIMIA  133

Query  414  SKYVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGI  235
            SKYVED+NYRNSYFA+VGGL T ++N+LE++FLFLM FKLHVNVSVF SYCCHLEREV  
Sbjct  134  SKYVEDLNYRNSYFAKVGGLETEDLNRLELKFLFLMGFKLHVNVSVFESYCCHLEREVSF  193

Query  234  GGGYQIERTLRCAQDIKSKQ  175
            GGGYQIE+ LRCA++IKS+Q
Sbjct  194  GGGYQIEKALRCAEEIKSRQ  213



>gb|KHM99414.1| Cyclin-U2-1 [Glycine soja]
Length=224

 Score =   284 bits (726),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 149/212 (70%), Positives = 178/212 (84%), Gaps = 1/212 (0%)
 Frame = -1

Query  768  LRDDLYLYAYQEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEA  589
            LR DLY Y+Y+E S+TPLVI+VLASLI R++ R QRI +N   ++   + ST +F+C E 
Sbjct  14   LRYDLYSYSYKEDSNTPLVINVLASLIERSMARTQRIVKNCSNSLSKAI-STNIFDCREI  72

Query  588  PDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASK  409
            PD+TI+SYLER+FRYT AGPSVYVVAYVY+DRFCQ +P FRI   NVHRLLITTIMVASK
Sbjct  73   PDLTIQSYLERIFRYTRAGPSVYVVAYVYIDRFCQNNPGFRINARNVHRLLITTIMVASK  132

Query  408  YVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGG  229
            YVEDMN+RNSYFARVGGLTT E+N+LE+EFLF+M FKLHVNVSVF SYCCHLEREV IGG
Sbjct  133  YVEDMNFRNSYFARVGGLTTNELNELELEFLFMMGFKLHVNVSVFESYCCHLEREVSIGG  192

Query  228  GYQIERTLRCAQDIKSKQREDTTFTQVTSLLL  133
            GY IERTLRCA++IK+K  E   +TQ+T ++L
Sbjct  193  GYHIERTLRCAEEIKAKNIEGRGYTQITRVML  224



>ref|XP_008459728.1| PREDICTED: cyclin-U2-1 [Cucumis melo]
Length=297

 Score =   285 bits (730),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 139/201 (69%), Positives = 166/201 (83%), Gaps = 13/201 (6%)
 Frame = -1

Query  720  PLVISVLASLIGRTVTRNQRIARNF---RGAMDINVGSTKVFEC-NEAPDMTIESYLERV  553
            PLVISV+ASLI R + RN RIARN+   +GA+        VF+C +EAPDM+I+ YLER+
Sbjct  105  PLVISVVASLIERNMARNHRIARNYMSSKGAV--------VFDCRDEAPDMSIQRYLERI  156

Query  552  FRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYF  373
            FRYT A PSVYVVAYVY+DRFCQ +P FRI   NVHRLLITT+MVASKYVEDMNYRNSY+
Sbjct  157  FRYTKAAPSVYVVAYVYIDRFCQQNPSFRITLRNVHRLLITTVMVASKYVEDMNYRNSYY  216

Query  372  ARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQIERTLRCAQ  193
            ARVGGLTT EMN+LE++FLFLM+FK HVN+SVF SYCCHLEREV IGGGY IERTLRCA+
Sbjct  217  ARVGGLTTKEMNQLEMDFLFLMKFKCHVNLSVFESYCCHLEREVSIGGGYHIERTLRCAE  276

Query  192  DIKSKQREDTTF-TQVTSLLL  133
            ++KSKQ + TT+  Q+  ++L
Sbjct  277  ELKSKQNQQTTYINQIARIML  297



>ref|XP_010258918.1| PREDICTED: cyclin-U2-1 [Nelumbo nucifera]
Length=232

 Score =   281 bits (719),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 140/201 (70%), Positives = 164/201 (82%), Gaps = 5/201 (2%)
 Frame = -1

Query  768  LRDDLYLYAYQEQS--STPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECN  595
            LR DLY ++ QE S  STPLVISVLASL+ RT+ RN+RI+   R A+  +     VFEC 
Sbjct  13   LRSDLYTFSSQEDSTSSTPLVISVLASLLERTIARNERISGKCRWALPKD-ARIHVFECC  71

Query  594  EAPDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVA  415
            + P+MTI+S+LER+FRYT     VYVVAYVY+DR CQ+ P+FRI  +NV+RLLITTIMVA
Sbjct  72   QVPNMTIQSFLERIFRYTRVASPVYVVAYVYIDRLCQIQPEFRITSSNVYRLLITTIMVA  131

Query  414  SKYVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGI  235
            SK+VEDMNYRNSYFA+VGGLTT EMNKLEV+FLFLM F+LHVNVSVF SYCCHLEREV I
Sbjct  132  SKFVEDMNYRNSYFAKVGGLTTKEMNKLEVDFLFLMGFRLHVNVSVFESYCCHLEREVSI  191

Query  234  GGGYQIERTLR--CAQDIKSK  178
            GGGYQIERTLR  C+ DIKS+
Sbjct  192  GGGYQIERTLRSMCSGDIKSE  212



>ref|XP_010264310.1| PREDICTED: cyclin-U2-2-like isoform X1 [Nelumbo nucifera]
Length=220

 Score =   275 bits (703),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 135/202 (67%), Positives = 162/202 (80%), Gaps = 7/202 (3%)
 Frame = -1

Query  768  LRDDLYLYAYQEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFE--CN  595
             R DLY  +YQE S+ PLVI V+ASL+ RT+ +N+RIA     ++ ++  S   FE  C 
Sbjct  13   FRSDLY-SSYQEDSNIPLVIYVVASLLERTIAKNERIATKCSRSLSMDSRSLAAFEFDCY  71

Query  594  EAPDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVA  415
            EAP+M I+S+LER+ RYTG GP VYVVAYVY+DR CQ+HP+FRI  TNVHRLLITTIMVA
Sbjct  72   EAPNMEIQSFLERISRYTGVGPPVYVVAYVYIDRLCQIHPEFRITSTNVHRLLITTIMVA  131

Query  414  SKYVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGI  235
            SK+VEDMNYRNSYFA+VGGLTT +MNKLEV+FLFL+ FKLHVNVSVF SYCCHLEREV +
Sbjct  132  SKFVEDMNYRNSYFAKVGGLTTNQMNKLEVDFLFLVGFKLHVNVSVFKSYCCHLEREVSV  191

Query  234  GGGYQIERTLRC----AQDIKS  181
            GGGYQIE TL+     A++IKS
Sbjct  192  GGGYQIESTLKSLWTEAEEIKS  213



>gb|ACU13246.1| unknown [Glycine max]
Length=226

 Score =   272 bits (695),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 143/200 (72%), Positives = 170/200 (85%), Gaps = 1/200 (1%)
 Frame = -1

Query  768  LRDDLYLYAYQEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEA  589
            LR DLY Y+Y+E S+TPLVI+VLASLI R++ R QRI +N   ++   + ST +F+C E 
Sbjct  14   LRYDLYSYSYKEDSNTPLVINVLASLIERSMARTQRIVKNCSNSLSKAI-STNIFDCREI  72

Query  588  PDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASK  409
            PD+TI+SYLER+FRYT AGPSVYVVAYVY+DRFCQ +P FRI   NVHRLLITTIMVASK
Sbjct  73   PDLTIQSYLERIFRYTRAGPSVYVVAYVYIDRFCQNNPGFRINARNVHRLLITTIMVASK  132

Query  408  YVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGG  229
            Y+EDMN+RNSYFARVGGLTT E+N+LE+EFLF+M FKLHVNVSVF SYCCHLEREV IGG
Sbjct  133  YMEDMNFRNSYFARVGGLTTNELNELELEFLFMMGFKLHVNVSVFESYCCHLEREVSIGG  192

Query  228  GYQIERTLRCAQDIKSKQRE  169
            GY IERTL+CA++IK+K  E
Sbjct  193  GYHIERTLKCAEEIKAKNIE  212



>ref|XP_003605284.1| Cyclin-U2-1 [Medicago truncatula]
 gb|AES87481.1| cyclin p4 [Medicago truncatula]
Length=218

 Score =   269 bits (687),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 142/209 (68%), Positives = 170/209 (81%), Gaps = 6/209 (3%)
 Frame = -1

Query  759  DLYLYAYQEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDM  580
            DLY Y+Y+E S+TPLVI+VLASLI R + R QRI +N    + ++  STK+F+C E PD+
Sbjct  16   DLYSYSYKEDSNTPLVINVLASLIERNMARAQRIVKNCSSRV-LSKASTKIFDCREIPDL  74

Query  579  TIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVE  400
            TI+SYLER+FRYT AGPSVYVVAYVY+DRFCQ +  FRI   NVHRLLITTIMVASKYVE
Sbjct  75   TIQSYLERIFRYTRAGPSVYVVAYVYIDRFCQNNLGFRINSRNVHRLLITTIMVASKYVE  134

Query  399  DMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQ  220
            DMN+RNSYFA+VGGLTT E+N+LE+EFLF+M FKLHVNVSVF SYC HLEREV IGGGY 
Sbjct  135  DMNFRNSYFAKVGGLTTSELNELELEFLFMMNFKLHVNVSVFESYCSHLEREVSIGGGYH  194

Query  219  IERTLRCAQDIKSKQREDTTFTQVTSLLL  133
            IERTLRCA++IK +       TQ+  ++L
Sbjct  195  IERTLRCAEEIKERGH-----TQIARVML  218



>gb|ACJ85224.1| unknown [Medicago truncatula]
 gb|AFK48737.1| unknown [Medicago truncatula]
Length=218

 Score =   266 bits (679),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 141/209 (67%), Positives = 169/209 (81%), Gaps = 6/209 (3%)
 Frame = -1

Query  759  DLYLYAYQEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDM  580
            DLY Y+Y+E S+TPLVI+VLASLI R + R QRI +N    + ++  STK+F+C E PD+
Sbjct  16   DLYSYSYKEDSNTPLVINVLASLIERNMARAQRIVKNCSSRV-LSKASTKIFDCREIPDL  74

Query  579  TIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVE  400
            TI+SYLER+FRYT AGPSVYVVAYVY+DRFCQ +  FRI   NVHRLLITTIMVASKYVE
Sbjct  75   TIQSYLERIFRYTRAGPSVYVVAYVYIDRFCQNNLGFRINSRNVHRLLITTIMVASKYVE  134

Query  399  DMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQ  220
            DMN+RNSYFA+VGGLTT E+N+LE+EFLF+M FKLHVNVSVF SYC HLEREV IGGGY 
Sbjct  135  DMNFRNSYFAKVGGLTTSELNELELEFLFMMNFKLHVNVSVFESYCSHLEREVSIGGGYP  194

Query  219  IERTLRCAQDIKSKQREDTTFTQVTSLLL  133
            IER LRCA++IK +       TQ+  ++L
Sbjct  195  IERPLRCAEEIKERGH-----TQIARVML  218



>ref|XP_010264311.1| PREDICTED: cyclin-U2-2-like isoform X2 [Nelumbo nucifera]
Length=217

 Score =   263 bits (672),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 132/202 (65%), Positives = 159/202 (79%), Gaps = 10/202 (5%)
 Frame = -1

Query  768  LRDDLYLYAYQEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFE--CN  595
             R DLY  +YQE S+ PLVI V+ASL+ RT+ +N+RIA     ++ ++  S   FE  C 
Sbjct  13   FRSDLY-SSYQEDSNIPLVIYVVASLLERTIAKNERIATKCSRSLSMDSRSLAAFEFDCY  71

Query  594  EAPDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVA  415
            EAP+M I+S+LER+ RYTG GP VYVVAYVY+DR CQ+HP+FRI  TNVHRLLITTIMVA
Sbjct  72   EAPNMEIQSFLERISRYTGVGPPVYVVAYVYIDRLCQIHPEFRITSTNVHRLLITTIMVA  131

Query  414  SKYVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGI  235
            SK+VEDM   NSYFA+VGGLTT +MNKLEV+FLFL+ FKLHVNVSVF SYCCHLEREV +
Sbjct  132  SKFVEDM---NSYFAKVGGLTTNQMNKLEVDFLFLVGFKLHVNVSVFKSYCCHLEREVSV  188

Query  234  GGGYQIERTLRC----AQDIKS  181
            GGGYQIE TL+     A++IKS
Sbjct  189  GGGYQIESTLKSLWTEAEEIKS  210



>ref|XP_010919573.1| PREDICTED: cyclin-U2-2-like [Elaeis guineensis]
Length=228

 Score =   249 bits (636),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 120/213 (56%), Positives = 157/213 (74%), Gaps = 3/213 (1%)
 Frame = -1

Query  768  LRDDLYLYAYQEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEA  589
            LR DLY ++ +E+ STPLVISVLASL+ RT+ RN+R+       + +    ++ F  ++ 
Sbjct  17   LRSDLYSFSCEEEPSTPLVISVLASLVERTIARNERVIGKC-SIVAVKDARSRAFYSHQV  75

Query  588  PDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASK  409
             DM+I+S+LER FRY    P VYVVAY+Y+DR CQL+P  ++   NVHRLLIT+IMVASK
Sbjct  76   LDMSIQSFLERFFRYAHVTPPVYVVAYIYMDRLCQLNPGLKVCLMNVHRLLITSIMVASK  135

Query  408  YVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGG  229
            +VED NY NSYFA+VGG++TME+N LE+ FLFLM+FKLHV+VSVF SYC HLEREV  GG
Sbjct  136  FVEDRNYWNSYFAKVGGISTMELNNLELNFLFLMKFKLHVSVSVFKSYCSHLEREVSFGG  195

Query  228  GYQIERTLR--CAQDIKSKQREDTTFTQVTSLL  136
            GY IER+L+  C  +I SK+RE     Q+  +L
Sbjct  196  GYHIERSLKFMCGGEITSKERERRKLNQLARVL  228



>ref|XP_008802822.1| PREDICTED: cyclin-U2-2-like [Phoenix dactylifera]
Length=226

 Score =   247 bits (631),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 120/213 (56%), Positives = 154/213 (72%), Gaps = 3/213 (1%)
 Frame = -1

Query  768  LRDDLYLYAYQEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEA  589
            LR DLY +  +++ S PLVISVLASL+ RT+ RN+R+     G + +  G ++ F     
Sbjct  15   LRSDLYSFPCEDEPSAPLVISVLASLVERTIARNERVVGEC-GVVALKDGRSRAFYSRHV  73

Query  588  PDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASK  409
             DMTI+S+LER FRY    P VYVVAYVY+DR C L+P  ++   NVHRLLIT+IMVASK
Sbjct  74   LDMTIQSFLERFFRYARVAPPVYVVAYVYMDRLCHLNPGLKVCLMNVHRLLITSIMVASK  133

Query  408  YVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGG  229
            +VED NYRNSYFA+VGG++T+E+N LE+ FLFLM+FKLHV+VSVF SYC HLEREV  GG
Sbjct  134  FVEDRNYRNSYFAKVGGISTLELNSLELNFLFLMKFKLHVSVSVFESYCSHLEREVSFGG  193

Query  228  GYQIERTLR--CAQDIKSKQREDTTFTQVTSLL  136
            GY IER+L+  C  +  SK+RE     Q+  +L
Sbjct  194  GYHIERSLKFMCGGESTSKERERRELNQLARVL  226



>ref|XP_009398116.1| PREDICTED: cyclin-P2-1-like [Musa acuminata subsp. malaccensis]
Length=232

 Score =   243 bits (620),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 121/207 (58%), Positives = 150/207 (72%), Gaps = 8/207 (4%)
 Frame = -1

Query  768  LRDDLYLYAYQEQSST----PLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFE  601
            LR DLY +   +  ST    P VISVLASL+ R + RN R A N RG   +    ++ FE
Sbjct  12   LRSDLYNFPCDDDESTTTAPPSVISVLASLLDRAIARNDRAAVN-RGNAAVGDARSRAFE  70

Query  600  CNEAPDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIM  421
             ++  DMTI+S+LER++RY    P VYVVAYVY+DR CQ +P  RI   N HRLLITTIM
Sbjct  71   SHQVLDMTIQSFLERIYRYARVAPPVYVVAYVYMDRLCQFNPGLRICSANAHRLLITTIM  130

Query  420  VASKYVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREV  241
            VASK+VED+NY NSYFA+VGGL+  E+N LE++FLFLM+FKLHV+VSVF SYC HLEREV
Sbjct  131  VASKFVEDLNYCNSYFAKVGGLSARELNSLELDFLFLMKFKLHVSVSVFESYCSHLEREV  190

Query  240  GIGGGYQIERTLR---CAQDIKSKQRE  169
              GGGYQIER+LR   C  +I +K++E
Sbjct  191  SFGGGYQIERSLRRLMCGGEITAKEKE  217



>ref|XP_006838178.1| hypothetical protein AMTR_s00106p00124350 [Amborella trichopoda]
 gb|ERN00747.1| hypothetical protein AMTR_s00106p00124350 [Amborella trichopoda]
Length=220

 Score =   239 bits (609),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 117/202 (58%), Positives = 146/202 (72%), Gaps = 6/202 (3%)
 Frame = -1

Query  768  LRDDLYLYAYQEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEA  589
            L  D+Y ++  E  STPLVISVLASL+ R + R QRI  +   ++   +   + F+    
Sbjct  8    LLTDIYTFSSDEDGSTPLVISVLASLLERAMARTQRIQVSSNSSL---IAGFRSFDSQHG  64

Query  588  PDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASK  409
             ++T++S+LER+FR+T    SV+VVAY Y+DR CQ HP FRI   NVHRLLITT+MVASK
Sbjct  65   LEITVQSFLERIFRHTRLSSSVFVVAYAYIDRLCQFHPGFRISCRNVHRLLITTVMVASK  124

Query  408  YVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGG  229
            +VEDMNY+NSYFARVGGL   EMN LEV+FLFLM+FKL V++ VF SYC HLEREV +GG
Sbjct  125  FVEDMNYKNSYFARVGGLRIREMNALEVDFLFLMKFKLQVSIKVFESYCSHLEREVAMGG  184

Query  228  GYQIERTLR---CAQDIKSKQR  172
            GYQIERTL    C  +I SK R
Sbjct  185  GYQIERTLNKLMCGGEIASKSR  206



>ref|NP_001053503.1| Os04g0552300 [Oryza sativa Japonica Group]
 sp|Q7FAT5.1|CCP21_ORYSJ RecName: Full=Cyclin-P2-1; Short=CycP2;1 [Oryza sativa Japonica 
Group]
 emb|CAE01689.2| OSJNBa0010H02.9 [Oryza sativa Japonica Group]
 dbj|BAF15417.1| Os04g0552300 [Oryza sativa Japonica Group]
 emb|CAH67409.1| OSIGBa0143N19.3 [Oryza sativa Indica Group]
 gb|EAY95096.1| hypothetical protein OsI_16912 [Oryza sativa Indica Group]
 gb|EAZ31568.1| hypothetical protein OsJ_15711 [Oryza sativa Japonica Group]
 dbj|BAG87726.1| unnamed protein product [Oryza sativa Japonica Group]
Length=217

 Score =   178 bits (451),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 93/177 (53%), Positives = 119/177 (67%), Gaps = 3/177 (2%)
 Frame = -1

Query  726  STPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVFR  547
            STP+V+SVLASL+ R + RN+R       A        + F+     DM++ ++LER  R
Sbjct  24   STPVVVSVLASLLERHIARNER--DQAAAADGEAARRARAFDSGTVLDMSLHAFLERFSR  81

Query  546  YTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFAR  367
            Y    P VYVVAY YLDR  +     R+   N  RLL T I+VASK+VED NY+NSYFA 
Sbjct  82   YANVSPQVYVVAYAYLDRL-RRGDGVRVVSANAQRLLTTAILVASKFVEDRNYKNSYFAA  140

Query  366  VGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQIERTLRCA  196
            VGGLT  E++ LE++FLFLM+F+L+V+VSVF SYC HLEREV  GGGYQ+ER L+ A
Sbjct  141  VGGLTAAELSSLELDFLFLMQFRLNVSVSVFQSYCRHLEREVSYGGGYQVERCLKKA  197



>dbj|BAJ86100.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=226

 Score =   174 bits (442),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 92/187 (49%), Positives = 117/187 (63%), Gaps = 1/187 (1%)
 Frame = -1

Query  726  STPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVFR  547
            S  +V+SVLASL+ R + RN+R       A   +      F+     DM +  +LER  R
Sbjct  27   SPTVVVSVLASLLERHIARNERALAGTTAATGEDARRAAAFDGGTVLDMGMREFLERFSR  86

Query  546  YTGAGPSVYVVAYVYLDRFCQLHP-QFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFA  370
            Y    P VYVVAY YLDR  +      R+  TN  RLL   I+VASK+VED NY+NSYFA
Sbjct  87   YAHVSPQVYVVAYAYLDRLRRGGAGAVRVVATNAQRLLTAAILVASKFVEDRNYKNSYFA  146

Query  369  RVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQIERTLRCAQD  190
             VGGL   E++ LE++FLFLMRF+L+V+VSVF SYC HLERE G GGGYQ+ER L  A  
Sbjct  147  AVGGLGAAELSSLELDFLFLMRFRLNVSVSVFRSYCRHLEREAGHGGGYQVERCLEKALL  206

Query  189  IKSKQRE  169
            + S + +
Sbjct  207  VSSGEAQ  213



>gb|AFK44464.1| unknown [Lotus japonicus]
Length=140

 Score =   171 bits (433),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 100/125 (80%), Gaps = 1/125 (1%)
 Frame = -1

Query  768  LRDDLYLYAYQEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEA  589
            LR DLY Y+YQE S+TPLVI+VL+SLI R + R +RI +N   ++   + S  +F+C E 
Sbjct  17   LRYDLYSYSYQEDSNTPLVINVLSSLIERNMARTKRIVKNCSRSLSKAI-SANIFDCREI  75

Query  588  PDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASK  409
            PDMTI+SYLER+FRYT AGPSVYVVAYVY+DRFCQ +P FRI   NVHRLLITTIMVASK
Sbjct  76   PDMTIQSYLERIFRYTRAGPSVYVVAYVYIDRFCQNNPGFRINARNVHRLLITTIMVASK  135

Query  408  YVEDM  394
            YVEDM
Sbjct  136  YVEDM  140



>emb|CDM81206.1| unnamed protein product [Triticum aestivum]
Length=232

 Score =   171 bits (432),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 94/192 (49%), Positives = 119/192 (62%), Gaps = 8/192 (4%)
 Frame = -1

Query  726  STPLVISVLASLIGRTVTRNQR-----IARNFRGAMDINVGSTKVFECNEAPDMTIESYL  562
            S  +V+SVLASL+ R + RN+R      A +   A   +      F+     DM +  +L
Sbjct  26   SPTVVVSVLASLLERHIARNERATAGATAGHGPEASGEDARRAAAFDGGTVLDMGMREFL  85

Query  561  ERVFRYTGAGPSVYVVAYVYLDRF---CQLHPQFRIGPTNVHRLLITTIMVASKYVEDMN  391
            ER  RY    P VYVVAY YLDR           R+  TN  RLL   I+VASK+VED N
Sbjct  86   ERFSRYAHVSPQVYVVAYAYLDRLRRGGDGAGAVRVVATNAQRLLTAAILVASKFVEDRN  145

Query  390  YRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQIER  211
            Y+NSYFA VGGL+  E++ LE++FLFLMRF+L+V+VSVF SYC HLEREVG GGGYQ+ER
Sbjct  146  YKNSYFAAVGGLSAAELSSLELDFLFLMRFRLNVSVSVFRSYCRHLEREVGHGGGYQVER  205

Query  210  TLRCAQDIKSKQ  175
             L  A  + S +
Sbjct  206  CLEKALLVSSGE  217



>gb|KHG28555.1| Cyclin-U2-1 -like protein [Gossypium arboreum]
Length=145

 Score =   167 bits (424),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 99/127 (78%), Gaps = 2/127 (2%)
 Frame = -1

Query  768  LRDDLYLYAYQEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGS--TKVFECN  595
            LR DLY Y+Y+   + PLVI+VLASLI RT+ RN+RI    RG   +      +KVF+C+
Sbjct  19   LRSDLYSYSYKNDGNNPLVITVLASLIERTMVRNERIDAKNRGRQTLRQRDFRSKVFDCH  78

Query  594  EAPDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVA  415
            EAPDMT++ YLER+FRYT AGPSVYVVAYVY+DRFC+ +P FRI   NVHRLLITT+MVA
Sbjct  79   EAPDMTVQCYLERIFRYTKAGPSVYVVAYVYIDRFCEANPGFRITARNVHRLLITTMMVA  138

Query  414  SKYVEDM  394
            SKYVEDM
Sbjct  139  SKYVEDM  145



>ref|XP_002985239.1| hypothetical protein SELMODRAFT_48560, partial [Selaginella moellendorffii]
 gb|EFJ13733.1| hypothetical protein SELMODRAFT_48560, partial [Selaginella moellendorffii]
Length=170

 Score =   167 bits (424),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 83/166 (50%), Positives = 114/166 (69%), Gaps = 11/166 (7%)
 Frame = -1

Query  732  QSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTK--VFECNEAPDMTIESYLE  559
            ++  P VISVLASL+ R V RN R          +  G+TK  VF    AP ++IE YLE
Sbjct  1    ENRPPTVISVLASLLERVVARNHR---------HLGGGATKLTVFHGLRAPSISIEKYLE  51

Query  558  RVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNS  379
            R+F+Y    P+ +VVAY Y+DRF    P   I   NVHRLLIT++MVA+K+++D  Y N+
Sbjct  52   RIFKYANCSPACFVVAYAYMDRFIHQQPDVPITSLNVHRLLITSVMVAAKFLDDAYYNNA  111

Query  378  YFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREV  241
            Y+A+VGG++T+EMN+LE++FLF + F+L V V++F SYC HLEREV
Sbjct  112  YYAKVGGVSTLEMNRLELQFLFRLDFRLQVTVTMFESYCSHLEREV  157



>ref|XP_004976447.1| PREDICTED: cyclin-P2-1-like [Setaria italica]
Length=228

 Score =   169 bits (429),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 93/219 (42%), Positives = 130/219 (59%), Gaps = 19/219 (9%)
 Frame = -1

Query  768  LRDDLYLYAYQEQSST-----PLVISVLASLIGRTVTRNQRI-----ARNFRGAMDINVG  619
            L  D + +  +E  S+     P+VISVLAS++ R + RN+R       R    + D +  
Sbjct  6    LPSDAFAFPCREDGSSSALSPPVVISVLASILDRHIARNERALAPGSDREVAASGDDDDS  65

Query  618  ST-----KVFECNEAPDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPT  454
            +      + F+     DM++ ++LER  RY    P+VYVVAY YLDR  +     R+   
Sbjct  66   AATRRRVRAFDGGTELDMSLRAFLERFSRYAQVSPAVYVVAYAYLDRLRRGDAGVRVVRA  125

Query  453  NVHRLLITTIMVASKYVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVF  274
            N  RLL   I+VASK+VED NY NSYFA VGGL   E+  LE++FLFLM+F+L+V  SVF
Sbjct  126  NAQRLLTAAILVASKFVEDRNYSNSYFAAVGGLGAAELGALELDFLFLMQFRLNVCASVF  185

Query  273  HSYCCHLEREVGIGGGYQI----ERTLRCAQDIKSKQRE  169
             SYC HLEREV  GGGY++    E+ L CA + + ++R+
Sbjct  186  QSYCRHLEREVSHGGGYRVEQGLEKALVCAGEARGQRRQ  224



>ref|XP_006652616.1| PREDICTED: cyclin-P2-1-like [Oryza brachyantha]
Length=225

 Score =   168 bits (426),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/182 (51%), Positives = 118/182 (65%), Gaps = 5/182 (3%)
 Frame = -1

Query  726  STPLVISVLASLIGRTVTRNQR----IARNFRGAMDINVGSTKVFECNEAPDMTIESYLE  559
            STP+V+SVLASL+ R + RN+R      R    A        + F+     DM++ ++LE
Sbjct  24   STPVVVSVLASLLERHIARNERELAAGHREAAAAEGEAARRARAFDSGTVLDMSLRAFLE  83

Query  558  RVFRYTGAGPSVYVVAYVYLDRFCQL-HPQFRIGPTNVHRLLITTIMVASKYVEDMNYRN  382
            R  RY    P VYVVAY YLDR  +      R+   N  RLL T I+VASK+VED NY+N
Sbjct  84   RFSRYAHVSPQVYVVAYAYLDRLRRGGDAGVRVVSANAQRLLTTAILVASKFVEDRNYKN  143

Query  381  SYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQIERTLR  202
            SYFA VGGL+  E++ LE++FLFLM+FKL+V+VSVF SY  HL+REV  GGG Q+ER LR
Sbjct  144  SYFAAVGGLSAAELSSLELDFLFLMQFKLNVSVSVFQSYSRHLQREVSYGGGDQVERCLR  203

Query  201  CA  196
             A
Sbjct  204  KA  205



>ref|XP_002310464.1| cyclin family protein [Populus trichocarpa]
 gb|EEE90914.1| cyclin family protein [Populus trichocarpa]
Length=230

 Score =   166 bits (421),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 84/200 (42%), Positives = 129/200 (65%), Gaps = 10/200 (5%)
 Frame = -1

Query  732  QSSTPLVISVLASLIGRTVTRNQRIARNFRGAMD-INVG------STKVFECNEAPDMTI  574
            +S+TP V+++L+ +I + V RN ++  +    +D ++ G      S  VF    AP+++I
Sbjct  21   ESTTPRVLTILSHVIEKLVARNDKLVDDMDKKLDGVSSGLARVGKSLNVFHGVRAPNISI  80

Query  573  ESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDM  394
              YLER+++YT   PS +VV YVY+DR    HP   +   NVHRLL+T++MVASK ++D+
Sbjct  81   VKYLERLYKYTSCSPSCFVVGYVYIDRLTHKHPDSLVISLNVHRLLVTSVMVASKMLDDV  140

Query  393  NYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQ-I  217
            +Y N+++ARVGG++  E+N+LE+EFLFL+ F + V+  VF SYC HLE+E+ I G  Q I
Sbjct  141  HYNNAFYARVGGVSNAELNRLEMEFLFLLDFGVVVSSRVFESYCSHLEKEMMINGASQRI  200

Query  216  ERTL--RCAQDIKSKQREDT  163
            ER +      D+     EDT
Sbjct  201  ERAIVSNAVDDVTELSVEDT  220



>ref|XP_011003213.1| PREDICTED: cyclin-U1-1 [Populus euphratica]
Length=230

 Score =   166 bits (420),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 84/200 (42%), Positives = 128/200 (64%), Gaps = 10/200 (5%)
 Frame = -1

Query  732  QSSTPLVISVLASLIGRTVTRNQRIARNFRGAMD-INVG------STKVFECNEAPDMTI  574
            +S+TP V+++L+ +I + V RN ++  +    +D ++ G      S  VF    AP+++I
Sbjct  21   ESTTPRVLTILSHVIEKLVARNDKLVDDMDKKLDGVSSGLARVGKSLNVFHGVRAPNISI  80

Query  573  ESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDM  394
              YLER+++YT   PS +VV YVY+DR    HP   +   NVHRLL+T++MVASK ++D+
Sbjct  81   VKYLERLYKYTSCSPSCFVVGYVYIDRLTHKHPDSLVISLNVHRLLVTSVMVASKMLDDV  140

Query  393  NYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQ-I  217
            +Y N+++ARVGG++  E+N+LE+EFLFL+ F   V+  VF SYC HLE+E+ I G  Q I
Sbjct  141  HYNNAFYARVGGVSNAELNRLEMEFLFLLDFGFVVSSRVFESYCSHLEKEMMINGASQRI  200

Query  216  ERTL--RCAQDIKSKQREDT  163
            ER +      D+     EDT
Sbjct  201  ERAIVSNAVDDVTELSVEDT  220



>ref|XP_003580288.1| PREDICTED: cyclin-P2-1-like [Brachypodium distachyon]
Length=248

 Score =   166 bits (420),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 89/190 (47%), Positives = 113/190 (59%), Gaps = 13/190 (7%)
 Frame = -1

Query  726  STPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAP---------DMTI  574
            S P+V+SVLASL+ R + RN+R     R +     G     +              DM++
Sbjct  28   SPPVVVSVLASLLERHIARNERALALSRSSHGTAAGDEDEEDARRMAAFDGGGTVLDMSM  87

Query  573  ESYLERVFRYTGAGPSVYVVAYVYLDRFCQLH----PQFRIGPTNVHRLLITTIMVASKY  406
              +L+R  RY    P VYVVAY YLDR  +L     P  R+   N  RLL   I+VASK+
Sbjct  88   REFLDRFSRYAHVSPQVYVVAYAYLDRLGRLRRGAGPPVRVVAGNAQRLLTAAILVASKF  147

Query  405  VEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGG  226
            VED NY+NS+FA VGGL   E+  LE+ FLFLMRF+L+V+VSVF SYC HLERE G GGG
Sbjct  148  VEDRNYKNSHFAAVGGLGAAELGALELHFLFLMRFRLNVSVSVFRSYCRHLEREAGYGGG  207

Query  225  YQIERTLRCA  196
            Y +E  L+ A
Sbjct  208  YHVETCLQKA  217



>ref|XP_002966846.1| hypothetical protein SELMODRAFT_68732, partial [Selaginella moellendorffii]
 gb|EFJ31445.1| hypothetical protein SELMODRAFT_68732, partial [Selaginella moellendorffii]
Length=157

 Score =   163 bits (412),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 110/159 (69%), Gaps = 3/159 (2%)
 Frame = -1

Query  714  VISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVFRYTGA  535
            +++VL+SL+ R V +N+R A +       N+    VF    AP ++I+ YLER+F+Y   
Sbjct  2    ILAVLSSLLDRVVVKNERYAASATANGHSNL---TVFHGLRAPSISIDKYLERIFKYANC  58

Query  534  GPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFARVGGL  355
             PS +VVAYVY+DRF Q  P   I   NVHRLL+T++MVA+K+++D  Y N+Y+A+VGG+
Sbjct  59   SPSCFVVAYVYIDRFIQQKPSLPITSLNVHRLLVTSVMVAAKFLDDAYYNNAYYAKVGGV  118

Query  354  TTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVG  238
             T EMN+LE+EFLF + F+L V VSVF SYC  LE+EV 
Sbjct  119  NTQEMNRLELEFLFHLNFRLQVTVSVFESYCNRLEKEVS  157



>ref|XP_002994358.1| hypothetical protein SELMODRAFT_48686, partial [Selaginella moellendorffii]
 gb|EFJ04573.1| hypothetical protein SELMODRAFT_48686, partial [Selaginella moellendorffii]
Length=157

 Score =   162 bits (411),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 110/159 (69%), Gaps = 3/159 (2%)
 Frame = -1

Query  714  VISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVFRYTGA  535
            +++VL+SL+ R V +N+R A +       N+    VF    AP ++I+ YLER+F+Y   
Sbjct  2    ILAVLSSLLDRVVVKNERYAASATANGHSNL---TVFHGLRAPSISIDKYLERIFKYANC  58

Query  534  GPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFARVGGL  355
             PS +VVAYVY+DRF Q  P   +   NVHRLL+T++MVA+K+++D  Y N+Y+A+VGG+
Sbjct  59   SPSCFVVAYVYIDRFIQQKPSLPVTSLNVHRLLVTSVMVAAKFLDDAYYNNAYYAKVGGV  118

Query  354  TTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVG  238
             T EMN+LE+EFLF + F+L V VSVF SYC  LE+EV 
Sbjct  119  NTQEMNRLELEFLFHLNFRLQVTVSVFESYCNRLEKEVS  157



>ref|XP_010552777.1| PREDICTED: cyclin-U3-1 [Tarenaya hassleriana]
Length=222

 Score =   162 bits (411),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/198 (40%), Positives = 130/198 (66%), Gaps = 11/198 (6%)
 Frame = -1

Query  723  TPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVFRY  544
            +P+V+S L+S + R+V +N+++     G+ +I   +T VF     PD+++  YL+R+F+Y
Sbjct  31   SPMVLSWLSSSLERSVLQNEKLI----GSFEIKDSAT-VFHGRSPPDISVRQYLDRIFKY  85

Query  543  TGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFARV  364
            +G  PS +VVA +Y+DRF QL  +  +   NVHRLLIT++M+A+K ++D  + N+Y+ARV
Sbjct  86   SGCSPSCFVVAQIYMDRFLQLA-RVHLTSLNVHRLLITSVMLAAKVLDDRYFNNAYYARV  144

Query  363  GGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQIE----RTLRCA  196
            GG++T E+N+LE++ LF + FKL V    FH YCC LE+E   G G+QIE    +  R  
Sbjct  145  GGVSTRELNRLEMKLLFTLDFKLQVKPQTFHVYCCQLEKETS-GEGFQIEWPIQQACRAK  203

Query  195  QDIKSKQREDTTFTQVTS  142
            ++   K+R ++   Q T+
Sbjct  204  EETWPKRRPESACPQTTA  221



>ref|XP_001763676.1| predicted protein [Physcomitrella patens]
 gb|EDQ71566.1| predicted protein, partial [Physcomitrella patens]
Length=161

 Score =   159 bits (403),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 75/164 (46%), Positives = 112/164 (68%), Gaps = 4/164 (2%)
 Frame = -1

Query  732  QSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERV  553
            +  TP V++VLA+++ R VTRN+     F  A         +F    AP ++I  YLER+
Sbjct  2    EKETPKVLNVLAAVLDRLVTRNEL----FVNAPSQQGKKLTIFHGLRAPSISIAKYLERI  57

Query  552  FRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYF  373
            F+YT   PS +VVAYV+LDR     P   +   NVHRLL+T++MVA+K ++D+++ N++F
Sbjct  58   FKYTNCSPSCFVVAYVFLDRLVHRQPDLLVTTLNVHRLLVTSVMVATKMLDDVHFNNAFF  117

Query  372  ARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREV  241
            ARVGG++ +E+N+LE+EFLF + FKL V +SVF SYC +LER++
Sbjct  118  ARVGGVSVVELNRLELEFLFRLDFKLSVTISVFESYCTYLERDI  161



>ref|XP_002515728.1| Nuc-1 negative regulatory protein preg, putative [Ricinus communis]
 gb|EEF46675.1| Nuc-1 negative regulatory protein preg, putative [Ricinus communis]
Length=230

 Score =   161 bits (408),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/201 (41%), Positives = 127/201 (63%), Gaps = 14/201 (7%)
 Frame = -1

Query  738  QEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMD------INVG-STKVFECNEAPDM  580
            Q + +TP V+++L+++I + VTRN R+       +D       ++G S   F    AP +
Sbjct  19   QSEQTTPRVLTILSTVIEKLVTRNDRLVDGLSHRVDGMSSGLTHLGKSLNAFHGVRAPTI  78

Query  579  TIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVE  400
            +I  YLER+++YT   PS +VV YVY+DR    HP   +   NVHRLL+T++MVASK ++
Sbjct  79   SIPKYLERLYKYTNCSPSCFVVGYVYIDRLLHKHPDSLVISLNVHRLLVTSVMVASKVLD  138

Query  399  DMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQ  220
            D++Y N+++A+VGG++  E+N+LE+E LFL+ F + V+  +F SYC HLE+E+ + G  Q
Sbjct  139  DVHYNNAFYAKVGGVSNAELNRLEIELLFLLDFGVMVSSRIFESYCLHLEKEMLLHGAIQ  198

Query  219  -IERTLRCAQDIKSKQREDTT  160
             IERT      I S   +D T
Sbjct  199  KIERT------IPSNSLDDVT  213



>ref|XP_006349677.1| PREDICTED: cyclin-P3-1-like isoform X1 [Solanum tuberosum]
Length=223

 Score =   160 bits (406),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/199 (40%), Positives = 134/199 (67%), Gaps = 9/199 (5%)
 Frame = -1

Query  738  QEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLE  559
            +E+S  P V+S+L++L+ R+V  N+ +  + +    I +     F  + AP ++IE YL+
Sbjct  32   KEKSGKPRVLSLLSTLLERSVQNNESLLESSQSEDVITI-----FHGSRAPSLSIEQYLD  86

Query  558  RVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNS  379
            R+++Y+   PS +VVA++Y++RF +      +   NVHRLLIT++MVA+K+++D  Y N+
Sbjct  87   RIYKYSCCSPSCFVVAHIYMERFIECTGA-HLTSLNVHRLLITSVMVAAKFIDDAFYNNA  145

Query  378  YFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQIERTLR-  202
            Y+ARVGG+TT E+NKLE++FLF + F+LHVNV  F SYC  LE+E  +  G QIE +++ 
Sbjct  146  YYARVGGVTTKELNKLEMKFLFGLDFQLHVNVQTFGSYCSLLEKEGTV--GLQIECSIQA  203

Query  201  CAQDIKSKQREDTTFTQVT  145
            C  +     ++D+T++Q+ 
Sbjct  204  CRINESWSNKDDSTWSQIA  222



>ref|XP_006349678.1| PREDICTED: cyclin-P3-1-like isoform X2 [Solanum tuberosum]
Length=217

 Score =   160 bits (405),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/199 (40%), Positives = 134/199 (67%), Gaps = 9/199 (5%)
 Frame = -1

Query  738  QEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLE  559
            +E+S  P V+S+L++L+ R+V  N+ +  + +    I +     F  + AP ++IE YL+
Sbjct  26   KEKSGKPRVLSLLSTLLERSVQNNESLLESSQSEDVITI-----FHGSRAPSLSIEQYLD  80

Query  558  RVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNS  379
            R+++Y+   PS +VVA++Y++RF +      +   NVHRLLIT++MVA+K+++D  Y N+
Sbjct  81   RIYKYSCCSPSCFVVAHIYMERFIECTGA-HLTSLNVHRLLITSVMVAAKFIDDAFYNNA  139

Query  378  YFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQIERTLR-  202
            Y+ARVGG+TT E+NKLE++FLF + F+LHVNV  F SYC  LE+E  +  G QIE +++ 
Sbjct  140  YYARVGGVTTKELNKLEMKFLFGLDFQLHVNVQTFGSYCSLLEKEGTV--GLQIECSIQA  197

Query  201  CAQDIKSKQREDTTFTQVT  145
            C  +     ++D+T++Q+ 
Sbjct  198  CRINESWSNKDDSTWSQIA  216



>gb|ABK22429.1| unknown [Picea sitchensis]
Length=241

 Score =   160 bits (405),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 83/220 (38%), Positives = 133/220 (60%), Gaps = 17/220 (8%)
 Frame = -1

Query  732  QSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERV  553
            +S  P +++VL+  + R VTRN + A      +  +     VF    +P +T+  YLER+
Sbjct  31   ESQLPRILAVLSYALQRLVTRNDQCA------LPADGKKITVFHGVRSPSITVAKYLERI  84

Query  552  FRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYF  373
            ++YT   PS +VV YVY+DR     P F +   N+HRLL+T++M+A+K ++D +Y N+++
Sbjct  85   YKYTSCSPSCFVVGYVYIDRLVHRQPDFPVISLNIHRLLLTSVMIAAKMLDDAHYNNAFY  144

Query  372  ARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIG-GGYQIERTL---  205
            ARVGG++  E+N+LE++FLF + F+L V   VF SYC HLE+E+ +G  G +IERTL   
Sbjct  145  ARVGGISNTELNRLEIDFLFRLGFRLKVTGKVFESYCLHLEKEMLLGTAGQRIERTLPEF  204

Query  204  -RCAQDIKSKQREDTTFTQVTSLLL*KLKHRIFIWCMPDP  88
             R + +  S +RE++   + +S     + H       PDP
Sbjct  205  HRVSLESDSAKREESKVPRCSSATAMVVGHH------PDP  238



>gb|EYU40342.1| hypothetical protein MIMGU_mgv1a013920mg [Erythranthe guttata]
Length=206

 Score =   159 bits (401),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 78/176 (44%), Positives = 114/176 (65%), Gaps = 6/176 (3%)
 Frame = -1

Query  738  QEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLE  559
            +  S  P +I  L+SL+ R    N  ++R F+    I+V     F     P+++I+SYLE
Sbjct  5    ESPSVMPKLIGFLSSLLQRAAETND-LSREFQPPQKISV-----FHGLSRPNISIQSYLE  58

Query  558  RVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNS  379
            R+F+Y    PS Y+VAYVYLDRF Q  P   I   NVHRLLIT++MV++K+++DM Y N+
Sbjct  59   RIFKYANCSPSCYIVAYVYLDRFTQTQPSLPINSFNVHRLLITSVMVSAKFMDDMYYNNA  118

Query  378  YFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQIER  211
            Y+A+VGG++T EMN LE++FLF M F L+V  S F +YC +L+RE+ I   + +  
Sbjct  119  YYAKVGGISTTEMNFLELDFLFGMGFHLNVTPSTFQTYCSYLQREMMIHPHFSVSE  174



>ref|XP_008230100.1| PREDICTED: cyclin-U1-1 [Prunus mume]
Length=228

 Score =   159 bits (403),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 81/208 (39%), Positives = 131/208 (63%), Gaps = 9/208 (4%)
 Frame = -1

Query  762  DDLYLYAYQEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMD------INVG-STKVF  604
            D+   +  + + S P V+++L+ ++ + + RN  +A      +D        +G S  VF
Sbjct  5    DEFTNHHGRPEPSIPRVLTILSFVLEKLIARNNTLADGLSQQLDGQSCGSAEIGKSLNVF  64

Query  603  ECNEAPDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTI  424
                AP ++I  YLER+++YT   PS +VV YVY+DR    HP   +   NVHRLL+T++
Sbjct  65   HGVRAPSISIPKYLERLYKYTDCSPSCFVVGYVYIDRLLHKHPDSLVLSLNVHRLLVTSV  124

Query  423  MVASKYVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLERE  244
            M+ASK ++D++Y N+++ARVGG++  E+N+LEVE LFL+ F + V+  VF SYC HLE+E
Sbjct  125  MIASKMLDDVHYNNAFYARVGGVSNAELNRLEVELLFLLDFGVMVSSRVFESYCFHLEKE  184

Query  243  VGIGGGYQ-IERTLRCAQDIKSKQREDT  163
            + + G +Q IER L    D+ ++ RE++
Sbjct  185  MMLNGAFQRIERPLLVLSDV-AEIRENS  211



>ref|XP_009804077.1| PREDICTED: cyclin-P3-1 [Nicotiana sylvestris]
Length=217

 Score =   158 bits (400),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/198 (40%), Positives = 132/198 (67%), Gaps = 9/198 (5%)
 Frame = -1

Query  738  QEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLE  559
            +++S  P V+S+L++L+ R+V + + +  + +    I +     F  + AP + IE YL+
Sbjct  26   KQKSGKPRVLSLLSTLLERSVQKTESLLESTQRKDVITI-----FHGSRAPSLGIEQYLD  80

Query  558  RVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNS  379
            R+F+Y+   PS +VVA +Y++RF + H    +   NVHRLLIT++MVA+K+++D  Y N+
Sbjct  81   RIFKYSCCSPSCFVVAQIYMERFIE-HTSAHLTSLNVHRLLITSVMVAAKFIDDAFYNNA  139

Query  378  YFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQIERTLRC  199
            Y+ARVGG+TT E+NKLE++FLF + F+LHVNV  F SYC  LE+E  +  G  IER+++ 
Sbjct  140  YYARVGGVTTKELNKLEMKFLFGLDFRLHVNVKTFGSYCSLLEKEGTL--GLPIERSIQA  197

Query  198  AQDIKS-KQREDTTFTQV  148
             +  +S   ++D+T  Q+
Sbjct  198  CRITESWSNKDDSTCAQI  215



>ref|XP_006490025.1| PREDICTED: cyclin-U4-1-like [Citrus sinensis]
Length=220

 Score =   158 bits (399),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 79/196 (40%), Positives = 126/196 (64%), Gaps = 8/196 (4%)
 Frame = -1

Query  768  LRDDLYLYAYQEQSST-PLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNE  592
            L  ++ L  +QE+++  P +I+VL+SL+ R    N    R     + +  G T+      
Sbjct  13   LGTNIILEGHQEEAAVMPKLITVLSSLLQRVAESNDLSQRFHPQKISVFHGLTR------  66

Query  591  APDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVAS  412
             P ++I SYLER+F+Y    PS +VVAYVYLDRF Q  P   I   NVHRLLIT+++V++
Sbjct  67   -PTISIHSYLERIFKYANCSPSCFVVAYVYLDRFAQKQPSLPINSFNVHRLLITSVLVSA  125

Query  411  KYVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIG  232
            K+++D+ Y N+++A+VGG++T EMN LEV+FLF + F+L+V  + F++YC +L+RE+ + 
Sbjct  126  KFMDDIYYNNAFYAKVGGISTTEMNLLEVDFLFDLGFQLNVTPAAFYTYCSYLQREMFLQ  185

Query  231  GGYQIERTLRCAQDIK  184
               Q+E  L   + +K
Sbjct  186  SPLQLEEPLNVGRQLK  201



>ref|XP_009627788.1| PREDICTED: cyclin-P3-1 [Nicotiana tomentosiformis]
Length=217

 Score =   157 bits (397),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 79/198 (40%), Positives = 132/198 (67%), Gaps = 9/198 (5%)
 Frame = -1

Query  738  QEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLE  559
            +++S  P V+S+L++L+ R+V + + +  + +    I +     F  + AP + IE YL+
Sbjct  26   KQKSGKPRVLSLLSTLLERSVQKTESLLESTQRKDVITI-----FHGSRAPSLGIEQYLD  80

Query  558  RVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNS  379
            R+F+Y+   PS +VVA++Y++RF + H    +   NVHRLLIT++MVA+K+++D  Y N+
Sbjct  81   RIFKYSCCSPSCFVVAHIYMERFIE-HTSAHLTSLNVHRLLITSVMVAAKFIDDAFYNNA  139

Query  378  YFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQIERTLRC  199
            Y+ARVGG+TT E+NKLE++FLF + F+LHVNV  F SYC  LE+E  +  G  IE +++ 
Sbjct  140  YYARVGGVTTKELNKLEMKFLFGLDFRLHVNVKTFGSYCSLLEKEGTL--GLPIEHSIQA  197

Query  198  AQDIKS-KQREDTTFTQV  148
             +  +S   ++D+T  Q+
Sbjct  198  CRITESWSNKDDSTCAQI  215



>ref|XP_001760666.1| predicted protein [Physcomitrella patens]
 gb|EDQ74405.1| predicted protein, partial [Physcomitrella patens]
Length=166

 Score =   155 bits (393),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 73/169 (43%), Positives = 110/169 (65%), Gaps = 4/169 (2%)
 Frame = -1

Query  744  AYQEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESY  565
            A       P V+ VLA+++ R V RN++    F  A         +F    AP+++I +Y
Sbjct  2    AGSSDKEIPKVLYVLAAVLDRLVARNEQ----FSNAPSQQGKKLTIFHGLRAPNISIANY  57

Query  564  LERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYR  385
            LER+F+YT   PS +VV YV+LDR     P   +   NVHRLL+T++MVA+K ++D+++ 
Sbjct  58   LERIFKYTSCSPSCFVVGYVFLDRLIHRQPDLLVTSLNVHRLLVTSVMVATKMLDDVHFN  117

Query  384  NSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVG  238
            N++FARVGG++ +E+N+LE+EFLF + FKL V +SVF SYC  LER++ 
Sbjct  118  NAFFARVGGVSVLELNRLELEFLFRLDFKLSVTISVFESYCTFLERDIS  166



>ref|XP_004247165.1| PREDICTED: cyclin-P3-1 [Solanum lycopersicum]
 ref|XP_010326376.1| PREDICTED: cyclin-P3-1 [Solanum lycopersicum]
 ref|XP_010326378.1| PREDICTED: cyclin-P3-1 [Solanum lycopersicum]
Length=217

 Score =   157 bits (397),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 79/199 (40%), Positives = 132/199 (66%), Gaps = 9/199 (5%)
 Frame = -1

Query  738  QEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLE  559
            +E+S  P V+S+L++L+ R+V  N+ +  + +    I +     F  + AP + IE YL+
Sbjct  26   KEKSGKPRVLSLLSTLLERSVQNNESLLESSQSEDVITI-----FHGSRAPSLNIEQYLD  80

Query  558  RVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNS  379
            R+++Y+   PS +VVA++Y++RF +      +   NVHRLLIT++MVA+K+++D  Y N+
Sbjct  81   RIYKYSCCSPSCFVVAHIYMERFIEC-TSAHLTSLNVHRLLITSVMVAAKFIDDAFYNNA  139

Query  378  YFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQIERTLRC  199
            Y+ARVGG+TT E+NKLE++FLF + F+LHVNV  F SYC  +E+E  +  G QIER+++ 
Sbjct  140  YYARVGGVTTKELNKLEMKFLFGLDFQLHVNVPTFGSYCSLIEKEGTV--GLQIERSIQA  197

Query  198  AQDIKS-KQREDTTFTQVT  145
             +  +S   ++D+   Q+ 
Sbjct  198  CRISESWSNKDDSKCAQIA  216



>ref|XP_004289157.1| PREDICTED: cyclin-U1-1-like [Fragaria vesca subsp. vesca]
Length=227

 Score =   157 bits (398),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 78/186 (42%), Positives = 121/186 (65%), Gaps = 8/186 (4%)
 Frame = -1

Query  738  QEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMD-INVGSTKV------FECNEAPDM  580
            + + S P V+++L+ ++ + V RN  +  +    +D ++ GS  +      F    AP +
Sbjct  13   RPEPSIPRVLTILSFVLEKLVARNNSLVDDLTQPLDALSCGSAAIGKRLNPFHGVRAPSI  72

Query  579  TIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVE  400
            +I  YLER+++YT   PS +VV YVY+DR    HP   +   NVHRLL+T+IMVASK ++
Sbjct  73   SIPKYLERLYKYTDCSPSCFVVGYVYIDRLVHKHPDSLVLSLNVHRLLVTSIMVASKMLD  132

Query  399  DMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQ  220
            D++Y N+++A+VGG++  E+N+LEVEFLFL+ F + V+  VF SYC HLE+E+ + G  Q
Sbjct  133  DVHYNNAFYAKVGGVSNAELNRLEVEFLFLLDFGVTVSSRVFESYCFHLEKEMMLNGACQ  192

Query  219  -IERTL  205
             IER L
Sbjct  193  TIERAL  198



>ref|XP_007215945.1| hypothetical protein PRUPE_ppa011252mg [Prunus persica]
 gb|EMJ17144.1| hypothetical protein PRUPE_ppa011252mg [Prunus persica]
Length=217

 Score =   157 bits (397),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 82/208 (39%), Positives = 130/208 (63%), Gaps = 9/208 (4%)
 Frame = -1

Query  762  DDLYLYAYQEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMD------INVG-STKVF  604
            D+   +  + + S P V+++L+ ++ + V RN  +A      +D        +G S  VF
Sbjct  5    DEFTNHHGRPEPSIPRVLTILSFVLEKLVARNNTLADGLSQQLDGQSCGSAGIGKSLNVF  64

Query  603  ECNEAPDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTI  424
                AP ++I  YLER+++YT   PS +VV YVY+DR    HP   +   NVHRLL+T++
Sbjct  65   HGVRAPSISIPKYLERLYKYTDCSPSCFVVGYVYIDRLLHKHPDSLVLSLNVHRLLVTSV  124

Query  423  MVASKYVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLERE  244
            M+ASK ++D++Y N+++ARVGG++  E+N+LEVE LFL+ F + V+  VF SYC HLE+E
Sbjct  125  MIASKMLDDVHYNNAFYARVGGVSNAELNRLEVELLFLLDFGVMVSSRVFESYCFHLEKE  184

Query  243  VGIGGGYQ-IERTLRCAQDIKSKQREDT  163
            + + G  Q IER L    D+ ++ RE++
Sbjct  185  MILNGACQRIERPLLVLSDV-AEIRENS  211



>ref|XP_001784038.1| predicted protein [Physcomitrella patens]
 gb|EDQ51144.1| predicted protein [Physcomitrella patens]
Length=166

 Score =   155 bits (392),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 73/160 (46%), Positives = 108/160 (68%), Gaps = 4/160 (3%)
 Frame = -1

Query  720  PLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVFRYT  541
            P V+ VLA+++ R V+RN++    F  A         +F    AP + I  YLER+F+YT
Sbjct  11   PKVLHVLAAVLDRLVSRNEQ----FANAPSQQGKKLTIFHGLRAPSINIAKYLERIFKYT  66

Query  540  GAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFARVG  361
               PS +VV YVYLDR     P   +   NVHRLL+T++MVA+K ++D+++ N++FARVG
Sbjct  67   NCSPSCFVVGYVYLDRLIHRQPDLLVTSLNVHRLLVTSVMVATKMLDDVHFNNAFFARVG  126

Query  360  GLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREV  241
            G++ +E+N+LE+EFLF + FKL V +SVF SYC +LER++
Sbjct  127  GVSVVELNRLELEFLFRLDFKLSVTISVFESYCSYLERDI  166



>ref|XP_008794908.1| PREDICTED: cyclin-P4-1 [Phoenix dactylifera]
Length=201

 Score =   156 bits (395),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 80/180 (44%), Positives = 111/180 (62%), Gaps = 5/180 (3%)
 Frame = -1

Query  738  QEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLE  559
            +E  + P V+S+L+SL+ R   RN    R  R A+         F     P +++ SYLE
Sbjct  7    EEPHAIPRVVSILSSLLQRVAERNDAAQR--RPALH---DRALAFHGLSKPAISVRSYLE  61

Query  558  RVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNS  379
            R+FRY    P+ YVVAYVYLDRF + HP   I   NVHR +IT+++ A K+++D+ Y N+
Sbjct  62   RIFRYASCSPACYVVAYVYLDRFTKRHPSVSIDSFNVHRFIITSVLTAVKFMDDIYYNNA  121

Query  378  YFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQIERTLRC  199
            YFA+VGG+T MEMN LEV+FLF M F+L+V   +FHSYC  L+RE+ +         L C
Sbjct  122  YFAKVGGITLMEMNYLEVDFLFGMGFELNVTPVIFHSYCSILQREMHLLESPPAPPRLHC  181



>ref|XP_010258734.1| PREDICTED: cyclin-U4-1-like [Nelumbo nucifera]
Length=189

 Score =   155 bits (392),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 76/168 (45%), Positives = 111/168 (66%), Gaps = 7/168 (4%)
 Frame = -1

Query  720  PLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVFRYT  541
            P VI+ L+S++ R V+ +  ++R F            VF     P ++I+SYLER+F+Y 
Sbjct  11   PKVITFLSSMLQR-VSESNDVSRRFEPQ------KISVFHGLTRPTISIQSYLERIFKYA  63

Query  540  GAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFARVG  361
               PS +VVAY+YLDRF Q  P   I   NVHRLLIT++MVA+K+++DM Y N+Y+A+VG
Sbjct  64   NCSPSCFVVAYIYLDRFAQKQPSLPINSFNVHRLLITSVMVAAKFMDDMYYNNAYYAKVG  123

Query  360  GLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQI  217
            G+ T EMN LEV+FLF + F L+V  S FH+YC +++RE+ I    ++
Sbjct  124  GIITTEMNYLEVDFLFGLSFHLNVTPSTFHTYCSYIQREMYIESPLKL  171



>ref|XP_006851148.1| hypothetical protein AMTR_s00043p00103760 [Amborella trichopoda]
 gb|ERN12729.1| hypothetical protein AMTR_s00043p00103760 [Amborella trichopoda]
Length=209

 Score =   155 bits (393),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 78/200 (39%), Positives = 127/200 (64%), Gaps = 2/200 (1%)
 Frame = -1

Query  732  QSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERV  553
            +SSTP +++VL+ ++ R V RN+R+  +    + ++  S  VF    AP ++I  YLER+
Sbjct  10   ESSTPRILAVLSYVLERLVARNERLGSS-TSPVSLSNQSLAVFHGVRAPSISIPKYLERI  68

Query  552  FRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYF  373
            ++YT   PS +VV YVY+DR    +P   +   NVHRLL+T++MVASK ++D++Y N+++
Sbjct  69   YKYTNCSPSCFVVGYVYMDRLFHRYPDAPLVSLNVHRLLVTSLMVASKVLDDVHYNNAFY  128

Query  372  ARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIG-GGYQIERTLRCA  196
            ARVGG++  E+N+LE+E LFL+ F + V+  VF SYC HLE+E+      ++IE+ +   
Sbjct  129  ARVGGVSNAELNRLELEMLFLLDFGVMVSSRVFESYCLHLEKEMMCNPSAHKIEKVMWNL  188

Query  195  QDIKSKQREDTTFTQVTSLL  136
             +      E+T  T    +L
Sbjct  189  DNEIELSIEETPKTSPPEIL  208



>ref|XP_007038242.1| Cyclin p4,1 [Theobroma cacao]
 gb|EOY22743.1| Cyclin p4,1 [Theobroma cacao]
Length=207

 Score =   155 bits (393),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 78/186 (42%), Positives = 119/186 (64%), Gaps = 9/186 (5%)
 Frame = -1

Query  735  EQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLER  556
            E+ + P VI+ L+SL+ R    N  I R       +   +  VF     P ++I SYLER
Sbjct  11   ERETVPKVITFLSSLLQRVAESNDHIRR-------LQSQNISVFHGLTRPTISIRSYLER  63

Query  555  VFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSY  376
            +F+Y    PS +VVAYVYLDRF Q+ P   I   NVHRLLIT+++V++K+++D+ Y N+Y
Sbjct  64   IFKYANCSPSCFVVAYVYLDRFVQMQPSLPINSFNVHRLLITSVLVSAKFMDDIYYNNAY  123

Query  375  FARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQ--IERTLR  202
            +A+VGG++T+E+N LE++FLF + F+L+V  S FH+YC  L+RE+ +    Q   E +L 
Sbjct  124  YAKVGGISTVELNLLELDFLFGLGFQLNVTPSDFHTYCSFLQREMWMQSPLQHLAEPSLN  183

Query  201  CAQDIK  184
              + +K
Sbjct  184  IGRPLK  189



>ref|XP_001784037.1| predicted protein [Physcomitrella patens]
 gb|EDQ51143.1| predicted protein [Physcomitrella patens]
Length=171

 Score =   154 bits (389),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 107/160 (67%), Gaps = 0/160 (0%)
 Frame = -1

Query  720  PLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVFRYT  541
            P VI+VLAS++ R V RN++ A         N     +F    AP ++I  YLER+F+YT
Sbjct  8    PKVITVLASVLDRLVARNEQFANTPSQPGVFNSKKLTIFHGLRAPSISIAKYLERIFKYT  67

Query  540  GAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFARVG  361
                S +VV YV++DR     P   +   NVHRLL+T++MVA+K ++D+++ N++FARVG
Sbjct  68   NCSASCFVVGYVFIDRLIHRQPDLLVTSLNVHRLLVTSVMVATKILDDVHFNNAFFARVG  127

Query  360  GLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREV  241
            G++  E+N+LE+EFLF + F+L V VS+F SYC +LE+EV
Sbjct  128  GVSVGELNRLELEFLFRLDFRLTVTVSIFESYCSYLEKEV  167



>gb|KDP25867.1| hypothetical protein JCGZ_22897 [Jatropha curcas]
Length=219

 Score =   155 bits (393),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 84/206 (41%), Positives = 126/206 (61%), Gaps = 8/206 (4%)
 Frame = -1

Query  744  AYQEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGS-TKVFECNEAPDMTIES  568
            ++ EQS TP V+++L+++I + V RN ++ R     M   VG     F    AP ++I  
Sbjct  16   SHSEQS-TPRVLTILSTVIEKLVARNDKLVRCI---MSSRVGKRLNAFHGIRAPSISIPK  71

Query  567  YLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNY  388
            YLER+++YT   PS +VV YVYLDR    HP   I   NVHRLL+T +MVASK ++D + 
Sbjct  72   YLERLYKYTNCSPSCFVVGYVYLDRLLHKHPDSLIISLNVHRLLVTCVMVASKMLDDEHC  131

Query  387  RNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGG-YQIER  211
             N+++ARVGG++  E+NKLE+E LFL+ F + V+   F SYC HLE+E+ + G  ++IER
Sbjct  132  DNAFYARVGGVSNAELNKLEIELLFLLDFGVMVSSRAFESYCLHLEKEMLLNGSIHKIER  191

Query  210  TL--RCAQDIKSKQREDTTFTQVTSL  139
             +      D+     ED + +  + L
Sbjct  192  AIPSNSLDDLTEISVEDKSNSSPSHL  217



>gb|AAC32127.1| PREG-like protein [Picea mariana]
Length=284

 Score =   157 bits (397),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 79/181 (44%), Positives = 116/181 (64%), Gaps = 12/181 (7%)
 Frame = -1

Query  741  YQEQSSTPLVISVLASLIGRTVTRN-QRIARNFRGAMDINVGSTKVFECNEAPDMTIESY  565
            +   S  P ++SVL+  + R VTRN Q   +NF            VF     P ++I  Y
Sbjct  64   FPPDSQQPRILSVLSYALRRLVTRNDQFTPKNF----------VTVFHGVRTPGISIAKY  113

Query  564  LERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYR  385
            LERV++YT   PS +VVAY+Y+DR     P F +   N+HRLL+T++M+A+K ++D +Y 
Sbjct  114  LERVYKYTSCSPSCFVVAYIYIDRLVHRQPNFPVISLNIHRLLLTSLMIAAKMLDDAHYN  173

Query  384  NSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGG-GYQIERT  208
            N+++ARVGG++  E+N+LEV+FLF + F+L V  SVF SYC HLE+E+  G  G +I+RT
Sbjct  174  NAFYARVGGVSIAELNRLEVDFLFRLDFRLKVTASVFESYCLHLEKEMLCGASGQRIDRT  233

Query  207  L  205
            L
Sbjct  234  L  234



>ref|XP_010109140.1| hypothetical protein L484_017079 [Morus notabilis]
 gb|EXC21069.1| hypothetical protein L484_017079 [Morus notabilis]
Length=205

 Score =   154 bits (390),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/173 (44%), Positives = 112/173 (65%), Gaps = 7/173 (4%)
 Frame = -1

Query  729  SSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVF  550
            ++ P VI  L+SL+ R    N  + R F            VF     P ++IESYL+R+F
Sbjct  12   AAMPRVIGFLSSLLQRVAESND-VNRRFEP------QKISVFHGLTRPTISIESYLQRIF  64

Query  549  RYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFA  370
            +Y    PS +VVAYVYLDRF Q  P   I   NVHRLL+T++MV++K+V+D+ Y N+Y+A
Sbjct  65   KYANCSPSCFVVAYVYLDRFTQCQPLLPINSFNVHRLLVTSVMVSAKFVDDLYYNNAYYA  124

Query  369  RVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQIER  211
            +VGG++T EMN LE++FLF + F+L+V  + FHSYC +L+RE+ +    Q+ +
Sbjct  125  KVGGISTAEMNLLELDFLFGLSFQLNVTPTTFHSYCSYLQREMLLHSPLQLAQ  177



>ref|XP_010919767.1| PREDICTED: cyclin-P4-1 [Elaeis guineensis]
Length=201

 Score =   154 bits (389),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 78/180 (43%), Positives = 111/180 (62%), Gaps = 5/180 (3%)
 Frame = -1

Query  738  QEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLE  559
            +E  + P V+S+++SL+ R   RN    R  R A+         F     P +++ SYLE
Sbjct  7    EEAHAIPRVVSIVSSLLQRVAERNDASQR--RPALH---DRASAFHGLSKPAISVRSYLE  61

Query  558  RVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNS  379
            R+FRY    P+ YVVAY+YLDRF   HP   I   NVHR +IT+++ A K+++D+ Y N+
Sbjct  62   RIFRYANCSPACYVVAYIYLDRFTLRHPSVSIDSLNVHRFIITSVLTAVKFMDDIYYNNA  121

Query  378  YFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQIERTLRC  199
            YFA+VGG+T MEMN LEV+FLF M F+L+V+  +FHSYC  L+RE+ +         L C
Sbjct  122  YFAKVGGITLMEMNYLEVDFLFGMGFELNVSPDIFHSYCSVLQREMYLLESPPAPPRLHC  181



>ref|XP_010035608.1| PREDICTED: cyclin-U1-1-like [Eucalyptus grandis]
 gb|KCW47058.1| hypothetical protein EUGRSUZ_K00862 [Eucalyptus grandis]
Length=238

 Score =   155 bits (392),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 79/189 (42%), Positives = 120/189 (63%), Gaps = 11/189 (6%)
 Frame = -1

Query  738  QEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVG--------STKVFECNEAPD  583
            Q + + P V++VL+ ++ R V RN R+  +  G ++   G        S   F     P+
Sbjct  18   QVEGTLPRVLTVLSFVLERLVARNDRLLESLSGQLNGLGGHGWAMLGKSLNGFHGVRPPN  77

Query  582  MTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYV  403
            ++I  YLER+++YTG  PS +VV YVY+DR    HP   +   NVHRLL+T++MVASK +
Sbjct  78   ISIPKYLERIYKYTGCSPSCFVVGYVYIDRLVHKHPDSLVVSLNVHRLLVTSVMVASKML  137

Query  402  EDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREV---GIG  232
            +D +Y N+++A+VGG++  E+N+LE+E LFL+ F + V+  VF +YC HLEREV   G G
Sbjct  138  DDEHYNNAFYAKVGGVSNAELNRLEMELLFLLDFGVVVSSRVFETYCFHLEREVLLNGHG  197

Query  231  GGYQIERTL  205
            G  +IE+ L
Sbjct  198  GHGEIEKAL  206



>gb|KHG11686.1| Cyclin-U4-1 -like protein [Gossypium arboreum]
Length=214

 Score =   154 bits (389),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 76/177 (43%), Positives = 115/177 (65%), Gaps = 7/177 (4%)
 Frame = -1

Query  735  EQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLER  556
            +Q   P +I+ L+SL+ R    N    R F+           VF     P ++I+SYLER
Sbjct  15   DQEIVPKIITFLSSLLQRVAESNDH-CRLFQSQ------KISVFHGLTRPTISIKSYLER  67

Query  555  VFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSY  376
            +F+Y    PS +VVAYVYLDRF Q+ P   I   NVHRLL+T+++V++K+++DM Y N+Y
Sbjct  68   IFKYANCSPSCFVVAYVYLDRFVQMQPSLPINSYNVHRLLLTSVLVSAKFMDDMYYNNAY  127

Query  375  FARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQIERTL  205
            +A+VGG++T+EMN LEV+FLF + F L+V  + FH+YC  L+RE+ +   Y +++ L
Sbjct  128  YAKVGGISTVEMNLLEVDFLFGLGFHLNVAPTTFHTYCTFLQREMCMQIQYPLQQLL  184



>ref|XP_007139676.1| hypothetical protein PHAVU_008G049600g [Phaseolus vulgaris]
 gb|ESW11670.1| hypothetical protein PHAVU_008G049600g [Phaseolus vulgaris]
Length=204

 Score =   154 bits (388),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 73/160 (46%), Positives = 106/160 (66%), Gaps = 7/160 (4%)
 Frame = -1

Query  720  PLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVFRYT  541
            P +IS L+SL+ R    N    +     + +  G T+       P ++I++YLER+F+Y 
Sbjct  11   PKLISFLSSLLKRVAESNDLNQQQLHQKISVFHGLTR-------PTISIQTYLERIFKYA  63

Query  540  GAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFARVG  361
               PS ++VAYVYLDRF Q  P   I   NVHRLLIT++MVA+K+++D+ Y N+Y+A+VG
Sbjct  64   NCSPSCFIVAYVYLDRFTQRQPSLPINSFNVHRLLITSVMVAAKFMDDLYYNNAYYAKVG  123

Query  360  GLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREV  241
            G+TT+EMN LEV+FLF + F L+V    F +YC HL+RE+
Sbjct  124  GITTIEMNFLEVDFLFGLGFHLNVTPGTFQAYCAHLQREM  163



>ref|XP_002511026.1| cyclin-dependent protein kinase, putative [Ricinus communis]
 gb|EEF51628.1| cyclin-dependent protein kinase, putative [Ricinus communis]
Length=203

 Score =   153 bits (387),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 75/181 (41%), Positives = 119/181 (66%), Gaps = 9/181 (5%)
 Frame = -1

Query  720  PLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVFRYT  541
            P V++ L+SL+       QR+A +   +  ++     VF     P ++++SYLER+F+Y 
Sbjct  12   PKVVTFLSSLL-------QRVAESNDLSHQLHPQRISVFHGLTRPSISVQSYLERIFKYA  64

Query  540  GAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFARVG  361
               PS +V+AYVYLDRF Q  P F I   NVHRLLIT+++V++K+++D+ Y N+Y+A+VG
Sbjct  65   NCSPSCFVIAYVYLDRFAQRQPSFPINSFNVHRLLITSVLVSAKFMDDIYYNNAYYAKVG  124

Query  360  GLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQ--IERTLRCAQDI  187
            G++T EMN LEV+FLF + F+L+V  + FH+YC +L+RE+ +       +E  L  A+ +
Sbjct  125  GISTSEMNILEVDFLFGLGFQLNVTPNTFHTYCSYLQREMLVQSSQHQLVEPPLNMARAL  184

Query  186  K  184
            K
Sbjct  185  K  185



>ref|XP_006851092.1| hypothetical protein AMTR_s00025p00245040 [Amborella trichopoda]
 gb|ERN12673.1| hypothetical protein AMTR_s00025p00245040 [Amborella trichopoda]
Length=227

 Score =   154 bits (389),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 76/193 (39%), Positives = 123/193 (64%), Gaps = 15/193 (8%)
 Frame = -1

Query  729  SSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTK--VFECNEAPDMTIESYLER  556
            S  P V+SVL+S++  TV +N         A+D+     +  +F+    P + I  YLER
Sbjct  30   SECPRVLSVLSSVLEGTVLKNAI-------ALDVTKKQKRLTIFDGLRPPSLCIRQYLER  82

Query  555  VFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSY  376
            +F Y+   PS +++AY+Y+DRF    P+  +   NVHRLLIT++MVA+K+++D  + N+Y
Sbjct  83   IFEYSSCSPSCFILAYIYMDRFIHQQPEVPLTSLNVHRLLITSVMVAAKFIDDAFFDNAY  142

Query  375  FARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQIERT---L  205
            +A+VGG++T E+N+LE+E LF + F+L V++  F + C HLE+E    GGYQIER    L
Sbjct  143  YAKVGGVSTTEINRLELELLFTLDFRLQVSIVAFQTCCAHLEKE---AGGYQIERPPVKL  199

Query  204  RCAQDIKSKQRED  166
               + + ++++ED
Sbjct  200  CKLRGVAARKKED  212



>ref|XP_006375171.1| cyclin family protein [Populus trichocarpa]
 gb|ERP52968.1| cyclin family protein [Populus trichocarpa]
Length=202

 Score =   153 bits (386),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 75/160 (47%), Positives = 107/160 (67%), Gaps = 7/160 (4%)
 Frame = -1

Query  720  PLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVFRYT  541
            P  I+ L+SL+ R    N  + R F+           VF     P ++I+SYLER+F+Y 
Sbjct  11   PKSITFLSSLLQRVADSND-LNREFQPQ------KISVFHGLTRPTISIQSYLERIFKYA  63

Query  540  GAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFARVG  361
               PS +VVAYVYLDRF Q  P   I   NVHRLLIT+++V++K+++DM Y N+Y+ARVG
Sbjct  64   NCSPSCFVVAYVYLDRFAQRQPSLPINSLNVHRLLITSVLVSAKFMDDMYYNNAYYARVG  123

Query  360  GLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREV  241
            G++T+EMN LEV+FLF + F L+V  + FH+YC +L+RE+
Sbjct  124  GISTIEMNYLEVDFLFGLGFNLNVTPNTFHTYCSYLQREM  163



>ref|XP_008245770.1| PREDICTED: cyclin-U4-1-like [Prunus mume]
Length=203

 Score =   153 bits (386),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 73/165 (44%), Positives = 109/165 (66%), Gaps = 3/165 (2%)
 Frame = -1

Query  735  EQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLER  556
            E+   P+V++ + + +   V   QR+A +     +       VF     P ++I+SYLER
Sbjct  2    EELENPIVMAKVITFLSSLV---QRVAESNDINCEFQPKKISVFHGQTRPPISIQSYLER  58

Query  555  VFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSY  376
            +F+Y    PS  +VA+VYLDRF Q  P   I   NVHRLLIT++MVA+K+++DM Y N+Y
Sbjct  59   IFKYADCSPSCLIVAHVYLDRFSQRQPDLPINSYNVHRLLITSVMVAAKFMDDMYYNNAY  118

Query  375  FARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREV  241
            +A+VGG++T+EMN LEV+FLF + F L+VN S F +YC +L+RE+
Sbjct  119  YAKVGGISTIEMNFLEVDFLFGLNFNLNVNPSTFTTYCSYLQREI  163



>gb|KDP22483.1| hypothetical protein JCGZ_26314 [Jatropha curcas]
Length=202

 Score =   153 bits (386),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 73/174 (42%), Positives = 116/174 (67%), Gaps = 7/174 (4%)
 Frame = -1

Query  738  QEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLE  559
            +   + P VIS L+SL+ R    N   ++ +   + +  G T+       P+++I++YLE
Sbjct  5    EASEAMPKVISFLSSLLQRVAESNDLRSQLYPQRISVFHGLTR-------PNISIQTYLE  57

Query  558  RVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNS  379
            R+F+Y    PS +VVAYVYLDRF Q  P   I   NVHRLLIT+++V++K+++D+ Y N+
Sbjct  58   RIFKYANCSPSCFVVAYVYLDRFAQRQPSLPINSFNVHRLLITSVLVSAKFMDDIYYNNA  117

Query  378  YFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQI  217
            Y+A+VGG++T EMN LEV+FLF + F+L+V  + FH+YC +L+RE+ +    Q+
Sbjct  118  YYAKVGGISTAEMNVLEVDFLFGLGFQLNVAPTTFHTYCSYLQREMLMQSPVQL  171



>ref|XP_011032483.1| PREDICTED: cyclin-U4-1 [Populus euphratica]
Length=202

 Score =   152 bits (385),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/160 (47%), Positives = 107/160 (67%), Gaps = 7/160 (4%)
 Frame = -1

Query  720  PLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVFRYT  541
            P  I+ L+SL+ R    N  + R F+           VF     P ++I+SYLER+F+Y 
Sbjct  11   PKSITFLSSLLQRVADSND-LHREFQPQ------KISVFHGLTRPTISIQSYLERIFKYA  63

Query  540  GAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFARVG  361
               PS +VVAYVYLDRF Q  P   I   NVHRLLIT+++V++K+++DM Y N+Y+ARVG
Sbjct  64   NCSPSCFVVAYVYLDRFAQRQPSLPINSLNVHRLLITSVLVSAKFMDDMYYNNAYYARVG  123

Query  360  GLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREV  241
            G++T+EMN LEV+FLF + F L+V  + FH+YC +L+RE+
Sbjct  124  GISTIEMNYLEVDFLFGLGFNLNVTPNTFHTYCSYLQREM  163



>ref|XP_006421507.1| hypothetical protein CICLE_v10005725mg [Citrus clementina]
 gb|ESR34747.1| hypothetical protein CICLE_v10005725mg [Citrus clementina]
Length=246

 Score =   154 bits (389),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 78/196 (40%), Positives = 125/196 (64%), Gaps = 8/196 (4%)
 Frame = -1

Query  768  LRDDLYLYAYQEQSST-PLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNE  592
            L  ++ L  +QE+++  P +I+VL+SL+ R    N    R     + +  G T+      
Sbjct  39   LGTNIILEGHQEEAAVMPKLITVLSSLLQRVAESNDISQRFHPQKISVFHGLTR------  92

Query  591  APDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVAS  412
             P ++I SYLER+F+Y    PS +VVAYVYLDRF Q      I   NVHRLLIT+++V++
Sbjct  93   -PTISIHSYLERIFKYANCSPSCFVVAYVYLDRFAQKQTSLPINSFNVHRLLITSVLVSA  151

Query  411  KYVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIG  232
            K+++D+ Y N+++A+VGG++T EMN LEV+FLF + F+L+V  + F++YC +L+RE+ + 
Sbjct  152  KFMDDIYYNNAFYAKVGGVSTTEMNLLEVDFLFALGFQLNVTPAAFYTYCSYLQREMFLQ  211

Query  231  GGYQIERTLRCAQDIK  184
               Q+E  L   + +K
Sbjct  212  SPLQLEEPLNVGRQLK  227



>ref|XP_010089785.1| hypothetical protein L484_008035 [Morus notabilis]
 gb|EXB38377.1| hypothetical protein L484_008035 [Morus notabilis]
Length=210

 Score =   152 bits (384),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 74/155 (48%), Positives = 103/155 (66%), Gaps = 0/155 (0%)
 Frame = -1

Query  705  VLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVFRYTGAGPS  526
            V+ SLI    +  QR++ +             VF     P ++I+SYLER+F+Y    PS
Sbjct  11   VMTSLITFLSSLLQRVSESNDINCQFQPQKISVFHGLTRPTISIQSYLERIFKYANCSPS  70

Query  525  VYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFARVGGLTTM  346
             YVVAYVYLDRF Q  P   I   NVHRLLIT++MVA+K+++DM Y N+Y+A+VGG+ T 
Sbjct  71   CYVVAYVYLDRFAQRQPSLPINSLNVHRLLITSVMVAAKFMDDMYYNNAYYAKVGGINTR  130

Query  345  EMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREV  241
            EMN LEV+FLF + F L+V+ + F +YCC+L+RE+
Sbjct  131  EMNFLEVDFLFGLGFHLNVSPTTFQTYCCYLQREM  165



>ref|XP_011085729.1| PREDICTED: cyclin-U4-1 [Sesamum indicum]
Length=209

 Score =   152 bits (383),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 76/160 (48%), Positives = 108/160 (68%), Gaps = 8/160 (5%)
 Frame = -1

Query  708  SVLASLIGRTVTRNQRIARNFRGAMDINVG----STKVFECNEAPDMTIESYLERVFRYT  541
            +V+  LIG   +  QR+A     A D+N G       VF     P ++I++YLER+F+Y 
Sbjct  8    TVMPRLIGFLSSLLQRVAE----ANDLNRGFHPQKISVFHGLTRPTISIQTYLERIFKYA  63

Query  540  GAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFARVG  361
               PS Y+VAYVYLDRF Q  P   I   NVHRLLIT++MV++K+++DM Y N+Y+A+VG
Sbjct  64   NCSPSCYIVAYVYLDRFTQRQPALPINSFNVHRLLITSVMVSAKFMDDMYYNNAYYAKVG  123

Query  360  GLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREV  241
            G++T EMN LEV+FLF + F L+V  + FH+YC +L+RE+
Sbjct  124  GISTTEMNFLEVDFLFGLGFHLNVTPTTFHTYCSYLQREM  163



>ref|XP_009800863.1| PREDICTED: cyclin-U4-1 [Nicotiana sylvestris]
Length=208

 Score =   152 bits (383),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 110/166 (66%), Gaps = 7/166 (4%)
 Frame = -1

Query  738  QEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLE  559
            Q QS  P +I  L+SL+ R    N    R     + +  G T+       P+++I++YLE
Sbjct  8    QNQSLMPKLIDYLSSLLQRVAEANDINGRFQPQKISVFHGLTR-------PNISIQNYLE  60

Query  558  RVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNS  379
            R+F+Y    PS +VVAYVYLDRF Q  P   I   N+HRLLIT++M+A+K+++DM Y N+
Sbjct  61   RIFKYANCSPSCFVVAYVYLDRFTQCQPSLPINSFNIHRLLITSVMIAAKFMDDMYYNNA  120

Query  378  YFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREV  241
            Y+A+VGG++T EMN LEV+FLF + F+L+V  + F +YC +L++E+
Sbjct  121  YYAKVGGISTTEMNFLEVDFLFGLGFRLNVTPTTFQTYCSYLQKEM  166



>ref|XP_002973135.1| hypothetical protein SELMODRAFT_413599 [Selaginella moellendorffii]
 gb|EFJ25509.1| hypothetical protein SELMODRAFT_413599 [Selaginella moellendorffii]
Length=267

 Score =   153 bits (387),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 74/181 (41%), Positives = 113/181 (62%), Gaps = 21/181 (12%)
 Frame = -1

Query  720  PLVISVLASLIGRTVTRNQR-------------------IARNFRGAMDINVGST--KVF  604
            P ++++LAS++ R + RN++                    AR  +        S+  ++F
Sbjct  46   PRILALLASVLERLIARNEQYMRGSSNRGSSSGKYLGIATARGAKSVFSARSCSSPGRIF  105

Query  603  ECNEAPDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTI  424
               +AP ++IE YLER+F+YT   P+ +VV YVY+DR    HP   I P NVHRLL+T++
Sbjct  106  SGLKAPSISIEKYLERIFKYTNCSPACFVVGYVYIDRLSHKHPDLPITPLNVHRLLVTSV  165

Query  423  MVASKYVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLERE  244
            M ASK ++D+++ N++FARVGG++T E+NKLE+EFLF + F+L V V  F SYC +L+RE
Sbjct  166  MTASKILDDVHFNNAFFARVGGISTSEVNKLELEFLFRLDFRLTVTVQEFESYCSYLDRE  225

Query  243  V  241
             
Sbjct  226  A  226



>ref|XP_002271136.1| PREDICTED: cyclin-U4-1 [Vitis vinifera]
 emb|CBI16684.3| unnamed protein product [Vitis vinifera]
Length=204

 Score =   151 bits (382),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 105/158 (66%), Gaps = 7/158 (4%)
 Frame = -1

Query  714  VISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVFRYTGA  535
            +I+ L+S++ R    N    R     + +  G T+       P+++I+SYLER+F Y   
Sbjct  13   LITFLSSILQRVAESNDLNRRFLPQKISVFHGLTR-------PNISIQSYLERIFNYANC  65

Query  534  GPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFARVGGL  355
             PS YVVAY+YLDRF Q  P   I   NVHRLLIT +MVA+K+++DM Y N+Y+A+VGG+
Sbjct  66   SPSCYVVAYIYLDRFVQKQPSLPINSYNVHRLLITGVMVAAKFMDDMYYNNAYYAKVGGI  125

Query  354  TTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREV  241
            +T EMN LEV+FLF + F L+V  + FH+YCC L+RE+
Sbjct  126  STREMNFLEVDFLFGLAFDLNVTPTTFHTYCCCLQREM  163



>ref|XP_010246095.1| PREDICTED: cyclin-U4-1-like [Nelumbo nucifera]
Length=203

 Score =   151 bits (382),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 76/171 (44%), Positives = 107/171 (63%), Gaps = 7/171 (4%)
 Frame = -1

Query  720  PLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVFRYT  541
            P VI+ L+SL+ R    N    R       +      VF     P ++I+SYLER+F+Y 
Sbjct  11   PKVITFLSSLLQRVADSNDVNRR-------LETQRISVFHGLTRPTISIQSYLERIFKYA  63

Query  540  GAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFARVG  361
               PS +VVAYVYLDRF Q  P   I   N+HRLLIT++MVA+K+++DM Y N+Y+A+VG
Sbjct  64   NCSPSCFVVAYVYLDRFAQRQPSLPINSLNIHRLLITSVMVAAKFMDDMYYNNAYYAKVG  123

Query  360  GLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQIERT  208
            G+ T EMN LEV+FLF + F L+V  + +++YC +L+REV I     +  T
Sbjct  124  GINTTEMNYLEVDFLFGLSFHLNVTPNTYYTYCSYLQREVYIESPLSLVET  174



>ref|XP_002976722.1| hypothetical protein SELMODRAFT_416667 [Selaginella moellendorffii]
 gb|EFJ22391.1| hypothetical protein SELMODRAFT_416667 [Selaginella moellendorffii]
Length=264

 Score =   153 bits (386),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 75/181 (41%), Positives = 112/181 (62%), Gaps = 21/181 (12%)
 Frame = -1

Query  720  PLVISVLASLIGRTVTRNQR-------------------IARNFRGAMDINVGSTK--VF  604
            P ++++LAS++ R + RN++                    AR  +        S+   VF
Sbjct  46   PRILALLASVLERLIARNEQYMRGSSNRGSSSGKYLGIATARGAKNVFSARSCSSPGMVF  105

Query  603  ECNEAPDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTI  424
               +AP ++IE YLER+F+YT   P+ +VV YVY+DR    HP   I P NVHRLL+T++
Sbjct  106  SGLKAPSISIEKYLERIFKYTNCSPACFVVGYVYIDRLSHKHPDLPITPLNVHRLLVTSV  165

Query  423  MVASKYVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLERE  244
            M ASK ++D+++ N++FARVGG++T E+NKLE+EFLF + F+L V V  F SYC +L+RE
Sbjct  166  MTASKILDDVHFNNAFFARVGGISTSEVNKLELEFLFRLDFRLTVTVQEFESYCSYLDRE  225

Query  243  V  241
             
Sbjct  226  A  226



>gb|KDP21459.1| hypothetical protein JCGZ_21930 [Jatropha curcas]
Length=219

 Score =   152 bits (383),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 73/190 (38%), Positives = 124/190 (65%), Gaps = 8/190 (4%)
 Frame = -1

Query  723  TPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVFRY  544
            TP V+++L+S + R V +N+ +    +        S  VF    AP ++I+ Y++R+F+Y
Sbjct  31   TPRVLTLLSSFLERLVHKNEMLMETSQIK-----DSITVFHGLRAPAVSIQQYIDRIFKY  85

Query  543  TGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFARV  364
            +   PS +VVA++Y+DRF Q      +   NVHRLL+T++M+A+K+++D  + N+Y+A+V
Sbjct  86   SACSPSCFVVAHIYVDRFIQ-STHVHVTSLNVHRLLMTSLMIAAKFIDDAFFNNAYYAKV  144

Query  363  GGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQIERTLRCAQDIK  184
            GG++T E+N+LE++FLF + F+LHVN++ F  YCC LE+E     G QIER ++  +  +
Sbjct  145  GGVSTAELNRLEMKFLFSIDFRLHVNLNTFGRYCCQLEKEA--AEGLQIERPIQACRIKE  202

Query  183  SKQREDTTFT  154
            S   +D + T
Sbjct  203  SWSNKDDSTT  212



>ref|XP_002446908.1| hypothetical protein SORBIDRAFT_06g024670 [Sorghum bicolor]
 gb|EES11236.1| hypothetical protein SORBIDRAFT_06g024670 [Sorghum bicolor]
Length=234

 Score =   152 bits (383),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 84/185 (45%), Positives = 112/185 (61%), Gaps = 11/185 (6%)
 Frame = -1

Query  726  STPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGS----------TKVFECNEAPDMT  577
            S P+VISVLAS++ R + RN+R         D    +           + F+     DM+
Sbjct  28   SPPVVISVLASILERHIARNERALAAAAAPGDAAAAADDDDSATRKRARAFDSGTELDMS  87

Query  576  IESYLERVFRYTGAGPSVYVVAYVYLDRFCQL-HPQFRIGPTNVHRLLITTIMVASKYVE  400
            + ++LER  RY    P VYVVAY YLDR  +L     R+   N  RLL T I+VASK+VE
Sbjct  88   VHAFLERFARYAHVPPQVYVVAYAYLDRLRRLGDAGVRVVRGNAQRLLTTAILVASKFVE  147

Query  399  DMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQ  220
            D NY NS+FA VGGL   E+  LE++FLFL++F+L+V  +VF SYC HLEREV  GG Y+
Sbjct  148  DRNYSNSHFAAVGGLAPAELGALELDFLFLLQFRLNVCTAVFRSYCRHLEREVSHGGWYR  207

Query  219  IERTL  205
            ++R L
Sbjct  208  VQRPL  212



>ref|XP_006433309.1| hypothetical protein CICLE_v10002472mg [Citrus clementina]
 ref|XP_006472004.1| PREDICTED: cyclin-P3-1-like [Citrus sinensis]
 gb|ESR46549.1| hypothetical protein CICLE_v10002472mg [Citrus clementina]
Length=211

 Score =   151 bits (381),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 70/165 (42%), Positives = 113/165 (68%), Gaps = 6/165 (4%)
 Frame = -1

Query  738  QEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLE  559
            ++ SS+P V+S+L+S++ R++ +N+  ++  +    + +     F C++AP ++I  Y+E
Sbjct  24   KKSSSSPRVLSILSSVLERSIQKNESSSKASKKKEVVTI-----FHCSQAPSLSIRQYIE  78

Query  558  RVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNS  379
            R+F+Y+   PS +VVAY+YLDRF Q      +   N+HRLLIT+ +VA+K+V+D  Y N+
Sbjct  79   RIFKYSRCNPSSFVVAYIYLDRFLQ-QINGCLTRLNIHRLLITSFLVAAKFVDDECYNNA  137

Query  378  YFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLERE  244
            Y+A++GG++T EMNKLE+ FLF + FKLHV   VF  YC  L+ E
Sbjct  138  YYAKIGGISTAEMNKLELNFLFTLEFKLHVTTEVFAKYCSQLDME  182



>ref|XP_002526473.1| cyclin-dependent protein kinase, putative [Ricinus communis]
 gb|EEF35864.1| cyclin-dependent protein kinase, putative [Ricinus communis]
Length=203

 Score =   150 bits (380),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 109/160 (68%), Gaps = 7/160 (4%)
 Frame = -1

Query  720  PLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVFRYT  541
            P +I+ L+SL+       QR+A +    + I+     VF     P ++I++YLER+F+Y 
Sbjct  11   PKLITFLSSLL-------QRVAESNDLNLQIHTQKISVFHGLTRPTISIQNYLERIFKYA  63

Query  540  GAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFARVG  361
               PS ++VAYVYLDRF Q  P   +   NVHRLLIT++MVA+K+++DM Y N+Y+A+VG
Sbjct  64   NCSPSCFIVAYVYLDRFAQRQPSLPLNSFNVHRLLITSVMVAAKFMDDMYYNNAYYAKVG  123

Query  360  GLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREV  241
            G++T+EMN LEV+FLF + F L+V  + FH+Y  +L+RE+
Sbjct  124  GISTIEMNYLEVDFLFGLGFHLNVTPNTFHTYSSYLQREM  163



>ref|XP_004492903.1| PREDICTED: cyclin-U4-1-like [Cicer arietinum]
Length=203

 Score =   150 bits (379),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 73/167 (44%), Positives = 108/167 (65%), Gaps = 7/167 (4%)
 Frame = -1

Query  741  YQEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYL  562
            ++  +  P +IS L+SL+ R    N    +  +    +  G T+       P ++I+SYL
Sbjct  4    FENPNEMPKLISFLSSLLKRVSESNDMNQQLVQQKNSVFQGLTR-------PTISIQSYL  56

Query  561  ERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRN  382
            ER+F+Y    PS ++VAYVYLDRF Q  P   I   NVHRLLIT++MVA+K+++DM Y N
Sbjct  57   ERIFKYANCSPSCFIVAYVYLDRFTQRQPSLPINSLNVHRLLITSVMVAAKFMDDMYYNN  116

Query  381  SYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREV  241
            +Y+A+VGG+TT+EMN LE++FLF + F L+V  + F  YC HL+ E+
Sbjct  117  AYYAKVGGITTIEMNFLELDFLFGLGFHLNVTPNTFQVYCVHLQSEM  163



>ref|XP_003624270.1| Cyclin-dependent protein kinase regulator Pho80 [Medicago truncatula]
 gb|AES80488.1| cyclin p4 [Medicago truncatula]
Length=203

 Score =   150 bits (379),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 74/164 (45%), Positives = 107/164 (65%), Gaps = 15/164 (9%)
 Frame = -1

Query  720  PLVISVLASLIGRTVTRNQRIARNFRGAMDINVG----STKVFECNEAPDMTIESYLERV  553
            P +I+ L+SL+ R    N           DIN         VF+    P+++I++YLER+
Sbjct  11   PKLIAFLSSLLKRVAESN-----------DINQQLLEQKISVFQGLTCPNISIQNYLERI  59

Query  552  FRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYF  373
            F+Y    PS ++VAYVYLDRF Q  P   I   NVHRLLIT++MVA+K+++DM Y N+Y+
Sbjct  60   FKYANCSPSCFIVAYVYLDRFTQRQPSLPINSFNVHRLLITSVMVAAKFMDDMYYNNAYY  119

Query  372  ARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREV  241
            A+VGG+TT+EMN LE++FLF + F L+V  + F +YC HL+ E+
Sbjct  120  AKVGGITTIEMNFLELDFLFGLGFHLNVTPNTFQAYCVHLQSEM  163



>ref|XP_002520742.1| cyclin-dependent protein kinase, putative [Ricinus communis]
 gb|EEF41704.1| cyclin-dependent protein kinase, putative [Ricinus communis]
Length=219

 Score =   150 bits (380),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 74/188 (39%), Positives = 126/188 (67%), Gaps = 8/188 (4%)
 Frame = -1

Query  723  TPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVFRY  544
            TP  +++L+SL+ R+V +N+ +         IN   T+ F  + AP ++I  Y++R+F+Y
Sbjct  31   TPRALTLLSSLLERSVQKNEMLLE----TTQINDSRTE-FHGSRAPTVSIRQYIDRIFKY  85

Query  543  TGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFARV  364
            +G  PS ++VA++Y+DRF Q +    +   NVHRLLIT++MVA+K+++D  + N+Y+A+V
Sbjct  86   SGCSPSCFIVAHIYVDRFIQ-NTDIHLTSLNVHRLLITSVMVAAKFIDDAFFNNAYYAKV  144

Query  363  GGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQIERTLRCAQDIK  184
            GG++T E+NKLE++FLF + F+L V+V+ F  YC  LE+E     G+QIER ++  +  +
Sbjct  145  GGVSTEELNKLEMKFLFSIDFRLQVSVNTFGRYCSQLEKEA--AEGHQIERPIQVCRIKE  202

Query  183  SKQREDTT  160
            S   +D +
Sbjct  203  SWSNKDDS  210



>ref|XP_008669050.1| PREDICTED: cyclin-P2-1 [Zea mays]
 tpg|DAA36533.1| TPA: hypothetical protein ZEAMMB73_378812 [Zea mays]
Length=237

 Score =   151 bits (382),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 86/191 (45%), Positives = 111/191 (58%), Gaps = 18/191 (9%)
 Frame = -1

Query  726  STPLVISVLASLIGRTVTRNQRIARNFRG-----------------AMDINVGSTKVFEC  598
            S P+VISVLAS++ R +  N+R      G                 A        + F+ 
Sbjct  28   SPPVVISVLASILERHIALNERAMAAASGLDQSAPGDKDDDDDSDPAAAAARKRARAFDG  87

Query  597  NEAPDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMV  418
                DM++ ++LER  RY    P VYVVAY YLDR  +     R+   N  RLL T I+V
Sbjct  88   GTVLDMSLHAFLERFSRYAHVSPQVYVVAYAYLDRL-RRGAGVRVVRANAQRLLTTAILV  146

Query  417  ASKYVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVG  238
            ASK+VED NYRNSYFA VGGL   E++ LE++FLFLM+F+L+V   VF SYC HLEREV 
Sbjct  147  ASKFVEDRNYRNSYFAAVGGLAAAELSALELDFLFLMQFRLNVCAGVFRSYCRHLEREVS  206

Query  237  IGGGYQIERTL  205
             GG Y+++R L
Sbjct  207  HGGWYRVDRRL  217



>ref|XP_007218436.1| hypothetical protein PRUPE_ppa011642mg [Prunus persica]
 gb|EMJ19635.1| hypothetical protein PRUPE_ppa011642mg [Prunus persica]
Length=202

 Score =   150 bits (379),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 76/161 (47%), Positives = 106/161 (66%), Gaps = 14/161 (9%)
 Frame = -1

Query  714  VISVLASLIGRTVTRNQRIARNFRGAMDINVGSTK---VFECNEAPDMTIESYLERVFRY  544
            +I+ L+SL+ R    N           DIN   T+   VF     P ++I+SYLER+F+Y
Sbjct  13   IITFLSSLVQRVAESN-----------DINPFQTQRISVFHGLTRPTISIQSYLERIFKY  61

Query  543  TGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFARV  364
                PS  +VAYVYLDRF Q  P   I   NVHRLLIT++MVA+K+++DM Y N+Y+A+V
Sbjct  62   ANCSPSCLIVAYVYLDRFSQRQPTLPINSYNVHRLLITSVMVAAKFMDDMYYNNAYYAKV  121

Query  363  GGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREV  241
            GG++T+EMN LEV+FLF + F L+V  S F +YC +L+RE+
Sbjct  122  GGISTIEMNFLEVDFLFGLSFNLNVTPSTFTTYCSYLQREM  162



>ref|XP_001753286.1| predicted protein [Physcomitrella patens]
 gb|EDQ81915.1| predicted protein [Physcomitrella patens]
Length=164

 Score =   149 bits (375),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 69/160 (43%), Positives = 107/160 (67%), Gaps = 0/160 (0%)
 Frame = -1

Query  720  PLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVFRYT  541
            P V++VLAS++ R V  N++ A         N  +  +F    AP ++I  YLER+F+YT
Sbjct  5    PKVVTVLASVLDRLVASNEQFATTPSQPSVYNPKTLTIFHGLRAPSISIAKYLERIFKYT  64

Query  540  GAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFARVG  361
                S +VV YV++DR     P+  +   NVHRLL+T++MVA+K ++D+++ N++FAR G
Sbjct  65   NCSASCFVVGYVFIDRLIHQQPELLVTSLNVHRLLVTSVMVATKILDDVHFNNAFFARGG  124

Query  360  GLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREV  241
            G++  E+N+LE+EFLF + F+L V VS+F SYC +LE+EV
Sbjct  125  GVSVSELNRLELEFLFRLGFRLTVTVSLFESYCSYLEKEV  164



>ref|XP_009592904.1| PREDICTED: cyclin-U4-1 [Nicotiana tomentosiformis]
Length=207

 Score =   150 bits (378),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 72/166 (43%), Positives = 109/166 (66%), Gaps = 7/166 (4%)
 Frame = -1

Query  738  QEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLE  559
            Q QS  P +I  L+SL+ R    N    R     + +  G T+       P+++I++YLE
Sbjct  8    QNQSLMPKLIDYLSSLLQRVAEANDINGRFQPQKISVFHGLTR-------PNISIQNYLE  60

Query  558  RVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNS  379
            R+F+Y    P  +VVAYVYLDRF Q  P   I   N+HRLLIT++M+A+K+++DM Y N+
Sbjct  61   RIFKYANCSPCCFVVAYVYLDRFTQCQPSLPINSFNIHRLLITSVMIAAKFMDDMYYNNA  120

Query  378  YFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREV  241
            Y+A+VGG++T EMN LEV+FLF + F+L+V  + F +YC +L++E+
Sbjct  121  YYAKVGGISTTEMNFLEVDFLFGLGFRLNVTPTTFQTYCSYLQKEM  166



>ref|XP_007134401.1| hypothetical protein PHAVU_010G044800g [Phaseolus vulgaris]
 gb|ESW06395.1| hypothetical protein PHAVU_010G044800g [Phaseolus vulgaris]
Length=200

 Score =   149 bits (377),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/166 (43%), Positives = 105/166 (63%), Gaps = 6/166 (4%)
 Frame = -1

Query  738  QEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLE  559
            +  S  P VIS L+S++ R    N                   VF     P+++++ YLE
Sbjct  7    ESPSVMPKVISFLSSMLERVAESNDE------KQQLQQQQKISVFHGLTRPNISVQKYLE  60

Query  558  RVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNS  379
            R+F+Y    PS ++VAYVYLDRF Q  P   I   NVHRLLIT++MVA+K+++DM Y N+
Sbjct  61   RIFKYANCSPSCFIVAYVYLDRFTQRQPSLPINSFNVHRLLITSVMVAAKFMDDMYYNNA  120

Query  378  YFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREV  241
            Y+A+VGG++ +EMN LE++FLF + F+L+V+   F SYC HL+RE+
Sbjct  121  YYAKVGGISKIEMNFLELDFLFGLGFQLNVSPGTFQSYCVHLQREM  166



>gb|KCW58844.1| hypothetical protein EUGRSUZ_H01477 [Eucalyptus grandis]
Length=215

 Score =   149 bits (377),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 80/209 (38%), Positives = 131/209 (63%), Gaps = 14/209 (7%)
 Frame = -1

Query  765  RDDLYL-YAYQEQSST----PLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFE  601
            R D+YL    +EQ       P V+ +L+S + R+V +N+R+    +    I +     F 
Sbjct  10   RPDMYLSLGLREQGKKILGYPRVLMLLSSALDRSVQKNERLLETSQSKDVITI-----FH  64

Query  600  CNEAPDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIM  421
                P +TI  Y+ER+F+Y+   PS +V+A +Y+DRF Q +    +   NVHRLLIT++ 
Sbjct  65   GVRPPALTIRQYIERIFKYSACSPSCFVIAQIYMDRFVQ-NTDVLLTSLNVHRLLITSLT  123

Query  420  VASKYVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREV  241
            VA+K+V+D  + N+Y+A+VGG++T E+N+LE++FLF + F+LHV++  F  YC  LE+EV
Sbjct  124  VAAKFVDDAFFNNAYYAKVGGVSTSELNRLEMKFLFSIDFRLHVSIDTFQRYCLLLEKEV  183

Query  240  GIGGGYQIERTLRCAQDIKS-KQREDTTF  157
                G QIER+++  +  +S   +ED+T+
Sbjct  184  --SEGLQIERSIQSCRITESWSNKEDSTW  210



>gb|KHN22156.1| Cyclin-U4-1 [Glycine soja]
Length=206

 Score =   149 bits (376),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 104/165 (63%), Gaps = 16/165 (10%)
 Frame = -1

Query  720  PLVISVLASLIGRTVTRNQRIARNFRGAMDINVG-----STKVFECNEAPDMTIESYLER  556
            P +IS L+SL+ R    N           D+N          VF     P ++I+SYLER
Sbjct  11   PKLISFLSSLLKRVAESN-----------DLNQQQLIHQKVSVFHGLTRPTISIQSYLER  59

Query  555  VFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSY  376
            +F+Y    PS ++VAYVYLDRF Q  P   I   NVHRLLIT++MVA+K+++D+ Y N+Y
Sbjct  60   IFKYANCSPSCFIVAYVYLDRFTQRQPSLPINSFNVHRLLITSVMVAAKFMDDLYYNNAY  119

Query  375  FARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREV  241
            +A+VGG+TT+EMN LEV+FLF + F L+V    F +YC HL+ E+
Sbjct  120  YAKVGGITTIEMNFLEVDFLFGLGFHLNVTPGTFQAYCAHLQSEM  164



>gb|KDP28881.1| hypothetical protein JCGZ_14652 [Jatropha curcas]
Length=206

 Score =   149 bits (376),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 106/158 (67%), Gaps = 7/158 (4%)
 Frame = -1

Query  714  VISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVFRYTGA  535
            +I+ L+SL+       QR+A +             VF     P ++I+SYLER+F+Y   
Sbjct  13   LITFLSSLL-------QRVAESNDLNSQFQPQKISVFHGLTRPTISIQSYLERIFKYANC  65

Query  534  GPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFARVGGL  355
             PS ++VAYVYLDRF Q  P   I   NVHRLLIT+++VA+K+++DM Y N+Y+A+VGG+
Sbjct  66   SPSCFIVAYVYLDRFAQRQPSLPINSFNVHRLLITSVLVAAKFMDDMYYNNAYYAKVGGI  125

Query  354  TTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREV  241
            +T+EMN LEV+FLF + F L+V  + FH+YC +L+RE+
Sbjct  126  STIEMNYLEVDFLFGLGFHLNVTPNTFHTYCSYLQREM  163



>ref|XP_008235285.1| PREDICTED: cyclin-P3-1 [Prunus mume]
 ref|XP_008235286.1| PREDICTED: cyclin-P3-1 [Prunus mume]
Length=217

 Score =   149 bits (376),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 76/188 (40%), Positives = 123/188 (65%), Gaps = 10/188 (5%)
 Frame = -1

Query  720  PLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVFRYT  541
            P V+S L+SL+ R V +N+ +      A DI    T +F    AP ++I  Y++R+F+Y+
Sbjct  32   PRVLSPLSSLLERCVQKNEMLLE----ATDIKEVMT-IFHGLRAPTLSIRQYVDRIFKYS  86

Query  540  GAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFARVG  361
            G  PS +VVA +Y+DRF Q   + R+   NVHRLLIT++M+A+K+++D  + N+Y+A+VG
Sbjct  87   GCSPSCFVVAQIYVDRFIQC-TEVRLTSFNVHRLLITSVMLAAKFIDDAFFNNAYYAKVG  145

Query  360  GLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQIERTLR-CAQDIK  184
            G++T E+N+LE++FLF + F+L V++  F  YC  LE+E     G QIER+++ C     
Sbjct  146  GVSTSELNRLEMKFLFTIDFRLQVSIETFKRYCSQLEKE---AAGLQIERSIQACGIKEN  202

Query  183  SKQREDTT  160
               ++D+T
Sbjct  203  WSNKDDST  210



>gb|KHN12243.1| Cyclin-U4-1 [Glycine soja]
Length=202

 Score =   149 bits (375),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/166 (45%), Positives = 107/166 (64%), Gaps = 9/166 (5%)
 Frame = -1

Query  738  QEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLE  559
            +  S  P VI+ L+SL+ R    N    ++ +           VF     P+++I+SYLE
Sbjct  5    ESPSVMPKVITFLSSLLERVAESNDHNQQHQK---------ISVFHGLTRPNISIQSYLE  55

Query  558  RVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNS  379
            R+F+Y    PS +VVAYVYLDRF Q  P   I   NVHRLLIT++MVA+K+++DM Y N+
Sbjct  56   RIFKYANCSPSCFVVAYVYLDRFTQRQPSLPINTFNVHRLLITSVMVAAKFMDDMYYNNA  115

Query  378  YFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREV  241
            Y+A+VGG+T +EMN LE++FLF + F L+V    F +YC +L+RE+
Sbjct  116  YYAKVGGITKIEMNFLELDFLFGLGFHLNVTPGTFQAYCVNLQREM  161



>gb|AFK41945.1| unknown [Lotus japonicus]
Length=207

 Score =   149 bits (375),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 71/160 (44%), Positives = 103/160 (64%), Gaps = 5/160 (3%)
 Frame = -1

Query  720  PLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVFRYT  541
            P +++ L+S++ +    N     +      +      VF     P ++I+SYLER+F+Y 
Sbjct  11   PKLLAFLSSMLKKVAESN-----DLNQQQQLIHQKISVFHGLTRPTISIQSYLERIFKYA  65

Query  540  GAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFARVG  361
               PS ++VAYVYLDRF Q  P   I   NVHRLLIT++MVA+K+++DM Y N+Y+ARVG
Sbjct  66   NCSPSCFIVAYVYLDRFTQKQPSLPINSFNVHRLLITSVMVAAKFMDDMYYNNAYYARVG  125

Query  360  GLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREV  241
            G+TT+EMN LE++FLF + F L+V    F  YC HL+RE+
Sbjct  126  GITTIEMNFLELDFLFGLGFNLNVTPGTFQGYCSHLQREM  165



>ref|XP_010692026.1| PREDICTED: cyclin-U4-1 [Beta vulgaris subsp. vulgaris]
Length=217

 Score =   149 bits (376),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 73/163 (45%), Positives = 106/163 (65%), Gaps = 7/163 (4%)
 Frame = -1

Query  729  SSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVF  550
            +S P +I+ L+SL+ R    N    R       +      VF     P ++I+SYLER+F
Sbjct  12   NSVPKMITFLSSLLQRVAESNDIHRR-------LEPQKVSVFHGLTQPTISIQSYLERIF  64

Query  549  RYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFA  370
            +Y    PS +VVAYVYLDRF Q  P   I   NVHRLLIT++M+++K+++DM Y N+Y+A
Sbjct  65   KYANCSPSCFVVAYVYLDRFTQRQPLLPINSYNVHRLLITSVMISAKFMDDMYYNNAYYA  124

Query  369  RVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREV  241
            ++GG+T  EMN LEV+FLF + F L+V  + FH+YC +L+RE+
Sbjct  125  KIGGITITEMNFLEVDFLFGLGFHLNVTPNTFHTYCSYLQREM  167



>ref|XP_008232383.1| PREDICTED: cyclin-U4-1-like [Prunus mume]
Length=202

 Score =   148 bits (374),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 75/161 (47%), Positives = 105/161 (65%), Gaps = 14/161 (9%)
 Frame = -1

Query  714  VISVLASLIGRTVTRNQRIARNFRGAMDINVGSTK---VFECNEAPDMTIESYLERVFRY  544
            +I+ L+SL+ R    N           DIN   T+   VF     P ++I+SYLER+F+Y
Sbjct  13   IITFLSSLVQRVAESN-----------DINPFQTQRISVFHGLTRPTISIQSYLERIFKY  61

Query  543  TGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFARV  364
                PS  +VAYVYLDRF Q  P   I   NVHRLLI ++MVA+K+++DM Y N+Y+A+V
Sbjct  62   ANCSPSCLIVAYVYLDRFSQRQPTLPINSYNVHRLLIASVMVAAKFMDDMYYNNAYYAKV  121

Query  363  GGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREV  241
            GG++T+EMN LEV+FLF + F L+V  S F +YC +L+RE+
Sbjct  122  GGISTIEMNFLEVDFLFGLSFNLNVTPSTFTTYCSYLQREM  162



>ref|XP_007205921.1| hypothetical protein PRUPE_ppa011614mg [Prunus persica]
 gb|EMJ07120.1| hypothetical protein PRUPE_ppa011614mg [Prunus persica]
Length=203

 Score =   148 bits (374),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 103/158 (65%), Gaps = 7/158 (4%)
 Frame = -1

Query  714  VISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVFRYTGA  535
            VI+ L+SL+       QR+A +     +       VF     P + I+ YLER+F+Y   
Sbjct  13   VITFLSSLV-------QRVAESNDINCEFQPQKISVFHGQTRPPIAIQGYLERIFKYADC  65

Query  534  GPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFARVGGL  355
             PS  +VAYVYLDRF Q  P   I   NVHRLLIT++MVA+K+++DM Y N+Y+A+VGG+
Sbjct  66   SPSCLIVAYVYLDRFSQRQPDLPINSYNVHRLLITSVMVAAKFMDDMYYNNAYYAKVGGI  125

Query  354  TTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREV  241
            +T+EMN LEV+FLF + F L+V  S F +YC +L+RE+
Sbjct  126  STIEMNFLEVDFLFGLNFNLNVTPSTFTTYCSYLQREM  163



>ref|XP_009375368.1| PREDICTED: cyclin-U4-1 [Pyrus x bretschneideri]
Length=206

 Score =   148 bits (374),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 106/158 (67%), Gaps = 7/158 (4%)
 Frame = -1

Query  714  VISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVFRYTGA  535
            +I+ L+SL+ R    N  +  +F+           VF     P ++I+SYLER+F+Y   
Sbjct  13   IITFLSSLVQRVAESND-LNSHFQPQ------KISVFHGLTRPTISIQSYLERIFKYADC  65

Query  534  GPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFARVGGL  355
             PS  +VAYVYLDRF Q HP   I   NVHRLLIT++MVA+K+++DM Y N+Y+A+VGG+
Sbjct  66   SPSCLIVAYVYLDRFSQRHPSLPINSFNVHRLLITSVMVAAKFMDDMYYNNAYYAKVGGI  125

Query  354  TTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREV  241
            +T+EMN LEV+FLF + F L+V  S F ++C +L+RE+
Sbjct  126  STIEMNFLEVDFLFGLSFDLNVTPSTFTTHCSYLQREM  163



>ref|XP_002278426.1| PREDICTED: cyclin-U4-1 [Vitis vinifera]
 emb|CBI38577.3| unnamed protein product [Vitis vinifera]
Length=194

 Score =   148 bits (373),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 71/173 (41%), Positives = 107/173 (62%), Gaps = 8/173 (5%)
 Frame = -1

Query  720  PLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVFRYT  541
            P +IS L+SL+ R    N    +       ++      F     P ++I+SYLER+F+Y 
Sbjct  11   PELISFLSSLLQRVAISNDLNPK-------LHTQKISAFHGLTRPSISIQSYLERIFKYA  63

Query  540  GAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFARVG  361
               PS ++VA++YLDRF Q  P   +   N HRLLIT++MVA+K+++DM Y N+Y+A+VG
Sbjct  64   NCSPSCFIVAFIYLDRFSQSQPSLPLSSFNAHRLLITSVMVAAKFMDDMYYNNAYYAKVG  123

Query  360  GLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQIERTLR  202
            G++  EMN LEV+FLF ++F+L+V  + FHSYC  L +E+       +ER L 
Sbjct  124  GISRAEMNLLEVDFLFGLKFQLNVTPNAFHSYCSFLHKEMSFQSP-PLERPLN  175



>ref|XP_003552477.1| PREDICTED: cyclin-U4-1-like [Glycine max]
Length=205

 Score =   148 bits (374),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 73/160 (46%), Positives = 102/160 (64%), Gaps = 6/160 (4%)
 Frame = -1

Query  720  PLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVFRYT  541
            P +IS L+SL+ R    N    +              VF     P ++I+SYLER+F+Y 
Sbjct  11   PKLISFLSSLLKRVAESNDLNQQQLLHQ------KVSVFHGLTRPTISIQSYLERIFKYA  64

Query  540  GAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFARVG  361
               PS ++VAYVYLDRF Q  P   I   NVHRLLIT++MVA+K+++D+ Y N+Y+A+VG
Sbjct  65   NCSPSCFIVAYVYLDRFTQRQPSLPINFFNVHRLLITSVMVAAKFMDDLYYNNAYYAKVG  124

Query  360  GLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREV  241
            G+TT+EMN LEV+FLF + F L+V    F +YC HL+ E+
Sbjct  125  GITTIEMNFLEVDFLFGLGFHLNVTPGTFQAYCAHLQSEM  164



>gb|KHN40524.1| Cyclin-U4-1 [Glycine soja]
Length=205

 Score =   148 bits (374),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 73/160 (46%), Positives = 102/160 (64%), Gaps = 6/160 (4%)
 Frame = -1

Query  720  PLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVFRYT  541
            P +IS L+SL+ R    N    +              VF     P ++I+SYLER+F+Y 
Sbjct  11   PKLISFLSSLLKRVAESNDLNQQQLLHQ------KVSVFHGLTRPTISIQSYLERIFKYA  64

Query  540  GAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFARVG  361
               PS ++VAYVYLDRF Q  P   I   NVHRLLIT++MVA+K+++D+ Y N+Y+A+VG
Sbjct  65   NCSPSCFIVAYVYLDRFTQRQPSLPINFFNVHRLLITSVMVAAKFMDDLYYNNAYYAKVG  124

Query  360  GLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREV  241
            G+TT+EMN LEV+FLF + F L+V    F +YC HL+ E+
Sbjct  125  GITTIEMNFLEVDFLFGLGFHLNVTPGTFQAYCAHLQSEM  164



>ref|XP_006388184.1| hypothetical protein POPTR_0296s00210g [Populus trichocarpa]
 gb|ERP47098.1| hypothetical protein POPTR_0296s00210g [Populus trichocarpa]
Length=201

 Score =   148 bits (373),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 78/185 (42%), Positives = 118/185 (64%), Gaps = 8/185 (4%)
 Frame = -1

Query  735  EQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLER  556
            E +  P VI+ L+SL+ R    N    + +     I  G T+       P ++I++YLER
Sbjct  6    ETAVMPKVITFLSSLLQRVAESNDISHQLYPQKASIFHGLTR-------PTISIQNYLER  58

Query  555  VFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSY  376
            +F+Y+   PS +VVAYVYLDRF Q    F +   NVHRLLIT+++V+ K+++D+ Y N++
Sbjct  59   IFKYSNCSPSCFVVAYVYLDRFSQRQSCFPLNSFNVHRLLITSVLVSVKFMDDIYYNNAF  118

Query  375  FARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQIERT-LRC  199
            +A+VGG++T EMN LEV+FLF + F+L+V  + FH YC +L+RE+ I    QI  T L  
Sbjct  119  YAKVGGISTREMNLLEVDFLFGLGFQLNVTPTTFHLYCSYLQREMSIQSPLQIVDTPLNI  178

Query  198  AQDIK  184
            A+ +K
Sbjct  179  ARPLK  183



>ref|XP_009400236.1| PREDICTED: cyclin-P4-1-like [Musa acuminata subsp. malaccensis]
Length=206

 Score =   148 bits (373),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 70/166 (42%), Positives = 104/166 (63%), Gaps = 5/166 (3%)
 Frame = -1

Query  738  QEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLE  559
            +E  + P V+SVL++++ R   RN    R               F     P +++  YLE
Sbjct  6    EEAHAVPGVVSVLSAILARVAERNDAAGRPVSPRH-----LASAFRGLARPAISVRGYLE  60

Query  558  RVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNS  379
            R+FRY G  P+ YVVAY+YLDRF + HP       NVHR LIT+++ A K+++D+ Y N+
Sbjct  61   RIFRYAGCSPACYVVAYIYLDRFARRHPAASFDSLNVHRFLITSVLTAVKFMDDICYNNA  120

Query  378  YFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREV  241
            YFA+VGG++ MEMN LE++FLF + F+L+V  ++F SYC  L+RE+
Sbjct  121  YFAKVGGISLMEMNHLEIDFLFSIGFELNVTPAIFSSYCSILQREL  166



>ref|XP_003529016.1| PREDICTED: cyclin-U4-1-like [Glycine max]
Length=202

 Score =   148 bits (373),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 74/166 (45%), Positives = 106/166 (64%), Gaps = 9/166 (5%)
 Frame = -1

Query  738  QEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLE  559
            +  S  P VI+ L+SL+ R    N    ++ +           VF     P+++I SYLE
Sbjct  5    ESPSVMPKVITFLSSLLERVAESNDHNQQHQK---------ISVFHGLTRPNISIHSYLE  55

Query  558  RVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNS  379
            R+F+Y    PS +VVAYVYLDRF Q  P   I   NVHRLLIT++MVA+K+++DM Y N+
Sbjct  56   RIFKYANCSPSCFVVAYVYLDRFTQRQPSLPINTFNVHRLLITSVMVAAKFMDDMYYNNA  115

Query  378  YFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREV  241
            Y+A+VGG+T +EMN LE++FLF + F L+V    F +YC +L+RE+
Sbjct  116  YYAKVGGITKIEMNFLELDFLFGLGFHLNVTPGTFQAYCVNLQREM  161



>ref|XP_004515319.1| PREDICTED: cyclin-U4-1-like [Cicer arietinum]
Length=202

 Score =   148 bits (373),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 74/186 (40%), Positives = 116/186 (62%), Gaps = 8/186 (4%)
 Frame = -1

Query  735  EQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLER  556
            E    P +I+ L+SL+ R    N    +  +  + +  G T+       P+++I+SYLER
Sbjct  5    ESPMMPKLITFLSSLLERVAESNDETQQEQQQKISVFHGLTR-------PNISIQSYLER  57

Query  555  VFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSY  376
            +F+Y    PS ++VAYVYLDRF Q  P   I   NVHRLLIT++MVA+K+++D+ Y N+Y
Sbjct  58   IFKYANCSPSCFIVAYVYLDRFTQTQPSLPINSFNVHRLLITSVMVAAKFMDDVYYNNAY  117

Query  375  FARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREV-GIGGGYQIERTLRC  199
            +A+VGG+T  EMN LE++FLF + F L+V    F +Y  HL+RE+  +   +  + T+  
Sbjct  118  YAKVGGITKAEMNFLELDFLFGLGFNLNVTPITFQAYSVHLQREMFHMQPLHFADSTINL  177

Query  198  AQDIKS  181
            A+ +K+
Sbjct  178  AKSLKA  183



>ref|XP_002274682.1| PREDICTED: cyclin-P3-1 isoform X1 [Vitis vinifera]
Length=226

 Score =   148 bits (374),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 76/194 (39%), Positives = 125/194 (64%), Gaps = 9/194 (5%)
 Frame = -1

Query  723  TPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVFRY  544
            TP V+ +L+SL+ R+V +N+ +    +    I +     F  + AP +++  Y++R+F+Y
Sbjct  40   TPRVLLLLSSLLERSVQKNETLLETAQIKDAITI-----FHGSRAPTLSVRQYIDRIFKY  94

Query  543  TGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFARV  364
            +G  PS +VVA++Y+DRF Q H    +   NVHRLLIT++MVA+K+++D  + N+Y+A+V
Sbjct  95   SGCSPSCFVVAHIYVDRFLQ-HTDAHLTSLNVHRLLITSVMVAAKFIDDAFFNNAYYAKV  153

Query  363  GGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQIERTLR-CAQDI  187
            GG++T E+N+LE++FLF + F+L V V  F SYC  L++EV   GG QIER  + C    
Sbjct  154  GGVSTAELNRLEMKFLFSLDFRLQVTVETFRSYCSQLDKEV--AGGLQIERPFQACGIKE  211

Query  186  KSKQREDTTFTQVT  145
                +ED+  + + 
Sbjct  212  SWSSKEDSCASTIA  225



>ref|XP_009760207.1| PREDICTED: cyclin-P3-1-like isoform X5 [Nicotiana sylvestris]
 ref|XP_009760208.1| PREDICTED: cyclin-P3-1-like isoform X5 [Nicotiana sylvestris]
Length=224

 Score =   148 bits (374),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 74/173 (43%), Positives = 115/173 (66%), Gaps = 8/173 (5%)
 Frame = -1

Query  720  PLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVFRYT  541
            P ++S+LAS++ RTV +N++  +  +       G   VF    +P +T++ Y+ER+F+Y+
Sbjct  31   PKILSILASVLERTVQKNEKAMKGSK-----ERGVVTVFHGTRSPVLTVQQYIERIFKYS  85

Query  540  GAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFARVG  361
               PS +VVAYVYL+RF  L     +   NVHR+LIT+I++A K+V+D  Y N+Y+A+VG
Sbjct  86   NCSPSCFVVAYVYLERFLNLTDCL-LTSLNVHRILITSIVLAVKFVDDDCYNNAYYAKVG  144

Query  360  GLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQIERTLR  202
            G+TT E+NKLE++FL  + F+LHV+V  F  YC  LE+E  +    QI+R +R
Sbjct  145  GITTAELNKLEMKFLAALDFRLHVSVESFDKYCLQLEKEDNV--KLQIDRPIR  195



>ref|XP_011040341.1| PREDICTED: cyclin-U4-1-like isoform X1 [Populus euphratica]
Length=194

 Score =   147 bits (372),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 74/178 (42%), Positives = 113/178 (63%), Gaps = 7/178 (4%)
 Frame = -1

Query  735  EQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLER  556
            E +  P VI  L+SL+       QR+A +   +  +      +F     P ++I++YLER
Sbjct  6    ETAVMPKVIPFLSSLL-------QRVAESNDISHQLYPQKVSIFHGLSRPAISIQNYLER  58

Query  555  VFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSY  376
            +F+Y    PS +VVAYVYLDRF Q    F +   NVHRLLIT+++V+ K+++D+ Y N++
Sbjct  59   IFKYANCSPSCFVVAYVYLDRFSQRQSCFPLNSFNVHRLLITSVLVSVKFMDDIYYNNAF  118

Query  375  FARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQIERTLR  202
            +A+VGG++T EMN LEV+FLF + F+L+V  + FH YC +L+RE+ I     I R L+
Sbjct  119  YAKVGGISTREMNLLEVDFLFGLGFQLNVTPATFHFYCSYLQREMSIQSPLNIARPLK  176



>ref|XP_010652114.1| PREDICTED: cyclin-P3-1 isoform X2 [Vitis vinifera]
Length=217

 Score =   148 bits (374),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 76/194 (39%), Positives = 125/194 (64%), Gaps = 9/194 (5%)
 Frame = -1

Query  723  TPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVFRY  544
            TP V+ +L+SL+ R+V +N+ +    +    I +     F  + AP +++  Y++R+F+Y
Sbjct  31   TPRVLLLLSSLLERSVQKNETLLETAQIKDAITI-----FHGSRAPTLSVRQYIDRIFKY  85

Query  543  TGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFARV  364
            +G  PS +VVA++Y+DRF Q H    +   NVHRLLIT++MVA+K+++D  + N+Y+A+V
Sbjct  86   SGCSPSCFVVAHIYVDRFLQ-HTDAHLTSLNVHRLLITSVMVAAKFIDDAFFNNAYYAKV  144

Query  363  GGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQIERTLR-CAQDI  187
            GG++T E+N+LE++FLF + F+L V V  F SYC  L++EV   GG QIER  + C    
Sbjct  145  GGVSTAELNRLEMKFLFSLDFRLQVTVETFRSYCSQLDKEV--AGGLQIERPFQACGIKE  202

Query  186  KSKQREDTTFTQVT  145
                +ED+  + + 
Sbjct  203  SWSSKEDSCASTIA  216



>ref|XP_010070213.1| PREDICTED: cyclin-P3-1 isoform X2 [Eucalyptus grandis]
 gb|KCW58845.1| hypothetical protein EUGRSUZ_H01477 [Eucalyptus grandis]
Length=228

 Score =   148 bits (374),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 74/189 (39%), Positives = 123/189 (65%), Gaps = 9/189 (5%)
 Frame = -1

Query  720  PLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVFRYT  541
            P V+ +L+S + R+V +N+R+    +    I +     F     P +TI  Y+ER+F+Y+
Sbjct  43   PRVLMLLSSALDRSVQKNERLLETSQSKDVITI-----FHGVRPPALTIRQYIERIFKYS  97

Query  540  GAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFARVG  361
               PS +V+A +Y+DRF Q +    +   NVHRLLIT++ VA+K+V+D  + N+Y+A+VG
Sbjct  98   ACSPSCFVIAQIYMDRFVQ-NTDVLLTSLNVHRLLITSLTVAAKFVDDAFFNNAYYAKVG  156

Query  360  GLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQIERTLRCAQDIKS  181
            G++T E+N+LE++FLF + F+LHV++  F  YC  LE+EV    G QIER+++  +  +S
Sbjct  157  GVSTSELNRLEMKFLFSIDFRLHVSIDTFQRYCLLLEKEV--SEGLQIERSIQSCRITES  214

Query  180  -KQREDTTF  157
               +ED+T+
Sbjct  215  WSNKEDSTW  223



>ref|XP_006445448.1| hypothetical protein CICLE_v10022279mg [Citrus clementina]
 ref|XP_006464405.1| PREDICTED: cyclin-U4-1-like [Citrus sinensis]
 gb|ESR58688.1| hypothetical protein CICLE_v10022279mg [Citrus clementina]
 gb|KDO85467.1| hypothetical protein CISIN_1g028611mg [Citrus sinensis]
Length=206

 Score =   147 bits (372),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 106/158 (67%), Gaps = 7/158 (4%)
 Frame = -1

Query  714  VISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVFRYTGA  535
            +I+ L+S + R    N    R     + +  G T+       P ++I+SYLER+F+Y   
Sbjct  13   LITFLSSFLQRVSESNDINCRFQPQKISVFHGLTR-------PSISIQSYLERIFKYANC  65

Query  534  GPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFARVGGL  355
             PS ++VAYVYLDRF Q  P   I   NVHRLLIT++MVA+K+++DM Y N+Y+A+VGG+
Sbjct  66   SPSCFIVAYVYLDRFVQRQPSLPINSFNVHRLLITSVMVAAKFLDDMYYNNAYYAKVGGI  125

Query  354  TTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREV  241
            +T+EMN LE++FLF + F L+V  + FH+YC +L+RE+
Sbjct  126  STIEMNFLELDFLFGLSFHLNVTPNAFHTYCTYLQREM  163



>ref|XP_009342256.1| PREDICTED: cyclin-U1-1-like [Pyrus x bretschneideri]
Length=239

 Score =   149 bits (375),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 77/184 (42%), Positives = 115/184 (63%), Gaps = 8/184 (4%)
 Frame = -1

Query  732  QSSTPLVISVLASLIGRTVTRNQRIARNFRGAMD-INVGST------KVFECNEAPDMTI  574
            ++S P V+++L+ ++ + V RN  +  +    +  I+ GS        V      P ++I
Sbjct  15   ETSIPRVLTILSFVLEKLVARNNTLVDDLNQQLSGISCGSAVIGKNLDVLHGVRPPSVSI  74

Query  573  ESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDM  394
              YLER+++YT   PS +VV YVY+DR    HP   +   NVHRLL+T++MVASK ++D+
Sbjct  75   PKYLERLYKYTDCSPSCFVVGYVYIDRLLHKHPDSLVLSLNVHRLLVTSVMVASKMLDDV  134

Query  393  NYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQ-I  217
            +Y N+++ARVGG++  E+NKLEVE LFL+ F + V+  VF SYC HLE+E    G  Q I
Sbjct  135  HYNNAFYARVGGVSNAELNKLEVELLFLLDFGVMVSSRVFESYCFHLEKENMQNGACQRI  194

Query  216  ERTL  205
            ER L
Sbjct  195  ERPL  198



>ref|NP_196362.1| cyclin p4;3 [Arabidopsis thaliana]
 sp|Q9LY16.1|CCU42_ARATH RecName: Full=Cyclin-U4-2; Short=CycU4;2; AltName: Full=Cyclin-P4.3; 
Short=CycP4;3 [Arabidopsis thaliana]
 emb|CAB87934.1| putative protein [Arabidopsis thaliana]
 dbj|BAC43685.1| unknown protein [Arabidopsis thaliana]
 gb|AAO63299.1| At5g07450 [Arabidopsis thaliana]
 gb|AED91160.1| cyclin p4;3 [Arabidopsis thaliana]
Length=216

 Score =   148 bits (373),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/166 (42%), Positives = 110/166 (66%), Gaps = 5/166 (3%)
 Frame = -1

Query  720  PLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVFRYT  541
            P VI+ ++SL+ R    N  ++R FR    I+      F     P ++I SY+ER+F+Y 
Sbjct  21   PNVITAMSSLLQRVSETNDDLSRPFREHKRISA-----FNAVTKPSISIRSYMERIFKYA  75

Query  540  GAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFARVG  361
                S Y+VAY+YLDRF Q  P   I  +NVHRL+IT+++V++K+++D+ Y N+++A+VG
Sbjct  76   DCSDSCYIVAYIYLDRFIQKQPLLPIDSSNVHRLIITSVLVSAKFMDDLCYNNAFYAKVG  135

Query  360  GLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGY  223
            G+TT EMN LE++FLF + F+L+V +S ++ YC  L+RE+ +   Y
Sbjct  136  GITTEEMNLLELDFLFGIGFQLNVTISTYNDYCSSLQREMVMRTMY  181



>ref|XP_009600659.1| PREDICTED: cyclin-P3-1-like [Nicotiana tomentosiformis]
Length=226

 Score =   148 bits (373),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 74/173 (43%), Positives = 114/173 (66%), Gaps = 8/173 (5%)
 Frame = -1

Query  720  PLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVFRYT  541
            P ++S+LAS++ +TV +N++  +  +       G   VF    AP +T++ Y+ER+F+Y+
Sbjct  34   PKILSILASVLEKTVQKNEKAMKGSK-----ERGVVTVFHGTRAPVLTVQQYIERIFKYS  88

Query  540  GAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFARVG  361
               PS +VVAYVYL+RF  L     +   NVHRLLIT I++A K+V+D  Y ++Y+A+VG
Sbjct  89   NCSPSCFVVAYVYLERFLNLTDCL-LTSLNVHRLLITCIVLAVKFVDDDCYNDAYYAKVG  147

Query  360  GLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQIERTLR  202
            G+TT E+NKLE++FL  + F+LHV+V  F  YC  LE+E  +    QI+R +R
Sbjct  148  GITTKELNKLEMKFLAALDFRLHVSVESFDKYCLQLEKEANV--KLQIDRPIR  198



>ref|XP_010070212.1| PREDICTED: cyclin-P3-1 isoform X1 [Eucalyptus grandis]
 gb|KCW58846.1| hypothetical protein EUGRSUZ_H01477 [Eucalyptus grandis]
 gb|KCW58847.1| hypothetical protein EUGRSUZ_H01477 [Eucalyptus grandis]
Length=239

 Score =   148 bits (374),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 74/189 (39%), Positives = 123/189 (65%), Gaps = 9/189 (5%)
 Frame = -1

Query  720  PLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVFRYT  541
            P V+ +L+S + R+V +N+R+    +    I +     F     P +TI  Y+ER+F+Y+
Sbjct  54   PRVLMLLSSALDRSVQKNERLLETSQSKDVITI-----FHGVRPPALTIRQYIERIFKYS  108

Query  540  GAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFARVG  361
               PS +V+A +Y+DRF Q +    +   NVHRLLIT++ VA+K+V+D  + N+Y+A+VG
Sbjct  109  ACSPSCFVIAQIYMDRFVQ-NTDVLLTSLNVHRLLITSLTVAAKFVDDAFFNNAYYAKVG  167

Query  360  GLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQIERTLRCAQDIKS  181
            G++T E+N+LE++FLF + F+LHV++  F  YC  LE+EV    G QIER+++  +  +S
Sbjct  168  GVSTSELNRLEMKFLFSIDFRLHVSIDTFQRYCLLLEKEV--SEGLQIERSIQSCRITES  225

Query  180  -KQREDTTF  157
               +ED+T+
Sbjct  226  WSNKEDSTW  234



>gb|EMS61422.1| hypothetical protein TRIUR3_30801 [Triticum urartu]
Length=266

 Score =   149 bits (376),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/191 (40%), Positives = 112/191 (59%), Gaps = 22/191 (12%)
 Frame = -1

Query  744  AYQEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVG------------------  619
            A ++Q++ P V+S+L++L+ R   RN  +A   R   D+                     
Sbjct  2    AAEDQAAVPRVVSILSALLERVAKRNDVVAAVERRIRDVEEQEEQEDQGEDGKETTTTTT  61

Query  618  ----STKVFECNEAPDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTN  451
                +   F+    P +++  YLER+FR+ G  PS YVVAY+YLDRF +  P   +   N
Sbjct  62   TKKTAVSAFQGLTKPAISVGGYLERIFRFAGCSPSCYVVAYIYLDRFLRRRPALAVDSFN  121

Query  450  VHRLLITTIMVASKYVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFH  271
            VHRLLIT+++ A K+V+D+ Y N+YFARVGG++ MEMN LEV+FLF + F L+V  +VF 
Sbjct  122  VHRLLITSVLTAVKFVDDICYNNAYFARVGGISLMEMNYLEVDFLFGIAFDLNVTPAVFA  181

Query  270  SYCCHLEREVG  238
            SYC  L+ E+ 
Sbjct  182  SYCAVLQTEMA  192



>emb|CDY30482.1| BnaA04g25830D [Brassica napus]
 emb|CDY23452.1| BnaC04g49800D [Brassica napus]
Length=201

 Score =   147 bits (371),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 106/162 (65%), Gaps = 5/162 (3%)
 Frame = -1

Query  720  PLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVFRYT  541
            P +I+ L+SL+ R    N    R     +     S  VF     P +TI+SYLER+F+Y 
Sbjct  11   PKLIAFLSSLLERVAESNDLTRR-----VTTQSQSVSVFHGLSRPTITIQSYLERIFKYA  65

Query  540  GAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFARVG  361
               PS +VVAYVYLDRF Q  P   I   NVHRLLIT++MV++K+++D+ Y N+Y+A+VG
Sbjct  66   NCSPSCFVVAYVYLDRFTQRQPSLPINSFNVHRLLITSVMVSAKFLDDLYYNNAYYAKVG  125

Query  360  GLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGI  235
            G++T EMN LE++FLF + F L+V  + FH+Y  +L++E+ +
Sbjct  126  GISTKEMNLLELDFLFGLGFDLNVKPNTFHAYFSYLQKEMTL  167



>ref|XP_009760204.1| PREDICTED: cyclin-P3-1-like isoform X3 [Nicotiana sylvestris]
Length=257

 Score =   149 bits (375),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/173 (43%), Positives = 115/173 (66%), Gaps = 8/173 (5%)
 Frame = -1

Query  720  PLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVFRYT  541
            P ++S+LAS++ RTV +N++  +  +       G   VF    +P +T++ Y+ER+F+Y+
Sbjct  64   PKILSILASVLERTVQKNEKAMKGSK-----ERGVVTVFHGTRSPVLTVQQYIERIFKYS  118

Query  540  GAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFARVG  361
               PS +VVAYVYL+RF  L     +   NVHR+LIT+I++A K+V+D  Y N+Y+A+VG
Sbjct  119  NCSPSCFVVAYVYLERFLNLTDCL-LTSLNVHRILITSIVLAVKFVDDDCYNNAYYAKVG  177

Query  360  GLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQIERTLR  202
            G+TT E+NKLE++FL  + F+LHV+V  F  YC  LE+E  +    QI+R +R
Sbjct  178  GITTAELNKLEMKFLAALDFRLHVSVESFDKYCLQLEKEDNV--KLQIDRPIR  228



>emb|CDX74684.1| BnaA05g04300D [Brassica napus]
Length=226

 Score =   147 bits (372),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/162 (46%), Positives = 106/162 (65%), Gaps = 5/162 (3%)
 Frame = -1

Query  720  PLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVFRYT  541
            P +IS L+SL+ R    N  I R     +     S  VFE    P +TI+SYLER+F+Y 
Sbjct  11   PKLISFLSSLLERVSETNDLIRR-----VTTQSQSVSVFEGLSRPPITIQSYLERIFKYA  65

Query  540  GAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFARVG  361
               PS +VVAYVYLDRF    P   I   NVHRLLIT++MV++K+++D  Y N+Y+A+VG
Sbjct  66   NCSPSCFVVAYVYLDRFTHRQPSLPINSFNVHRLLITSVMVSAKFLDDRYYNNAYYAKVG  125

Query  360  GLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGI  235
            G++T EMN LE++FLF + F L+V  + FH+Y  +L++E+ +
Sbjct  126  GISTKEMNLLELDFLFGLGFDLNVTPNTFHAYFSYLKKEMTL  167



>gb|EYU20163.1| hypothetical protein MIMGU_mgv1a024090mg [Erythranthe guttata]
Length=205

 Score =   147 bits (371),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 106/158 (67%), Gaps = 7/158 (4%)
 Frame = -1

Query  714  VISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVFRYTGA  535
            VI  L+SL+       QR++    G    +     +F     P ++IESYLER+F+Y   
Sbjct  13   VIKFLSSLL-------QRVSETNDGFRFFHTQRISIFHGLTRPTISIESYLERIFKYANC  65

Query  534  GPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFARVGGL  355
             PS +VVAY+YLDRF Q  P   I   NVHRLLI +++V++K+++D+ Y N+Y+A++GG+
Sbjct  66   SPSCFVVAYIYLDRFAQKQPLLPINSFNVHRLLIASVLVSAKFMDDIFYNNAYYAKIGGI  125

Query  354  TTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREV  241
            TT EMN LE++FLF + F+L+V++S FH YC +L+RE+
Sbjct  126  TTAEMNLLEMDFLFGLGFQLNVSISTFHHYCSYLQREM  163



>ref|XP_004229728.1| PREDICTED: cyclin-U4-1 [Solanum lycopersicum]
Length=206

 Score =   147 bits (371),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 71/166 (43%), Positives = 107/166 (64%), Gaps = 7/166 (4%)
 Frame = -1

Query  738  QEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLE  559
            Q Q+  P +I  L+SL+ R    N    R     + +  G T+       P+++I+SYLE
Sbjct  7    QNQNLMPKLIDYLSSLLQRVAEANDINGRFQPQKISVFHGLTR-------PNISIQSYLE  59

Query  558  RVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNS  379
            R+F+Y    P  +VVAYVYLDRF Q  P   I   N+HRLLIT++M+A+K+++DM Y N+
Sbjct  60   RIFKYANCSPCCFVVAYVYLDRFTQCQPSLPINSFNIHRLLITSVMIAAKFMDDMYYNNA  119

Query  378  YFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREV  241
            Y+A+VGG++  EMN LEV+FLF + F L+V  + F +YC +L++E+
Sbjct  120  YYAKVGGISITEMNFLEVDFLFGLGFHLNVTPTTFQTYCAYLQKEM  165



>ref|XP_006374594.1| hypothetical protein POPTR_0015s12380g [Populus trichocarpa]
 gb|ERP52391.1| hypothetical protein POPTR_0015s12380g [Populus trichocarpa]
Length=201

 Score =   147 bits (370),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 77/185 (42%), Positives = 118/185 (64%), Gaps = 8/185 (4%)
 Frame = -1

Query  735  EQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLER  556
            E +  P VI+ L+SL+ R    N    + +     I  G T+       P ++I++YLER
Sbjct  6    ETAVMPKVITFLSSLLKRVAESNDISHQLYPQKASIFHGLTR-------PTISIQNYLER  58

Query  555  VFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSY  376
            +F+Y+   PS +VVAYVYLDRF Q    F +   NVHRLLIT+++V+ K+++D+ Y N++
Sbjct  59   IFKYSNCSPSCFVVAYVYLDRFSQRQSCFPLNSFNVHRLLITSVLVSVKFMDDIYYNNAF  118

Query  375  FARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQIERT-LRC  199
            +A+VGG++T EMN LEV+FLF + F+L+V  + FH YC +L+R++ I    QI  T L  
Sbjct  119  YAKVGGISTREMNLLEVDFLFGLGFQLNVTPATFHLYCSYLQRDMSIQSPLQIVDTPLNI  178

Query  198  AQDIK  184
            A+ +K
Sbjct  179  ARPLK  183



>ref|XP_008455834.1| PREDICTED: cyclin-U1-1 [Cucumis melo]
Length=233

 Score =   147 bits (372),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/184 (40%), Positives = 116/184 (63%), Gaps = 10/184 (5%)
 Frame = -1

Query  723  TPLVISVLASLIGRTVTRNQRIARNFRGAMD---------INVGST-KVFECNEAPDMTI  574
            TP V+ +LA ++ R V RN R+       ++          ++G++   F    AP ++I
Sbjct  22   TPRVLIILAFVLDRLVARNDRLLNELTQQLEELGCCSSSSNHLGNSFNAFHGVRAPTISI  81

Query  573  ESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDM  394
              YLER+++YT   PS  VV +VY+DR    HP   +   NVHRLL+T++MVASK ++D+
Sbjct  82   LKYLERIYKYTNCSPSCLVVGFVYIDRLIHRHPDSLVISLNVHRLLVTSVMVASKMLDDV  141

Query  393  NYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQIE  214
            +Y N+++ARVGG++  E+NKLE+E LFL+ F + V+   F +YCCHLE+E+ + G  +++
Sbjct  142  HYNNAFYARVGGVSKGELNKLELEMLFLLDFGVTVSSRAFETYCCHLEKEMLLNGNGEMQ  201

Query  213  RTLR  202
            R  R
Sbjct  202  RVER  205



>ref|XP_009760205.1| PREDICTED: cyclin-P3-1-like isoform X4 [Nicotiana sylvestris]
Length=256

 Score =   148 bits (374),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/173 (43%), Positives = 115/173 (66%), Gaps = 8/173 (5%)
 Frame = -1

Query  720  PLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVFRYT  541
            P ++S+LAS++ RTV +N++  +  +       G   VF    +P +T++ Y+ER+F+Y+
Sbjct  63   PKILSILASVLERTVQKNEKAMKGSK-----ERGVVTVFHGTRSPVLTVQQYIERIFKYS  117

Query  540  GAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFARVG  361
               PS +VVAYVYL+RF  L     +   NVHR+LIT+I++A K+V+D  Y N+Y+A+VG
Sbjct  118  NCSPSCFVVAYVYLERFLNLTDCL-LTSLNVHRILITSIVLAVKFVDDDCYNNAYYAKVG  176

Query  360  GLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQIERTLR  202
            G+TT E+NKLE++FL  + F+LHV+V  F  YC  LE+E  +    QI+R +R
Sbjct  177  GITTAELNKLEMKFLAALDFRLHVSVESFDKYCLQLEKEDNV--KLQIDRPIR  227



>ref|XP_007218421.1| hypothetical protein PRUPE_ppa011572mg [Prunus persica]
 ref|XP_008234040.1| PREDICTED: cyclin-U4-1-like [Prunus mume]
 gb|EMJ19620.1| hypothetical protein PRUPE_ppa011572mg [Prunus persica]
Length=205

 Score =   147 bits (370),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/182 (40%), Positives = 118/182 (65%), Gaps = 7/182 (4%)
 Frame = -1

Query  726  STPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVFR  547
            + P +I  ++S++ R V ++  ++R F     +++     F     P +TI SYL+R+F+
Sbjct  12   AMPRMIDFMSSVLER-VAKSNDLSRGFEPTQRLSL-----FHSLTTPTITIHSYLQRIFK  65

Query  546  YTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFAR  367
            Y    PS +VVAYVYLDRF Q  P   I   NVHRLLI +++V++K+++D+ Y N+Y+AR
Sbjct  66   YADCSPSCFVVAYVYLDRFTQTQPLLPIDSFNVHRLLIASVLVSAKFMDDIYYNNAYYAR  125

Query  366  VGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQI-ERTLRCAQD  190
            VGG++T EMN LEV+FLF + F+L+V  + F++YC +L+RE+ +     + E  L  A+ 
Sbjct  126  VGGISTAEMNLLEVDFLFGLGFQLNVTPATFYTYCSYLQREMLLQSPLHVAESPLNLARR  185

Query  189  IK  184
            +K
Sbjct  186  LK  187



>ref|XP_009143062.1| PREDICTED: LOW QUALITY PROTEIN: cyclin-U4-1 [Brassica rapa]
Length=199

 Score =   146 bits (369),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/162 (45%), Positives = 105/162 (65%), Gaps = 5/162 (3%)
 Frame = -1

Query  720  PLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVFRYT  541
            P +IS L+SL+ R    N    R     +     S  VFE    P +TI+SYLER+F+Y 
Sbjct  11   PKLISFLSSLLERVSESNDLTRR-----VTTQSQSVSVFEGLSRPPITIQSYLERIFKYA  65

Query  540  GAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFARVG  361
               PS +VVAYVYLDRF    P   I   NVHRLLIT++MV++K+++D  Y N+Y+A+VG
Sbjct  66   NCSPSCFVVAYVYLDRFTHRQPSLPINSFNVHRLLITSVMVSAKFLDDRYYNNAYYAKVG  125

Query  360  GLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGI  235
            G++T EMN LE++FLF + F L+V  + FH+Y  +L++E+ +
Sbjct  126  GISTKEMNLLELDFLFGLGFDLNVTPNTFHAYFSYLKKEMTL  167



>ref|XP_006347995.1| PREDICTED: cyclin-U4-1-like [Solanum tuberosum]
Length=208

 Score =   147 bits (370),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 71/166 (43%), Positives = 104/166 (63%), Gaps = 7/166 (4%)
 Frame = -1

Query  738  QEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLE  559
            Q Q+  P +I  L+SL+ R    N    R              VF     P+++I+SYLE
Sbjct  7    QNQNLMPKLIDYLSSLLQRVAEANDINGR-------FQPQKISVFHGLSRPNISIQSYLE  59

Query  558  RVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNS  379
            R+F+Y    P  +VVAYVYLDRF Q  P   I   N+HRLLIT++M+A+K+++DM Y N+
Sbjct  60   RIFKYANCSPCCFVVAYVYLDRFTQCQPSLPINSFNIHRLLITSVMIAAKFMDDMYYNNA  119

Query  378  YFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREV  241
            Y+A+VGG++  EMN LEV+FLF + F L+V  + F +YC +L++E+
Sbjct  120  YYAKVGGISITEMNFLEVDFLFGLGFHLNVTPTTFQTYCAYLQKEM  165



>gb|KHN31107.1| Cyclin-U4-1 [Glycine soja]
Length=209

 Score =   147 bits (370),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 79/189 (42%), Positives = 117/189 (62%), Gaps = 11/189 (6%)
 Frame = -1

Query  738  QEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINV--GSTKVFECNEAPDMTIESY  565
            +  S  P VI+ L SL+ R    N    ++ +    I+V  G T+       P+++I+ Y
Sbjct  7    ESPSVMPKVITFLCSLLERVAESNDH-NQHLQQHQKISVFHGLTR-------PNISIQCY  58

Query  564  LERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYR  385
            LER+F+Y    PS +VVAYVYLDRF Q  P   I   NVHRLLIT++MVA+K+++DM Y 
Sbjct  59   LERIFKYANCSPSCFVVAYVYLDRFTQRQPSLPINSFNVHRLLITSVMVAAKFMDDMFYN  118

Query  384  NSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQI-ERT  208
            N+++A+VGG+T +EMN LE++FLF + F L+V    F +YC HL+RE+ +       + T
Sbjct  119  NAHYAKVGGITKVEMNFLELDFLFGLGFHLNVTPGTFQAYCVHLQREMLLIQPLNFSDST  178

Query  207  LRCAQDIKS  181
            L   Q +K+
Sbjct  179  LNLGQSLKA  187



>ref|XP_004307245.1| PREDICTED: cyclin-U4-1-like [Fragaria vesca subsp. vesca]
Length=204

 Score =   146 bits (369),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 103/157 (66%), Gaps = 7/157 (4%)
 Frame = -1

Query  711  ISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVFRYTGAG  532
            I+ L+SL+       QR+A +        +    VF     P ++I+SYLER+F+Y    
Sbjct  14   ITFLSSLV-------QRVAESNDLNSQFQIQKVSVFHGLTRPTISIQSYLERIFKYANCS  66

Query  531  PSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFARVGGLT  352
            PS  +VAYVYLDRF Q  P   I   NVHRLLIT++MVA+K+++D+ Y N+Y+A+VGG++
Sbjct  67   PSCLIVAYVYLDRFTQKQPSLPINSFNVHRLLITSVMVAAKFMDDLYYNNAYYAKVGGIS  126

Query  351  TMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREV  241
            T EMN LEV+FLF + F L+V  + F +YC +L+RE+
Sbjct  127  TAEMNFLEVDFLFGLSFNLNVTPTTFTTYCSYLQREM  163



>ref|XP_006397655.1| hypothetical protein EUTSA_v10001641mg [Eutrema salsugineum]
 gb|ESQ39108.1| hypothetical protein EUTSA_v10001641mg [Eutrema salsugineum]
Length=199

 Score =   146 bits (369),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 71/162 (44%), Positives = 105/162 (65%), Gaps = 5/162 (3%)
 Frame = -1

Query  720  PLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVFRYT  541
            P +I+ L+SL+ R    N R  R     +        VF     P +TI+SYLER+F+Y 
Sbjct  11   PKLIAFLSSLLERVAESNDRTRR-----VTTQSQRVSVFHGLSRPTITIQSYLERIFKYA  65

Query  540  GAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFARVG  361
               PS +VVAYVYLDRF    P   I   NVHRLLIT++MV++K+++D+ Y N+Y+A+VG
Sbjct  66   NCSPSCFVVAYVYLDRFTHRQPSLPINSFNVHRLLITSVMVSAKFLDDLYYNNAYYAKVG  125

Query  360  GLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGI  235
            G++T EMN LE++FLF + F L+V  + FH+Y  +L++E+ +
Sbjct  126  GISTKEMNLLELDFLFGLGFDLNVTPNTFHAYFSYLQKEMTL  167



>tpg|DAA46330.1| TPA: hypothetical protein ZEAMMB73_464167 [Zea mays]
Length=226

 Score =   147 bits (371),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 104/166 (63%), Gaps = 0/166 (0%)
 Frame = -1

Query  735  EQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLER  556
            E ++ P V+S+L++L+ R   RN   A     A          F+    P ++I  YLER
Sbjct  8    EAAAVPRVVSILSALLQRVAERNDAAAAAPPPAAAAGPPVLSAFQGLTKPAISIGGYLER  67

Query  555  VFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSY  376
            +FR+ G  PS YVVAY+YLDRF +  P   +   NVHRLLIT+++ A K+V+D+ Y N+Y
Sbjct  68   IFRFAGCSPSCYVVAYIYLDRFLRRRPALAVDSFNVHRLLITSVLTAVKFVDDICYNNAY  127

Query  375  FARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVG  238
            FARVGG++ +EMN LEV+FLF + F L+V  + F SYC  L+ E+ 
Sbjct  128  FARVGGISLVEMNYLEVDFLFGIAFDLNVTPAAFASYCAVLQSEMA  173



>ref|XP_009760203.1| PREDICTED: cyclin-P3-1-like isoform X2 [Nicotiana sylvestris]
Length=267

 Score =   148 bits (374),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 74/173 (43%), Positives = 115/173 (66%), Gaps = 8/173 (5%)
 Frame = -1

Query  720  PLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVFRYT  541
            P ++S+LAS++ RTV +N++  +  +       G   VF    +P +T++ Y+ER+F+Y+
Sbjct  74   PKILSILASVLERTVQKNEKAMKGSK-----ERGVVTVFHGTRSPVLTVQQYIERIFKYS  128

Query  540  GAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFARVG  361
               PS +VVAYVYL+RF  L     +   NVHR+LIT+I++A K+V+D  Y N+Y+A+VG
Sbjct  129  NCSPSCFVVAYVYLERFLNLTDCL-LTSLNVHRILITSIVLAVKFVDDDCYNNAYYAKVG  187

Query  360  GLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQIERTLR  202
            G+TT E+NKLE++FL  + F+LHV+V  F  YC  LE+E  +    QI+R +R
Sbjct  188  GITTAELNKLEMKFLAALDFRLHVSVESFDKYCLQLEKEDNV--KLQIDRPIR  238



>ref|XP_009142278.1| PREDICTED: cyclin-U4-1 [Brassica rapa]
Length=201

 Score =   146 bits (368),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 105/162 (65%), Gaps = 5/162 (3%)
 Frame = -1

Query  720  PLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVFRYT  541
            P +I+ L+SL+ R    N    R     +     S  VF     P +TI SYLER+F+Y 
Sbjct  11   PKLIAFLSSLLERVAESNDLTRR-----VTTQSQSVSVFHGLSRPTITIHSYLERIFKYA  65

Query  540  GAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFARVG  361
               PS +VVAYVYLDRF Q  P   I   NVHRLLIT++MV++K+++D+ Y N+Y+A+VG
Sbjct  66   NCSPSCFVVAYVYLDRFTQRQPSLPINSFNVHRLLITSVMVSAKFLDDLYYNNAYYAKVG  125

Query  360  GLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGI  235
            G++T EMN LE++FLF + F L+V  + FH+Y  +L++E+ +
Sbjct  126  GISTKEMNLLELDFLFGLGFDLNVKPNTFHAYFSYLQKEMTL  167



>ref|XP_009760202.1| PREDICTED: cyclin-P3-1-like isoform X1 [Nicotiana sylvestris]
Length=268

 Score =   148 bits (373),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 74/173 (43%), Positives = 115/173 (66%), Gaps = 8/173 (5%)
 Frame = -1

Query  720  PLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVFRYT  541
            P ++S+LAS++ RTV +N++  +  +       G   VF    +P +T++ Y+ER+F+Y+
Sbjct  75   PKILSILASVLERTVQKNEKAMKGSK-----ERGVVTVFHGTRSPVLTVQQYIERIFKYS  129

Query  540  GAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFARVG  361
               PS +VVAYVYL+RF  L     +   NVHR+LIT+I++A K+V+D  Y N+Y+A+VG
Sbjct  130  NCSPSCFVVAYVYLERFLNLTDCL-LTSLNVHRILITSIVLAVKFVDDDCYNNAYYAKVG  188

Query  360  GLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQIERTLR  202
            G+TT E+NKLE++FL  + F+LHV+V  F  YC  LE+E  +    QI+R +R
Sbjct  189  GITTAELNKLEMKFLAALDFRLHVSVESFDKYCLQLEKEDNV--KLQIDRPIR  239



>ref|XP_010277841.1| PREDICTED: cyclin-P3-1-like [Nelumbo nucifera]
 ref|XP_010277851.1| PREDICTED: cyclin-P3-1-like [Nelumbo nucifera]
Length=221

 Score =   147 bits (370),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 106/161 (66%), Gaps = 8/161 (5%)
 Frame = -1

Query  684  RTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVFRYTGAGPSVYVVAYV  505
            R+V +N+++  + +    I +     F   +AP M+I  Y++R+F+Y+G  PS +VVAY+
Sbjct  44   RSVQKNEKLLDSMKKKDAITI-----FHGLKAPTMSIRKYIDRIFKYSGCTPSCFVVAYI  98

Query  504  YLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFARVGGLTTMEMNKLEV  325
            Y+DRF Q      +   NVHRLLIT +M+A K+VED+ Y N+Y+ARVGG+T  EMN++E+
Sbjct  99   YMDRFLQ-QTDVYLTSLNVHRLLITAVMLAVKFVEDVYYNNAYYARVGGITIAEMNRMEM  157

Query  324  EFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQIERTLR  202
            +FLF + F+LHV    F SYC  LE+E      Y+IER ++
Sbjct  158  KFLFSLEFRLHVTTETFKSYCLQLEKEA--AAEYKIERPIQ  196



>ref|XP_003572092.2| PREDICTED: cyclin-P4-1-like [Brachypodium distachyon]
Length=211

 Score =   146 bits (369),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 105/167 (63%), Gaps = 1/167 (1%)
 Frame = -1

Query  738  QEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLE  559
            ++Q+  P V+S+L++L+ R   RN  +             +   F+    P +++  YLE
Sbjct  8    EKQAPVPRVVSILSALLERVAERND-VVAAAPEKEKKEEKAVSAFQGLTKPAISVGVYLE  66

Query  558  RVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNS  379
            R+FR+ G  PS YVVAY+YLDRF +  P   +   NVHRLLIT+++ A K+V+D+ Y N+
Sbjct  67   RIFRFAGCSPSCYVVAYIYLDRFLRRRPALAVDSFNVHRLLITSVLTAVKFVDDICYNNA  126

Query  378  YFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVG  238
            YFARVGG++ MEMN LEV+FLF + F L+V  + F SYC  L+ E+ 
Sbjct  127  YFARVGGISLMEMNYLEVDFLFGVAFDLNVTPATFDSYCSVLQAEMA  173



>ref|NP_001235331.1| uncharacterized protein LOC100305689 [Glycine max]
 gb|ACU13506.1| unknown [Glycine max]
Length=209

 Score =   146 bits (368),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 79/189 (42%), Positives = 116/189 (61%), Gaps = 11/189 (6%)
 Frame = -1

Query  738  QEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINV--GSTKVFECNEAPDMTIESY  565
            +  S  P VI+ L SL+ R    N     + +    I+V  G T+       P+++I+ Y
Sbjct  7    ESPSVMPKVITFLCSLLERVAESNDH-NHHLQQHQKISVFHGLTR-------PNISIQCY  58

Query  564  LERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYR  385
            LER+F+Y    PS +VVAYVYLDRF Q  P   I   NVHRLLIT++MVA+K+++DM Y 
Sbjct  59   LERIFKYANCSPSCFVVAYVYLDRFTQRQPSLPINSFNVHRLLITSVMVAAKFMDDMFYN  118

Query  384  NSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQI-ERT  208
            N+++A+VGG+T +EMN LE++FLF + F L+V    F +YC HL+RE+ +       + T
Sbjct  119  NAHYAKVGGITKVEMNFLELDFLFGLGFHLNVTPGTFQAYCVHLQREMLLIQPLNFSDST  178

Query  207  LRCAQDIKS  181
            L   Q +K+
Sbjct  179  LNLGQSLKA  187



>ref|XP_009370411.1| PREDICTED: cyclin-U4-1 [Pyrus x bretschneideri]
Length=207

 Score =   146 bits (368),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 68/169 (40%), Positives = 114/169 (67%), Gaps = 6/169 (4%)
 Frame = -1

Query  726  STPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVFR  547
            S P +I+ ++S++ R V+ +  + R F     ++V     F     P ++I SYL+R+F+
Sbjct  14   SMPRMIAFMSSVLER-VSESNDLNRRFHPTQKLSV-----FHSLTTPTISIHSYLQRIFK  67

Query  546  YTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFAR  367
            Y    PS ++VAYVYLDRF Q+ P   I   NVHRLLIT+++V++K+++D+ Y N+++AR
Sbjct  68   YADCSPSCFIVAYVYLDRFTQMQPLLPIDSFNVHRLLITSVLVSAKFMDDIYYNNAFYAR  127

Query  366  VGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQ  220
            VGG++T EMN LEV+FLF + F+++V  + +++YC +L+RE+ +    Q
Sbjct  128  VGGISTQEMNLLEVDFLFGLGFQMNVTPATYYTYCSYLQREMLLQSPLQ  176



>ref|XP_009387832.1| PREDICTED: cyclin-P3-1-like [Musa acuminata subsp. malaccensis]
Length=222

 Score =   146 bits (369),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 69/173 (40%), Positives = 119/173 (69%), Gaps = 9/173 (5%)
 Frame = -1

Query  720  PLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVFRYT  541
            P V+++L+S++  TV +N++       +++I    T +F+   AP ++I+ Y+ER+F+Y+
Sbjct  32   PRVLTLLSSILEATVQKNEKKL----DSLEIKEFVT-LFDGMRAPTLSIKKYMERIFKYS  86

Query  540  GAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFARVG  361
               PS +V+AY+Y++RF Q  P   +   NVHRLLI +++VA+K+++D  + N+Y+A+VG
Sbjct  87   KCSPSCFVLAYIYIERFLQ-QPNICLTSLNVHRLLIASVVVAAKFIDDAFFSNAYYAKVG  145

Query  360  GLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQIERTLR  202
            G++TMEMN+LE+ FLF + F+L V V  F +YC  LE+E  +   YQ+ER ++
Sbjct  146  GISTMEMNRLEINFLFSVDFRLQVTVGTFEAYCLRLEKENKV---YQVERPIK  195



>ref|XP_010056382.1| PREDICTED: cyclin-U4-1 [Eucalyptus grandis]
 gb|KCW73091.1| hypothetical protein EUGRSUZ_E01538 [Eucalyptus grandis]
Length=202

 Score =   145 bits (367),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 107/162 (66%), Gaps = 5/162 (3%)
 Frame = -1

Query  726  STPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVFR  547
            + P +I+ L+SL+ +    N    +  +    I+V     F     P ++I SYLER+F+
Sbjct  9    AMPRLIAFLSSLLQKAAESNDLDRQIHQQPQRISV-----FHGLTRPAISIRSYLERIFK  63

Query  546  YTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFAR  367
            Y    PS +VVAYVYL+RF Q  P   +   NVHRLLIT++MVA+K+++D+ Y N+Y+A+
Sbjct  64   YANCSPSCFVVAYVYLERFAQRQPTLPLNSLNVHRLLITSVMVAAKFLDDIYYNNAYYAK  123

Query  366  VGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREV  241
            VGG++TMEMN LEV+FLF + F L+V  S F +YC +L+RE+
Sbjct  124  VGGISTMEMNFLEVDFLFGLGFNLNVTPSAFQTYCSYLQREM  165



>ref|XP_006376963.1| hypothetical protein POPTR_0012s11610g [Populus trichocarpa]
 gb|ERP54760.1| hypothetical protein POPTR_0012s11610g [Populus trichocarpa]
Length=225

 Score =   146 bits (369),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 72/173 (42%), Positives = 113/173 (65%), Gaps = 7/173 (4%)
 Frame = -1

Query  735  EQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLER  556
            E +  P VI+ L+SL+       QR+A +   +  +      +F     P ++I++YLER
Sbjct  30   ETTVMPKVITFLSSLL-------QRVAESNDLSQQLYPQKVSIFHGLSRPPISIQNYLER  82

Query  555  VFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSY  376
            +F+Y    PS +VVAYVYLDRF Q    F I   NVHRLLIT+++++ K+++D+ Y N++
Sbjct  83   IFKYANCSPSCFVVAYVYLDRFAQRQSCFPINSFNVHRLLITSVLISVKFMDDIYYNNAF  142

Query  375  FARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQI  217
            +A+VGG++T EMN LEV+FLF + F+L+V  ++FH+YC +L+RE+ I     I
Sbjct  143  YAKVGGISTAEMNLLEVDFLFGLGFQLNVTPTMFHAYCSYLQREMLIQSPLPI  195



>ref|XP_008246475.1| PREDICTED: cyclin-P3-1 [Prunus mume]
Length=196

 Score =   145 bits (367),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 73/182 (40%), Positives = 121/182 (66%), Gaps = 8/182 (4%)
 Frame = -1

Query  738  QEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLE  559
            +  + TP V+SV++S++ R++ +N+++    RG+   +V    +F  +E P ++I  Y+E
Sbjct  19   ESATRTPRVLSVVSSVLERSIRKNEKL---IRGSKMKDV--ITMFHASEVPALSIRRYIE  73

Query  558  RVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNS  379
            R+F+Y+   PS +VVAY+Y++RF Q      +   N+HRLLIT+I+VA+K+++D  Y N+
Sbjct  74   RIFKYSSCSPSCFVVAYIYIERFLQ-RRGICLTSLNIHRLLITSIVVAAKFMDDECYSNA  132

Query  378  YFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQIERTLRC  199
            Y+A++GG++  E+NKLE+EFL  + FKLHV +  F  YC  LE E G+G   QI R +R 
Sbjct  133  YYAKIGGVSLSELNKLEIEFLLSLDFKLHVTIDTFGKYCRQLEDE-GVGEK-QISRLMRV  190

Query  198  AQ  193
            + 
Sbjct  191  SS  192



>ref|XP_004307773.1| PREDICTED: cyclin-U4-1-like [Fragaria vesca subsp. vesca]
Length=204

 Score =   145 bits (367),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 71/162 (44%), Positives = 106/162 (65%), Gaps = 7/162 (4%)
 Frame = -1

Query  726  STPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVFR  547
            + P +I+ L+ ++ R    N    R       ++     VF C   P ++I+SYLER+F+
Sbjct  10   AMPRMIAFLSDVLDRVAKSNDLNRR-------LDSQKLSVFHCLTKPTISIQSYLERIFK  62

Query  546  YTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFAR  367
            Y    PS +VVAYVYLDRF Q      I   NVHRLLIT++MV++K+++D++Y N+YFAR
Sbjct  63   YADCSPSCFVVAYVYLDRFTQRQKALPINSFNVHRLLITSVMVSAKFMDDISYNNAYFAR  122

Query  366  VGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREV  241
            VGG++T EMN LE++FLF + F+L+V    F +YC +L+RE+
Sbjct  123  VGGISTKEMNLLEMDFLFGLGFELNVTPENFITYCSYLQREM  164



>ref|XP_010255964.1| PREDICTED: cyclin-P3-1-like isoform X2 [Nelumbo nucifera]
 ref|XP_010255965.1| PREDICTED: cyclin-P3-1-like isoform X2 [Nelumbo nucifera]
Length=221

 Score =   146 bits (368),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 71/173 (41%), Positives = 115/173 (66%), Gaps = 8/173 (5%)
 Frame = -1

Query  684  RTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVFRYTGAGPSVYVVAYV  505
            R+V +N+++  + +   D+      VF    AP ++I  Y++R+F+Y+   PS +VVAY+
Sbjct  44   RSVQKNEKLLDSMKKK-DV----VTVFHGLRAPTLSIHQYIDRIFKYSSCSPSCFVVAYI  98

Query  504  YLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFARVGGLTTMEMNKLEV  325
            Y+DRF Q      +   NVHRLLIT++MVA+K+++D  + N+Y+A+VGG++  EMN+LE+
Sbjct  99   YMDRFLQ-RTDIYLTSLNVHRLLITSVMVAAKFLDDAFFNNAYYAKVGGVSLAEMNRLEM  157

Query  324  EFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQIERTLRCAQDIKSKQRED  166
            +FLF + F+LHV V  F SYC  LE+E    GGY+IER ++  +  +S  ++D
Sbjct  158  KFLFTLDFRLHVTVETFKSYCLLLEKEA--AGGYKIERPIQVCRLKESWPKKD  208



>gb|ACU24636.1| unknown [Glycine max]
Length=188

 Score =   145 bits (366),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 103/165 (62%), Gaps = 16/165 (10%)
 Frame = -1

Query  720  PLVISVLASLIGRTVTRNQRIARNFRGAMDINVG-----STKVFECNEAPDMTIESYLER  556
            P +IS L+SL+ R    N           D+N          VF     P ++I+SYLER
Sbjct  11   PKLISFLSSLLKRVAESN-----------DLNQQQLIHQKVSVFHGLTRPTISIQSYLER  59

Query  555  VFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSY  376
            +F+Y    PS ++VAYVYLDRF Q  P   I   NVHRL IT++MVA+K+++D+ Y N+Y
Sbjct  60   IFKYANCSPSCFIVAYVYLDRFTQRQPSSPINSFNVHRLPITSVMVAAKFMDDLYYNNAY  119

Query  375  FARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREV  241
            +A+VGG+TT+EMN LEV+FLF + F L+V    F +YC HL+ E+
Sbjct  120  YAKVGGITTIEMNFLEVDFLFGLGFHLNVTPGTFQAYCAHLQSEM  164



>ref|XP_006591586.1| PREDICTED: cyclin-U2-1-like [Glycine max]
Length=128

 Score =   143 bits (360),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = -1

Query  393  NYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQIE  214
            NYRNSYF RVGGLTT E+NKLE+EFLFLM FKLHVNVSVF SYCCHLEREV IGGGY IE
Sbjct  42   NYRNSYFGRVGGLTTDELNKLELEFLFLMDFKLHVNVSVFESYCCHLEREVSIGGGYHIE  101

Query  213  RTLRCAQDIKSKQREDTTFTQVTSLLL  133
            RTLRCA++IK+K RE+  +T +  ++L
Sbjct  102  RTLRCAEEIKAKHREERGYTHIARVML  128



>ref|XP_003636176.1| Cyclin-U4-1 [Medicago truncatula]
 gb|ACJ84314.1| unknown [Medicago truncatula]
 gb|AFK49541.1| unknown [Medicago truncatula]
 gb|KEH17921.1| cyclin p4 [Medicago truncatula]
Length=200

 Score =   145 bits (366),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 70/165 (42%), Positives = 103/165 (62%), Gaps = 9/165 (5%)
 Frame = -1

Query  735  EQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLER  556
            E    P +I+ L+SL+ R    N     + +           +F     P+++I+SYLER
Sbjct  5    ESPMMPKLINFLSSLLERVAESNDETQNHHK---------ISIFHGLSRPNISIQSYLER  55

Query  555  VFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSY  376
            +F+Y     S ++VAYVYLDRF Q  P   I   NVHRLLIT++MVA+K+++D+ Y N+Y
Sbjct  56   IFKYANCSSSCFIVAYVYLDRFTQTQPSLPINSFNVHRLLITSVMVAAKFMDDVCYNNAY  115

Query  375  FARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREV  241
            +A+VGG+T  EMN LE++FLF + F L+V    F +YC HL+RE+
Sbjct  116  YAKVGGITKTEMNFLELDFLFGLGFNLNVTPVTFQAYCVHLQREM  160



>ref|XP_010255963.1| PREDICTED: cyclin-P3-1-like isoform X1 [Nelumbo nucifera]
Length=246

 Score =   146 bits (369),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 71/173 (41%), Positives = 115/173 (66%), Gaps = 8/173 (5%)
 Frame = -1

Query  684  RTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVFRYTGAGPSVYVVAYV  505
            R+V +N+++  + +   D+      VF    AP ++I  Y++R+F+Y+   PS +VVAY+
Sbjct  69   RSVQKNEKLLDSMKKK-DV----VTVFHGLRAPTLSIHQYIDRIFKYSSCSPSCFVVAYI  123

Query  504  YLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFARVGGLTTMEMNKLEV  325
            Y+DRF Q      +   NVHRLLIT++MVA+K+++D  + N+Y+A+VGG++  EMN+LE+
Sbjct  124  YMDRFLQ-RTDIYLTSLNVHRLLITSVMVAAKFLDDAFFNNAYYAKVGGVSLAEMNRLEM  182

Query  324  EFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQIERTLRCAQDIKSKQRED  166
            +FLF + F+LHV V  F SYC  LE+E    GGY+IER ++  +  +S  ++D
Sbjct  183  KFLFTLDFRLHVTVETFKSYCLLLEKEA--AGGYKIERPIQVCRLKESWPKKD  233



>ref|XP_007200546.1| hypothetical protein PRUPE_ppa011715mg [Prunus persica]
 gb|EMJ01745.1| hypothetical protein PRUPE_ppa011715mg [Prunus persica]
Length=199

 Score =   145 bits (365),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 72/173 (42%), Positives = 115/173 (66%), Gaps = 9/173 (5%)
 Frame = -1

Query  720  PLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVFRYT  541
            P V+S L+SL+ R V +N+ +      A DI    T +F    AP ++I  Y++R+F+Y+
Sbjct  32   PRVLSPLSSLLERCVQKNEMLLE----ATDIKEVMT-IFHGLRAPTLSIRQYIDRIFKYS  86

Query  540  GAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFARVG  361
            G  PS +VVA +Y+DRF Q   + R+   N+HRLLIT +M+A+K+++D  + N+Y+A+VG
Sbjct  87   GCSPSCFVVAQIYVDRFIQC-TEVRLTSFNIHRLLITGVMLAAKFIDDAFFNNAYYAKVG  145

Query  360  GLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQIERTLR  202
            G++T E+N+LE++FLF + F+L V++  F  YC  LE+E     G QIER ++
Sbjct  146  GVSTSELNRLEMKFLFTIDFRLQVSIETFKRYCSQLEKE---AAGLQIERLIQ  195



>ref|XP_008362758.1| PREDICTED: cyclin-U4-1-like [Malus domestica]
Length=207

 Score =   145 bits (366),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 68/169 (40%), Positives = 114/169 (67%), Gaps = 6/169 (4%)
 Frame = -1

Query  726  STPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVFR  547
            S P +I+ ++S++ R V+++  + R F     ++V     F     P ++I SYL+R+F 
Sbjct  14   SMPRMIAFMSSVLER-VSKSNDLNRRFHRTQKLSV-----FHSLTTPTISIHSYLQRIFN  67

Query  546  YTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFAR  367
            Y    PS ++VAYVYLDRF Q+ P   I   NVHRLLIT+++V++K+++D+ Y N+++AR
Sbjct  68   YADCSPSCFIVAYVYLDRFTQMQPLLPIDSFNVHRLLITSVLVSAKFMDDIYYNNAFYAR  127

Query  366  VGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQ  220
            VGG++T EMN LEV+FLF + F+++V  + +++YC +L+RE+ +    Q
Sbjct  128  VGGISTQEMNLLEVDFLFGLGFQMNVTPATYYTYCSYLQREMLLQSPLQ  176



>ref|XP_004290653.1| PREDICTED: cyclin-P3-1-like [Fragaria vesca subsp. vesca]
Length=214

 Score =   145 bits (366),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 69/174 (40%), Positives = 114/174 (66%), Gaps = 10/174 (6%)
 Frame = -1

Query  720  PLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVFRYT  541
            P V+S L+SL+ R+V  N+             +    +F    AP ++I  Y++RVF+Y+
Sbjct  33   PRVLSPLSSLLERSVQSNEMHMEA------TEIKEVTIFHGLRAPPLSIRQYIDRVFKYS  86

Query  540  GAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFARVG  361
            G  PS +VVA +Y+DR+ Q   Q  +   NVHRLLIT++M+A+K+++D  + N+Y+A+VG
Sbjct  87   GCSPSCFVVAKIYVDRYLQ-STQVHLTSFNVHRLLITSVMLAAKFIDDAFFNNAYYAKVG  145

Query  360  GLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQIERTLRC  199
            G++T E+N+LE++FLF + F+L V++  F  YC HLE+E  +   +QIER+++ 
Sbjct  146  GVSTAELNRLEMKFLFSIDFRLQVSIDTFKKYCSHLEKEAAV---HQIERSIQA  196



>emb|CDP09417.1| unnamed protein product [Coffea canephora]
Length=206

 Score =   145 bits (366),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 103/158 (65%), Gaps = 7/158 (4%)
 Frame = -1

Query  714  VISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVFRYTGA  535
            +IS L+SL+ R    N    R       +      VF     P ++IE+YL+R+ +Y   
Sbjct  13   LISFLSSLLQRAAESNDLNRR-------LQPQKISVFHGLTRPTISIENYLDRILKYANC  65

Query  534  GPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFARVGGL  355
             PS ++V+Y+YLDRF Q  P   I   NVHRLLIT++MVA+K+++DM Y N+Y+A+VGG+
Sbjct  66   SPSCFIVSYIYLDRFTQRQPALPINSFNVHRLLITSVMVAAKFMDDMYYNNAYYAKVGGI  125

Query  354  TTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREV  241
            +T EMN LEV+FLF + F L+V  + FH+YC +L+RE+
Sbjct  126  STAEMNFLEVDFLFGLGFHLNVTPTTFHTYCSYLQREM  163



>ref|XP_009760376.1| PREDICTED: cyclin-U4-1-like [Nicotiana sylvestris]
Length=205

 Score =   145 bits (365),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/160 (44%), Positives = 107/160 (67%), Gaps = 7/160 (4%)
 Frame = -1

Query  720  PLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVFRYT  541
            P VI+ +AS++ R    N  ++R F            +F     P +++ESYLER+F+Y 
Sbjct  12   PKVINFMASVLERVAETND-LSRRFSAQ------KISMFHGLTRPTISVESYLERIFKYA  64

Query  540  GAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFARVG  361
               PS +VVAY+YLDRF Q  P   I   NVHRLLIT+++V++K+++D+ Y N+Y+A+VG
Sbjct  65   NCSPSCFVVAYIYLDRFSQRQPLLPINSFNVHRLLITSVLVSAKFMDDIFYNNAYYAKVG  124

Query  360  GLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREV  241
            G++T EMN LEV+FLF + F+L+V  + FH+YC +L+ E+
Sbjct  125  GISTKEMNLLEVDFLFGIGFQLNVTPTTFHTYCSYLQTEM  164



>ref|XP_009122338.1| PREDICTED: cyclin-U4-2 [Brassica rapa]
Length=216

 Score =   145 bits (366),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 74/184 (40%), Positives = 114/184 (62%), Gaps = 9/184 (5%)
 Frame = -1

Query  762  DDLYLYAYQEQS----STPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECN  595
            DD      QEQ     + P VI+ L+SL+ R    N  ++R       I+      F   
Sbjct  2    DDQIEKMIQEQEPMAETMPNVITALSSLLQRVSETNDDLSRPLWEHQRISA-----FSAL  56

Query  594  EAPDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVA  415
              P ++I SY+ER+F+Y     S Y+VAY+YLDRF Q  P   I   NVHRL+IT+++V+
Sbjct  57   TKPSISIRSYMERIFKYANCSDSCYIVAYIYLDRFIQKQPFVPIDSFNVHRLIITSVLVS  116

Query  414  SKYVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGI  235
            +K+++DM Y N+Y+A++GG+TT EMN LE++FLF + F+L+V +S +++YC  L+RE+ +
Sbjct  117  AKFMDDMCYNNAYYAKIGGITTEEMNLLELDFLFGIGFQLNVTLSTYNNYCSSLQREMVM  176

Query  234  GGGY  223
               Y
Sbjct  177  RNMY  180



>ref|XP_011003554.1| PREDICTED: cyclin-U4-1-like [Populus euphratica]
Length=225

 Score =   145 bits (367),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/173 (42%), Positives = 113/173 (65%), Gaps = 7/173 (4%)
 Frame = -1

Query  735  EQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLER  556
            E +  P VI+ L+SL+       QR+A +   +  +      +F     P ++I++YLER
Sbjct  30   ETTVMPKVITFLSSLL-------QRVAESNDLSQQLYPQKVSIFHGLSRPAISIQNYLER  82

Query  555  VFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSY  376
            +F+Y    PS +VVAYVYLDRF Q    F +   NVHRLLIT+++V+ K+++D+ Y N++
Sbjct  83   IFKYANCSPSCFVVAYVYLDRFSQRQSCFPLNSFNVHRLLITSVLVSVKFMDDIYYNNAF  142

Query  375  FARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQI  217
            +A+VGG++T EMN LEV+FLF + F+L+V  ++FH+YC +L+RE+ I     I
Sbjct  143  YAKVGGISTAEMNLLEVDFLFGLGFQLNVTPTMFHAYCSYLQREMLIQSPLPI  195



>ref|XP_004151930.1| PREDICTED: cyclin-U1-1-like [Cucumis sativus]
 gb|KGN63274.1| hypothetical protein Csa_2G422050 [Cucumis sativus]
Length=233

 Score =   145 bits (367),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 73/184 (40%), Positives = 116/184 (63%), Gaps = 10/184 (5%)
 Frame = -1

Query  723  TPLVISVLASLIGRTVTRNQRIARNFRGAMD---------INVGST-KVFECNEAPDMTI  574
            TP V+ +LA ++ R V RN R+       ++          ++G++   F    AP ++I
Sbjct  22   TPRVLIILAFVLDRLVARNDRLLNELSQQLEELGCCSSSSNHLGNSFNAFHGVRAPTISI  81

Query  573  ESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDM  394
              YLER+++YT   PS  VV +VY+DR    HP   +   NVHRLL+T++MVASK ++D+
Sbjct  82   LKYLERIYKYTNCSPSCLVVGFVYIDRLIHRHPDSLVISLNVHRLLVTSVMVASKMLDDV  141

Query  393  NYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQIE  214
            +Y N+++ARVGG++  E+NKLE+E LFL+ F + V+  VF +YC HLE+E+ + G  +++
Sbjct  142  HYNNAFYARVGGVSKGELNKLELEMLFLLDFGVTVSSRVFETYCWHLEKEMLLNGNGEMQ  201

Query  213  RTLR  202
            R  R
Sbjct  202  RVER  205



>ref|XP_006444072.1| hypothetical protein CICLE_v10021982mg [Citrus clementina]
 ref|XP_006479719.1| PREDICTED: cyclin-P3-1-like isoform X1 [Citrus sinensis]
 ref|XP_006479720.1| PREDICTED: cyclin-P3-1-like isoform X2 [Citrus sinensis]
 gb|ESR57312.1| hypothetical protein CICLE_v10021982mg [Citrus clementina]
 gb|KDO68736.1| hypothetical protein CISIN_1g026467mg [Citrus sinensis]
 gb|KDO68737.1| hypothetical protein CISIN_1g026467mg [Citrus sinensis]
Length=217

 Score =   145 bits (366),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 66/177 (37%), Positives = 113/177 (64%), Gaps = 9/177 (5%)
 Frame = -1

Query  723  TPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVFRY  544
            +P ++S++  L+ ++V +N+ +         I      +F    AP ++I+ Y++R+F+Y
Sbjct  31   SPKILSLIGRLLEKSVQKNEMLLDT------IKTKDVTIFHGLRAPTISIQQYIDRIFKY  84

Query  543  TGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFARV  364
                PS +V+A++Y+DRF Q      +   NVHRLLIT++MVA+K+++D  + N+Y+ARV
Sbjct  85   GACSPSCFVIAHIYMDRFLQ-KTDGHLTSLNVHRLLITSVMVAAKFIDDAFFNNAYYARV  143

Query  363  GGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQIERTLRCAQ  193
            GG++T EMN++EV+FLF + F+L VNV  FH +C  L +E     G QI+R ++  +
Sbjct  144  GGVSTAEMNRMEVKFLFSLDFRLQVNVETFHKFCSQLGKEA--AEGLQIDRPIQACK  198



>ref|XP_002873308.1| CYCP4_3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49567.1| CYCP4_3 [Arabidopsis lyrata subsp. lyrata]
Length=220

 Score =   145 bits (366),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/166 (42%), Positives = 109/166 (66%), Gaps = 5/166 (3%)
 Frame = -1

Query  720  PLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVFRYT  541
            P VI+ ++SL+ R    N  ++R FR    I+      F     P ++I SY+ER+F+Y 
Sbjct  21   PNVITAISSLLQRVSETNDDLSRPFREHQRISA-----FNALAKPSISIRSYMERIFKYA  75

Query  540  GAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFARVG  361
                S Y+VAY+YLDRF Q  P   I   NVHRL+IT+++V++K+++D+ Y N+++A+VG
Sbjct  76   DCSDSCYIVAYIYLDRFIQKQPFLPIDSFNVHRLIITSVLVSAKFMDDLCYNNAFYAKVG  135

Query  360  GLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGY  223
            G+TT EMN LE++FLF + F+L+V VS ++ YC  L+RE+ +   Y
Sbjct  136  GITTEEMNLLELDFLFGIGFQLNVTVSSYNDYCSSLQREMVMRTMY  181



>ref|XP_007050616.1| Cyclin p1,1 isoform 1 [Theobroma cacao]
 gb|EOX94773.1| Cyclin p1,1 isoform 1 [Theobroma cacao]
Length=218

 Score =   145 bits (365),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/188 (41%), Positives = 124/188 (66%), Gaps = 9/188 (5%)
 Frame = -1

Query  723  TPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVFRY  544
            TP ++S+L+SL+ ++V +N+  +      +DI   S  +F    AP ++I+ Y++R+F+Y
Sbjct  31   TPRILSLLSSLLEKSVQKNEMQSET----VDIK-DSVAIFHGLRAPTISIQQYIDRIFKY  85

Query  543  TGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFARV  364
             G  PS +VVAY+Y+DRF Q      +   NVHRLLIT++MVA+K+++D  + N+Y+ARV
Sbjct  86   AGCSPSCFVVAYIYVDRFVQ-QTDVHLTSLNVHRLLITSVMVAAKFIDDAFFNNAYYARV  144

Query  363  GGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQIERTLR-CAQDI  187
            GG++T E+N+LE++FLF + F+L V+V+ F  YC  L++E     G+QIER +R C    
Sbjct  145  GGISTAELNRLEMKFLFSLDFRLQVSVNTFQRYCSQLQKES--SEGHQIERPIRACGIKE  202

Query  186  KSKQREDT  163
                + DT
Sbjct  203  SWSSKSDT  210



>ref|XP_004230189.1| PREDICTED: cyclin-P3-1 isoform X1 [Solanum lycopersicum]
Length=226

 Score =   145 bits (366),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 76/179 (42%), Positives = 114/179 (64%), Gaps = 12/179 (7%)
 Frame = -1

Query  732  QSSTPLVISVLASLIGRTVTRNQR--IARNFRGAMDINVGSTKVFECNEAPDMTIESYLE  559
                P ++ ++AS+I R+V +N++     N RG +        VF    AP +T++ Y+E
Sbjct  30   DKGNPKILWIVASVIERSVQKNEKGLKGSNKRGVV-------TVFHGTRAPVLTVQQYIE  82

Query  558  RVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNS  379
            R+F+Y+   PS +VVAY+YL+RF  L     +   NVHRLLIT+IM+A K+V+D  Y N+
Sbjct  83   RIFKYSNCSPSCFVVAYIYLERFLNLTDCL-LTSLNVHRLLITSIMLAVKFVDDDCYNNA  141

Query  378  YFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQIERTLR  202
            Y+A+VGG+TT E+NKLEV+FL  + F+LHV+V  F  YC  LE++       QI+R +R
Sbjct  142  YYAKVGGITTRELNKLEVKFLAALDFRLHVSVESFDKYCLQLEKDS--NEKLQIDRPIR  198



>ref|XP_006444071.1| hypothetical protein CICLE_v10021982mg [Citrus clementina]
 gb|ESR57311.1| hypothetical protein CICLE_v10021982mg [Citrus clementina]
 gb|KDO68735.1| hypothetical protein CISIN_1g026467mg [Citrus sinensis]
Length=238

 Score =   145 bits (366),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/177 (37%), Positives = 113/177 (64%), Gaps = 9/177 (5%)
 Frame = -1

Query  723  TPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVFRY  544
            +P ++S++  L+ ++V +N+ +         I      +F    AP ++I+ Y++R+F+Y
Sbjct  52   SPKILSLIGRLLEKSVQKNEMLLDT------IKTKDVTIFHGLRAPTISIQQYIDRIFKY  105

Query  543  TGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFARV  364
                PS +V+A++Y+DRF Q      +   NVHRLLIT++MVA+K+++D  + N+Y+ARV
Sbjct  106  GACSPSCFVIAHIYMDRFLQ-KTDGHLTSLNVHRLLITSVMVAAKFIDDAFFNNAYYARV  164

Query  363  GGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQIERTLRCAQ  193
            GG++T EMN++EV+FLF + F+L VNV  FH +C  L +E     G QI+R ++  +
Sbjct  165  GGVSTAEMNRMEVKFLFSLDFRLQVNVETFHKFCSQLGKEA--AEGLQIDRPIQACK  219



>emb|CDX70040.1| BnaA10g23890D [Brassica napus]
Length=216

 Score =   145 bits (365),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 73/184 (40%), Positives = 114/184 (62%), Gaps = 9/184 (5%)
 Frame = -1

Query  762  DDLYLYAYQEQS----STPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECN  595
            DD      QEQ     + P VI+ L+SL+ R    N  ++R       I+      F   
Sbjct  2    DDQIEKMIQEQEPMAETMPNVITALSSLLQRVSVTNDDLSRPLWEHQRISA-----FSAL  56

Query  594  EAPDMTIESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVA  415
              P ++I SY+ER+F+Y     S Y+VAY+Y+DRF Q  P   I   NVHRL+IT+++V+
Sbjct  57   TKPSISIRSYMERIFKYANCSDSCYIVAYIYMDRFIQKQPFVPIDSFNVHRLIITSVLVS  116

Query  414  SKYVEDMNYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGI  235
            +K+++DM Y N+Y+A++GG+TT EMN LE++FLF + F+L+V +S +++YC  L+RE+ +
Sbjct  117  AKFMDDMCYNNAYYAKIGGITTEEMNLLELDFLFGIGFQLNVTLSTYNNYCSSLQREMVM  176

Query  234  GGGY  223
               Y
Sbjct  177  RNMY  180



>ref|XP_006295023.1| hypothetical protein CARUB_v10024094mg [Capsella rubella]
 gb|EOA27921.1| hypothetical protein CARUB_v10024094mg [Capsella rubella]
Length=199

 Score =   144 bits (363),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/160 (44%), Positives = 105/160 (66%), Gaps = 5/160 (3%)
 Frame = -1

Query  714  VISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVFRYTGA  535
            +I+ L+SL+ R    N +  R     +        VF     P +TI+SYLER+F+Y   
Sbjct  13   LIAFLSSLLERVAESNDQTRR-----VTTQSQRVSVFHGLSRPTITIQSYLERIFKYANC  67

Query  534  GPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFARVGGL  355
             PS +VVAYVYLDRF    P   I   NVHRLLIT++MVA+K+++D+ Y N+Y+A+VGG+
Sbjct  68   SPSCFVVAYVYLDRFTHRQPSLPINSFNVHRLLITSVMVAAKFLDDLYYNNAYYAKVGGI  127

Query  354  TTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGI  235
            +T EMN LE++FLF + F+L+V  + FH+Y  +L++E+ +
Sbjct  128  STKEMNFLELDFLFGLGFELNVTPNTFHAYFSYLQKEMTL  167



>ref|XP_009613666.1| PREDICTED: cyclin-U4-1-like [Nicotiana tomentosiformis]
Length=209

 Score =   144 bits (364),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/160 (44%), Positives = 107/160 (67%), Gaps = 7/160 (4%)
 Frame = -1

Query  720  PLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVFRYT  541
            P VI+ +AS++ R    N  ++R F            +F     P +++ESYLER+F+Y 
Sbjct  12   PKVINFMASVLERVAETND-LSRRFSAQ------KISMFHGLTRPTISVESYLERIFKYA  64

Query  540  GAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFARVG  361
               PS +VVAY+YLDRF Q  P   I   NVHRLLIT+++V++K+++D+ Y N+Y+A+VG
Sbjct  65   NCSPSCFVVAYIYLDRFSQRQPLLPINSFNVHRLLITSVLVSAKFMDDIFYNNAYYAKVG  124

Query  360  GLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREV  241
            G++T EMN LEV+FLF + F+L+V  + FH+YC +L+ E+
Sbjct  125  GISTNEMNLLEVDFLFGIGFQLNVTPTTFHTYCSYLQTEM  164



>ref|XP_008386497.1| PREDICTED: cyclin-P3-1-like [Malus domestica]
Length=219

 Score =   144 bits (364),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/199 (36%), Positives = 127/199 (64%), Gaps = 16/199 (8%)
 Frame = -1

Query  723  TPLVISVLASLIGRTVTRNQRI--ARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVF  550
            TP V+S L+S++ R+V RN+ +    N +  + I       F    AP ++I  Y++R+ 
Sbjct  31   TPRVLSPLSSILERSVQRNEMLLETTNIKEVITI-------FHGLRAPPLSIRQYIDRIC  83

Query  549  RYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFA  370
            +Y+G  PS +VVA +Y+DR+ +   +  +   NVHRLLIT++M+A+K+++D  + N+Y+A
Sbjct  84   KYSGCSPSCFVVAQIYVDRYLKC-TEVHLTSFNVHRLLITSVMLAAKFMDDAFFNNAYYA  142

Query  369  RVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQIERTLRCA--  196
            +VGG++T E+N+LE++FLF + F+L VN+  F  YC  LE+E     G QIER+++    
Sbjct  143  KVGGVSTAELNRLEMKFLFTIDFRLQVNLETFTKYCSQLEKE---AAGVQIERSIQACGI  199

Query  195  -QDIKSKQREDTTFTQVTS  142
             ++    ++ED+T+ +  +
Sbjct  200  KENWSKSKKEDSTYARTVA  218



>ref|XP_006361848.1| PREDICTED: cyclin-P3-1-like [Solanum tuberosum]
Length=226

 Score =   145 bits (365),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/179 (41%), Positives = 115/179 (64%), Gaps = 12/179 (7%)
 Frame = -1

Query  732  QSSTPLVISVLASLIGRTVTRNQRIAR--NFRGAMDINVGSTKVFECNEAPDMTIESYLE  559
                P ++ ++AS++ R+V +N++  +  N RG +        VF    AP +T++ Y+E
Sbjct  30   DKGNPKILWIVASVVERSVQKNEKALKGSNKRGVV-------TVFHGTRAPVLTVQQYIE  82

Query  558  RVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNS  379
            R+F+Y+   PS +VVAY+YL+RF  L     +   NVHRLLIT+IM+A K+V+D  Y N+
Sbjct  83   RIFKYSNCSPSCFVVAYIYLERFLNL-THCLLTSLNVHRLLITSIMLAVKFVDDDCYNNA  141

Query  378  YFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQIERTLR  202
            Y+A+VGG+TT E+NKLE++FL  + F+LHV+V  F  YC  LE++       QI+R +R
Sbjct  142  YYAKVGGITTTELNKLEMKFLAALDFRLHVSVENFDKYCLQLEKDT--NEKLQIDRPIR  198



>ref|XP_008343752.1| PREDICTED: cyclin-U4-1-like [Malus domestica]
Length=207

 Score =   144 bits (363),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 104/158 (66%), Gaps = 7/158 (4%)
 Frame = -1

Query  714  VISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVFRYTGA  535
            +I+ L+SL+ R    N   +      + +  G T+       P ++I++YLER+F+Y   
Sbjct  13   IITFLSSLVQRVAESNDLNSHFQHQKISVFHGLTR-------PTISIQNYLERIFKYANC  65

Query  534  GPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFARVGGL  355
             PS  +VAYVYLDRF Q  P   I   NVHRLLIT++MVA+K+++DM Y N+Y+A+VGG+
Sbjct  66   SPSCLIVAYVYLDRFSQRQPSLPINSFNVHRLLITSVMVAAKFMDDMYYNNAYYAKVGGI  125

Query  354  TTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREV  241
            +T+EMN LEV+FLF + F L+V  S F  YC +L+RE+
Sbjct  126  STIEMNFLEVDFLFGLSFNLNVTPSTFTIYCSYLQREM  163



>ref|XP_009363720.1| PREDICTED: cyclin-U4-1-like [Pyrus x bretschneideri]
Length=207

 Score =   144 bits (363),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/169 (40%), Positives = 113/169 (67%), Gaps = 6/169 (4%)
 Frame = -1

Query  726  STPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVFR  547
            S P +I  ++S++ R V+ +  + R F     ++V     F     P ++I SYL+R+F+
Sbjct  14   SMPRMIGFMSSVLER-VSESNVLNRRFHPTQKLSV-----FHSLTTPTISIHSYLQRIFK  67

Query  546  YTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFAR  367
            Y    PS ++VAYVYLDRF Q+ P   I   NVHRLLIT+++V++K+++D+ Y N+++AR
Sbjct  68   YADCSPSCFIVAYVYLDRFTQMQPLLPIDSFNVHRLLITSVLVSAKFMDDIYYNNAFYAR  127

Query  366  VGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQ  220
            VGG++T EMN LEV+FLF + F+++V  + +++YC +L+RE+ +    Q
Sbjct  128  VGGISTQEMNLLEVDFLFGLGFQMNVTPATYYTYCSYLQREMLLQSPLQ  176



>gb|KHG00595.1| Cyclin-P3-1 [Gossypium arboreum]
Length=215

 Score =   144 bits (363),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 72/192 (38%), Positives = 118/192 (61%), Gaps = 20/192 (10%)
 Frame = -1

Query  723  TPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTK----VFECNEAPDMTIESYLER  556
            TP ++++L+SL+ ++V +N+         M I   S K    +F     P ++I  Y++R
Sbjct  31   TPRILTLLSSLLEKSVQKNE---------MQIETASAKDNIAIFHGLRVPTISIRQYIDR  81

Query  555  VFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSY  376
            +F+Y    PS ++VAY+YLDRF Q      +   NVHRLLIT++MVA+K+++D  + N+Y
Sbjct  82   IFKYARCSPSCFLVAYIYLDRFSQ-QTDMHLTSLNVHRLLITSVMVAAKFIDDTYFNNAY  140

Query  375  FARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQIERTLR-C  199
            +ARVGG++T E+N+LE++FL  + F+L V+++ F  YC  L++E     G Q+ER +R C
Sbjct  141  YARVGGISTAELNRLEMKFLLSLDFRLQVSINTFRRYCLQLQKE-----GNQVERPIRAC  195

Query  198  AQDIKSKQREDT  163
                    + DT
Sbjct  196  GIKESWPSKSDT  207



>ref|XP_004493668.1| PREDICTED: cyclin-P3-1-like [Cicer arietinum]
Length=218

 Score =   144 bits (363),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 71/185 (38%), Positives = 121/185 (65%), Gaps = 8/185 (4%)
 Frame = -1

Query  720  PLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVFRYT  541
            P V+S+L+S + R+V +N+ +  + +   D+      VF    AP +++  Y++R+F+Y+
Sbjct  32   PRVLSLLSSFLDRSVQKNEMLLDD-KHIEDV----VTVFHGLSAPALSVRKYIDRIFKYS  86

Query  540  GAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFARVG  361
            G  PS +VVA++Y+DRF Q +   ++   NVHRLLIT+IM+A+K+++D  + N+Y+A+VG
Sbjct  87   GCSPSCFVVAHIYVDRFLQ-NTDIKLTSLNVHRLLITSIMLAAKFMDDAFFNNAYYAKVG  145

Query  360  GLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQIERTLRCAQDIKS  181
            G++T E+N+LE+ FLF + F+L V+V  F  YC  LE+E       QIER ++  +  +S
Sbjct  146  GVSTAELNRLEMSFLFGIDFRLQVSVDTFGRYCWDLEKEA--SETLQIERPMKACRIKES  203

Query  180  KQRED  166
               +D
Sbjct  204  WSNKD  208



>ref|XP_009389264.1| PREDICTED: cyclin-P4-1 [Musa acuminata subsp. malaccensis]
Length=197

 Score =   143 bits (361),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/188 (39%), Positives = 112/188 (60%), Gaps = 5/188 (3%)
 Frame = -1

Query  738  QEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLE  559
            +E  + P V++VL++++ R   RN  + R    A+         F     P +++ SYLE
Sbjct  6    EEPHAIPRVVAVLSTILERLAERNDAVRRPL--ALH---HCASAFHGLTKPAISVRSYLE  60

Query  558  RVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNS  379
            R+FRY    PS YVVAY+Y+DRF   HP   +   NVHR LIT+++ A K+++D+ Y N+
Sbjct  61   RIFRYANCSPSCYVVAYIYIDRFLWRHPAVFLDSFNVHRFLITSVLTAVKFMDDIYYNNA  120

Query  378  YFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQIERTLRC  199
            YFA+VGG++ MEMN LEV+FLF + F+L+V   +F SYC  L+RE+ +       R   C
Sbjct  121  YFAKVGGISLMEMNYLEVDFLFGVGFELNVTPVIFSSYCSTLQREMYLESPASPPRLHCC  180

Query  198  AQDIKSKQ  175
              + +S  
Sbjct  181  LTEEESSS  188



>emb|CDY48257.1| BnaC04g05160D [Brassica napus]
Length=199

 Score =   143 bits (361),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 70/162 (43%), Positives = 105/162 (65%), Gaps = 5/162 (3%)
 Frame = -1

Query  720  PLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVFRYT  541
            P +I+ L+SL+ R    N    R     +     S  VF+    P +T++SYLER+F+Y 
Sbjct  11   PKLIAFLSSLLERVSESNDLTRR-----VATQSQSVSVFDGLSRPSITVQSYLERIFKYA  65

Query  540  GAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFARVG  361
               PS +VVAYVYLDRF    P   I   NVHRLLIT++MV++K+++D  Y N+Y+A+VG
Sbjct  66   NCSPSCFVVAYVYLDRFTHRQPSLPINSFNVHRLLITSVMVSAKFLDDRYYNNAYYAKVG  125

Query  360  GLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGI  235
            G++T EMN LE++FLF + F L+V  + FH+Y  +L++E+ +
Sbjct  126  GISTKEMNLLELDFLFGLGFDLNVTPNTFHAYFSYLKKEMTL  167



>ref|XP_007208184.1| hypothetical protein PRUPE_ppa020960mg, partial [Prunus persica]
 gb|EMJ09383.1| hypothetical protein PRUPE_ppa020960mg, partial [Prunus persica]
Length=175

 Score =   142 bits (359),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 68/167 (41%), Positives = 112/167 (67%), Gaps = 6/167 (4%)
 Frame = -1

Query  738  QEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLE  559
            +  + TP V+SV++S+  R++ +N+++ R  R  M        +F  +E P ++I  Y+E
Sbjct  11   KSATRTPRVLSVVSSVFERSIRKNEKLIR--RSKMK---DVITMFHASEVPALSIRRYIE  65

Query  558  RVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNS  379
            R+F+Y+   PS +VVAY+Y++RF Q      +   N+HRLLIT+IMVA+K+++D  Y N+
Sbjct  66   RIFKYSSCSPSCFVVAYIYIERFLQ-RTGICLTSLNIHRLLITSIMVAAKFMDDECYSNA  124

Query  378  YFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVG  238
            ++A++GG++  E+NKLE+EFL  + FKLHV +++F  YC  LE  VG
Sbjct  125  HYAKIGGVSLSELNKLEIEFLLSLDFKLHVTINMFGKYCRQLEDGVG  171



>ref|XP_004172662.1| PREDICTED: LOW QUALITY PROTEIN: cyclin-U1-1-like, partial [Cucumis 
sativus]
Length=213

 Score =   144 bits (362),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 115/184 (63%), Gaps = 10/184 (5%)
 Frame = -1

Query  723  TPLVISVLASLIGRTVTRNQRIARNFRGAMD---------INVGST-KVFECNEAPDMTI  574
            TP V+ +LA ++ R V RN R+       ++          ++G++   F    AP ++I
Sbjct  2    TPRVLIILAFVLDRLVARNDRLLNELSQQLEELGCCSSSSNHLGNSFNAFHGVRAPTISI  61

Query  573  ESYLERVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDM  394
              YLER+++YT   PS  VV +VY+DR    HP   +   NVHRLL+T++MVASK ++D+
Sbjct  62   LKYLERIYKYTNCSPSCLVVGFVYIDRLIHRHPDSLVISLNVHRLLVTSVMVASKMLDDV  121

Query  393  NYRNSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQIE  214
            +Y N+++ARVGG++  E+NKLE+E  FL+ F + V+  VF +YC HLE+E+ + G  +++
Sbjct  122  HYNNAFYARVGGVSKGELNKLELEMXFLLDFGVTVSSRVFETYCWHLEKEMLLNGNGEMQ  181

Query  213  RTLR  202
            R  R
Sbjct  182  RVER  185



>ref|XP_006838523.1| hypothetical protein AMTR_s00002p00190080 [Amborella trichopoda]
 gb|ERN01092.1| hypothetical protein AMTR_s00002p00190080 [Amborella trichopoda]
Length=227

 Score =   144 bits (363),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 80/173 (46%), Positives = 110/173 (64%), Gaps = 5/173 (3%)
 Frame = -1

Query  720  PLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVFRYT  541
            P VI +L+ L+ R   +N    R   G          VF     P ++IESYLERVF+Y 
Sbjct  19   PRVIRLLSFLLQRVAEKNDE--RENEGPCFSQ--KISVFHGICRPAISIESYLERVFKYA  74

Query  540  GAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFARVG  361
               PS +VVAYVYLDRF Q      I   +VHRLLIT+++VA+K+++D+ Y N+Y+A+VG
Sbjct  75   NCSPSCFVVAYVYLDRFSQRQQTLPITSLSVHRLLITSVLVAAKFMDDLYYNNAYYAKVG  134

Query  360  GLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREV-GIGGGYQIERTL  205
            G++  EMN LEV+FLF + F L+V  + F+SYC HL+RE+    G YQI+R L
Sbjct  135  GISITEMNCLEVDFLFGLGFHLNVTPTAFNSYCTHLQREMFECIGEYQIQRGL  187



>ref|XP_008343655.1| PREDICTED: cyclin-U4-1-like [Malus domestica]
Length=206

 Score =   143 bits (361),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 105/158 (66%), Gaps = 7/158 (4%)
 Frame = -1

Query  714  VISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVFRYTGA  535
            +I+ L+SL+ R    N  +  +F+           VF     P ++I+SYLER+F+Y   
Sbjct  13   IITFLSSLVQRVAESND-LNSHFQPQ------KISVFHGLTRPTISIQSYLERIFKYANC  65

Query  534  GPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFARVGGL  355
             PS  +VAYVYLDRF Q  P   I   NVHRLLIT+++VA+K+++DM Y N+Y+A+VGG+
Sbjct  66   SPSCLIVAYVYLDRFSQRQPSLPINSFNVHRLLITSVLVAAKFMDDMYYNNAYYAKVGGI  125

Query  354  TTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREV  241
            +T+EMN LEV+FLF + F L+V  + F ++C +L+RE+
Sbjct  126  STIEMNFLEVDFLFGLSFDLNVTPTTFTTHCSYLQREM  163



>ref|XP_011032712.1| PREDICTED: cyclin-P3-1-like isoform X2 [Populus euphratica]
 ref|XP_011032713.1| PREDICTED: cyclin-P3-1-like isoform X2 [Populus euphratica]
 ref|XP_011032715.1| PREDICTED: cyclin-P3-1-like isoform X2 [Populus euphratica]
Length=219

 Score =   144 bits (362),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 72/189 (38%), Positives = 123/189 (65%), Gaps = 9/189 (5%)
 Frame = -1

Query  723  TPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVFRY  544
            +P V+ +L+SL+ R+V +N+ +    +   D+      +F     P ++I +Y++R+F+Y
Sbjct  31   SPRVLMLLSSLLDRSVQKNEMLLETTQ-IKDV----VTIFHGLRPPTVSIRNYVDRIFKY  85

Query  543  TGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFARV  364
            +   PS +VVA++Y+DRF Q      +   NVHRLLIT++M+A+K+V+D  + N+Y+A+V
Sbjct  86   SACSPSCFVVAHIYMDRFLQ-QTDIHLTSRNVHRLLITSVMIAAKFVDDAFFNNAYYAKV  144

Query  363  GGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQIERTLR-CAQDI  187
            GG++T E+N+LE++FLF + F+L VNV+ F  +C  LE+E    GG QIER ++ C    
Sbjct  145  GGVSTEELNRLEMKFLFSIDFRLQVNVNTFGKHCYQLEKES--AGGLQIERPIQACRIKE  202

Query  186  KSKQREDTT  160
                ++D+T
Sbjct  203  NWSSKDDST  211



>ref|XP_009389583.1| PREDICTED: cyclin-P4-1-like [Musa acuminata subsp. malaccensis]
Length=205

 Score =   143 bits (361),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 73/183 (40%), Positives = 110/183 (60%), Gaps = 4/183 (2%)
 Frame = -1

Query  738  QEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLE  559
            +E  + P V+SVL++++ R   RN  +    RG           F     P +++ SYLE
Sbjct  6    EENHAVPGVVSVLSTILERLAERNDAV----RGRPVAPHHRASAFHGLTKPSISVRSYLE  61

Query  558  RVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNS  379
            R+FRY G   S YV AY+YLDRF + HP   +   NVHR LIT+++ A K+V+D++Y N+
Sbjct  62   RIFRYAGCSLSCYVAAYIYLDRFLRRHPAVSLHSLNVHRFLITSVLAAVKFVDDIHYNNA  121

Query  378  YFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQIERTLRC  199
            YFA+VGG+  +EMN LEV+FLF + F+L++   +F SYC  L+RE+ +       R   C
Sbjct  122  YFAKVGGINLVEMNYLEVDFLFGIGFELNITPVMFTSYCSILQREMYLEPPPSPPRLHSC  181

Query  198  AQD  190
            + +
Sbjct  182  STE  184



>gb|KHG14991.1| Cyclin-U4-1 -like protein [Gossypium arboreum]
Length=205

 Score =   143 bits (360),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 67/154 (44%), Positives = 103/154 (67%), Gaps = 4/154 (3%)
 Frame = -1

Query  696  SLIGRTVTRNQRIARNFRGAMDINVG----STKVFECNEAPDMTIESYLERVFRYTGAGP  529
            +++   +T    + +N   + D+N G       VF    +P ++I+SYL R+++Y    P
Sbjct  8    NVMSNLITFLSSLIQNVAESNDLNCGFQAQKISVFHGLTSPTISIQSYLHRIYKYANCSP  67

Query  528  SVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFARVGGLTT  349
            S ++VAYVYLDRF Q  P   I   NVHRLLIT++MVA+K+++DM Y N+++A+VGG++T
Sbjct  68   SCFIVAYVYLDRFAQRQPSLPINSFNVHRLLITSVMVAAKFMDDMYYNNAFYAKVGGIST  127

Query  348  MEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLER  247
             EMN LEV+FLF + F L+VN+  FH+Y  +L+R
Sbjct  128  TEMNFLEVDFLFGLGFHLNVNLKTFHTYYSYLQR  161



>ref|XP_002512374.1| cyclin-dependent protein kinase, putative [Ricinus communis]
 gb|EEF49826.1| cyclin-dependent protein kinase, putative [Ricinus communis]
Length=221

 Score =   144 bits (362),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 115/175 (66%), Gaps = 8/175 (5%)
 Frame = -1

Query  729  SSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVF  550
            S TP V+ +LAS++ R+  +N R+     G+   +V    VF  + +P ++I  Y+ERVF
Sbjct  23   SGTPRVLLLLASVLERSTQKNDRL---LEGSRRKDV--VTVFHGSRSPSLSIRQYIERVF  77

Query  549  RYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFA  370
            +YT    S +VVAY+Y++RF +      +   NVHRLLIT+IM+A+K+++D  Y N+Y+A
Sbjct  78   KYTKCSTSCFVVAYIYVERFLRRMDAC-LTSLNVHRLLITSIMLAAKFLDDECYNNAYYA  136

Query  369  RVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQIERTL  205
            +VGG++T EMN++E + LF + F+L V V  F SYC  LERE   GG Y+IER +
Sbjct  137  KVGGVSTPEMNRMETKLLFNLDFRLQVTVEAFRSYCLKLEREC--GGEYRIERPI  189



>ref|XP_008453846.1| PREDICTED: cyclin-U4-1-like [Cucumis melo]
Length=207

 Score =   143 bits (360),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 73/168 (43%), Positives = 109/168 (65%), Gaps = 4/168 (2%)
 Frame = -1

Query  738  QEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLE  559
            +E    P VI+ L+S++ R    N +  R        N  S   F+    P ++I+SYLE
Sbjct  8    EEMVGIPKVINYLSSVLQRVSESNDQEDRMMNNGTKRNNYSG--FDGISRPSISIQSYLE  65

Query  558  RVFRYTGAGPSVYVVAYVYLDRFCQLH--PQFRIGPTNVHRLLITTIMVASKYVEDMNYR  385
            R+F+Y    PS +VVAYVYL RF   H    F I   NVHRLLIT+++V++K+ +D+ Y 
Sbjct  66   RIFKYANCSPSCFVVAYVYLHRFLHNHHPSNFHIDSFNVHRLLITSVLVSAKFFDDLYYN  125

Query  384  NSYFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREV  241
            N+Y+A+VGG++TMEMN LE++FLF +RF+L+V+ + FH YC +L+ E+
Sbjct  126  NAYYAKVGGISTMEMNLLELDFLFGLRFQLNVSPNTFHIYCSYLQSEM  173



>ref|XP_011032710.1| PREDICTED: cyclin-P3-1-like isoform X1 [Populus euphratica]
 ref|XP_011032711.1| PREDICTED: cyclin-P3-1-like isoform X1 [Populus euphratica]
Length=227

 Score =   144 bits (362),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 72/189 (38%), Positives = 123/189 (65%), Gaps = 9/189 (5%)
 Frame = -1

Query  723  TPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVFRY  544
            +P V+ +L+SL+ R+V +N+ +    +   D+      +F     P ++I +Y++R+F+Y
Sbjct  39   SPRVLMLLSSLLDRSVQKNEMLLETTQ-IKDV----VTIFHGLRPPTVSIRNYVDRIFKY  93

Query  543  TGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFARV  364
            +   PS +VVA++Y+DRF Q      +   NVHRLLIT++M+A+K+V+D  + N+Y+A+V
Sbjct  94   SACSPSCFVVAHIYMDRFLQ-QTDIHLTSRNVHRLLITSVMIAAKFVDDAFFNNAYYAKV  152

Query  363  GGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQIERTLR-CAQDI  187
            GG++T E+N+LE++FLF + F+L VNV+ F  +C  LE+E    GG QIER ++ C    
Sbjct  153  GGVSTEELNRLEMKFLFSIDFRLQVNVNTFGKHCYQLEKES--AGGLQIERPIQACRIKE  210

Query  186  KSKQREDTT  160
                ++D+T
Sbjct  211  NWSSKDDST  219



>ref|XP_006366726.1| PREDICTED: cyclin-U4-1-like [Solanum tuberosum]
Length=203

 Score =   143 bits (360),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 68/160 (43%), Positives = 105/160 (66%), Gaps = 7/160 (4%)
 Frame = -1

Query  720  PLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVFRYT  541
            P VI+ +AS++ R    N    R     + I  G T+       P ++++SYLER+F+Y 
Sbjct  12   PRVINFMASVLERVAETNDLNGRYSAQKISIFDGLTR-------PTISVQSYLERIFKYA  64

Query  540  GAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFARVG  361
               PS ++VAY+YLDRF Q+ P   I   NVHRLLIT+++V++K+++D+ Y N Y+ +VG
Sbjct  65   NCSPSCFIVAYIYLDRFSQMQPLLPINSFNVHRLLITSVLVSAKFMDDIFYNNGYYGKVG  124

Query  360  GLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREV  241
            G++T EMN LEV+FLF + F+L+V  + FH+YC +L  E+
Sbjct  125  GISTREMNLLEVDFLFGIGFQLNVTPTTFHTYCSYLHTEM  164



>ref|XP_010508257.1| PREDICTED: cyclin-U4-1 [Camelina sativa]
 ref|XP_010508258.1| PREDICTED: cyclin-U4-1 [Camelina sativa]
Length=200

 Score =   142 bits (359),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 70/160 (44%), Positives = 104/160 (65%), Gaps = 5/160 (3%)
 Frame = -1

Query  714  VISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVFRYTGA  535
            +I+ L+SL+ R    N    R     +        VF     P +TI+SYLER+F+Y   
Sbjct  13   LIAFLSSLLERVAESNDLTRR-----VTTQSQRVSVFHGLSRPTITIQSYLERIFKYANC  67

Query  534  GPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFARVGGL  355
             PS +VVAYVYLDRF    P   I   NVHRLLIT++MVA+K+++D+ Y N+Y+A+VGG+
Sbjct  68   SPSCFVVAYVYLDRFTHRQPSLPINSFNVHRLLITSVMVAAKFLDDLYYNNAYYAKVGGI  127

Query  354  TTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGI  235
            +T EMN LE++FLF + F+L+V  + FH+Y  +L++E+ +
Sbjct  128  STKEMNFLELDFLFGLGFELNVTPNTFHAYFTYLQKEMTL  167



>ref|XP_002306774.1| cyclin family protein [Populus trichocarpa]
 gb|EEE93770.1| cyclin family protein [Populus trichocarpa]
Length=219

 Score =   143 bits (360),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 71/188 (38%), Positives = 123/188 (65%), Gaps = 8/188 (4%)
 Frame = -1

Query  723  TPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVFRY  544
            +P V+ +L+SL+ R+V +N+ +    +   D+      +F     P ++I +Y++R+F+Y
Sbjct  31   SPRVLMLLSSLLDRSVQKNEMLLETTQ-IKDV----VTIFHGLRPPTVSIRNYVDRIFKY  85

Query  543  TGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFARV  364
            +   PS +VVA++Y+DRF Q      +   NVHRLLIT++M+A+K+V+D  + N+Y+A+V
Sbjct  86   SACSPSCFVVAHIYMDRFLQ-QTDIHLTALNVHRLLITSVMIAAKFVDDAFFNNAYYAKV  144

Query  363  GGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQIERTLRCAQDIK  184
            GG++T E+N+LE++FLF + F+L VNV+ F  +C  LE+E    GG QIER ++  +  +
Sbjct  145  GGVSTEELNRLEMKFLFSIDFRLQVNVNTFGKHCYQLEKES--VGGLQIERPIQACRIKE  202

Query  183  SKQREDTT  160
            S   +D +
Sbjct  203  SWSSKDDS  210



>ref|XP_010518078.1| PREDICTED: cyclin-U4-1-like [Camelina sativa]
Length=200

 Score =   142 bits (359),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 70/160 (44%), Positives = 104/160 (65%), Gaps = 5/160 (3%)
 Frame = -1

Query  714  VISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVFRYTGA  535
            +I+ L+SL+ R    N    R     +        VF     P +TI+SYLER+F+Y   
Sbjct  13   LIAFLSSLLERVAESNDLTRR-----VTTQSQRVSVFHGLSRPTITIQSYLERIFKYANC  67

Query  534  GPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFARVGGL  355
             PS +VVAYVYLDRF    P   I   NVHRLLIT++MVA+K+++D+ Y N+Y+A+VGG+
Sbjct  68   SPSCFVVAYVYLDRFTHRQPSLPINSFNVHRLLITSVMVAAKFLDDLYYNNAYYAKVGGI  127

Query  354  TTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGI  235
            +T EMN LE++FLF + F+L+V  + FH+Y  +L++E+ +
Sbjct  128  STKEMNFLELDFLFGLGFELNVTPNTFHAYFTYLQKEMTL  167



>ref|XP_008368850.1| PREDICTED: cyclin-P3-1-like [Malus domestica]
Length=219

 Score =   143 bits (360),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 70/196 (36%), Positives = 123/196 (63%), Gaps = 12/196 (6%)
 Frame = -1

Query  720  PLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVFRYT  541
            P V+S L+S++ R V RN+ +    +    I +     +    AP ++I  Y++R+ +Y+
Sbjct  32   PRVLSPLSSILERYVQRNEMLLETTKIKQVITI-----YHGLRAPPLSIRQYIDRICKYS  86

Query  540  GAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFARVG  361
            G  PS +VVA +YLDR+ Q   Q  +   NVHRLLIT++M+A+K+++D  + N+Y+A+VG
Sbjct  87   GCSPSCFVVAQIYLDRYLQCX-QVHLTSFNVHRLLITSVMLAAKFMDDAFFNNAYYAKVG  145

Query  360  GLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQIERTL---RCAQD  190
            G++T E+N+LE++FLF + F+L V +  F+ YC  L++E     G QIER++   R  ++
Sbjct  146  GVSTAELNRLEIKFLFTIDFRLQVTIETFNKYCSQLDKE---ATGVQIERSIQACRIKEN  202

Query  189  IKSKQREDTTFTQVTS  142
                +++D+T+    +
Sbjct  203  WSKSKKKDSTYVHTVA  218



>ref|XP_011079855.1| PREDICTED: cyclin-P3-1-like [Sesamum indicum]
 ref|XP_011079856.1| PREDICTED: cyclin-P3-1-like [Sesamum indicum]
Length=217

 Score =   143 bits (360),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 73/194 (38%), Positives = 120/194 (62%), Gaps = 10/194 (5%)
 Frame = -1

Query  738  QEQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLE  559
             E    P ++S+LA+++ R+V +N+ I    +    I +     F    AP ++I+ Y++
Sbjct  26   NENPRNPPILSLLAAVLERSVQKNEWILETSQTKDVITI-----FHGLRAPSLSIQQYID  80

Query  558  RVFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNS  379
            R+F+Y    PS +V+A +YLDRF Q    F +   N+HRLLIT++MVA+K+++D  + N+
Sbjct  81   RIFKYACCSPSCFVIANIYLDRFIQRTNLF-LTSLNIHRLLITSVMVAAKFMDDAFFNNA  139

Query  378  YFARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQIERT-LR  202
            Y+ARVGG++T E+NKLE++FLF + F++HV V  F  YC   ++E     G  IER+ L 
Sbjct  140  YYARVGGVSTAELNKLEIKFLFGLDFRIHVTVKTFGEYCSVFKKE---ATGGLIERSILA  196

Query  201  CAQDIKSKQREDTT  160
            C  +     ++D+T
Sbjct  197  CGVEESWANKDDST  210



>ref|XP_010674759.1| PREDICTED: cyclin-P3-1 isoform X1 [Beta vulgaris subsp. vulgaris]
Length=230

 Score =   143 bits (361),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 71/192 (37%), Positives = 120/192 (63%), Gaps = 7/192 (4%)
 Frame = -1

Query  735  EQSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLER  556
            E    P VIS +AS++ +T+ +N ++ +    + D    +  ++   +AP ++I  Y+ER
Sbjct  28   EPEKPPQVISFIASILEKTIQKNGKLLKRSSRSKD----NVTIYHGIKAPTLSIRQYIER  83

Query  555  VFRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSY  376
            VF+Y+   PS +VVAY+Y+D+F Q    + +   NVHRLLI  ++VA+K++ED++Y N+Y
Sbjct  84   VFKYSKCSPSCFVVAYIYMDKFIQATKCY-LTSLNVHRLLIACVLVATKFIEDVSYNNAY  142

Query  375  FARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGIGGGYQIERTLRCA  196
            FA+VGG++  EMNKLE++ L  + ++LHV + +F  YC  LE+    GG  ++ER  +  
Sbjct  143  FAKVGGVSIAEMNKLEMKLLRSLDYRLHVTLELFDQYCLQLEK--AGGGSERVERATQSC  200

Query  195  QDIKSKQREDTT  160
                S  ++D T
Sbjct  201  GFKGSWLKKDET  212



>ref|XP_010506407.1| PREDICTED: cyclin-U4-1-like [Camelina sativa]
Length=200

 Score =   142 bits (358),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 69/153 (45%), Positives = 101/153 (66%), Gaps = 15/153 (10%)
 Frame = -1

Query  693  LIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERVFRYTGAGPSVYVV  514
            L  R  TR+QR++               VF     P +TI+SYLER+F+Y    PS +VV
Sbjct  30   LTRRVTTRSQRVS---------------VFHGLSRPTITIQSYLERIFKYANCSPSCFVV  74

Query  513  AYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYFARVGGLTTMEMNK  334
            AYVYLDRF    P   I   NVHRLLIT++MVA+K+++D+ Y N+Y+A+VGG++T EMN 
Sbjct  75   AYVYLDRFTHRQPSLPINSFNVHRLLITSVMVAAKFLDDLYYNNAYYAKVGGISTKEMNF  134

Query  333  LEVEFLFLMRFKLHVNVSVFHSYCCHLEREVGI  235
            LE++FLF + F+L+V  + FH+Y  +L++E+ +
Sbjct  135  LELDFLFGLGFELNVTPNTFHAYFTYLQKEMTL  167



>ref|XP_010934125.1| PREDICTED: cyclin-P4-1 [Elaeis guineensis]
Length=204

 Score =   142 bits (359),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 73/164 (45%), Positives = 103/164 (63%), Gaps = 3/164 (2%)
 Frame = -1

Query  732  QSSTPLVISVLASLIGRTVTRNQRIARNFRGAMDINVGSTKVFECNEAPDMTIESYLERV  553
            +   P V+SVL+S++ R +  N        G +         F     P ++++SYLER+
Sbjct  6    REDPPRVVSVLSSVLRRVMELNDLA---IHGRLAAPHPRASAFHVPRVPGISVQSYLERI  62

Query  552  FRYTGAGPSVYVVAYVYLDRFCQLHPQFRIGPTNVHRLLITTIMVASKYVEDMNYRNSYF  373
            FR+    P+ YVVAYVYL+RF Q HP   I   NVH LL+T+I+ A K++E ++Y N+YF
Sbjct  63   FRHADCSPTCYVVAYVYLERFAQRHPPVFINSLNVHLLLLTSILTAVKFMERIHYDNAYF  122

Query  372  ARVGGLTTMEMNKLEVEFLFLMRFKLHVNVSVFHSYCCHLEREV  241
            ARVGG+T MEMN LEV FLF + F+L+V  +VF+SYC  L  E+
Sbjct  123  ARVGGITLMEMNNLEVNFLFGVGFELNVTPTVFYSYCSRLREEM  166



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1352312960240