BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c107865_g1_i1 len=259 path=[237:0-258]

Length=259
                                                                      Score     E

ref|XP_011091995.1|  PREDICTED: uncharacterized protein LOC105172309    112   4e-27   
ref|XP_011078132.1|  PREDICTED: uncharacterized protein LOC105161948    110   2e-26   
ref|XP_010668293.1|  PREDICTED: uncharacterized protein LOC104885298    107   1e-25   
ref|XP_011090499.1|  PREDICTED: uncharacterized protein LOC105171171    109   3e-25   
ref|XP_011093966.1|  PREDICTED: uncharacterized protein LOC105173785    109   4e-25   
ref|XP_011073620.1|  PREDICTED: uncharacterized protein LOC105158536    109   4e-25   
ref|XP_011078247.1|  PREDICTED: uncharacterized protein LOC105162039    109   5e-25   
ref|XP_011076961.1|  PREDICTED: uncharacterized protein LOC105161084    108   5e-25   
ref|XP_011073571.1|  PREDICTED: uncharacterized protein LOC105158484    108   7e-25   
ref|XP_011074079.1|  PREDICTED: uncharacterized protein LOC105158875    108   7e-25   
ref|XP_011100107.1|  PREDICTED: uncharacterized protein LOC105178339    107   2e-24   
ref|XP_010684144.1|  PREDICTED: uncharacterized protein LOC104898740    107   2e-24   
ref|XP_011075617.1|  PREDICTED: uncharacterized protein LOC105160050    107   2e-24   
ref|XP_011101631.1|  PREDICTED: inositol phosphorylceramide glucu...    106   3e-24   
ref|XP_011102166.1|  PREDICTED: uncharacterized protein LOC105180202    106   3e-24   
ref|XP_011098400.1|  PREDICTED: uncharacterized protein LOC105177075    107   3e-24   
ref|XP_011078211.1|  PREDICTED: uncharacterized protein LOC105162011    106   3e-24   
ref|XP_011085917.1|  PREDICTED: uncharacterized protein LOC105167800    106   3e-24   
ref|XP_011100995.1|  PREDICTED: uncharacterized protein LOC105179098    106   4e-24   
ref|XP_011071250.1|  PREDICTED: uncharacterized protein LOC105156729    105   7e-24   
emb|CAE04292.2|  OSJNBa0083I11.2                                        104   1e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011100170.1|  PREDICTED: uncharacterized protein LOC105178403    103   2e-23   
ref|XP_011070149.1|  PREDICTED: uncharacterized protein LOC105155862    104   2e-23   
ref|XP_011102006.1|  PREDICTED: uncharacterized protein LOC105180037    103   3e-23   
ref|XP_008222236.1|  PREDICTED: uncharacterized protein LOC103322132    102   4e-23   
gb|ABA97545.1|  retrotransposon protein, putative, unclassified         103   4e-23   Oryza sativa Japonica Group [Japonica rice]
gb|AAU10818.1|  putative polyprotein                                    103   4e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011087128.1|  PREDICTED: uncharacterized protein LOC105168695    103   5e-23   
ref|XP_011093333.1|  PREDICTED: uncharacterized protein LOC105173330    102   5e-23   
ref|XP_010695334.1|  PREDICTED: uncharacterized protein LOC104907994    101   6e-23   
gb|ABF98199.1|  retrotransposon protein, putative, unclassified         102   7e-23   Oryza sativa Japonica Group [Japonica rice]
gb|AAK26119.1|AC084406_2  putative gag-pol precursor                    102   7e-23   Oryza sativa [red rice]
emb|CAE06012.3|  OSJNBa0016O02.22                                       102   9e-23   Oryza sativa [red rice]
ref|XP_011100179.1|  PREDICTED: uncharacterized protein LOC105178414    102   1e-22   
gb|ABA95702.1|  retrotransposon protein, putative, unclassified         102   1e-22   Oryza sativa Japonica Group [Japonica rice]
gb|ABA93606.2|  retrotransposon protein, putative, unclassified         102   1e-22   Oryza sativa Japonica Group [Japonica rice]
gb|AAX96829.1|  retrotransposon protein, putative, unclassified         102   1e-22   Oryza sativa Japonica Group [Japonica rice]
emb|CAE02825.1|  OSJNBa0043A12.30                                       102   1e-22   Oryza sativa Japonica Group [Japonica rice]
emb|CAJ86094.1|  H0818H01.16                                            102   1e-22   Oryza sativa [red rice]
gb|ABA98939.1|  transposon protein, putative, unclassified              102   1e-22   Oryza sativa Japonica Group [Japonica rice]
gb|ABF96026.1|  retrotransposon protein, putative, unclassified         102   1e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011079221.1|  PREDICTED: uncharacterized protein LOC105162805    101   1e-22   
emb|CAH66197.1|  OSIGBa0148D14.3                                        101   1e-22   Oryza sativa [red rice]
ref|XP_011092660.1|  PREDICTED: uncharacterized protein LOC105172781  97.4    1e-22   
gb|AAX94870.1|  retrotransposon protein, putative, unclassified       99.8    2e-22   Oryza sativa Japonica Group [Japonica rice]
gb|AAS07318.1|  putative polyprotein                                    101   2e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010676986.1|  PREDICTED: uncharacterized protein LOC104892696    101   2e-22   
gb|AAU44223.1|  putative polyprotein                                    101   2e-22   Oryza sativa Japonica Group [Japonica rice]
gb|AAS88834.1|  putative polyprotein                                    101   2e-22   Oryza sativa Japonica Group [Japonica rice]
emb|CAD40323.2|  OSJNBb0054B09.8                                        101   2e-22   Oryza sativa Japonica Group [Japonica rice]
gb|AAV43949.1|  putative polyprotein                                    101   2e-22   Oryza sativa Japonica Group [Japonica rice]
emb|CAE02129.2|  OSJNBa0035M09.13                                       101   2e-22   Oryza sativa Japonica Group [Japonica rice]
gb|ABA98426.1|  retrotransposon protein, putative, unclassified         101   2e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011101638.1|  PREDICTED: uncharacterized protein LOC105179687    101   2e-22   
gb|AAV43845.1|  putative polyprotein                                    101   2e-22   Oryza sativa Japonica Group [Japonica rice]
emb|CAN80484.1|  hypothetical protein VITISV_017184                     100   2e-22   Vitis vinifera
gb|AAT85175.1|  putative polyprotein                                    101   2e-22   Oryza sativa Japonica Group [Japonica rice]
gb|ABB47864.2|  retrotransposon protein, putative, unclassified         101   2e-22   Oryza sativa Japonica Group [Japonica rice]
gb|AAM95684.1|  putative GAG-POL precursor                              101   2e-22   Oryza sativa Japonica Group [Japonica rice]
emb|CAE04928.2|  OSJNBa0017P10.5                                        101   2e-22   Oryza sativa Japonica Group [Japonica rice]
emb|CAD39966.2|  OSJNBa0072D08.5                                        101   2e-22   Oryza sativa Japonica Group [Japonica rice]
emb|CAH67521.1|  OSIGBa0131L05.2                                        101   3e-22   Oryza sativa [red rice]
gb|AAU10764.1|  putative polyprotein                                    101   3e-22   Oryza sativa Japonica Group [Japonica rice]
emb|CAE01723.2|  OSJNBb0050O03.13                                       101   3e-22   Oryza sativa Japonica Group [Japonica rice]
emb|CAE03745.1|  OSJNBa0019D11.11                                       101   3e-22   Oryza sativa Japonica Group [Japonica rice]
gb|ABF94159.1|  retrotransposon protein, putative, unclassified         101   3e-22   Oryza sativa Japonica Group [Japonica rice]
gb|ABF93464.1|  retrotransposon protein, putative, unclassified         100   3e-22   Oryza sativa Japonica Group [Japonica rice]
gb|AAK55777.1|AC079038_11  Putative polyprotein                         101   3e-22   Oryza sativa [red rice]
emb|CAE03902.2|  OSJNBb0026I12.10                                       101   3e-22   Oryza sativa Japonica Group [Japonica rice]
gb|AAT75253.1|  putative gag-pol precursor                              101   3e-22   Oryza sativa Japonica Group [Japonica rice]
gb|AAS98497.1|  putative polyprotein                                    101   3e-22   Oryza sativa Japonica Group [Japonica rice]
emb|CAE05493.2|  OSJNBa0022H21.13                                       101   3e-22   Oryza sativa Japonica Group [Japonica rice]
gb|AAX96572.1|  transposon protein, putative, unclassified              101   3e-22   Oryza sativa Japonica Group [Japonica rice]
gb|AAO66539.1|  retrotransposon protein, putative, unclassified         101   3e-22   Oryza sativa Japonica Group [Japonica rice]
gb|AAU44282.1|  putative polyprotein                                    101   3e-22   Oryza sativa Japonica Group [Japonica rice]
gb|ABF97875.1|  retrotransposon protein, putative, unclassified         101   3e-22   Oryza sativa Japonica Group [Japonica rice]
emb|CAE01816.2|  OSJNBa0041A02.3                                        101   3e-22   Oryza sativa Japonica Group [Japonica rice]
gb|ABA96833.1|  retrotransposon protein, putative, unclassified         101   3e-22   Oryza sativa Japonica Group [Japonica rice]
gb|AAX95002.1|  transposon protein, putative, unclassified              100   3e-22   Oryza sativa Japonica Group [Japonica rice]
gb|AAU44275.1|  putative polyprotein                                    101   3e-22   Oryza sativa Japonica Group [Japonica rice]
gb|AAQ56480.1|  putative polyprotein                                    101   3e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011079204.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    100   3e-22   
gb|ABA96776.1|  transposon protein, putative, unclassified              100   3e-22   Oryza sativa Japonica Group [Japonica rice]
emb|CAD41709.2|  OSJNBa0010D21.11                                       100   3e-22   Oryza sativa Japonica Group [Japonica rice]
gb|ABA99567.1|  retrotransposon protein, putative, unclassified         100   3e-22   Oryza sativa Japonica Group [Japonica rice]
gb|AAN31788.1|  Putative polyprotein                                    100   3e-22   Oryza sativa Japonica Group [Japonica rice]
gb|AAV31310.1|  putative polyprotein                                    100   3e-22   Oryza sativa Japonica Group [Japonica rice]
emb|CAD39933.2|  OSJNBa0091C12.11                                       100   3e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009123785.1|  PREDICTED: uncharacterized protein LOC103848687  96.7    3e-22   
gb|ABA95175.1|  retrotransposon protein, putative, unclassified         100   3e-22   Oryza sativa Japonica Group [Japonica rice]
gb|AAT07608.1|  putative polyprotein                                    100   3e-22   Oryza sativa Japonica Group [Japonica rice]
gb|ABA99771.1|  retrotransposon protein, putative, unclassified         100   3e-22   Oryza sativa Japonica Group [Japonica rice]
emb|CAE04515.1|  OSJNBb0059K02.25                                       100   3e-22   Oryza sativa Japonica Group [Japonica rice]
emb|CAD39523.2|  OSJNBa0027O01.10                                       100   3e-22   Oryza sativa Japonica Group [Japonica rice]
gb|ABF95088.1|  transposon protein, putative, unclassified              100   3e-22   Oryza sativa Japonica Group [Japonica rice]
gb|ABA99541.1|  retrotransposon protein, putative, unclassified         100   3e-22   Oryza sativa Japonica Group [Japonica rice]
gb|AAR88606.1|  putative polyprotein                                    100   3e-22   Oryza sativa Japonica Group [Japonica rice]
emb|CAH67840.1|  OSIGBa0159H11-OSIGBa0137A07.3                          100   3e-22   Oryza sativa [red rice]
emb|CAH66336.1|  OSIGBa0097I24.4                                        100   3e-22   Oryza sativa [red rice]
gb|AAN06839.1|  Putative retroelement                                   100   3e-22   Oryza sativa Japonica Group [Japonica rice]
gb|AAO38003.1|  putative polyprotein                                    100   3e-22   Oryza sativa Japonica Group [Japonica rice]
gb|ABF94078.1|  retrotransposon protein, putative, unclassified         100   3e-22   Oryza sativa Japonica Group [Japonica rice]
gb|ABA93961.1|  retrotransposon protein, putative, unclassified, ...    100   3e-22   Oryza sativa Japonica Group [Japonica rice]
gb|AAP53950.1|  transposon protein, putative, unclassified              100   3e-22   Oryza sativa Japonica Group [Japonica rice]
emb|CAE01613.2|  OSJNBa0067G20.11                                       100   3e-22   Oryza sativa Japonica Group [Japonica rice]
emb|CAN82687.1|  hypothetical protein VITISV_006267                     100   3e-22   Vitis vinifera
gb|ABF98055.1|  retrotransposon protein, putative, unclassified         100   3e-22   Oryza sativa Japonica Group [Japonica rice]
emb|CAH66724.1|  OSIGBa0118P15.14                                       100   3e-22   Oryza sativa [red rice]
emb|CAE01797.2|  OSJNBa0039K24.16                                       100   3e-22   Oryza sativa Japonica Group [Japonica rice]
gb|AAK55774.1|AC079038_8  Putative polyprotein                          100   3e-22   Oryza sativa [red rice]
dbj|BAB00646.1|  unnamed protein product                                100   3e-22   Oryza sativa Japonica Group [Japonica rice]
gb|ABF96052.1|  transposon protein, putative, unclassified              100   3e-22   Oryza sativa Japonica Group [Japonica rice]
emb|CAH67689.1|  H0510A06.14                                            100   3e-22   Oryza sativa [red rice]
gb|ABA94235.1|  retrotransposon protein, putative, unclassified         100   3e-22   Oryza sativa Japonica Group [Japonica rice]
emb|CAE03096.2|  OSJNBa0017B10.11                                       100   3e-22   Oryza sativa Japonica Group [Japonica rice]
emb|CAE04107.1|  OSJNBa0096F01.15                                       100   3e-22   
gb|AAR06355.1|  putative polyprotein                                    100   3e-22   Oryza sativa Japonica Group [Japonica rice]
gb|AAL58969.1|AC091811_18  putative gag-pol precursor                   100   3e-22   Oryza sativa [red rice]
gb|ABF99476.1|  retrotransposon protein, putative, unclassified         100   3e-22   Oryza sativa Japonica Group [Japonica rice]
emb|CAH67813.1|  OSIGBa0138H21-OSIGBa0138E01.4                          100   3e-22   Oryza sativa [red rice]
emb|CAE03073.3|  OSJNBa0089E12.11                                       100   3e-22   Oryza sativa [red rice]
gb|AAT73664.1|  putative polyprotein                                    100   4e-22   Oryza sativa Japonica Group [Japonica rice]
gb|ABF98885.1|  retrotransposon protein, putative, unclassified         100   4e-22   Oryza sativa Japonica Group [Japonica rice]
emb|CAE04563.1|  OSJNBb0039L24.2                                        100   4e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010496394.1|  PREDICTED: chitinase-3-like protein 2            99.0    4e-22   
gb|ABA91954.2|  retrotransposon protein, putative, unclassified         100   4e-22   Oryza sativa Japonica Group [Japonica rice]
emb|CAE05270.2|  OSJNBb0014D23.4                                        100   4e-22   Oryza sativa Japonica Group [Japonica rice]
gb|ABF96344.1|  retrotransposon protein, putative, unclassified         100   4e-22   Oryza sativa Japonica Group [Japonica rice]
gb|ABA95011.1|  transposon protein, putative, unclassified              100   4e-22   Oryza sativa Japonica Group [Japonica rice]
gb|ABA96681.1|  retrotransposon protein, putative, unclassified         100   4e-22   Oryza sativa Japonica Group [Japonica rice]
emb|CAH67964.1|  OSIGBa0142I02-OSIGBa0101B20.7                          100   4e-22   Oryza sativa [red rice]
ref|XP_011091718.1|  PREDICTED: uncharacterized protein LOC105172079  97.1    4e-22   
emb|CAH66086.1|  H0209A05.3                                             100   4e-22   Oryza sativa [red rice]
gb|AAX96861.1|  retrotransposon protein, putative, unclassified         100   4e-22   Oryza sativa Japonica Group [Japonica rice]
emb|CAE04877.2|  OSJNBa0086O06.25                                       100   4e-22   Oryza sativa Japonica Group [Japonica rice]
emb|CAH68539.2|  OSJNBa0009P12.6                                        100   4e-22   Oryza sativa [red rice]
emb|CAE04174.2|  OSJNBa0029C04.4                                        100   4e-22   Oryza sativa Japonica Group [Japonica rice]
emb|CAN64901.1|  hypothetical protein VITISV_037598                   97.4    4e-22   Vitis vinifera
gb|AAD20432.1|  putative retroelement pol polyprotein                 94.4    4e-22   Arabidopsis thaliana [mouse-ear cress]
gb|AAT77917.1|  putative polyprotein                                    100   4e-22   Oryza sativa Japonica Group [Japonica rice]
gb|AAO66535.1|  transposon protein, putative, unclassified              100   4e-22   Oryza sativa Japonica Group [Japonica rice]
emb|CAE02878.1|  OSJNBb0022F23.15                                       100   4e-22   Oryza sativa Japonica Group [Japonica rice]
emb|CAH67683.1|  H0510A06.8                                             100   5e-22   Oryza sativa [red rice]
emb|CAH67479.1|  H0805A05.9                                             100   5e-22   Oryza sativa [red rice]
gb|AAK92547.1|AC051624_5  Putative retroelement                         100   5e-22   Oryza sativa [red rice]
emb|CAN68770.1|  hypothetical protein VITISV_018662                     100   5e-22   Vitis vinifera
gb|AAM94933.1|  putative GAG-POL precursor                              100   5e-22   Oryza sativa Japonica Group [Japonica rice]
emb|CAE05339.2|  OSJNBa0079M09.11                                       100   5e-22   Oryza sativa Japonica Group [Japonica rice]
gb|KFK39802.1|  hypothetical protein AALP_AA3G290100                  99.8    5e-22   
gb|AAK16189.1|AC079887_21  putative polyprotein                         100   5e-22   Oryza sativa Japonica Group [Japonica rice]
gb|AAX96661.1|  retrotransposon protein, putative, unclassified         100   5e-22   Oryza sativa Japonica Group [Japonica rice]
gb|ABF95742.1|  retrotransposon protein, putative, unclassified         100   5e-22   Oryza sativa Japonica Group [Japonica rice]
emb|CAN64615.1|  hypothetical protein VITISV_036196                     100   5e-22   Vitis vinifera
emb|CAH67052.1|  OSIGBa0127A14.4                                        100   5e-22   Oryza sativa [red rice]
gb|AAU44314.1|  putative polyprotein                                    100   5e-22   Oryza sativa Japonica Group [Japonica rice]
emb|CAE03002.2|  OSJNBa0043L09.21                                       100   5e-22   Oryza sativa Japonica Group [Japonica rice]
gb|ABA98262.1|  transposon protein, putative, unclassified              100   5e-22   Oryza sativa Japonica Group [Japonica rice]
emb|CAN66238.1|  hypothetical protein VITISV_041838                   95.9    5e-22   Vitis vinifera
emb|CAE05074.2|  OSJNBa0094P09.13                                       100   5e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010490399.1|  PREDICTED: uncharacterized protein LOC104768172    100   5e-22   
emb|CAN71857.1|  hypothetical protein VITISV_012968                   99.8    5e-22   Vitis vinifera
emb|CAD41940.2|  OSJNBa0070M12.17                                       100   5e-22   Oryza sativa Japonica Group [Japonica rice]
gb|ABA94871.2|  retrotransposon protein, putative, unclassified         100   5e-22   Oryza sativa Japonica Group [Japonica rice]
gb|KFK29723.1|  hypothetical protein AALP_AA7G170100                  99.0    6e-22   
emb|CAE02013.3|  OSJNBa0079A21.2                                        100   6e-22   Oryza sativa [red rice]
emb|CAE05078.2|  OSJNBa0094P09.17                                       100   6e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010431341.1|  PREDICTED: uncharacterized protein LOC104715647    100   6e-22   
gb|ABA95291.1|  transposon protein, putative, unclassified              100   6e-22   Oryza sativa Japonica Group [Japonica rice]
gb|AAS07175.1|  putative reverse transcriptase                          100   6e-22   Oryza sativa Japonica Group [Japonica rice]
emb|CAE03547.2|  OSJNBa0060D06.13                                       100   6e-22   Oryza sativa Japonica Group [Japonica rice]
gb|AAU43927.1|  putative polyprotein                                    100   6e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001545081.1|  hypothetical protein BC1G_16418                  96.3    6e-22   Botrytis cinerea B05.10
emb|CAE03482.2|  OSJNBa0065O17.7                                        100   6e-22   Oryza sativa Japonica Group [Japonica rice]
gb|AAX95884.1|  retrotransposon protein, putative, unclassified         100   6e-22   Oryza sativa Japonica Group [Japonica rice]
gb|ABA92306.2|  retrotransposon protein, putative, unclassified         100   7e-22   Oryza sativa Japonica Group [Japonica rice]
gb|ABA94658.1|  retrotransposon protein, putative, unclassified         100   7e-22   Oryza sativa Japonica Group [Japonica rice]
gb|AAT85251.1|  putative polyprotein                                    100   7e-22   Oryza sativa Japonica Group [Japonica rice]
emb|CAD40289.2|  OSJNBb0062H02.6                                        100   7e-22   Oryza sativa Japonica Group [Japonica rice]
emb|CAN72190.1|  hypothetical protein VITISV_037820                   99.4    7e-22   Vitis vinifera
emb|CAE76060.1|  B1248C03.19                                            100   7e-22   Oryza sativa Japonica Group [Japonica rice]
gb|ABF94245.1|  transposon protein, putative, unclassified              100   7e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009148661.1|  PREDICTED: protein NYNRIN-like                   99.8    7e-22   
gb|ABF97535.1|  retrotransposon protein, putative, unclassified       99.8    8e-22   Oryza sativa Japonica Group [Japonica rice]
gb|ABA91113.2|  retrotransposon protein, putative, unclassified       99.8    8e-22   Oryza sativa Japonica Group [Japonica rice]
gb|ABA99331.1|  retrotransposon protein, putative, unclassified       99.8    8e-22   Oryza sativa Japonica Group [Japonica rice]
emb|CAN75487.1|  hypothetical protein VITISV_043149                   99.4    8e-22   Vitis vinifera
emb|CAN81205.1|  hypothetical protein VITISV_020910                   99.4    8e-22   Vitis vinifera
ref|XP_010513349.1|  PREDICTED: uncharacterized protein LOC104789330  99.4    8e-22   
emb|CAN68844.1|  hypothetical protein VITISV_032036                   99.4    8e-22   Vitis vinifera
gb|AAR87221.1|  retrotransposon protein, putative, unclassified       99.8    8e-22   Oryza sativa Japonica Group [Japonica rice]
gb|AAU10741.1|  putative polyprotein                                  99.8    8e-22   Oryza sativa Japonica Group [Japonica rice]
gb|ABA97130.1|  retrotransposon protein, putative, unclassified       99.8    9e-22   Oryza sativa Japonica Group [Japonica rice]
gb|ABA95559.1|  retrotransposon protein, putative, unclassified       99.8    9e-22   Oryza sativa Japonica Group [Japonica rice]
gb|ABA93826.2|  retrotransposon protein, putative, unclassified       99.8    9e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010451667.1|  PREDICTED: uncharacterized protein LOC104733819  99.4    9e-22   
gb|ABA98055.1|  retrotransposon protein, putative, unclassified       99.8    9e-22   Oryza sativa Japonica Group [Japonica rice]
emb|CAE03836.3|  OSJNBb0013J13.13                                     99.8    9e-22   Oryza sativa Japonica Group [Japonica rice]
emb|CAN67795.1|  hypothetical protein VITISV_009541                   99.0    1e-21   Vitis vinifera
emb|CAE03879.1|  OSJNBb0015N08.7                                      99.8    1e-21   Oryza sativa Japonica Group [Japonica rice]
emb|CAN80434.1|  hypothetical protein VITISV_001561                   99.0    1e-21   Vitis vinifera
gb|AAU44318.1|  putative polyprotein                                  99.4    1e-21   Oryza sativa Japonica Group [Japonica rice]
gb|KFK26623.1|  hypothetical protein AALP_AA8G272900                  99.4    1e-21   
emb|CAH66808.1|  OSIGBa0135C13.3                                      99.4    1e-21   Oryza sativa [red rice]
gb|AAV25049.1|  putative polyprotein                                  99.4    1e-21   Oryza sativa Japonica Group [Japonica rice]
gb|AAP06851.1|  putative polyprotein                                  99.4    1e-21   Oryza sativa Japonica Group [Japonica rice]
gb|ABA97306.1|  retrotransposon protein, putative, unclassified       99.4    1e-21   Oryza sativa Japonica Group [Japonica rice]
gb|AAK53857.1|AC016781_11  Putative retroelement                      99.4    1e-21   Oryza sativa Japonica Group [Japonica rice]
gb|KFK23214.1|  hypothetical protein AALP_AAs44667U000200             99.4    1e-21   
gb|AAO17025.1|  Putative gag-pol precursor                            99.4    1e-21   Oryza sativa Japonica Group [Japonica rice]
gb|ABA99479.1|  retrotransposon protein, putative, unclassified       99.0    1e-21   Oryza sativa Japonica Group [Japonica rice]
gb|AAU90124.1|  putative polyprotein                                  99.4    1e-21   Oryza sativa Japonica Group [Japonica rice]
emb|CAN76908.1|  hypothetical protein VITISV_006597                   99.0    1e-21   Vitis vinifera
gb|ABA94226.1|  retrotransposon protein, putative, unclassified       99.4    1e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009145079.1|  PREDICTED: uncharacterized protein LOC103868760  99.4    1e-21   
gb|ABA94805.1|  retrotransposon protein, putative, unclassified       99.0    1e-21   Oryza sativa Japonica Group [Japonica rice]
gb|AAT77889.1|  putative polyprotein                                  99.0    1e-21   Oryza sativa Japonica Group [Japonica rice]
emb|CAH66523.1|  H0502B11.3                                           99.0    1e-21   Oryza sativa [red rice]
emb|CAE01728.2|  OSJNBb0050O03.18                                     99.0    1e-21   Oryza sativa Japonica Group [Japonica rice]
emb|CAD40917.1|  OSJNBa0088K19.3                                      99.0    2e-21   Oryza sativa Japonica Group [Japonica rice]
emb|CAD40020.2|  OSJNBa0052O21.5                                      99.0    2e-21   Oryza sativa Japonica Group [Japonica rice]
gb|AAP44696.1|  putative GAG-POL precursor                            99.0    2e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009113559.1|  PREDICTED: uncharacterized protein LOC103838859  98.6    2e-21   
gb|AAT93943.1|  putative polyprotein                                  99.0    2e-21   Oryza sativa Japonica Group [Japonica rice]
gb|AAT81752.1|  Reverse transcriptase (RNA-dependent DNA polymera...  99.0    2e-21   Oryza sativa Japonica Group [Japonica rice]
emb|CAH67128.1|  H0315E07.6                                           99.0    2e-21   Oryza sativa [red rice]
emb|CAN80939.1|  hypothetical protein VITISV_035836                   98.2    2e-21   Vitis vinifera
ref|XP_010445558.1|  PREDICTED: uncharacterized protein LOC104728244  98.6    2e-21   
emb|CAN67467.1|  hypothetical protein VITISV_031393                   95.5    2e-21   Vitis vinifera
emb|CAN82984.1|  hypothetical protein VITISV_030339                   98.2    2e-21   Vitis vinifera
emb|CAN77146.1|  hypothetical protein VITISV_038341                   98.2    2e-21   Vitis vinifera
gb|KFK39764.1|  hypothetical protein AALP_AA3G284800                  98.6    2e-21   
emb|CAN67947.1|  hypothetical protein VITISV_002483                   98.2    2e-21   Vitis vinifera
gb|KFK44297.1|  hypothetical protein AALP_AA1G239700                  98.6    2e-21   
ref|XP_009762920.1|  PREDICTED: uncharacterized protein LOC104214896  95.5    2e-21   
gb|AAM14690.1|AC097446_19  Putative gag-pol precursor                 97.8    2e-21   Oryza sativa Japonica Group [Japonica rice]
emb|CAD40221.2|  OSJNBa0019J05.19                                     98.6    2e-21   Oryza sativa Japonica Group [Japonica rice]
gb|ABW81060.1|  GagPol3                                               98.2    2e-21   Arabidopsis lyrata subsp. lyrata
gb|KFK22060.1|  hypothetical protein AALP_AAs39363U000200             98.6    2e-21   
gb|AAP52180.2|  retrotransposon protein, putative, unclassified       97.4    2e-21   Oryza sativa Japonica Group [Japonica rice]
gb|ABA91263.1|  retrotransposon protein, putative, unclassified       98.6    2e-21   Oryza sativa Japonica Group [Japonica rice]
gb|AAT85261.1|  putative polyprotein                                  98.6    2e-21   Oryza sativa Japonica Group [Japonica rice]
gb|KFK24131.1|  hypothetical protein AALP_AAs45400U000100             97.4    3e-21   
emb|CAH66232.1|  H0825G02.9                                           98.2    3e-21   Oryza sativa [red rice]
gb|KFK44296.1|  hypothetical protein AALP_AA1G239700                  98.2    3e-21   
gb|AAP46242.1|  putative gag-pol precursor, 3'-partial                97.8    3e-21   Oryza sativa Japonica Group [Japonica rice]
emb|CAN77646.1|  hypothetical protein VITISV_024979                   94.4    3e-21   Vitis vinifera
gb|AAT77321.1|  putative polyprotein                                  98.2    3e-21   Oryza sativa Japonica Group [Japonica rice]
gb|KFK35944.1|  hypothetical protein AALP_AA4G058000                  98.2    3e-21   
gb|ABA99783.1|  retrotransposon protein, putative, unclassified       98.2    3e-21   Oryza sativa Japonica Group [Japonica rice]
emb|CAD40172.2|  OSJNBa0061A09.11                                     98.2    3e-21   Oryza sativa Japonica Group [Japonica rice]
emb|CAE02120.2|  OSJNBa0019G23.15                                     98.2    3e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010412811.1|  PREDICTED: uncharacterized protein LOC104699175  97.8    3e-21   
ref|XP_010451318.1|  PREDICTED: uncharacterized protein LOC104733437  97.8    3e-21   
gb|ABA95741.2|  retrotransposon protein, putative, unclassified       98.2    3e-21   Oryza sativa Japonica Group [Japonica rice]
emb|CAE75910.1|  OSJNBb0115I21.13                                     98.2    3e-21   Oryza sativa Japonica Group [Japonica rice]
emb|CAH66757.1|  OSIGBa0158F05.6                                      97.8    3e-21   Oryza sativa [red rice]
gb|AAV33321.1|  putative polyprotein                                  98.2    3e-21   Oryza sativa Japonica Group [Japonica rice]
emb|CAH66184.1|  OSIGBa0130O15.8                                      98.2    3e-21   Oryza sativa [red rice]
gb|AAT44273.1|  hypothetical protein                                  98.2    3e-21   Oryza sativa Japonica Group [Japonica rice]
emb|CAN76815.1|  hypothetical protein VITISV_044116                   97.8    3e-21   Vitis vinifera
gb|KFK39321.1|  hypothetical protein AALP_AA3G229400                  98.2    3e-21   
gb|AAU44127.1|  putative polyprotein                                  98.2    3e-21   Oryza sativa Japonica Group [Japonica rice]
emb|CAE05529.2|  OSJNBa0053B21.3                                      98.2    3e-21   Oryza sativa Japonica Group [Japonica rice]
emb|CAE05289.2|  OSJNBa0084N21.7                                      98.2    3e-21   Oryza sativa Japonica Group [Japonica rice]
emb|CAE01745.2|  OSJNBb0056F09.8                                      98.2    3e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010462734.1|  PREDICTED: uncharacterized protein LOC104743335  97.8    3e-21   
gb|KFK21865.1|  hypothetical protein AALP_AAs49670U000100             97.8    3e-21   
emb|CAN67674.1|  hypothetical protein VITISV_020900                   97.8    3e-21   Vitis vinifera
emb|CAN74823.1|  hypothetical protein VITISV_034594                   97.4    3e-21   Vitis vinifera
emb|CAN61804.1|  hypothetical protein VITISV_044085                   97.8    3e-21   Vitis vinifera
gb|AAT81661.1|  putative retrotransposon protein                      97.8    4e-21   Oryza sativa Japonica Group [Japonica rice]
emb|CAN75011.1|  hypothetical protein VITISV_003559                   97.4    4e-21   Vitis vinifera
gb|ABA98419.2|  retrotransposon protein, putative, Ty3-gypsy subc...  97.8    4e-21   Oryza sativa Japonica Group [Japonica rice]
gb|AAN06868.1|  Putative polyprotein                                  97.8    4e-21   Oryza sativa Japonica Group [Japonica rice]
gb|AAP03396.1|  putative GAG-POL precursor                            97.8    4e-21   Oryza sativa Japonica Group [Japonica rice]
emb|CAH67380.1|  OSIGBa0159F11.4                                      97.8    4e-21   Oryza sativa [red rice]
emb|CAN72118.1|  hypothetical protein VITISV_012997                   97.1    4e-21   Vitis vinifera
emb|CAE03695.2|  OSJNBb0026E15.13                                     97.8    4e-21   Oryza sativa Japonica Group [Japonica rice]
gb|AAT77060.1|  retrotransposon protein, putative, unclassified       97.1    4e-21   Oryza sativa Japonica Group [Japonica rice]
gb|AAO39874.1|  putative gag-pol precursor                            97.8    4e-21   
emb|CAE02251.2|  OSJNBb0032E06.9                                      97.4    4e-21   
gb|AAP53804.1|  retrotransposon protein, putative, unclassified       97.8    4e-21   
emb|CAN82848.1|  hypothetical protein VITISV_027636                   97.4    4e-21   
emb|CAE03621.3|  OSJNBb0003B01.12                                     97.8    4e-21   
gb|ABA98873.1|  transposon protein, putative, unclassified            97.1    4e-21   
gb|AAF79618.1|AC027665_19  F5M15.26                                   97.8    5e-21   
ref|XP_009387907.1|  PREDICTED: uncharacterized protein LOC103974748  97.1    5e-21   
gb|KFK24493.1|  hypothetical protein AALP_AAs49847U000100             97.4    5e-21   
emb|CAN72633.1|  hypothetical protein VITISV_007593                   96.7    5e-21   
ref|XP_006478539.1|  PREDICTED: uncharacterized protein LOC102614166  97.4    5e-21   
emb|CAN64535.1|  hypothetical protein VITISV_041855                   97.1    5e-21   
ref|XP_006486503.1|  PREDICTED: uncharacterized protein LOC102607673  97.4    5e-21   
gb|ABF99688.1|  retrotransposon protein, putative, unclassified       97.4    5e-21   
gb|AAU90115.1|  putative polyprotein                                  97.4    5e-21   
gb|ABA93610.1|  retrotransposon protein, putative, Ty3-gypsy subc...  96.3    5e-21   
gb|ABA96229.2|  retrotransposon protein, putative, unclassified       97.4    5e-21   
emb|CAE05745.1|  OSJNBb0017I01.25                                     97.4    5e-21   
emb|CBG76438.1|  OO_Ba0013J05-OO_Ba0033A15.25                         97.4    6e-21   
gb|ABF96045.1|  transposon protein, putative, unclassified            97.4    6e-21   
ref|XP_010413056.1|  PREDICTED: uncharacterized protein LOC104699451  97.1    6e-21   
ref|XP_009151551.1|  PREDICTED: uncharacterized protein LOC103874878  97.4    6e-21   
emb|CAE02875.1|  OSJNBb0022F23.12                                     97.1    6e-21   
emb|CAN79683.1|  hypothetical protein VITISV_011289                   97.1    6e-21   
emb|CAN69920.1|  hypothetical protein VITISV_040637                   97.1    6e-21   
gb|ABA97049.1|  retrotransposon protein, putative, Ty3-gypsy subc...  97.1    6e-21   
emb|CAE02453.2|  OSJNBa0042D13.6                                      94.7    6e-21   
gb|AAP52619.1|  retrotransposon protein, putative, unclassified       97.4    6e-21   
gb|AAQ56293.1|  putative gag-pol precursor                            97.1    6e-21   
ref|XP_010495640.1|  PREDICTED: uncharacterized protein LOC104772759  97.1    6e-21   
gb|ABA94515.1|  retrotransposon protein, putative, unclassified       97.4    6e-21   
gb|AAL31648.1|AC079179_3  Putative polyprotein                        97.1    6e-21   
emb|CAN74139.1|  hypothetical protein VITISV_038754                   97.1    6e-21   
gb|ABF99467.1|  retrotransposon protein, putative, unclassified       97.4    6e-21   
gb|AAP53982.2|  retrotransposon protein, putative, unclassified       97.1    7e-21   
gb|ABF98665.1|  retrotransposon protein, putative, unclassified       96.7    7e-21   
gb|AAS75222.1|  putative polyprotein                                  97.1    7e-21   
ref|XP_006579082.1|  PREDICTED: uncharacterized protein LOC100781178  94.0    7e-21   
emb|CAE04098.3|  OSJNBa0096F01.7                                      97.1    7e-21   
emb|CAN67782.1|  hypothetical protein VITISV_004473                   96.7    7e-21   
emb|CAE05649.2|  OSJNBa0038O10.15                                     97.1    7e-21   
emb|CAN73608.1|  hypothetical protein VITISV_026302                   96.7    7e-21   
gb|AAT77916.1|  putative polyprotein                                  97.1    7e-21   
gb|AAX96721.1|  retrotransposon protein, putative, unclassified       97.1    7e-21   
gb|ABA94348.1|  retrotransposon protein, putative, unclassified       97.1    8e-21   
emb|CAH67174.1|  H0211B05.11                                          97.1    8e-21   
gb|ABF94908.1|  retrotransposon protein, putative, unclassified       97.1    8e-21   
emb|CAN71052.1|  hypothetical protein VITISV_003719                   96.7    8e-21   
ref|XP_008219638.1|  PREDICTED: uncharacterized protein LOC103319819  96.3    8e-21   
emb|CAH68008.1|  OSIGBa0157K09-H0214G12.19                            96.7    8e-21   
emb|CAE03388.1|  OSJNBa0004N05.12                                     96.7    8e-21   
emb|CAN62339.1|  hypothetical protein VITISV_035643                   96.7    8e-21   
emb|CAN79251.1|  hypothetical protein VITISV_038223                   95.9    9e-21   
gb|AAT44267.1|  hypothetical protein                                  96.7    9e-21   
emb|CAN70842.1|  hypothetical protein VITISV_013563                   95.1    9e-21   
gb|AAP54205.2|  retrotransposon protein, putative, Ty3-gypsy subc...  96.7    9e-21   
ref|XP_008235888.1|  PREDICTED: disease resistance protein RPM1-like  96.7    9e-21   
gb|ABA94956.2|  retrotransposon protein, putative, Ty3-gypsy subc...  96.7    9e-21   
emb|CAH66864.1|  H0307D04.9                                           96.7    9e-21   
emb|CAH67900.1|  OSIGBa0115K01-H0319F09.6                             96.7    9e-21   
emb|CAN83098.1|  hypothetical protein VITISV_008533                   96.3    9e-21   
emb|CAN69893.1|  hypothetical protein VITISV_005621                   96.3    9e-21   
emb|CAN75942.1|  hypothetical protein VITISV_016459                   96.3    1e-20   
emb|CAN83420.1|  hypothetical protein VITISV_034225                   96.3    1e-20   
emb|CAN65043.1|  hypothetical protein VITISV_040652                   95.5    1e-20   
gb|AAK27822.1|AC022457_25  putative gag-pol precursor                 96.7    1e-20   
emb|CAN73109.1|  hypothetical protein VITISV_013434                   96.3    1e-20   
emb|CAN61713.1|  hypothetical protein VITISV_034504                   96.3    1e-20   
gb|ABA97905.1|  retrotransposon protein, putative, unclassified       91.7    1e-20   
gb|AAU44239.1|  putative polyprotein                                  96.7    1e-20   
gb|AAN01247.1|  Putative retroelement                                 96.7    1e-20   
emb|CAN71053.1|  hypothetical protein VITISV_003720                   96.3    1e-20   
emb|CAN83791.1|  hypothetical protein VITISV_031681                   96.3    1e-20   
emb|CAN62505.1|  hypothetical protein VITISV_010653                   96.3    1e-20   
ref|XP_010445318.1|  PREDICTED: uncharacterized protein LOC104727965  96.3    1e-20   
ref|XP_010695810.1|  PREDICTED: uncharacterized protein LOC104908390  96.7    1e-20   
emb|CAN73649.1|  hypothetical protein VITISV_036843                   96.3    1e-20   
emb|CAD41616.1|  OSJNBa0091D06.19                                     96.7    1e-20   
gb|ABA94416.2|  retrotransposon protein, putative, Ty3-gypsy subc...  96.3    1e-20   
ref|XP_008223641.1|  PREDICTED: uncharacterized protein LOC103323422  95.9    1e-20   
ref|XP_004983003.1|  PREDICTED: uncharacterized protein LOC101781066  96.3    1e-20   
emb|CAN70870.1|  hypothetical protein VITISV_029060                   95.9    1e-20   
gb|AAX95687.1|  RNase H, putative                                     96.3    1e-20   
ref|XP_010462569.1|  PREDICTED: uncharacterized protein LOC104743154  96.3    1e-20   
emb|CAN69792.1|  hypothetical protein VITISV_044000                   95.9    1e-20   
gb|AAK52121.1|AC079936_17  Putative retroelement                      96.3    1e-20   
gb|AAD30632.1|AC006085_5  Hypothetical protein                        96.3    1e-20   
emb|CAN60196.1|  hypothetical protein VITISV_019178                   95.9    1e-20   
gb|ABB47490.1|  retrotransposon protein, putative, Ty3-gypsy subc...  96.3    1e-20   
gb|ABF95942.1|  retrotransposon protein, putative, unclassified, ...  95.5    1e-20   
gb|ABG66296.1|  retrotransposon protein, putative, Ty3-gypsy subc...  96.3    1e-20   
emb|CAN74048.1|  hypothetical protein VITISV_017189                   95.9    1e-20   
gb|AAR13317.1|  gag-pol polyprotein                                   96.3    1e-20   
ref|XP_008245682.1|  PREDICTED: uncharacterized protein LOC103343819  93.2    1e-20   
emb|CAN70585.1|  hypothetical protein VITISV_013305                   95.9    1e-20   
gb|ABB46880.2|  retrotransposon protein, putative, unclassified       96.3    1e-20   
ref|XP_004308263.1|  PREDICTED: uncharacterized protein LOC101303281  94.4    1e-20   
gb|AAU10736.1|  putative polyprotein                                  96.3    2e-20   
ref|XP_010419103.1|  PREDICTED: uncharacterized protein LOC104704769  95.9    2e-20   
gb|ABF98840.1|  retrotransposon protein, putative, unclassified       95.9    2e-20   
gb|ABF98607.1|  retrotransposon protein, putative, unclassified       95.9    2e-20   
gb|AAK71558.1|AC087852_18  putative gag-pol protein precursor         95.9    2e-20   
emb|CAN65033.1|  hypothetical protein VITISV_041069                   95.9    2e-20   
gb|AAD03367.1|  putative retroelement pol polyprotein                 95.9    2e-20   
emb|CAN81063.1|  hypothetical protein VITISV_000726                   95.5    2e-20   
gb|AAX95171.1|  retrotransposon protein, putative, Ty3-gypsy sub-...  96.3    2e-20   
gb|AAU10826.1|  putative polyprotein                                  96.3    2e-20   
ref|XP_006488688.1|  PREDICTED: uncharacterized protein LOC102623105  95.9    2e-20   
ref|XP_008245656.1|  PREDICTED: uncharacterized protein LOC103343797  95.5    2e-20   
gb|AAG15480.1|  polyprotein                                           94.7    2e-20   
ref|XP_009794634.1|  PREDICTED: uncharacterized protein LOC104241394  92.8    2e-20   
emb|CAH66285.1|  OSIGBa0161P06.2                                      95.9    2e-20   
emb|CAN72219.1|  hypothetical protein VITISV_020539                   95.5    2e-20   
gb|ABA97388.2|  retrotransposon protein, putative, Ty3-gypsy subc...  94.7    2e-20   
emb|CAN70566.1|  hypothetical protein VITISV_010970                   95.5    2e-20   
gb|AAN65036.1|  putative RIRE2 retrotransposon protein                95.9    2e-20   
gb|ABF99143.1|  retrotransposon protein, putative, Ty3-gypsy subc...  95.9    2e-20   
ref|XP_010677035.1|  PREDICTED: uncharacterized protein LOC104892750  95.5    2e-20   
emb|CAN68501.1|  hypothetical protein VITISV_026904                   95.1    2e-20   
gb|AAD20101.1|  putative retroelement pol polyprotein                 95.1    2e-20   
emb|CAN77422.1|  hypothetical protein VITISV_032393                   95.5    2e-20   
emb|CAN65076.1|  hypothetical protein VITISV_028912                   95.1    2e-20   
emb|CAN73766.1|  hypothetical protein VITISV_012367                   95.5    2e-20   
emb|CAE03595.1|  OSJNBa0087O24.18                                     95.5    2e-20   
emb|CAN72671.1|  hypothetical protein VITISV_028694                   95.1    2e-20   
gb|AAT77820.1|  putative gag-pol protein                              95.5    2e-20   
emb|CAE03136.1|  OJ000114_01.17                                       95.5    2e-20   
gb|ABF96921.1|  retrotransposon protein, putative, Ty3-gypsy subc...  95.5    2e-20   
dbj|BAD18986.1|  GAG-POL precursor                                    95.1    2e-20   
emb|CAN69331.1|  hypothetical protein VITISV_030566                   95.1    2e-20   
gb|KFK23511.1|  hypothetical protein AALP_AAs69829U000200             95.5    2e-20   
emb|CAN64574.1|  hypothetical protein VITISV_003431                   95.1    2e-20   
gb|AAM19013.1|AC084748_3  putative gag-pol precursor protein          95.5    2e-20   
gb|ABF93468.1|  retrotransposon protein, putative, unclassified       95.5    2e-20   
emb|CAN64746.1|  hypothetical protein VITISV_041323                   95.1    2e-20   
gb|AAO66568.1|  putative gag-pol protein                              95.1    2e-20   
gb|AAM74243.1|AC074355_5  Putative retroelement                       95.5    2e-20   
emb|CAN83959.1|  hypothetical protein VITISV_013448                   95.1    3e-20   
gb|KFK24598.1|  hypothetical protein AALP_AAs72716U000200             95.5    3e-20   
emb|CAN68524.1|  hypothetical protein VITISV_025157                   95.1    3e-20   
gb|AAL76007.1|AF466646_15  prpol                                      95.1    3e-20   
gb|ABA97055.1|  retrotransposon protein, putative, Ty3-gypsy subc...  95.1    3e-20   
emb|CAE03668.3|  OSJNBa0042N22.10                                     95.5    3e-20   
emb|CAN79600.1|  hypothetical protein VITISV_015420                   95.1    3e-20   
gb|ABF99249.1|  retrotransposon protein, putative, Ty3-gypsy subc...  95.1    3e-20   
emb|CAN76324.1|  hypothetical protein VITISV_011885                   91.7    3e-20   
emb|CAH65991.1|  H1005F08.20                                          95.1    3e-20   
gb|AAO66548.1|  retrotransposon protein, putative, Ty3-gypsy sub-...  95.1    3e-20   
dbj|BAC05657.1|  putatitive retrotransposon Cinful-1                  95.5    3e-20   
gb|ABA97385.1|  retrotransposon protein, putative, Ty3-gypsy subc...  94.4    3e-20   
ref|XP_005315177.1|  PREDICTED: uncharacterized protein LOC101933223  95.1    3e-20   
gb|AAD11615.1|  prpol                                                 95.1    3e-20   
gb|ABF99975.1|  retrotransposon protein, putative, Ty3-gypsy subc...  95.1    3e-20   
emb|CAN78921.1|  hypothetical protein VITISV_011350                   95.1    3e-20   
gb|AAS01973.1|  retrotransposon protein, putative, Ty3-gypsy sub-...  95.1    3e-20   
emb|CAH66045.1|  OSIGBa0107A02.6                                      94.7    3e-20   
ref|XP_010681902.1|  PREDICTED: uncharacterized protein LOC104896808  94.0    3e-20   
gb|AAV32231.1|  putative polyprotein                                  95.5    3e-20   
gb|ABF96015.1|  retrotransposon protein, putative, unclassified       92.4    3e-20   
emb|CAN69952.1|  hypothetical protein VITISV_012847                   94.7    3e-20   
ref|XP_006464891.1|  PREDICTED: uncharacterized protein LOC102626228  95.1    3e-20   
gb|ABA92927.2|  retrotransposon protein, putative, Ty3-gypsy subc...  95.1    3e-20   
gb|AAP54065.1|  retrotransposon protein, putative, Ty3-gypsy subc...  95.1    3e-20   
emb|CAD39795.2|  OSJNBa0071G03.8                                      94.0    3e-20   
gb|ABA97229.1|  retrotransposon protein, putative, unclassified       95.1    3e-20   
emb|CAN61873.1|  hypothetical protein VITISV_031101                   94.7    3e-20   
gb|AAS90648.1|  putative polyprotein                                  95.1    3e-20   
emb|CAE05173.2|  OSJNBa0013A04.10                                     94.7    3e-20   
gb|ABA97957.1|  retrotransposon protein, putative, Ty3-gypsy subc...  95.1    4e-20   
gb|AAP52499.2|  retrotransposon protein, putative, Ty3-gypsy subc...  95.1    4e-20   
gb|ABF96095.1|  retrotransposon protein, putative, Ty3-gypsy subc...  94.4    4e-20   
gb|AAM74435.1|AC123594_18  Putative retroelement                      94.0    4e-20   
ref|XP_010474478.1|  PREDICTED: uncharacterized protein LOC104754011  94.7    4e-20   
gb|AAT73678.1|  putative polyprotein                                  95.1    4e-20   
gb|AAL82662.1|AC092387_10  retrotransposon protein, putative, Ty3...  95.1    4e-20   
emb|CAD40441.1|  OSJNBa0035B13.14                                     95.1    4e-20   
gb|AAM92802.1|  putative gag-pol precursor                            95.1    4e-20   
gb|ABF98738.1|  retrotransposon protein, putative, Ty3-gypsy subc...  94.7    4e-20   
gb|ABA93599.1|  retrotransposon protein, putative, Ty3-gypsy subc...  95.1    4e-20   
emb|CAE04995.2|  OSJNBb0093G06.3                                      95.1    4e-20   
gb|ABA96683.1|  retrotransposon protein, putative, Ty3-gypsy subc...  95.1    4e-20   
gb|ABA97627.1|  retrotransposon protein, putative, Ty3-gypsy subc...  95.1    4e-20   
emb|CAN64678.1|  hypothetical protein VITISV_024918                   94.4    4e-20   
gb|AAP03404.1|  putative GAG-POL precursor                            94.7    4e-20   
gb|AAX96424.1|  retrotransposon protein, putative, Ty3-gypsy sub-...  94.7    4e-20   
emb|CAN78251.1|  hypothetical protein VITISV_031951                   94.7    4e-20   
emb|CAH66342.1|  OSIGBa0104J13.2                                      94.7    4e-20   
gb|ABA95029.1|  retrotransposon protein, putative, Ty3-gypsy subc...  95.1    4e-20   
emb|CAH66189.1|  OSIGBa0144J05.1                                      94.7    4e-20   
emb|CAE03508.2|  OSJNBa0053K19.16                                     95.1    4e-20   
gb|ABA98182.1|  retrotransposon protein, putative, Ty3-gypsy subc...  95.1    4e-20   
gb|ABF93731.1|  retrotransposon protein, putative, Ty3-gypsy subc...  95.1    4e-20   
emb|CAE05341.2|  OSJNBa0079M09.16                                     94.7    4e-20   
dbj|BAA84458.1|  GAG-POL precursor                                    94.7    4e-20   
gb|ABA98729.1|  retrotransposon protein, putative, Ty3-gypsy subc...  95.1    4e-20   
gb|AAS98430.1|  putative polyprotein                                  95.1    4e-20   
emb|CAD40114.1|  OSJNBa0035O13.3                                      95.1    4e-20   
emb|CAH66866.1|  H0307D04.11                                          95.1    4e-20   
gb|ABA98574.1|  retrotransposon protein, putative, Ty3-gypsy subc...  95.1    4e-20   
gb|AAM92798.1|  putative gag-pol precursor                            95.1    4e-20   
emb|CAE05063.1|  OSJNBa0094P09.2                                      94.7    4e-20   
emb|CAD39529.2|  OSJNBa0027O01.4                                      95.1    4e-20   
emb|CAN83395.1|  hypothetical protein VITISV_021697                   94.7    4e-20   
gb|ABA97070.1|  retrotransposon protein, putative, Ty3-gypsy subc...  95.1    4e-20   
gb|AAS90646.1|  putative polyprotein                                  95.1    4e-20   
gb|AAN08244.1|  GAG-POL precursor                                     94.7    4e-20   
emb|CAH66795.1|  H0215F08.6                                           94.7    4e-20   
gb|ABA94908.1|  retrotransposon protein, putative, Ty3-gypsy subc...  94.7    4e-20   
gb|ABA98134.1|  retrotransposon protein, putative, Ty3-gypsy subc...  94.7    4e-20   
gb|ABA95079.1|  retrotransposon protein, putative, Ty3-gypsy subc...  94.7    4e-20   
emb|CCW72587.1|  ORW1943Ba0047B01.6                                   94.7    4e-20   
emb|CAE03913.2|  OSJNBb0015G09.7                                      94.7    4e-20   
gb|ABA97102.1|  retrotransposon protein, putative, Ty3-gypsy subc...  94.7    4e-20   
gb|ABA98213.1|  retrotransposon protein, putative, Ty3-gypsy subc...  94.7    4e-20   
gb|AAP52501.2|  retrotransposon protein, putative, Ty3-gypsy subc...  94.7    4e-20   
emb|CAE03068.2|  OSJNBa0089E12.6                                      94.7    4e-20   
emb|CAE02298.2|  OSJNBa0042F21.5                                      94.7    4e-20   
gb|AAV25234.1|  putative polyprotein                                  94.7    4e-20   
gb|ABA99731.1|  retrotransposon protein, putative, Ty3-gypsy subc...  94.7    4e-20   
gb|ABA95343.1|  retrotransposon protein, putative, Ty3-gypsy subc...  94.7    4e-20   
ref|XP_008381615.1|  PREDICTED: uncharacterized protein LOC103444468  92.0    4e-20   



>ref|XP_011091995.1| PREDICTED: uncharacterized protein LOC105172309 [Sesamum indicum]
Length=443

 Score =   112 bits (279),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 63/86 (73%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPPT  76
            H+L VDP  +P+QQRKR   +++ E +K+EVD LL++G+V E+ Y  WL+NVVL PK   
Sbjct  299  HRLNVDPMARPIQQRKRSFGSDKNEVIKQEVDKLLKVGYVSEIQYTNWLSNVVLVPKSSG  358

Query  75   -WRMCVDYIDLNKACPMDPFSFPNID  1
             WRMCVD+ DLNKACP DP+  P ID
Sbjct  359  KWRMCVDFTDLNKACPKDPYPLPRID  384



>ref|XP_011078132.1| PREDICTED: uncharacterized protein LOC105161948 [Sesamum indicum]
Length=485

 Score =   110 bits (275),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 48/86 (56%), Positives = 60/86 (70%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
            H+L +DP VKPV+Q+KR    ER + +++EV  LL  G VRE+ Y TWL+NVV+ PK   
Sbjct  254  HRLNIDPQVKPVKQKKRVFGVERNKIIEEEVAKLLRAGFVREIQYTTWLSNVVVVPKAAG  313

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
             WRMC DY DLNKACP DP+  P ID
Sbjct  314  KWRMCTDYTDLNKACPKDPYPLPRID  339



>ref|XP_010668293.1| PREDICTED: uncharacterized protein LOC104885298 [Beta vulgaris 
subsp. vulgaris]
Length=365

 Score =   107 bits (266),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 62/87 (71%), Gaps = 1/87 (1%)
 Frame = -2

Query  258  THKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLAN-VVLAPKP  82
            THKL VDP  KPV+Q++R  + ER   V +EVD LL+ G +REV YP WLAN VV+  K 
Sbjct  262  THKLNVDPNSKPVKQKRRKFAPERNMIVNEEVDKLLKAGKIREVKYPDWLANVVVVGKKN  321

Query  81   PTWRMCVDYIDLNKACPMDPFSFPNID  1
              WR+C+D+ DLNKACP DPF  P+ID
Sbjct  322  GKWRVCIDFTDLNKACPKDPFPLPHID  348



>ref|XP_011090499.1| PREDICTED: uncharacterized protein LOC105171171 [Sesamum indicum]
Length=1752

 Score =   109 bits (272),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 65/86 (76%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPPT  76
            H+L V+P V+PVQQRKR L++++ + +++EVD LL+ G++ E+ Y  WL+NVVL PK   
Sbjct  761  HRLNVNPTVRPVQQRKRTLNSDKNDAIRQEVDKLLKAGYISEIQYTNWLSNVVLVPKASG  820

Query  75   -WRMCVDYIDLNKACPMDPFSFPNID  1
             WRMCVD+ DLNKACP DP+  P ID
Sbjct  821  KWRMCVDFTDLNKACPKDPYPLPRID  846



>ref|XP_011093966.1| PREDICTED: uncharacterized protein LOC105173785 [Sesamum indicum]
Length=1737

 Score =   109 bits (272),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 63/86 (73%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPPT  76
            H+L VDP  +PVQQRKR  S E+ + +++EV+ LL+ G++ E+ Y +WL+NVVL PK   
Sbjct  729  HRLNVDPTARPVQQRKRNFSKEKNDAIRQEVEKLLKAGYISEIQYTSWLSNVVLVPKSSG  788

Query  75   -WRMCVDYIDLNKACPMDPFSFPNID  1
             WRMCVD+ DLNKACP DP+  P ID
Sbjct  789  KWRMCVDFTDLNKACPKDPYPLPRID  814



>ref|XP_011073620.1| PREDICTED: uncharacterized protein LOC105158536 [Sesamum indicum]
Length=1709

 Score =   109 bits (272),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 46/86 (53%), Positives = 63/86 (73%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+L VDP ++PVQQ+KR  S E+ + +++EVD LL  G++ EV Y  WL+NVV+ PKP  
Sbjct  724  HRLNVDPTMRPVQQKKRNFSMEKNQVIREEVDRLLNAGYIMEVQYTNWLSNVVVVPKPGG  783

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
             WR+C+D+ DLNKACP DP+  P ID
Sbjct  784  KWRVCIDFTDLNKACPKDPYPLPRID  809



>ref|XP_011078247.1| PREDICTED: uncharacterized protein LOC105162039 [Sesamum indicum]
Length=1768

 Score =   109 bits (272),  Expect = 5e-25, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 63/86 (73%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
            H+L VDP  +PVQQRKR  S E+ + +++EV+ LL+ G++ E+ Y +WL+NVVL PK   
Sbjct  760  HRLNVDPTARPVQQRKRNFSKEKNDAIRQEVEKLLKAGYISEIQYTSWLSNVVLVPKSSG  819

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
             WRMCVD+ DLNKACP DP+  P ID
Sbjct  820  KWRMCVDFTDLNKACPKDPYPLPRID  845



>ref|XP_011076961.1| PREDICTED: uncharacterized protein LOC105161084 [Sesamum indicum]
Length=1772

 Score =   108 bits (271),  Expect = 5e-25, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 63/86 (73%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
            H+L VDP  +PVQQRKR  S E+ + +++EV+ LL+ G++ E+ Y +WL+NVVL PK   
Sbjct  764  HRLNVDPTARPVQQRKRNFSKEKNDAIRQEVEKLLKAGYISEIQYTSWLSNVVLVPKSSG  823

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
             WRMCVD+ DLNKACP DP+  P ID
Sbjct  824  KWRMCVDFTDLNKACPKDPYPLPRID  849



>ref|XP_011073571.1| PREDICTED: uncharacterized protein LOC105158484 [Sesamum indicum]
Length=1207

 Score =   108 bits (270),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 62/86 (72%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPPT  76
            H+L VDP+++PVQQ+KR   AE+   ++ EV+ LL+ G+V EV Y  WLANVV+ PKP  
Sbjct  573  HRLNVDPSMRPVQQKKRTFGAEKNAIIEGEVNKLLKAGYVSEVQYTDWLANVVVVPKPGG  632

Query  75   -WRMCVDYIDLNKACPMDPFSFPNID  1
             WRMC D+ DLNKACP DP+  P ID
Sbjct  633  KWRMCTDFTDLNKACPKDPYPLPRID  658



>ref|XP_011074079.1| PREDICTED: uncharacterized protein LOC105158875 [Sesamum indicum]
Length=1703

 Score =   108 bits (270),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 62/86 (72%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPPT  76
            H+L  DPA++PV+Q+KR   +++ E ++KEVD LL  G+V E+ Y  WL+NVVL PK   
Sbjct  695  HRLNTDPAMRPVRQKKRSFGSDKNEIIRKEVDKLLNAGYVEEIQYTDWLSNVVLVPKSAG  754

Query  75   -WRMCVDYIDLNKACPMDPFSFPNID  1
             WRMCVD+ DLNKACP DP+  P ID
Sbjct  755  KWRMCVDFTDLNKACPKDPYPLPRID  780



>ref|XP_011100107.1| PREDICTED: uncharacterized protein LOC105178339 [Sesamum indicum]
Length=1769

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 63/86 (73%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPPT  76
            H+L VDP V+PVQQRKR  S+++ + +++EVD LL+  ++ E+ Y  WL+NVVL PK   
Sbjct  761  HRLNVDPTVRPVQQRKRTFSSDKNDAIRQEVDKLLKARYISEIQYTNWLSNVVLVPKASG  820

Query  75   -WRMCVDYIDLNKACPMDPFSFPNID  1
             WRMCVD+ DLNKACP DP+  P ID
Sbjct  821  KWRMCVDFTDLNKACPKDPYPLPRID  846



>ref|XP_010684144.1| PREDICTED: uncharacterized protein LOC104898740 [Beta vulgaris 
subsp. vulgaris]
Length=1581

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 62/87 (71%), Gaps = 1/87 (1%)
 Frame = -2

Query  258  THKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLAN-VVLAPKP  82
            THKL VDP  KPV+Q++R  + ER   V +EVD LL+ G +REV YP WLAN VV+  K 
Sbjct  642  THKLNVDPNSKPVKQKRRKFAPERNMIVNEEVDKLLKAGKIREVKYPDWLANVVVVGKKN  701

Query  81   PTWRMCVDYIDLNKACPMDPFSFPNID  1
              WR+C+D+ DLNKACP DPF  P+ID
Sbjct  702  GKWRVCIDFTDLNKACPKDPFPLPHID  728



>ref|XP_011075617.1| PREDICTED: uncharacterized protein LOC105160050 [Sesamum indicum]
Length=1765

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPPT  76
            H+L VDP+++PVQQ+KR    E+   ++ EV+ LL+ G+V EV Y  WLANVV+ PKP  
Sbjct  764  HRLNVDPSMRPVQQKKRTFGGEKNAIIEGEVNKLLKAGYVSEVQYTDWLANVVVVPKPGG  823

Query  75   -WRMCVDYIDLNKACPMDPFSFPNID  1
             WRMC D+ DLNKACP DP+  P ID
Sbjct  824  KWRMCTDFTDLNKACPKDPYPLPRID  849



>ref|XP_011101631.1| PREDICTED: inositol phosphorylceramide glucuronosyltransferase 
1 [Sesamum indicum]
Length=785

 Score =   106 bits (264),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 62/86 (72%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
            H+L VDP  +PVQQRKR  S ++ + +++EV+ LL+ G+V EV Y  WL+NVVL PK   
Sbjct  649  HRLNVDPTARPVQQRKRTFSNDKNDAIRQEVEKLLKAGYVSEVQYTNWLSNVVLVPKSSR  708

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
             WRMCVD+ DLNKACP DP+  P ID
Sbjct  709  KWRMCVDFTDLNKACPKDPYPLPRID  734



>ref|XP_011102166.1| PREDICTED: uncharacterized protein LOC105180202 [Sesamum indicum]
Length=1015

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 62/86 (72%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPPT  76
            H+L VDP ++P++Q+KR    ++ E ++KEVD LL+ G+V E+ Y  WL+NVVL PK   
Sbjct  409  HRLNVDPTMRPMKQKKRSFGYDKNEIIRKEVDKLLKAGYVSEIQYTDWLSNVVLVPKSSG  468

Query  75   -WRMCVDYIDLNKACPMDPFSFPNID  1
             WRMCVD+ DLNKACP DP+  P ID
Sbjct  469  KWRMCVDFTDLNKACPKDPYPLPRID  494



>ref|XP_011098400.1| PREDICTED: uncharacterized protein LOC105177075 [Sesamum indicum]
Length=1713

 Score =   107 bits (266),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 48/86 (56%), Positives = 59/86 (69%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
            H+L +DP  +PVQQRKR   AE+   +K+EV  LL+ G+V EV Y  WL+NVV+ PK   
Sbjct  712  HRLNLDPKAQPVQQRKRAFGAEKNAIIKEEVGKLLKAGYVSEVRYTDWLSNVVVVPKAAG  771

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
             WRMC D+ DLNKACP DPF  P ID
Sbjct  772  KWRMCTDFTDLNKACPKDPFPLPRID  797



>ref|XP_011078211.1| PREDICTED: uncharacterized protein LOC105162011 [Sesamum indicum]
Length=1758

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPPT  76
            H+L  DP+++PVQQ+KR   AE+   ++ EV+ LL+ G+V EV Y  WLANVV+ PKP  
Sbjct  757  HRLNADPSMRPVQQKKRTFGAEKNAIIEGEVNKLLKAGYVSEVQYTDWLANVVVVPKPGG  816

Query  75   -WRMCVDYIDLNKACPMDPFSFPNID  1
             WRMC D+ DLNKACP DP+  P ID
Sbjct  817  KWRMCTDFTDLNKACPKDPYPLPRID  842



>ref|XP_011085917.1| PREDICTED: uncharacterized protein LOC105167800 [Sesamum indicum]
Length=1746

 Score =   106 bits (265),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 48/86 (56%), Positives = 59/86 (69%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
            H+L +DP  +PVQQRKR   AE+   +K+EV  LL+ G+V EV Y  WL+NVV+ PK   
Sbjct  745  HRLNLDPKAQPVQQRKRAFGAEKNAIIKEEVGKLLKAGYVSEVRYTDWLSNVVVVPKAAG  804

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
             WRMC D+ DLNKACP DPF  P ID
Sbjct  805  KWRMCTDFTDLNKACPKDPFPLPRID  830



>ref|XP_011100995.1| PREDICTED: uncharacterized protein LOC105179098 [Sesamum indicum]
Length=1763

 Score =   106 bits (264),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 62/86 (72%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPK-PP  79
            H+L  DPA++PV+Q+KR   +++ E ++KEVD LL  G+V E+ +  WL+NVVL PK   
Sbjct  755  HRLNTDPAMRPVRQKKRSFGSDKNEIIRKEVDKLLNAGYVEEIQHTDWLSNVVLVPKFAG  814

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
             WRMCVD+ DLNKACP DP+  P ID
Sbjct  815  KWRMCVDFTDLNKACPKDPYPLPRID  840



>ref|XP_011071250.1| PREDICTED: uncharacterized protein LOC105156729 [Sesamum indicum]
Length=1720

 Score =   105 bits (263),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 62/86 (72%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPPT  76
            H+L VDP+++PVQQ+KR   +E+   ++ EV+ LL+ G+V EV Y  WLANVV+ PKP  
Sbjct  719  HRLNVDPSMRPVQQKKRTFGSEKNAIIEGEVNKLLKAGYVSEVQYTDWLANVVVVPKPGG  778

Query  75   -WRMCVDYIDLNKACPMDPFSFPNID  1
             WRMC ++ DLNKACP DP+  P ID
Sbjct  779  KWRMCTNFTDLNKACPKDPYPLPRID  804



>emb|CAE04292.2| OSJNBa0083I11.2 [Oryza sativa Japonica Group]
 emb|CAE04811.2| OSJNBb0022P19.6 [Oryza sativa Japonica Group]
Length=1111

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 64/86 (74%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P+ KPV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  11   HRLAVRPSAKPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  70

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DYIDLNKACP DP++ P ID
Sbjct  71   KLRMCIDYIDLNKACPKDPYTLPRID  96



>ref|XP_011100170.1| PREDICTED: uncharacterized protein LOC105178403 [Sesamum indicum]
Length=981

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 57/86 (66%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H L VDP  +PVQQ+KR    +R E +++EV  LL  G+V E+ Y  WL+NVVL PK   
Sbjct  227  HHLNVDPKARPVQQKKRSFGGDRNEIIRQEVKKLLRAGYVSEIQYTDWLSNVVLVPKSWG  286

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
             WRMCVD  DLNKACP DP+  P ID
Sbjct  287  KWRMCVDLTDLNKACPKDPYPLPRID  312



>ref|XP_011070149.1| PREDICTED: uncharacterized protein LOC105155862 [Sesamum indicum]
Length=1753

 Score =   104 bits (259),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 58/86 (67%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+L VDP+++ VQQ+KR    E+   ++ EV  LL  G+V EV Y  WLANVVL PKP  
Sbjct  764  HRLNVDPSMRLVQQKKRTFGGEKNAIIEGEVSKLLRAGYVSEVQYTDWLANVVLVPKPGG  823

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
             WRMC D+ DLNKACP DP+  P ID
Sbjct  824  KWRMCTDFTDLNKACPKDPYPLPRID  849



>ref|XP_011102006.1| PREDICTED: uncharacterized protein LOC105180037 [Sesamum indicum]
Length=1023

 Score =   103 bits (257),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 45/86 (52%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
            H+L V P ++P++Q+KR    ++ E ++KEVD LL+ G+V E+ Y  WL+NVVL PK   
Sbjct  512  HRLNVYPTMRPMKQKKRSFGYDKNEIIRKEVDKLLKAGYVSEIQYTDWLSNVVLVPKSSG  571

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
             WRMCVD+ DLNKACP DP+  P ID
Sbjct  572  KWRMCVDFTDLNKACPKDPYPLPRID  597



>ref|XP_008222236.1| PREDICTED: uncharacterized protein LOC103322132 [Prunus mume]
Length=557

 Score =   102 bits (253),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 48/87 (55%), Positives = 59/87 (68%), Gaps = 1/87 (1%)
 Frame = -2

Query  258  THKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-  82
            +HKL++ P+ KP++Q++R   AER E +K EVD L  IG +REV YP WLAN VL  K  
Sbjct  378  SHKLSISPSFKPIRQKRRSYDAERYEAMKTEVDKLQAIGFIREVTYPIWLANSVLVKKSG  437

Query  81   PTWRMCVDYIDLNKACPMDPFSFPNID  1
              WRMC DYI+LNKAC  D F  P ID
Sbjct  438  GAWRMCEDYINLNKACLKDSFPLPRID  464



>gb|ABA97545.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1793

 Score =   103 bits (257),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 48/86 (56%), Positives = 63/86 (73%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPPT  76
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK  +
Sbjct  684  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANS  743

Query  75   -WRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACPMDP+  P ID
Sbjct  744  KLRMCIDYTDLNKACPMDPYPLPRID  769



>gb|AAU10818.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1974

 Score =   103 bits (257),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 49/86 (57%), Positives = 62/86 (72%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
            H+LAV P  KPV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  811  HRLAVRPGAKPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  870

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DYIDLNKACP DP+  P ID
Sbjct  871  KLRMCIDYIDLNKACPKDPYPLPRID  896



>ref|XP_011087128.1| PREDICTED: uncharacterized protein LOC105168695 [Sesamum indicum]
Length=1753

 Score =   103 bits (256),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 45/86 (52%), Positives = 59/86 (69%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
            H+L ++P+V+PVQQ+KR    E+   ++ EVD LL  G+V EV Y  WL+NVV+ PK   
Sbjct  751  HRLNINPSVRPVQQKKRAFGIEKNRIIQAEVDKLLGAGYVSEVHYTEWLSNVVVVPKASG  810

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
             WRMC D+ DLNKACP DP+  P ID
Sbjct  811  KWRMCTDFTDLNKACPKDPYPLPRID  836



>ref|XP_011093333.1| PREDICTED: uncharacterized protein LOC105173330 [Sesamum indicum]
Length=934

 Score =   102 bits (255),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 46/86 (53%), Positives = 59/86 (69%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
            H+L +D  VKPV+Q+KR    +R   +++EV+ LL+ G VREV Y TWL+NVV+ PK   
Sbjct  425  HRLNIDSQVKPVKQKKRVFGVKRNRIIEEEVNKLLQAGFVREVQYTTWLSNVVIVPKAAG  484

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
             WRMC DY DLNKACP DP+    ID
Sbjct  485  KWRMCTDYTDLNKACPKDPYPLLRID  510



>ref|XP_010695334.1| PREDICTED: uncharacterized protein LOC104907994 [Beta vulgaris 
subsp. vulgaris]
Length=570

 Score =   101 bits (252),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 47/83 (57%), Positives = 57/83 (69%), Gaps = 1/83 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            HKL +DP  KPV+Q+KR+L   R + V +EV  LL+    RE  YP W+ANVV+ PKP  
Sbjct  286  HKLNIDPGQKPVRQKKRHLGPARNQSVDQEVQKLLKSKFTRETFYPDWIANVVMVPKPND  345

Query  78   TWRMCVDYIDLNKACPMDPFSFP  10
            TWRMCVDY +LNKACP D F  P
Sbjct  346  TWRMCVDYTNLNKACPKDSFPLP  368



>gb|ABF98199.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1887

 Score =   102 bits (255),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PVQQ+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  775  HRLAVRPGARPVQQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  834

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  835  KLRMCIDYTDLNKACPKDPYPLPRID  860



>gb|AAK26119.1|AC084406_2 putative gag-pol precursor [Oryza sativa Japonica Group]
Length=1901

 Score =   102 bits (255),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PVQQ+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  775  HRLAVRPGARPVQQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  834

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  835  KLRMCIDYTDLNKACPKDPYPLPRID  860



>emb|CAE06012.3| OSJNBa0016O02.22 [Oryza sativa Japonica Group]
Length=2027

 Score =   102 bits (254),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 62/86 (72%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  817  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  876

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DYIDLNKACP DP+  P ID
Sbjct  877  KLRMCIDYIDLNKACPKDPYPLPRID  902



>ref|XP_011100179.1| PREDICTED: uncharacterized protein LOC105178414 [Sesamum indicum]
Length=1378

 Score =   102 bits (253),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 45/86 (52%), Positives = 58/86 (67%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+L VDP+++PVQQ+KR    E+   ++ EV+ LL  G+V E+ Y  WLANVVL  KP  
Sbjct  551  HRLNVDPSIRPVQQKKRTFGGEKNTIIEGEVNKLLRAGYVFEIQYTNWLANVVLVLKPGG  610

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
             WRMC D+ DLNKAC  DP+  P ID
Sbjct  611  KWRMCTDFTDLNKACSKDPYPLPRID  636



>gb|ABA95702.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1619

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 62/86 (72%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P V+PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  603  HRLAVRPGVRPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  662

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  663  KLRMCIDYTDLNKACPKDPYPLPRID  688



>gb|ABA93606.2| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1939

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 62/86 (72%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PV+Q+ R  ++ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  729  HRLAVRPGARPVRQKVRRQASERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  788

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  789  KLRMCIDYTDLNKACPKDPYPLPRID  814



>gb|AAX96829.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
 gb|ABA92872.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1914

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  704  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANAVVVPKANG  763

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  764  KLRMCIDYTDLNKACPKDPYPLPRID  789



>emb|CAE02825.1| OSJNBa0043A12.30 [Oryza sativa Japonica Group]
Length=1827

 Score =   102 bits (253),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 48/86 (56%), Positives = 62/86 (72%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
            H+LAV P V+PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  817  HRLAVRPGVRPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  876

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  877  KLRMCIDYTDLNKACPKDPYPLPRID  902



>emb|CAJ86094.1| H0818H01.16 [Oryza sativa Indica Group]
Length=1827

 Score =   102 bits (253),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 48/86 (56%), Positives = 62/86 (72%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
            H+LAV P V+PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  817  HRLAVRPGVRPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  876

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  877  KLRMCIDYTDLNKACPKDPYPLPRID  902



>gb|ABA98939.1| transposon protein, putative, unclassified [Oryza sativa Japonica 
Group]
Length=2027

 Score =   102 bits (253),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 48/86 (56%), Positives = 62/86 (72%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
            H+LAV P V+PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  817  HRLAVRPGVRPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  876

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  877  KLRMCIDYTDLNKACPKDPYPLPRID  902



>gb|ABF96026.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1977

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  KPV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  789  HRLAVRPGAKPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  848

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  849  KLRMCIDYTDLNKACPKDPYPLPRID  874



>ref|XP_011079221.1| PREDICTED: uncharacterized protein LOC105162805 [Sesamum indicum]
Length=898

 Score =   101 bits (252),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 45/86 (52%), Positives = 57/86 (66%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
            H+L +D  VKPV+Q+KR    ER   +K+EV+ LL+ G VRE+ Y TWL+NVV+ PK   
Sbjct  197  HRLNIDLQVKPVKQKKRVFGVERNRIIKEEVNKLLQAGFVREIQYTTWLSNVVIVPKAAG  256

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
             WRMC DY DLNK C  DP+    ID
Sbjct  257  KWRMCTDYTDLNKTCLKDPYPLSRID  282



>emb|CAH66197.1| OSIGBa0148D14.3 [Oryza sativa Indica Group]
Length=988

 Score =   101 bits (252),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  KPV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  11   HRLAVRPGAKPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  70

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  71   KLRMCIDYTDLNKACPKDPYPLPRID  96



>ref|XP_011092660.1| PREDICTED: uncharacterized protein LOC105172781 [Sesamum indicum]
Length=240

 Score = 97.4 bits (241),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 58/86 (67%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
            H L +DP +KPV+Q+K+    ER   +++EV+ LL+ G VRE+ Y TWL+NVV+  K   
Sbjct  151  HHLNIDPQIKPVKQKKKMFGVERNRIIEEEVNKLLQAGFVREIQYTTWLSNVVIVTKAAR  210

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
             WRMC  + DLNKACP DP+  P ID
Sbjct  211  KWRMCTYFTDLNKACPKDPYPLPRID  236



>gb|AAX94870.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
 gb|ABA92162.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=498

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  248  HRLAVLPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  307

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  308  KLRMCIDYTDLNKACPKDPYPLPRID  333



>gb|AAS07318.1| putative polyprotein [Oryza sativa Japonica Group]
Length=968

 Score =   101 bits (251),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
            H+LAV P  +PV+Q+ R+ + ER+ F+ +EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  755  HRLAVRPGARPVRQKVRWQAPERQAFIHEEVARLLEAGFIREVIHPEWLANPVVVPKANG  814

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  815  KLRMCIDYTDLNKACPKDPYPLPRID  840



>ref|XP_010676986.1| PREDICTED: uncharacterized protein LOC104892696 [Beta vulgaris 
subsp. vulgaris]
Length=819

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 60/87 (69%), Gaps = 1/87 (1%)
 Frame = -2

Query  258  THKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLAN-VVLAPKP  82
            TH+L VDP  KPV+Q++R  + ER + +  EV  L++ G VREV YP WLAN VV+  K 
Sbjct  69   THRLNVDPNHKPVKQKRRKFAPERNQIINDEVQKLIDTGKVREVKYPDWLANVVVVGKKN  128

Query  81   PTWRMCVDYIDLNKACPMDPFSFPNID  1
              WR+C+D+ DLNKACP D F  P+ID
Sbjct  129  GKWRVCIDFTDLNKACPKDSFPLPHID  155



>gb|AAU44223.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1823

 Score =   101 bits (252),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 48/86 (56%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPK-PP  79
            H+LAV P  +PVQQ+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  811  HRLAVRPGARPVQQKVRRQAPERQAFIREEVAQLLEAGFIREVIHPEWLANPVVVPKVNG  870

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  871  KLRMCIDYTDLNKACPKDPYPLPRID  896



>gb|AAS88834.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1937

 Score =   101 bits (252),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 63/86 (73%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
            H+LAV P+ +PV+Q+ R  + ER++F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  802  HRLAVRPSARPVRQKVRRQAPERQDFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  861

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  862  KLRMCIDYTDLNKACPKDPYPLPRID  887



>emb|CAD40323.2| OSJNBb0054B09.8 [Oryza sativa Japonica Group]
Length=1480

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  861  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  920

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  921  KLRMCIDYTDLNKACPKDPYPLPRID  946



>gb|AAV43949.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1688

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 62/86 (72%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  589  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  648

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P+ID
Sbjct  649  KLRMCIDYTDLNKACPKDPYPLPHID  674



>emb|CAE02129.2| OSJNBa0035M09.13 [Oryza sativa Japonica Group]
Length=1297

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  449  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  508

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  509  KLRMCIDYTDLNKACPKDPYPLPRID  534



>gb|ABA98426.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=2030

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PV+Q+ R  + +R+ F++KEV  LLE G +REVI+P WLAN V+ PK   
Sbjct  820  HRLAVRPGARPVRQKARRQAPKRQAFIRKEVARLLEAGFIREVIHPEWLANPVVVPKANG  879

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  880  KLRMCIDYTDLNKACPKDPYPLPRID  905



>ref|XP_011101638.1| PREDICTED: uncharacterized protein LOC105179687 [Sesamum indicum]
Length=1030

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 58/86 (67%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPPT  76
            H+L  DPA +PVQQ+KR    E+   +K+EV+ LL  G++ EV Y  WL+NVV+ PK   
Sbjct  410  HRLNADPAARPVQQKKRSFGIEKNAIIKEEVEKLLAAGYISEVHYTDWLSNVVVVPKASG  469

Query  75   -WRMCVDYIDLNKACPMDPFSFPNID  1
             WRMC D+ +LNKACP DP+  P ID
Sbjct  470  KWRMCTDFTNLNKACPKDPYPLPKID  495



>gb|AAV43845.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1207

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 62/86 (72%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  11   HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  70

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P+ID
Sbjct  71   KLRMCIDYTDLNKACPKDPYPLPHID  96



>emb|CAN80484.1| hypothetical protein VITISV_017184 [Vitis vinifera]
Length=842

 Score =   100 bits (250),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 45/87 (52%), Positives = 59/87 (68%), Gaps = 1/87 (1%)
 Frame = -2

Query  258  THKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP  79
            +H+L V P  +PV+QR R    +R++ ++ E+D LLE G +REV YP WLANVV+ PK  
Sbjct  10   SHRLNVLPTARPVRQRVRRFHPDRQKIIRDEIDKLLEAGFIREVEYPDWLANVVVVPKKE  69

Query  78   -TWRMCVDYIDLNKACPMDPFSFPNID  1
              WR+CVDY +LN ACP D F  P ID
Sbjct  70   GKWRVCVDYTNLNNACPKDSFPLPRID  96



>gb|AAT85175.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1096

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 62/86 (72%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  11   HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  70

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P+ID
Sbjct  71   KLRMCIDYTDLNKACPKDPYPLPHID  96



>gb|ABB47864.2| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1733

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  533  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPVWLANPVVVPKANG  592

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  593  KLRMCIDYTDLNKACPKDPYPLPRID  618



>gb|AAM95684.1| putative GAG-POL precursor [Oryza sativa Japonica Group]
Length=1740

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  533  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPVWLANPVVVPKANG  592

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  593  KLRMCIDYTDLNKACPKDPYPLPRID  618



>emb|CAE04928.2| OSJNBa0017P10.5 [Oryza sativa Japonica Group]
 emb|CAE03294.2| OSJNBb0046P18.10 [Oryza sativa Japonica Group]
Length=2027

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  817  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANQVVVPKANG  876

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  877  KLRMCIDYTDLNKACPKDPYPLPRID  902



>emb|CAD39966.2| OSJNBa0072D08.5 [Oryza sativa Japonica Group]
Length=1862

 Score =   101 bits (251),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  817  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  876

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  877  KLRMCIDYTDLNKACPKDPYPLPRID  902



>emb|CAH67521.1| OSIGBa0131L05.2 [Oryza sativa Indica Group]
Length=1770

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  797  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  856

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMCVDY DLNKACP DP+  P ID
Sbjct  857  RLRMCVDYTDLNKACPKDPYPLPRID  882



>gb|AAU10764.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1743

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  690  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  749

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  750  KLRMCIDYTDLNKACPKDPYPLPRID  775



>emb|CAE01723.2| OSJNBb0050O03.13 [Oryza sativa Japonica Group]
Length=2030

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  820  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  879

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  880  KLRMCIDYTDLNKACPKDPYPLPRID  905



>emb|CAE03745.1| OSJNBa0019D11.11 [Oryza sativa Japonica Group]
Length=1770

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  797  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  856

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMCVDY DLNKACP DP+  P ID
Sbjct  857  RLRMCVDYTDLNKACPKDPYPLPRID  882



>gb|ABF94159.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=2025

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  815  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  874

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  875  KLRMCIDYTDLNKACPKDPYPLPRID  900



>gb|ABF93464.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1037

 Score =   100 bits (250),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 46/86 (53%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REV++P WLAN V+ PK   
Sbjct  787  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVLHPEWLANPVVVPKANG  846

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  847  KLRMCIDYTDLNKACPKDPYPLPRID  872



>gb|AAK55777.1|AC079038_11 Putative polyprotein [Oryza sativa]
Length=1992

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  817  HRLAVRPGARPVRQKVRRQALERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  876

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  877  KLRMCIDYTDLNKACPKDPYPLPRID  902



>emb|CAE03902.2| OSJNBb0026I12.10 [Oryza sativa Japonica Group]
Length=2009

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  803  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  862

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  863  KLRMCIDYTDLNKACPKDPYPLPRID  888



>gb|AAT75253.1| putative gag-pol precursor [Oryza sativa Japonica Group]
 gb|ABF99259.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1980

 Score =   101 bits (251),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 48/86 (56%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
            H+LAV P  KPV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  810  HRLAVRPGAKPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  869

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  870  KLRMCIDYTDLNKACPKDPYPLPRID  895



>gb|AAS98497.1| putative polyprotein [Oryza sativa Japonica Group]
Length=2027

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  817  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  876

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  877  KLRMCIDYTDLNKACPKDPYPLPRID  902



>emb|CAE05493.2| OSJNBa0022H21.13 [Oryza sativa Japonica Group]
Length=1993

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  817  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  876

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  877  KLRMCIDYTDLNKACPKDPYPLPRID  902



>gb|AAX96572.1| transposon protein, putative, unclassified [Oryza sativa Japonica 
Group]
 gb|ABA95462.1| transposon protein, putative, unclassified [Oryza sativa Japonica 
Group]
Length=2027

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  817  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  876

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  877  KLRMCIDYTDLNKACPKDPYPLPRID  902



>gb|AAO66539.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
 gb|ABF99971.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=2027

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  817  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  876

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  877  KLRMCIDYTDLNKACPKDPYPLPRID  902



>gb|AAU44282.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1992

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  782  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  841

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  842  KLRMCIDYTDLNKACPKDPYPLPRID  867



>gb|ABF97875.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1881

 Score =   101 bits (251),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  803  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  862

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  863  KLRMCIDYTDLNKACPKDPYPLPRID  888



>emb|CAE01816.2| OSJNBa0041A02.3 [Oryza sativa Japonica Group]
 emb|CAD41821.2| OSJNBa0083N12.19 [Oryza sativa Japonica Group]
Length=2027

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  817  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  876

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  877  KLRMCIDYTDLNKACPKDPYPLPRID  902



>gb|ABA96833.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1987

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  817  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  876

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  877  KLRMCIDYTDLNKACPKDPYPLPRID  902



>gb|AAX95002.1| transposon protein, putative, unclassified [Oryza sativa Japonica 
Group]
 gb|ABA95436.1| transposon protein, putative, unclassified [Oryza sativa Japonica 
Group]
Length=1914

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  704  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  763

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  764  KLRMCIDYTDLNKACPKDPYPLPRID  789



>gb|AAU44275.1| putative polyprotein [Oryza sativa Japonica Group]
Length=2027

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 62/86 (72%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P+ +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  817  HRLAVRPSARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  876

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  877  KLRMCIDYTDLNKACPKDPYPLPRID  902



>gb|AAQ56480.1| putative polyprotein [Oryza sativa Japonica Group]
Length=2027

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  817  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  876

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  877  KLRMCIDYTDLNKACPKDPYPLPRID  902



>ref|XP_011079204.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105162781 
[Sesamum indicum]
Length=1049

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 58/86 (67%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPPT  76
            H+L ++P+V+PVQQ+KR    E+   ++ EVD LL  G++ EV Y  WL+NVV+ PK   
Sbjct  112  HRLNINPSVRPVQQKKRAFGIEKNRIIQAEVDKLLGAGYISEVHYTEWLSNVVVVPKASG  171

Query  75   -WRMCVDYIDLNKACPMDPFSFPNID  1
             WRMC D+ DLNK CP DP+  P ID
Sbjct  172  KWRMCTDFTDLNKTCPKDPYPLPRID  197



>gb|ABA96776.1| transposon protein, putative, unclassified [Oryza sativa Japonica 
Group]
Length=1990

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  817  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  876

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  877  KLRMCIDYTDLNKACPKDPYPLPRID  902



>emb|CAD41709.2| OSJNBa0010D21.11 [Oryza sativa Japonica Group]
Length=1884

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  774  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  833

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  834  KLRMCIDYTDLNKACPKDPYPLPRID  859



>gb|ABA99567.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=2027

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  817  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  876

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  877  KLRMCIDYTDLNKACPKDPYPLPRID  902



>gb|AAN31788.1| Putative polyprotein [Oryza sativa Japonica Group]
 gb|AAP53392.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=2027

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  817  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  876

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  877  KLRMCIDYTDLNKACPKDPYPLPRID  902



>gb|AAV31310.1| putative polyprotein [Oryza sativa Japonica Group]
Length=2027

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  817  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  876

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  877  KLRMCIDYTDLNKACPKDPYPLPRID  902



>emb|CAD39933.2| OSJNBa0091C12.11 [Oryza sativa Japonica Group]
Length=1992

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  818  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  877

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  878  KLRMCIDYTDLNKACPKDPYPLPRID  903



>ref|XP_009123785.1| PREDICTED: uncharacterized protein LOC103848687 [Brassica rapa]
Length=257

 Score = 96.7 bits (239),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 60/87 (69%), Gaps = 1/87 (1%)
 Frame = -2

Query  258  THKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLAN-VVLAPKP  82
            TH++ VDP +KP++Q++R L  ER + V +EV+ LL  G + EV Y  WLAN VV+  K 
Sbjct  165  THEVNVDPNIKPIRQKRRKLGPERSKAVVEEVERLLSAGSITEVRYLEWLANPVVVKKKN  224

Query  81   PTWRMCVDYIDLNKACPMDPFSFPNID  1
              WRMCVD+ DLNKACP D +  PNID
Sbjct  225  GKWRMCVDFTDLNKACPKDSYPLPNID  251



>gb|ABA95175.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=2027

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  817  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  876

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  877  KLRMCIDYTDLNKACPKDPYPLPRID  902



>gb|AAT07608.1| putative polyprotein [Oryza sativa Japonica Group]
 gb|AAV59311.1| putative polyprotein [Oryza sativa Japonica Group]
Length=2021

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  817  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  876

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  877  KLRMCIDYTDLNKACPKDPYPLPRID  902



>gb|ABA99771.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1770

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  767  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  826

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  827  KLRMCIDYTDLNKACPKDPYPLPRID  852



>emb|CAE04515.1| OSJNBb0059K02.25 [Oryza sativa Japonica Group]
 emb|CAE03541.2| OSJNBa0060D06.7 [Oryza sativa Japonica Group]
Length=1831

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  817  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  876

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  877  KLRMCIDYTDLNKACPKDPYPLPRID  902



>emb|CAD39523.2| OSJNBa0027O01.10 [Oryza sativa Japonica Group]
Length=2020

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  817  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  876

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  877  KLRMCIDYTDLNKACPKDPYPLPRID  902



>gb|ABF95088.1| transposon protein, putative, unclassified [Oryza sativa Japonica 
Group]
Length=1965

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  820  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  879

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  880  KLRMCIDYTDLNKACPKDPYPLPRID  905



>gb|ABA99541.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1904

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  694  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  753

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  754  KLRMCIDYTDLNKACPKDPYPLPRID  779



>gb|AAR88606.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1871

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PV+Q+ R+ + ER+ F+ +EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  755  HRLAVRPGARPVRQKVRWQAPERQAFIHEEVARLLEAGFIREVIHPEWLANPVVVPKANG  814

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  815  KLRMCIDYTDLNKACPKDPYPLPRID  840



>emb|CAH67840.1| OSIGBa0159H11-OSIGBa0137A07.3 [Oryza sativa Indica Group]
Length=2027

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  817  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  876

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  877  KLRMCIDYTDLNKACPKDPYPLPRID  902



>emb|CAH66336.1| OSIGBa0097I24.4 [Oryza sativa Indica Group]
Length=2027

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  817  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  876

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  877  KLRMCIDYTDLNKACPKDPYPLPRID  902



>gb|AAN06839.1| Putative retroelement [Oryza sativa Japonica Group]
Length=1741

 Score =   100 bits (250),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  763  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  822

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  823  KLRMCIDYTDLNKACPKDPYPLPRID  848



>gb|AAO38003.1| putative polyprotein [Oryza sativa Japonica Group]
 gb|AAO60005.1| putative GAG-POL precursor [Oryza sativa Japonica Group]
 gb|ABF97442.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1911

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  820  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  879

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  880  KLRMCIDYTDLNKACPKDPYPLPRID  905



>gb|ABF94078.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1729

 Score =   100 bits (250),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  751  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  810

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  811  KLRMCIDYTDLNKACPKDPYPLPRID  836



>gb|ABA93961.1| retrotransposon protein, putative, unclassified, expressed [Oryza 
sativa Japonica Group]
Length=1986

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  817  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  876

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  877  KLRMCIDYTDLNKACPKDPYPLPRID  902



>gb|AAP53950.1| transposon protein, putative, unclassified [Oryza sativa Japonica 
Group]
Length=2026

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  816  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  875

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  876  KLRMCIDYTDLNKACPKDPYPLPRID  901



>emb|CAE01613.2| OSJNBa0067G20.11 [Oryza sativa Japonica Group]
Length=2027

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  817  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  876

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  877  KLRMCIDYTDLNKACPKDPYPLPRID  902



>emb|CAN82687.1| hypothetical protein VITISV_006267 [Vitis vinifera]
Length=969

 Score =   100 bits (249),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 60/87 (69%), Gaps = 1/87 (1%)
 Frame = -2

Query  258  THKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP  79
            +HKL V PA +PVQQ+ R    +R+  ++ E++ LLE+G +REV YP WLANVV+ PK  
Sbjct  10   SHKLNVFPAARPVQQKIRRFHPDRQRVIQDEINKLLEVGFIREVSYPEWLANVVVVPKKE  69

Query  78   T-WRMCVDYIDLNKACPMDPFSFPNID  1
              WR+CVDY +LN ACP D F  P ID
Sbjct  70   GKWRVCVDYTNLNNACPKDSFPLPRID  96



>gb|ABF98055.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1890

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PV+Q+ R+ + ER+ F+ +EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  755  HRLAVRPGARPVRQKVRWQAPERQAFIHEEVARLLEAGFIREVIHPEWLANPVVVPKANG  814

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  815  KLRMCIDYTDLNKACPKDPYPLPRID  840



>emb|CAH66724.1| OSIGBa0118P15.14 [Oryza sativa Indica Group]
Length=1951

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  785  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  844

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  845  KLRMCIDYTDLNKACPKDPYPLPRID  870



>emb|CAE01797.2| OSJNBa0039K24.16 [Oryza sativa Japonica Group]
Length=1881

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  809  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  868

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  869  KLRMCIDYTDLNKACPKDPYPLPRID  894



>gb|AAK55774.1|AC079038_8 Putative polyprotein [Oryza sativa]
Length=2027

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  817  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  876

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  877  KLRMCIDYTDLNKACPKDPYPLPRID  902



>dbj|BAB00646.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAB17742.1| GAG-POL precursor [Oryza sativa Japonica Group]
Length=1473

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  534  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  593

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  594  KLRMCIDYTDLNKACPKDPYPLPRID  619



>gb|ABF96052.1| transposon protein, putative, unclassified [Oryza sativa Japonica 
Group]
Length=2027

 Score =   100 bits (250),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  817  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  876

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  877  KLRMCIDYTDLNKACPKDPYPLPRID  902



>emb|CAH67689.1| H0510A06.14 [Oryza sativa Indica Group]
 emb|CAH66966.1| H0525D09.6 [Oryza sativa Indica Group]
Length=2027

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  817  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  876

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  877  KLRMCIDYTDLNKACPKDPYPLPRID  902



>gb|ABA94235.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1800

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 60/86 (70%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PVQQ+ R  + ER+ F+++EV  LLE G +RE I+P WLAN V+ PK   
Sbjct  704  HRLAVRPGARPVQQKVRRQAPERQAFIREEVARLLEAGFIREDIHPEWLANPVIVPKANG  763

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  764  KLRMCIDYTDLNKACPKDPYPLPRID  789



>emb|CAE03096.2| OSJNBa0017B10.11 [Oryza sativa Japonica Group]
Length=1814

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  746  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  805

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  806  KLRMCIDYTDLNKACPKDPYPLPRID  831



>emb|CAE04107.1| OSJNBa0096F01.15 [Oryza sativa Japonica Group]
 emb|CAE04552.1| OSJNBa0052P16.1 [Oryza sativa Japonica Group]
Length=1384

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  205  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  264

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  265  KLRMCIDYTDLNKACPKDPYPLPRID  290



>gb|AAR06355.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1809

 Score =   100 bits (250),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  817  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  876

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  877  KLRMCIDYTDLNKACPKDPYPLPRID  902



>gb|AAL58969.1|AC091811_18 putative gag-pol precursor [Oryza sativa Japonica Group]
Length=1997

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  819  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  878

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  879  KLRMCIDYTDLNKACPKDPYPLPRID  904



>gb|ABF99476.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1840

 Score =   100 bits (250),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  741  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  800

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  801  KLRMCIDYTDLNKACPKDPYPLPRID  826



>emb|CAH67813.1| OSIGBa0138H21-OSIGBa0138E01.4 [Oryza sativa Indica Group]
Length=1949

 Score =   100 bits (250),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  785  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  844

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  845  KLRMCIDYTDLNKACPKDPYPLPRID  870



>emb|CAE03073.3| OSJNBa0089E12.11 [Oryza sativa Japonica Group]
Length=1370

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  160  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  219

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  220  KLRMCIDYTDLNKACPKDPYPLPRID  245



>gb|AAT73664.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1221

 Score =   100 bits (249),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  11   HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  70

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  71   KLRMCIDYTDLNKACPKDPYPLPRID  96



>gb|ABF98885.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=2012

 Score =   100 bits (250),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  819  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  878

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  879  KLRMCIDYTDLNKACPKDPYPLPRID  904



>emb|CAE04563.1| OSJNBb0039L24.2 [Oryza sativa Japonica Group]
 emb|CAD41151.2| OSJNBa0081C01.21 [Oryza sativa Japonica Group]
Length=2027

 Score =   100 bits (250),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  817  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  876

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  877  KLRMCIDYTDLNKACPKDPYPLPRID  902



>ref|XP_010496394.1| PREDICTED: chitinase-3-like protein 2 [Camelina sativa]
Length=519

 Score = 99.0 bits (245),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 45/87 (52%), Positives = 58/87 (67%), Gaps = 1/87 (1%)
 Frame = -2

Query  258  THKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLAN-VVLAPKP  82
            +H+L VDP  KPV+ ++R L AER   V  EV  LL+ G + EV YP WL+N +V+  K 
Sbjct  10   SHELNVDPTYKPVKHKRRKLGAERTAAVNDEVKKLLDAGSITEVRYPDWLSNPMVVKKKN  69

Query  81   PTWRMCVDYIDLNKACPMDPFSFPNID  1
             TWR+C+D+ DLNKACP D F  P ID
Sbjct  70   GTWRVCIDFTDLNKACPKDSFPLPRID  96



>gb|ABA91954.2| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1759

 Score =   100 bits (250),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  570  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  629

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  630  KLRMCIDYTDLNKACPKDPYPLPRID  655



>emb|CAE05270.2| OSJNBb0014D23.4 [Oryza sativa Japonica Group]
Length=1684

 Score =   100 bits (250),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 60/86 (70%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
            H+LAV P  +PV+Q+ R    ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  817  HRLAVRPGARPVRQKVRRQGPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  876

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  877  KLRMCIDYTDLNKACPKDPYPLPRID  902



>gb|ABF96344.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1841

 Score =   100 bits (250),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  817  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  876

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  877  KLRMCIDYTDLNKACPKDPYPLPRID  902



>gb|ABA95011.1| transposon protein, putative, unclassified [Oryza sativa Japonica 
Group]
Length=2028

 Score =   100 bits (250),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  818  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  877

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  878  KLRMCIDYTDLNKACPKDPYPLPRID  903



>gb|ABA96681.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1512

 Score =   100 bits (249),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  490  HRLAVRPGARPVRQKVRRQAPERQAFIREEVTRLLEAGFIREVIHPEWLANPVVIPKANG  549

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  550  KLRMCIDYTDLNKACPKDPYPLPRID  575



>emb|CAH67964.1| OSIGBa0142I02-OSIGBa0101B20.7 [Oryza sativa Indica Group]
Length=1873

 Score =   100 bits (250),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  820  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  879

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  880  KLRMCIDYTDLNKACPKDPYPLPRID  905



>ref|XP_011091718.1| PREDICTED: uncharacterized protein LOC105172079 [Sesamum indicum]
Length=306

 Score = 97.1 bits (240),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 59/86 (69%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPPT  76
            H+L VDPA +PVQQ+KR    ++   +++EV+ LL+ G+V EV Y  WLAN+V+ PK   
Sbjct  213  HRLNVDPAARPVQQKKRTFGIDKNRIIEEEVNKLLKAGYVSEVQYTDWLANMVMVPKTAG  272

Query  75   -WRMCVDYIDLNKACPMDPFSFPNID  1
             WRMC D+ DLNKACP +P+    I+
Sbjct  273  KWRMCTDFTDLNKACPKNPYPLSRIN  298



>emb|CAH66086.1| H0209A05.3 [Oryza sativa Indica Group]
Length=945

 Score =   100 bits (248),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 46/86 (53%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN ++ PK   
Sbjct  748  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPMVVPKANG  807

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  808  KLRMCIDYTDLNKACPKDPYPLPRID  833



>gb|AAX96861.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
 gb|ABA92421.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=2027

 Score =   100 bits (250),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  817  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  876

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  877  KLRMCIDYTDLNKACPKDPYPLPRID  902



>emb|CAE04877.2| OSJNBa0086O06.25 [Oryza sativa Japonica Group]
Length=2027

 Score =   100 bits (250),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  817  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  876

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  877  KLRMCIDYTDLNKACPKDPYPLPRID  902



>emb|CAH68539.2| OSJNBa0009P12.6 [Oryza sativa Japonica Group]
Length=2027

 Score =   100 bits (250),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  817  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  876

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  877  KLRMCIDYTDLNKACPKDPYPLPRID  902



>emb|CAE04174.2| OSJNBa0029C04.4 [Oryza sativa Japonica Group]
Length=2027

 Score =   100 bits (249),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  817  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  876

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  877  KLRMCIDYTDLNKACPKDPYPLPRID  902



>emb|CAN64901.1| hypothetical protein VITISV_037598 [Vitis vinifera]
Length=369

 Score = 97.4 bits (241),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 57/87 (66%), Gaps = 1/87 (1%)
 Frame = -2

Query  258  THKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP  79
            +H+L V    +PV+QR R    +R+  ++ E+D LLE G +REV YP WLANVV+ PK  
Sbjct  10   SHRLNVFSTARPVRQRIRRFHPDRQRVIRNEIDKLLETGFIREVSYPDWLANVVVVPKKE  69

Query  78   T-WRMCVDYIDLNKACPMDPFSFPNID  1
              WR+CVDY  LN ACP D FS P ID
Sbjct  70   GKWRVCVDYTSLNNACPKDSFSLPQID  96



>gb|AAD20432.1| putative retroelement pol polyprotein [Arabidopsis thaliana]
Length=152

 Score = 94.4 bits (233),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 57/85 (67%), Gaps = 1/85 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLAN-VVLAPKPP  79
            H+L VDP  KPV+Q++R L  ER E VK EV+ LL IG + +  YP WLAN VV+  K  
Sbjct  23   HELNVDPTFKPVKQKRRKLGRERAEAVKAEVEKLLRIGSITKAKYPEWLANPVVVKKKNG  82

Query  78   TWRMCVDYIDLNKACPMDPFSFPNI  4
             WR+C+D+ DLNKACP D F   +I
Sbjct  83   KWRVCIDFTDLNKACPKDSFPMSHI  107



>gb|AAT77917.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1898

 Score =   100 bits (249),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  799  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  858

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  859  KLRMCIDYTDLNKACPKDPYPLPRID  884



>gb|AAO66535.1| transposon protein, putative, unclassified [Oryza sativa Japonica 
Group]
 gb|ABF99949.1| transposon protein, putative, unclassified [Oryza sativa Japonica 
Group]
Length=2026

 Score =   100 bits (249),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  816  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  875

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  876  KLRMCIDYTDLNKACPKDPYPLPRID  901



>emb|CAE02878.1| OSJNBb0022F23.15 [Oryza sativa Japonica Group]
Length=1612

 Score =   100 bits (249),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  784  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  843

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  844  KLRMCIDYTDLNKACPKDPYPLPRID  869



>emb|CAH67683.1| H0510A06.8 [Oryza sativa Indica Group]
Length=1685

 Score =   100 bits (249),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  566  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  625

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  626  KLRMCIDYTDLNKACPKDPYPLPRID  651



>emb|CAH67479.1| H0805A05.9 [Oryza sativa Indica Group]
Length=1930

 Score =   100 bits (249),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  742  HRLAVRPGARPVRQKMRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  801

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  802  KLRMCIDYTDLNKACPKDPYPLPRID  827



>gb|AAK92547.1|AC051624_5 Putative retroelement [Oryza sativa Japonica Group]
 gb|AAP52876.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1963

 Score =   100 bits (249),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  817  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVIVPKANG  876

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  877  KLRMCIDYTDLNKACPKDPYPLPRID  902



>emb|CAN68770.1| hypothetical protein VITISV_018662 [Vitis vinifera]
Length=1010

 Score =   100 bits (248),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 60/87 (69%), Gaps = 1/87 (1%)
 Frame = -2

Query  258  THKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP  79
            +HKL V PA +PV+Q+ R    +R++ ++ E+D LLE G VREV YP WLANVV+ PK  
Sbjct  10   SHKLNVFPAARPVRQKIRRFHPDRQKVIRNEIDKLLEAGFVREVSYPDWLANVVVVPKKE  69

Query  78   T-WRMCVDYIDLNKACPMDPFSFPNID  1
              WR+CVDY +LN ACP D F  P ID
Sbjct  70   GKWRVCVDYTNLNNACPKDSFPLPRID  96



>gb|AAM94933.1| putative GAG-POL precursor [Oryza sativa Japonica Group]
Length=1850

 Score =   100 bits (249),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  684  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPVWLANPVVVPKANG  743

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  744  KLRMCIDYTDLNKACPKDPYPLPRID  769



>emb|CAE05339.2| OSJNBa0079M09.11 [Oryza sativa Japonica Group]
Length=2028

 Score =   100 bits (249),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  818  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  877

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  878  KLRMCIDYTDLNKACPKDPYPLPRID  903



>gb|KFK39802.1| hypothetical protein AALP_AA3G290100, partial [Arabis alpina]
Length=785

 Score = 99.8 bits (247),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 45/87 (52%), Positives = 61/87 (70%), Gaps = 1/87 (1%)
 Frame = -2

Query  258  THKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLAN-VVLAPKP  82
            +H+L VDP  KP++Q++R L +ER + V  EV  LL+ G + EV YP WLAN VV+  K 
Sbjct  90   SHRLNVDPTFKPIRQKRRKLGSERTKAVNDEVAMLLDAGSITEVQYPEWLANPVVVKKKN  149

Query  81   PTWRMCVDYIDLNKACPMDPFSFPNID  1
             +WR+CVD+ DLNKACP D +  P+ID
Sbjct  150  GSWRVCVDFTDLNKACPKDSYPLPHID  176



>gb|AAK16189.1|AC079887_21 putative polyprotein [Oryza sativa Japonica Group]
 gb|AAR01665.1| putative retrotransposon gag protein [Oryza sativa Japonica Group]
 gb|ABF98958.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1867

 Score =   100 bits (249),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 46/86 (53%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
            H+LA+ P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  786  HRLAIRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  845

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  846  KLRMCIDYTDLNKACPKDPYPLPRID  871



>gb|AAX96661.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
 gb|ABA92274.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=2027

 Score =   100 bits (249),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  817  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  876

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  877  KLRMCIDYTDLNKACPKDPYPLPRID  902



>gb|ABF95742.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1926

 Score =   100 bits (249),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  777  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVIPKANG  836

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  837  KLRMCIDYTDLNKACPKDPYPLPRID  862



>emb|CAN64615.1| hypothetical protein VITISV_036196 [Vitis vinifera]
Length=918

 Score =   100 bits (248),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 45/87 (52%), Positives = 59/87 (68%), Gaps = 1/87 (1%)
 Frame = -2

Query  258  THKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP  79
            +H+L V PA +PV+Q+ R    +R+E ++ E+D LLE   +REV YP WLANVV+ PK  
Sbjct  10   SHRLNVFPAARPVRQKIRRFHPDRQEVIRNEIDKLLEARFIREVSYPDWLANVVVVPKKE  69

Query  78   -TWRMCVDYIDLNKACPMDPFSFPNID  1
              WR+CVDY +LN ACP D F  P ID
Sbjct  70   GKWRVCVDYTNLNSACPKDSFPLPRID  96



>emb|CAH67052.1| OSIGBa0127A14.4 [Oryza sativa Indica Group]
Length=1983

 Score =   100 bits (249),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  817  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  876

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  877  KLRMCIDYTDLNKACPTDPYPLPRID  902



>gb|AAU44314.1| putative polyprotein [Oryza sativa Japonica Group]
Length=2027

 Score =   100 bits (249),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  817  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  876

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  877  KLRMCIDYTDLNKACPKDPYPLPRID  902



>emb|CAE03002.2| OSJNBa0043L09.21 [Oryza sativa Japonica Group]
Length=2028

 Score =   100 bits (249),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  817  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  876

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  877  KLRMCIDYTDLNKACPKDPYPLPRID  902



>gb|ABA98262.1| transposon protein, putative, unclassified [Oryza sativa Japonica 
Group]
Length=2013

 Score =   100 bits (249),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  817  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  876

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  877  KLRMCIDYTDLNKACPKDPYPLPRID  902



>emb|CAN66238.1| hypothetical protein VITISV_041838 [Vitis vinifera]
Length=225

 Score = 95.9 bits (237),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 59/87 (68%), Gaps = 1/87 (1%)
 Frame = -2

Query  258  THKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP  79
            +H+L V P  +P+ QR R    +R++ ++ E+D LLE+G +REV YP WLANVV+ PK  
Sbjct  10   SHRLNVWPIARPIWQRVRRFHPDRQKIIRDEIDKLLEVGFIREVDYPDWLANVVVVPKKE  69

Query  78   T-WRMCVDYIDLNKACPMDPFSFPNID  1
              WR+CVDY +LN ACP D F  P ID
Sbjct  70   GKWRVCVDYTNLNNACPKDSFPLPRID  96



>emb|CAE05074.2| OSJNBa0094P09.13 [Oryza sativa Japonica Group]
Length=2027

 Score =   100 bits (249),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  817  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  876

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  877  KLRMCIDYTDLNKACPKDPYPLPRID  902



>ref|XP_010490399.1| PREDICTED: uncharacterized protein LOC104768172 [Camelina sativa]
Length=1132

 Score =   100 bits (248),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 60/86 (70%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLA-PKPP  79
            H+L VDP  +PV+Q++R  + ER   + KEV  LL+ G +REV YP WLANVV+   K  
Sbjct  171  HQLEVDPDHQPVRQKRRKFAPERDSIINKEVQNLLDAGFIREVKYPDWLANVVVVRKKNG  230

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
             WR+C+D+ DLNKACP DPF  P+ID
Sbjct  231  KWRVCIDFTDLNKACPKDPFPLPHID  256



>emb|CAN71857.1| hypothetical protein VITISV_012968 [Vitis vinifera]
Length=781

 Score = 99.8 bits (247),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 43/87 (49%), Positives = 58/87 (67%), Gaps = 1/87 (1%)
 Frame = -2

Query  258  THKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP  79
            +H+L V P  +P+QQR R    +R++ ++ E+D LLE G ++EV YP WL NVV+ PK  
Sbjct  508  SHRLNVLPTARPIQQRVRRFHLDRQKIIRNEIDKLLEAGFIKEVDYPDWLTNVVVVPKKE  567

Query  78   -TWRMCVDYIDLNKACPMDPFSFPNID  1
              WR+CVDY +LN ACP D F  P ID
Sbjct  568  GKWRVCVDYTNLNNACPKDSFPLPRID  594



>emb|CAD41940.2| OSJNBa0070M12.17 [Oryza sativa Japonica Group]
Length=1709

 Score =   100 bits (249),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 46/86 (53%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REV++P WLAN V+ PK   
Sbjct  704  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVLHPEWLANPVVVPKANG  763

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  764  KLRMCIDYTDLNKACPKDPYPLPRID  789



>gb|ABA94871.2| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1965

 Score =   100 bits (249),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P W+AN V+ PK   
Sbjct  810  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWMANPVVVPKANG  869

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  870  KLRMCIDYTDLNKACPKDPYPLPRID  895



>gb|KFK29723.1| hypothetical protein AALP_AA7G170100 [Arabis alpina]
Length=617

 Score = 99.0 bits (245),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 60/87 (69%), Gaps = 1/87 (1%)
 Frame = -2

Query  258  THKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLAN-VVLAPKP  82
            +H+L VDP  KP++Q++R L  ER + V  EV+ LL +G + EV YP WLAN VV+  K 
Sbjct  116  SHELNVDPTFKPIKQKRRKLGPERAKAVNDEVERLLRVGSISEVKYPDWLANQVVVKKKN  175

Query  81   PTWRMCVDYIDLNKACPMDPFSFPNID  1
              WR+CVD+ DLNKACP D F  P+ID
Sbjct  176  GKWRVCVDFTDLNKACPKDSFLLPHID  202



>emb|CAE02013.3| OSJNBa0079A21.2 [Oryza sativa Japonica Group]
Length=1988

 Score =   100 bits (248),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  794  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  853

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  854  KLRMCIDYTDLNKACPKDPYPLPRID  879



>emb|CAE05078.2| OSJNBa0094P09.17 [Oryza sativa Japonica Group]
Length=2027

 Score =   100 bits (248),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  817  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  876

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  877  KLRMCIDYTDLNKACPKDPYPLPRID  902



>ref|XP_010431341.1| PREDICTED: uncharacterized protein LOC104715647 [Camelina sativa]
Length=1966

 Score =   100 bits (248),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 59/87 (68%), Gaps = 1/87 (1%)
 Frame = -2

Query  258  THKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLAN-VVLAPKP  82
            +H+L VDP  KPV+Q++R L AER   V  EV  LL+ G + EV YP WL+N VV+  K 
Sbjct  904  SHELNVDPTYKPVKQKRRKLGAERTAAVNDEVKKLLDAGSITEVRYPDWLSNPVVVKKKN  963

Query  81   PTWRMCVDYIDLNKACPMDPFSFPNID  1
             TWR+CVD+ DLNKACP D F  P ID
Sbjct  964  GTWRVCVDFTDLNKACPKDSFPLPRID  990



>gb|ABA95291.1| transposon protein, putative, unclassified [Oryza sativa Japonica 
Group]
Length=1972

 Score =   100 bits (248),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  817  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  876

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  877  KLRMCIDYTDLNKACPKDPYPLPRID  902



>gb|AAS07175.1| putative reverse transcriptase [Oryza sativa Japonica Group]
 gb|ABF97312.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=2002

 Score =   100 bits (248),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  820  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  879

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  880  KLRMCIDYTDLNKACPKDPYPLPRID  905



>emb|CAE03547.2| OSJNBa0060D06.13 [Oryza sativa Japonica Group]
Length=1909

 Score =   100 bits (248),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REV++P WLAN V+ PK   
Sbjct  699  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVVHPEWLANPVVVPKANG  758

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  759  KLRMCIDYTDLNKACPKDPYPLPRID  784



>gb|AAU43927.1| putative polyprotein [Oryza sativa Japonica Group]
Length=2027

 Score =   100 bits (248),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 60/86 (70%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PV+Q  R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  817  HRLAVRPGARPVRQNVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  876

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  877  KLRMCIDYTDLNKACPKDPYPLPRID  902



>ref|XP_001545081.1| hypothetical protein BC1G_16418 [Botrytis cinerea B05.10]
Length=271

 Score = 96.3 bits (238),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 56/86 (65%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H L VDP+ +P +QR R +S ++ E  + EV  LL  G +REV YP WLAN ++  K   
Sbjct  162  HSLNVDPSFRPRKQRLRNMSDDKAEGARNEVKRLLSAGVIREVKYPEWLANTIMVKKANG  221

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
             WRMC+D+ DLNKACP D FS P ID
Sbjct  222  KWRMCIDFTDLNKACPKDEFSLPRID  247



>emb|CAE03482.2| OSJNBa0065O17.7 [Oryza sativa Japonica Group]
Length=3331

 Score =   100 bits (248),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255   HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
             H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  2511  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  2570

Query  78    TWRMCVDYIDLNKACPMDPFSFPNID  1
               RMC+DY DLNKACP DP+  P ID
Sbjct  2571  KLRMCIDYTDLNKACPKDPYPLPRID  2596



>gb|AAX95884.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1920

 Score =   100 bits (248),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  817  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  876

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  877  KLRMCIDYTDLNKACPKDPYPLPRID  902



>gb|ABA92306.2| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1920

 Score =   100 bits (248),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  817  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  876

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  877  KLRMCIDYTDLNKACPKDPYPLPRID  902



>gb|ABA94658.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1965

 Score =   100 bits (248),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  794  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  853

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  854  KLRMCIDYTDLNKACPKDPYPLPRID  879



>gb|AAT85251.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1863

 Score =   100 bits (248),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  717  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  776

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  777  KLRMCIDYTDLNKACPKDPYPLPRID  802



>emb|CAD40289.2| OSJNBb0062H02.6 [Oryza sativa Japonica Group]
Length=2001

 Score =   100 bits (248),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  817  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  876

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  877  KLRMCIDYTDLNKACPKDPYPLPRID  902



>emb|CAN72190.1| hypothetical protein VITISV_037820 [Vitis vinifera]
Length=870

 Score = 99.4 bits (246),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 46/87 (53%), Positives = 58/87 (67%), Gaps = 1/87 (1%)
 Frame = -2

Query  258  THKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP  79
            +HKL V PA +PV Q+      +R+E ++ E+D LLE G +REV YP WLANVV+ PK  
Sbjct  9    SHKLNVFPAARPVWQKISRFHPDRQEVIRNEIDKLLEAGFIREVSYPDWLANVVVVPKKE  68

Query  78   -TWRMCVDYIDLNKACPMDPFSFPNID  1
              WR+CVDY +LN ACP D F  P ID
Sbjct  69   GKWRVCVDYTNLNNACPKDSFPLPRID  95



>emb|CAE76060.1| B1248C03.19 [Oryza sativa Japonica Group]
 emb|CAE76067.1| B1340F09.5 [Oryza sativa Japonica Group]
Length=1958

 Score =   100 bits (248),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  779  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  838

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  839  KLRMCIDYTDLNKACPKDPYPLPRID  864



>gb|ABF94245.1| transposon protein, putative, unclassified [Oryza sativa Japonica 
Group]
Length=1995

 Score =   100 bits (248),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  802  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  861

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  862  KLRMCIDYTDLNKACPKDPYPLPRID  887



>ref|XP_009148661.1| PREDICTED: protein NYNRIN-like [Brassica rapa]
Length=1294

 Score = 99.8 bits (247),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 60/87 (69%), Gaps = 1/87 (1%)
 Frame = -2

Query  258  THKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLAN-VVLAPKP  82
            TH+L VDP  KP++Q++R L  +R + V +EVD LL  G + EV YP WLAN VV+  K 
Sbjct  270  THELNVDPTFKPIRQKRRKLGPDRSKAVNEEVDRLLGAGSIAEVRYPEWLANPVVVKKKN  329

Query  81   PTWRMCVDYIDLNKACPMDPFSFPNID  1
              WR+CVD+ DLNKACP D +  PNID
Sbjct  330  GKWRVCVDFTDLNKACPKDSYPLPNID  356



>gb|ABF97535.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1735

 Score = 99.8 bits (247),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 60/86 (70%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P   PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  694  HRLAVRPGATPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  753

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  754  KLRMCIDYTDLNKACPKDPYPLPRID  779



>gb|ABA91113.2| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1981

 Score = 99.8 bits (247),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  817  HRLAVRPGARPVRQKVRRQAPERQAFIREEVAQLLEAGFIREVIHPEWLANPVVVPKANG  876

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  877  KLRMCIDYTDLNKACPKDPYPLPRID  902



>gb|ABA99331.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1452

 Score = 99.8 bits (247),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  826  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  885

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  886  KLRMCIDYTDLNKACPKDPYPLPRID  911



>emb|CAN75487.1| hypothetical protein VITISV_043149 [Vitis vinifera]
Length=866

 Score = 99.4 bits (246),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 60/87 (69%), Gaps = 1/87 (1%)
 Frame = -2

Query  258  THKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP  79
            +HKL V PA +PV+Q+ R    +R++ ++ E+D LLE G +REV YP WLANVV+ PK  
Sbjct  10   SHKLNVFPAARPVRQKIRRFHPDRQKVIRNEIDKLLEAGFIREVSYPDWLANVVVVPKKE  69

Query  78   T-WRMCVDYIDLNKACPMDPFSFPNID  1
              WR+CVDY +LN ACP D F  P ID
Sbjct  70   GKWRVCVDYTNLNNACPKDSFPLPRID  96



>emb|CAN81205.1| hypothetical protein VITISV_020910 [Vitis vinifera]
Length=993

 Score = 99.4 bits (246),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 60/87 (69%), Gaps = 1/87 (1%)
 Frame = -2

Query  258  THKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP  79
            +HKL V PA +PV+Q+ R    +R++ ++ E+D LLE G +REV YP WLANVV+ PK  
Sbjct  10   SHKLNVFPAARPVRQKIRRFHPDRQKVIRNEIDKLLEAGFIREVSYPDWLANVVVVPKKE  69

Query  78   T-WRMCVDYIDLNKACPMDPFSFPNID  1
              WR+CVDY +LN ACP D F  P ID
Sbjct  70   GKWRVCVDYTNLNNACPKDSFPLPRID  96



>ref|XP_010513349.1| PREDICTED: uncharacterized protein LOC104789330 [Camelina sativa]
Length=1009

 Score = 99.4 bits (246),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 58/87 (67%), Gaps = 1/87 (1%)
 Frame = -2

Query  258  THKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLAN-VVLAPKP  82
            TH+L  DP  KP++Q++R L +ER + V  EVD LL  G + EV YP WLAN VV+  K 
Sbjct  32   THELNADPTHKPIKQKRRKLGSERSQAVNDEVDKLLGAGSIMEVKYPEWLANPVVVKKKN  91

Query  81   PTWRMCVDYIDLNKACPMDPFSFPNID  1
              WR+CVD+ DLNKACP D F  P ID
Sbjct  92   GKWRICVDFTDLNKACPKDSFPLPRID  118



>emb|CAN68844.1| hypothetical protein VITISV_032036 [Vitis vinifera]
Length=929

 Score = 99.4 bits (246),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 60/87 (69%), Gaps = 1/87 (1%)
 Frame = -2

Query  258  THKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP  79
            +HKL V PA +PV+Q+ R    +R++ ++ E+D LLE G +REV YP WLANVV+ PK  
Sbjct  10   SHKLNVFPAARPVRQKIRRFHPDRQKVIRNEIDKLLEAGFIREVSYPDWLANVVVVPKEE  69

Query  78   T-WRMCVDYIDLNKACPMDPFSFPNID  1
              WR+CVDY +LN ACP D F  P ID
Sbjct  70   GKWRVCVDYTNLNNACPKDSFPLPRID  96



>gb|AAR87221.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1703

 Score = 99.8 bits (247),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 60/86 (70%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P   PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  694  HRLAVRPGATPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  753

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  754  KLRMCIDYTDLNKACPKDPYPLPRID  779



>gb|AAU10741.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1510

 Score = 99.8 bits (247),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 46/86 (53%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
            H+LAV P  +PV+Q+ R  + +R+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  615  HRLAVRPGARPVRQKVRRQAPKRQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  674

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  675  KLRMCIDYTDLNKACPKDPYPLPRID  700



>gb|ABA97130.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1503

 Score = 99.8 bits (247),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 60/86 (70%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +P +Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  564  HRLAVQPGARPGRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  623

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  624  KLRMCIDYTDLNKACPKDPYPLPRID  649



>gb|ABA95559.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1922

 Score = 99.8 bits (247),  Expect = 9e-22, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  712  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  771

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  772  KLRMCIDYTDLNKACPKDPYPLPRID  797



>gb|ABA93826.2| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1739

 Score = 99.8 bits (247),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 60/86 (70%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  L E G +REVI+P WLAN V+ PK   
Sbjct  668  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLFEAGFIREVIHPEWLANPVVVPKANG  727

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  728  KLRMCIDYTDLNKACPKDPYPLPRID  753



>ref|XP_010451667.1| PREDICTED: uncharacterized protein LOC104733819 [Camelina sativa]
Length=931

 Score = 99.4 bits (246),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 61/87 (70%), Gaps = 1/87 (1%)
 Frame = -2

Query  258  THKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLAN-VVLAPKP  82
            +H+L VDP  +PV+Q++R L  ER E V KEV+ LL+ G +REV YP WLAN VV+  K 
Sbjct  20   SHELNVDPTFRPVKQKRRKLGPERAEIVNKEVERLLKAGQIREVKYPEWLANTVVVKKKN  79

Query  81   PTWRMCVDYIDLNKACPMDPFSFPNID  1
               R+CVD+ DLNKACP D F  P+ID
Sbjct  80   GKSRVCVDFTDLNKACPKDSFPLPHID  106



>gb|ABA98055.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1983

 Score = 99.8 bits (247),  Expect = 9e-22, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  814  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGLIREVIHPEWLANPVVVPKANG  873

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  874  KLRMCIDYTDLNKACPKDPYPLPRID  899



>emb|CAE03836.3| OSJNBb0013J13.13 [Oryza sativa Japonica Group]
Length=1836

 Score = 99.8 bits (247),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PV+Q+ R  + ER+ F++++V  LLE G +REVI+P WLAN V+ PK   
Sbjct  764  HRLAVRPGARPVRQKVRRQAPERQAFIREKVAQLLEAGFIREVIHPEWLANPVVVPKANG  823

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  824  KLRMCIDYTDLNKACPKDPYPLPRID  849



>emb|CAN67795.1| hypothetical protein VITISV_009541 [Vitis vinifera]
Length=904

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 61/87 (70%), Gaps = 1/87 (1%)
 Frame = -2

Query  258  THKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP  79
            +HKL V PA +PV+Q+ R    +R+E ++ E+D LL++G +R+V YP WLANVV+ PK  
Sbjct  10   SHKLNVFPAARPVRQKIRRFHPDRQEVIRNEIDKLLKVGFIRKVSYPDWLANVVVVPKKE  69

Query  78   T-WRMCVDYIDLNKACPMDPFSFPNID  1
              WR+CVDY +LN ACP D F  P ID
Sbjct  70   GKWRVCVDYTNLNNACPKDSFPLPRID  96



>emb|CAE03879.1| OSJNBb0015N08.7 [Oryza sativa Japonica Group]
Length=1975

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 60/86 (70%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P   PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  785  HRLAVRPGAMPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  844

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  845  KLRMCIDYTDLNKACPKDPYPLPRID  870



>emb|CAN80434.1| hypothetical protein VITISV_001561 [Vitis vinifera]
Length=886

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 59/87 (68%), Gaps = 1/87 (1%)
 Frame = -2

Query  258  THKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP  79
            +H+L + PA +PVQQ+ R    +R+E ++ EVD LLE+G +REV Y  WL NVV+ PK  
Sbjct  10   SHRLNIFPAARPVQQKIRRFHPDRQEVIRNEVDKLLEVGFIREVSYSDWLENVVVVPKKE  69

Query  78   T-WRMCVDYIDLNKACPMDPFSFPNID  1
              WR+CVDY +LN ACP D F  P ID
Sbjct  70   GKWRVCVDYTNLNNACPKDSFPLPRID  96



>gb|AAU44318.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1333

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  817  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPKWLANPVVVPKANG  876

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  877  KLRMCIDYTDLNKACPKDPYPLPRID  902



>gb|KFK26623.1| hypothetical protein AALP_AA8G272900 [Arabis alpina]
Length=1392

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 62/87 (71%), Gaps = 1/87 (1%)
 Frame = -2

Query  258  THKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLAN-VVLAPKP  82
            +H+L VDP  KP++Q++R L +ER + V +EV  LL+ G + EV YP WLAN VV+  K 
Sbjct  459  SHRLNVDPTFKPIRQKRRKLGSERAKAVNEEVTKLLDAGSITEVHYPEWLANPVVVKKKN  518

Query  81   PTWRMCVDYIDLNKACPMDPFSFPNID  1
             +WR+CVD+ DLNKACP D +  P+ID
Sbjct  519  GSWRVCVDFTDLNKACPKDSYPLPHID  545



>emb|CAH66808.1| OSIGBa0135C13.3 [Oryza sativa Indica Group]
Length=1911

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  704  HRLAVRPDARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  763

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  764  KLRMCIDYTDLNKACPKDPYPLPRID  789



>gb|AAV25049.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1869

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  693  HRLAVRPDARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  752

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  753  KLRMCIDYTDLNKACPKDPYPLPRID  778



>gb|AAP06851.1| putative polyprotein [Oryza sativa Japonica Group]
 gb|ABF95101.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1918

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 46/86 (53%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
            H+LAV P  +P++Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  815  HRLAVRPGARPIRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  874

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  875  KLRMCIDYTDLNKACPKDPYPLPRID  900



>gb|ABA97306.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1500

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 46/86 (53%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
            H+LAV P  +PV+Q+ R  + +R+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  713  HRLAVRPGARPVRQKVRRQAPKRQAFIREEVARLLEAGFIREVIHPKWLANPVVVPKANG  772

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  773  KLRMCIDYTDLNKACPKDPYPLPRID  798



>gb|AAK53857.1|AC016781_11 Putative retroelement [Oryza sativa Japonica Group]
 gb|ABF97140.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1541

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 60/86 (70%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+L V P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  432  HRLTVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPKWLANPVVVPKANG  491

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  492  KLRMCIDYTDLNKACPKDPYPLPRID  517



>gb|KFK23214.1| hypothetical protein AALP_AAs44667U000200 [Arabis alpina]
Length=1192

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 60/87 (69%), Gaps = 1/87 (1%)
 Frame = -2

Query  258  THKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLAN-VVLAPKP  82
            +H+L VDP  KP++Q++R L  ER + V  EV+ LL +G + EV YP WLAN VV+  K 
Sbjct  723  SHELNVDPTFKPIKQKRRKLGPERAKAVNNEVERLLRVGSITEVKYPDWLANPVVVKKKN  782

Query  81   PTWRMCVDYIDLNKACPMDPFSFPNID  1
              WR+CVD+ DLNKACP D F  P+ID
Sbjct  783  GKWRVCVDFTDLNKACPKDSFPLPHID  809



>gb|AAO17025.1| Putative gag-pol precursor [Oryza sativa Japonica Group]
 gb|ABF93633.1| transposon protein, putative, unclassified [Oryza sativa Japonica 
Group]
Length=2027

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 60/86 (70%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REV +P WLAN V+ PK   
Sbjct  817  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVFHPEWLANPVVVPKANG  876

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  877  KLRMCIDYTDLNKACPKDPYPLPRID  902



>gb|ABA99479.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1322

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PV+Q+ R  + ER+ F++++V  LLE G +REVI+P WLAN V+ PK   
Sbjct  627  HRLAVRPGARPVRQKVRRQAPERQAFIREKVARLLEAGFIREVIHPEWLANPVVVPKANG  686

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  687  KLRMCIDYTDLNKACPKDPYPLPRID  712



>gb|AAU90124.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1796

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 60/86 (70%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
            H+LAV P  +PV Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  828  HRLAVRPGARPVWQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  887

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  888  KLRMCIDYTDLNKACPKDPYPLPRID  913



>emb|CAN76908.1| hypothetical protein VITISV_006597 [Vitis vinifera]
Length=931

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 60/87 (69%), Gaps = 1/87 (1%)
 Frame = -2

Query  258  THKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP  79
            +H+L V  A KP++Q+ R    +R++ ++ E+D LLE G +REV YP WLANVV+ PK  
Sbjct  10   SHRLNVFSAAKPIRQKIRRFHPDRQKVIRNEIDKLLEAGFIREVSYPDWLANVVVVPKKE  69

Query  78   T-WRMCVDYIDLNKACPMDPFSFPNID  1
              WR+CVDY +LN ACP D FS P ID
Sbjct  70   GKWRVCVDYTNLNNACPKDSFSLPRID  96



>gb|ABA94226.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1739

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  665  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  724

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              +MC+DY DLNKACP DP+  P ID
Sbjct  725  KLQMCIDYTDLNKACPKDPYPLPRID  750



>ref|XP_009145079.1| PREDICTED: uncharacterized protein LOC103868760 [Brassica rapa]
Length=1626

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 60/87 (69%), Gaps = 1/87 (1%)
 Frame = -2

Query  258  THKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLAN-VVLAPKP  82
            TH+L VDP  KP++Q++R L  +R + V +E+D LL  G + EV YP WLAN VV+  K 
Sbjct  738  THELNVDPTFKPIRQKRRKLGPDRSKAVNEELDRLLGAGSIAEVRYPEWLANPVVVKKKN  797

Query  81   PTWRMCVDYIDLNKACPMDPFSFPNID  1
              WR+CVD+ DLNKACP D +  PNID
Sbjct  798  GKWRVCVDFTDLNKACPKDSYPLPNID  824



>gb|ABA94805.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1659

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 60/86 (70%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+L V P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  524  HRLTVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  583

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  584  KLRMCIDYTDLNKACPKDPYPLPRID  609



>gb|AAT77889.1| putative polyprotein [Oryza sativa Japonica Group]
 gb|ABF98704.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1851

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLAN-VVLAPKPP  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN VV++    
Sbjct  817  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVSKANG  876

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  877  KLRMCIDYTDLNKACPKDPYPLPRID  902



>emb|CAH66523.1| H0502B11.3 [Oryza sativa Indica Group]
Length=1677

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 60/86 (70%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PV+Q+ R    ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  678  HRLAVRPGTRPVRQKVRRQVPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKENG  737

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  738  KLRMCIDYTDLNKACPKDPYPLPRID  763



>emb|CAE01728.2| OSJNBb0050O03.18 [Oryza sativa Japonica Group]
Length=2015

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +P++Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  817  HRLAVRPDARPIRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  876

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  877  KLRMCIDYTDLNKACPKDPYPLPRID  902



>emb|CAD40917.1| OSJNBa0088K19.3 [Oryza sativa Japonica Group]
Length=1882

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
            H+LAV P  KPV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  751  HRLAVRPGAKPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  810

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              +MC+DY DLNKACP DP+  P ID
Sbjct  811  KLQMCIDYTDLNKACPKDPYPLPRID  836



>emb|CAD40020.2| OSJNBa0052O21.5 [Oryza sativa Japonica Group]
Length=1888

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 60/86 (70%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PV+Q+ R  + ER+ F+ +EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  742  HRLAVRPGARPVRQKVRRQAPERQAFICEEVARLLEAGFIREVIHPEWLANPVVVPKANG  801

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  802  KLRMCIDYTDLNKACPKDPYPLPRID  827



>gb|AAP44696.1| putative GAG-POL precursor [Oryza sativa Japonica Group]
 gb|ABF98769.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1987

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 46/86 (53%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  818  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  877

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+D+ DLNKACP DP+  P ID
Sbjct  878  KLRMCIDFTDLNKACPKDPYPLPRID  903



>ref|XP_009113559.1| PREDICTED: uncharacterized protein LOC103838859 [Brassica rapa]
Length=911

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 60/87 (69%), Gaps = 1/87 (1%)
 Frame = -2

Query  258  THKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLAN-VVLAPKP  82
            TH+L VDP  KP++Q++R L  +R + V +E+D LL  G + EV YP WLAN VV+  K 
Sbjct  10   THELNVDPTFKPIRQKRRKLGPDRSKAVNEELDRLLGAGSIAEVRYPEWLANPVVVKKKN  69

Query  81   PTWRMCVDYIDLNKACPMDPFSFPNID  1
              WR+CVD+ DLNKACP D +  PNID
Sbjct  70   GKWRVCVDFTDLNKACPKDSYPLPNID  96



>gb|AAT93943.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1575

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 46/86 (53%), Positives = 60/86 (70%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  773  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  832

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+ Y DLNKACP DP+  P ID
Sbjct  833  KLRMCIAYTDLNKACPKDPYPLPRID  858



>gb|AAT81752.1| Reverse transcriptase (RNA-dependent DNA polymerase) domain containing 
protein [Oryza sativa Japonica Group]
 gb|ABF97409.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1431

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 46/86 (53%), Positives = 60/86 (70%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
            H+LAV    +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  795  HRLAVRSGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  854

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  855  KLRMCIDYTDLNKACPKDPYPLPRID  880



>emb|CAH67128.1| H0315E07.6 [Oryza sativa Indica Group]
Length=1891

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
            H+LAV P  KPV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  751  HRLAVRPGAKPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  810

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              +MC+DY DLNKACP DP+  P ID
Sbjct  811  KLQMCIDYTDLNKACPKDPYPLPRID  836



>emb|CAN80939.1| hypothetical protein VITISV_035836 [Vitis vinifera]
Length=888

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 43/87 (49%), Positives = 59/87 (68%), Gaps = 1/87 (1%)
 Frame = -2

Query  258  THKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP  79
            +H+L V P  +P+QQR R+   ++++ +  E+D LLE G +REV YP WLANVV+ PK  
Sbjct  10   SHRLNVLPTARPIQQRVRHFHPDKQKIIWNEIDKLLEAGFIREVDYPDWLANVVVVPKKE  69

Query  78   -TWRMCVDYIDLNKACPMDPFSFPNID  1
              W++CVDY +LN ACP D F  P ID
Sbjct  70   GKWQVCVDYTNLNNACPKDSFPLPRID  96



>ref|XP_010445558.1| PREDICTED: uncharacterized protein LOC104728244 [Camelina sativa]
Length=995

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 57/86 (66%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLAN-VVLAPKPP  79
            H+L VD   KP++QR+R L  ER   V +EV  LLE G +REV YP WL+N VV+  K  
Sbjct  603  HELNVDSTFKPIKQRRRKLGLERTAAVNEEVKKLLEAGSIREVKYPDWLSNPVVVKKKNG  662

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
             WR+CVD+ DLNKACP D F  P ID
Sbjct  663  KWRVCVDFTDLNKACPKDSFLLPRID  688



>emb|CAN67467.1| hypothetical protein VITISV_031393 [Vitis vinifera]
Length=384

 Score = 95.5 bits (236),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 58/87 (67%), Gaps = 1/87 (1%)
 Frame = -2

Query  258  THKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP  79
            +HKL V PA +P++Q+ R    +R+  ++ E++ LLE G +REV YP WLANVV  PK  
Sbjct  10   SHKLNVFPAARPIRQKIRRFHPDRQRVIQDEINKLLEAGFIREVXYPDWLANVVXVPKKE  69

Query  78   T-WRMCVDYIDLNKACPMDPFSFPNID  1
              WR+CVDY +LN ACP D F  P ID
Sbjct  70   GKWRVCVDYTNLNNACPKDSFPLPRID  96



>emb|CAN82984.1| hypothetical protein VITISV_030339 [Vitis vinifera]
Length=939

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 45/87 (52%), Positives = 56/87 (64%), Gaps = 1/87 (1%)
 Frame = -2

Query  258  THKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP  79
            +HKL V    +PV+QR R    ER   ++ E+D LLE G ++EV YP WLANVV+ PK  
Sbjct  10   SHKLNVFSTARPVRQRIRRFHPERERVIRNEIDKLLEAGFIKEVSYPDWLANVVVVPKKE  69

Query  78   -TWRMCVDYIDLNKACPMDPFSFPNID  1
              WR+CVDY +LN ACP D F  P ID
Sbjct  70   GKWRVCVDYTNLNNACPKDSFPLPRID  96



>emb|CAN77146.1| hypothetical protein VITISV_038341 [Vitis vinifera]
Length=910

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 61/87 (70%), Gaps = 1/87 (1%)
 Frame = -2

Query  258  THKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP  79
            +HKL + P+ +PV+Q+ R   +++++ ++ EVD LLE G +REV YP WLANVV+ PK  
Sbjct  10   SHKLNILPSSRPVRQKVRRFHSDKQKIIQDEVDKLLEAGFIREVEYPNWLANVVVVPKKE  69

Query  78   T-WRMCVDYIDLNKACPMDPFSFPNID  1
              WR+CVDY +LN ACP D F  P ID
Sbjct  70   GKWRVCVDYTNLNNACPKDSFPLPQID  96



>gb|KFK39764.1| hypothetical protein AALP_AA3G284800, partial [Arabis alpina]
Length=1266

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 60/87 (69%), Gaps = 1/87 (1%)
 Frame = -2

Query  258  THKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLAN-VVLAPKP  82
            +H+L VDP  KP++Q++R L  ER + V  EV+ LL +G + EV YP WLAN VV+  K 
Sbjct  359  SHELNVDPTFKPIKQKRRKLGPERAKAVNDEVERLLRVGSITEVKYPDWLANPVVVKKKN  418

Query  81   PTWRMCVDYIDLNKACPMDPFSFPNID  1
              WR+CVD+ DLNKACP D F  P+ID
Sbjct  419  GKWRVCVDFTDLNKACPKDSFPLPHID  445



>emb|CAN67947.1| hypothetical protein VITISV_002483 [Vitis vinifera]
Length=869

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 59/87 (68%), Gaps = 1/87 (1%)
 Frame = -2

Query  258  THKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP  79
            +H+L V P  +PV+QR R    +R++ ++ E+D LLE G +REV YP WLANVV+ PK  
Sbjct  10   SHRLNVLPTTRPVRQRVRRFHLDRQKIIRDEIDKLLEAGFIREVEYPDWLANVVVVPKKE  69

Query  78   T-WRMCVDYIDLNKACPMDPFSFPNID  1
              WR+CVDY +LN ACP D F  P ID
Sbjct  70   GKWRVCVDYTNLNNACPKDSFPLPRID  96



>gb|KFK44297.1| hypothetical protein AALP_AA1G239700 [Arabis alpina]
Length=1374

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 60/87 (69%), Gaps = 1/87 (1%)
 Frame = -2

Query  258  THKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLAN-VVLAPKP  82
            +H+L VDP  KP++Q++R L  ER + V  EV+ LL +G + EV YP WLAN VV+  K 
Sbjct  394  SHELNVDPTFKPIKQKRRKLGPERAKAVNDEVERLLRVGSITEVKYPDWLANPVVVKKKN  453

Query  81   PTWRMCVDYIDLNKACPMDPFSFPNID  1
              WR+CVD+ DLNKACP D F  P+ID
Sbjct  454  GKWRVCVDFTDLNKACPKDSFPLPHID  480



>ref|XP_009762920.1| PREDICTED: uncharacterized protein LOC104214896 [Nicotiana sylvestris]
Length=398

 Score = 95.5 bits (236),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 58/87 (67%), Gaps = 1/87 (1%)
 Frame = -2

Query  258  THKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP  79
            THKL  DP   PV+Q +R  +A   E V +EVD LL  G +RE  YP W+ANVV+  K  
Sbjct  290  THKLNDDPLHPPVRQMRRKFNAAINEAVSEEVDKLLANGSIRESKYPQWVANVVMVKKKN  349

Query  78   -TWRMCVDYIDLNKACPMDPFSFPNID  1
              WRMCVD+IDLNKACP+D F  P+ID
Sbjct  350  RKWRMCVDFIDLNKACPIDSFPLPHID  376



>gb|AAM14690.1|AC097446_19 Putative gag-pol precursor [Oryza sativa Japonica Group]
Length=684

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 60/86 (70%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +P++Q  R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  440  HRLAVRPDARPIRQNVRRQAPERQAFIREEVTRLLEAGFIREVIHPEWLANPVVVPKANG  499

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY+DLNK CP DPF  P ID
Sbjct  500  KLRMCIDYMDLNKVCPKDPFPLPCID  525



>emb|CAD40221.2| OSJNBa0019J05.19 [Oryza sativa Japonica Group]
Length=1969

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 60/86 (70%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
            H+LAV P  +PV+Q+ R  + ER+ F++ EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  817  HRLAVRPGARPVRQKVRRQAPERQAFIRVEVARLLEAGFIREVIHPEWLANPVVVPKANG  876

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  877  KLRMCIDYTDLNKACPKDPYPLPRID  902



>gb|ABW81060.1| GagPol3 [Arabidopsis lyrata subsp. lyrata]
Length=1103

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLAN-VVLAPKPP  79
            H+L VDP+ KPV+Q++R L  ER + V  EVD LL+IG +REV YP W+AN VV+  K  
Sbjct  11   HELNVDPSFKPVKQKRRKLGVERAKIVNDEVDKLLKIGSIREVQYPEWVANTVVVKKKNG  70

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              R+C+D+ DLNKACP D F  P+ID
Sbjct  71   KDRVCIDFTDLNKACPKDSFPLPHID  96



>gb|KFK22060.1| hypothetical protein AALP_AAs39363U000200 [Arabis alpina]
Length=2000

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 45/87 (52%), Positives = 61/87 (70%), Gaps = 1/87 (1%)
 Frame = -2

Query  258   THKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLAN-VVLAPKP  82
             +H+L VDP  KP++Q++R L +ER + V  EV  LL+ G + EV YP WLAN VV+  K 
Sbjct  950   SHRLNVDPTFKPIRQKRRKLGSERTKAVNDEVTKLLDAGSITEVQYPEWLANPVVVKKKN  1009

Query  81    PTWRMCVDYIDLNKACPMDPFSFPNID  1
              +WR+CVD+ DLNKACP D +  P+ID
Sbjct  1010  GSWRVCVDFTDLNKACPKDSYPLPHID  1036



>gb|AAP52180.2| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=650

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 60/86 (70%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +P++Q  R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  406  HRLAVRPDARPIRQNVRRQAPERQAFIREEVTRLLEAGFIREVIHPEWLANPVVVPKANG  465

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY+DLNK CP DPF  P ID
Sbjct  466  KLRMCIDYMDLNKVCPKDPFPLPCID  491



>gb|ABA91263.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=2030

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PV+Q+ R  ++ER+ F+++EV  LLE G +REVI+  WLAN V+ PK   
Sbjct  820  HRLAVRPGARPVRQKVRRQASERQAFIREEVARLLEAGFIREVIHLEWLANPVVVPKANG  879

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  880  KLRMCIDYTDLNKACPKDPYPLPRID  905



>gb|AAT85261.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1992

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 46/86 (53%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  782  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  841

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP +P+  P ID
Sbjct  842  KLRMCIDYTDLNKACPKEPYPLPRID  867



>gb|KFK24131.1| hypothetical protein AALP_AAs45400U000100, partial [Arabis alpina]
Length=638

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 44/87 (51%), Positives = 60/87 (69%), Gaps = 1/87 (1%)
 Frame = -2

Query  258  THKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLAN-VVLAPKP  82
            +H+L VDP  KP++Q ++ L +ER + V  EV  LL+ G + EV YP WLAN VV+  K 
Sbjct  90   SHRLNVDPTFKPIRQTRQKLGSERTKAVNDEVTKLLDAGSITEVQYPEWLANPVVVKKKN  149

Query  81   PTWRMCVDYIDLNKACPMDPFSFPNID  1
             +WR+CVD+ DLNKACP D +  P+ID
Sbjct  150  GSWRVCVDFTDLNKACPKDSYPLPHID  176



>emb|CAH66232.1| H0825G02.9 [Oryza sativa Indica Group]
Length=1716

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 60/86 (70%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PV+Q+ R  + ER+ F++++V  LLE G +REVI+P WL N V+ PK   
Sbjct  730  HRLAVQPGARPVRQKVRRQAPERQAFIREKVARLLEAGFIREVIHPEWLTNPVVVPKANG  789

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  790  KLRMCIDYTDLNKACPKDPYPLPRID  815



>gb|KFK44296.1| hypothetical protein AALP_AA1G239700 [Arabis alpina]
Length=1197

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 60/87 (69%), Gaps = 1/87 (1%)
 Frame = -2

Query  258  THKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLAN-VVLAPKP  82
            +H+L VDP  KP++Q++R L  ER + V  EV+ LL +G + EV YP WLAN VV+  K 
Sbjct  217  SHELNVDPTFKPIKQKRRKLGPERAKAVNDEVERLLRVGSITEVKYPDWLANPVVVKKKN  276

Query  81   PTWRMCVDYIDLNKACPMDPFSFPNID  1
              WR+CVD+ DLNKACP D F  P+ID
Sbjct  277  GKWRVCVDFTDLNKACPKDSFPLPHID  303



>gb|AAP46242.1| putative gag-pol precursor, 3'-partial [Oryza sativa Japonica 
Group]
Length=948

 Score = 97.8 bits (242),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE   +REVI+P WLAN V+ PK   
Sbjct  632  HRLAVRPDARPVRQKVRRQAPERQAFIREEVARLLEADFIREVIHPEWLANPVVVPKANG  691

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DPF  P+ID
Sbjct  692  KLRMCIDYTDLNKACPKDPFPLPHID  717



>emb|CAN77646.1| hypothetical protein VITISV_024979 [Vitis vinifera]
Length=265

 Score = 94.4 bits (233),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 58/87 (67%), Gaps = 1/87 (1%)
 Frame = -2

Query  258  THKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP  79
            +HKL V P  +PV+Q+ R    +R+  ++ E++ LLE G +REV YP WLANVV+ PK  
Sbjct  10   SHKLNVLPXARPVRQKIRRFHPDRQRVIQDEINKLLEAGFIREVSYPDWLANVVVVPKKE  69

Query  78   T-WRMCVDYIDLNKACPMDPFSFPNID  1
              WR+CVDY +LN ACP D F  P ID
Sbjct  70   GKWRVCVDYTNLNNACPKDSFPLPRID  96



>gb|AAT77321.1| putative polyprotein [Oryza sativa Japonica Group]
 gb|AAV31327.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1677

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 59/86 (69%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLAN-VVLAPKPP  79
            H L V    KP++QR RY + +R++ +K+E+  LL +G ++EV++P WLAN V+   K  
Sbjct  900  HSLHVKEDAKPIKQRLRYFAQDRKDAIKEELTKLLAVGFIKEVLHPDWLANPVLFRKKTG  959

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
             WRMCVD+ DLNK+CP DPF  P ID
Sbjct  960  QWRMCVDFTDLNKSCPKDPFGLPRID  985



>gb|KFK35944.1| hypothetical protein AALP_AA4G058000 [Arabis alpina]
Length=1807

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 59/87 (68%), Gaps = 1/87 (1%)
 Frame = -2

Query  258  THKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLAN-VVLAPKP  82
            +H+L VDP  KP++Q++R L  ER   V +EV  LLE G + EV YP WLAN VV+  K 
Sbjct  898  SHELHVDPTYKPIKQKRRKLGYERARAVNEEVTKLLEAGSITEVQYPEWLANPVVVKKKN  957

Query  81   PTWRMCVDYIDLNKACPMDPFSFPNID  1
              WR+C+D+ DLNKACP D F  P+ID
Sbjct  958  GKWRVCIDFTDLNKACPKDSFPLPHID  984



>gb|ABA99783.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1908

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 60/86 (70%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKP-P  79
            H+LAV    +PV+Q+ R  + ER+ F+++EV  LLE G +REVI+P WLAN V+ PK   
Sbjct  762  HRLAVRSGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREVIHPEWLANPVVVPKANG  821

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  822  KLRMCIDYTDLNKACPKDPYPLPRID  847



>emb|CAD40172.2| OSJNBa0061A09.11 [Oryza sativa Japonica Group]
Length=2030

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 46/86 (53%), Positives = 60/86 (70%), Gaps = 1/86 (1%)
 Frame = -2

Query  255  HKLAVDPAVKPVQQRKRYLSAERREFVKKEVDTLLEIGHVREVIYPTWLANVVLAPKPP-  79
            H+LAV P  +PV+Q+ R  + ER+ F+++EV  LLE G +RE I+P WLAN V+ PK   
Sbjct  820  HRLAVRPGARPVRQKVRRQAPERQAFIREEVARLLEAGFIREFIHPEWLANPVVVPKANG  879

Query  78   TWRMCVDYIDLNKACPMDPFSFPNID  1
              RMC+DY DLNKACP DP+  P ID
Sbjct  880  KLRMCIDYTDLNKACPKDPYPLPRID  905



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 525010460520