BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c108687_g1_i1 len=103 path=[81:0-102]

Length=103
                                                                      Score     E

ref|XP_007016837.1|  ABC-2 type transporter family protein isoform 3  73.6    7e-14   
ref|XP_007016836.1|  ABC-2 type transporter family protein isoform 2  73.6    8e-14   
ref|XP_007016835.1|  ABC-2 type transporter family protein isoform 1  73.6    9e-14   
ref|XP_002273792.1|  PREDICTED: ABC transporter G family member 3...  73.6    9e-14   Vitis vinifera
ref|XP_010241828.1|  PREDICTED: ABC transporter G family member 3...  73.6    9e-14   
ref|XP_010521732.1|  PREDICTED: ABC transporter G family member 3     73.6    9e-14   
gb|KHG11960.1|  ABC transporter G family member 3                     72.8    2e-13   
gb|KHG11962.1|  ABC transporter G family member 3                     72.8    2e-13   
gb|KHG11961.1|  ABC transporter G family member 3                     72.8    2e-13   
emb|CDP07059.1|  unnamed protein product                              72.4    2e-13   
ref|XP_011089242.1|  PREDICTED: ABC transporter G family member 3     72.4    2e-13   
ref|XP_010253968.1|  PREDICTED: ABC transporter G family member 3...  72.4    2e-13   
ref|XP_010253966.1|  PREDICTED: ABC transporter G family member 3...  72.4    2e-13   
ref|XP_009783257.1|  PREDICTED: ABC transporter G family member 3...  72.4    3e-13   
ref|XP_009593336.1|  PREDICTED: ABC transporter G family member 3...  72.4    3e-13   
ref|XP_008463193.1|  PREDICTED: ABC transporter G family member 3     71.2    6e-13   
ref|XP_004161314.1|  PREDICTED: ABC transporter G family member 3...  71.2    6e-13   
ref|XP_004147284.1|  PREDICTED: ABC transporter G family member 3...  71.2    6e-13   
gb|KDP43994.1|  hypothetical protein JCGZ_05461                       71.2    6e-13   
ref|XP_010111807.1|  ABC transporter G family member 3                71.2    6e-13   
gb|AIU41645.1|  ABC transporter family protein                        70.5    1e-12   
ref|XP_010043796.1|  PREDICTED: ABC transporter G family member 3     70.1    1e-12   
ref|XP_006340222.1|  PREDICTED: ABC transporter G family member 3...  69.7    2e-12   
ref|XP_004251157.1|  PREDICTED: ABC transporter G family member 3     69.7    2e-12   
ref|XP_011040921.1|  PREDICTED: ABC transporter G family member 3...  69.7    2e-12   
ref|XP_006384936.1|  hypothetical protein POPTR_0004s22390g           69.7    2e-12   
gb|KHG09336.1|  ABC transporter G family member 3                     69.3    2e-12   
ref|XP_010689111.1|  PREDICTED: ABC transporter G family member 3     69.3    3e-12   
ref|XP_011004785.1|  PREDICTED: ABC transporter G family member 3...  68.9    4e-12   
ref|XP_002313530.2|  hypothetical protein POPTR_0009s01380g           68.9    4e-12   Populus trichocarpa [western balsam poplar]
gb|KHN37951.1|  ABC transporter G family member 3                     68.6    5e-12   
ref|XP_010907036.1|  PREDICTED: ABC transporter G family member 3...  68.6    5e-12   
ref|XP_010907035.1|  PREDICTED: ABC transporter G family member 3...  68.6    5e-12   
ref|XP_010907033.1|  PREDICTED: ABC transporter G family member 3...  68.6    5e-12   
ref|XP_006424500.1|  hypothetical protein CICLE_v10027904mg           68.2    5e-12   
ref|XP_010907031.1|  PREDICTED: ABC transporter G family member 3...  68.6    6e-12   
ref|XP_006424505.1|  hypothetical protein CICLE_v10027904mg           67.4    6e-12   
gb|KHN21497.1|  ABC transporter G family member 3                     68.6    6e-12   
ref|XP_007150161.1|  hypothetical protein PHAVU_005G132000g           68.6    6e-12   
ref|XP_003543454.1|  PREDICTED: ABC transporter G family member 3...  68.6    6e-12   
ref|XP_003540196.1|  PREDICTED: ABC transporter G family member 3...  68.6    6e-12   
ref|XP_004487073.1|  PREDICTED: ABC transporter G family member 3...  68.6    6e-12   
ref|XP_003638054.1|  White-brown-complex ABC transporter family       68.6    6e-12   
gb|KDO60211.1|  hypothetical protein CISIN_1g004932mg                 68.2    6e-12   
ref|XP_006833150.1|  hypothetical protein AMTR_s00072p00119650        68.2    6e-12   
gb|KDO60210.1|  hypothetical protein CISIN_1g004932mg                 68.2    7e-12   
gb|KDO60205.1|  hypothetical protein CISIN_1g004932mg                 68.2    7e-12   
ref|XP_006488036.1|  PREDICTED: ABC transporter G family member 3...  68.2    7e-12   
ref|XP_006424501.1|  hypothetical protein CICLE_v10027904mg           68.2    7e-12   
ref|XP_008776879.1|  PREDICTED: ABC transporter G family member 3     67.8    9e-12   
ref|XP_009796613.1|  PREDICTED: ABC transporter G family member 3...  67.8    1e-11   
ref|XP_009796612.1|  PREDICTED: ABC transporter G family member 3...  67.8    1e-11   
ref|XP_009594129.1|  PREDICTED: ABC transporter G family member 3...  67.8    1e-11   
ref|XP_010496840.1|  PREDICTED: ABC transporter G family member 3...  67.0    1e-11   
gb|EYU18798.1|  hypothetical protein MIMGU_mgv1a0020231mg             67.0    1e-11   
ref|XP_010470153.1|  PREDICTED: ABC transporter G family member 3...  67.0    2e-11   
ref|XP_010414603.1|  PREDICTED: ABC transporter G family member 3...  67.0    2e-11   
ref|XP_010414602.1|  PREDICTED: ABC transporter G family member 3...  67.0    2e-11   
ref|XP_006293759.1|  hypothetical protein CARUB_v10022719mg           67.0    2e-11   
ref|XP_010510699.1|  PREDICTED: ABC transporter G family member 3     67.0    2e-11   
ref|XP_002880954.1|  abc transporter family protein                   67.0    2e-11   
ref|NP_850111.1|  ABC transporter G family member 3                   67.0    2e-11   Arabidopsis thaliana [mouse-ear cress]
emb|CDY04533.1|  BnaA07g13590D                                        67.0    2e-11   
ref|XP_006409825.1|  hypothetical protein EUTSA_v10016313mg           66.6    2e-11   
ref|XP_009103641.1|  PREDICTED: ABC transporter G family member 3     66.6    2e-11   
emb|CDX71393.1|  BnaC04g16280D                                        66.6    2e-11   
gb|AAC98459.1|  putative ABC transporter                              66.6    2e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006652051.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...  66.2    3e-11   
ref|XP_006347197.1|  PREDICTED: ABC transporter G family member 3...  65.9    4e-11   
ref|XP_004288095.1|  PREDICTED: ABC transporter G family member 3...  65.9    4e-11   
ref|XP_006347196.1|  PREDICTED: ABC transporter G family member 3...  65.9    5e-11   
ref|XP_002523691.1|  ATP-binding cassette transporter, putative       65.5    6e-11   Ricinus communis
ref|XP_004980962.1|  PREDICTED: ABC transporter G family member 3...  65.1    9e-11   
ref|XP_010322410.1|  PREDICTED: ABC transporter G family member 3...  64.3    1e-10   
ref|XP_010322409.1|  PREDICTED: ABC transporter G family member 3...  64.3    2e-10   
ref|XP_004241287.1|  PREDICTED: ABC transporter G family member 3...  64.3    2e-10   
ref|XP_009384039.1|  PREDICTED: ABC transporter G family member 3     63.2    4e-10   
ref|XP_009356904.1|  PREDICTED: ABC transporter G family member 3     62.8    5e-10   
ref|XP_009376081.1|  PREDICTED: ABC transporter G family member 3...  62.4    7e-10   
ref|XP_008355191.1|  PREDICTED: ABC transporter G family member 3...  62.4    7e-10   
ref|XP_008385361.1|  PREDICTED: ABC transporter G family member 3...  61.6    7e-10   
ref|XP_007208059.1|  hypothetical protein PRUPE_ppa002046mg           62.4    7e-10   
gb|EMS56912.1|  ABC transporter G family member 3                     62.4    8e-10   
emb|CDX77150.1|  BnaC04g39450D                                        62.0    9e-10   
ref|XP_008226268.1|  PREDICTED: ABC transporter G family member 3     60.8    2e-09   
ref|XP_003558482.2|  PREDICTED: ABC transporter G family member 3     59.7    6e-09   
ref|XP_008661134.1|  PREDICTED: uncharacterized protein LOC100194...  59.7    6e-09   
ref|XP_008661082.1|  PREDICTED: uncharacterized protein LOC100194...  59.7    6e-09   
gb|EEC76581.1|  hypothetical protein OsI_14426                        59.3    1e-08   Oryza sativa Indica Group [Indian rice]
gb|AAP44750.1|  putative ABC transporter                              59.3    1e-08   Oryza sativa Japonica Group [Japonica rice]
gb|EEE60340.1|  hypothetical protein OsJ_13450                        58.9    1e-08   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001051967.2|  Os03g0859500                                     59.3    1e-08   Oryza sativa Japonica Group [Japonica rice]
emb|CDY30512.1|  BnaA04g16210D                                        58.2    1e-08   
ref|XP_002463469.1|  hypothetical protein SORBIDRAFT_01g000400        58.5    2e-08   Sorghum bicolor [broomcorn]
gb|EPS67634.1|  hypothetical protein M569_07144                       49.7    7e-06   



>ref|XP_007016837.1| ABC-2 type transporter family protein isoform 3, partial [Theobroma 
cacao]
 gb|EOY34456.1| ABC-2 type transporter family protein isoform 3, partial [Theobroma 
cacao]
Length=600

 Score = 73.6 bits (179),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 31/34 (91%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            LGDY NKLIGGHCYMKGLP GERRR+SIARELVM
Sbjct  231  LGDYANKLIGGHCYMKGLPSGERRRVSIARELVM  264



>ref|XP_007016836.1| ABC-2 type transporter family protein isoform 2 [Theobroma cacao]
 gb|EOY34455.1| ABC-2 type transporter family protein isoform 2 [Theobroma cacao]
Length=692

 Score = 73.6 bits (179),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 31/34 (91%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            LGDY NKLIGGHCYMKGLP GERRR+SIARELVM
Sbjct  231  LGDYANKLIGGHCYMKGLPSGERRRVSIARELVM  264



>ref|XP_007016835.1| ABC-2 type transporter family protein isoform 1 [Theobroma cacao]
 gb|EOY34454.1| ABC-2 type transporter family protein isoform 1 [Theobroma cacao]
Length=721

 Score = 73.6 bits (179),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 31/34 (91%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            LGDY NKLIGGHCYMKGLP GERRR+SIARELVM
Sbjct  231  LGDYANKLIGGHCYMKGLPSGERRRVSIARELVM  264



>ref|XP_002273792.1| PREDICTED: ABC transporter G family member 3 isoform X1 [Vitis 
vinifera]
 ref|XP_010651805.1| PREDICTED: ABC transporter G family member 3 isoform X1 [Vitis 
vinifera]
 ref|XP_010651806.1| PREDICTED: ABC transporter G family member 3 isoform X2 [Vitis 
vinifera]
 emb|CBI17169.3| unnamed protein product [Vitis vinifera]
Length=722

 Score = 73.6 bits (179),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 31/34 (91%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            LGDY NKLIGGHCYMKGLP GERRR+SIARELVM
Sbjct  230  LGDYANKLIGGHCYMKGLPSGERRRVSIARELVM  263



>ref|XP_010241828.1| PREDICTED: ABC transporter G family member 3-like [Nelumbo nucifera]
 ref|XP_010241829.1| PREDICTED: ABC transporter G family member 3-like [Nelumbo nucifera]
 ref|XP_010241830.1| PREDICTED: ABC transporter G family member 3-like [Nelumbo nucifera]
Length=723

 Score = 73.6 bits (179),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 31/34 (91%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            LGDY NKLIGGHCYMKGLP GERRR+SIARELVM
Sbjct  232  LGDYANKLIGGHCYMKGLPSGERRRVSIARELVM  265



>ref|XP_010521732.1| PREDICTED: ABC transporter G family member 3 [Tarenaya hassleriana]
 ref|XP_010521733.1| PREDICTED: ABC transporter G family member 3 [Tarenaya hassleriana]
 ref|XP_010521734.1| PREDICTED: ABC transporter G family member 3 [Tarenaya hassleriana]
 ref|XP_010521735.1| PREDICTED: ABC transporter G family member 3 [Tarenaya hassleriana]
 ref|XP_010521736.1| PREDICTED: ABC transporter G family member 3 [Tarenaya hassleriana]
Length=733

 Score = 73.6 bits (179),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 31/34 (91%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            LGDY NKLIGGHCYMKGLP GERRR+SIARELVM
Sbjct  235  LGDYANKLIGGHCYMKGLPSGERRRVSIARELVM  268



>gb|KHG11960.1| ABC transporter G family member 3 [Gossypium arboreum]
Length=677

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 31/34 (91%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            LGDY NKLIGGHCYMKGL RGERRR+SIARELVM
Sbjct  231  LGDYANKLIGGHCYMKGLARGERRRVSIARELVM  264



>gb|KHG11962.1| ABC transporter G family member 3 [Gossypium arboreum]
Length=679

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 31/34 (91%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            LGDY NKLIGGHCYMKGL RGERRR+SIARELVM
Sbjct  233  LGDYANKLIGGHCYMKGLARGERRRVSIARELVM  266



>gb|KHG11961.1| ABC transporter G family member 3 [Gossypium arboreum]
Length=693

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 31/34 (91%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            LGDY NKLIGGHCYMKGL RGERRR+SIARELVM
Sbjct  247  LGDYANKLIGGHCYMKGLARGERRRVSIARELVM  280



>emb|CDP07059.1| unnamed protein product [Coffea canephora]
Length=640

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 30/34 (88%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            LGD+ NKLIG HCYMKGLPRGERRR+SIARELVM
Sbjct  231  LGDFANKLIGAHCYMKGLPRGERRRVSIARELVM  264



>ref|XP_011089242.1| PREDICTED: ABC transporter G family member 3 [Sesamum indicum]
 ref|XP_011089244.1| PREDICTED: ABC transporter G family member 3 [Sesamum indicum]
Length=724

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 30/34 (88%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            LGDY NKLIGGHCYMKGLP GERRR++IARELVM
Sbjct  232  LGDYANKLIGGHCYMKGLPSGERRRVTIARELVM  265



>ref|XP_010253968.1| PREDICTED: ABC transporter G family member 3-like isoform X2 
[Nelumbo nucifera]
Length=721

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 31/34 (91%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            LGDY NKLIGGHCYMKGLP GERRR+SIARELVM
Sbjct  230  LGDYANKLIGGHCYMKGLPCGERRRVSIARELVM  263



>ref|XP_010253966.1| PREDICTED: ABC transporter G family member 3-like isoform X1 
[Nelumbo nucifera]
 ref|XP_010253967.1| PREDICTED: ABC transporter G family member 3-like isoform X1 
[Nelumbo nucifera]
Length=729

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 31/34 (91%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            LGDY NKLIGGHCYMKGLP GERRR+SIARELVM
Sbjct  230  LGDYANKLIGGHCYMKGLPCGERRRVSIARELVM  263



>ref|XP_009783257.1| PREDICTED: ABC transporter G family member 3-like [Nicotiana 
sylvestris]
 ref|XP_009783258.1| PREDICTED: ABC transporter G family member 3-like [Nicotiana 
sylvestris]
 ref|XP_009783259.1| PREDICTED: ABC transporter G family member 3-like [Nicotiana 
sylvestris]
Length=723

 Score = 72.4 bits (176),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 31/34 (91%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            LGDY NKLIGGHCYMKGL RGERRR+SIARELVM
Sbjct  231  LGDYANKLIGGHCYMKGLRRGERRRVSIARELVM  264



>ref|XP_009593336.1| PREDICTED: ABC transporter G family member 3-like [Nicotiana 
tomentosiformis]
Length=723

 Score = 72.4 bits (176),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 31/34 (91%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            LGDY NKLIGGHCYMKGL RGERRR+SIARELVM
Sbjct  231  LGDYANKLIGGHCYMKGLRRGERRRVSIARELVM  264



>ref|XP_008463193.1| PREDICTED: ABC transporter G family member 3 [Cucumis melo]
 ref|XP_008463196.1| PREDICTED: ABC transporter G family member 3 [Cucumis melo]
Length=721

 Score = 71.2 bits (173),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 30/34 (88%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            L DY NKLIGGHCYMKGLP GERRR+SIARELVM
Sbjct  231  LSDYANKLIGGHCYMKGLPNGERRRVSIARELVM  264



>ref|XP_004161314.1| PREDICTED: ABC transporter G family member 3-like [Cucumis sativus]
Length=721

 Score = 71.2 bits (173),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 30/34 (88%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            L DY NKLIGGHCYMKGLP GERRR+SIARELVM
Sbjct  231  LSDYANKLIGGHCYMKGLPNGERRRVSIARELVM  264



>ref|XP_004147284.1| PREDICTED: ABC transporter G family member 3-like [Cucumis sativus]
 gb|KGN64793.1| hypothetical protein Csa_1G097710 [Cucumis sativus]
Length=721

 Score = 71.2 bits (173),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 30/34 (88%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            L DY NKLIGGHCYMKGLP GERRR+SIARELVM
Sbjct  231  LSDYANKLIGGHCYMKGLPNGERRRVSIARELVM  264



>gb|KDP43994.1| hypothetical protein JCGZ_05461 [Jatropha curcas]
Length=723

 Score = 71.2 bits (173),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 30/34 (88%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            L DY NKLIGGHCYMKGLP GERRR+SIARELVM
Sbjct  231  LSDYANKLIGGHCYMKGLPNGERRRVSIARELVM  264



>ref|XP_010111807.1| ABC transporter G family member 3 [Morus notabilis]
 gb|EXC31772.1| ABC transporter G family member 3 [Morus notabilis]
Length=708

 Score = 71.2 bits (173),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 30/34 (88%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            L DY NKLIGGHCYMKGLP GERRR+SIARELVM
Sbjct  231  LSDYANKLIGGHCYMKGLPSGERRRVSIARELVM  264



>gb|AIU41645.1| ABC transporter family protein [Hevea brasiliensis]
Length=723

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 29/34 (85%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            L DY NKLIGGHCYMKG+P GERRR+SIARELVM
Sbjct  231  LSDYANKLIGGHCYMKGIPNGERRRVSIARELVM  264



>ref|XP_010043796.1| PREDICTED: ABC transporter G family member 3 [Eucalyptus grandis]
 gb|KCW85784.1| hypothetical protein EUGRSUZ_B02536 [Eucalyptus grandis]
Length=723

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 31/34 (91%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            LGDY NKLIGGHCYMKGL  GERRRISIARELVM
Sbjct  231  LGDYANKLIGGHCYMKGLRSGERRRISIARELVM  264



>ref|XP_006340222.1| PREDICTED: ABC transporter G family member 3-like [Solanum tuberosum]
Length=723

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/34 (88%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            LGDY NKLIGGHCYMKGL  GERRR+SIARELVM
Sbjct  231  LGDYANKLIGGHCYMKGLRSGERRRVSIARELVM  264



>ref|XP_004251157.1| PREDICTED: ABC transporter G family member 3 [Solanum lycopersicum]
 ref|XP_010313431.1| PREDICTED: ABC transporter G family member 3 [Solanum lycopersicum]
Length=723

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/34 (88%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            LGDY NKLIGGHCYMKGL  GERRR+SIARELVM
Sbjct  231  LGDYANKLIGGHCYMKGLRSGERRRVSIARELVM  264



>ref|XP_011040921.1| PREDICTED: ABC transporter G family member 3-like [Populus euphratica]
 ref|XP_011040922.1| PREDICTED: ABC transporter G family member 3-like [Populus euphratica]
 ref|XP_011040923.1| PREDICTED: ABC transporter G family member 3-like [Populus euphratica]
 ref|XP_011040924.1| PREDICTED: ABC transporter G family member 3-like [Populus euphratica]
Length=723

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/34 (88%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            L DY NKLIGGHCY KGLP GERRRISIARELVM
Sbjct  231  LSDYANKLIGGHCYFKGLPSGERRRISIARELVM  264



>ref|XP_006384936.1| hypothetical protein POPTR_0004s22390g [Populus trichocarpa]
 gb|ERP62733.1| hypothetical protein POPTR_0004s22390g [Populus trichocarpa]
Length=723

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/34 (88%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            L DY NKLIGGHCY KGLP GERRRISIARELVM
Sbjct  231  LSDYANKLIGGHCYFKGLPSGERRRISIARELVM  264



>gb|KHG09336.1| ABC transporter G family member 3 [Gossypium arboreum]
 gb|KHG16174.1| ABC transporter G family member 3 [Gossypium arboreum]
Length=648

 Score = 69.3 bits (168),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 28/34 (82%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            LGD+ NKLIGGHC+MKGLP GERRR++IARELVM
Sbjct  191  LGDFANKLIGGHCFMKGLPSGERRRVAIARELVM  224



>ref|XP_010689111.1| PREDICTED: ABC transporter G family member 3 [Beta vulgaris subsp. 
vulgaris]
Length=725

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 30/34 (88%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            LGDY NKLIGGHCYM+GL  GERRRISIARELVM
Sbjct  233  LGDYANKLIGGHCYMRGLRSGERRRISIARELVM  266



>ref|XP_011004785.1| PREDICTED: ABC transporter G family member 3-like [Populus euphratica]
Length=722

 Score = 68.9 bits (167),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 29/34 (85%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            L DY NKLIGGHCY KGLP GERRR+SIARELVM
Sbjct  230  LSDYANKLIGGHCYFKGLPSGERRRVSIARELVM  263



>ref|XP_002313530.2| hypothetical protein POPTR_0009s01380g [Populus trichocarpa]
 gb|EEE87485.2| hypothetical protein POPTR_0009s01380g [Populus trichocarpa]
Length=722

 Score = 68.9 bits (167),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 29/34 (85%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            L DY NKLIGGHCY KGLP GERRR+SIARELVM
Sbjct  230  LSDYANKLIGGHCYFKGLPSGERRRVSIARELVM  263



>gb|KHN37951.1| ABC transporter G family member 3 [Glycine soja]
Length=540

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 29/34 (85%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            LGD+ NKLIGGHCYMKGLP GERR +SIARELVM
Sbjct  231  LGDHANKLIGGHCYMKGLPSGERRLVSIARELVM  264



>ref|XP_010907036.1| PREDICTED: ABC transporter G family member 3 isoform X4 [Elaeis 
guineensis]
Length=634

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 29/34 (85%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            LGDY +KLIGGHCYMK LP GERRR+SIARELVM
Sbjct  233  LGDYADKLIGGHCYMKRLPSGERRRVSIARELVM  266



>ref|XP_010907035.1| PREDICTED: ABC transporter G family member 3 isoform X3 [Elaeis 
guineensis]
Length=643

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 29/34 (85%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            LGDY +KLIGGHCYMK LP GERRR+SIARELVM
Sbjct  233  LGDYADKLIGGHCYMKRLPSGERRRVSIARELVM  266



>ref|XP_010907033.1| PREDICTED: ABC transporter G family member 3 isoform X2 [Elaeis 
guineensis]
Length=696

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 29/34 (85%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            LGDY +KLIGGHCYMK LP GERRR+SIARELVM
Sbjct  233  LGDYADKLIGGHCYMKRLPSGERRRVSIARELVM  266



>ref|XP_006424500.1| hypothetical protein CICLE_v10027904mg [Citrus clementina]
 ref|XP_006424502.1| hypothetical protein CICLE_v10027904mg [Citrus clementina]
 gb|ESR37740.1| hypothetical protein CICLE_v10027904mg [Citrus clementina]
 gb|ESR37742.1| hypothetical protein CICLE_v10027904mg [Citrus clementina]
 gb|KDO60212.1| hypothetical protein CISIN_1g004932mg [Citrus sinensis]
Length=513

 Score = 68.2 bits (165),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 29/34 (85%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            L DY NKLIGGHCYMKGLP GERRR+ IARELVM
Sbjct  231  LSDYANKLIGGHCYMKGLPCGERRRVRIARELVM  264



>ref|XP_010907031.1| PREDICTED: ABC transporter G family member 3 isoform X1 [Elaeis 
guineensis]
 ref|XP_010907032.1| PREDICTED: ABC transporter G family member 3 isoform X1 [Elaeis 
guineensis]
Length=725

 Score = 68.6 bits (166),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 29/34 (85%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            LGDY +KLIGGHCYMK LP GERRR+SIARELVM
Sbjct  233  LGDYADKLIGGHCYMKRLPSGERRRVSIARELVM  266



>ref|XP_006424505.1| hypothetical protein CICLE_v10027904mg [Citrus clementina]
 gb|ESR37745.1| hypothetical protein CICLE_v10027904mg [Citrus clementina]
Length=390

 Score = 67.4 bits (163),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 29/34 (85%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            L DY NKLIGGHCYMKGLP GERRR+ IARELVM
Sbjct  231  LSDYANKLIGGHCYMKGLPCGERRRVRIARELVM  264



>gb|KHN21497.1| ABC transporter G family member 3 [Glycine soja]
Length=724

 Score = 68.6 bits (166),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 29/34 (85%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            LGD+ NKLIGGHCYMKGLP GERR +SIARELVM
Sbjct  231  LGDHANKLIGGHCYMKGLPSGERRLVSIARELVM  264



>ref|XP_007150161.1| hypothetical protein PHAVU_005G132000g [Phaseolus vulgaris]
 ref|XP_007150162.1| hypothetical protein PHAVU_005G132000g [Phaseolus vulgaris]
 ref|XP_007150163.1| hypothetical protein PHAVU_005G132000g [Phaseolus vulgaris]
 ref|XP_007150164.1| hypothetical protein PHAVU_005G132000g [Phaseolus vulgaris]
 gb|ESW22155.1| hypothetical protein PHAVU_005G132000g [Phaseolus vulgaris]
 gb|ESW22156.1| hypothetical protein PHAVU_005G132000g [Phaseolus vulgaris]
 gb|ESW22157.1| hypothetical protein PHAVU_005G132000g [Phaseolus vulgaris]
 gb|ESW22158.1| hypothetical protein PHAVU_005G132000g [Phaseolus vulgaris]
Length=724

 Score = 68.6 bits (166),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 29/34 (85%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            LGD+ NKLIGGHCYMKGLP GERR +SIARELVM
Sbjct  231  LGDHANKLIGGHCYMKGLPSGERRLVSIARELVM  264



>ref|XP_003543454.1| PREDICTED: ABC transporter G family member 3-like [Glycine max]
Length=724

 Score = 68.6 bits (166),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 29/34 (85%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            LGD+ NKLIGGHCYMKGLP GERR +SIARELVM
Sbjct  231  LGDHANKLIGGHCYMKGLPSGERRLVSIARELVM  264



>ref|XP_003540196.1| PREDICTED: ABC transporter G family member 3-like isoform X1 
[Glycine max]
 ref|XP_006592711.1| PREDICTED: ABC transporter G family member 3-like isoform X2 
[Glycine max]
 gb|KHN06870.1| ABC transporter G family member 3 [Glycine soja]
Length=724

 Score = 68.6 bits (166),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 29/34 (85%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            LGD+ NKLIGGHCYMKGLP GERR +SIARELVM
Sbjct  231  LGDHANKLIGGHCYMKGLPSGERRLVSIARELVM  264



>ref|XP_004487073.1| PREDICTED: ABC transporter G family member 3-like [Cicer arietinum]
Length=725

 Score = 68.6 bits (166),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 29/34 (85%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            LGD+ NKLIGGHCYMKGLP GERR +SIARELVM
Sbjct  232  LGDHANKLIGGHCYMKGLPSGERRLVSIARELVM  265



>ref|XP_003638054.1| White-brown-complex ABC transporter family [Medicago truncatula]
 gb|KEH39384.1| white-brown-complex ABC transporter family protein [Medicago 
truncatula]
Length=725

 Score = 68.6 bits (166),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 29/34 (85%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            LGD+ NKLIGGHCYMKGLP GERR +SIARELVM
Sbjct  232  LGDHANKLIGGHCYMKGLPSGERRLVSIARELVM  265



>gb|KDO60211.1| hypothetical protein CISIN_1g004932mg [Citrus sinensis]
Length=602

 Score = 68.2 bits (165),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 29/34 (85%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            L DY NKLIGGHCYMKGLP GERRR+ IARELVM
Sbjct  231  LSDYANKLIGGHCYMKGLPCGERRRVRIARELVM  264



>ref|XP_006833150.1| hypothetical protein AMTR_s00072p00119650 [Amborella trichopoda]
 gb|ERM98428.1| hypothetical protein AMTR_s00072p00119650 [Amborella trichopoda]
Length=718

 Score = 68.2 bits (165),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 29/34 (85%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            LGDY +KLIGGHC MK LPRGERRR+SIARELVM
Sbjct  232  LGDYSDKLIGGHCRMKSLPRGERRRVSIARELVM  265



>gb|KDO60210.1| hypothetical protein CISIN_1g004932mg [Citrus sinensis]
Length=641

 Score = 68.2 bits (165),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 29/34 (85%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            L DY NKLIGGHCYMKGLP GERRR+ IARELVM
Sbjct  231  LSDYANKLIGGHCYMKGLPCGERRRVRIARELVM  264



>gb|KDO60205.1| hypothetical protein CISIN_1g004932mg [Citrus sinensis]
 gb|KDO60206.1| hypothetical protein CISIN_1g004932mg [Citrus sinensis]
 gb|KDO60207.1| hypothetical protein CISIN_1g004932mg [Citrus sinensis]
 gb|KDO60208.1| hypothetical protein CISIN_1g004932mg [Citrus sinensis]
Length=723

 Score = 68.2 bits (165),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 29/34 (85%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            L DY NKLIGGHCYMKGLP GERRR+ IARELVM
Sbjct  231  LSDYANKLIGGHCYMKGLPCGERRRVRIARELVM  264



>ref|XP_006488036.1| PREDICTED: ABC transporter G family member 3-like isoform X1 
[Citrus sinensis]
 ref|XP_006488037.1| PREDICTED: ABC transporter G family member 3-like isoform X2 
[Citrus sinensis]
 ref|XP_006488038.1| PREDICTED: ABC transporter G family member 3-like isoform X3 
[Citrus sinensis]
Length=723

 Score = 68.2 bits (165),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 29/34 (85%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            L DY NKLIGGHCYMKGLP GERRR+ IARELVM
Sbjct  231  LSDYANKLIGGHCYMKGLPCGERRRVRIARELVM  264



>ref|XP_006424501.1| hypothetical protein CICLE_v10027904mg [Citrus clementina]
 ref|XP_006424503.1| hypothetical protein CICLE_v10027904mg [Citrus clementina]
 ref|XP_006424504.1| hypothetical protein CICLE_v10027904mg [Citrus clementina]
 gb|ESR37741.1| hypothetical protein CICLE_v10027904mg [Citrus clementina]
 gb|ESR37743.1| hypothetical protein CICLE_v10027904mg [Citrus clementina]
 gb|ESR37744.1| hypothetical protein CICLE_v10027904mg [Citrus clementina]
Length=723

 Score = 68.2 bits (165),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 29/34 (85%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            L DY NKLIGGHCYMKGLP GERRR+ IARELVM
Sbjct  231  LSDYANKLIGGHCYMKGLPCGERRRVRIARELVM  264



>ref|XP_008776879.1| PREDICTED: ABC transporter G family member 3 [Phoenix dactylifera]
 ref|XP_008776880.1| PREDICTED: ABC transporter G family member 3 [Phoenix dactylifera]
Length=725

 Score = 67.8 bits (164),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 28/34 (82%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            LGDY +KLIGGHCYMK LP GER+R+SIARELVM
Sbjct  233  LGDYADKLIGGHCYMKSLPSGERKRVSIARELVM  266



>ref|XP_009796613.1| PREDICTED: ABC transporter G family member 3-like isoform X2 
[Nicotiana sylvestris]
Length=706

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 29/34 (85%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            LGDY N LIGGHCYMKGL  GERRR+SIARELVM
Sbjct  231  LGDYANNLIGGHCYMKGLRSGERRRVSIARELVM  264



>ref|XP_009796612.1| PREDICTED: ABC transporter G family member 3-like isoform X1 
[Nicotiana sylvestris]
Length=723

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 29/34 (85%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            LGDY N LIGGHCYMKGL  GERRR+SIARELVM
Sbjct  231  LGDYANNLIGGHCYMKGLRSGERRRVSIARELVM  264



>ref|XP_009594129.1| PREDICTED: ABC transporter G family member 3-like [Nicotiana 
tomentosiformis]
Length=723

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 29/34 (85%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            LGDY N LIGGHCYMKGL  GERRR+SIARELVM
Sbjct  231  LGDYANNLIGGHCYMKGLRSGERRRVSIARELVM  264



>ref|XP_010496840.1| PREDICTED: ABC transporter G family member 3-like, partial [Camelina 
sativa]
Length=610

 Score = 67.0 bits (162),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 29/34 (85%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            L DY NKLIGGHCYMKGL  GERRR+SIARELVM
Sbjct  239  LSDYANKLIGGHCYMKGLRSGERRRVSIARELVM  272



>gb|EYU18798.1| hypothetical protein MIMGU_mgv1a0020231mg, partial [Erythranthe 
guttata]
Length=640

 Score = 67.0 bits (162),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 28/34 (82%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            LGDY NKLIGGHCYMKGL  GE+RR++IARELVM
Sbjct  233  LGDYANKLIGGHCYMKGLRSGEKRRVTIARELVM  266



>ref|XP_010470153.1| PREDICTED: ABC transporter G family member 3-like [Camelina sativa]
Length=733

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 29/34 (85%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            L DY NKLIGGHCYMKGL  GERRR+SIARELVM
Sbjct  242  LSDYANKLIGGHCYMKGLRSGERRRVSIARELVM  275



>ref|XP_010414603.1| PREDICTED: ABC transporter G family member 3-like isoform X2 
[Camelina sativa]
Length=734

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 29/34 (85%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            L DY NKLIGGHCYMKGL  GERRR+SIARELVM
Sbjct  243  LSDYANKLIGGHCYMKGLRSGERRRVSIARELVM  276



>ref|XP_010414602.1| PREDICTED: ABC transporter G family member 3-like isoform X1 
[Camelina sativa]
Length=739

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 29/34 (85%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            L DY NKLIGGHCYMKGL  GERRR+SIARELVM
Sbjct  248  LSDYANKLIGGHCYMKGLRSGERRRVSIARELVM  281



>ref|XP_006293759.1| hypothetical protein CARUB_v10022719mg [Capsella rubella]
 gb|EOA26657.1| hypothetical protein CARUB_v10022719mg [Capsella rubella]
Length=730

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 29/34 (85%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            L DY NKLIGGHCYMKGL  GERRR+SIARELVM
Sbjct  239  LSDYANKLIGGHCYMKGLRSGERRRVSIARELVM  272



>ref|XP_010510699.1| PREDICTED: ABC transporter G family member 3 [Camelina sativa]
Length=730

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 29/34 (85%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            L DY NKLIGGHCYMKGL  GERRR+SIARELVM
Sbjct  239  LSDYANKLIGGHCYMKGLRSGERRRVSIARELVM  272



>ref|XP_002880954.1| abc transporter family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57213.1| abc transporter family protein [Arabidopsis lyrata subsp. lyrata]
Length=730

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 29/34 (85%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            L DY NKLIGGHCYMKGL  GERRR+SIARELVM
Sbjct  239  LSDYANKLIGGHCYMKGLRSGERRRVSIARELVM  272



>ref|NP_850111.1| ABC transporter G family member 3 [Arabidopsis thaliana]
 sp|Q9ZUU9.2|AB3G_ARATH RecName: Full=ABC transporter G family member 3; Short=ABC transporter 
ABCG.3; Short=AtABCG3; AltName: Full=White-brown complex 
homolog protein 3; Short=AtWBC3 [Arabidopsis thaliana]
 gb|AEC08075.1| ABC transporter G family member 3 [Arabidopsis thaliana]
Length=730

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 29/34 (85%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            L DY NKLIGGHCYMKGL  GERRR+SIARELVM
Sbjct  239  LSDYANKLIGGHCYMKGLRSGERRRVSIARELVM  272



>emb|CDY04533.1| BnaA07g13590D [Brassica napus]
Length=816

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 29/34 (85%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            L DY NKLIGGHCYMKGL  GERRR+SIARELVM
Sbjct  324  LSDYANKLIGGHCYMKGLRSGERRRVSIARELVM  357



>ref|XP_006409825.1| hypothetical protein EUTSA_v10016313mg [Eutrema salsugineum]
 gb|ESQ51278.1| hypothetical protein EUTSA_v10016313mg [Eutrema salsugineum]
Length=725

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 29/34 (85%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            L DY NKLIGGHCYMKGL  GERRR+SIARELVM
Sbjct  238  LSDYANKLIGGHCYMKGLRSGERRRVSIARELVM  271



>ref|XP_009103641.1| PREDICTED: ABC transporter G family member 3 [Brassica rapa]
Length=732

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 29/34 (85%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            L DY NKLIGGHCYMKGL  GERRR+SIARELVM
Sbjct  240  LSDYANKLIGGHCYMKGLRSGERRRVSIARELVM  273



>emb|CDX71393.1| BnaC04g16280D [Brassica napus]
Length=798

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 29/34 (85%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            L DY NKLIGGHCYMKGL  GERRR+SIARELVM
Sbjct  307  LSDYANKLIGGHCYMKGLRSGERRRVSIARELVM  340



>gb|AAC98459.1| putative ABC transporter [Arabidopsis thaliana]
 gb|AAM15328.1| putative ABC transporter [Arabidopsis thaliana]
Length=705

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 29/34 (85%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            L DY NKLIGGHCYMKGL  GERRR+SIARELVM
Sbjct  239  LSDYANKLIGGHCYMKGLRSGERRRVSIARELVM  272



>ref|XP_006652051.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter G family member 
3-like [Oryza brachyantha]
Length=695

 Score = 66.2 bits (160),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 28/34 (82%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            LGDY +KLIGGHC+MK LP GERRR+SIARELVM
Sbjct  194  LGDYADKLIGGHCFMKRLPTGERRRLSIARELVM  227



>ref|XP_006347197.1| PREDICTED: ABC transporter G family member 3-like isoform X2 
[Solanum tuberosum]
Length=545

 Score = 65.9 bits (159),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 28/34 (82%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            LGDY NKLIGG+CYM+GL  GERRR+SIARELVM
Sbjct  53   LGDYANKLIGGNCYMRGLRSGERRRVSIARELVM  86



>ref|XP_004288095.1| PREDICTED: ABC transporter G family member 3-like [Fragaria vesca 
subsp. vesca]
Length=723

 Score = 65.9 bits (159),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 28/34 (82%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            LGD  ++LIGGHCYMKGLP GERRRI IARELVM
Sbjct  231  LGDCADRLIGGHCYMKGLPNGERRRIGIARELVM  264



>ref|XP_006347196.1| PREDICTED: ABC transporter G family member 3-like isoform X1 
[Solanum tuberosum]
Length=723

 Score = 65.9 bits (159),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 28/34 (82%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            LGDY NKLIGG+CYM+GL  GERRR+SIARELVM
Sbjct  231  LGDYANKLIGGNCYMRGLRSGERRRVSIARELVM  264



>ref|XP_002523691.1| ATP-binding cassette transporter, putative [Ricinus communis]
 gb|EEF38631.1| ATP-binding cassette transporter, putative [Ricinus communis]
Length=722

 Score = 65.5 bits (158),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 28/34 (82%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            L DY NKLIGGHCYMKGL  GERRR+S+ARELVM
Sbjct  231  LTDYANKLIGGHCYMKGLRNGERRRVSMARELVM  264



>ref|XP_004980962.1| PREDICTED: ABC transporter G family member 3-like [Setaria italica]
Length=722

 Score = 65.1 bits (157),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 27/34 (79%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            LGD+ +KLIGGHC+MK LP GERRR+SIARELVM
Sbjct  226  LGDHADKLIGGHCFMKRLPNGERRRVSIARELVM  259



>ref|XP_010322410.1| PREDICTED: ABC transporter G family member 3-like isoform X3 
[Solanum lycopersicum]
Length=553

 Score = 64.3 bits (155),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/34 (82%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            LGDY NKLIGG+CY KGL  GERRR+SIARELVM
Sbjct  61   LGDYANKLIGGNCYTKGLRSGERRRVSIARELVM  94



>ref|XP_010322409.1| PREDICTED: ABC transporter G family member 3-like isoform X2 
[Solanum lycopersicum]
Length=611

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/34 (82%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            LGDY NKLIGG+CY KGL  GERRR+SIARELVM
Sbjct  231  LGDYANKLIGGNCYTKGLRSGERRRVSIARELVM  264



>ref|XP_004241287.1| PREDICTED: ABC transporter G family member 3-like isoform X1 
[Solanum lycopersicum]
 ref|XP_010322408.1| PREDICTED: ABC transporter G family member 3-like isoform X1 
[Solanum lycopersicum]
Length=723

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/34 (82%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            LGDY NKLIGG+CY KGL  GERRR+SIARELVM
Sbjct  231  LGDYANKLIGGNCYTKGLRSGERRRVSIARELVM  264



>ref|XP_009384039.1| PREDICTED: ABC transporter G family member 3 [Musa acuminata 
subsp. malaccensis]
Length=725

 Score = 63.2 bits (152),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            LGD+ + LIGGHCY K LP GERRR+SIARELVM
Sbjct  233  LGDFADSLIGGHCYTKSLPSGERRRVSIARELVM  266



>ref|XP_009356904.1| PREDICTED: ABC transporter G family member 3 [Pyrus x bretschneideri]
Length=723

 Score = 62.8 bits (151),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 27/34 (79%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            LGD  NKLIGG+C MKGLP G+RRR+SIARELVM
Sbjct  231  LGDCANKLIGGYCLMKGLPNGDRRRVSIARELVM  264



>ref|XP_009376081.1| PREDICTED: ABC transporter G family member 3-like [Pyrus x bretschneideri]
 ref|XP_009376082.1| PREDICTED: ABC transporter G family member 3-like [Pyrus x bretschneideri]
Length=723

 Score = 62.4 bits (150),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 27/34 (79%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            LGD  NKLIGG+C MKGLP G+RRR+SIARELVM
Sbjct  231  LGDCANKLIGGYCNMKGLPNGDRRRVSIARELVM  264



>ref|XP_008355191.1| PREDICTED: ABC transporter G family member 3-like [Malus domestica]
 ref|XP_008355192.1| PREDICTED: ABC transporter G family member 3-like [Malus domestica]
Length=723

 Score = 62.4 bits (150),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 27/34 (79%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            LGD  NKLIGG+C MKGLP G+RRR+SIARELVM
Sbjct  231  LGDCANKLIGGYCNMKGLPNGDRRRVSIARELVM  264



>ref|XP_008385361.1| PREDICTED: ABC transporter G family member 3-like isoform X1 
[Malus domestica]
Length=341

 Score = 61.6 bits (148),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 27/34 (79%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            LGD  NKLIGG+C MKGLP G+RRR+SIARELVM
Sbjct  231  LGDCANKLIGGYCLMKGLPNGDRRRVSIARELVM  264



>ref|XP_007208059.1| hypothetical protein PRUPE_ppa002046mg [Prunus persica]
 gb|EMJ09258.1| hypothetical protein PRUPE_ppa002046mg [Prunus persica]
Length=724

 Score = 62.4 bits (150),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 27/34 (79%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            LGD  NKLIGG+C+MKGL  GERRR+SIARELVM
Sbjct  231  LGDCSNKLIGGYCFMKGLSNGERRRVSIARELVM  264



>gb|EMS56912.1| ABC transporter G family member 3 [Triticum urartu]
Length=644

 Score = 62.4 bits (150),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            LGD+ +KLIGGHC+ K LP GERRR+SIARELVM
Sbjct  118  LGDHADKLIGGHCFTKRLPTGERRRVSIARELVM  151



>emb|CDX77150.1| BnaC04g39450D [Brassica napus]
Length=730

 Score = 62.0 bits (149),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 29/35 (83%), Positives = 30/35 (86%), Gaps = 1/35 (3%)
 Frame = +2

Query  2    LGDYGNKLIGG-HCYMKGLPRGERRRISIARELVM  103
            L DY NKLIGG HCYMKGL  GERRR+SIARELVM
Sbjct  240  LSDYANKLIGGGHCYMKGLRSGERRRVSIARELVM  274



>ref|XP_008226268.1| PREDICTED: ABC transporter G family member 3 [Prunus mume]
Length=709

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/34 (79%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            L D  NKLIGG+CYMKGL  GERRR+SIARELVM
Sbjct  216  LDDCSNKLIGGYCYMKGLSNGERRRVSIARELVM  249



>ref|XP_003558482.2| PREDICTED: ABC transporter G family member 3 [Brachypodium distachyon]
Length=722

 Score = 59.7 bits (143),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            LGDY +KLIGGH + K LP GERRR+SIARELVM
Sbjct  222  LGDYADKLIGGHFFSKSLPTGERRRVSIARELVM  255



>ref|XP_008661134.1| PREDICTED: uncharacterized protein LOC100194127 isoform X2 [Zea 
mays]
 gb|ACN31991.1| unknown [Zea mays]
 tpg|DAA52601.1| TPA: hypothetical protein ZEAMMB73_610923 [Zea mays]
Length=722

 Score = 59.7 bits (143),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            LGD+ +KLIGG+C+M  LP GERRR+SIARELVM
Sbjct  225  LGDHADKLIGGNCFMTRLPTGERRRVSIARELVM  258



>ref|XP_008661082.1| PREDICTED: uncharacterized protein LOC100194127 isoform X1 [Zea 
mays]
Length=723

 Score = 59.7 bits (143),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            LGD+ +KLIGG+C+M  LP GERRR+SIARELVM
Sbjct  225  LGDHADKLIGGNCFMTRLPTGERRRVSIARELVM  258



>gb|EEC76581.1| hypothetical protein OsI_14426 [Oryza sativa Indica Group]
Length=679

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            L DY + LIGGHC++  LP GERRR+SIARELVM
Sbjct  222  LADYADNLIGGHCFINSLPAGERRRLSIARELVM  255



>gb|AAP44750.1| putative ABC transporter [Oryza sativa Japonica Group]
Length=687

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            L DY + LIGGHC++  LP GERRR+SIARELVM
Sbjct  222  LADYADNLIGGHCFINSLPAGERRRLSIARELVM  255



>gb|EEE60340.1| hypothetical protein OsJ_13450 [Oryza sativa Japonica Group]
Length=505

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            L DY + LIGGHC++  LP GERRR+SIARELVM
Sbjct  222  LADYADNLIGGHCFINSLPAGERRRLSIARELVM  255



>ref|NP_001051967.2| Os03g0859500 [Oryza sativa Japonica Group]
 gb|ABG00010.1| ABC transporter family protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAG92069.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF13881.2| Os03g0859500 [Oryza sativa Japonica Group]
Length=719

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            L DY + LIGGHC++  LP GERRR+SIARELVM
Sbjct  222  LADYADNLIGGHCFINSLPAGERRRLSIARELVM  255



>emb|CDY30512.1| BnaA04g16210D [Brassica napus]
Length=413

 Score = 58.2 bits (139),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 29/35 (83%), Gaps = 1/35 (3%)
 Frame = +2

Query  2    LGDYGNKLIGG-HCYMKGLPRGERRRISIARELVM  103
            L DY NKLIGG  CYMKGL  GERRR+SIARELVM
Sbjct  242  LSDYANKLIGGGDCYMKGLRSGERRRVSIARELVM  276



>ref|XP_002463469.1| hypothetical protein SORBIDRAFT_01g000400 [Sorghum bicolor]
 gb|EER90467.1| hypothetical protein SORBIDRAFT_01g000400 [Sorghum bicolor]
Length=722

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    LGDYGNKLIGGHCYMKGLPRGERRRISIARELVM  103
            L D+ +KLIGG+C+MK LP GERRR+SIARELVM
Sbjct  226  LCDHADKLIGGNCFMKRLPTGERRRVSIARELVM  259



>gb|EPS67634.1| hypothetical protein M569_07144, partial [Genlisea aurea]
Length=253

 Score = 49.7 bits (117),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 29/35 (83%), Gaps = 1/35 (3%)
 Frame = +2

Query  2    LGDYGNKLIGGHC-YMKGLPRGERRRISIARELVM  103
            LGD  +KLIGG C Y +GLP GERRR++IAREL+M
Sbjct  204  LGDCADKLIGGGCCYTRGLPSGERRRVAIARELIM  238



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 527207176184