BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c108043_g1_i1 len=454 path=[432:0-453]

Length=454
                                                                      Score     E

ref|XP_009595423.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    145   2e-39   
gb|AHW50682.1|  phosphoenolpyruvate carboxylase kinase                  145   2e-39   
gb|AAF19402.1|AF203480_1  phosphoenolpyruvate carboxylase kinase        144   5e-39   Solanum lycopersicum
ref|NP_001234394.1|  phosphoenolpyruvate carboxylase kinase             144   6e-39   
ref|XP_009788812.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    142   2e-38   
ref|NP_001275162.1|  PEP carboxylase kinase                             140   1e-37   
gb|AAQ10029.1|  PEPC kinase 1b                                          140   1e-37   Solanum tuberosum [potatoes]
dbj|BAB71853.1|  phosphoenolpyruvate carboxylase kinase                 139   3e-37   Flaveria trinervia
ref|XP_004236793.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    139   4e-37   
gb|ADY38796.1|  phosphoenolpyruvate carboxylase kinase                  139   4e-37   
ref|XP_006361431.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    139   5e-37   
ref|XP_009771066.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    138   8e-37   
emb|CDO99979.1|  unnamed protein product                                138   1e-36   
dbj|BAF48321.1|  phosphoenolpyruvate carboxylase kinase                 137   2e-36   Flaveria bidentis
gb|EYU33158.1|  hypothetical protein MIMGU_mgv1a011495mg                137   3e-36   
ref|XP_009599299.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    136   5e-36   
ref|XP_009621492.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    136   5e-36   
ref|XP_011077233.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    135   2e-35   
ref|XP_009799313.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    134   4e-35   
gb|ABZ89189.1|  hypothetical protein 46C02.15                           133   8e-35   Coffea canephora [robusta coffee]
gb|ADZ55307.1|  phosphoenolpyruvate carboxylase kinase                  133   1e-34   
gb|KDP23706.1|  hypothetical protein JCGZ_23539                         132   2e-34   
ref|XP_010274773.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    131   4e-34   
ref|XP_009790267.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    130   6e-34   
ref|XP_002521969.1|  calcium-dependent protein kinase, putative         127   6e-34   Ricinus communis
gb|EYU19883.1|  hypothetical protein MIMGU_mgv1a011726mg                129   2e-33   
ref|XP_002285162.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    129   2e-33   Vitis vinifera
emb|CAN72597.1|  hypothetical protein VITISV_015543                     129   2e-33   Vitis vinifera
ref|XP_010675055.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    129   2e-33   
ref|XP_006487723.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    129   3e-33   
ref|XP_010262311.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    129   3e-33   
ref|XP_009765234.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    129   4e-33   
ref|XP_010102238.1|  Phosphoenolpyruvate carboxylase kinase 1           128   5e-33   
ref|XP_007030432.1|  Phosphoenolpyruvate carboxylase kinase 1           128   6e-33   
ref|XP_002325771.2|  phosphoenolpyruvate-carboxylase kinase famil...    128   6e-33   Populus trichocarpa [western balsam poplar]
ref|XP_011036288.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    128   6e-33   
ref|XP_011036287.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    128   7e-33   
ref|XP_006350688.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    128   7e-33   
gb|KDO41194.1|  hypothetical protein CISIN_1g023898mg                   127   8e-33   
gb|AAO61489.1|  phosphoenolpyruvate carboxylase kinase 1                127   9e-33   Solanum tuberosum [potatoes]
gb|KHG11424.1|  Phosphoenolpyruvate carboxylase kinase 1 -like pr...    127   1e-32   
ref|NP_001238645.1|  phosphoenolpyruvate-carboxylase kinase             127   2e-32   
ref|XP_004495570.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    126   3e-32   
ref|XP_010043286.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    126   3e-32   
emb|CAL25341.1|  phosphoenolpyruvate carboxylase kinase                 120   4e-32   Platanus x hispanica [London plane tree]
ref|XP_006442697.1|  hypothetical protein CICLE_v10020693mg             126   4e-32   
ref|NP_001234304.1|  phosphoenolpyruvate carboxylase kinase 2           126   4e-32   
ref|XP_009601335.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    125   5e-32   
ref|XP_006354488.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    125   6e-32   
ref|XP_007144008.1|  hypothetical protein PHAVU_007G121500g             124   1e-31   
ref|XP_004302084.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    124   1e-31   
ref|XP_008218512.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    124   2e-31   
ref|XP_004247730.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    123   4e-31   
ref|NP_001236660.1|  phosphoenolpyruvate carboxylase kinase             123   4e-31   
gb|ABO65213.1|  phosphoenolpyruvate carboxylase kinase                  123   6e-31   Kalanchoe pinnata [airplant]
gb|AAN12513.1|  phosphoenolpyruvate carboxylase kinase                  122   1e-30   Glycine max [soybeans]
emb|CBI22394.3|  unnamed protein product                                120   2e-30   
gb|AAF05112.1|AF158091_1  phosphoenolpyruvate carboxylase-kinase        121   2e-30   Mesembryanthemum crystallinum
ref|XP_008350641.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    117   2e-30   
emb|CAN74792.1|  hypothetical protein VITISV_001997                     121   2e-30   Vitis vinifera
ref|XP_007205705.1|  hypothetical protein PRUPE_ppa009865mg             121   2e-30   
ref|XP_002265952.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    121   3e-30   Vitis vinifera
ref|XP_011038521.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    121   3e-30   
gb|AIR93786.1|  phosphoenolpyruvate carboxylase kinase                  120   4e-30   
ref|XP_004305051.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    120   6e-30   
ref|XP_008785247.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    120   7e-30   
ref|XP_008224360.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    120   7e-30   
ref|XP_007035108.1|  Phosphoenolpyruvate carboxylase kinase 1, pu...    120   8e-30   
ref|XP_010550413.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    120   9e-30   
ref|XP_007222516.1|  hypothetical protein PRUPE_ppa009846mg             119   2e-29   
ref|XP_003590952.1|  Calcium-dependent protein kinase                   119   2e-29   
ref|XP_006649148.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    118   2e-29   
ref|XP_004142534.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    119   2e-29   
gb|ABO65214.1|  phosphoenolpyruvate carboxylase kinase                  118   2e-29   Kalanchoe daigremontiana
ref|XP_010934324.1|  PREDICTED: LOW QUALITY PROTEIN: phosphoenolp...    118   3e-29   
ref|XP_002319653.1|  phosphoenolpyruvate-carboxylase kinase famil...    117   5e-29   Populus trichocarpa [western balsam poplar]
ref|XP_008352306.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    115   6e-29   
ref|XP_008791584.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    117   6e-29   
ref|XP_009373992.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    117   9e-29   
dbj|BAC20362.1|  phosphoenolpyruvate carboxylase kinase                 117   9e-29   Lotus japonicus
ref|XP_008388711.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    116   2e-28   
ref|XP_010104734.1|  Phosphoenolpyruvate carboxylase kinase 1           116   2e-28   
ref|XP_010910900.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    116   2e-28   
ref|XP_008462700.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    116   2e-28   
gb|KHN01069.1|  Phosphoenolpyruvate carboxylase kinase 1                114   3e-28   
ref|XP_004297821.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    115   4e-28   
ref|XP_008438527.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    115   5e-28   
ref|XP_009398974.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    115   6e-28   
gb|EAY87934.1|  hypothetical protein OsI_09358                          115   7e-28   Oryza sativa Indica Group [Indian rice]
ref|NP_001048452.1|  Os02g0807000                                       115   7e-28   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006298293.1|  hypothetical protein CARUB_v10014357mg             114   8e-28   
ref|NP_001237016.1|  phosphoenolpyruvate-carboxylase kinase             114   8e-28   
ref|XP_004134067.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    114   9e-28   
ref|XP_004954289.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    114   1e-27   
ref|XP_011073525.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    114   1e-27   
ref|XP_009339620.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    114   1e-27   
ref|XP_010519961.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    114   1e-27   
gb|AFK48265.1|  unknown                                                 114   1e-27   
ref|XP_009388072.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    114   1e-27   
gb|KDP40328.1|  hypothetical protein JCGZ_02326                         114   1e-27   
gb|EPS58774.1|  hypothetical protein M569_16039                         114   1e-27   
ref|NP_172341.1|  phosphoenolpyruvate carboxylase kinase 1              114   2e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003572921.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    114   2e-27   
ref|XP_002889707.1|  hypothetical protein ARALYDRAFT_888100             114   2e-27   
emb|CDX95043.1|  BnaC05g06280D                                          114   2e-27   
ref|XP_010023952.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    114   2e-27   
ref|XP_010475673.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    113   4e-27   
ref|XP_010489225.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    113   4e-27   
ref|XP_010458110.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    113   4e-27   
dbj|BAJ86963.1|  predicted protein                                      110   6e-27   
ref|XP_009397678.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    112   7e-27   
ref|XP_010485831.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    112   8e-27   
ref|XP_006417662.1|  hypothetical protein EUTSA_v10008405mg             112   8e-27   
ref|XP_010906537.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    112   9e-27   
emb|CDX93546.1|  BnaA06g05020D                                          112   1e-26   
ref|XP_009148120.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    112   1e-26   
ref|XP_009399471.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    112   1e-26   
gb|EYU32551.1|  hypothetical protein MIMGU_mgv1a011841mg                110   2e-26   
ref|NP_001105808.1|  phosphoenolpyruvate carboxylase kinase 1           110   2e-26   Zea mays [maize]
ref|NP_001151917.1|  calcium-dependent protein kinase, isoform AK1      110   2e-26   Zea mays [maize]
ref|XP_007144083.1|  hypothetical protein PHAVU_007G127200g             110   2e-26   
ref|XP_010463932.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    110   3e-26   
gb|AAF06969.1|AF162661_1  phosphoenolpyruvate carboxylase kinase        110   3e-26   Kalanchoe fedtschenkoi [lavender-scallops]
ref|XP_011030503.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    110   4e-26   
emb|CDO99228.1|  unnamed protein product                                110   4e-26   
ref|XP_006378339.1|  hypothetical protein POPTR_0010s08220g             110   4e-26   
ref|XP_009399472.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    110   4e-26   
ref|XP_010553779.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    109   6e-26   
dbj|BAK02595.1|  predicted protein                                      109   7e-26   
ref|XP_006305485.1|  hypothetical protein CARUB_v10009932mg             109   1e-25   
gb|ACG40535.1|  calcium-dependent protein kinase, isoform AK1           108   1e-25   Zea mays [maize]
dbj|BAE80227.1|  phosphoenolpyruvate carboxylase kinase                 108   1e-25   Oryza sativa Japonica Group [Japonica rice]
gb|AAR31831.1|  phosphoenolpyruvate carboxylase kinase 2                108   1e-25   Clusia minor [cupey de monte]
gb|ACF87767.1|  unknown                                                 108   1e-25   Zea mays [maize]
ref|XP_002882359.1|  phosphoenolpyruvate carboxylase kinase 2           108   1e-25   
ref|XP_010023950.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    108   2e-25   
ref|XP_011029828.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    108   2e-25   
ref|XP_010274775.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    108   2e-25   
gb|AAR31830.1|  phosphoenolpyruvate carboxylase kinase 1                107   3e-25   Clusia minor [cupey de monte]
gb|KFK37868.1|  phosphoenolpyruvate carboxylase kinase                  108   3e-25   
ref|XP_010553778.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    107   3e-25   
ref|XP_006379898.1|  hypothetical protein POPTR_0008s16640g             107   3e-25   
ref|NP_566229.1|  phosphoenolpyruvate carboxylase kinase 2              107   3e-25   Arabidopsis thaliana [mouse-ear cress]
gb|AAK43710.1|AF358915_1  phosphoenolpyruvate carboxylase kinase 2      107   4e-25   Arabidopsis thaliana [mouse-ear cress]
emb|CDY64699.1|  BnaCnng44550D                                          107   4e-25   
ref|XP_007147221.1|  hypothetical protein PHAVU_006G105900g             107   5e-25   
gb|ABD39238.1|  phosphoenolpyruvate carboxylase kinase 1                107   7e-25   Sorghum bicolor [broomcorn]
ref|XP_006653602.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    104   7e-25   
ref|XP_002454746.1|  hypothetical protein SORBIDRAFT_04g036570          107   7e-25   Sorghum bicolor [broomcorn]
ref|XP_002531530.1|  calcium-dependent protein kinase, putative         106   1e-24   Ricinus communis
ref|XP_006408181.1|  hypothetical protein EUTSA_v10021288mg             106   1e-24   
gb|KFK43166.1|  hypothetical protein AALP_AA1G088400                    106   1e-24   
emb|CDY49329.1|  BnaA05g32910D                                          105   2e-24   
ref|NP_001105774.1|  phosphoenolpyruvate carboxylase kinase 4           105   2e-24   Zea mays [maize]
emb|CDY46740.1|  BnaCnng14430D                                          105   2e-24   
gb|ACF87617.1|  unknown                                                 105   2e-24   Zea mays [maize]
ref|XP_009110877.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    105   2e-24   
ref|XP_006846828.1|  hypothetical protein AMTR_s00148p00097360          105   3e-24   
ref|XP_009389066.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    105   3e-24   
ref|XP_004976235.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    105   3e-24   
dbj|BAJ86282.1|  predicted protein                                      105   4e-24   
ref|XP_008668658.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    105   4e-24   
ref|XP_008668659.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    105   4e-24   
ref|XP_008668657.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    105   4e-24   
ref|XP_009123980.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    104   5e-24   
ref|XP_003575394.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    104   5e-24   
ref|XP_006648852.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    102   6e-24   
ref|XP_002446790.1|  hypothetical protein SORBIDRAFT_06g022690          104   7e-24   Sorghum bicolor [broomcorn]
emb|CDY68533.1|  BnaA08g31670D                                          104   8e-24   
ref|XP_009601338.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    103   1e-23   
gb|EMS59439.1|  Phosphoenolpyruvate carboxylase kinase 1                101   1e-23   
ref|XP_004302083.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    103   2e-23   
ref|XP_006420218.1|  hypothetical protein CICLE_v10005624mg             102   2e-23   
gb|EMT33229.1|  Calcium-dependent protein kinase 33                     101   2e-23   
ref|XP_006442696.1|  hypothetical protein CICLE_v10020693mg             102   5e-23   
dbj|BAE80213.1|  phosphoenolpyruvate carboxylase kinase                 101   7e-23   Oryza sativa Japonica Group [Japonica rice]
dbj|BAE80214.1|  phosphoenolpyruvate carboxylase kinase                 101   8e-23   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ84853.1|  predicted protein                                      101   8e-23   
gb|AFW63059.1|  putative phosphoenolpyruvate carboxylase kinase f...    100   1e-22   
ref|XP_003580142.1|  PREDICTED: phosphoenolpyruvate carboxylase k...    100   3e-22   
ref|XP_002452476.1|  hypothetical protein SORBIDRAFT_04g026490          100   3e-22   Sorghum bicolor [broomcorn]
gb|EMS53046.1|  Phosphoenolpyruvate carboxylase kinase 2              95.9    3e-22   
gb|KHN35323.1|  Phosphoenolpyruvate carboxylase kinase 2              99.0    4e-22   
gb|AAF19401.1|AF203479_1  phosphoenolpyruvate carboxylase kinase      99.4    4e-22   Glycine max [soybeans]
ref|NP_001105772.1|  phosphoenolpyruvate carboxylase kinase 2         99.4    4e-22   Zea mays [maize]
ref|NP_001241581.1|  phosphoenolpyruvate carboxylase kinase           99.4    5e-22   
gb|AFW72402.1|  putative phosphoenolpyruvate carboxylase kinase f...  98.6    1e-21   
ref|NP_001105773.1|  phosphoenolpyruvate carboxylase kinase 3         98.6    1e-21   Zea mays [maize]
gb|EEC74202.1|  hypothetical protein OsI_09360                        97.8    1e-21   Oryza sativa Indica Group [Indian rice]
ref|XP_004953151.1|  PREDICTED: phosphoenolpyruvate carboxylase k...  97.8    2e-21   
ref|NP_001184941.1|  phosphoenolpyruvate carboxylase kinase 1         95.9    6e-21   
gb|ABK22812.1|  unknown                                               95.9    8e-21   Picea sitchensis
ref|XP_008362057.1|  PREDICTED: phosphoenolpyruvate carboxylase k...  95.5    9e-21   
gb|AAF99758.1|AC003981_8  F22O13.13                                   95.5    9e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010023951.1|  PREDICTED: phosphoenolpyruvate carboxylase k...  95.5    9e-21   
ref|XP_010671036.1|  PREDICTED: phosphoenolpyruvate carboxylase k...  95.5    1e-20   
gb|AFW73950.1|  putative phosphoenolpyruvate carboxylase kinase f...  95.5    1e-20   
gb|AAF63784.1|  phosphoenolpyruvate carboxylase kinase, putative      95.1    2e-20   Arabidopsis thaliana [mouse-ear cress]
gb|ABR17452.1|  unknown                                               94.7    2e-20   Picea sitchensis
gb|EMS53047.1|  Phosphoenolpyruvate carboxylase kinase 1              94.7    2e-20   
gb|AAK98691.1|AC069158_3  Putative phosphoenolpyruvate kinase         95.1    2e-20   Oryza sativa [red rice]
ref|XP_010023949.1|  PREDICTED: phosphoenolpyruvate carboxylase k...  94.7    2e-20   
gb|AAF04907.1|AC011437_22  putative calmodulin-domain protein kin...  94.0    3e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011029830.1|  PREDICTED: phosphoenolpyruvate carboxylase k...  94.4    3e-20   
gb|ABK26672.1|  unknown                                               91.3    4e-19   Picea sitchensis
ref|XP_003626482.1|  Calcium-dependent protein kinase                 90.1    8e-19   
gb|AEW07693.1|  hypothetical protein 0_9122_01                        87.8    9e-19   
dbj|BAD23784.1|  putative phosphoenolpyruvate carboxylase kinase      89.7    1e-18   Oryza sativa Japonica Group [Japonica rice]
tpg|DAA36995.1|  TPA: putative phosphoenolpyruvate carboxylase ki...  89.0    2e-18   
dbj|BAJ93189.1|  predicted protein                                    82.8    3e-17   
ref|NP_001053321.1|  Os04g0517500                                     84.7    6e-17   Oryza sativa Japonica Group [Japonica rice]
gb|EPS73723.1|  hypothetical protein M569_01033                       86.3    7e-17   
ref|XP_004976234.1|  PREDICTED: phosphoenolpyruvate carboxylase k...  84.7    8e-17   
ref|XP_010910901.1|  PREDICTED: phosphoenolpyruvate carboxylase k...  83.6    1e-16   
gb|EMT22125.1|  hypothetical protein F775_43471                       84.3    2e-16   
ref|NP_001047478.2|  Os02g0625300                                     83.6    2e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007145769.1|  hypothetical protein PHAVU_007G266100g           85.5    3e-16   
gb|AFW72403.1|  putative phosphoenolpyruvate carboxylase kinase f...  83.2    4e-16   
gb|ADE77630.1|  unknown                                               80.5    5e-16   
gb|AFW63060.1|  putative phosphoenolpyruvate carboxylase kinase f...  82.4    5e-16   
ref|XP_007018143.1|  Phosphoenolpyruvate carboxylase-related kina...  83.6    9e-16   
ref|XP_007018144.1|  Phosphoenolpyruvate carboxylase-related kina...  83.2    1e-15   
ref|XP_008234302.1|  PREDICTED: calcium-dependent protein kinase ...  83.2    1e-15   
ref|XP_004497629.1|  PREDICTED: calcium-dependent protein kinase ...  82.8    2e-15   
emb|CDY21060.1|  BnaA08g24650D                                        82.0    2e-15   
ref|XP_007028039.1|  Calcium dependent protein kinase 1               82.8    3e-15   
emb|CDP19110.1|  unnamed protein product                              77.4    3e-15   
ref|XP_009110630.1|  PREDICTED: serine/threonine-protein kinase P...  81.6    3e-15   
gb|EAZ23870.1|  hypothetical protein OsJ_07587                        80.1    4e-15   Oryza sativa Japonica Group [Japonica rice]
emb|CDX98048.1|  BnaA06g07990D                                        81.3    5e-15   
ref|XP_009383151.1|  PREDICTED: calcium-dependent protein kinase ...  81.6    5e-15   
emb|CDY57079.1|  BnaCnng31590D                                        81.3    6e-15   
gb|KHG01181.1|  Serine/threonine-protein kinase PEPKR2                81.3    6e-15   
ref|XP_008377036.1|  PREDICTED: calcium-dependent protein kinase ...  81.3    6e-15   
gb|EFA79379.1|  myosin light chain kinase                             79.0    6e-15   Polysphondylium pallidum PN500
gb|KDP41445.1|  hypothetical protein JCGZ_15852                       80.9    7e-15   
ref|XP_008437204.1|  PREDICTED: calcium-dependent protein kinase ...  80.9    7e-15   
gb|KEH41846.1|  calcium-dependent kinase                              81.3    8e-15   
ref|XP_006857928.1|  hypothetical protein AMTR_s00069p00149760        80.9    8e-15   
ref|XP_001461819.1|  hypothetical protein                             80.9    8e-15   Paramecium tetraurelia strain d4-2
gb|KHG07421.1|  Calcium-dependent protein kinase 2                    81.3    8e-15   
ref|XP_641424.1|  myosin light chain kinase                           79.0    8e-15   Dictyostelium discoideum AX4
gb|KHG01345.1|  Calcium-dependent protein kinase 29                   78.6    1e-14   
ref|XP_002285713.2|  PREDICTED: serine/threonine-protein kinase P...  80.1    1e-14   Vitis vinifera
ref|XP_007017897.1|  Calcium-dependent protein kinase 29              80.5    1e-14   
emb|CBI19226.3|  unnamed protein product                              79.3    1e-14   
ref|XP_008376518.1|  PREDICTED: calcium-dependent protein kinase ...  80.5    1e-14   
gb|KFP83334.1|  Myosin light chain kinase 2, skeletal/cardiac muscle  76.3    1e-14   
ref|XP_009148574.1|  PREDICTED: serine/threonine-protein kinase P...  80.1    1e-14   
emb|CDO97401.1|  unnamed protein product                              80.1    1e-14   
ref|XP_009341273.1|  PREDICTED: calcium-dependent protein kinase ...  80.1    2e-14   
gb|KFO53230.1|  Myosin light chain kinase 2, skeletal/cardiac muscle  75.9    2e-14   
ref|XP_008437201.1|  PREDICTED: calcium-dependent protein kinase ...  79.7    2e-14   
ref|XP_009118064.1|  PREDICTED: serine/threonine-protein kinase P...  79.3    2e-14   
emb|CDY26581.1|  BnaA09g46960D                                        79.3    2e-14   
ref|XP_011090473.1|  PREDICTED: calcium-dependent protein kinase ...  79.7    2e-14   
ref|XP_007040388.1|  Calcium-dependent protein kinase 6 isoform 2     79.3    2e-14   
ref|XP_004303388.1|  PREDICTED: calcium-dependent protein kinase ...  79.7    2e-14   
ref|XP_010520772.1|  PREDICTED: serine/threonine-protein kinase P...  79.3    2e-14   
gb|AFR11235.1|  calcium dependent protein kinase 5                    77.4    3e-14   
ref|XP_010916696.1|  PREDICTED: serine/threonine-protein kinase P...  79.0    3e-14   
ref|XP_003518161.1|  PREDICTED: calcium-dependent protein kinase ...  79.3    3e-14   
ref|XP_004299694.1|  PREDICTED: serine/threonine-protein kinase P...  79.0    3e-14   
gb|AEO21918.1|  calcium-dependent protein kinase                      79.0    3e-14   
ref|XP_010106803.1|  Calcium-dependent protein kinase 30              79.3    3e-14   
ref|XP_002510851.1|  calcium-dependent protein kinase, putative       79.0    4e-14   Ricinus communis
ref|XP_010673770.1|  PREDICTED: calcium-dependent protein kinase ...  79.0    4e-14   
ref|XP_006475138.1|  PREDICTED: calcium-dependent protein kinase ...  76.3    4e-14   
gb|AGI78245.1|  phosphoenolpyruvate carboxylase-related kinase 1      79.0    4e-14   
ref|XP_006452353.1|  hypothetical protein CICLE_v100107181mg          76.6    4e-14   
ref|XP_009393380.1|  PREDICTED: calcium-dependent protein kinase 26   79.0    4e-14   
ref|XP_007042877.1|  Phosphoenolpyruvate carboxylase-related kina...  78.6    4e-14   
ref|XP_007040387.1|  Calcium-dependent protein kinase 6 isoform 1     79.0    5e-14   
ref|XP_007141507.1|  hypothetical protein PHAVU_008G201900g           78.6    5e-14   
ref|XP_003535945.1|  PREDICTED: calcium-dependent protein kinase 1    79.0    5e-14   
gb|KFO08779.1|  Myosin light chain kinase 2, skeletal/cardiac muscle  74.7    5e-14   
gb|KHN05362.1|  Calcium-dependent protein kinase 1                    78.6    6e-14   
ref|XP_003555695.1|  PREDICTED: calcium-dependent protein kinase ...  78.6    6e-14   
gb|KHN08596.1|  Calcium-dependent protein kinase 1                    78.6    6e-14   
emb|CBI26637.3|  unnamed protein product                              77.0    6e-14   
emb|CDP10568.1|  unnamed protein product                              79.0    6e-14   
ref|XP_006588885.1|  PREDICTED: calcium-dependent protein kinase ...  78.6    6e-14   
ref|XP_006475139.1|  PREDICTED: calcium-dependent protein kinase ...  76.3    6e-14   
ref|XP_003553625.2|  PREDICTED: calcium-dependent protein kinase ...  78.6    6e-14   
ref|XP_004249395.1|  PREDICTED: calcium-dependent protein kinase ...  78.6    7e-14   
ref|XP_010266540.1|  PREDICTED: serine/threonine-protein kinase P...  78.2    7e-14   
ref|XP_009373512.1|  PREDICTED: serine/threonine-protein kinase P...  78.2    7e-14   
ref|XP_003590333.1|  Calcium-dependent protein kinase                 78.2    8e-14   
ref|XP_004136266.1|  PREDICTED: serine/threonine-protein kinase P...  77.8    8e-14   
gb|AGQ20413.1|  calcium dependent protein kinase 3                    75.5    8e-14   
ref|XP_010476240.1|  PREDICTED: serine/threonine-protein kinase P...  77.8    8e-14   
ref|XP_008466186.1|  PREDICTED: serine/threonine-protein kinase P...  77.8    8e-14   
ref|XP_008338903.1|  PREDICTED: serine/threonine-protein kinase P...  77.8    8e-14   
ref|XP_004143936.1|  PREDICTED: calcium-dependent protein kinase ...  78.2    8e-14   
ref|XP_011014420.1|  PREDICTED: calcium-dependent protein kinase ...  78.2    9e-14   
ref|XP_011009111.1|  PREDICTED: calcium-dependent protein kinase ...  78.2    9e-14   
ref|XP_002313265.1|  calcium-dependent protein kinase                 78.2    9e-14   
ref|XP_010494499.1|  PREDICTED: serine/threonine-protein kinase P...  77.8    9e-14   
emb|CDP05759.1|  unnamed protein product                              77.8    9e-14   
ref|XP_006307418.1|  hypothetical protein CARUB_v10009041mg           77.8    9e-14   
ref|XP_002892701.1|  hypothetical protein ARALYDRAFT_471419           77.8    9e-14   
ref|XP_008241096.1|  PREDICTED: calcium-dependent protein kinase 26   78.2    9e-14   
ref|XP_002885716.1|  predicted protein                                77.4    9e-14   
ref|XP_007204872.1|  hypothetical protein PRUPE_ppa002734mg           78.2    9e-14   
emb|CDY31273.1|  BnaC08g15680D                                        76.3    9e-14   
emb|CDY52603.1|  BnaCnng22820D                                        77.4    9e-14   
ref|XP_006663248.1|  PREDICTED: calcium-dependent protein kinase ...  77.8    9e-14   
ref|XP_007017899.1|  Calcium-dependent protein kinase 29              77.8    9e-14   
emb|CDY16526.1|  BnaA08g02410D                                        77.4    1e-13   
ref|XP_003592324.1|  Calcium-dependent protein kinase                 77.8    1e-13   
ref|XP_007222818.1|  hypothetical protein PRUPE_ppa005068mg           77.4    1e-13   
gb|EYU25048.1|  hypothetical protein MIMGU_mgv1a005528mg              77.4    1e-13   
gb|KDP40948.1|  hypothetical protein JCGZ_24947                       77.4    1e-13   
gb|ACM45705.1|  calcium-dependent protein kinase                      75.1    1e-13   
ref|XP_003589907.1|  Calcium dependent protein kinase                 77.8    1e-13   
ref|XP_004498060.1|  PREDICTED: calcium-dependent protein kinase ...  77.8    1e-13   
ref|XP_006417206.1|  hypothetical protein EUTSA_v10007542mg           77.4    1e-13   
ref|XP_007152349.1|  hypothetical protein PHAVU_004G122500g           77.4    1e-13   
ref|XP_010263084.1|  PREDICTED: calcium-dependent protein kinase ...  77.8    1e-13   
gb|KFP31143.1|  Myosin light chain kinase 2, skeletal/cardiac muscle  73.6    1e-13   
ref|XP_010458698.1|  PREDICTED: serine/threonine-protein kinase P...  77.4    1e-13   
ref|XP_010509303.1|  PREDICTED: calcium-dependent protein kinase 3    77.4    1e-13   
ref|NP_172728.1|  phosphoenolpyruvate carboxylase-related kinase 2    77.4    1e-13   
emb|CDY16025.1|  BnaC08g40980D                                        77.4    1e-13   
ref|XP_010439150.1|  PREDICTED: calcium-dependent protein kinase ...  77.4    1e-13   
ref|XP_010433881.1|  PREDICTED: calcium-dependent protein kinase ...  77.4    1e-13   
ref|XP_011032926.1|  PREDICTED: calcium-dependent protein kinase 1    77.8    1e-13   
prf||1507147A  myosin L kinase                                        75.9    1e-13
ref|XP_008219372.1|  PREDICTED: serine/threonine-protein kinase P...  77.4    1e-13   
ref|XP_008391998.1|  PREDICTED: calcium-dependent protein kinase ...  77.4    1e-13   
ref|XP_004308122.1|  PREDICTED: calcium-dependent protein kinase ...  77.4    1e-13   
ref|XP_007162999.1|  hypothetical protein PHAVU_001G197700g           77.4    1e-13   
emb|CDO99952.1|  unnamed protein product                              77.4    1e-13   
ref|XP_007145376.1|  hypothetical protein PHAVU_007G233900g           77.4    1e-13   
gb|KDO84959.1|  hypothetical protein CISIN_1g010263mg                 76.3    2e-13   
ref|XP_011034967.1|  PREDICTED: calcium-dependent protein kinase 29   77.4    2e-13   
ref|XP_007152348.1|  hypothetical protein PHAVU_004G122500g           77.0    2e-13   
ref|XP_001443538.1|  hypothetical protein                             77.0    2e-13   
ref|XP_002514000.1|  calcium-dependent protein kinase, putative       77.0    2e-13   
emb|CDY47496.1|  BnaA09g09050D                                        77.0    2e-13   
ref|XP_007222396.1|  hypothetical protein PRUPE_ppa004027mg           77.0    2e-13   
gb|AGQ20417.1|  calcium dependent protein kinase 7                    74.3    2e-13   
ref|XP_010558239.1|  PREDICTED: calcium-dependent protein kinase ...  77.4    2e-13   
ref|XP_011047130.1|  PREDICTED: calcium-dependent protein kinase ...  77.4    2e-13   
ref|XP_002309269.1|  calcium-dependent protein kinase                 77.4    2e-13   
ref|XP_009349885.1|  PREDICTED: calcium-dependent protein kinase ...  77.4    2e-13   
ref|XP_010558242.1|  PREDICTED: calcium-dependent protein kinase ...  77.4    2e-13   
ref|XP_002509698.1|  calcium-dependent protein kinase, putative       77.0    2e-13   
ref|XP_010558243.1|  PREDICTED: calcium-dependent protein kinase ...  77.0    2e-13   
ref|XP_002310978.1|  calcium-dependent protein kinase 2               77.4    2e-13   
ref|XP_003293130.1|  myosin light chain kinase                        75.1    2e-13   
ref|XP_007040113.1|  Phosphoenolpyruvate carboxylase-related kina...  77.0    2e-13   
ref|XP_002323958.2|  hypothetical protein POPTR_0017s07570g           76.6    2e-13   
gb|KFQ33159.1|  Myosin light chain kinase 2, skeletal/cardiac muscle  73.2    2e-13   
ref|XP_008442973.1|  PREDICTED: calcium-dependent protein kinase ...  77.4    2e-13   
ref|XP_010419805.1|  PREDICTED: calcium-dependent protein kinase ...  77.0    2e-13   
ref|XP_010419806.1|  PREDICTED: calcium-dependent protein kinase ...  77.0    2e-13   
gb|KFK25494.1|  hypothetical protein AALP_AA8G122000                  77.0    2e-13   
ref|NP_196779.1|  calcium-dependent protein kinase 17                 77.0    2e-13   
gb|AAL59948.1|  putative calcium-dependent protein kinase             77.0    2e-13   
ref|XP_010453282.1|  PREDICTED: calcium-dependent protein kinase 17   77.0    2e-13   
ref|XP_006289327.1|  hypothetical protein CARUB_v10002812mg           77.0    2e-13   
ref|XP_002871516.1|  calcium-dependent protein kinase 17              77.0    2e-13   
ref|XP_008475097.1|  PREDICTED: death-associated protein kinase 2...  76.3    2e-13   
gb|KFK24927.1|  hypothetical protein AALP_AA8G042900                  77.4    2e-13   
gb|KDO62725.1|  hypothetical protein CISIN_1g0096581mg                73.6    2e-13   
ref|XP_008795200.1|  PREDICTED: serine/threonine-protein kinase P...  76.6    2e-13   
gb|AAZ32753.1|  putative calcium dependent kinase 6                   77.0    2e-13   
gb|KFR04315.1|  Myosin light chain kinase 2, skeletal/cardiac muscle  73.2    2e-13   
ref|XP_011076247.1|  PREDICTED: calcium-dependent protein kinase ...  77.0    2e-13   
gb|AAZ32752.1|  putative calcium dependent kinase 6                   77.0    2e-13   
gb|EYU19860.1|  hypothetical protein MIMGU_mgv1a003630mg              77.0    2e-13   
ref|XP_011076246.1|  PREDICTED: calcium-dependent protein kinase ...  77.0    2e-13   
gb|AAH19408.1|  Mylk2 protein                                         74.7    2e-13   
ref|XP_007040112.1|  Phosphoenolpyruvate carboxylase-related kina...  77.0    2e-13   
gb|AGG35975.1|  calcium-dependent protein kinase 6                    77.0    2e-13   
ref|XP_009112421.1|  PREDICTED: calcium-dependent protein kinase ...  77.0    2e-13   
ref|XP_010278509.1|  PREDICTED: calcium-dependent protein kinase 26   77.0    2e-13   
ref|XP_008246010.1|  PREDICTED: calcium-dependent protein kinase ...  77.0    2e-13   
ref|XP_008238793.1|  PREDICTED: calcium-dependent protein kinase ...  77.0    2e-13   
ref|XP_010255556.1|  PREDICTED: calcium-dependent protein kinase ...  77.0    2e-13   
ref|XP_008795199.1|  PREDICTED: serine/threonine-protein kinase P...  76.6    2e-13   
ref|XP_010940904.1|  PREDICTED: calcium-dependent protein kinase 26   76.6    2e-13   
ref|XP_010062002.1|  PREDICTED: calcium-dependent protein kinase ...  74.7    2e-13   
gb|KGM00002.1|  Myosin light chain kinase 2, skeletal/cardiac muscle  73.2    2e-13   
ref|XP_006287286.1|  hypothetical protein CARUB_v10000481mg           77.0    2e-13   
ref|XP_002522616.1|  calcium-dependent protein kinase, putative       76.6    2e-13   
ref|XP_010545509.1|  PREDICTED: calcium-dependent protein kinase 33   76.6    2e-13   
ref|XP_010536137.1|  PREDICTED: calcium-dependent protein kinase 17   76.6    2e-13   
ref|XP_010693517.1|  PREDICTED: calcium-dependent protein kinase ...  76.6    2e-13   
ref|XP_003558912.1|  PREDICTED: calcium-dependent protein kinase ...  76.6    2e-13   
ref|XP_006391947.1|  hypothetical protein EUTSA_v10023804mg           76.6    2e-13   
ref|XP_010693518.1|  PREDICTED: calcium-dependent protein kinase ...  76.6    2e-13   
gb|KFM58268.1|  Serine/threonine-protein kinase 17A                   73.6    2e-13   
gb|AGQ20414.1|  calcium dependent protein kinase 6                    73.9    2e-13   
ref|NP_001065864.1|  Os11g0171500                                     76.6    2e-13   
gb|AAN41657.1|  OsCDPK protein                                        76.6    2e-13   
gb|KFK40633.1|  hypothetical protein AALP_AA2G022000                  76.6    2e-13   
gb|KFV68353.1|  Myosin light chain kinase 2, skeletal/cardiac muscle  72.8    2e-13   
gb|KDO40818.1|  hypothetical protein CISIN_1g0428232mg                75.5    3e-13   
emb|CBI40890.3|  unnamed protein product                              75.1    3e-13   
gb|ABB54456.1|  calcium-dependent protein kinase                      76.6    3e-13   
ref|XP_006475142.1|  PREDICTED: calcium-dependent protein kinase ...  76.3    3e-13   
ref|XP_004496616.1|  PREDICTED: calcium-dependent protein kinase ...  76.6    3e-13   
gb|KDP29499.1|  hypothetical protein JCGZ_19338                       76.6    3e-13   
ref|XP_010031714.1|  PREDICTED: calcium-dependent protein kinase ...  76.6    3e-13   
ref|XP_010658918.1|  PREDICTED: calcium-dependent protein kinase ...  75.1    3e-13   
gb|ADB19851.1|  calcium-dependent protein kinase CDPK12               76.3    3e-13   
gb|ABC59621.1|  calcium-dependent protein kinase                      76.3    3e-13   
ref|XP_005833133.1|  hypothetical protein GUITHDRAFT_157803           74.7    3e-13   
ref|XP_002278179.1|  PREDICTED: calcium-dependent protein kinase 2    76.6    3e-13   
ref|NP_187677.1|  Ccalcium-dependent protein kinase 2                 76.6    3e-13   
ref|XP_004491231.1|  PREDICTED: calcium-dependent protein kinase ...  76.3    3e-13   
gb|AGJ83807.1|  calcium-dependent protein kinase 1e                   76.3    3e-13   
gb|KHG03938.1|  Serine/threonine-protein kinase PEPKR2                76.3    3e-13   
ref|XP_010317567.1|  PREDICTED: calcium-dependent protein kinase 26   76.3    3e-13   
ref|XP_006353382.1|  PREDICTED: calcium-dependent protein kinase ...  76.3    3e-13   
ref|NP_001275484.1|  CDPK-like protein                                76.3    3e-13   
gb|KCW46377.1|  hypothetical protein EUGRSUZ_K00214                   75.5    3e-13   
ref|XP_006386161.1|  hypothetical protein POPTR_0002s01850g           76.3    3e-13   
gb|EYU35947.1|  hypothetical protein MIMGU_mgv1a004350mg              76.3    3e-13   
gb|KDO62724.1|  hypothetical protein CISIN_1g0096581mg                73.9    4e-13   
gb|ABY59007.1|  calcium-dependent protein kinase                      76.3    4e-13   
gb|KHG05702.1|  Calcium-dependent protein kinase 2                    76.3    4e-13   
ref|XP_002265450.1|  PREDICTED: calcium-dependent protein kinase ...  76.3    4e-13   
ref|XP_010464745.1|  PREDICTED: calcium-dependent protein kinase ...  76.6    4e-13   
ref|XP_003564438.1|  PREDICTED: calcium-dependent protein kinase 34   76.3    4e-13   
ref|XP_011094214.1|  PREDICTED: calcium-dependent protein kinase ...  76.3    4e-13   
gb|AAF88093.1|AC025417_21  T12C24.22                                  77.0    4e-13   
ref|XP_011014244.1|  PREDICTED: serine/threonine-protein kinase P...  75.9    4e-13   
ref|XP_011043089.1|  PREDICTED: serine/threonine-protein kinase P...  75.9    4e-13   
ref|XP_002884805.1|  calmodulin-domain protein kinase CDPK isoform 2  76.6    4e-13   
ref|XP_003526564.1|  PREDICTED: serine/threonine-protein kinase P...  75.9    4e-13   
gb|KFO77499.1|  Myosin light chain kinase 2, skeletal/cardiac muscle  72.4    4e-13   
ref|XP_010493983.1|  PREDICTED: calcium-dependent protein kinase 2    76.6    4e-13   
ref|XP_009766597.1|  PREDICTED: calcium-dependent protein kinase ...  76.3    4e-13   
gb|KDP22334.1|  hypothetical protein JCGZ_26165                       75.9    4e-13   
emb|CBI31852.3|  unnamed protein product                              75.5    4e-13   
ref|XP_006297365.1|  hypothetical protein CARUB_v10013385mg           76.3    4e-13   
gb|EPS61686.1|  calcium dependent protein kinase 5                    75.9    4e-13   
ref|XP_010278695.1|  PREDICTED: calcium-dependent protein kinase ...  76.3    4e-13   
emb|CDX97174.1|  BnaC09g44510D                                        75.9    4e-13   
ref|XP_009131258.1|  PREDICTED: calcium-dependent protein kinase ...  75.9    4e-13   
emb|CDX70450.1|  BnaC03g05340D                                        75.9    4e-13   
emb|CDX78468.1|  BnaA03g03800D                                        75.9    4e-13   
ref|XP_010062001.1|  PREDICTED: calcium-dependent protein kinase ...  74.3    4e-13   
gb|KHN22589.1|  Calcium-dependent protein kinase 2                    76.3    4e-13   
ref|XP_010486680.1|  PREDICTED: calcium-dependent protein kinase ...  76.3    4e-13   
ref|XP_010276092.1|  PREDICTED: calcium-dependent protein kinase ...  75.9    4e-13   
gb|AHN16201.1|  CPK3-2.1                                              75.9    4e-13   
ref|XP_010247940.1|  PREDICTED: calcium-dependent protein kinase ...  76.3    4e-13   
ref|XP_004305563.1|  PREDICTED: calcium-dependent protein kinase ...  76.3    4e-13   
ref|XP_011023025.1|  PREDICTED: serine/threonine-protein kinase P...  75.9    4e-13   
ref|XP_002977722.1|  calcium dependent protein kinase 17              75.9    4e-13   
emb|CAD70165.1|  calcium-dependent protein kinase                     75.9    4e-13   
ref|XP_009371274.1|  PREDICTED: calcium-dependent protein kinase ...  75.9    5e-13   
ref|XP_006399734.1|  hypothetical protein EUTSA_v10013236mg           75.9    5e-13   
ref|XP_011030040.1|  PREDICTED: calcium-dependent protein kinase ...  75.9    5e-13   
ref|XP_011024983.1|  PREDICTED: calcium-dependent protein kinase 17   75.9    5e-13   
gb|AAS57948.1|  CDPK-related protein kinase                           75.5    5e-13   
ref|XP_002310497.2|  hypothetical protein POPTR_0007s03570g           75.5    5e-13   
ref|XP_010491015.1|  PREDICTED: calcium-dependent protein kinase ...  76.3    5e-13   
ref|XP_008679628.1|  PREDICTED: calcium-dependent protein kinase 11   75.9    5e-13   
ref|XP_002299975.2|  hypothetical protein POPTR_0001s28150g           75.9    5e-13   
ref|XP_002873173.1|  calcium-dependent protein kinase isoform ak1     75.9    5e-13   
ref|XP_009406102.1|  PREDICTED: calcium-dependent protein kinase ...  75.9    5e-13   
ref|XP_002979552.1|  calcium dependent protein kinase 17              75.9    5e-13   
ref|XP_010423525.1|  PREDICTED: calcium-dependent protein kinase 1    75.9    5e-13   
ref|XP_010106395.1|  Calcium-dependent protein kinase 17              75.9    5e-13   
ref|XP_010099802.1|  Calcium-dependent protein kinase 17              75.9    5e-13   
ref|XP_008449648.1|  PREDICTED: calcium-dependent protein kinase ...  75.9    5e-13   
ref|XP_004136537.1|  PREDICTED: calcium-dependent protein kinase ...  75.9    5e-13   
ref|XP_006657761.1|  PREDICTED: calcium-dependent protein kinase ...  75.9    5e-13   
ref|XP_010452389.1|  PREDICTED: calcium-dependent protein kinase ...  75.9    5e-13   
ref|XP_010677598.1|  PREDICTED: calcium-dependent protein kinase 20   75.9    5e-13   
ref|XP_011012729.1|  PREDICTED: serine/threonine-protein kinase P...  75.5    5e-13   
ref|NP_196107.1|  calcium dependent protein kinase 1                  75.9    5e-13   
ref|XP_006398940.1|  hypothetical protein EUTSA_v10012990mg           75.9    5e-13   
ref|XP_006398939.1|  hypothetical protein EUTSA_v10012990mg           75.9    5e-13   
ref|XP_011076878.1|  PREDICTED: calcium-dependent protein kinase ...  75.9    5e-13   
ref|XP_011003085.1|  PREDICTED: calcium-dependent protein kinase ...  75.5    5e-13   
ref|XP_011003084.1|  PREDICTED: calcium-dependent protein kinase ...  75.5    5e-13   
gb|AGS15002.1|  calcium-dependent protein kinase 25                   75.5    6e-13   
ref|XP_002884049.1|  calcium-dependent protein kinase 6               75.9    6e-13   
ref|XP_008387135.1|  PREDICTED: calcium-dependent protein kinase ...  75.9    6e-13   
ref|XP_003577783.1|  PREDICTED: calcium-dependent protein kinase ...  75.5    6e-13   
ref|XP_010662534.1|  PREDICTED: calcium-dependent protein kinase ...  75.5    6e-13   
ref|XP_002280303.1|  PREDICTED: calcium-dependent protein kinase ...  75.5    6e-13   
ref|XP_010694387.1|  PREDICTED: calcium-dependent protein kinase 1    75.9    6e-13   
gb|EYU38709.1|  hypothetical protein MIMGU_mgv1a002855mg              75.9    6e-13   
ref|XP_006657762.1|  PREDICTED: calcium-dependent protein kinase ...  75.5    6e-13   
ref|XP_010422295.1|  PREDICTED: calcium-dependent protein kinase 21   75.5    6e-13   
ref|XP_010455773.1|  PREDICTED: calcium-dependent protein kinase ...  75.5    6e-13   
ref|XP_008221211.1|  PREDICTED: calcium-dependent protein kinase 29   75.5    6e-13   
gb|KDO62722.1|  hypothetical protein CISIN_1g0096581mg                73.6    6e-13   
ref|XP_006297360.1|  hypothetical protein CARUB_v10013380mg           75.5    6e-13   
ref|XP_010489356.1|  PREDICTED: calcium-dependent protein kinase ...  75.5    6e-13   
ref|XP_010053342.1|  PREDICTED: calcium-dependent protein kinase ...  75.5    6e-13   
gb|KCW77616.1|  hypothetical protein EUGRSUZ_D01928                   75.5    6e-13   
ref|XP_010053340.1|  PREDICTED: calcium-dependent protein kinase ...  75.5    6e-13   



>ref|XP_009595423.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 1-like [Nicotiana 
tomentosiformis]
Length=279

 Score =   145 bits (366),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ILYIML+GV PF G+TTTETF+AVLRANLRFP + FRSVSPEAKDLLRKMIC+DVSRRF 
Sbjct  197  ILYIMLSGVPPFYGETTTETFQAVLRANLRFPTRNFRSVSPEAKDLLRKMICKDVSRRFS  256

Query  182  AEQVLRHPWVMSEGETRSMADM  247
            AEQVLRHPWV++ GETRSMAD+
Sbjct  257  AEQVLRHPWVINGGETRSMADL  278



>gb|AHW50682.1| phosphoenolpyruvate carboxylase kinase [Nicotiana tabacum]
Length=279

 Score =   145 bits (365),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ILYIML+GV PF G+TTTETF+AVLRANLRFP + FRSVSPEAKDLLRKMIC+DVSRRF 
Sbjct  197  ILYIMLSGVPPFYGETTTETFQAVLRANLRFPTRNFRSVSPEAKDLLRKMICKDVSRRFS  256

Query  182  AEQVLRHPWVMSEGETRSMADM  247
            AEQVLRHPWV++ GETRSMAD+
Sbjct  257  AEQVLRHPWVINGGETRSMADL  278



>gb|AAF19402.1|AF203480_1 phosphoenolpyruvate carboxylase kinase, partial [Solanum lycopersicum]
Length=276

 Score =   144 bits (363),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 67/83 (81%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ILYIML+GV PF G+T TETF+AVLR NLRFP + FRSVSPEAKDLLRKMIC+DVSRRF 
Sbjct  194  ILYIMLSGVPPFYGETPTETFQAVLRGNLRFPTRNFRSVSPEAKDLLRKMICKDVSRRFS  253

Query  182  AEQVLRHPWVMSEGETRSMADMN  250
            AEQVLRHPWV++ GETRSMAD+N
Sbjct  254  AEQVLRHPWVINGGETRSMADLN  276



>ref|NP_001234394.1| phosphoenolpyruvate carboxylase kinase [Solanum lycopersicum]
 gb|AAF19403.1|AF203481_1 phosphoenolpyruvate carboxylase kinase [Solanum lycopersicum]
 gb|AAO33924.1| phosphoenolpyruvate carboxylase kinase 1 [Solanum lycopersicum]
Length=279

 Score =   144 bits (362),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 67/83 (81%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ILYIML+GV PF G+T TETF+AVLR NLRFP + FRSVSPEAKDLLRKMIC+DVSRRF 
Sbjct  197  ILYIMLSGVPPFYGETPTETFQAVLRGNLRFPTRNFRSVSPEAKDLLRKMICKDVSRRFS  256

Query  182  AEQVLRHPWVMSEGETRSMADMN  250
            AEQVLRHPWV++ GETRSMAD+N
Sbjct  257  AEQVLRHPWVINGGETRSMADLN  279



>ref|XP_009788812.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 1-like [Nicotiana 
sylvestris]
Length=278

 Score =   142 bits (358),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ILYIML+G+ PF G+T TETF+AVLRANLRFP + FRSVSPEAKDLLRKMIC+DVSRRF 
Sbjct  196  ILYIMLSGIPPFYGETPTETFQAVLRANLRFPTRNFRSVSPEAKDLLRKMICKDVSRRFS  255

Query  182  AEQVLRHPWVMSEGETRSMADM  247
            AEQVLRHPWV++ GETRSMAD+
Sbjct  256  AEQVLRHPWVINGGETRSMADL  277



>ref|NP_001275162.1| PEP carboxylase kinase [Solanum tuberosum]
 gb|AAN76811.1|AF453448_1 PEP carboxylase kinase [Solanum tuberosum]
 gb|AAQ10030.1| PEPC kinase 1a [Solanum tuberosum]
Length=279

 Score =   140 bits (354),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ILYIML+GV PF G+T TETF+AVLR NLRFP + FRSVS EAKDLLRKMIC+DVSRRF 
Sbjct  197  ILYIMLSGVPPFYGETPTETFQAVLRGNLRFPTRNFRSVSSEAKDLLRKMICKDVSRRFS  256

Query  182  AEQVLRHPWVMSEGETRSMADMN  250
            AEQVLRHPWV++ GETRSMAD+N
Sbjct  257  AEQVLRHPWVINGGETRSMADLN  279



>gb|AAQ10029.1| PEPC kinase 1b [Solanum tuberosum]
 gb|AAQ10031.1| PEPC kinase 1b [Solanum tuberosum]
Length=277

 Score =   140 bits (354),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ILYIML+GV PF G+T TETF+AVLR NLRFP + FRSVSPEAKDLLRKMIC+DVSRRF 
Sbjct  197  ILYIMLSGVPPFYGETPTETFQAVLRGNLRFPTRNFRSVSPEAKDLLRKMICKDVSRRFS  256

Query  182  AEQVLRHPWVMSEGETRSMAD  244
            AEQVLRHPWV++ GETRSMAD
Sbjct  257  AEQVLRHPWVINGGETRSMAD  277



>dbj|BAB71853.1| phosphoenolpyruvate carboxylase kinase [Flaveria trinervia]
Length=281

 Score =   139 bits (351),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 63/82 (77%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ILYIMLAGV PF GD+  +TFEAVLR NLRFP ++FRSVSPEAKDLLRKM+C+DVSRRF 
Sbjct  199  ILYIMLAGVPPFHGDSPADTFEAVLRGNLRFPTRLFRSVSPEAKDLLRKMLCKDVSRRFS  258

Query  182  AEQVLRHPWVMSEGETRSMADM  247
            A+QVLRHPWV++ G+TRSMAD+
Sbjct  259  ADQVLRHPWVVNGGKTRSMADL  280



>ref|XP_004236793.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 2-like [Solanum 
lycopersicum]
Length=277

 Score =   139 bits (350),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ILYIML+GV PF G+T TETF+AVLR NLRFP + FRSVSPEAKDLLRKMIC+DVSRRF 
Sbjct  197  ILYIMLSGVPPFYGETPTETFQAVLRGNLRFPTRNFRSVSPEAKDLLRKMICKDVSRRFS  256

Query  182  AEQVLRHPWVMSEGETRSMAD  244
            AEQVLRHPWV++ GETRSM D
Sbjct  257  AEQVLRHPWVLNGGETRSMVD  277



>gb|ADY38796.1| phosphoenolpyruvate carboxylase kinase [Coffea arabica]
Length=281

 Score =   139 bits (350),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ILYIML+GV PF G+T+TETFEAVLR NLRFP ++FRSVSPEAKDLLRKMIC+DVSRR  
Sbjct  199  ILYIMLSGVPPFFGETSTETFEAVLRGNLRFPHRLFRSVSPEAKDLLRKMICKDVSRRIS  258

Query  182  AEQVLRHPWVMSEGETRSMADMN  250
            A+QVLRHPWV+S GE RSMAD+ 
Sbjct  259  ADQVLRHPWVISGGEIRSMADLT  281



>ref|XP_006361431.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 2-like [Solanum 
tuberosum]
Length=277

 Score =   139 bits (349),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ILYIML+GV PF G+T TETF+AVLR NLRFP + FRSVSPEAKDLLRKMIC+DVSRRF 
Sbjct  197  ILYIMLSGVPPFYGETPTETFQAVLRGNLRFPTRNFRSVSPEAKDLLRKMICKDVSRRFS  256

Query  182  AEQVLRHPWVMSEGETRSMAD  244
            AEQVLRHPWV++ GETRSM D
Sbjct  257  AEQVLRHPWVINGGETRSMVD  277



>ref|XP_009771066.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 1-like [Nicotiana 
sylvestris]
Length=277

 Score =   138 bits (348),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ILYIML+GV PF G+T TETF+AVLRANLRFP + FRSVSPEAKDLLRKMIC+DVSRRF 
Sbjct  197  ILYIMLSGVPPFYGETPTETFQAVLRANLRFPTRNFRSVSPEAKDLLRKMICKDVSRRFS  256

Query  182  AEQVLRHPWVMSEGETRSMAD  244
            AEQVLRH WV++ GETRSMAD
Sbjct  257  AEQVLRHQWVINGGETRSMAD  277



>emb|CDO99979.1| unnamed protein product [Coffea canephora]
Length=281

 Score =   138 bits (347),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ILYIML+GV PF G+T TETFEAVLR NLRFP ++FRSVSPEAKDLLRKMIC+DVSRR  
Sbjct  199  ILYIMLSGVPPFFGETPTETFEAVLRGNLRFPHRLFRSVSPEAKDLLRKMICKDVSRRIS  258

Query  182  AEQVLRHPWVMSEGETRSMADMN  250
            A+QVLRHPWV+S GE RSMAD+ 
Sbjct  259  ADQVLRHPWVISGGEIRSMADLT  281



>dbj|BAF48321.1| phosphoenolpyruvate carboxylase kinase [Flaveria bidentis]
Length=281

 Score =   137 bits (345),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ILYIMLAGV PF GD+  +TFEAVLR NLRFP ++FRSVSPEAKDLLRKM+C+DV RRF 
Sbjct  199  ILYIMLAGVPPFHGDSPADTFEAVLRGNLRFPTRLFRSVSPEAKDLLRKMLCKDVYRRFS  258

Query  182  AEQVLRHPWVMSEGETRSMADM  247
            A+QVLRHPWV++ G+TRSMAD+
Sbjct  259  ADQVLRHPWVVNGGKTRSMADL  280



>gb|EYU33158.1| hypothetical protein MIMGU_mgv1a011495mg [Erythranthe guttata]
Length=279

 Score =   137 bits (344),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ILYIMLAGV PF GD   ETFEAVLR NLRFP KIFRSVSPEAKDLLRKMICRDVSRR  
Sbjct  197  ILYIMLAGVPPFFGDGPAETFEAVLRGNLRFPTKIFRSVSPEAKDLLRKMICRDVSRRLS  256

Query  182  AEQVLRHPWVMSEGETRSMADM  247
            AEQVLRHPW+++ G T SMAD 
Sbjct  257  AEQVLRHPWIINGGVTSSMADF  278



>ref|XP_009599299.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 1-like [Nicotiana 
tomentosiformis]
Length=277

 Score =   136 bits (343),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ILYIML+GV PF G+T TETF+AVLRANLRFP + FRSVSPEAKDLLRKMIC+DVSRRF 
Sbjct  197  ILYIMLSGVPPFYGETPTETFQAVLRANLRFPTRNFRSVSPEAKDLLRKMICKDVSRRFS  256

Query  182  AEQVLRHPWVMSEGETRSMAD  244
            AEQVLRH WV++ GETRSM D
Sbjct  257  AEQVLRHQWVINGGETRSMDD  277



>ref|XP_009621492.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 1-like [Nicotiana 
tomentosiformis]
Length=280

 Score =   136 bits (342),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LYIML+GV PF GDTT E FEAVLR NLRFP +IF SVS E KDLLRKMIC+DVSRRF 
Sbjct  197  MLYIMLSGVAPFCGDTTKEIFEAVLRGNLRFPTRIFGSVSTEVKDLLRKMICKDVSRRFS  256

Query  182  AEQVLRHPWVMSEGETRSMAD  244
            AEQVLRHPW+++ GETRSMAD
Sbjct  257  AEQVLRHPWIINGGETRSMAD  277



>ref|XP_011077233.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 2 [Sesamum 
indicum]
Length=276

 Score =   135 bits (339),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ILYIMLAGV PF GD   ETFEAVLR NLRFP KIFRSVSPEAKDLLRKMICRDVSRR  
Sbjct  196  ILYIMLAGVPPFYGDGPAETFEAVLRGNLRFPTKIFRSVSPEAKDLLRKMICRDVSRRLS  255

Query  182  AEQVLRHPWVMSEGETRSMAD  244
            AEQVLRHPW+++ GE   MAD
Sbjct  256  AEQVLRHPWMINGGEPTPMAD  276



>ref|XP_009799313.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 2-like [Nicotiana 
sylvestris]
Length=280

 Score =   134 bits (336),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LYIML+GV PF GDTT E FEAVLR NLRFP +IF SVS E KDLLRKMIC+DVSRRF 
Sbjct  197  MLYIMLSGVAPFCGDTTKEIFEAVLRGNLRFPTRIFGSVSTEVKDLLRKMICKDVSRRFS  256

Query  182  AEQVLRHPWVMSEGETRSMAD  244
            AEQVLRHPW+++ GETRS AD
Sbjct  257  AEQVLRHPWIINGGETRSTAD  277



>gb|ABZ89189.1| hypothetical protein 46C02.15 [Coffea canephora]
Length=282

 Score =   133 bits (335),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 65/84 (77%), Positives = 73/84 (87%), Gaps = 1/84 (1%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ILYIML+GV PF G+T TETFEAVLR NLRFP ++FRSVSPEAKDLLRKMIC+DVSRR  
Sbjct  199  ILYIMLSGVPPFFGETPTETFEAVLRGNLRFPHRLFRSVSPEAKDLLRKMICKDVSRRIS  258

Query  182  AEQVLR-HPWVMSEGETRSMADMN  250
            A+QVLR HPWV+S GE RSMAD+ 
Sbjct  259  ADQVLRGHPWVISGGEIRSMADLT  282



>gb|ADZ55307.1| phosphoenolpyruvate carboxylase kinase [Coffea arabica]
Length=282

 Score =   133 bits (334),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/84 (77%), Positives = 72/84 (86%), Gaps = 1/84 (1%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ILYIML+GV PF GDT TETFEAVLR NLRFP ++FRSVSPEAKDLLRKMIC+DVSRR  
Sbjct  199  ILYIMLSGVPPFFGDTPTETFEAVLRGNLRFPHRLFRSVSPEAKDLLRKMICKDVSRRIS  258

Query  182  AEQVLR-HPWVMSEGETRSMADMN  250
            A+QVL  HPWV+S GE RSMAD+ 
Sbjct  259  ADQVLTGHPWVISGGEIRSMADLT  282



>gb|KDP23706.1| hypothetical protein JCGZ_23539 [Jatropha curcas]
Length=276

 Score =   132 bits (332),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LY+MLAG+ PF G+T  E FEAV+R NLRFP +IFR+VSPEAKDLL+KMICRDVSRRF 
Sbjct  197  VLYVMLAGIPPFYGETVEEIFEAVIRGNLRFPPRIFRNVSPEAKDLLKKMICRDVSRRFS  256

Query  182  AEQVLRHPWVMSEGETRSM  238
            AEQ LRHPW+++EGET SM
Sbjct  257  AEQALRHPWILNEGETSSM  275



>ref|XP_010274773.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 1-like isoform 
X1 [Nelumbo nucifera]
Length=277

 Score =   131 bits (330),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 60/82 (73%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            I+YIMLAG+ PF GD+ TE F+AVLRANLRFP +IF SVSP AKDLLRKM+C+DVSRRF 
Sbjct  195  IMYIMLAGIPPFYGDSATEIFDAVLRANLRFPTRIFHSVSPAAKDLLRKMLCKDVSRRFS  254

Query  182  AEQVLRHPWVMSEGETRSMADM  247
            AEQVLRHPW+ S G  RSM D+
Sbjct  255  AEQVLRHPWITSGGGERSMNDL  276



>ref|XP_009790267.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 2-like [Nicotiana 
sylvestris]
Length=274

 Score =   130 bits (328),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 71/81 (88%), Gaps = 3/81 (4%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ILYIML+GV PF G+T TETF+AVLRANLRFP + FRSVSPEAKDLLRKMIC+DVSRRF 
Sbjct  197  ILYIMLSGVPPFYGETPTETFQAVLRANLRFPTRNFRSVSPEAKDLLRKMICKDVSRRFS  256

Query  182  AEQVLRHPWVMSEGETRSMAD  244
            AEQVLRHPWV++ G   SMAD
Sbjct  257  AEQVLRHPWVINGG---SMAD  274



>ref|XP_002521969.1| calcium-dependent protein kinase, putative [Ricinus communis]
 gb|EEF40373.1| calcium-dependent protein kinase, putative [Ricinus communis]
Length=162

 Score =   127 bits (320),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LY+MLAG+ PF G+T  E FEAV+R NLRFP +IFR+VSP AKDLLRKMICRD SRRF 
Sbjct  83   VLYVMLAGIPPFYGETVEEIFEAVIRGNLRFPPRIFRNVSPAAKDLLRKMICRDASRRFS  142

Query  182  AEQVLRHPWVMSEGETRSM  238
            AEQ LRHPW++SEG+T SM
Sbjct  143  AEQALRHPWIVSEGDTISM  161



>gb|EYU19883.1| hypothetical protein MIMGU_mgv1a011726mg [Erythranthe guttata]
Length=272

 Score =   129 bits (325),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ILYIMLAGV PF GD   ETFEAVLR NLRFP K+FRSVSPEAKDLLRKM+CRDVSRR  
Sbjct  196  ILYIMLAGVPPFYGDGPAETFEAVLRGNLRFPTKLFRSVSPEAKDLLRKMMCRDVSRRLS  255

Query  182  AEQVLRHPWVMSEGET  229
            AEQVLRHPW+++ GET
Sbjct  256  AEQVLRHPWMINGGET  271



>ref|XP_002285162.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 1 [Vitis vinifera]
 emb|CBI23638.3| unnamed protein product [Vitis vinifera]
Length=278

 Score =   129 bits (325),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ILYIMLAG+ PF G+++ E FEAVLRANLRFPA+IF SVS  AKDLLR+MIC+DVSRRF 
Sbjct  196  ILYIMLAGIPPFYGESSMEIFEAVLRANLRFPARIFHSVSTAAKDLLRRMICKDVSRRFT  255

Query  182  AEQVLRHPWVMSEGETRSMADMN  250
            AEQVLRHPW+ S GETR+ AD+ 
Sbjct  256  AEQVLRHPWMTSVGETRTEADLT  278



>emb|CAN72597.1| hypothetical protein VITISV_015543 [Vitis vinifera]
Length=278

 Score =   129 bits (325),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ILYIMLAG+ PF G+++ E FEAVLRANLRFPA+IF SVS  AKDLLR+MIC+DVSRRF 
Sbjct  196  ILYIMLAGIPPFYGESSMEIFEAVLRANLRFPARIFHSVSTAAKDLLRRMICKDVSRRFT  255

Query  182  AEQVLRHPWVMSEGETRSMADMN  250
            AEQVLRHPW+ S GETR+ AD+ 
Sbjct  256  AEQVLRHPWMTSVGETRTEADLT  278



>ref|XP_010675055.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 2-like [Beta 
vulgaris subsp. vulgaris]
 emb|CAC43293.1| putative phosphoenolpyruvate carboxylase kinase [Beta vulgaris]
Length=282

 Score =   129 bits (325),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ILYIML GV PF GDT  +TF AVLR NLRFP KIFRS+SPEAKDL+RKM+ +DVSRRF 
Sbjct  200  ILYIMLGGVPPFYGDTVEDTFAAVLRGNLRFPTKIFRSISPEAKDLMRKMLSKDVSRRFS  259

Query  182  AEQVLRHPWVMSEGETRSMADMN  250
            AEQVLRHPWV S G T +M DM+
Sbjct  260  AEQVLRHPWVTSGGMTSTMNDMS  282



>ref|XP_006487723.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 1-like [Citrus 
sinensis]
Length=275

 Score =   129 bits (324),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 60/79 (76%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LY MLAG+ PF G+T  E FEAVLRANLRFP +IFRSVSP AKDLLRKMICRDVSRR  
Sbjct  196  VLYTMLAGIPPFYGETAAEIFEAVLRANLRFPTRIFRSVSPAAKDLLRKMICRDVSRRLS  255

Query  182  AEQVLRHPWVMSEGETRSM  238
            AEQ LRHPW++S GET SM
Sbjct  256  AEQALRHPWILSGGETTSM  274



>ref|XP_010262311.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 1-like [Nelumbo 
nucifera]
Length=277

 Score =   129 bits (323),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            I+YIMLAG+ PF G++ TE FEAVLRANLRFP +IF SVSP AKDLLR+M+C+DVSRRF 
Sbjct  195  IMYIMLAGIPPFYGESATEIFEAVLRANLRFPTRIFHSVSPAAKDLLRRMLCKDVSRRFS  254

Query  182  AEQVLRHPWVMSEGETRSMADM  247
            AEQVLRHPW+ S G TR ++D+
Sbjct  255  AEQVLRHPWITSGGGTRLLSDL  276



>ref|XP_009765234.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 1-like [Nicotiana 
sylvestris]
Length=298

 Score =   129 bits (324),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ILYIMLAG+ PF GD+T E FEAVLRANLRFP +IFRSVSP AKDLLR M+C+DVSRRF 
Sbjct  216  ILYIMLAGIPPFYGDSTVEIFEAVLRANLRFPMRIFRSVSPAAKDLLRGMLCKDVSRRFS  275

Query  182  AEQVLRHPWVMSEGETRSMA  241
            AEQVLRHPW+ S  E R++A
Sbjct  276  AEQVLRHPWITSNDERRAVA  295



>ref|XP_010102238.1| Phosphoenolpyruvate carboxylase kinase 1 [Morus notabilis]
 gb|EXB93181.1| Phosphoenolpyruvate carboxylase kinase 1 [Morus notabilis]
Length=274

 Score =   128 bits (322),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ILY+MLAG+ PF G++ TE FEAVLR NLRFP ++FRSVSP AKDLLRKMICRDVSRR  
Sbjct  195  ILYVMLAGIPPFYGESATEIFEAVLRGNLRFPTRVFRSVSPAAKDLLRKMICRDVSRRLT  254

Query  182  AEQVLRHPWVMSEGETRSM  238
            A+Q LRHPW++S GET SM
Sbjct  255  ADQALRHPWILSGGETGSM  273



>ref|XP_007030432.1| Phosphoenolpyruvate carboxylase kinase 1 [Theobroma cacao]
 gb|EOY10934.1| Phosphoenolpyruvate carboxylase kinase 1 [Theobroma cacao]
Length=274

 Score =   128 bits (321),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LY+MLAGV PF G+T  E FEAVLR NLRFP +IFRSVS EAKDLLRKMICRDVS+R  
Sbjct  195  VLYVMLAGVPPFYGETAEEIFEAVLRGNLRFPTRIFRSVSAEAKDLLRKMICRDVSKRLS  254

Query  182  AEQVLRHPWVMSEGETRSM  238
            AEQVLRHPW+++ GET SM
Sbjct  255  AEQVLRHPWILNGGETTSM  273



>ref|XP_002325771.2| phosphoenolpyruvate-carboxylase kinase family protein [Populus 
trichocarpa]
 gb|EEF00153.2| phosphoenolpyruvate-carboxylase kinase family protein [Populus 
trichocarpa]
Length=276

 Score =   128 bits (321),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LY MLAG  PF G+T  E FEAV+R NLRFP K+FR+VSPEAKDLLRKMICRDVSRRF 
Sbjct  197  VLYAMLAGFPPFYGETVEEIFEAVVRGNLRFPPKVFRNVSPEAKDLLRKMICRDVSRRFS  256

Query  182  AEQVLRHPWVMSEGETRSM  238
            AEQ LRHPW++S GET SM
Sbjct  257  AEQALRHPWILSGGETVSM  275



>ref|XP_011036288.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 2-like isoform 
X2 [Populus euphratica]
 ref|XP_011036290.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 2-like isoform 
X3 [Populus euphratica]
Length=276

 Score =   128 bits (321),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LY MLAG  PF G+T  E FEAV+R NLRFP K+FR+VSPEAKDLLRKMICRDVSRRF 
Sbjct  197  VLYAMLAGFPPFYGETVEEIFEAVVRGNLRFPPKVFRNVSPEAKDLLRKMICRDVSRRFS  256

Query  182  AEQVLRHPWVMSEGETRSM  238
            AEQ LRHPW++S GET SM
Sbjct  257  AEQALRHPWILSGGETVSM  275



>ref|XP_011036287.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 2-like isoform 
X1 [Populus euphratica]
Length=276

 Score =   128 bits (321),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LY MLAG  PF G+T  E FEAV+R NLRFP K+FR+VSPEAKDLLRKMICRDVSRRF 
Sbjct  197  VLYAMLAGFPPFYGETVEEIFEAVVRGNLRFPPKVFRNVSPEAKDLLRKMICRDVSRRFS  256

Query  182  AEQVLRHPWVMSEGETRSM  238
            AEQ LRHPW++S GET SM
Sbjct  257  AEQALRHPWILSGGETVSM  275



>ref|XP_006350688.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 1-like [Solanum 
tuberosum]
Length=278

 Score =   128 bits (321),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ILYIMLAGV PF GD+ TE FEAVLRANLRFP++IF SVSP AKDLLR+M+ +DVSRRF 
Sbjct  197  ILYIMLAGVPPFFGDSATEIFEAVLRANLRFPSRIFHSVSPAAKDLLRRMLSKDVSRRFS  256

Query  182  AEQVLRHPWVMSEGETRSMA  241
            AEQVLRHPW+ S GE R++A
Sbjct  257  AEQVLRHPWMTSNGEIRTVA  276



>gb|KDO41194.1| hypothetical protein CISIN_1g023898mg [Citrus sinensis]
Length=275

 Score =   127 bits (320),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LY MLAG+ PF G+T  E FEAVLRANLRFP +IFRSVSP AKDLLRKMICRDVSRR  
Sbjct  196  VLYTMLAGIPPFYGETAAEIFEAVLRANLRFPTRIFRSVSPAAKDLLRKMICRDVSRRLS  255

Query  182  AEQVLRHPWVMSEGETRSM  238
            AEQ LRHPW++  GET SM
Sbjct  256  AEQALRHPWILGGGETTSM  274



>gb|AAO61489.1| phosphoenolpyruvate carboxylase kinase 1, partial [Solanum tuberosum]
Length=266

 Score =   127 bits (320),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ILYIML+GV PF G+T TETF+AVLR NLRFP + FRSVS EAKDLLRK+IC+DVSRRF 
Sbjct  190  ILYIMLSGVPPFYGETPTETFQAVLRGNLRFPTRNFRSVSSEAKDLLRKIICKDVSRRFS  249

Query  182  AEQVLRHPWVMSEGETR  232
            AEQVLRHPWV++ GETR
Sbjct  250  AEQVLRHPWVINGGETR  266



>gb|KHG11424.1| Phosphoenolpyruvate carboxylase kinase 1 -like protein [Gossypium 
arboreum]
Length=275

 Score =   127 bits (319),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LY+MLAGV PF G+T  E FEAVLR NLRFP++IFRSVS E KDLLRKMICRDVSRR+ 
Sbjct  196  VLYVMLAGVPPFYGETADEIFEAVLRGNLRFPSRIFRSVSAEVKDLLRKMICRDVSRRWS  255

Query  182  AEQVLRHPWVMSEGETRSM  238
            AEQVLRHPW+++ GET SM
Sbjct  256  AEQVLRHPWILNGGETISM  274



>ref|NP_001238645.1| phosphoenolpyruvate-carboxylase kinase [Glycine max]
 gb|AAN12515.1| phosphoenolpyruvate carboxylase kinase [Glycine max]
 gb|AAN12516.1| phosphoenolpyruvate carboxylase kinase [Glycine max]
 gb|AAQ82624.1| phosphoenolpyruvate-carboxylase kinase [Glycine max]
 gb|AAQ82625.1| phosphoenolpyruvate-carboxylase kinase [Glycine max]
Length=274

 Score =   127 bits (318),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ILYIMLAG+ PF GD+  E FEAV+RANLRFP++IFR+VSP AKDLLRKMICRD SRRF 
Sbjct  195  ILYIMLAGIPPFYGDSAAEIFEAVVRANLRFPSRIFRTVSPAAKDLLRKMICRDSSRRFS  254

Query  182  AEQVLRHPWVMSEGETRSM  238
            AEQ LRHPW++S G+T  +
Sbjct  255  AEQALRHPWILSAGDTAEL  273



>ref|XP_004495570.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 1-like [Cicer 
arietinum]
Length=274

 Score =   126 bits (317),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LYIML+G+ PF GD+  E FEAV+RANLRFP++IFRSVSP AKDLLRKMICRD SRRF 
Sbjct  195  LLYIMLSGIPPFYGDSAAEIFEAVIRANLRFPSRIFRSVSPAAKDLLRKMICRDDSRRFS  254

Query  182  AEQVLRHPWVMSEGETRSM  238
            AEQ LRHPW++S GET ++
Sbjct  255  AEQALRHPWIVSGGETTNL  273



>ref|XP_010043286.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 2 [Eucalyptus 
grandis]
 gb|KCW85298.1| hypothetical protein EUGRSUZ_B02141 [Eucalyptus grandis]
Length=280

 Score =   126 bits (317),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ILYIM+AGV PF GD+  E FE V+R NLRFP K+FR VS + KDLLRKMICRDV+RRF 
Sbjct  198  ILYIMVAGVPPFYGDSVEEIFEKVVRGNLRFPTKLFRGVSADLKDLLRKMICRDVNRRFS  257

Query  182  AEQVLRHPWVMSEGETRSMADM  247
            AEQ LRHPW+++ GET S+ADM
Sbjct  258  AEQALRHPWILNGGETNSLADM  279



>emb|CAL25341.1| phosphoenolpyruvate carboxylase kinase [Platanus x acerifolia]
Length=80

 Score =   120 bits (302),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +2

Query  11   IMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFCAEQ  190
            IMLAGV PF G++  E FEAVLR NLRFP +IF SVSP AKDLLR+M+C+DVSRRF AEQ
Sbjct  1    IMLAGVPPFYGESAAEIFEAVLRGNLRFPTRIFHSVSPVAKDLLRRMLCKDVSRRFSAEQ  60

Query  191  VLRHPWVMSEGETRSMADMN  250
            VL HPW+ S GE  SM D+ 
Sbjct  61   VLSHPWITSRGEASSMVDLT  80



>ref|XP_006442697.1| hypothetical protein CICLE_v10020693mg [Citrus clementina]
 gb|ESR55937.1| hypothetical protein CICLE_v10020693mg [Citrus clementina]
Length=275

 Score =   126 bits (316),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LY +LAG+ PF G+T  E FEAVLRANLRFP +IFRSVSP AKDLLRKMICRDVSRR  
Sbjct  196  VLYTILAGIPPFYGETAAEIFEAVLRANLRFPTRIFRSVSPAAKDLLRKMICRDVSRRLS  255

Query  182  AEQVLRHPWVMSEGETRSM  238
            AEQ LRHPW++  GET SM
Sbjct  256  AEQALRHPWILGGGETTSM  274



>ref|NP_001234304.1| phosphoenolpyruvate carboxylase kinase 2 [Solanum lycopersicum]
 gb|AAO32318.1| phosphoenolpyruvate carboxylase kinase 2 [Solanum lycopersicum]
 gb|AAO32075.1| phosphoenolpyruvate carboxylase kinase 2 [Solanum lycopersicum]
Length=278

 Score =   126 bits (316),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ILYIMLAGV PF GD+ +E FEAVLRANLRFP +IF SVSP AKDLLR+M+ +DVSRRF 
Sbjct  197  ILYIMLAGVPPFFGDSASEIFEAVLRANLRFPPRIFHSVSPAAKDLLRRMLSKDVSRRFS  256

Query  182  AEQVLRHPWVMSEGETRSMA  241
            AEQVLRHPW+ S GE R++A
Sbjct  257  AEQVLRHPWMTSNGEIRTVA  276



>ref|XP_009601335.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 1-like isoform 
X1 [Nicotiana tomentosiformis]
Length=278

 Score =   125 bits (315),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            I+YIMLAG+ PF G++ TE FEAVLRANLRFP +IF+SVSP AKDLLR+M+ +DVSRRF 
Sbjct  197  IMYIMLAGIPPFYGESATEIFEAVLRANLRFPTRIFQSVSPAAKDLLRRMLSKDVSRRFS  256

Query  182  AEQVLRHPWVMSEGETRSMA  241
            AEQVLRH WV S GETR++A
Sbjct  257  AEQVLRHTWVTSNGETRTVA  276



>ref|XP_006354488.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 1-like [Solanum 
tuberosum]
Length=279

 Score =   125 bits (314),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 57/77 (74%), Positives = 66/77 (86%), Gaps = 0/77 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ILYIMLAG+ PF GD+T E FEAVLRANLRFP +IFRSVSP AKDLLR+M+C+D+SRRF 
Sbjct  197  ILYIMLAGIPPFYGDSTEEIFEAVLRANLRFPTRIFRSVSPAAKDLLRRMLCKDISRRFS  256

Query  182  AEQVLRHPWVMSEGETR  232
            AEQVLRHPW+ S   T+
Sbjct  257  AEQVLRHPWITSNDGTK  273



>ref|XP_007144008.1| hypothetical protein PHAVU_007G121500g [Phaseolus vulgaris]
 gb|ESW16002.1| hypothetical protein PHAVU_007G121500g [Phaseolus vulgaris]
Length=274

 Score =   124 bits (312),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ILYIMLAGV PF G++  E FEAV+RANLRFP++IFR+VSP AKDLLRK+ICRD SRRF 
Sbjct  195  ILYIMLAGVPPFYGESAAEIFEAVVRANLRFPSRIFRTVSPAAKDLLRKLICRDPSRRFS  254

Query  182  AEQVLRHPWVMSEGETRSM  238
            AEQ LRHPW++S G+T  M
Sbjct  255  AEQALRHPWILSAGDTAHM  273



>ref|XP_004302084.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 1-like isoform 
2 [Fragaria vesca subsp. vesca]
Length=275

 Score =   124 bits (312),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 55/79 (70%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ++YIML G+ PF G+T TE FEAVLR NLRFP K+FR VSP AKDLLRKM+CRDVSRR  
Sbjct  196  MMYIMLGGIPPFYGETATEIFEAVLRGNLRFPPKVFRGVSPAAKDLLRKMMCRDVSRRLS  255

Query  182  AEQVLRHPWVMSEGETRSM  238
            AEQ LRHPW++S GE+  M
Sbjct  256  AEQALRHPWILSGGESNPM  274



>ref|XP_008218512.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 1-like [Prunus 
mume]
Length=263

 Score =   124 bits (310),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 55/79 (70%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LYIML G+ PF G++ +E FEAVLR NLRFP K+FRSVSP AKDLLRKMICRDVSRRF 
Sbjct  184  MLYIMLGGIPPFYGESASEIFEAVLRGNLRFPPKVFRSVSPAAKDLLRKMICRDVSRRFS  243

Query  182  AEQVLRHPWVMSEGETRSM  238
            A+Q LRHPW++S GE   +
Sbjct  244  ADQALRHPWILSGGEANPI  262



>ref|XP_004247730.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 1-like [Solanum 
lycopersicum]
Length=285

 Score =   123 bits (309),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 57/77 (74%), Positives = 65/77 (84%), Gaps = 0/77 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ILYIMLAG+ PF GD+T E FEAVLRANLRFP + FRSVSP AKDLLR+M+C+DVSRRF 
Sbjct  203  ILYIMLAGMPPFYGDSTEEIFEAVLRANLRFPTRTFRSVSPAAKDLLRRMLCKDVSRRFS  262

Query  182  AEQVLRHPWVMSEGETR  232
            AEQVLRHPW+ S   T+
Sbjct  263  AEQVLRHPWITSNDGTK  279



>ref|NP_001236660.1| phosphoenolpyruvate carboxylase kinase [Glycine max]
 gb|AAN06939.1| phosphoenolpyruvate carboxylase kinase [Glycine max]
 gb|AAQ81581.1| phosphoenolpyruvate-carboxylase kinase [Glycine max]
Length=274

 Score =   123 bits (309),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 56/79 (71%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ILYIMLAG+ PF GD+  E FEAV+RANLRFP++IFR+VSP AKDLLRKMI RD SRRF 
Sbjct  195  ILYIMLAGIPPFYGDSAAEIFEAVVRANLRFPSRIFRTVSPAAKDLLRKMISRDSSRRFS  254

Query  182  AEQVLRHPWVMSEGETRSM  238
            AEQ LRHPW++S G+T  +
Sbjct  255  AEQALRHPWILSAGDTAEL  273



>gb|ABO65213.1| phosphoenolpyruvate carboxylase kinase [Kalanchoe pinnata]
Length=276

 Score =   123 bits (308),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ILYIMLAG+ PF G++ TE F+AVLR NLRFP + F SVSP AKDLL+KM+C+DVSRR  
Sbjct  196  ILYIMLAGIPPFYGESATEIFQAVLRGNLRFPTRPFHSVSPAAKDLLKKMLCKDVSRRLS  255

Query  182  AEQVLRHPWVMSEGETRSMAD  244
            A+QVLRHPW+MS G+ RSM +
Sbjct  256  ADQVLRHPWMMSGGDLRSMTN  276



>gb|AAN12513.1| phosphoenolpyruvate carboxylase kinase [Glycine max]
 gb|AAN12514.1| phosphoenolpyruvate carboxylase kinase [Glycine max]
Length=274

 Score =   122 bits (306),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/79 (70%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ILYIMLAG+ PF GD+  E FEAV++ANLRFP++IFR+VSP AKDLLRKMI RD SRRF 
Sbjct  195  ILYIMLAGIPPFYGDSAAEIFEAVVKANLRFPSRIFRTVSPAAKDLLRKMISRDSSRRFS  254

Query  182  AEQVLRHPWVMSEGETRSM  238
            AEQ LRHPW++S G+T  +
Sbjct  255  AEQALRHPWILSAGDTAEL  273



>emb|CBI22394.3| unnamed protein product [Vitis vinifera]
Length=241

 Score =   120 bits (302),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ILY+MLAGV PF GD+  E FEAVLR NLRFP +IFR+VSP AKDLLRKMIC+DVSRR  
Sbjct  166  ILYVMLAGVPPFYGDSAAEIFEAVLRGNLRFPTRIFRTVSPAAKDLLRKMICKDVSRRLS  225

Query  182  AEQVLRHPWVMSEGE  226
            AEQ LRHPW+ + GE
Sbjct  226  AEQALRHPWITNGGE  240



>gb|AAF05112.1|AF158091_1 phosphoenolpyruvate carboxylase-kinase [Mesembryanthemum crystallinum]
Length=279

 Score =   121 bits (304),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ILYIML GV PF G+T  ETFEAVLR NLRFPA+IFR+VS +A+DLLRKM+C+DVSRRF 
Sbjct  202  ILYIMLGGVPPFYGETVEETFEAVLRGNLRFPARIFRNVSTQARDLLRKMMCKDVSRRFS  261

Query  182  AEQVLRHPWVMSEG  223
            AEQVLRHPWV S G
Sbjct  262  AEQVLRHPWVTSGG  275



>ref|XP_008350641.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 2-like [Malus 
domestica]
Length=112

 Score =   117 bits (292),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 63/79 (80%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ++YIML G+ PF G++ TE F+AVLR NLRFP K+FRSVSP AKDLLRKMI RDVSRR  
Sbjct  33   MMYIMLGGIPPFCGESATEIFQAVLRGNLRFPPKVFRSVSPAAKDLLRKMISRDVSRRLS  92

Query  182  AEQVLRHPWVMSEGETRSM  238
            A+Q LRHPW++S GE   +
Sbjct  93   ADQALRHPWILSGGEANPI  111



>emb|CAN74792.1| hypothetical protein VITISV_001997 [Vitis vinifera]
Length=271

 Score =   121 bits (303),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ILY+MLAGV PF GD+  E FEAVLR NLRFP +IFR+VSP AKDLLRKMIC+DVSRR  
Sbjct  196  ILYVMLAGVPPFYGDSAAEIFEAVLRGNLRFPTRIFRTVSPAAKDLLRKMICKDVSRRLS  255

Query  182  AEQVLRHPWVMSEGE  226
            AEQ LRHPW+ + GE
Sbjct  256  AEQALRHPWITNGGE  270



>ref|XP_007205705.1| hypothetical protein PRUPE_ppa009865mg [Prunus persica]
 gb|EMJ06904.1| hypothetical protein PRUPE_ppa009865mg [Prunus persica]
Length=274

 Score =   121 bits (303),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LYIML G+ PF G++ ++ FEAVLR NLRFP K+FRSVSP AKDLLRKMICRDVSRRF 
Sbjct  195  MLYIMLGGIPPFYGESASDIFEAVLRGNLRFPPKVFRSVSPAAKDLLRKMICRDVSRRFS  254

Query  182  AEQVLRHPWVMSEGETRSM  238
            A+Q LRHPW++  GE   +
Sbjct  255  ADQALRHPWILGGGEANPI  273



>ref|XP_002265952.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 1 [Vitis vinifera]
Length=271

 Score =   121 bits (303),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ILY+MLAGV PF GD+  E FEAVLR NLRFP +IFR+VSP AKDLLRKMIC+DVSRR  
Sbjct  196  ILYVMLAGVPPFYGDSAAEIFEAVLRGNLRFPTRIFRTVSPAAKDLLRKMICKDVSRRLS  255

Query  182  AEQVLRHPWVMSEGE  226
            AEQ LRHPW+ + GE
Sbjct  256  AEQALRHPWITNGGE  270



>ref|XP_011038521.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 2 [Populus 
euphratica]
Length=302

 Score =   121 bits (304),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LY++LAG  PF G+T  E F+AV+R NLRFP K+FR+VSPEAKDLLRKM+CRDVSRRF 
Sbjct  223  VLYVLLAGFPPFYGETVEEIFQAVVRGNLRFPPKVFRNVSPEAKDLLRKMVCRDVSRRFS  282

Query  182  AEQVLRHPWVMSEGETRSM  238
            AEQ L HPW++S GE  SM
Sbjct  283  AEQALWHPWILSGGEAVSM  301



>gb|AIR93786.1| phosphoenolpyruvate carboxylase kinase [Kalanchoe fedtschenkoi]
Length=272

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 55/77 (71%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ILYIMLAG+ PF G++ TE F+AVLR NLRFP + F SVSP AKDLLRKM+C+DVSRR  
Sbjct  196  ILYIMLAGIPPFYGESATEIFQAVLRGNLRFPTRPFHSVSPAAKDLLRKMLCKDVSRRLS  255

Query  182  AEQVLRHPWVMSEGETR  232
            A+QVLRHPW+MS GE R
Sbjct  256  ADQVLRHPWMMSGGELR  272



>ref|XP_004305051.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 1-like [Fragaria 
vesca subsp. vesca]
Length=275

 Score =   120 bits (301),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 62/79 (78%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LYIML G  PF G+T TE FEAVLR NLRFP K+F+ VSP AKDLLRKM+CRDVSRR  
Sbjct  196  MLYIMLGGNPPFYGETATEIFEAVLRGNLRFPPKVFKGVSPAAKDLLRKMMCRDVSRRLS  255

Query  182  AEQVLRHPWVMSEGETRSM  238
            AE+ LRHPW++S GE   M
Sbjct  256  AEEALRHPWILSGGEANPM  274



>ref|XP_008785247.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 2-like [Phoenix 
dactylifera]
Length=280

 Score =   120 bits (300),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LYIML+G+ PF GDT  E FEAVLRANLRFP +IF +VSP AKDLLR+M+C+D+SRRF 
Sbjct  198  VLYIMLSGMPPFYGDTAVEIFEAVLRANLRFPTRIFHTVSPMAKDLLRRMLCKDISRRFS  257

Query  182  AEQVLRHPWVMSEGETRS  235
            AEQVLRHPW+ S G  R+
Sbjct  258  AEQVLRHPWITSGGGLRA  275



>ref|XP_008224360.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 1-like [Prunus 
mume]
Length=275

 Score =   120 bits (300),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 64/81 (79%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LYIMLAG  PF G+T  E FEAVLRANLRFP+++F  VS   KDLLR+M+C+DVSRRF 
Sbjct  195  VLYIMLAGFPPFYGETAAEIFEAVLRANLRFPSRVFNGVSASVKDLLRRMLCKDVSRRFS  254

Query  182  AEQVLRHPWVMSEGETRSMAD  244
            AEQVLRHPW+ S G  R+ AD
Sbjct  255  AEQVLRHPWITSGGGARAGAD  275



>ref|XP_007035108.1| Phosphoenolpyruvate carboxylase kinase 1, putative [Theobroma 
cacao]
 gb|EOY06034.1| Phosphoenolpyruvate carboxylase kinase 1, putative [Theobroma 
cacao]
Length=270

 Score =   120 bits (300),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ILYIMLAG  PF G+T  E FEAVLR NLRFP ++F+SVSP AKDLLRKM+C+DVSRRF 
Sbjct  197  ILYIMLAGFPPFYGETVVEIFEAVLRGNLRFPVRVFQSVSPAAKDLLRKMLCKDVSRRFS  256

Query  182  AEQVLRHPWVMSEG  223
            AEQVLRHPW+ + G
Sbjct  257  AEQVLRHPWITTGG  270



>ref|XP_010550413.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 1 [Tarenaya 
hassleriana]
Length=284

 Score =   120 bits (300),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LY MLAG  PF G+T  E FEAV+R NLRFP KIFR +S  AKDLLRKMICRDVSRRF 
Sbjct  204  VLYTMLAGAPPFYGETAEEIFEAVIRGNLRFPPKIFRGISSSAKDLLRKMICRDVSRRFS  263

Query  182  AEQVLRHPWVMSEGETRS  235
            AEQ LRHPW+++ GET +
Sbjct  264  AEQALRHPWIVNAGETDA  281



>ref|XP_007222516.1| hypothetical protein PRUPE_ppa009846mg [Prunus persica]
 gb|EMJ23715.1| hypothetical protein PRUPE_ppa009846mg [Prunus persica]
Length=275

 Score =   119 bits (297),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 63/81 (78%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LYIMLAG  PF G+T  E FEAVLRANLRFP ++F  VS   KDLLR+M+C+DVSRRF 
Sbjct  195  VLYIMLAGFPPFYGETAEEIFEAVLRANLRFPVRVFNGVSASVKDLLRRMLCKDVSRRFS  254

Query  182  AEQVLRHPWVMSEGETRSMAD  244
            AEQVLRHPW+ S G  R+ AD
Sbjct  255  AEQVLRHPWITSGGGARAGAD  275



>ref|XP_003590952.1| Calcium-dependent protein kinase [Medicago truncatula]
 gb|AES61203.1| phosphoenolpyruvate carboxylase-related kinase [Medicago truncatula]
Length=274

 Score =   119 bits (297),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LYIML+G+ PF GD+T E FE+V+RANLRFP++IFRSVS  AKDLLRKM+CRD SRRF 
Sbjct  195  LLYIMLSGIPPFYGDSTAEIFESVIRANLRFPSRIFRSVSSSAKDLLRKMMCRDDSRRFS  254

Query  182  AEQVLRHPWVMSEGETRSM  238
            AEQ L HPW++S GE  ++
Sbjct  255  AEQALAHPWIVSGGEAMNL  273



>ref|XP_006649148.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 2-like [Oryza 
brachyantha]
Length=250

 Score =   118 bits (296),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LY+ML+G +PF G T  E FE+VLR+NLRFP + F SVSPEAKDL+R+M+C+DVSRRF 
Sbjct  171  VLYMMLSGTVPFYGATAAEIFESVLRSNLRFPPRAFASVSPEAKDLMRRMLCKDVSRRFS  230

Query  182  AEQVLRHPWVMSEGETRSMA  241
            A+QVLRHPW++S G T +M 
Sbjct  231  ADQVLRHPWIVSRGGTVAMG  250



>ref|XP_004142534.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 1-like [Cucumis 
sativus]
 ref|XP_004171413.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 1-like [Cucumis 
sativus]
 gb|KGN66776.1| hypothetical protein Csa_1G690150 [Cucumis sativus]
Length=276

 Score =   119 bits (297),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ILY MLAG  PF G++  E FEAVLR NLRFP ++FRSVS  AKDL++KMICRDVSRRF 
Sbjct  196  ILYTMLAGFPPFYGESAAEVFEAVLRGNLRFPTRVFRSVSSAAKDLMKKMICRDVSRRFS  255

Query  182  AEQVLRHPWVMSEGETRS  235
            AEQ LRHPW++S GE  S
Sbjct  256  AEQALRHPWILSGGEATS  273



>gb|ABO65214.1| phosphoenolpyruvate carboxylase kinase [Kalanchoe daigremontiana]
Length=272

 Score =   118 bits (296),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/77 (70%), Positives = 63/77 (82%), Gaps = 0/77 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ILYIMLAG+ PF G++ TE F+AV R NLRFP + F SVSP AKDLLRKM+C+DVSRR  
Sbjct  196  ILYIMLAGIPPFYGESATEIFQAVSRGNLRFPTRSFHSVSPAAKDLLRKMLCKDVSRRLS  255

Query  182  AEQVLRHPWVMSEGETR  232
            A+QVLRHPW+MS GE R
Sbjct  256  ADQVLRHPWMMSGGELR  272



>ref|XP_010934324.1| PREDICTED: LOW QUALITY PROTEIN: phosphoenolpyruvate carboxylase 
kinase 2-like [Elaeis guineensis]
Length=281

 Score =   118 bits (296),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 54/77 (70%), Positives = 63/77 (82%), Gaps = 0/77 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LYIML+G+ PF GDT  E FE VLRANLRFP +IFR+VSP AKDLLR+M+C+DVSRRF 
Sbjct  198  VLYIMLSGMPPFYGDTAVEIFEKVLRANLRFPTRIFRTVSPAAKDLLRRMLCKDVSRRFS  257

Query  182  AEQVLRHPWVMSEGETR  232
            AEQVL HPW+ S G  R
Sbjct  258  AEQVLGHPWITSGGGLR  274



>ref|XP_002319653.1| phosphoenolpyruvate-carboxylase kinase family protein [Populus 
trichocarpa]
 gb|EEE95576.1| phosphoenolpyruvate-carboxylase kinase family protein [Populus 
trichocarpa]
Length=273

 Score =   117 bits (294),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 52/75 (69%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LY++LAG  PF G+T  E F+AV+R NLRFP K+FR+VSPEAKDLLRKMICRDVSRRF 
Sbjct  199  VLYVLLAGFPPFYGETAEEIFQAVVRGNLRFPPKVFRNVSPEAKDLLRKMICRDVSRRFS  258

Query  182  AEQVLRHPWVMSEGE  226
            AEQ L HPW++S G+
Sbjct  259  AEQALWHPWILSGGD  273



>ref|XP_008352306.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 1-like [Malus 
domestica]
Length=191

 Score =   115 bits (289),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 64/93 (69%), Gaps = 1/93 (1%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ++YIML G+ PF G++ TE FEAVLR  LRFP K  RSV P AKDLLRKMICRD SRR  
Sbjct  83   MMYIMLGGIPPFYGESATEIFEAVLRGKLRFPPKASRSVXPGAKDLLRKMICRDASRRLS  142

Query  182  AEQVLRHPWVMSEGETRSMADMNFT*TPATPTQ  280
            A+Q LRHPW++S GE   + D N T   A   Q
Sbjct  143  ADQALRHPWILSGGEANPI-DQNLTFGSADSDQ  174



>ref|XP_008791584.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 2-like [Phoenix 
dactylifera]
Length=273

 Score =   117 bits (294),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LYIMLAGV PF GDT  E FEAVLRANLRFP + F +VSP AKDLLR+M+C+DVSRRF 
Sbjct  198  VLYIMLAGVPPFYGDTAVEIFEAVLRANLRFPTRNFHAVSPAAKDLLRRMLCKDVSRRFS  257

Query  182  AEQVLRHPWVMSEG  223
            AEQVL HPW+ S G
Sbjct  258  AEQVLGHPWITSGG  271



>ref|XP_009373992.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 1-like [Pyrus 
x bretschneideri]
 ref|XP_009342479.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 1-like [Pyrus 
x bretschneideri]
Length=276

 Score =   117 bits (293),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 61/79 (77%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ++YIML G+ PF G++ TE FEAVLR NLRFP K FRSVSP AKDLLR MICRD SRR  
Sbjct  195  MMYIMLGGIPPFYGESATEIFEAVLRGNLRFPPKAFRSVSPAAKDLLRTMICRDASRRLS  254

Query  182  AEQVLRHPWVMSEGETRSM  238
            A+Q LRHPW++S GE   +
Sbjct  255  ADQALRHPWILSGGEANPI  273



>dbj|BAC20362.1| phosphoenolpyruvate carboxylase kinase [Lotus japonicus]
 dbj|BAC20363.1| phosphoenolpyruvate carboxylase kinase [Lotus japonicus]
Length=277

 Score =   117 bits (293),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 61/76 (80%), Gaps = 0/76 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ILYIML+G  PF GD+  E FEAV+R NLRFP++IFR+VSP AKDLLRKMICRD S R  
Sbjct  198  ILYIMLSGTPPFYGDSAAEIFEAVIRGNLRFPSRIFRNVSPAAKDLLRKMICRDPSNRIS  257

Query  182  AEQVLRHPWVMSEGET  229
            AEQ LRHPW +S G+T
Sbjct  258  AEQALRHPWFLSAGDT  273



>ref|XP_008388711.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 2 [Malus domestica]
Length=274

 Score =   116 bits (291),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 63/79 (80%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ++YIML G+ PF G++ TE F+AVLR NLRFP K+FRSVSP AKDLLRKMI RDVSRR  
Sbjct  195  MMYIMLGGIPPFCGESATEIFQAVLRGNLRFPPKVFRSVSPAAKDLLRKMISRDVSRRLS  254

Query  182  AEQVLRHPWVMSEGETRSM  238
            A+Q LRHPW++S GE   +
Sbjct  255  ADQALRHPWILSGGEANPI  273



>ref|XP_010104734.1| Phosphoenolpyruvate carboxylase kinase 1 [Morus notabilis]
 gb|EXC01784.1| Phosphoenolpyruvate carboxylase kinase 1 [Morus notabilis]
Length=279

 Score =   116 bits (291),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LYIMLAG  PF G++  E FEAVLRANLRFP+++F SVSP AKDLLR+M+C+DVSRRF 
Sbjct  199  VLYIMLAGFPPFYGESVVEIFEAVLRANLRFPSRVFHSVSPAAKDLLRRMLCKDVSRRFS  258

Query  182  AEQVLRHPWVMS  217
            AEQVLRHPW+ S
Sbjct  259  AEQVLRHPWITS  270



>ref|XP_010910900.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 1-like isoform 
X1 [Elaeis guineensis]
Length=280

 Score =   116 bits (291),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LY+ML+GV PF GDT  E FEAVLRANLRFP + FR++SP AKDLLR+M+C+DVSRRF 
Sbjct  198  VLYVMLSGVPPFYGDTAVEIFEAVLRANLRFPTRNFRAISPAAKDLLRRMLCKDVSRRFS  257

Query  182  AEQVLRHPWVMSEGETRS  235
            A+QVL HPW+ S   TR+
Sbjct  258  ADQVLGHPWITSGEGTRA  275



>ref|XP_008462700.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 1-like [Cucumis 
melo]
Length=276

 Score =   116 bits (290),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ILY MLAG  PF G++  E FEAVLR NLRFP ++FRSVS  AKDL++KMICRDVSRR  
Sbjct  196  ILYTMLAGFPPFYGESAAEVFEAVLRGNLRFPTRVFRSVSSAAKDLMKKMICRDVSRRLS  255

Query  182  AEQVLRHPWVMSEGETRS  235
            AEQ LRHPW++S GE  S
Sbjct  256  AEQALRHPWILSGGEGTS  273



>gb|KHN01069.1| Phosphoenolpyruvate carboxylase kinase 1 [Glycine soja]
Length=231

 Score =   114 bits (286),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LY MLAG LPFRGD+  E FEAVLRANLRFP ++F SVSP AKDLLR+M+C++VSRRF 
Sbjct  155  VLYQMLAGFLPFRGDSPVEIFEAVLRANLRFPTRVFCSVSPAAKDLLRRMLCKEVSRRFS  214

Query  182  AEQVLRHPW  208
            AEQVLRHPW
Sbjct  215  AEQVLRHPW  223



>ref|XP_004297821.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 1-like [Fragaria 
vesca subsp. vesca]
Length=275

 Score =   115 bits (288),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 51/81 (63%), Positives = 64/81 (79%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LYIMLAG  PF G+++ E F AV RANLRFPA++F SVSP  K+LLR+M+C+DVSRRF 
Sbjct  194  VLYIMLAGFPPFYGESSAEIFGAVQRANLRFPARVFHSVSPSVKELLRRMLCKDVSRRFS  253

Query  182  AEQVLRHPWVMSEGETRSMAD  244
            AEQVLRHPW+ S G   ++ D
Sbjct  254  AEQVLRHPWITSGGGATAVTD  274



>ref|XP_008438527.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 1-like [Cucumis 
melo]
Length=280

 Score =   115 bits (288),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 64/83 (77%), Gaps = 0/83 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LY+MLAG  PF G++  E F AVLRANLRFP+++F SVSP AKDLLRKM+C+DVSRR  
Sbjct  198  VLYVMLAGFPPFHGESVVEIFHAVLRANLRFPSRVFHSVSPSAKDLLRKMLCKDVSRRIS  257

Query  182  AEQVLRHPWVMSEGETRSMADMN  250
            AEQVLRHPW+ +  E  +  ++ 
Sbjct  258  AEQVLRHPWITNYVENMAETELG  280



>ref|XP_009398974.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 2-like [Musa 
acuminata subsp. malaccensis]
Length=305

 Score =   115 bits (288),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 63/75 (84%), Gaps = 1/75 (1%)
 Frame = +2

Query  2    ILYIMLAG-VLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRF  178
            ++Y+ML+G   PF GDT  ETFE V RANLRFP+++FRSVSP AKDLLR+M+CRDVSRRF
Sbjct  204  VMYMMLSGGAPPFYGDTAAETFELVARANLRFPSRVFRSVSPAAKDLLRRMLCRDVSRRF  263

Query  179  CAEQVLRHPWVMSEG  223
             AEQVLRHPW+ S G
Sbjct  264  SAEQVLRHPWITSGG  278



>gb|EAY87934.1| hypothetical protein OsI_09358 [Oryza sativa Indica Group]
Length=289

 Score =   115 bits (287),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LY+ML+G LPF G T  E F+ VLR NLRFP + F SVSPEAKDL+R+M+C+DVSRRF 
Sbjct  210  VLYMMLSGTLPFYGATAAEVFQCVLRGNLRFPPRAFASVSPEAKDLMRRMLCKDVSRRFS  269

Query  182  AEQVLRHPWVMSEGETRSMA  241
            A+QVLRHPW++S G    M 
Sbjct  270  ADQVLRHPWIVSRGGAAVMG  289



>ref|NP_001048452.1| Os02g0807000 [Oryza sativa Japonica Group]
 dbj|BAD19392.1| putative phosphoenolpyruvate carboxylase kinase [Oryza sativa 
Japonica Group]
 dbj|BAF10366.1| Os02g0807000 [Oryza sativa Japonica Group]
Length=289

 Score =   115 bits (287),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LY+ML+G LPF G T  E F+ VLR NLRFP + F SVSPEAKDL+R+M+C+DVSRRF 
Sbjct  210  VLYMMLSGTLPFYGATAAEVFQCVLRGNLRFPPRAFASVSPEAKDLMRRMLCKDVSRRFS  269

Query  182  AEQVLRHPWVMSEGETRSMA  241
            A+QVLRHPW++S G    M 
Sbjct  270  ADQVLRHPWIVSRGGAAVMG  289



>ref|XP_006298293.1| hypothetical protein CARUB_v10014357mg [Capsella rubella]
 gb|EOA31191.1| hypothetical protein CARUB_v10014357mg [Capsella rubella]
Length=278

 Score =   114 bits (286),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ++Y MLAG  PF G+T  E FE+VLR NLRFP KIF SVS EAKDLLRKMICRDVSRRF 
Sbjct  201  VIYTMLAGEPPFNGETAEEIFESVLRGNLRFPPKIFGSVSGEAKDLLRKMICRDVSRRFS  260

Query  182  AEQVLRHPWVMSEGETRS  235
            A+  LRHPWVM+ G+  S
Sbjct  261  ADDALRHPWVMNVGDLTS  278



>ref|NP_001237016.1| phosphoenolpyruvate-carboxylase kinase [Glycine max]
 gb|AAQ72692.1| phosphoenolpyruvate-carboxylase kinase [Glycine max]
 gb|AAQ72784.1| phosphoenolpyruvate-carboxylase kinase [Glycine max]
 gb|AAS75449.1| phosphoenolpyruvate carboxylase kinase 4 [Glycine max]
 gb|AAS75450.1| phosphoenolpyruvate carboxylase kinase 4 [Glycine max]
Length=270

 Score =   114 bits (286),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LY MLAG LPFRGD+  E FEAVLRANLRFP ++F SVSP AKDLLR+M+C++VSRRF 
Sbjct  194  VLYQMLAGFLPFRGDSPVEIFEAVLRANLRFPTRVFCSVSPAAKDLLRRMLCKEVSRRFS  253

Query  182  AEQVLRHPW  208
            AEQVLRHPW
Sbjct  254  AEQVLRHPW  262



>ref|XP_004134067.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 1-like [Cucumis 
sativus]
 ref|XP_004157637.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 1-like [Cucumis 
sativus]
 gb|KGN56859.1| Phosphoenolpyruvate carboxylase kinase 4 [Cucumis sativus]
Length=280

 Score =   114 bits (286),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 60/76 (79%), Gaps = 0/76 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LY+MLAG  PF G++  E F AVLRANLRFP+++F SVSP AKDLLRKM+C+DVSRR  
Sbjct  198  VLYVMLAGFPPFHGESVVEIFHAVLRANLRFPSRVFHSVSPSAKDLLRKMLCKDVSRRIS  257

Query  182  AEQVLRHPWVMSEGET  229
            AEQVLRHPW+    E 
Sbjct  258  AEQVLRHPWITRYAEN  273



>ref|XP_004954289.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 2-like [Setaria 
italica]
Length=284

 Score =   114 bits (286),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LY+ML+G +PF G T  E FEAVLR NLRFP + F  VSPEAKDL+R+M+C+DVSRRF 
Sbjct  207  VLYVMLSGTVPFGGATAGEIFEAVLRGNLRFPPRAFAGVSPEAKDLMRRMLCKDVSRRFS  266

Query  182  AEQVLRHPWVMSEGET  229
            AEQVLRHPW+++ G +
Sbjct  267  AEQVLRHPWIVTRGGS  282



>ref|XP_011073525.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 1-like [Sesamum 
indicum]
Length=281

 Score =   114 bits (286),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 63/77 (82%), Gaps = 0/77 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ILYIMLAG+ PF G++  E FE+VLRANLRFP  IF SVS EAKDLLR+M+C+D  RRF 
Sbjct  197  ILYIMLAGIPPFYGESAGEIFESVLRANLRFPRSIFSSVSSEAKDLLRRMLCKDAWRRFS  256

Query  182  AEQVLRHPWVMSEGETR  232
            A+QVLRHPW+ S G++R
Sbjct  257  ADQVLRHPWMTSGGDSR  273



>ref|XP_009339620.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 2-like [Pyrus 
x bretschneideri]
Length=288

 Score =   114 bits (286),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LYIMLAG  PF G+T  E F+AVLRANLRFPA+ F SVS + KDLLR+M+C+DVSRRF 
Sbjct  195  VLYIMLAGFPPFYGETAAEIFDAVLRANLRFPARAFNSVSADLKDLLRRMLCKDVSRRFS  254

Query  182  AEQVLRHPWVMSEG  223
            AEQVLRHPW+ S G
Sbjct  255  AEQVLRHPWITSGG  268



>ref|XP_010519961.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 2 [Tarenaya 
hassleriana]
Length=280

 Score =   114 bits (285),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ++Y MLAG  PF G+T  E FEAV+R NLRFP +IF+SVSPEAKDL+RKMICRDVSRR  
Sbjct  203  VMYTMLAGEPPFNGETAAEIFEAVVRGNLRFPPRIFQSVSPEAKDLMRKMICRDVSRRLS  262

Query  182  AEQVLRHPWVMSEGE  226
            AE+ LRHPW+ + GE
Sbjct  263  AEEALRHPWLNNGGE  277



>gb|AFK48265.1| unknown [Medicago truncatula]
Length=274

 Score =   114 bits (285),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LYIML+G+ PF GD+T E FE+V+RANLRFP++IFRSVS  AKDLLRKM+CRD  RRF 
Sbjct  195  LLYIMLSGIPPFYGDSTAEIFESVIRANLRFPSRIFRSVSSFAKDLLRKMMCRDDFRRFF  254

Query  182  AEQVLRHPWVMSEGETRSM  238
            AEQ L HPW++S GE  ++
Sbjct  255  AEQALAHPWIVSGGEAMNL  273



>ref|XP_009388072.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 2-like [Musa 
acuminata subsp. malaccensis]
Length=287

 Score =   114 bits (285),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 65/79 (82%), Gaps = 1/79 (1%)
 Frame = +2

Query  2    ILYIML-AGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRF  178
            ++Y+ML  GV PF G+T  ETF+AV+RANLRFP++ FRSVSP AKDLLR+M+C+DVSRRF
Sbjct  203  VMYMMLTGGVPPFYGETVAETFDAVVRANLRFPSRAFRSVSPAAKDLLRRMLCKDVSRRF  262

Query  179  CAEQVLRHPWVMSEGETRS  235
             AEQVLRHPW+   GE  S
Sbjct  263  SAEQVLRHPWITCGGEEPS  281



>gb|KDP40328.1| hypothetical protein JCGZ_02326 [Jatropha curcas]
Length=271

 Score =   114 bits (285),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 50/75 (67%), Positives = 60/75 (80%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LYIMLAG  PF G+T  E FE+VLR NLRFP + F SVSP  KDLLRKM+C+DVS+RF 
Sbjct  197  VLYIMLAGFPPFHGETAVEIFESVLRGNLRFPFRAFHSVSPVVKDLLRKMLCKDVSKRFS  256

Query  182  AEQVLRHPWVMSEGE  226
            AEQVLRHPW+ + G+
Sbjct  257  AEQVLRHPWITNGGD  271



>gb|EPS58774.1| hypothetical protein M569_16039, partial [Genlisea aurea]
Length=265

 Score =   114 bits (284),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ILYIMLAGV PF GD   E F+AVLR NLRFP +IFRSVS +AKDLLRKMIC+DVSRR  
Sbjct  195  ILYIMLAGVPPFYGDGPAEIFQAVLRGNLRFPPEIFRSVSSDAKDLLRKMICKDVSRRLS  254

Query  182  AEQVLRHPWVM  214
            A+QVLRHPW++
Sbjct  255  ADQVLRHPWLL  265



>ref|NP_172341.1| phosphoenolpyruvate carboxylase kinase 1 [Arabidopsis thaliana]
 sp|Q9SPK4.1|PPCK1_ARATH RecName: Full=Phosphoenolpyruvate carboxylase kinase 1; Short=AtPPCK1 
[Arabidopsis thaliana]
 gb|AAF06968.1|AF162660_1 phosphoenolpyruvate carboxylase kinase [Arabidopsis thaliana]
 gb|AAL38773.1| putative calcium-dependent protein kinase [Arabidopsis thaliana]
 gb|AAN12902.1| putative calcium-dependent protein kinase [Arabidopsis thaliana]
 gb|AEE28326.1| phosphoenolpyruvate carboxylase kinase 1 [Arabidopsis thaliana]
Length=284

 Score =   114 bits (284),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LY MLAG  PF G+T  E FEAVLR NLRFP KIFR VS  AKD LRK+IC+D SRRF 
Sbjct  204  VLYTMLAGTPPFYGETAEEIFEAVLRGNLRFPTKIFRGVSSMAKDFLRKLICKDASRRFS  263

Query  182  AEQVLRHPWVMSEGET  229
            AEQ LRHPW+   GET
Sbjct  264  AEQALRHPWIQRAGET  279



>ref|XP_003572921.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 2 [Brachypodium 
distachyon]
Length=283

 Score =   114 bits (284),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LY+ML+G +PF G T  E FE+VLR NLRFP + F SVSPEAKDL+R+M+C+DVSRRF 
Sbjct  204  VLYVMLSGTVPFYGATAPEIFESVLRGNLRFPPRAFASVSPEAKDLMRRMLCKDVSRRFS  263

Query  182  AEQVLRHPWVMSEG  223
            A+QVLRHPW+ S G
Sbjct  264  ADQVLRHPWIASRG  277



>ref|XP_002889707.1| hypothetical protein ARALYDRAFT_888100 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65966.1| hypothetical protein ARALYDRAFT_888100 [Arabidopsis lyrata subsp. 
lyrata]
Length=284

 Score =   114 bits (284),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LY MLAG  PF G+T  E FEAVLR NLRFP KIFR VS  AKD LRK+IC+D SRRF 
Sbjct  204  VLYTMLAGTPPFYGETAEEIFEAVLRGNLRFPTKIFRGVSSMAKDFLRKLICKDASRRFS  263

Query  182  AEQVLRHPWVMSEGET  229
            AEQ LRHPW+   GET
Sbjct  264  AEQALRHPWIQRAGET  279



>emb|CDX95043.1| BnaC05g06280D [Brassica napus]
Length=287

 Score =   114 bits (284),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/75 (69%), Positives = 56/75 (75%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LY MLAG  PF GDT  E FEAVLR NLRFP K+FR VS  AKD LRKMIC+D SRRF 
Sbjct  207  VLYTMLAGSPPFYGDTAEEIFEAVLRGNLRFPPKVFRGVSSMAKDFLRKMICKDASRRFS  266

Query  182  AEQVLRHPWVMSEGE  226
            AEQ LRHPW+   GE
Sbjct  267  AEQALRHPWIQRAGE  281



>ref|XP_010023952.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 2-like [Eucalyptus 
grandis]
 gb|KCW60344.1| hypothetical protein EUGRSUZ_H03060 [Eucalyptus grandis]
Length=289

 Score =   114 bits (284),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LY+MLAG  PF G++  E F AVLRANLRFP ++FRSVS  AKDLLRKM+CRDVSRRF 
Sbjct  205  VLYVMLAGFPPFYGESAAEIFGAVLRANLRFPPRVFRSVSATAKDLLRKMLCRDVSRRFS  264

Query  182  AEQVLRHPWVMSEG  223
            A+QVLRHPWV S G
Sbjct  265  ADQVLRHPWVTSFG  278



>ref|XP_010475673.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 1-like [Camelina 
sativa]
Length=284

 Score =   113 bits (282),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 56/75 (75%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LY MLAG  PF G+T  E FEAVLR NLRFP K+FR VS  AKD LRKMIC+D SRRF 
Sbjct  203  VLYTMLAGTPPFYGETAEEIFEAVLRGNLRFPTKVFRGVSSMAKDFLRKMICKDASRRFS  262

Query  182  AEQVLRHPWVMSEGE  226
            AEQ LRHPW+   GE
Sbjct  263  AEQALRHPWIQRAGE  277



>ref|XP_010489225.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 1 [Camelina 
sativa]
Length=283

 Score =   113 bits (282),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 56/75 (75%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LY MLAG  PF G+T  E FEAVLR NLRFP K+FR VS  AKD LRKMIC+D SRRF 
Sbjct  202  VLYTMLAGTPPFYGETAEEIFEAVLRGNLRFPTKVFRGVSSMAKDFLRKMICKDASRRFS  261

Query  182  AEQVLRHPWVMSEGE  226
            AEQ LRHPW+   GE
Sbjct  262  AEQALRHPWIQRAGE  276



>ref|XP_010458110.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 1-like [Camelina 
sativa]
Length=283

 Score =   113 bits (282),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 56/75 (75%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LY MLAG  PF G+T  E FEAVLR NLRFP K+FR VS  AKD LRKMIC+D SRRF 
Sbjct  202  VLYTMLAGTPPFYGETAEEIFEAVLRGNLRFPTKVFRGVSSMAKDFLRKMICKDASRRFS  261

Query  182  AEQVLRHPWVMSEGE  226
            AEQ LRHPW+   GE
Sbjct  262  AEQALRHPWIQRAGE  276



>dbj|BAJ86963.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=195

 Score =   110 bits (275),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LY+ML+G +PF G T  E FEAVLR NLRFP + F  VSPEAKDL+R+M+C+DVSRRF 
Sbjct  116  VLYMMLSGAVPFYGATAPEIFEAVLRGNLRFPPRAFAGVSPEAKDLMRRMLCKDVSRRFS  175

Query  182  AEQVLRHPWVMSEG  223
             EQVLRHPW+ S G
Sbjct  176  TEQVLRHPWIASCG  189



>ref|XP_009397678.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 2-like [Musa 
acuminata subsp. malaccensis]
Length=306

 Score =   112 bits (281),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 64/75 (85%), Gaps = 1/75 (1%)
 Frame = +2

Query  2    ILYIMLAGVLP-FRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRF  178
            ++Y++LAG LP F G+T  ETFEAV RANLRFP ++FRSVSP AKDLLR+M+C+DVSRRF
Sbjct  203  VMYMLLAGGLPPFYGETAAETFEAVSRANLRFPPRVFRSVSPAAKDLLRRMLCKDVSRRF  262

Query  179  CAEQVLRHPWVMSEG  223
             A+QVLRHPW+ + G
Sbjct  263  SADQVLRHPWITNGG  277



>ref|XP_010485831.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 2 [Camelina 
sativa]
Length=278

 Score =   112 bits (279),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ++Y MLAG  PF G+T  E FE++LR NLRFP K F SVS EAKDLLRKMICRDVSRRF 
Sbjct  200  VIYTMLAGEPPFNGETAEEIFESILRGNLRFPPKKFGSVSAEAKDLLRKMICRDVSRRFS  259

Query  182  AEQVLRHPWVMSEGETRS  235
            A+  LRHPWVM+ G  +S
Sbjct  260  ADDALRHPWVMNVGNLQS  277



>ref|XP_006417662.1| hypothetical protein EUTSA_v10008405mg [Eutrema salsugineum]
 gb|ESQ36015.1| hypothetical protein EUTSA_v10008405mg [Eutrema salsugineum]
Length=284

 Score =   112 bits (279),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LY MLAG  PF G+T  E FEAVLR NLRFP K+FR VS  AKD LRKMIC+D SRR  
Sbjct  204  VLYTMLAGAPPFYGETAEEIFEAVLRGNLRFPPKVFRGVSSMAKDFLRKMICKDASRRLS  263

Query  182  AEQVLRHPWVMSEGET  229
            AEQ LRHPW+   GET
Sbjct  264  AEQALRHPWIQRAGET  279



>ref|XP_010906537.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 1-like [Elaeis 
guineensis]
Length=278

 Score =   112 bits (279),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ILY+ML G+ PF G++  E  EAVLR NLRFP +IFR VS  AKDL+RKM+C+DVSRRF 
Sbjct  199  ILYMMLGGMAPFCGESAVEILEAVLRGNLRFPPRIFRGVSTAAKDLIRKMLCKDVSRRFS  258

Query  182  AEQVLRHPWVMSEGETRS  235
            A+QVLRHPW+++ GE  S
Sbjct  259  ADQVLRHPWMLTGGEPAS  276



>emb|CDX93546.1| BnaA06g05020D [Brassica napus]
Length=287

 Score =   112 bits (279),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 56/75 (75%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LY MLAG  PF G+T  E FEAVLR NLRFP K+FR VS  AKD LRKMIC+D SRRF 
Sbjct  207  VLYTMLAGSPPFYGETAEEIFEAVLRGNLRFPPKVFRGVSSMAKDFLRKMICKDASRRFS  266

Query  182  AEQVLRHPWVMSEGE  226
            AEQ LRHPW+   GE
Sbjct  267  AEQALRHPWIQRAGE  281



>ref|XP_009148120.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 1 [Brassica 
rapa]
Length=288

 Score =   112 bits (279),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 56/75 (75%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LY MLAG  PF G+T  E FEAVLR NLRFP K+FR VS  AKD LRKMIC+D SRRF 
Sbjct  208  VLYTMLAGSPPFYGETAEEIFEAVLRGNLRFPPKVFRGVSSMAKDFLRKMICKDASRRFS  267

Query  182  AEQVLRHPWVMSEGE  226
            AEQ LRHPW+   GE
Sbjct  268  AEQALRHPWIQRAGE  282



>ref|XP_009399471.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 2-like [Musa 
acuminata subsp. malaccensis]
Length=304

 Score =   112 bits (279),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 49/75 (65%), Positives = 64/75 (85%), Gaps = 1/75 (1%)
 Frame = +2

Query  2    ILYIMLAG-VLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRF  178
            ++Y+ML+G   PF GDT  ETFEAV RANLRFP+++FRS+SP AKDL+R+M+CRDV+RRF
Sbjct  203  VMYMMLSGGAPPFYGDTAAETFEAVARANLRFPSRVFRSLSPAAKDLMRRMLCRDVARRF  262

Query  179  CAEQVLRHPWVMSEG  223
             AEQ+L HPW++S G
Sbjct  263  SAEQILGHPWILSGG  277



>gb|EYU32551.1| hypothetical protein MIMGU_mgv1a011841mg [Erythranthe guttata]
Length=269

 Score =   110 bits (276),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ILYIMLAG+ PF G++  E FEAVLRANLRFP  IF SVS EAKDLLR+M+ +DVSRRF 
Sbjct  197  ILYIMLAGIPPFYGESAKEIFEAVLRANLRFPRSIFASVSSEAKDLLRRMLSKDVSRRFS  256

Query  182  AEQVLRHPWVMS  217
            A+QVLRHPW+ S
Sbjct  257  ADQVLRHPWMTS  268



>ref|NP_001105808.1| phosphoenolpyruvate carboxylase kinase 1 [Zea mays]
 gb|AAX07935.1| phosphoenolpyruvate carboxylase kinase 1 [Zea mays]
Length=286

 Score =   110 bits (276),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 61/76 (80%), Gaps = 0/76 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LY+ML+G +PF G T  E F+AVLR NLRFP + F +VSPEAKDLLR+M+CRDV RR  
Sbjct  204  VLYMMLSGTVPFSGATAGEIFQAVLRGNLRFPPRAFAAVSPEAKDLLRRMLCRDVWRRLS  263

Query  182  AEQVLRHPWVMSEGET  229
            AEQVLRHPW+++ G +
Sbjct  264  AEQVLRHPWIVTRGGS  279



>ref|NP_001151917.1| calcium-dependent protein kinase, isoform AK1 [Zea mays]
 gb|ACG44976.1| calcium-dependent protein kinase, isoform AK1 [Zea mays]
Length=286

 Score =   110 bits (276),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 61/76 (80%), Gaps = 0/76 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LY+ML+G +PF G T  E F+AVLR NLRFP + F +VSPEAKDLLR+M+CRDV RR  
Sbjct  204  VLYMMLSGTVPFSGATAGEIFQAVLRGNLRFPPRAFAAVSPEAKDLLRRMLCRDVWRRLS  263

Query  182  AEQVLRHPWVMSEGET  229
            AEQVLRHPW+++ G +
Sbjct  264  AEQVLRHPWIVTRGGS  279



>ref|XP_007144083.1| hypothetical protein PHAVU_007G127200g [Phaseolus vulgaris]
 gb|ESW16077.1| hypothetical protein PHAVU_007G127200g [Phaseolus vulgaris]
Length=270

 Score =   110 bits (275),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/69 (72%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LY MLAG LPFRGD+  E FEAVL ++LRFP ++F SVSP AKDLLR+M+CRDVSRRF 
Sbjct  194  VLYQMLAGFLPFRGDSPVEIFEAVLHSSLRFPTRVFSSVSPAAKDLLRRMLCRDVSRRFS  253

Query  182  AEQVLRHPW  208
            AEQVLRH W
Sbjct  254  AEQVLRHQW  262



>ref|XP_010463932.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 2-like [Camelina 
sativa]
Length=278

 Score =   110 bits (275),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ++Y MLAG  PF G+T  E FE++LR NLRFP K F SVS EAKDLLRKMICRDVSRRF 
Sbjct  200  VIYTMLAGEPPFNGETAEEIFESILRGNLRFPQKKFGSVSGEAKDLLRKMICRDVSRRFS  259

Query  182  AEQVLRHPWVMSEGETRS  235
            A+  LRHPW+M+ G   S
Sbjct  260  ADDALRHPWMMNVGNLES  277



>gb|AAF06969.1|AF162661_1 phosphoenolpyruvate carboxylase kinase [Kalanchoe fedtschenkoi]
 gb|AAF06970.1|AF162662_1 phosphoenolpyruvate carboxylase kinase [Kalanchoe fedtschenkoi]
Length=274

 Score =   110 bits (275),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 63/84 (75%), Gaps = 5/84 (6%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ILY MLAG  PF G+T  + FEAV+R NLRFP + FR+VS  AKDLLR+M+CRDVSRRF 
Sbjct  196  ILYTMLAGFPPFYGETAQDIFEAVMRGNLRFPFRAFRNVSAGAKDLLRRMLCRDVSRRFS  255

Query  182  AEQVLRHPWVMSEGETRSMADMNF  253
            AEQVLRH W++S G+     D NF
Sbjct  256  AEQVLRHSWILSAGD-----DTNF  274



>ref|XP_011030503.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 1-like [Populus 
euphratica]
Length=273

 Score =   110 bits (274),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LYIMLAG  PF G+T  + FEAVLR NLRFPA++F+SVS   KDLLR+++C+DVSRRF 
Sbjct  197  VLYIMLAGFPPFDGETADKIFEAVLRGNLRFPARVFQSVSASVKDLLRRILCKDVSRRFS  256

Query  182  AEQVLRHPWVMS  217
            AEQVLRHPWV +
Sbjct  257  AEQVLRHPWVAN  268



>emb|CDO99228.1| unnamed protein product [Coffea canephora]
Length=289

 Score =   110 bits (275),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 63/82 (77%), Gaps = 2/82 (2%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ILYIMLAG  PF GD+  E FEAVLRAN+RFP ++F S+SPE KDLLR+M+ +DV RRF 
Sbjct  197  ILYIMLAGFPPFYGDSAPEIFEAVLRANVRFPTRVFNSLSPEVKDLLRRMLSKDVIRRFS  256

Query  182  AEQVLRHPWVMSE--GETRSMA  241
            AEQVL HPW+  E  GE R +A
Sbjct  257  AEQVLGHPWMAGEGGGEIRPVA  278



>ref|XP_006378339.1| hypothetical protein POPTR_0010s08220g [Populus trichocarpa]
 gb|ERP56136.1| hypothetical protein POPTR_0010s08220g [Populus trichocarpa]
Length=273

 Score =   110 bits (274),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LYIMLAG  PF G+T  + FEAVLR NLRFPA++F+SVS   KDLLR+++C+DVSRRF 
Sbjct  197  VLYIMLAGFPPFYGETADKIFEAVLRGNLRFPARVFQSVSASVKDLLRRILCKDVSRRFS  256

Query  182  AEQVLRHPWVMS  217
            AEQVLRHPWV +
Sbjct  257  AEQVLRHPWVAN  268



>ref|XP_009399472.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 2-like [Musa 
acuminata subsp. malaccensis]
Length=304

 Score =   110 bits (275),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 67/87 (77%), Gaps = 7/87 (8%)
 Frame = +2

Query  2    ILYIML-AGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRF  178
            ++Y+ML  G  PF GDT  ETFEAV RANLRFP+++FRS+SP AKDL+R+M+CRDV+RR 
Sbjct  203  VMYMMLSGGAPPFYGDTAVETFEAVARANLRFPSRVFRSLSPAAKDLMRRMLCRDVARRL  262

Query  179  CAEQVLRHPWVMS------EGETRSMA  241
             AEQ+L HPW++S      EG TR ++
Sbjct  263  SAEQILGHPWILSGGMSPVEGTTRDLS  289



>ref|XP_010553779.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 1-like [Tarenaya 
hassleriana]
Length=283

 Score =   109 bits (273),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LY MLAG  PF G+T  E FEAV+R +LRFP KIF  VS  AKDLLRKMICRDVSRRF 
Sbjct  201  VLYTMLAGTPPFYGETAEEIFEAVIRRSLRFPPKIFLGVSSAAKDLLRKMICRDVSRRFS  260

Query  182  AEQVLRHPWVMSEG  223
            AEQ LRHPW+++ G
Sbjct  261  AEQALRHPWIVNAG  274



>dbj|BAK02595.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=284

 Score =   109 bits (273),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ++Y+ML+G +PF G T  E FEAVLR NLRFP + F  VSPEAKDL+R+M+C+DVSRR  
Sbjct  205  VVYMMLSGAVPFYGATAPEIFEAVLRGNLRFPPRAFAGVSPEAKDLMRRMLCKDVSRRLS  264

Query  182  AEQVLRHPWVMSEG  223
            AEQVLRHPW+ S G
Sbjct  265  AEQVLRHPWIASCG  278



>ref|XP_006305485.1| hypothetical protein CARUB_v10009932mg [Capsella rubella]
 gb|EOA38383.1| hypothetical protein CARUB_v10009932mg [Capsella rubella]
Length=285

 Score =   109 bits (272),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/75 (67%), Positives = 55/75 (73%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LY MLAG  PF G+T  E FEAVLR NLRFP KIFR VS  AKD LRK+IC+D SRR  
Sbjct  205  VLYTMLAGTPPFYGETAEEIFEAVLRGNLRFPTKIFRGVSSMAKDFLRKLICKDGSRRLS  264

Query  182  AEQVLRHPWVMSEGE  226
            AEQ LRHPW+   GE
Sbjct  265  AEQALRHPWIQRAGE  279



>gb|ACG40535.1| calcium-dependent protein kinase, isoform AK1 [Zea mays]
Length=286

 Score =   108 bits (271),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 60/76 (79%), Gaps = 0/76 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LY+ML+G +PF G T  E F+AVLR NLRFP + F +VSPEAKDLLR+M+CRDV RR  
Sbjct  204  VLYMMLSGTVPFSGATAGEIFQAVLRGNLRFPPRAFAAVSPEAKDLLRRMLCRDVWRRLS  263

Query  182  AEQVLRHPWVMSEGET  229
            AEQVL HPW+++ G +
Sbjct  264  AEQVLSHPWIVTRGGS  279



>dbj|BAE80227.1| phosphoenolpyruvate carboxylase kinase [Oryza sativa Japonica 
Group]
 gb|EAZ31351.1| hypothetical protein OsJ_15473 [Oryza sativa Japonica Group]
Length=285

 Score =   108 bits (271),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 62/80 (78%), Gaps = 1/80 (1%)
 Frame = +2

Query  2    ILYIML-AGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRF  178
            ++Y++L  G LPF G+T ++ F AVLR NLRFP ++F  VSP AKDL+R+M+CRDV RRF
Sbjct  203  VMYVLLTGGALPFGGETASDVFAAVLRGNLRFPPRLFSGVSPAAKDLMRRMMCRDVYRRF  262

Query  179  CAEQVLRHPWVMSEGETRSM  238
             AEQVLRHPW++S G  R +
Sbjct  263  SAEQVLRHPWIVSGGGARDV  282



>gb|AAR31831.1| phosphoenolpyruvate carboxylase kinase 2 [Clusia minor]
Length=260

 Score =   108 bits (270),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LY+MLAG  PF G+T  E FEAVLR NLRFP++ F +VS   KDLLR+++CRDVSRRF 
Sbjct  187  VLYVMLAGFPPFYGETVVEIFEAVLRGNLRFPSRAFCTVSSSVKDLLRRILCRDVSRRFT  246

Query  182  AEQVLRHPWVMSEG  223
            A+QVLRHPWV S G
Sbjct  247  ADQVLRHPWVTSGG  260



>gb|ACF87767.1| unknown [Zea mays]
 gb|AFW73951.1| putative phosphoenolpyruvate carboxylase kinase family protein 
[Zea mays]
Length=286

 Score =   108 bits (271),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 60/76 (79%), Gaps = 0/76 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LY+ML+G +PF G T  E F+AVLR NLRFP + F +VSPEAKDLLR+M+CRDV RR  
Sbjct  204  VLYMMLSGTVPFSGATAGEIFQAVLRGNLRFPPRAFAAVSPEAKDLLRRMLCRDVWRRLS  263

Query  182  AEQVLRHPWVMSEGET  229
            AEQVL HPW+++ G +
Sbjct  264  AEQVLSHPWIVTRGGS  279



>ref|XP_002882359.1| phosphoenolpyruvate carboxylase kinase 2 [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH58618.1| phosphoenolpyruvate carboxylase kinase 2 [Arabidopsis lyrata 
subsp. lyrata]
Length=278

 Score =   108 bits (270),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ++Y MLAG  PF G+T  E FE++LR NLRFP K F SVS EAKDLLRKMICRDVSRRF 
Sbjct  200  VIYTMLAGEPPFNGETAEEIFESILRGNLRFPPKKFGSVSSEAKDLLRKMICRDVSRRFS  259

Query  182  AEQVLRHPWVMSEGETRS  235
            AE  LRH W+M+ G  +S
Sbjct  260  AEDALRHSWLMNVGNLQS  277



>ref|XP_010023950.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 1-like isoform 
X2 [Eucalyptus grandis]
 gb|KCW60342.1| hypothetical protein EUGRSUZ_H03059 [Eucalyptus grandis]
Length=289

 Score =   108 bits (270),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LY+MLAG  PFRG++  E F AVLRANLRFP ++FRSVS  AKDLLR M+CRD SRR  
Sbjct  207  VLYVMLAGFPPFRGESAVEIFGAVLRANLRFPPRVFRSVSAAAKDLLRMMLCRDASRRLS  266

Query  182  AEQVLRHPWVMS  217
            A+QVL+HPWV S
Sbjct  267  ADQVLKHPWVTS  278



>ref|XP_011029828.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 1-like isoform 
X1 [Populus euphratica]
Length=273

 Score =   108 bits (269),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 58/75 (77%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LYIML G  PF G+T  E FEAVLR NLRF A++F+S S   KDLLR+M+C+DVSRRF 
Sbjct  197  VLYIMLTGFPPFYGETVVEIFEAVLRGNLRFSARVFQSASTSVKDLLRRMLCKDVSRRFS  256

Query  182  AEQVLRHPWVMSEGE  226
            AEQVLRHPWV +  +
Sbjct  257  AEQVLRHPWVANAAD  271



>ref|XP_010274775.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 1-like isoform 
X2 [Nelumbo nucifera]
Length=276

 Score =   108 bits (269),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            I+YIMLAG+ PF GD+ TE F+AVLRANLRFP +IF SVSP AKDLLRKM+C+DVSRRF 
Sbjct  195  IMYIMLAGIPPFYGDSATEIFDAVLRANLRFPTRIFHSVSPAAKDLLRKMLCKDVSRRFS  254

Query  182  AEQVLR  199
            AEQVL+
Sbjct  255  AEQVLK  260



>gb|AAR31830.1| phosphoenolpyruvate carboxylase kinase 1 [Clusia minor]
Length=258

 Score =   107 bits (268),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LY+MLAG  PF G+T  E FEAVLR NLRFP + F +VS   KDLLR+++CRDVSRRF 
Sbjct  185  VLYVMLAGFPPFYGETVVEIFEAVLRGNLRFPTRAFCTVSSSVKDLLRRILCRDVSRRFT  244

Query  182  AEQVLRHPWVMSEG  223
            A+QVLRHPWV S G
Sbjct  245  ADQVLRHPWVTSGG  258



>gb|KFK37868.1| phosphoenolpyruvate carboxylase kinase [Arabis alpina]
Length=280

 Score =   108 bits (269),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ++Y MLAG  PF G+T  E FE++LR NLRFP K F SVS EAKDLLRKMICRDVSRRF 
Sbjct  202  LIYTMLAGEPPFNGETAEEIFESILRGNLRFPPKKFGSVSVEAKDLLRKMICRDVSRRFS  261

Query  182  AEQVLRHPWVMSEGETRS  235
            AE  LRH W+M+ G  +S
Sbjct  262  AEDALRHSWMMNVGNLQS  279



>ref|XP_010553778.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 1-like [Tarenaya 
hassleriana]
Length=283

 Score =   107 bits (268),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LY ML+G  PF G+T  E FEAV+R +LRFP KIFR VS  AKD LRK ICRDVSRRF 
Sbjct  201  VLYTMLSGTPPFYGETAEEIFEAVIRRSLRFPPKIFRGVSSAAKDFLRKTICRDVSRRFS  260

Query  182  AEQVLRHPWVMSEG  223
            AEQ LRHPW+++ G
Sbjct  261  AEQALRHPWIVNAG  274



>ref|XP_006379898.1| hypothetical protein POPTR_0008s16640g [Populus trichocarpa]
 gb|ERP57695.1| hypothetical protein POPTR_0008s16640g [Populus trichocarpa]
Length=273

 Score =   107 bits (268),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LYIML G  PF G+T  E FEAVLR NLRF A++F+S S   KDLLR+M+C+DVSRRF 
Sbjct  197  VLYIMLTGFPPFYGETVVEIFEAVLRGNLRFSARVFQSASTSVKDLLRRMLCKDVSRRFS  256

Query  182  AEQVLRHPWVMS  217
            AEQVLRHPWV +
Sbjct  257  AEQVLRHPWVAN  268



>ref|NP_566229.1| phosphoenolpyruvate carboxylase kinase 2 [Arabidopsis thaliana]
 sp|Q93VK0.2|PPCK2_ARATH RecName: Full=Phosphoenolpyruvate carboxylase kinase 2; Short=AtPPCK2 
[Arabidopsis thaliana]
 gb|AEE74093.1| phosphoenolpyruvate carboxylase kinase 2 [Arabidopsis thaliana]
Length=278

 Score =   107 bits (268),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ++Y MLAG  PF G+T  + FE++LR NLRFP K F SVS EAKDLLRKMICRDVSRRF 
Sbjct  200  VIYTMLAGEPPFNGETAEDIFESILRGNLRFPPKKFGSVSSEAKDLLRKMICRDVSRRFS  259

Query  182  AEQVLRHPWVMSEGETRS  235
            AE  LRH W+M+ G  +S
Sbjct  260  AEDALRHSWMMNVGNLQS  277



>gb|AAK43710.1|AF358915_1 phosphoenolpyruvate carboxylase kinase 2 [Arabidopsis thaliana]
 gb|AAK84668.1| phosphoenolpyruvate carboxylase kinase 2 [Arabidopsis thaliana]
Length=278

 Score =   107 bits (268),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ++Y MLAG  PF G+T  + FE++LR NLRFP K F SVS EAKDLLRKMICRDVSRRF 
Sbjct  200  VIYTMLAGEPPFNGETAEDIFESILRGNLRFPPKKFGSVSSEAKDLLRKMICRDVSRRFS  259

Query  182  AEQVLRHPWVMSEGETRS  235
            AE  LRH W+M+ G  +S
Sbjct  260  AEDALRHSWMMNVGNLQS  277



>emb|CDY64699.1| BnaCnng44550D [Brassica napus]
Length=282

 Score =   107 bits (267),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ++Y MLAG  PF G+T  E FE +LR NLRFP K+F SVS EAKDLLR+MICRDVSRRF 
Sbjct  204  VIYTMLAGEPPFNGETAEEIFETILRGNLRFPRKVFGSVSAEAKDLLRRMICRDVSRRFS  263

Query  182  AEQVLRHPWVMSEGETRS  235
            AE  LRH W+++ G  +S
Sbjct  264  AEDALRHAWIVNVGNLQS  281



>ref|XP_007147221.1| hypothetical protein PHAVU_006G105900g [Phaseolus vulgaris]
 gb|ESW19215.1| hypothetical protein PHAVU_006G105900g [Phaseolus vulgaris]
Length=274

 Score =   107 bits (267),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +2

Query  5    LYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFCA  184
            LY ML+G+ PF GD+T E FEAVLR+NLRFP   FRSVS  AKDLLRKMICRD SRR  A
Sbjct  200  LYAMLSGIPPFYGDSTEEIFEAVLRSNLRFPTTNFRSVSSSAKDLLRKMICRDPSRRISA  259

Query  185  EQVLRHPWVMS  217
             Q L HPW++S
Sbjct  260  HQALNHPWILS  270



>gb|ABD39238.1| phosphoenolpyruvate carboxylase kinase 1 [Sorghum bicolor]
Length=284

 Score =   107 bits (266),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LY+ML+G +PF G T  + F+AVLR NLRFP + F +VSPEAKDL+R+M+C+DV RR  
Sbjct  205  VLYMMLSGTVPFSGATAGDVFQAVLRGNLRFPPRAFPAVSPEAKDLMRRMLCKDVWRRLS  264

Query  182  AEQVLRHPWVMSEGETRSMA  241
            AEQVL HPW+++ G + ++A
Sbjct  265  AEQVLSHPWIVTRGGSVAVA  284



>ref|XP_006653602.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 1-like [Oryza 
brachyantha]
Length=156

 Score =   104 bits (259),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 60/78 (77%), Gaps = 1/78 (1%)
 Frame = +2

Query  2    ILYIML-AGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRF  178
            ++Y++L  G LP  G+T ++ F AVLR NLRFP ++F  VSP AKDL+R+M+CRDV RRF
Sbjct  73   VMYVLLTGGALPIGGETASDVFAAVLRGNLRFPPRLFSGVSPAAKDLMRRMMCRDVYRRF  132

Query  179  CAEQVLRHPWVMSEGETR  232
             AEQVL HPW++S G +R
Sbjct  133  SAEQVLMHPWIVSGGGSR  150



>ref|XP_002454746.1| hypothetical protein SORBIDRAFT_04g036570 [Sorghum bicolor]
 gb|EES07722.1| hypothetical protein SORBIDRAFT_04g036570 [Sorghum bicolor]
Length=284

 Score =   107 bits (266),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LY+ML+G +PF G T  + F+AVLR NLRFP + F +VSPEAKDL+R+M+C+DV RR  
Sbjct  205  VLYMMLSGTVPFSGATAGDVFQAVLRGNLRFPPRAFPAVSPEAKDLMRRMLCKDVWRRLS  264

Query  182  AEQVLRHPWVMSEGETRSMA  241
            AEQVL HPW+++ G + ++A
Sbjct  265  AEQVLSHPWIVTRGGSVAVA  284



>ref|XP_002531530.1| calcium-dependent protein kinase, putative [Ricinus communis]
 gb|EEF30849.1| calcium-dependent protein kinase, putative [Ricinus communis]
Length=273

 Score =   106 bits (264),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ILY+MLAG  PF G+T  E F+AVLRANLRFP + F  VSP  KDLLR+M+C+DV +RF 
Sbjct  199  ILYVMLAGFPPFYGETAVEIFDAVLRANLRFPVRSFHGVSPAVKDLLRRMLCKDVFKRFS  258

Query  182  AEQVLRHPWVMSEG  223
            A+QVL HPW+ S G
Sbjct  259  ADQVLGHPWITSVG  272



>ref|XP_006408181.1| hypothetical protein EUTSA_v10021288mg [Eutrema salsugineum]
 gb|ESQ49634.1| hypothetical protein EUTSA_v10021288mg [Eutrema salsugineum]
Length=280

 Score =   106 bits (264),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ++Y MLAG  PF G+T  + FE ++R NLRFP K F SVS EAKDLLRKMICRDVSRRF 
Sbjct  203  VIYTMLAGEPPFNGETAEQIFETIMRGNLRFPPKKFGSVSAEAKDLLRKMICRDVSRRFS  262

Query  182  AEQVLRHPWVMSEGETRS  235
            AE  LRH W+M+ G  +S
Sbjct  263  AEDALRHAWMMNVGNLQS  280



>gb|KFK43166.1| hypothetical protein AALP_AA1G088400 [Arabis alpina]
Length=287

 Score =   106 bits (264),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 54/74 (73%), Gaps = 0/74 (0%)
 Frame = +2

Query  8    YIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFCAE  187
            Y MLAG  PF G+T  E FEAVLR NLRFP K+FR VS  AKD +RK+IC+D S RF AE
Sbjct  209  YTMLAGAPPFYGETAEEIFEAVLRGNLRFPMKVFRGVSSLAKDFMRKLICKDPSSRFSAE  268

Query  188  QVLRHPWVMSEGET  229
            Q LRHPW+   GET
Sbjct  269  QALRHPWIQRAGET  282



>emb|CDY49329.1| BnaA05g32910D [Brassica napus]
Length=282

 Score =   105 bits (263),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ++Y MLAG  PF G+T  E FE +LR NLRFP K+F SVS EAKDLLR+MICRDVSRRF 
Sbjct  204  VIYTMLAGEPPFNGETAEEIFETILRGNLRFPRKVFGSVSAEAKDLLRRMICRDVSRRFS  263

Query  182  AEQVLRHPWVMSEGETRS  235
            AE  L H W+++ G  +S
Sbjct  264  AEDALGHAWIVNVGNVQS  281



>ref|NP_001105774.1| phosphoenolpyruvate carboxylase kinase 4 [Zea mays]
 gb|AAX07938.1| phosphoenolpyruvate carboxylase kinase 4 [Zea mays]
Length=293

 Score =   105 bits (263),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 59/80 (74%), Gaps = 1/80 (1%)
 Frame = +2

Query  2    ILYIML-AGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRF  178
            ++Y +L  G LPF G+T  + F AVLR +LRFP  +F  VSP AKDL+R+M+CRDVSRRF
Sbjct  210  VMYALLSGGALPFGGETAADVFAAVLRGSLRFPPALFAGVSPAAKDLMRRMMCRDVSRRF  269

Query  179  CAEQVLRHPWVMSEGETRSM  238
             AEQVLRHPW+ S G  R +
Sbjct  270  SAEQVLRHPWIQSGGGGREL  289



>emb|CDY46740.1| BnaCnng14430D [Brassica napus]
Length=283

 Score =   105 bits (263),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 54/75 (72%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LY MLAG  PF G+T  E FEAVLR NLRFP  +FR VS  AKD LRK++C+D SRR  
Sbjct  203  VLYTMLAGAPPFYGETAEEIFEAVLRGNLRFPPSVFRGVSSMAKDFLRKLMCKDASRRLS  262

Query  182  AEQVLRHPWVMSEGE  226
            AEQ LRHPW+   GE
Sbjct  263  AEQALRHPWIQRAGE  277



>gb|ACF87617.1| unknown [Zea mays]
 gb|ACG40175.1| calcium-dependent protein kinase 2 [Zea mays]
 tpg|DAA36994.1| TPA: putative phosphoenolpyruvate carboxylase kinase family protein 
[Zea mays]
Length=293

 Score =   105 bits (263),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 59/80 (74%), Gaps = 1/80 (1%)
 Frame = +2

Query  2    ILYIML-AGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRF  178
            ++Y +L  G LPF G+T  + F AVLR +LRFP  +F  VSP AKDL+R+M+CRDVSRRF
Sbjct  210  VMYALLSGGALPFGGETAADVFAAVLRGSLRFPPALFAGVSPAAKDLMRRMMCRDVSRRF  269

Query  179  CAEQVLRHPWVMSEGETRSM  238
             AEQVLRHPW+ S G  R +
Sbjct  270  SAEQVLRHPWIQSGGGGREL  289



>ref|XP_009110877.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 1-like [Brassica 
rapa]
Length=283

 Score =   105 bits (262),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 54/75 (72%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LY MLAG  PF G+T  E FEAVLR NLRFP  +FR VS  AKD LRK++C+D SRR  
Sbjct  203  VLYTMLAGAPPFYGETAEEIFEAVLRGNLRFPPSVFRGVSSMAKDFLRKLMCKDASRRLS  262

Query  182  AEQVLRHPWVMSEGE  226
            AEQ LRHPW+   GE
Sbjct  263  AEQALRHPWIQRAGE  277



>ref|XP_006846828.1| hypothetical protein AMTR_s00148p00097360 [Amborella trichopoda]
 gb|ERN08409.1| hypothetical protein AMTR_s00148p00097360 [Amborella trichopoda]
Length=276

 Score =   105 bits (261),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LY++L G  PF G++  + F AVLR NLRFP + F  +S  AKDL+R+M+C+D ++R+ 
Sbjct  194  VLYVLLGGEPPFSGESPADIFAAVLRGNLRFPFRKFVGISTSAKDLMRRMLCKDPAKRYT  253

Query  182  AEQVLRHPWVMSEGETRSMADMN  250
            AEQVLRHPW+ S GE R+M DM 
Sbjct  254  AEQVLRHPWITSGGEQRTMVDMT  276



>ref|XP_009389066.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 2-like [Musa 
acuminata subsp. malaccensis]
Length=291

 Score =   105 bits (262),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 62/75 (83%), Gaps = 1/75 (1%)
 Frame = +2

Query  2    ILYIMLAGVLP-FRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRF  178
            ++Y+MLAG LP F G+T  E F+AV RANLRFP ++FRSVSP AKDL+R+++C+DVSRRF
Sbjct  203  VMYMMLAGGLPPFYGETAVEIFDAVARANLRFPPRVFRSVSPAAKDLMRRILCKDVSRRF  262

Query  179  CAEQVLRHPWVMSEG  223
             AEQVLRH W+ + G
Sbjct  263  SAEQVLRHRWITNRG  277



>ref|XP_004976235.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 1-like isoform 
X2 [Setaria italica]
Length=300

 Score =   105 bits (262),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 58/80 (73%), Gaps = 1/80 (1%)
 Frame = +2

Query  2    ILYIML-AGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRF  178
            + Y++L  G LPF G+T  E F AVLR +LRFP  +F  VSP AKDL+R+M+CRD SRRF
Sbjct  217  VAYVLLSGGALPFGGETPAEVFAAVLRGSLRFPPALFAGVSPAAKDLMRRMMCRDASRRF  276

Query  179  CAEQVLRHPWVMSEGETRSM  238
             AEQVLRHPW+ S G  R +
Sbjct  277  SAEQVLRHPWIQSGGGAREV  296



>dbj|BAJ86282.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=289

 Score =   105 bits (261),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 61/78 (78%), Gaps = 1/78 (1%)
 Frame = +2

Query  2    ILYIML-AGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRF  178
            +LY++L  G LPF G+T ++ F AVLR + RFP ++F  VSP AKDL+R+M+CRDVSRRF
Sbjct  206  VLYVLLTGGALPFSGETASDVFAAVLRGSPRFPPRLFSGVSPLAKDLMRRMMCRDVSRRF  265

Query  179  CAEQVLRHPWVMSEGETR  232
             A+QVLRHPW++S G  R
Sbjct  266  SADQVLRHPWIVSGGGAR  283



>ref|XP_008668658.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 4 isoform X2 
[Zea mays]
Length=348

 Score =   105 bits (262),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 59/80 (74%), Gaps = 1/80 (1%)
 Frame = +2

Query  2    ILYIML-AGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRF  178
            ++Y +L  G LPF G+T  + F AVLR +LRFP  +F  VSP AKDL+R+M+CRDVSRRF
Sbjct  265  VMYALLSGGALPFGGETAADVFAAVLRGSLRFPPALFAGVSPAAKDLMRRMMCRDVSRRF  324

Query  179  CAEQVLRHPWVMSEGETRSM  238
             AEQVLRHPW+ S G  R +
Sbjct  325  SAEQVLRHPWIQSGGGGREL  344



>ref|XP_008668659.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 4 isoform X3 
[Zea mays]
Length=338

 Score =   105 bits (262),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 59/80 (74%), Gaps = 1/80 (1%)
 Frame = +2

Query  2    ILYIML-AGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRF  178
            ++Y +L  G LPF G+T  + F AVLR +LRFP  +F  VSP AKDL+R+M+CRDVSRRF
Sbjct  255  VMYALLSGGALPFGGETAADVFAAVLRGSLRFPPALFAGVSPAAKDLMRRMMCRDVSRRF  314

Query  179  CAEQVLRHPWVMSEGETRSM  238
             AEQVLRHPW+ S G  R +
Sbjct  315  SAEQVLRHPWIQSGGGGREL  334



>ref|XP_008668657.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 4 isoform X1 
[Zea mays]
Length=349

 Score =   105 bits (262),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 59/80 (74%), Gaps = 1/80 (1%)
 Frame = +2

Query  2    ILYIML-AGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRF  178
            ++Y +L  G LPF G+T  + F AVLR +LRFP  +F  VSP AKDL+R+M+CRDVSRRF
Sbjct  266  VMYALLSGGALPFGGETAADVFAAVLRGSLRFPPALFAGVSPAAKDLMRRMMCRDVSRRF  325

Query  179  CAEQVLRHPWVMSEGETRSM  238
             AEQVLRHPW+ S G  R +
Sbjct  326  SAEQVLRHPWIQSGGGGREL  345



>ref|XP_009123980.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 2 [Brassica 
rapa]
Length=282

 Score =   104 bits (260),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ++Y MLAG  PF G+T  E FE +LR NL FP K+F SVS EAKDLLR+MICRDVSRRF 
Sbjct  204  VIYTMLAGEPPFNGETAEEIFETILRGNLMFPRKVFGSVSVEAKDLLRRMICRDVSRRFS  263

Query  182  AEQVLRHPWVMSEGETRS  235
            AE  LRH W+++ G  +S
Sbjct  264  AEDALRHAWIVNVGNLQS  281



>ref|XP_003575394.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 2-like [Brachypodium 
distachyon]
Length=292

 Score =   104 bits (260),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 61/80 (76%), Gaps = 1/80 (1%)
 Frame = +2

Query  2    ILYIML-AGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRF  178
            ++Y++L  G LPF G+T  E   AV+R ++RFP ++F  VSP AKDL+R+MICRD  RRF
Sbjct  209  VMYVLLSGGALPFGGETAKEVLSAVMRGSVRFPPRLFSGVSPAAKDLMRRMICRDEWRRF  268

Query  179  CAEQVLRHPWVMSEGETRSM  238
             AEQVLRHPW++S G +R+M
Sbjct  269  SAEQVLRHPWILSGGGSRAM  288



>ref|XP_006648852.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 1-like [Oryza 
brachyantha]
Length=201

 Score =   102 bits (255),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 59/80 (74%), Gaps = 1/80 (1%)
 Frame = +2

Query  2    ILYIML-AGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRF  178
            +LY+ML  G LPF G+T  E   +VLR ++RFP ++F  VSP AKDL+R+M+CRD  RRF
Sbjct  118  VLYVMLSGGALPFGGETAAEVLSSVLRGSVRFPPRLFAGVSPAAKDLMRRMMCRDTWRRF  177

Query  179  CAEQVLRHPWVMSEGETRSM  238
             AEQVL HPW++S G  R+M
Sbjct  178  SAEQVLGHPWIVSGGGARAM  197



>ref|XP_002446790.1| hypothetical protein SORBIDRAFT_06g022690 [Sorghum bicolor]
 gb|EES11118.1| hypothetical protein SORBIDRAFT_06g022690 [Sorghum bicolor]
Length=299

 Score =   104 bits (259),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 59/80 (74%), Gaps = 1/80 (1%)
 Frame = +2

Query  2    ILYIML-AGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRF  178
            ++Y +L  G LPF G+T  + F AVLR +LRFP  +F  VSP AKDL+R+M+CRDVSRRF
Sbjct  214  VMYALLSGGALPFGGETPADVFAAVLRGSLRFPPALFAGVSPAAKDLMRRMMCRDVSRRF  273

Query  179  CAEQVLRHPWVMSEGETRSM  238
             AEQVLRHPW+ S G  R +
Sbjct  274  SAEQVLRHPWIQSGGGVREV  293



>emb|CDY68533.1| BnaA08g31670D [Brassica napus]
Length=283

 Score =   104 bits (259),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 53/75 (71%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            + Y MLAG  PF G+T  E FEAVLR NLRFP  +FR VS  AKD LRK++C+D SRR  
Sbjct  203  VFYTMLAGAPPFYGETAEEIFEAVLRGNLRFPPSVFRGVSSMAKDFLRKLMCKDASRRLS  262

Query  182  AEQVLRHPWVMSEGE  226
            AEQ LRHPW+   GE
Sbjct  263  AEQALRHPWIQRAGE  277



>ref|XP_009601338.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 1-like isoform 
X2 [Nicotiana tomentosiformis]
Length=268

 Score =   103 bits (257),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            I+YIMLAG+ PF G++ TE FEAVLRANLRFP +IF+SVSP AKDLLR+M+ +DVSRRF 
Sbjct  197  IMYIMLAGIPPFYGESATEIFEAVLRANLRFPTRIFQSVSPAAKDLLRRMLSKDVSRRFS  256

Query  182  AEQVL  196
            AEQVL
Sbjct  257  AEQVL  261



>gb|EMS59439.1| Phosphoenolpyruvate carboxylase kinase 1 [Triticum urartu]
Length=188

 Score =   101 bits (252),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 60/80 (75%), Gaps = 1/80 (1%)
 Frame = +2

Query  2    ILYIML-AGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRF  178
            ++Y++L  G LPF G+T  +   AV+R ++RFP ++F  VSP AKDL+R+M+CRD  RRF
Sbjct  105  VMYVLLSGGALPFGGETAKDVLSAVMRGSVRFPPRLFSGVSPAAKDLMRRMMCRDEWRRF  164

Query  179  CAEQVLRHPWVMSEGETRSM  238
             AEQVLRHPW++S G  R+M
Sbjct  165  SAEQVLRHPWIVSGGGARAM  184



>ref|XP_004302083.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 1-like isoform 
1 [Fragaria vesca subsp. vesca]
Length=297

 Score =   103 bits (256),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ++YIML G+ PF G+T TE FEAVLR NLRFP K+FR VSP AKDLLRKM+CRDVSRR  
Sbjct  196  MMYIMLGGIPPFYGETATEIFEAVLRGNLRFPPKVFRGVSPAAKDLLRKMMCRDVSRRLS  255

Query  182  AEQVL  196
            AEQ L
Sbjct  256  AEQAL  260



>ref|XP_006420218.1| hypothetical protein CICLE_v10005624mg [Citrus clementina]
 ref|XP_006489738.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 1-like [Citrus 
sinensis]
 gb|ESR33458.1| hypothetical protein CICLE_v10005624mg [Citrus clementina]
Length=269

 Score =   102 bits (255),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ILY+MLAG  PF G++ T+ F+AVLR NLRFP + F SVSP AKDLLR+M+ +DVSRRF 
Sbjct  199  ILYVMLAGFPPFYGESVTDIFDAVLRGNLRFPTRAFHSVSPLAKDLLRRMLSKDVSRRFS  258

Query  182  AEQVLRHPWV  211
            A+QVLRH W+
Sbjct  259  ADQVLRHQWM  268



>gb|EMT33229.1| Calcium-dependent protein kinase 33 [Aegilops tauschii]
Length=201

 Score =   101 bits (251),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 60/80 (75%), Gaps = 1/80 (1%)
 Frame = +2

Query  2    ILYIML-AGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRF  178
            ++Y++L  G LPF G+T  +   AV+R ++RFP ++F  VSP AKDL+R+M+CRD  RRF
Sbjct  118  VMYVLLSGGALPFGGETAKDVLSAVMRGSVRFPPRLFSGVSPAAKDLMRRMMCRDEWRRF  177

Query  179  CAEQVLRHPWVMSEGETRSM  238
             AEQVLRHPW++S G  R+M
Sbjct  178  SAEQVLRHPWIVSGGGARAM  197



>ref|XP_006442696.1| hypothetical protein CICLE_v10020693mg [Citrus clementina]
 gb|ESR55936.1| hypothetical protein CICLE_v10020693mg [Citrus clementina]
Length=370

 Score =   102 bits (255),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 49/65 (75%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LY +LAG+ PF G+T  E FEAVLRANLRFP +IFRSVSP AKDLLRKMICRDVSRR  
Sbjct  196  VLYTILAGIPPFYGETAAEIFEAVLRANLRFPTRIFRSVSPAAKDLLRKMICRDVSRRLS  255

Query  182  AEQVL  196
            AEQ L
Sbjct  256  AEQAL  260



>dbj|BAE80213.1| phosphoenolpyruvate carboxylase kinase [Oryza sativa Japonica 
Group]
 gb|ACA51031.1| PEPC kinase [Oryza sativa Japonica Group]
 gb|EEC73631.1| hypothetical protein OsI_08138 [Oryza sativa Indica Group]
Length=292

 Score =   101 bits (252),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 59/80 (74%), Gaps = 1/80 (1%)
 Frame = +2

Query  2    ILYIML-AGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRF  178
            +LY++L  G LPF G+T  E   +VLR ++RFP ++F  VSP AKDL+R+M+CRD  RRF
Sbjct  209  VLYVLLSGGALPFGGETAAEVLASVLRGSVRFPPRLFAGVSPAAKDLMRRMMCRDTWRRF  268

Query  179  CAEQVLRHPWVMSEGETRSM  238
             AEQVL HPW++S G  R+M
Sbjct  269  SAEQVLGHPWIVSGGGARAM  288



>dbj|BAE80214.1| phosphoenolpyruvate carboxylase kinase [Oryza sativa Japonica 
Group]
Length=305

 Score =   101 bits (252),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 59/80 (74%), Gaps = 1/80 (1%)
 Frame = +2

Query  2    ILYIML-AGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRF  178
            +LY++L  G LPF G+T  E   +VLR ++RFP ++F  VSP AKDL+R+M+CRD  RRF
Sbjct  222  VLYVLLSGGALPFGGETAAEVLASVLRGSVRFPPRLFAGVSPAAKDLMRRMMCRDTWRRF  281

Query  179  CAEQVLRHPWVMSEGETRSM  238
             AEQVL HPW++S G  R+M
Sbjct  282  SAEQVLGHPWIVSGGGARAM  301



>dbj|BAJ84853.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=290

 Score =   101 bits (251),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 60/80 (75%), Gaps = 1/80 (1%)
 Frame = +2

Query  2    ILYIML-AGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRF  178
            ++Y++L  G LPF G+T  +   AV+R ++RFP ++F  VSP AKDL+R+M+CRD  RRF
Sbjct  207  VMYVLLSGGALPFGGETAKDVLSAVMRGSVRFPPRLFSGVSPAAKDLMRRMMCRDEWRRF  266

Query  179  CAEQVLRHPWVMSEGETRSM  238
             AEQVLRHPW++S G  R+M
Sbjct  267  SAEQVLRHPWIVSGGGARAM  286



>gb|AFW63059.1| putative phosphoenolpyruvate carboxylase kinase family protein 
[Zea mays]
Length=298

 Score =   100 bits (250),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 57/80 (71%), Gaps = 1/80 (1%)
 Frame = +2

Query  2    ILYIML-AGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRF  178
            ++Y +L  G LPF GD+  E   AVLR + RFP ++F  VSP AKDL+R+MICRD  RRF
Sbjct  215  VMYALLSGGALPFGGDSAAEVLAAVLRGSARFPPRLFGGVSPAAKDLMRRMICRDEWRRF  274

Query  179  CAEQVLRHPWVMSEGETRSM  238
             AEQVL HPW++S G  R+M
Sbjct  275  TAEQVLAHPWIVSGGGARAM  294



>ref|XP_003580142.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 2-like [Brachypodium 
distachyon]
Length=290

 Score =   100 bits (248),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 58/78 (74%), Gaps = 1/78 (1%)
 Frame = +2

Query  2    ILYIML-AGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRF  178
            +LY++L  G LPF G+T ++ F AVLR   RF  ++F  VSP AKDL+R+M+CRDVSRRF
Sbjct  207  VLYVLLSGGALPFSGETASDVFAAVLRGGPRFSPRLFAGVSPLAKDLMRRMMCRDVSRRF  266

Query  179  CAEQVLRHPWVMSEGETR  232
             AEQVL HPW+++ G  R
Sbjct  267  SAEQVLGHPWILNGGGAR  284



>ref|XP_002452476.1| hypothetical protein SORBIDRAFT_04g026490 [Sorghum bicolor]
 gb|AAK81871.1|AF399915_1 phosphoenolpyruvate carboxylase kinase [Sorghum bicolor]
 gb|EES05452.1| hypothetical protein SORBIDRAFT_04g026490 [Sorghum bicolor]
Length=307

 Score =   100 bits (248),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 58/80 (73%), Gaps = 1/80 (1%)
 Frame = +2

Query  2    ILYIML-AGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRF  178
            ++Y +L  G LPF G+T  E   AVLR ++RFP ++F  VSP AKDLLR+MICRD  RRF
Sbjct  224  VMYALLSGGALPFGGETAAEVLAAVLRGSVRFPPRLFSGVSPAAKDLLRRMICRDEWRRF  283

Query  179  CAEQVLRHPWVMSEGETRSM  238
             AEQVL HPW++S G  R++
Sbjct  284  TAEQVLAHPWIVSGGGARAI  303



>gb|EMS53046.1| Phosphoenolpyruvate carboxylase kinase 2 [Triticum urartu]
Length=112

 Score = 95.9 bits (237),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LY+ML+G +PF G    E FEAVLR N+RFP + F  VSPEAKDL+R+M+C+DVSRRF 
Sbjct  33   VLYMMLSGSVPFYGAAAPEIFEAVLRGNVRFPPRAFAGVSPEAKDLMRRMLCKDVSRRFS  92

Query  182  AEQVL  196
            AEQVL
Sbjct  93   AEQVL  97



>gb|KHN35323.1| Phosphoenolpyruvate carboxylase kinase 2 [Glycine soja]
Length=263

 Score = 99.0 bits (245),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ILY MLAG  PF G++  E FE+VLRANLRFP+ IF SVS  AKDLLRKMI RD S R  
Sbjct  179  ILYAMLAGFPPFYGESAPEIFESVLRANLRFPSLIFSSVSAPAKDLLRKMISRDPSNRIS  238

Query  182  AEQVLRHPWVMS  217
            A Q LRHPW+++
Sbjct  239  AHQALRHPWILT  250



>gb|AAF19401.1|AF203479_1 phosphoenolpyruvate carboxylase kinase, partial [Glycine max]
Length=274

 Score = 99.4 bits (246),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ILY MLAG  PF G++  E FE+VLRANLRFP+ IF SVS  AKDLLRKMI RD S R  
Sbjct  190  ILYAMLAGFPPFYGESAPEIFESVLRANLRFPSLIFSSVSAPAKDLLRKMISRDPSNRIS  249

Query  182  AEQVLRHPWVMS  217
            A Q LRHPW+++
Sbjct  250  AHQALRHPWILT  261



>ref|NP_001105772.1| phosphoenolpyruvate carboxylase kinase 2 [Zea mays]
 gb|AAX07936.1| phosphoenolpyruvate carboxylase kinase 2 [Zea mays]
Length=298

 Score = 99.4 bits (246),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 56/80 (70%), Gaps = 1/80 (1%)
 Frame = +2

Query  2    ILYIML-AGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRF  178
            ++Y +L  G  PF GD+  E   AVLR + RFP ++F  VSP AKDL+R+MICRD  RRF
Sbjct  215  VMYALLSGGAFPFGGDSAAEVLAAVLRGSARFPPRLFGGVSPAAKDLMRRMICRDEWRRF  274

Query  179  CAEQVLRHPWVMSEGETRSM  238
             AEQVL HPW++S G  R+M
Sbjct  275  TAEQVLAHPWIVSGGGARAM  294



>ref|NP_001241581.1| phosphoenolpyruvate carboxylase kinase [Glycine max]
 gb|AAN12511.1| phosphoenolpyruvate carboxylase kinase [Glycine max]
 gb|AAN12512.1| phosphoenolpyruvate carboxylase kinase [Glycine max]
 gb|AAN06940.2| phosphoenolpyruvate carboxylase kinase [Glycine max]
 gb|AAQ83695.1| phosphoenolpyruvate-carboxylase kinase [Glycine max]
Length=282

 Score = 99.4 bits (246),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ILY MLAG  PF G++  E FE+VLRANLRFP+ IF SVS  AKDLLRKMI RD S R  
Sbjct  198  ILYAMLAGFPPFYGESAPEIFESVLRANLRFPSLIFSSVSAPAKDLLRKMISRDPSNRIS  257

Query  182  AEQVLRHPWVMS  217
            A Q LRHPW+++
Sbjct  258  AHQALRHPWILT  269



>gb|AFW72402.1| putative phosphoenolpyruvate carboxylase kinase family protein 
[Zea mays]
Length=311

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 56/80 (70%), Gaps = 1/80 (1%)
 Frame = +2

Query  2    ILYIML-AGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRF  178
            ++Y +L  G LPF G++  E   AVLR + RFP ++F  VSP AKDL+R+MICRD  RRF
Sbjct  228  VMYALLSGGALPFGGESAAEVLAAVLRGSARFPPRLFGGVSPAAKDLMRRMICRDEWRRF  287

Query  179  CAEQVLRHPWVMSEGETRSM  238
             AEQVL HPW++S G  R M
Sbjct  288  TAEQVLAHPWIVSGGGARGM  307



>ref|NP_001105773.1| phosphoenolpyruvate carboxylase kinase 3 [Zea mays]
 gb|AAX07937.1| phosphoenolpyruvate carboxylase kinase 3 [Zea mays]
Length=311

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 56/80 (70%), Gaps = 1/80 (1%)
 Frame = +2

Query  2    ILYIML-AGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRF  178
            ++Y +L  G LPF G++  E   AVLR + RFP ++F  VSP AKDL+R+MICRD  RRF
Sbjct  228  VMYALLSGGALPFGGESAAEVLAAVLRGSARFPPRLFGGVSPAAKDLMRRMICRDEWRRF  287

Query  179  CAEQVLRHPWVMSEGETRSM  238
             AEQVL HPW++S G  R M
Sbjct  288  TAEQVLAHPWIVSGGGARGM  307



>gb|EEC74202.1| hypothetical protein OsI_09360 [Oryza sativa Indica Group]
Length=277

 Score = 97.8 bits (242),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LY+ML+G LPF G T  E F+ VLR NLRFP + F SVSPEAKDL+R+M+C+DVSRRF 
Sbjct  210  VLYMMLSGTLPFYGATAAEVFQCVLRGNLRFPPRAFASVSPEAKDLMRRMLCKDVSRRFS  269

Query  182  AEQVL  196
            A+QVL
Sbjct  270  ADQVL  274



>ref|XP_004953151.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 1-like [Setaria 
italica]
Length=302

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 58/81 (72%), Gaps = 1/81 (1%)
 Frame = +2

Query  2    ILYIML-AGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRF  178
            ++Y +L  G LPF G++  E   AV+R ++RFP ++F  VSP AKDL+R+MICRD  RRF
Sbjct  219  VMYTLLSGGALPFGGESGAEVLAAVMRGSVRFPPRLFGGVSPAAKDLMRRMICRDEWRRF  278

Query  179  CAEQVLRHPWVMSEGETRSMA  241
             AEQVL HPW++S G  R++ 
Sbjct  279  TAEQVLAHPWIVSGGGARAVG  299



>ref|NP_001184941.1| phosphoenolpyruvate carboxylase kinase 1 [Arabidopsis thaliana]
 gb|AEE28327.1| phosphoenolpyruvate carboxylase kinase 1 [Arabidopsis thaliana]
Length=276

 Score = 95.9 bits (237),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LY MLAG  PF G+T  E FEAVLR NLRFP KIFR VS  AKD LRK+IC+D SRRF 
Sbjct  204  VLYTMLAGTPPFYGETAEEIFEAVLRGNLRFPTKIFRGVSSMAKDFLRKLICKDASRRFS  263

Query  182  AEQVL  196
            AEQ L
Sbjct  264  AEQAL  268



>gb|ABK22812.1| unknown [Picea sitchensis]
Length=290

 Score = 95.9 bits (237),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ILYIML+GV PF G+T  E FEAVLR  LRFP+  + S+S  AKDL+R+M+CRDV+RR  
Sbjct  210  ILYIMLSGVAPFLGNTPQEIFEAVLRGRLRFPSDPWLSISHSAKDLIRRMLCRDVTRRLS  269

Query  182  AEQVLRHPWVMSEGETRSMAD  244
            A+QVL H W+ +       +D
Sbjct  270  AQQVLEHGWISAHTYANPSSD  290



>ref|XP_008362057.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 1-like [Malus 
domestica]
 ref|XP_008368394.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 1-like [Malus 
domestica]
Length=269

 Score = 95.5 bits (236),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LYIMLAG  PF G+T  E F+AVLRANLRFPA +F S+S   KDLLR M+C+DVSRRF 
Sbjct  195  VLYIMLAGFPPFYGETAAEIFDAVLRANLRFPAXVFNSLSAALKDLLRXMLCKDVSRRFS  254

Query  182  AEQVL  196
            AEQVL
Sbjct  255  AEQVL  259



>gb|AAF99758.1|AC003981_8 F22O13.13 [Arabidopsis thaliana]
Length=280

 Score = 95.5 bits (236),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LY MLAG  PF G+T  E FEAVLR NLRFP KIFR VS  AKD LRK+IC+D SRRF 
Sbjct  204  VLYTMLAGTPPFYGETAEEIFEAVLRGNLRFPTKIFRGVSSMAKDFLRKLICKDASRRFS  263

Query  182  AEQVL  196
            AEQ L
Sbjct  264  AEQAL  268



>ref|XP_010023951.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 1-like isoform 
X3 [Eucalyptus grandis]
 gb|KCW60343.1| hypothetical protein EUGRSUZ_H03059 [Eucalyptus grandis]
Length=280

 Score = 95.5 bits (236),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LY+MLAG  PFRG++  E F AVLRANLRFP ++FRSVS  AKDLLR M+CRD SRR  
Sbjct  207  VLYVMLAGFPPFRGESAVEIFGAVLRANLRFPPRVFRSVSAAAKDLLRMMLCRDASRRLS  266

Query  182  AEQVLR  199
            A+QVL+
Sbjct  267  ADQVLK  272



>ref|XP_010671036.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 1-like [Beta 
vulgaris subsp. vulgaris]
Length=292

 Score = 95.5 bits (236),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LYIMLAG  PF G+   E F+ VL+ NLRFP ++F + +   KDLLRKMIC+DVSRR  
Sbjct  206  VLYIMLAGFPPFYGERVEEVFDMVLKGNLRFPFRVFGNFNSVVKDLLRKMICKDVSRRLS  265

Query  182  AEQVLRHPWVMSEGETRSMADM  247
            A++ LRHPW  + G      DM
Sbjct  266  AQEALRHPWFTTSGGQPINNDM  287



>gb|AFW73950.1| putative phosphoenolpyruvate carboxylase kinase family protein 
[Zea mays]
Length=309

 Score = 95.5 bits (236),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LY+ML+G +PF G T  E F+AVLR NLRFP + F +VSPEAKDLLR+M+CRDV RR  
Sbjct  204  VLYMMLSGTVPFSGATAGEIFQAVLRGNLRFPPRAFAAVSPEAKDLLRRMLCRDVWRRLS  263

Query  182  AEQVL  196
            AEQVL
Sbjct  264  AEQVL  268



>gb|AAF63784.1| phosphoenolpyruvate carboxylase kinase, putative [Arabidopsis 
thaliana]
Length=277

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ++Y MLAG  PF G+T  + FE++LR NLRFP K F SVS EAKDLLRKMICRDVSRRF 
Sbjct  200  VIYTMLAGEPPFNGETAEDIFESILRGNLRFPPKKFGSVSSEAKDLLRKMICRDVSRRFS  259

Query  182  AEQVLR  199
            AE  LR
Sbjct  260  AEDALR  265



>gb|ABR17452.1| unknown [Picea sitchensis]
Length=283

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            I+YIML+GV PF GDT  E FEAVL   LRFP+  + S+S  AKDL+R+M+CRDV++R  
Sbjct  205  IVYIMLSGVAPFLGDTPQEIFEAVLCGRLRFPSDPWLSISNSAKDLIRRMVCRDVTKRLS  264

Query  182  AEQVLRHPWVMSE  220
            A QVL HPW+ + 
Sbjct  265  AHQVLEHPWITTH  277



>gb|EMS53047.1| Phosphoenolpyruvate carboxylase kinase 1 [Triticum urartu]
Length=264

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 59/81 (73%), Gaps = 6/81 (7%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LY+ML+G +PF G T  E FEAVLR N+RFP + F  VSP AKDL+R+M+C+DV+RR  
Sbjct  96   VLYVMLSGTVPFYGATAPEIFEAVLRGNMRFPPRAFAGVSPGAKDLMRRMLCKDVARRLS  155

Query  182  AEQVLRHPWVMSEGETRSMAD  244
            AEQVL      S+ + R+M+D
Sbjct  156  AEQVL------SKHQQRTMSD  170



>gb|AAK98691.1|AC069158_3 Putative phosphoenolpyruvate kinase [Oryza sativa Japonica Group]
Length=369

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 58/86 (67%), Gaps = 11/86 (13%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LY+ML+G LPF G T  E F+ VLR NLRFP + F SVSPEAKDL+R+M+C+DVSRR C
Sbjct  210  VLYMMLSGTLPFYGATAAEVFQCVLRGNLRFPPRAFASVSPEAKDLMRRMLCKDVSRRKC  269

Query  182  ----------AEQVLRHPWVMSEGET  229
                        +V  HPW++ EG T
Sbjct  270  EVFLLTIGSFGVRVAGHPWIL-EGST  294



>ref|XP_010023949.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 2-like isoform 
X1 [Eucalyptus grandis]
Length=297

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LY+MLAG  PFRG++  E F AVLRANLRFP ++FRSVS  AKDLLR M+CRD SRR  
Sbjct  207  VLYVMLAGFPPFRGESAVEIFGAVLRANLRFPPRVFRSVSAAAKDLLRMMLCRDASRRLS  266

Query  182  AEQVL  196
            A+QVL
Sbjct  267  ADQVL  271



>gb|AAF04907.1|AC011437_22 putative calmodulin-domain protein kinase, 5' partial [Arabidopsis 
thaliana]
Length=249

 Score = 94.0 bits (232),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ++Y MLAG  PF G+T  + FE++LR NLRFP K F SVS EAKDLLRKMICRDVSRRF 
Sbjct  166  VIYTMLAGEPPFNGETAEDIFESILRGNLRFPPKKFGSVSSEAKDLLRKMICRDVSRRFS  225

Query  182  AEQVLR  199
            AE  L 
Sbjct  226  AEDALH  231



>ref|XP_011029830.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 1-like isoform 
X2 [Populus euphratica]
Length=273

 Score = 94.4 bits (233),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LYIML G  PF G+T  E FEAVLR NLRF A++F+S S   KDLLR+M+C+DVSRRF 
Sbjct  197  VLYIMLTGFPPFYGETVVEIFEAVLRGNLRFSARVFQSASTSVKDLLRRMLCKDVSRRFS  256

Query  182  AEQVL  196
            AEQVL
Sbjct  257  AEQVL  261



>gb|ABK26672.1| unknown [Picea sitchensis]
Length=290

 Score = 91.3 bits (225),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 53/70 (76%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            I+YIML+GV PF GDT  E F+AVL   LRFP+  + S+S  AKDL+R+M+CRDV+RR  
Sbjct  210  IVYIMLSGVAPFLGDTPQEIFDAVLCGRLRFPSDPWLSISHSAKDLIRRMLCRDVTRRLS  269

Query  182  AEQVLRHPWV  211
            A+QVL H W+
Sbjct  270  AQQVLEHGWI  279



>ref|XP_003626482.1| Calcium-dependent protein kinase [Medicago truncatula]
 gb|AES82700.1| phosphoenolpyruvate carboxylase-related kinase [Medicago truncatula]
Length=295

 Score = 90.1 bits (222),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 52/73 (71%), Gaps = 0/73 (0%)
 Frame = +2

Query  5    LYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFCA  184
            LY+ML  + PF G+T  +TF+A+L+ NLRFP   F S+S  A DL++KMICRD S+R  A
Sbjct  206  LYVMLCAIEPFHGETPCDTFKAILKTNLRFPMTTFISMSTPATDLIKKMICRDPSKRISA  265

Query  185  EQVLRHPWVMSEG  223
            E+ L HPW++  G
Sbjct  266  EEALMHPWILKGG  278



>gb|AEW07693.1| hypothetical protein 0_9122_01, partial [Pinus radiata]
 gb|AFG46803.1| hypothetical protein 0_9122_01, partial [Pinus taeda]
 gb|AFG46804.1| hypothetical protein 0_9122_01, partial [Pinus taeda]
 gb|AFG46805.1| hypothetical protein 0_9122_01, partial [Pinus taeda]
 gb|AFG46806.1| hypothetical protein 0_9122_01, partial [Pinus taeda]
 gb|AFG46807.1| hypothetical protein 0_9122_01, partial [Pinus taeda]
 gb|AFG46808.1| hypothetical protein 0_9122_01, partial [Pinus taeda]
 gb|AFG46809.1| hypothetical protein 0_9122_01, partial [Pinus taeda]
 gb|AFG46810.1| hypothetical protein 0_9122_01, partial [Pinus taeda]
 gb|AFG46811.1| hypothetical protein 0_9122_01, partial [Pinus taeda]
Length=148

 Score = 87.8 bits (216),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 52/73 (71%), Gaps = 0/73 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ILYIML+GV PF G+T  E FEAVL   LRFP   + S+S  AKDL+R+M+ RDV++R  
Sbjct  72   ILYIMLSGVAPFVGETPQEIFEAVLCGRLRFPTDRWLSISHSAKDLIRRMLSRDVTKRIS  131

Query  182  AEQVLRHPWVMSE  220
             +QVL HPW+ + 
Sbjct  132  TDQVLEHPWITTH  144



>dbj|BAD23784.1| putative phosphoenolpyruvate carboxylase kinase [Oryza sativa 
Japonica Group]
Length=311

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 59/99 (60%), Gaps = 20/99 (20%)
 Frame = +2

Query  2    ILYIML-AGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRF  178
            +LY++L  G LPF G+T  E   +VLR ++RFP ++F  VSP AKDL+R+M+CRD  RRF
Sbjct  209  VLYVLLSGGALPFGGETAAEVLASVLRGSVRFPPRLFAGVSPAAKDLMRRMMCRDTWRRF  268

Query  179  CAEQVL-------------------RHPWVMSEGETRSM  238
             AEQVL                    HPW++S G  R+M
Sbjct  269  SAEQVLGFRSKRTNHLIACRAVRNAGHPWIVSGGGARAM  307



>tpg|DAA36995.1| TPA: putative phosphoenolpyruvate carboxylase kinase family protein 
[Zea mays]
Length=299

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 51/69 (74%), Gaps = 1/69 (1%)
 Frame = +2

Query  2    ILYIML-AGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRF  178
            ++Y +L  G LPF G+T  + F AVLR +LRFP  +F  VSP AKDL+R+M+CRDVSRRF
Sbjct  210  VMYALLSGGALPFGGETAADVFAAVLRGSLRFPPALFAGVSPAAKDLMRRMMCRDVSRRF  269

Query  179  CAEQVLRHP  205
             AEQVL  P
Sbjct  270  SAEQVLSKP  278



>dbj|BAJ93189.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=105

 Score = 82.8 bits (203),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +2

Query  62   FEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFCAEQVLRHPWVMSEGETRSM  238
              AV+R ++RFP ++F  VSP AKDL+R+M+CRD  RRF AEQVLRHPW++S G  R+M
Sbjct  43   ISAVMRGSVRFPPRLFSGVSPAAKDLMRRMMCRDEWRRFSAEQVLRHPWIVSGGGARAM  101



>ref|NP_001053321.1| Os04g0517500 [Oryza sativa Japonica Group]
 emb|CAE05449.3| OSJNBa0073E02.9 [Oryza sativa Japonica Group]
 dbj|BAF15235.1| Os04g0517500 [Oryza sativa Japonica Group]
Length=286

 Score = 84.7 bits (208),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +2

Query  71   VLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFCAEQVLRHPWVMSEGETRSM  238
            VLR NLRFP ++F  VSP AKDL+R+M+CRDV RRF AEQVLRHPW++S G  R +
Sbjct  228  VLRGNLRFPPRLFSGVSPAAKDLMRRMMCRDVYRRFSAEQVLRHPWIVSGGGARDV  283



>gb|EPS73723.1| hypothetical protein M569_01033 [Genlisea aurea]
Length=439

 Score = 86.3 bits (212),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ILYI+L+G+ PF G T +  F+AV  A+LRFPA ++ SVS  AK+L+R M+CRD S+R  
Sbjct  216  ILYILLSGIPPFWGKTKSRIFDAVRAADLRFPANLWDSVSDSAKELIRNMLCRDTSKRLT  275

Query  182  AEQVLRHPWV  211
              QVL HPWV
Sbjct  276  PRQVLDHPWV  285



>ref|XP_004976234.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 1-like isoform 
X1 [Setaria italica]
Length=305

 Score = 84.7 bits (208),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 48/67 (72%), Gaps = 1/67 (1%)
 Frame = +2

Query  2    ILYIML-AGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRF  178
            + Y++L  G LPF G+T  E F AVLR +LRFP  +F  VSP AKDL+R+M+CRD SRRF
Sbjct  217  VAYVLLSGGALPFGGETPAEVFAAVLRGSLRFPPALFAGVSPAAKDLMRRMMCRDASRRF  276

Query  179  CAEQVLR  199
             AEQ  R
Sbjct  277  SAEQGTR  283



>ref|XP_010910901.1| PREDICTED: phosphoenolpyruvate carboxylase kinase 2-like isoform 
X2 [Elaeis guineensis]
Length=266

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 51/78 (65%), Gaps = 14/78 (18%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LY+ML+GV PF GDT  E FEAVLRANLRFP + FR++SP AKDLLR+M          
Sbjct  198  VLYVMLSGVPPFYGDTAVEIFEAVLRANLRFPTRNFRAISPAAKDLLRRM----------  247

Query  182  AEQVLRHPWVMSEGETRS  235
                L HPW+ S   TR+
Sbjct  248  ----LWHPWITSGEGTRA  261



>gb|EMT22125.1| hypothetical protein F775_43471 [Aegilops tauschii]
Length=372

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LY+ L+G +PF G T  E FEAVLR N+RFP + F  VSPEAKDL+R+M+C+DVSRR  
Sbjct  307  VLYMTLSGSVPFYGATAPEIFEAVLRGNVRFPPRAFAGVSPEAKDLMRRMLCKDVSRRLA  366

Query  182  AE  187
              
Sbjct  367  GN  368



>ref|NP_001047478.2| Os02g0625300 [Oryza sativa Japonica Group]
 dbj|BAF09392.2| Os02g0625300 [Oryza sativa Japonica Group]
Length=344

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 49/66 (74%), Gaps = 1/66 (2%)
 Frame = +2

Query  2    ILYIML-AGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRF  178
            +LY++L  G LPF G+T  E   +VLR ++RFP ++F  VSP AKDL+R+M+CRD  RRF
Sbjct  222  VLYVLLSGGALPFGGETAAEVLASVLRGSVRFPPRLFAGVSPAAKDLMRRMMCRDTWRRF  281

Query  179  CAEQVL  196
             AEQVL
Sbjct  282  SAEQVL  287



>ref|XP_007145769.1| hypothetical protein PHAVU_007G266100g [Phaseolus vulgaris]
 gb|ESW17763.1| hypothetical protein PHAVU_007G266100g [Phaseolus vulgaris]
Length=582

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 39/75 (52%), Positives = 53/75 (71%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            I+YI+L+GV PF G+T  E F+A+LR  L F +  + S+S  AKDL+RKM+ RD S+R  
Sbjct  306  IIYILLSGVPPFWGETEQEIFDAILRFQLDFSSDPWPSISASAKDLVRKMLVRDPSKRIT  365

Query  182  AEQVLRHPWVMSEGE  226
            A  VLRHPW+  +GE
Sbjct  366  AFDVLRHPWIQVDGE  380



>gb|AFW72403.1| putative phosphoenolpyruvate carboxylase kinase family protein 
[Zea mays]
Length=356

 Score = 83.2 bits (204),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 48/68 (71%), Gaps = 1/68 (1%)
 Frame = +2

Query  2    ILYIML-AGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRF  178
            ++Y +L  G LPF G++  E   AVLR + RFP ++F  VSP AKDL+R+MICRD  RRF
Sbjct  228  VMYALLSGGALPFGGESAAEVLAAVLRGSARFPPRLFGGVSPAAKDLMRRMICRDEWRRF  287

Query  179  CAEQVLRH  202
             AEQVL H
Sbjct  288  TAEQVLVH  295



>gb|ADE77630.1| unknown [Picea sitchensis]
Length=148

 Score = 80.5 bits (197),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ILYIML+GV PF G+T  E FEAVL   LRFP+  + SVS  AKDL+R+M+ RDV++R  
Sbjct  33   ILYIMLSGVAPFLGETPQEIFEAVLCGRLRFPSDRWLSVSHSAKDLVRRMLSRDVTKRLS  92

Query  182  AEQVLRHP  205
            A+QVL  P
Sbjct  93   AQQVLGIP  100



>gb|AFW63060.1| putative phosphoenolpyruvate carboxylase kinase family protein 
[Zea mays]
Length=308

 Score = 82.4 bits (202),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 47/66 (71%), Gaps = 1/66 (2%)
 Frame = +2

Query  2    ILYIML-AGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRF  178
            ++Y +L  G LPF GD+  E   AVLR + RFP ++F  VSP AKDL+R+MICRD  RRF
Sbjct  215  VMYALLSGGALPFGGDSAAEVLAAVLRGSARFPPRLFGGVSPAAKDLMRRMICRDEWRRF  274

Query  179  CAEQVL  196
             AEQVL
Sbjct  275  TAEQVL  280



>ref|XP_007018143.1| Phosphoenolpyruvate carboxylase-related kinase 2 isoform 1 [Theobroma 
cacao]
 gb|EOY15368.1| Phosphoenolpyruvate carboxylase-related kinase 2 isoform 1 [Theobroma 
cacao]
Length=512

 Score = 83.6 bits (205),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 39/83 (47%), Positives = 57/83 (69%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +L+ +L GVLPF+GD+    FEA+   NL F + I+ SVS  A+DLL +M+ RDVS R  
Sbjct  285  LLHALLVGVLPFQGDSLKAVFEAIKNVNLDFHSGIWESVSKPARDLLARMLTRDVSSRIT  344

Query  182  AEQVLRHPWVMSEGETRSMADMN  250
            A++VLRHPW++   E RS+  ++
Sbjct  345  ADEVLRHPWILFYTE-RSLKTLS  366



>ref|XP_007018144.1| Phosphoenolpyruvate carboxylase-related kinase 2 isoform 2 [Theobroma 
cacao]
 ref|XP_007018145.1| Phosphoenolpyruvate carboxylase-related kinase 2 isoform 2 [Theobroma 
cacao]
 gb|EOY15369.1| Phosphoenolpyruvate carboxylase-related kinase 2 isoform 2 [Theobroma 
cacao]
 gb|EOY15370.1| Phosphoenolpyruvate carboxylase-related kinase 2 isoform 2 [Theobroma 
cacao]
Length=469

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 39/83 (47%), Positives = 57/83 (69%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +L+ +L GVLPF+GD+    FEA+   NL F + I+ SVS  A+DLL +M+ RDVS R  
Sbjct  285  LLHALLVGVLPFQGDSLKAVFEAIKNVNLDFHSGIWESVSKPARDLLARMLTRDVSSRIT  344

Query  182  AEQVLRHPWVMSEGETRSMADMN  250
            A++VLRHPW++   E RS+  ++
Sbjct  345  ADEVLRHPWILFYTE-RSLKTLS  366



>ref|XP_008234302.1| PREDICTED: calcium-dependent protein kinase 26-like [Prunus mume]
 ref|XP_008234303.1| PREDICTED: calcium-dependent protein kinase 26-like [Prunus mume]
Length=509

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 52/73 (71%), Gaps = 0/73 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ILYI+L+G+ PF G T +  F+AV  A+LRFP+  +  ++  AKDL+R M+C D SRR  
Sbjct  231  ILYILLSGMPPFWGKTKSRIFDAVRTADLRFPSDRWDCITESAKDLIRGMLCTDASRRLT  290

Query  182  AEQVLRHPWVMSE  220
            A+QVL HPW+ S+
Sbjct  291  AQQVLDHPWMSSQ  303



>ref|XP_004497629.1| PREDICTED: calcium-dependent protein kinase 1-like [Cicer arietinum]
Length=581

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 37/74 (50%), Positives = 52/74 (70%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ILYI+L GV PF G++  E FEA+L ++L F +  + S+S  AKDL++KM+ RD S+R  
Sbjct  305  ILYILLCGVPPFWGESEQEIFEAILHSDLDFSSDPWPSISESAKDLVKKMLVRDPSKRLS  364

Query  182  AEQVLRHPWVMSEG  223
            A  VLRHPW+  +G
Sbjct  365  AFDVLRHPWIQVDG  378



>emb|CDY21060.1| BnaA08g24650D [Brassica napus]
Length=456

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/71 (49%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LY +L+GVLPFRGD+    FEA+ +  L F + +++SVS  A+DLL +M+ RD S R  
Sbjct  276  LLYALLSGVLPFRGDSLDAIFEAIKKVKLDFNSGVWQSVSKPARDLLSRMLTRDESARLT  335

Query  182  AEQVLRHPWVM  214
            A++VLRHPW++
Sbjct  336  ADEVLRHPWIL  346



>ref|XP_007028039.1| Calcium dependent protein kinase 1 [Theobroma cacao]
 gb|EOY08541.1| Calcium dependent protein kinase 1 [Theobroma cacao]
Length=607

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 37/74 (50%), Positives = 51/74 (69%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            I+YI+L+GV PF G+T  E F+ VL  +L F +  + S+S  AKDL+RKM+ RD  +R  
Sbjct  332  IIYILLSGVPPFWGETEQEIFDEVLHGDLDFTSDPWPSISDSAKDLVRKMLVRDAKKRIT  391

Query  182  AEQVLRHPWVMSEG  223
            A +VLRHPWV  +G
Sbjct  392  AYEVLRHPWVQVDG  405



>emb|CDP19110.1| unnamed protein product [Coffea canephora]
Length=113

 Score = 77.4 bits (189),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = +2

Query  65   EAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFCAEQVLRHPWVMSEG  223
            + VLR N+RFP ++F S+SPE KDLLR+M+ + V RRF AEQVL HPW+  EG
Sbjct  42   DGVLRVNVRFPTRVFNSLSPEVKDLLRRMLSKGVIRRFTAEQVLTHPWMTGEG  94



>ref|XP_009110630.1| PREDICTED: serine/threonine-protein kinase PEPKR2-like [Brassica 
rapa]
Length=456

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 35/71 (49%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LY +L+GVLPFRGD+    FEA+ +  L F + ++ SVS  A+DLL +M+ RD S R  
Sbjct  276  LLYALLSGVLPFRGDSLDAIFEAIKKVKLDFNSGVWESVSKPARDLLSRMLTRDESARIT  335

Query  182  AEQVLRHPWVM  214
            A++VLRHPW++
Sbjct  336  ADEVLRHPWIL  346



>gb|EAZ23870.1| hypothetical protein OsJ_07587 [Oryza sativa Japonica Group]
Length=310

 Score = 80.1 bits (196),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = +2

Query  5    LYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFCA  184
            L  +  G LPF G+T  E   +VLR ++RFP ++F  VSP AKDL+R+M+CRD  RRF A
Sbjct  190  LRALSGGALPFGGETAAEVLASVLRGSVRFPPRLFAGVSPAAKDLMRRMMCRDTWRRFSA  249

Query  185  EQVL  196
            EQVL
Sbjct  250  EQVL  253



>emb|CDX98048.1| BnaA06g07990D [Brassica napus]
Length=461

 Score = 81.3 bits (199),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 34/71 (48%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LY +L+GVLPF+GD+    FEA+ +  L F + ++ SVS  A+DLL +M+ RD S R  
Sbjct  288  LLYALLSGVLPFKGDSLDAIFEAIKKVKLDFNSGVWESVSKPARDLLSRMLTRDESARIT  347

Query  182  AEQVLRHPWVM  214
            A++VLRHPW++
Sbjct  348  ADEVLRHPWIL  358



>ref|XP_009383151.1| PREDICTED: calcium-dependent protein kinase 26-like [Musa acuminata 
subsp. malaccensis]
Length=515

 Score = 81.6 bits (200),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 35/70 (50%), Positives = 52/70 (74%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ILY++L+G+ PF G T ++ FE+V  A LRFP+  +RSVS  AK+L+R M+CRD ++R  
Sbjct  227  ILYVLLSGMPPFWGKTKSKIFESVRSAELRFPSDPWRSVSDSAKELIRGMLCRDPAKRLT  286

Query  182  AEQVLRHPWV  211
            A+QV+ H W+
Sbjct  287  AKQVIDHSWI  296



>emb|CDY57079.1| BnaCnng31590D [Brassica napus]
Length=462

 Score = 81.3 bits (199),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 34/71 (48%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LY +L+GVLPF+GD+    FEA+ +  L F + ++ SVS  A+DLL +M+ RD S R  
Sbjct  287  LLYALLSGVLPFKGDSLDAIFEAIKKVKLDFNSGVWESVSKPARDLLSRMLSRDESARIT  346

Query  182  AEQVLRHPWVM  214
            A++VLRHPW++
Sbjct  347  ADEVLRHPWIL  357



>gb|KHG01181.1| Serine/threonine-protein kinase PEPKR2 [Gossypium arboreum]
Length=469

 Score = 81.3 bits (199),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 38/94 (40%), Positives = 60/94 (64%), Gaps = 2/94 (2%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +L+ +L GVLPF+GD+  E FEA+    L F +  + SVS  A+DLL +M+ RDVS R  
Sbjct  285  LLHALLVGVLPFQGDSLKEVFEAIKNVKLDFQSGKWESVSKPARDLLARMLTRDVSSRIT  344

Query  182  AEQVLRHPWVM--SEGETRSMADMNFT*TPATPT  277
            A++VLRHPW++  +E   +++   + +  P  P+
Sbjct  345  ADEVLRHPWILFYTEHSLKTLYTKSKSKNPVEPS  378



>ref|XP_008377036.1| PREDICTED: calcium-dependent protein kinase 26-like [Malus domestica]
 ref|XP_008377041.1| PREDICTED: calcium-dependent protein kinase 26-like [Malus domestica]
 ref|XP_008377045.1| PREDICTED: calcium-dependent protein kinase 26-like [Malus domestica]
Length=516

 Score = 81.3 bits (199),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 34/70 (49%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LYI+L+G+ PF G T +  F+AV  A+LRFP+  +  ++  AKDL+R M+C+D S+R  
Sbjct  231  VLYILLSGMPPFWGKTKSRIFDAVRTADLRFPSDPWDRITGSAKDLIRAMLCKDPSQRLT  290

Query  182  AEQVLRHPWV  211
            A+QVL HPW+
Sbjct  291  AQQVLDHPWM  300



>gb|EFA79379.1| myosin light chain kinase [Polysphondylium pallidum PN500]
Length=282

 Score = 79.0 bits (193),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            I YI+L G  PF GDT  E FE ++ AN  +P + +  +S  AKD + K++  D   R  
Sbjct  185  ITYILLCGFPPFYGDTIPEIFEFIMEANFEYPEEYWSHISSAAKDFINKLLVVDAKARLS  244

Query  182  AEQVLRHPWVMSEGETRSM  238
            AE  L HPW++S+G T ++
Sbjct  245  AEDALNHPWLLSKGSTEAL  263



>gb|KDP41445.1| hypothetical protein JCGZ_15852 [Jatropha curcas]
Length=466

 Score = 80.9 bits (198),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 34/71 (48%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +L+ +L GVLPF+GD+    FEA+    L F A +++SVS  A+DL+ +M+ RDVS R  
Sbjct  287  LLHALLVGVLPFQGDSLEAVFEAIKNVKLDFHAGLWKSVSKPARDLVSRMLTRDVSARIT  346

Query  182  AEQVLRHPWVM  214
            A++VLRHPW++
Sbjct  347  ADEVLRHPWIL  357



>ref|XP_008437204.1| PREDICTED: calcium-dependent protein kinase 10 isoform X2 [Cucumis 
melo]
Length=477

 Score = 80.9 bits (198),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 36/70 (51%), Positives = 49/70 (70%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ILYI+L+G+ PF G T +  FEAV  A LRFP+ ++  VS  AKDL+ +M+C D S+R  
Sbjct  232  ILYILLSGMPPFWGKTKSRIFEAVRAAELRFPSNLWDHVSTSAKDLISRMLCMDPSKRLT  291

Query  182  AEQVLRHPWV  211
            AE+VL H W+
Sbjct  292  AEEVLAHSWM  301



>gb|KEH41846.1| calcium-dependent kinase [Medicago truncatula]
Length=589

 Score = 81.3 bits (199),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 36/74 (49%), Positives = 53/74 (72%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ILYI+L GV PF G++  + FEA+L ++L F +  + S+S  AKDL++KM+ RD S+R  
Sbjct  313  ILYILLCGVPPFWGESEQDIFEAILNSDLDFSSDPWPSISESAKDLVKKMLVRDPSKRLT  372

Query  182  AEQVLRHPWVMSEG  223
            A  VLRHPW++ +G
Sbjct  373  AFDVLRHPWILIDG  386



>ref|XP_006857928.1| hypothetical protein AMTR_s00069p00149760 [Amborella trichopoda]
 gb|ERN19395.1| hypothetical protein AMTR_s00069p00149760 [Amborella trichopoda]
Length=502

 Score = 80.9 bits (198),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 38/73 (52%), Positives = 49/73 (67%), Gaps = 0/73 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ILYI+L+G+ PF G T +  FEAV  A+LRFP+  +  VS  AKDL+  M+C D  +R  
Sbjct  229  ILYILLSGMPPFWGKTKSRIFEAVRAADLRFPSDHWDRVSESAKDLIIGMLCTDPCKRLT  288

Query  182  AEQVLRHPWVMSE  220
            A QVL HPW+ SE
Sbjct  289  AAQVLDHPWIKSE  301



>ref|XP_001461819.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK94446.1| unnamed protein product [Paramecium tetraurelia]
Length=508

 Score = 80.9 bits (198),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 36/84 (43%), Positives = 55/84 (65%), Gaps = 1/84 (1%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ILYI+LAG  PF G   TE F+ +L+  + F    +  +S EAK+L+  M+C+DV +R+ 
Sbjct  254  ILYILLAGYPPFYGRNETEIFDRILKGKIPFHTTEWNKISKEAKNLITNMLCQDVEKRYS  313

Query  182  AEQVLRHPWVMSEGETRSMADMNF  253
            A+QVL  PW M +G+ +++ D NF
Sbjct  314  AQQVLDDPW-MQQGQEQNLVDDNF  336



>gb|KHG07421.1| Calcium-dependent protein kinase 2 [Gossypium arboreum]
Length=648

 Score = 81.3 bits (199),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 36/74 (49%), Positives = 50/74 (68%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            I+YI+L+GV PF G+T  E FE VL   L F +  + ++S  AKDL++KM+ RD  +R  
Sbjct  380  IVYILLSGVPPFWGETEQEIFEEVLHGELDFTSDPWPNISESAKDLVKKMLVRDAKKRIT  439

Query  182  AEQVLRHPWVMSEG  223
            A +VLRHPWV  +G
Sbjct  440  AHEVLRHPWVQVDG  453



>ref|XP_641424.1| myosin light chain kinase [Dictyostelium discoideum AX4]
 sp|P25323.2|MYLKA_DICDI RecName: Full=Myosin light chain kinase A; Short=MLCK-A [Dictyostelium 
discoideum]
 gb|AAB06337.1| myosin light chain kinase [Dictyostelium discoideum]
 gb|EAL67434.1| myosin light chain kinase [Dictyostelium discoideum AX4]
Length=295

 Score = 79.0 bits (193),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 46/79 (58%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            I YI+L G  PF GDT  E FE ++ AN  FP + +  +S EAKD + K++  DVS+R  
Sbjct  196  ITYILLCGFPPFYGDTVPEIFEQIMEANYEFPEEYWGGISKEAKDFIGKLLVVDVSKRLN  255

Query  182  AEQVLRHPWVMSEGETRSM  238
            A   L HPW+ S     ++
Sbjct  256  ATNALNHPWLKSNNSNNTI  274



>gb|KHG01345.1| Calcium-dependent protein kinase 29 [Gossypium arboreum]
Length=298

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 49/75 (65%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ILYI+L+GV PF G+T  E F+AV   NL   ++ + ++S  AKDL+RKM+ RD  +R  
Sbjct  39   ILYILLSGVPPFWGETDKEIFKAVSEGNLDLKSQPWPTISEVAKDLIRKMLARDPKKRIT  98

Query  182  AEQVLRHPWVMSEGE  226
            A Q L HPW+   GE
Sbjct  99   AAQALEHPWMKEGGE  113



>ref|XP_002285713.2| PREDICTED: serine/threonine-protein kinase PEPKR2 [Vitis vinifera]
Length=468

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 34/71 (48%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +L+ +L G+LPFRGD+    FEA+    L F   I+ S+S  A+DL+ +M+ RDVS R  
Sbjct  292  LLHALLVGMLPFRGDSLQAVFEAIKNVKLDFHTGIWESISKPARDLIERMLTRDVSARIT  351

Query  182  AEQVLRHPWVM  214
            AE+VLRHPW++
Sbjct  352  AEEVLRHPWIL  362



>ref|XP_007017897.1| Calcium-dependent protein kinase 29 [Theobroma cacao]
 gb|EOY15122.1| Calcium-dependent protein kinase 29 [Theobroma cacao]
Length=527

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 38/76 (50%), Positives = 50/76 (66%), Gaps = 0/76 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ILYI+L+GV PF G+T  +  +AVL  NL   ++ + S+S  AKDLLRKM+ RD  RR  
Sbjct  266  ILYILLSGVPPFWGETEEKILKAVLEGNLDLKSQPWPSISDAAKDLLRKMLARDPQRRIT  325

Query  182  AEQVLRHPWVMSEGET  229
            A Q L HPW+   G+T
Sbjct  326  ASQALEHPWMKEGGDT  341



>emb|CBI19226.3| unnamed protein product [Vitis vinifera]
Length=366

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +L+ +L G+LPFRGD+    FEA+    L F   I+ S+S  A+DL+ +M+ RDVS R  
Sbjct  190  LLHALLVGMLPFRGDSLQAVFEAIKNVKLDFHTGIWESISKPARDLIERMLTRDVSARIT  249

Query  182  AEQVLRHPWVM  214
            AE+VLRHPW++
Sbjct  250  AEEVLRHPWIL  260



>ref|XP_008376518.1| PREDICTED: calcium-dependent protein kinase 26-like [Malus domestica]
Length=503

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 34/70 (49%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            ILYI+L+G+ PF G T +  F+AV  A+L+FP+  +  ++  AKDL+R M+C+D S+R  
Sbjct  231  ILYILLSGMPPFWGKTKSRIFDAVRTADLKFPSDPWDRITGSAKDLIRAMLCKDPSQRLT  290

Query  182  AEQVLRHPWV  211
            A+QVL HPW+
Sbjct  291  AQQVLDHPWM  300



>gb|KFP83334.1| Myosin light chain kinase 2, skeletal/cardiac muscle, partial 
[Acanthisitta chloris]
Length=132

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 47/75 (63%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            I Y++L+G+ PF GD  TET   VL AN  F  + F S+S EAKD +  +I +D S R  
Sbjct  33   ITYMLLSGLSPFLGDDDTETLNNVLAANWYFDEETFESISDEAKDFVSNLIIKDKSARMS  92

Query  182  AEQVLRHPWVMSEGE  226
            A+Q L+HPW+ +  E
Sbjct  93   ADQCLQHPWLNNLAE  107



>ref|XP_009148574.1| PREDICTED: serine/threonine-protein kinase PEPKR2-like [Brassica 
rapa]
Length=475

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 34/70 (49%), Positives = 50/70 (71%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +LY +L+GVLPF+GD+    FEA+ +  L F + ++ SVS  A+DLL +M+ RD S R  
Sbjct  288  LLYALLSGVLPFKGDSLDAIFEAIKKVKLDFNSGVWESVSKPARDLLSRMLTRDESARIT  347

Query  182  AEQVLRHPWV  211
            A++VLRHPW+
Sbjct  348  ADEVLRHPWI  357



>emb|CDO97401.1| unnamed protein product [Coffea canephora]
Length=470

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 35/76 (46%), Positives = 50/76 (66%), Gaps = 0/76 (0%)
 Frame = +2

Query  2    ILYIMLAGVLPFRGDTTTETFEAVLRANLRFPAKIFRSVSPEAKDLLRKMICRDVSRRFC  181
            +L+ +L G LPF+GD+    FEA+ + NL F   ++  VSP A+DLL  M+ RDVS RF 
Sbjct  285  LLHALLVGFLPFQGDSLENVFEAIKKDNLDFIGGVWECVSPSARDLLSCMLTRDVSNRFT  344

Query  182  AEQVLRHPWVMSEGET  229
            A +VL HPW++   E+
Sbjct  345  AAEVLSHPWILFYTES  360



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 507136922424