BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c10723_g1_i1 len=1765 path=[1743:0-1279 3023:1280-1288
3032:1289-1764]

Length=1765
                                                                      Score     E

ref|XP_009758035.1|  PREDICTED: uncharacterized protein LOC104210...    573   0.0      
ref|XP_009758038.1|  PREDICTED: uncharacterized protein LOC104210...    570   0.0      
ref|XP_009770705.1|  PREDICTED: uncharacterized protein LOC104221...    568   0.0      
ref|XP_009770704.1|  PREDICTED: uncharacterized protein LOC104221...    566   0.0      
ref|XP_009619712.1|  PREDICTED: uncharacterized protein LOC104111...    566   0.0      
ref|XP_009619713.1|  PREDICTED: uncharacterized protein LOC104111...    566   0.0      
ref|XP_006339131.1|  PREDICTED: uncharacterized protein LOC102602...    565   0.0      
ref|XP_006339130.1|  PREDICTED: uncharacterized protein LOC102602...    563   0.0      
ref|XP_010312321.1|  PREDICTED: uncharacterized protein LOC101256...    563   0.0      
ref|XP_010312232.1|  PREDICTED: uncharacterized protein LOC101257...    561   0.0      
ref|XP_004249601.1|  PREDICTED: uncharacterized protein LOC101256...    559   0.0      
ref|XP_010312230.1|  PREDICTED: uncharacterized protein LOC101257...    559   0.0      
ref|XP_006338933.1|  PREDICTED: uncharacterized protein LOC102592...    556   0.0      
ref|XP_009758039.1|  PREDICTED: uncharacterized protein LOC104210...    554   0.0      
ref|XP_009630167.1|  PREDICTED: uncharacterized protein LOC104120...    553   0.0      
ref|XP_009619714.1|  PREDICTED: uncharacterized protein LOC104111...    547   0.0      
ref|XP_009770706.1|  PREDICTED: uncharacterized protein LOC104221...    547   0.0      
ref|XP_006339132.1|  PREDICTED: uncharacterized protein LOC102602...    544   0.0      
emb|CDP15424.1|  unnamed protein product                                544   0.0      
ref|XP_010312323.1|  PREDICTED: uncharacterized protein LOC101256...    543   0.0      
ref|XP_004249439.1|  PREDICTED: uncharacterized protein LOC101257...    540   0.0      
ref|XP_006338935.1|  PREDICTED: uncharacterized protein LOC102592...    537   0.0      
ref|XP_009630169.1|  PREDICTED: uncharacterized protein LOC104120...    535   0.0      
ref|XP_011077862.1|  PREDICTED: uncharacterized protein LOC105161758    528   2e-180   
ref|XP_007030697.1|  Homeodomain-like superfamily protein isoform 2     509   4e-173   
ref|XP_011034346.1|  PREDICTED: uncharacterized protein LOC105132...    509   1e-172   
ref|XP_002319702.2|  myb family transcription factor family protein     507   7e-172   Populus trichocarpa [western balsam poplar]
ref|XP_002525443.1|  transcription factor, putative                     506   7e-172   Ricinus communis
ref|XP_007030696.1|  Homeodomain-like superfamily protein isoform 1     509   7e-172   
ref|XP_011034347.1|  PREDICTED: uncharacterized protein LOC105132...    506   2e-171   
ref|XP_011094327.1|  PREDICTED: uncharacterized protein LOC105174060    504   3e-171   
gb|KDP20269.1|  hypothetical protein JCGZ_06855                         503   1e-170   
ref|XP_011034348.1|  PREDICTED: uncharacterized protein LOC105132...    502   4e-170   
ref|XP_002325408.2|  myb family transcription factor family protein     497   4e-168   Populus trichocarpa [western balsam poplar]
ref|XP_002282324.1|  PREDICTED: uncharacterized protein LOC100248614    494   6e-167   Vitis vinifera
gb|KDO55093.1|  hypothetical protein CISIN_1g013552mg                   486   4e-164   
gb|KDO55095.1|  hypothetical protein CISIN_1g013552mg                   486   7e-164   
ref|XP_006443380.1|  hypothetical protein CICLE_v10020171mg             485   1e-163   
ref|XP_011011687.1|  PREDICTED: uncharacterized protein LOC105116...    479   2e-161   
ref|XP_011011689.1|  PREDICTED: uncharacterized protein LOC105116...    476   6e-160   
ref|XP_006443379.1|  hypothetical protein CICLE_v10020171mg             476   1e-159   
ref|XP_011011690.1|  PREDICTED: uncharacterized protein LOC105116...    473   4e-159   
ref|XP_008240441.1|  PREDICTED: uncharacterized protein LOC103338947    471   1e-157   
ref|XP_003540247.1|  PREDICTED: uncharacterized protein LOC100810396    460   9e-154   
ref|XP_010036186.1|  PREDICTED: uncharacterized protein LOC104425...    457   1e-152   
gb|KCW47730.1|  hypothetical protein EUGRSUZ_K01476                     449   2e-149   
ref|XP_010036188.1|  PREDICTED: uncharacterized protein LOC104425...    443   3e-147   
ref|XP_007202959.1|  hypothetical protein PRUPE_ppa015076mg             440   7e-146   
ref|XP_010257717.1|  PREDICTED: uncharacterized protein LOC104597...    438   3e-145   
ref|XP_007150070.1|  hypothetical protein PHAVU_005G123900g             438   9e-145   
ref|XP_010257718.1|  PREDICTED: uncharacterized protein LOC104597...    437   9e-145   
ref|XP_007132437.1|  hypothetical protein PHAVU_011G094300g             435   3e-144   
gb|KHN32876.1|  Myb family transcription factor APL                     433   2e-143   
gb|EYU38638.1|  hypothetical protein MIMGU_mgv1a008175mg                428   8e-142   
ref|XP_004288533.1|  PREDICTED: uncharacterized protein LOC101304811    426   1e-140   
ref|XP_010276422.1|  PREDICTED: uncharacterized protein LOC104611172    426   3e-140   
ref|XP_003539830.1|  PREDICTED: uncharacterized protein LOC100805...    423   2e-139   
gb|KHN21148.1|  Myb family transcription factor APL                     419   7e-138   
ref|XP_009366424.1|  PREDICTED: uncharacterized protein LOC103956...    414   3e-135   
ref|XP_010528768.1|  PREDICTED: uncharacterized protein LOC104805787    411   7e-135   
ref|XP_009366423.1|  PREDICTED: uncharacterized protein LOC103956...    413   1e-134   
ref|XP_008360528.1|  PREDICTED: uncharacterized protein LOC103424216    411   3e-134   
ref|XP_008386803.1|  PREDICTED: uncharacterized protein LOC103449...    411   4e-134   
ref|XP_008386804.1|  PREDICTED: uncharacterized protein LOC103449...    411   4e-134   
ref|XP_009353160.1|  PREDICTED: uncharacterized protein LOC103944419    407   2e-132   
gb|KHG01106.1|  Myb family transcription factor APL                     400   5e-131   
ref|XP_010558713.1|  PREDICTED: uncharacterized protein LOC104827...    398   1e-129   
ref|XP_006599432.1|  PREDICTED: uncharacterized protein LOC100789...    395   2e-128   
gb|EYU35496.1|  hypothetical protein MIMGU_mgv1a025925mg                393   8e-128   
ref|XP_006574748.1|  PREDICTED: uncharacterized protein LOC100786...    392   2e-127   
ref|XP_006599431.1|  PREDICTED: uncharacterized protein LOC100789...    390   1e-126   
ref|XP_006599430.1|  PREDICTED: uncharacterized protein LOC100789...    390   1e-126   
ref|XP_010558714.1|  PREDICTED: uncharacterized protein LOC104827...    389   3e-126   
ref|XP_010672723.1|  PREDICTED: uncharacterized protein LOC104889...    387   6e-126   
ref|XP_006574747.1|  PREDICTED: uncharacterized protein LOC100786...    388   1e-125   
ref|XP_010938143.1|  PREDICTED: uncharacterized protein LOC105057276    388   1e-125   
ref|NP_197325.1|  myb-related protein 1                                 387   2e-125   Arabidopsis thaliana [mouse-ear cress]
gb|AAO30084.1|  transfactor-like protein                                386   3e-125   Arabidopsis thaliana [mouse-ear cress]
gb|AAK68818.1|  transfactor-like protein                                386   4e-125   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006599429.1|  PREDICTED: uncharacterized protein LOC100789...    386   6e-125   
ref|XP_003539165.1|  PREDICTED: uncharacterized protein LOC100781878    386   7e-125   
ref|XP_003596817.1|  Two-component response regulator ARR18             384   3e-124   
ref|XP_010672722.1|  PREDICTED: uncharacterized protein LOC104889...    383   5e-124   
ref|XP_006287896.1|  hypothetical protein CARUB_v10001129mg             382   1e-123   
ref|XP_010492826.1|  PREDICTED: uncharacterized protein LOC104770...    381   6e-123   
ref|XP_010558715.1|  PREDICTED: uncharacterized protein LOC104827...    379   2e-122   
ref|NP_974799.1|  myb-related protein 1                                 378   6e-122   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010921323.1|  PREDICTED: uncharacterized protein LOC105044924    379   6e-122   
ref|XP_010104961.1|  Myb family transcription factor APL                379   8e-122   
ref|XP_008793331.1|  PREDICTED: uncharacterized protein LOC103709...    378   1e-121   
ref|XP_010454048.1|  PREDICTED: uncharacterized protein LOC104735...    377   1e-121   
ref|XP_007151824.1|  hypothetical protein PHAVU_004G078200g             377   1e-121   
ref|XP_009120994.1|  PREDICTED: myb family transcription factor A...    377   2e-121   
ref|XP_010420567.1|  PREDICTED: uncharacterized protein LOC104706...    377   2e-121   
ref|XP_010485773.1|  PREDICTED: uncharacterized protein LOC104764039    377   2e-121   
ref|XP_010463875.1|  PREDICTED: uncharacterized protein LOC104744...    376   4e-121   
ref|XP_002873879.1|  hypothetical protein ARALYDRAFT_488696             375   7e-121   
ref|NP_001118567.1|  myb family transcription factor                    375   1e-120   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010492827.1|  PREDICTED: uncharacterized protein LOC104770...    372   1e-119   
ref|XP_010517765.1|  PREDICTED: uncharacterized protein LOC104793...    371   4e-119   
ref|XP_006297889.1|  hypothetical protein CARUB_v10013932mg             369   1e-118   
emb|CDY54047.1|  BnaC09g54190D                                          368   4e-118   
ref|NP_850842.1|  myb-related protein 1                                 368   4e-118   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010672721.1|  PREDICTED: uncharacterized protein LOC104889...    369   4e-118   
ref|XP_009120996.1|  PREDICTED: myb family transcription factor A...    367   5e-118   
ref|XP_002884424.1|  predicted protein                                  367   5e-118   
ref|XP_010420569.1|  PREDICTED: uncharacterized protein LOC104706...    368   6e-118   
ref|NP_974216.1|  myb family transcription factor                       366   1e-117   Arabidopsis thaliana [mouse-ear cress]
gb|ADO32622.1|  myb family transcription factor                         365   4e-117   
ref|XP_006400372.1|  hypothetical protein EUTSA_v10013729mg             365   6e-117   
ref|XP_009130413.1|  PREDICTED: two-component response regulator ...    364   9e-117   
ref|XP_010672720.1|  PREDICTED: uncharacterized protein LOC104889...    364   2e-116   
ref|XP_006287895.1|  hypothetical protein CARUB_v10001129mg             363   3e-116   
ref|XP_010492828.1|  PREDICTED: two-component response regulator ...    362   1e-115   
emb|CDY42899.1|  BnaC05g47520D                                          359   3e-115   
emb|CDY66489.1|  BnaA01g37390D                                          360   4e-115   
ref|XP_004487497.1|  PREDICTED: uncharacterized protein LOC101506...    360   5e-115   
ref|XP_010931456.1|  PREDICTED: uncharacterized protein LOC105052369    361   5e-115   
gb|KDO55098.1|  hypothetical protein CISIN_1g013552mg                   357   6e-115   
ref|XP_004487498.1|  PREDICTED: uncharacterized protein LOC101506...    359   2e-114   
ref|XP_009102100.1|  PREDICTED: uncharacterized protein LOC103828237    358   2e-114   
ref|XP_010454050.1|  PREDICTED: uncharacterized protein LOC104735...    358   3e-114   
ref|XP_009120997.1|  PREDICTED: myb family transcription factor A...    357   3e-114   
ref|XP_010420570.1|  PREDICTED: uncharacterized protein LOC104706...    358   4e-114   
ref|XP_010463876.1|  PREDICTED: uncharacterized protein LOC104744...    357   1e-113   
ref|XP_006408230.1|  hypothetical protein EUTSA_v10020861mg             357   1e-113   
ref|NP_187053.2|  myb family transcription factor                       356   1e-113   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009130414.1|  PREDICTED: two-component response regulator ...    355   3e-113   
emb|CDY50877.1|  BnaA05g37380D                                          353   8e-113   
ref|XP_006829830.1|  hypothetical protein AMTR_s00119p00095480          353   2e-112   
ref|XP_010517842.1|  PREDICTED: uncharacterized protein LOC104793...    352   1e-111   
ref|XP_009406834.1|  PREDICTED: uncharacterized protein LOC103989...    348   4e-110   
dbj|BAJ34163.1|  unnamed protein product                                345   2e-109   
ref|XP_009130415.1|  PREDICTED: uncharacterized protein LOC103855...    345   2e-109   
emb|CDY66978.1|  BnaCnng52990D                                          344   3e-109   
ref|XP_009406832.1|  PREDICTED: uncharacterized protein LOC103989...    345   7e-109   
gb|KCW47731.1|  hypothetical protein EUGRSUZ_K01476                     338   2e-107   
emb|CBI29923.3|  unnamed protein product                                337   3e-107   
ref|XP_009380592.1|  PREDICTED: uncharacterized protein LOC103968...    339   5e-107   
ref|XP_008807359.1|  PREDICTED: probable transcription factor KAN...    337   6e-107   
ref|XP_009380600.1|  PREDICTED: uncharacterized protein LOC103968...    338   1e-106   
ref|XP_008792509.1|  PREDICTED: uncharacterized protein LOC103709092    338   3e-106   
ref|XP_009400147.1|  PREDICTED: uncharacterized protein LOC103984394    364   3e-106   
ref|XP_010524965.1|  PREDICTED: uncharacterized protein LOC104802...    335   1e-105   
ref|XP_010054431.1|  PREDICTED: myb family transcription factor A...    332   1e-104   
gb|KEH25609.1|  myb-like transcription factor family protein            333   2e-104   
ref|XP_010524967.1|  PREDICTED: uncharacterized protein LOC104802...    332   2e-104   
ref|XP_004489714.1|  PREDICTED: uncharacterized protein LOC101512...    330   3e-103   
ref|XP_010054416.1|  PREDICTED: myb family transcription factor A...    328   6e-103   
ref|XP_004489716.1|  PREDICTED: uncharacterized protein LOC101512...    328   9e-103   
ref|XP_010922889.1|  PREDICTED: uncharacterized protein LOC105046091    328   2e-102   
ref|XP_008465332.1|  PREDICTED: chromatin modification-related pr...    327   2e-102   
ref|XP_009414233.1|  PREDICTED: uncharacterized protein LOC103995...    327   5e-102   
ref|XP_010524966.1|  PREDICTED: uncharacterized protein LOC104802...    325   2e-101   
ref|XP_004141144.1|  PREDICTED: uncharacterized protein LOC101206445    324   2e-101   
ref|XP_009414234.1|  PREDICTED: uncharacterized protein LOC103995...    325   3e-101   
ref|XP_004489717.1|  PREDICTED: uncharacterized protein LOC101512...    323   6e-101   
ref|XP_008465330.1|  PREDICTED: uncharacterized protein LOC103502...    324   7e-101   
gb|KGN59767.1|  hypothetical protein Csa_3G844850                       322   1e-100   
ref|XP_009416347.1|  PREDICTED: uncharacterized protein LOC103996...    318   4e-99    
ref|XP_002467933.1|  hypothetical protein SORBIDRAFT_01g036680          316   1e-98    Sorghum bicolor [broomcorn]
ref|XP_006654563.1|  PREDICTED: uncharacterized protein LOC102706...    317   3e-98    
ref|XP_004984520.1|  PREDICTED: uncharacterized protein LOC101781...    313   2e-97    
ref|XP_009416343.1|  PREDICTED: uncharacterized protein LOC103996...    313   3e-97    
ref|XP_009406837.1|  PREDICTED: protein PHR1-LIKE 1-like isoform X4     313   3e-97    
tpg|DAA45112.1|  TPA: putative MYB DNA-binding domain superfamily...    311   8e-97    
ref|XP_008655182.1|  PREDICTED: myb family transcription factor A...    311   1e-96    
ref|NP_001049984.1|  Os03g0325500                                       310   2e-96    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009406836.1|  PREDICTED: protein PHR1-LIKE 1-like isoform X3     310   7e-96    
ref|XP_006443378.1|  hypothetical protein CICLE_v10020171mg             306   9e-96    
ref|XP_008656404.1|  PREDICTED: uncharacterized protein LOC103635802    310   1e-95    
gb|EAY89836.1|  hypothetical protein OsI_11384                          310   1e-95    Oryza sativa Indica Group [Indian rice]
gb|KDO55099.1|  hypothetical protein CISIN_1g013552mg                   302   2e-94    
ref|XP_004961696.1|  PREDICTED: uncharacterized protein LOC101755...    306   4e-94    
ref|XP_004984519.1|  PREDICTED: uncharacterized protein LOC101781...    305   4e-94    
ref|XP_003568222.1|  PREDICTED: uncharacterized protein LOC100842130    305   1e-93    
ref|XP_002441286.1|  hypothetical protein SORBIDRAFT_09g023830          303   3e-93    Sorghum bicolor [broomcorn]
ref|XP_006650017.1|  PREDICTED: myb family transcription factor A...    301   5e-93    
ref|XP_008649803.1|  PREDICTED: uncharacterized protein LOC103630521    303   1e-92    
gb|AFW82346.1|  putative MYB DNA-binding domain superfamily protein     301   2e-92    
ref|XP_003558005.1|  PREDICTED: uncharacterized protein LOC100837299    297   2e-91    
gb|EEE64175.1|  hypothetical protein OsJ_19007                          299   2e-91    Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ98170.1|  predicted protein                                      290   8e-89    
ref|NP_001055886.1|  Os05g0488600                                       287   7e-87    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004489718.1|  PREDICTED: uncharacterized protein LOC101512...    284   3e-86    
gb|EPS73715.1|  hypothetical protein M569_01040                         276   1e-85    
ref|XP_006297891.1|  hypothetical protein CARUB_v10013932mg             278   3e-84    
ref|XP_009416349.1|  PREDICTED: uncharacterized protein LOC103996...    278   4e-84    
ref|XP_009416348.1|  PREDICTED: protein PHR1-LIKE 1-like isoform X3     278   5e-84    
ref|XP_004958726.1|  PREDICTED: myb family transcription factor A...    270   6e-81    
ref|XP_008793334.1|  PREDICTED: uncharacterized protein LOC103709...    267   4e-80    
gb|EMS63697.1|  Myb family transcription factor APL                     263   3e-78    
ref|XP_006297890.1|  hypothetical protein CARUB_v10013932mg             258   5e-77    
gb|EMT31949.1|  Myb family transcription factor APL                     260   1e-76    
gb|ACN39843.1|  unknown                                                 249   2e-72    Picea sitchensis
ref|XP_002463407.1|  hypothetical protein SORBIDRAFT_02g043320          246   8e-72    Sorghum bicolor [broomcorn]
ref|XP_009416351.1|  PREDICTED: uncharacterized protein LOC103996...    240   8e-70    
ref|XP_010524968.1|  PREDICTED: uncharacterized protein LOC104802...    238   2e-69    
ref|XP_008781220.1|  PREDICTED: uncharacterized protein LOC103701...    238   4e-69    
gb|ACU20177.1|  unknown                                                 232   1e-68    Glycine max [soybeans]
ref|XP_008781221.1|  PREDICTED: uncharacterized protein LOC103701...    236   2e-68    
ref|NP_001060674.1|  Os07g0685300                                       236   2e-68    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010257629.1|  PREDICTED: uncharacterized protein LOC104597...    236   5e-68    
ref|XP_009416350.1|  PREDICTED: uncharacterized protein LOC103996...    235   6e-68    
dbj|BAC83815.1|  transfactor-like protein                               235   9e-68    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010257647.1|  PREDICTED: uncharacterized protein LOC104597...    234   3e-67    
ref|XP_009414235.1|  PREDICTED: uncharacterized protein LOC103995...    233   3e-67    
gb|EEC82707.1|  hypothetical protein OsI_27377                          232   9e-67    Oryza sativa Indica Group [Indian rice]
ref|XP_010939806.1|  PREDICTED: uncharacterized protein LOC105058...    231   1e-66    
ref|XP_010939808.1|  PREDICTED: myb family transcription factor A...    230   2e-66    
ref|XP_008802582.1|  PREDICTED: myb family transcription factor A...    230   2e-66    
ref|XP_008802581.1|  PREDICTED: myb family transcription factor A...    230   2e-66    
ref|XP_006658148.1|  PREDICTED: myb family transcription factor A...    231   3e-66    
ref|XP_010241363.1|  PREDICTED: myb family transcription factor A...    229   3e-66    
ref|XP_010241364.1|  PREDICTED: myb family transcription factor A...    229   6e-66    
ref|XP_010257637.1|  PREDICTED: uncharacterized protein LOC104597...    228   7e-65    
ref|XP_009416352.1|  PREDICTED: uncharacterized protein LOC103996...    225   1e-64    
ref|XP_010939807.1|  PREDICTED: uncharacterized protein LOC105058...    222   2e-63    
ref|XP_010264110.1|  PREDICTED: myb family transcription factor A...    222   3e-63    
ref|XP_008802584.1|  PREDICTED: myb family transcription factor A...    221   3e-63    
emb|CDO99459.1|  unnamed protein product                                222   4e-63    
ref|XP_002323774.2|  myb family transcription factor family protein     221   7e-63    Populus trichocarpa [western balsam poplar]
gb|KHG14403.1|  Myb family transcription factor APL                     220   1e-62    
ref|XP_010066903.1|  PREDICTED: myb family transcription factor APL     221   1e-62    
ref|XP_008802586.1|  PREDICTED: myb family transcription factor A...    216   1e-62    
ref|XP_011017283.1|  PREDICTED: uncharacterized protein LOC105120679    220   1e-62    
ref|XP_006369801.1|  hypothetical protein POPTR_0001s32200g             219   3e-62    
gb|KCW64949.1|  hypothetical protein EUGRSUZ_G02494                     220   3e-62    
ref|XP_011045654.1|  PREDICTED: myb family transcription factor APL     218   5e-62    
ref|XP_008339891.1|  PREDICTED: protein PHR1-LIKE 1-like                219   6e-62    
gb|KHG25334.1|  Myb family transcription factor APL                     218   6e-62    
ref|XP_008783889.1|  PREDICTED: myb family transcription factor A...    218   7e-62    
ref|XP_006840145.1|  hypothetical protein AMTR_s00089p00057120          217   8e-62    
ref|XP_008802585.1|  PREDICTED: myb family transcription factor A...    217   9e-62    
ref|XP_002300173.2|  myb family transcription factor family protein     218   1e-61    Populus trichocarpa [western balsam poplar]
ref|XP_006493809.1|  PREDICTED: myb family transcription factor A...    217   2e-61    
gb|KDO61174.1|  hypothetical protein CISIN_1g021481mg                   217   2e-61    
ref|XP_002518104.1|  transcription factor, putative                     216   3e-61    Ricinus communis
ref|XP_010264109.1|  PREDICTED: myb family transcription factor A...    217   3e-61    
ref|XP_010233783.1|  PREDICTED: myb family transcription factor A...    216   5e-61    
ref|XP_011041879.1|  PREDICTED: myb family transcription factor A...    216   6e-61    
gb|KDO82944.1|  hypothetical protein CISIN_1g017978mg                   216   1e-60    
ref|XP_010054436.1|  PREDICTED: myb family transcription factor A...    214   1e-60    
ref|XP_007158649.1|  hypothetical protein PHAVU_002G170700g             216   1e-60    
ref|XP_010937171.1|  PREDICTED: myb family transcription factor A...    214   1e-60    
ref|XP_010937169.1|  PREDICTED: myb family transcription factor A...    214   2e-60    
gb|KDO82943.1|  hypothetical protein CISIN_1g017978mg                   216   2e-60    
ref|XP_010108678.1|  Myb family transcription factor APL                215   3e-60    
ref|XP_011013317.1|  PREDICTED: uncharacterized protein LOC105117364    214   5e-60    
gb|KDO82946.1|  hypothetical protein CISIN_1g017978mg                   214   6e-60    
ref|XP_011070990.1|  PREDICTED: uncharacterized protein LOC105156531    214   6e-60    
ref|XP_006438708.1|  hypothetical protein CICLE_v10031937mg             214   7e-60    
gb|KDO82945.1|  hypothetical protein CISIN_1g017978mg                   214   7e-60    
ref|XP_006850876.1|  hypothetical protein AMTR_s00025p00151950          210   2e-59    
gb|KDP41211.1|  hypothetical protein JCGZ_15618                         212   4e-59    
ref|XP_011091432.1|  PREDICTED: myb family transcription factor A...    209   9e-59    
ref|XP_008221605.1|  PREDICTED: uncharacterized protein LOC103321568    210   1e-58    
ref|XP_008783899.1|  PREDICTED: myb family transcription factor A...    208   2e-58    
ref|XP_008389459.1|  PREDICTED: uncharacterized protein LOC103451811    210   2e-58    
ref|XP_011075513.1|  PREDICTED: myb family transcription factor A...    210   3e-58    
ref|XP_006483141.1|  PREDICTED: uncharacterized protein LOC102612...    210   3e-58    
ref|XP_002522449.1|  transcription factor, putative                     209   4e-58    Ricinus communis
ref|XP_009801782.1|  PREDICTED: myb family transcription factor A...    207   4e-58    
ref|NP_001170326.1|  uncharacterized protein LOC100384296               210   4e-58    Zea mays [maize]
ref|XP_008807361.1|  PREDICTED: myb family transcription factor A...    204   5e-58    
ref|XP_009619229.1|  PREDICTED: myb family transcription factor A...    207   5e-58    
gb|KHG22985.1|  Myb family transcription factor APL                     207   6e-58    
ref|XP_009360327.1|  PREDICTED: uncharacterized protein LOC103950809    208   7e-58    
ref|XP_009374598.1|  PREDICTED: myb family transcription factor A...    207   7e-58    
gb|ACU17918.1|  unknown                                                 202   9e-58    Glycine max [soybeans]
gb|KHG08424.1|  Myb family transcription factor APL                     205   1e-57    
gb|KHG08425.1|  Myb family transcription factor APL                     205   1e-57    
ref|XP_010470952.1|  PREDICTED: uncharacterized protein LOC104750...    208   1e-57    
ref|XP_006414868.1|  hypothetical protein EUTSA_v10025876mg             206   1e-57    
emb|CCA29095.1|  putative MYB transcription factor                      207   1e-57    
dbj|BAJ93802.1|  predicted protein                                      208   1e-57    
ref|XP_004299108.1|  PREDICTED: uncharacterized protein LOC101302357    206   1e-57    
tpg|DAA64172.1|  TPA: putative MYB DNA-binding domain superfamily...    208   1e-57    
gb|KDO82947.1|  hypothetical protein CISIN_1g017978mg                   208   2e-57    
ref|XP_010550833.1|  PREDICTED: myb family transcription factor A...    206   2e-57    
ref|XP_006483139.1|  PREDICTED: uncharacterized protein LOC102612...    208   2e-57    
gb|EYU22410.1|  hypothetical protein MIMGU_mgv1a010781mg                206   2e-57    
ref|XP_006483140.1|  PREDICTED: uncharacterized protein LOC102612...    207   2e-57    
ref|XP_010937170.1|  PREDICTED: myb family transcription factor A...    206   3e-57    
ref|XP_002312250.2|  hypothetical protein POPTR_0008s08720g             206   3e-57    
ref|XP_010651406.1|  PREDICTED: myb family transcription factor A...    204   3e-57    
ref|XP_007046068.1|  Homeodomain-like superfamily protein isoform 1     207   3e-57    
ref|XP_008380567.1|  PREDICTED: myb family transcription factor A...    205   3e-57    
ref|NP_001280781.1|  myb family transcription factor APL                205   4e-57    
ref|XP_010415613.1|  PREDICTED: uncharacterized protein LOC104701...    206   4e-57    
ref|XP_010470951.1|  PREDICTED: uncharacterized protein LOC104750...    206   4e-57    
ref|XP_010415609.1|  PREDICTED: uncharacterized protein LOC104701...    206   4e-57    
ref|XP_009416353.1|  PREDICTED: protein PHR1-LIKE 1-like isoform X8     205   5e-57    
ref|XP_011091431.1|  PREDICTED: myb family transcription factor A...    204   6e-57    
ref|XP_003517998.2|  PREDICTED: uncharacterized protein LOC100784...    206   8e-57    
ref|XP_010107775.1|  Myb family transcription factor APL                204   1e-56    
ref|XP_010264406.1|  PREDICTED: myb family transcription factor A...    202   1e-56    
gb|KHN28253.1|  Myb family transcription factor APL                     205   1e-56    
ref|XP_009794235.1|  PREDICTED: myb family transcription factor A...    204   1e-56    
ref|XP_007157612.1|  hypothetical protein PHAVU_002G084100g             205   1e-56    
gb|EMT16442.1|  Myb family transcription factor APL                     208   1e-56    
ref|XP_010650358.1|  PREDICTED: uncharacterized protein LOC100250...    205   1e-56    
ref|XP_003556805.1|  PREDICTED: uncharacterized protein LOC100805252    205   1e-56    
ref|XP_002268698.3|  PREDICTED: uncharacterized protein LOC100250...    205   1e-56    
ref|XP_010550246.1|  PREDICTED: uncharacterized protein LOC104821144    203   2e-56    
ref|XP_010415611.1|  PREDICTED: uncharacterized protein LOC104701...    204   2e-56    
ref|XP_008224497.1|  PREDICTED: myb family transcription factor APL     204   2e-56    
gb|KGN56735.1|  hypothetical protein Csa_3G130900                       203   2e-56    
ref|XP_002315046.1|  myb family transcription factor family protein     204   3e-56    
ref|XP_004157675.1|  PREDICTED: uncharacterized protein LOC101223852    203   3e-56    
ref|XP_009794236.1|  PREDICTED: myb family transcription factor A...    202   3e-56    
emb|CDY46334.1|  BnaC01g30360D                                          202   4e-56    
ref|XP_010651953.1|  PREDICTED: uncharacterized protein LOC100255052    204   4e-56    
ref|XP_008438354.1|  PREDICTED: myb family transcription factor A...    203   4e-56    
ref|XP_004133994.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    203   4e-56    
ref|XP_010470954.1|  PREDICTED: uncharacterized protein LOC104750...    203   4e-56    
ref|XP_010512004.1|  PREDICTED: uncharacterized protein LOC104788...    203   5e-56    
emb|CBI31947.3|  unnamed protein product                                202   6e-56    
ref|XP_009794233.1|  PREDICTED: myb family transcription factor A...    202   6e-56    
ref|XP_010069038.1|  PREDICTED: myb family transcription factor A...    202   7e-56    
ref|NP_001077798.1|  homeodomain-like superfamily protein               203   8e-56    
ref|XP_009794234.1|  PREDICTED: myb family transcription factor A...    201   9e-56    
ref|XP_009777109.1|  PREDICTED: uncharacterized protein LOC104226747    202   1e-55    
ref|XP_010551440.1|  PREDICTED: uncharacterized protein LOC104822...    201   1e-55    
ref|XP_006284217.1|  hypothetical protein CARUB_v10005375mg             201   1e-55    
ref|XP_006414870.1|  hypothetical protein EUTSA_v10025876mg             201   1e-55    
emb|CDY18073.1|  BnaA01g23340D                                          201   1e-55    
ref|XP_010470953.1|  PREDICTED: uncharacterized protein LOC104750...    202   1e-55    
ref|XP_008438355.1|  PREDICTED: myb family transcription factor A...    201   1e-55    
ref|XP_010415610.1|  PREDICTED: uncharacterized protein LOC104701...    202   2e-55    
ref|XP_010415615.1|  PREDICTED: uncharacterized protein LOC104701...    202   2e-55    
ref|NP_566744.1|  myb family transcription factor                       201   2e-55    
ref|XP_006366846.1|  PREDICTED: myb family transcription factor A...    200   2e-55    
gb|EMS59849.1|  Myb family transcription factor APL                     203   2e-55    
ref|XP_010512002.1|  PREDICTED: uncharacterized protein LOC104788...    202   2e-55    
ref|XP_010551441.1|  PREDICTED: uncharacterized protein LOC104822...    201   2e-55    
ref|XP_003529477.1|  PREDICTED: uncharacterized protein LOC100776601    201   2e-55    
ref|XP_002887244.1|  hypothetical protein ARALYDRAFT_476093             201   3e-55    
emb|CDY18741.1|  BnaC08g08750D                                          199   3e-55    
ref|XP_009625308.1|  PREDICTED: myb family transcription factor A...    200   3e-55    
gb|KDP39373.1|  hypothetical protein JCGZ_01130                         200   4e-55    
ref|XP_009127744.1|  PREDICTED: protein PHR1-LIKE 1-like                201   4e-55    
ref|NP_567408.1|  unfertilized embryo sac 16 protein / transcript...    199   4e-55    
emb|CDY44077.1|  BnaA02g14410D                                          200   5e-55    
gb|KHN28146.1|  Myb family transcription factor APL                     200   5e-55    
gb|KFK39710.1|  hypothetical protein AALP_AA3G278400                    199   5e-55    
ref|XP_001754451.1|  predicted protein                                  199   6e-55    
ref|XP_006302512.1|  hypothetical protein CARUB_v10020610mg             200   6e-55    
ref|XP_010415614.1|  PREDICTED: uncharacterized protein LOC104701...    201   6e-55    
gb|AAF24605.1|AC021046_3  transfactor, putative; 28697-27224            200   6e-55    
ref|NP_177117.2|  homeodomain-like superfamily protein                  200   6e-55    
emb|CDY28564.1|  BnaC02g19330D                                          200   7e-55    
gb|KFK36254.1|  hypothetical protein AALP_AA4G098000                    199   7e-55    
ref|XP_004138915.1|  PREDICTED: myb family transcription factor A...    198   8e-55    
ref|XP_009625307.1|  PREDICTED: myb family transcription factor A...    198   1e-54    
ref|XP_008441712.1|  PREDICTED: myb family transcription factor APL     198   1e-54    
ref|XP_004505417.1|  PREDICTED: protein PHR1-LIKE 1-like                199   1e-54    
ref|XP_004247854.1|  PREDICTED: myb family transcription factor A...    198   1e-54    
ref|XP_010069039.1|  PREDICTED: myb family transcription factor A...    199   2e-54    
gb|EYU28769.1|  hypothetical protein MIMGU_mgv1a009784mg                199   2e-54    
ref|XP_009106171.1|  PREDICTED: myb family transcription factor A...    197   2e-54    
ref|XP_004490075.1|  PREDICTED: putative two-component response r...    199   3e-54    
gb|AFK39380.1|  unknown                                                 193   3e-54    
gb|EMS44985.1|  Myb family transcription factor APL                     196   3e-54    
ref|XP_004490073.1|  PREDICTED: putative two-component response r...    199   3e-54    
ref|XP_009105513.1|  PREDICTED: protein PHR1-LIKE 1-like isoform X2     198   4e-54    
gb|AFK49254.1|  unknown                                                 198   5e-54    
gb|AES89913.2|  myb-like transcription factor family protein            198   5e-54    
ref|XP_003607716.1|  Two-component response regulator ARR1              197   5e-54    
ref|XP_009105512.1|  PREDICTED: protein PHR1-LIKE 1-like isoform X1     197   5e-54    
ref|XP_009135873.1|  PREDICTED: myb family transcription factor A...    196   5e-54    
ref|XP_006573113.1|  PREDICTED: uncharacterized protein LOC100784...    197   7e-54    
ref|XP_006349928.1|  PREDICTED: myb family transcription factor A...    196   7e-54    
emb|CDX94845.1|  BnaC03g43430D                                          196   7e-54    
ref|XP_010914284.1|  PREDICTED: myb family transcription factor A...    198   7e-54    
ref|XP_004297295.1|  PREDICTED: uncharacterized protein LOC101303116    197   7e-54    
ref|XP_009625309.1|  PREDICTED: myb family transcription factor A...    196   9e-54    
ref|XP_006349927.1|  PREDICTED: myb family transcription factor A...    196   1e-53    
emb|CBI17321.3|  unnamed protein product                                193   1e-53    
ref|XP_006284218.1|  hypothetical protein CARUB_v10005375mg             196   1e-53    
ref|XP_003520080.1|  PREDICTED: uncharacterized protein LOC100787178    197   1e-53    
ref|XP_009625310.1|  PREDICTED: myb family transcription factor A...    195   1e-53    
ref|XP_007034375.1|  Homeodomain-like superfamily protein isoform 1     195   2e-53    
ref|XP_010683165.1|  PREDICTED: putative Myb family transcription...    196   2e-53    
ref|NP_974356.1|  myb family transcription factor                       195   2e-53    
gb|ACU23397.1|  unknown                                                 196   2e-53    
ref|XP_002868346.1|  predicted protein                                  194   3e-53    
ref|NP_001031626.1|  unfertilized embryo sac 16 protein / transcr...    194   3e-53    
emb|CDY01765.1|  BnaC06g28050D                                          196   3e-53    
ref|XP_010914281.1|  PREDICTED: myb family transcription factor A...    196   3e-53    
gb|KFK36253.1|  hypothetical protein AALP_AA4G098000                    193   6e-53    
gb|KFK39711.1|  hypothetical protein AALP_AA3G278400                    194   6e-53    
ref|XP_006298939.1|  hypothetical protein CARUB_v10015062mg             193   7e-53    
ref|XP_010069041.1|  PREDICTED: myb family transcription factor A...    194   1e-52    
ref|XP_003613820.1|  Myb family transcription factor APL                195   1e-52    
ref|XP_010435238.1|  PREDICTED: myb family transcription factor A...    192   2e-52    
gb|KFK41381.1|  hypothetical protein AALP_AA2G123100                    194   2e-52    
ref|XP_010941711.1|  PREDICTED: myb family transcription factor A...    194   2e-52    
dbj|BAJ88141.1|  predicted protein                                      192   2e-52    
ref|XP_010645092.1|  PREDICTED: myb family transcription factor A...    194   3e-52    
ref|XP_004252994.1|  PREDICTED: myb family transcription factor A...    192   3e-52    
ref|XP_009106163.1|  PREDICTED: myb family transcription factor A...    192   3e-52    
gb|KHN01239.1|  Myb family transcription factor APL                     194   3e-52    
ref|XP_010532792.1|  PREDICTED: myb family transcription factor A...    192   4e-52    
gb|KDO61532.1|  hypothetical protein CISIN_1g017478mg                   194   4e-52    
ref|XP_006493746.1|  PREDICTED: myb family transcription factor A...    194   4e-52    
dbj|BAK02601.1|  predicted protein                                      193   4e-52    
ref|XP_010466781.1|  PREDICTED: myb family transcription factor A...    191   4e-52    
ref|XP_010908088.1|  PREDICTED: myb family transcription factor A...    191   5e-52    
ref|XP_007149174.1|  hypothetical protein PHAVU_005G047600g             194   5e-52    
ref|XP_010450183.1|  PREDICTED: myb family transcription factor A...    191   5e-52    
ref|XP_004252995.1|  PREDICTED: myb family transcription factor A...    191   5e-52    
ref|XP_006585391.1|  PREDICTED: myb family transcription factor A...    194   5e-52    
gb|KFK41382.1|  hypothetical protein AALP_AA2G123100                    192   5e-52    
ref|XP_010513207.1|  PREDICTED: myb family transcription factor A...    191   6e-52    
ref|XP_010255718.1|  PREDICTED: myb family transcription factor A...    191   7e-52    
ref|XP_010941710.1|  PREDICTED: myb family transcription factor A...    192   8e-52    
ref|XP_009135872.1|  PREDICTED: myb family transcription factor A...    191   8e-52    
ref|XP_010908090.1|  PREDICTED: myb family transcription factor A...    190   1e-51    
ref|XP_010440556.1|  PREDICTED: myb family transcription factor A...    190   1e-51    
ref|XP_006585392.1|  PREDICTED: myb family transcription factor A...    192   1e-51    
gb|AEV91195.1|  MYB-related protein                                     192   1e-51    
ref|XP_010552572.1|  PREDICTED: uncharacterized protein LOC104822910    191   1e-51    
ref|XP_004515302.1|  PREDICTED: two-component response regulator ...    191   2e-51    
ref|XP_010110423.1|  Myb family transcription factor APL                189   2e-51    
ref|XP_009783076.1|  PREDICTED: uncharacterized protein LOC104231721    191   2e-51    
ref|XP_010069042.1|  PREDICTED: myb family transcription factor A...    190   3e-51    
ref|XP_010908091.1|  PREDICTED: myb family transcription factor A...    189   3e-51    
ref|XP_004490074.1|  PREDICTED: putative two-component response r...    191   3e-51    
ref|XP_003570345.2|  PREDICTED: myb family transcription factor A...    191   3e-51    
gb|AHH29589.1|  R1MYB1                                                  189   4e-51    
ref|XP_003560412.1|  PREDICTED: myb family transcription factor A...    190   4e-51    
emb|CAB36828.1|  putative protein                                       189   5e-51    
ref|XP_010651404.1|  PREDICTED: myb family transcription factor A...    187   5e-51    
ref|XP_010260756.1|  PREDICTED: myb family transcription factor A...    190   7e-51    
ref|XP_001757346.1|  predicted protein                                  195   9e-51    
ref|XP_004951748.1|  PREDICTED: myb family transcription factor A...    189   1e-50    
ref|XP_006355110.1|  PREDICTED: myb family transcription factor A...    189   1e-50    
ref|XP_002453376.1|  hypothetical protein SORBIDRAFT_04g004930          189   2e-50    
ref|XP_008645294.1|  PREDICTED: myb family transcription factor A...    189   2e-50    
ref|XP_011095765.1|  PREDICTED: myb family transcription factor A...    189   2e-50    
ref|XP_006598222.1|  PREDICTED: myb family transcription factor A...    189   2e-50    
ref|XP_008447069.1|  PREDICTED: myb family transcription factor A...    189   2e-50    
ref|NP_001183627.1|  uncharacterized protein LOC100502221               186   2e-50    
gb|AFQ69085.1|  APL                                                     182   2e-50    
emb|CAN77686.1|  hypothetical protein VITISV_002732                     185   2e-50    
emb|CDY07343.1|  BnaA07g24220D                                          187   3e-50    
ref|XP_010260754.1|  PREDICTED: myb family transcription factor A...    189   3e-50    
ref|XP_010651405.1|  PREDICTED: myb family transcription factor A...    186   3e-50    
ref|XP_010683575.1|  PREDICTED: myb family transcription factor A...    189   3e-50    
ref|XP_010648220.1|  PREDICTED: myb family transcription factor A...    185   4e-50    
ref|XP_007022785.1|  Homeodomain-like superfamily protein isoform 2     188   4e-50    
ref|XP_010532791.1|  PREDICTED: myb family transcription factor A...    187   4e-50    
ref|XP_004238822.1|  PREDICTED: uncharacterized protein LOC101248294    187   4e-50    
ref|XP_011095764.1|  PREDICTED: myb family transcription factor A...    188   4e-50    
ref|XP_006598223.1|  PREDICTED: myb family transcription factor A...    188   5e-50    
ref|XP_010450182.1|  PREDICTED: myb family transcription factor A...    186   5e-50    
ref|XP_010683574.1|  PREDICTED: myb family transcription factor A...    189   5e-50    
ref|XP_010466780.1|  PREDICTED: myb family transcription factor A...    186   6e-50    
gb|KHN12199.1|  Myb family transcription factor APL                     187   7e-50    
ref|XP_010513201.1|  PREDICTED: myb family transcription factor A...    185   7e-50    
gb|EMT04645.1|  Myb family transcription factor APL                     186   7e-50    
ref|XP_006418805.1|  hypothetical protein EUTSA_v10002625mg             185   8e-50    
ref|XP_004953575.1|  PREDICTED: myb family transcription factor A...    184   9e-50    
ref|XP_002454431.1|  hypothetical protein SORBIDRAFT_04g030830          184   9e-50    
ref|XP_010092480.1|  Myb family transcription factor APL                187   9e-50    
ref|XP_009347087.1|  PREDICTED: myb family transcription factor APL     185   9e-50    
ref|XP_006833019.1|  hypothetical protein AMTR_s00094p00028710          184   1e-49    
ref|XP_010440555.1|  PREDICTED: myb family transcription factor A...    184   1e-49    
ref|XP_010537819.1|  PREDICTED: myb family transcription factor A...    187   2e-49    
ref|XP_010648219.1|  PREDICTED: myb family transcription factor A...    183   2e-49    
ref|XP_009414489.1|  PREDICTED: myb family transcription factor A...    186   2e-49    
gb|EMS60802.1|  Myb family transcription factor APL                     185   2e-49    
ref|XP_010648222.1|  PREDICTED: myb family transcription factor A...    183   2e-49    
dbj|BAJ88577.1|  predicted protein                                      186   2e-49    
ref|XP_002312227.1|  WOODY family protein                               186   2e-49    
ref|NP_001046045.2|  Os02g0174000                                       186   2e-49    
dbj|BAB01353.1|  unnamed protein product                                184   3e-49    
ref|XP_002264275.3|  PREDICTED: myb family transcription factor A...    182   3e-49    
ref|XP_002883484.1|  myb family transcription factor                    183   4e-49    
ref|XP_008800016.1|  PREDICTED: myb family transcription factor APL     182   5e-49    
gb|KHG25335.1|  Myb family transcription factor APL                     183   7e-49    
gb|ADQ08683.1|  IPN2                                                    184   7e-49    
ref|XP_008226001.1|  PREDICTED: myb family transcription factor APL     184   7e-49    
ref|XP_007211463.1|  hypothetical protein PRUPE_ppa007417mg             184   8e-49    
ref|XP_006390997.1|  hypothetical protein EUTSA_v10018902mg             183   9e-49    
gb|KHN11849.1|  Myb family transcription factor APL                     181   9e-49    
gb|ACJ84223.1|  unknown                                                 183   1e-48    
gb|EMT09548.1|  Myb family transcription factor APL                     184   1e-48    
ref|XP_010941712.1|  PREDICTED: myb family transcription factor A...    184   1e-48    
ref|XP_004488552.1|  PREDICTED: myb family transcription factor A...    184   1e-48    
ref|XP_008356113.1|  PREDICTED: myb family transcription factor A...    184   1e-48    
gb|KHN48860.1|  Myb family transcription factor APL                     184   1e-48    
ref|XP_009340124.1|  PREDICTED: myb family transcription factor A...    184   1e-48    
ref|XP_006598225.1|  PREDICTED: myb family transcription factor A...    184   1e-48    
ref|XP_006647740.1|  PREDICTED: myb family transcription factor A...    181   1e-48    
ref|XP_004515303.1|  PREDICTED: two-component response regulator ...    183   1e-48    
ref|XP_010918102.1|  PREDICTED: myb family transcription factor APL     181   1e-48    
ref|XP_009340543.1|  PREDICTED: myb family transcription factor A...    184   1e-48    
ref|XP_006587621.1|  PREDICTED: myb family transcription factor A...    181   2e-48    



>ref|XP_009758035.1| PREDICTED: uncharacterized protein LOC104210771 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009758037.1| PREDICTED: uncharacterized protein LOC104210771 isoform X1 [Nicotiana 
sylvestris]
Length=416

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/422 (69%), Positives = 333/422 (79%), Gaps = 16/422 (4%)
 Frame = -2

Query  1632  MYHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVE  1453
             MYHHHRQ KSMHPST M +  ERHLF+QG NG+GDSGLVLSTDAKPRLKWT DLHERF+E
Sbjct  1     MYHHHRQDKSMHPSTRMSIS-ERHLFLQGGNGNGDSGLVLSTDAKPRLKWTPDLHERFIE  59

Query  1452  AVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSS-SNKAMSSGM  1276
             AVNQLGGADKATPKSVLK MGIQGLTLYHLKSHLQKYRLSKNLHG AN+S +NKA+    
Sbjct  60    AVNQLGGADKATPKSVLKLMGIQGLTLYHLKSHLQKYRLSKNLHGQANASGANKAV----  115

Query  1275  DAATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRI  1096
              AATG D+I E +   +++ +IGP  N N+ ISEAIQIQIEVQRRLHEQLEVQRHLQLRI
Sbjct  116   -AATGEDRISENSATCMSNPSIGPQPNKNIQISEAIQIQIEVQRRLHEQLEVQRHLQLRI  174

Query  1095  EAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGF  916
             EAQGKYL AVLEKAQETLGRQD+G +GLEAAK QLSELVS VSNQCLN  FS IKEL  +
Sbjct  175   EAQGKYLHAVLEKAQETLGRQDMGTVGLEAAKVQLSELVSTVSNQCLNPTFSDIKELSRY  234

Query  915   CQQQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQ  736
               QQ QAT+  D S+DSCLTS EGSLRD+ M N+Q+GLR   F   +E  D+ N+TR++Q
Sbjct  235   SNQQTQATRLADRSIDSCLTSCEGSLRDNTMHNNQIGLRPFEFTPSIECEDIENDTRIQQ  294

Query  735   TEFRWCDDIWENRKYLSKMDE--------ETKNNGLSVSTGLQGGKWNGNSNYSDRRFTG  580
             T  RWCD++ E++K  S M+E        ET    LS+S GLQ GK NG+SN+SD +F G
Sbjct  295   TALRWCDNLKESKKLFSAMNEGKEKTFTTETNCKDLSMSIGLQDGKLNGSSNHSDGKFNG  354

Query  579   TDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNGF  400
             TD  V+LF QA +R D S PE+QK+SQEYKL YF PKLDLN  D+TD ASSCKQ DLNGF
Sbjct  355   TDTAVRLFHQAANRGD-SMPERQKSSQEYKLSYFAPKLDLNMHDETDAASSCKQFDLNGF  413

Query  399   SW  394
             SW
Sbjct  414   SW  415



>ref|XP_009758038.1| PREDICTED: uncharacterized protein LOC104210771 isoform X2 [Nicotiana 
sylvestris]
Length=414

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/422 (69%), Positives = 331/422 (78%), Gaps = 18/422 (4%)
 Frame = -2

Query  1632  MYHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVE  1453
             MYHHHRQ KSMHPST M +  ERHLF+QG NG+GDSGLVLSTDAKPRLKWT DLHERF+E
Sbjct  1     MYHHHRQDKSMHPSTRMSIS-ERHLFLQGGNGNGDSGLVLSTDAKPRLKWTPDLHERFIE  59

Query  1452  AVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSS-SNKAMSSGM  1276
             AVNQLGGADKATPKSVLK MGIQGLTLYHLKSHLQKYRLSKNLHG AN+S +NKA     
Sbjct  60    AVNQLGGADKATPKSVLKLMGIQGLTLYHLKSHLQKYRLSKNLHGQANASGANKA-----  114

Query  1275  DAATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRI  1096
               ATG D+I E +   +++ +IGP  N N+ ISEAIQIQIEVQRRLHEQLEVQRHLQLRI
Sbjct  115   --ATGEDRISENSATCMSNPSIGPQPNKNIQISEAIQIQIEVQRRLHEQLEVQRHLQLRI  172

Query  1095  EAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGF  916
             EAQGKYL AVLEKAQETLGRQD+G +GLEAAK QLSELVS VSNQCLN  FS IKEL  +
Sbjct  173   EAQGKYLHAVLEKAQETLGRQDMGTVGLEAAKVQLSELVSTVSNQCLNPTFSDIKELSRY  232

Query  915   CQQQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQ  736
               QQ QAT+  D S+DSCLTS EGSLRD+ M N+Q+GLR   F   +E  D+ N+TR++Q
Sbjct  233   SNQQTQATRLADRSIDSCLTSCEGSLRDNTMHNNQIGLRPFEFTPSIECEDIENDTRIQQ  292

Query  735   TEFRWCDDIWENRKYLSKMDE--------ETKNNGLSVSTGLQGGKWNGNSNYSDRRFTG  580
             T  RWCD++ E++K  S M+E        ET    LS+S GLQ GK NG+SN+SD +F G
Sbjct  293   TALRWCDNLKESKKLFSAMNEGKEKTFTTETNCKDLSMSIGLQDGKLNGSSNHSDGKFNG  352

Query  579   TDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNGF  400
             TD  V+LF QA +R D S PE+QK+SQEYKL YF PKLDLN  D+TD ASSCKQ DLNGF
Sbjct  353   TDTAVRLFHQAANRGD-SMPERQKSSQEYKLSYFAPKLDLNMHDETDAASSCKQFDLNGF  411

Query  399   SW  394
             SW
Sbjct  412   SW  413



>ref|XP_009770705.1| PREDICTED: uncharacterized protein LOC104221350 isoform X2 [Nicotiana 
sylvestris]
Length=413

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/422 (70%), Positives = 329/422 (78%), Gaps = 19/422 (5%)
 Frame = -2

Query  1632  MYHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVE  1453
             MYH H Q  +MHPST M  P ERHLF+QG N +GDSGLVLSTDAKPRLKWT DLHERF+E
Sbjct  1     MYHQHHQTANMHPSTRMSFP-ERHLFLQGGNVNGDSGLVLSTDAKPRLKWTADLHERFIE  59

Query  1452  AVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMD  1273
             AVNQLGGADKATPKSVLK MGIQGLTLYHLKSHLQKYRLSKNLHG AN S       G++
Sbjct  60    AVNQLGGADKATPKSVLKLMGIQGLTLYHLKSHLQKYRLSKNLHGQANIS-------GVN  112

Query  1272  AATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIE  1093
              A G +KI E+ G  ++  +IGP  N N+PI+EAIQ+QIEVQRRLHEQLEVQRHLQLRIE
Sbjct  113   KAAGIEKICESTGTPMSHPSIGPQPNNNIPINEAIQMQIEVQRRLHEQLEVQRHLQLRIE  172

Query  1092  AQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFC  913
             AQGKYLQAVLEKAQETLG Q+LG +GLEAAK QLS+LVSKVSNQCLNSAFS IKEL GF 
Sbjct  173   AQGKYLQAVLEKAQETLGTQNLGTIGLEAAKDQLSDLVSKVSNQCLNSAFSEIKELSGFH  232

Query  912   QQQAQATQPTDCSLDSCLTSSEGSLRD-HEMRNSQMGLRSLNFGAHMESTDLYNETRLKQ  736
               Q QA  P DCS+DSCLTSSE  LRD  EM N+Q+GLR LNFG    + D+ NETRL+Q
Sbjct  233   NPQTQAIPPADCSMDSCLTSSERPLRDLREMHNNQIGLRPLNFGPC--TKDIENETRLQQ  290

Query  735   TEFRWCDDIWENRKYLSKMD--------EETKNNGLSVSTGLQGGKWNGNSNYSDRRFTG  580
             TE RW DD+ ENRK   KMD        +ET  + LS+  GLQG + N +S+Y D R  G
Sbjct  291   TELRWRDDLKENRKLFPKMDGDSEKEFTKETNWSNLSMDIGLQGERRNVSSSYFDGRLNG  350

Query  579   TDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNGF  400
              DAD+K F Q  DRSD+ KPEKQ +SQ Y+LPYF PKLDLNTDD+TD ASSCKQLDLNGF
Sbjct  351   IDADIKRFHQDADRSDSMKPEKQMSSQGYELPYFAPKLDLNTDDQTDAASSCKQLDLNGF  410

Query  399   SW  394
             SW
Sbjct  411   SW  412



>ref|XP_009770704.1| PREDICTED: uncharacterized protein LOC104221350 isoform X1 [Nicotiana 
sylvestris]
Length=414

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/424 (70%), Positives = 330/424 (78%), Gaps = 20/424 (5%)
 Frame = -2

Query  1632  MYHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVE  1453
             MYH H Q  +MHPST M  P ERHLF+QG N +GDSGLVLSTDAKPRLKWT DLHERF+E
Sbjct  1     MYHQHHQTANMHPSTRMSFP-ERHLFLQGGNVNGDSGLVLSTDAKPRLKWTADLHERFIE  59

Query  1452  AVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHAN-SSSNKAMSSGM  1276
             AVNQLGGADKATPKSVLK MGIQGLTLYHLKSHLQKYRLSKNLHG AN S  NKA     
Sbjct  60    AVNQLGGADKATPKSVLKLMGIQGLTLYHLKSHLQKYRLSKNLHGQANISGVNKA-----  114

Query  1275  DAATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRI  1096
               A G +KI E+ G  ++  +IGP  N N+PI+EAIQ+QIEVQRRLHEQLEVQRHLQLRI
Sbjct  115   --AAGIEKICESTGTPMSHPSIGPQPNNNIPINEAIQMQIEVQRRLHEQLEVQRHLQLRI  172

Query  1095  EAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGF  916
             EAQGKYLQAVLEKAQETLG Q+LG +GLEAAK QLS+LVSKVSNQCLNSAFS IKEL GF
Sbjct  173   EAQGKYLQAVLEKAQETLGTQNLGTIGLEAAKDQLSDLVSKVSNQCLNSAFSEIKELSGF  232

Query  915   CQQQAQATQPTDCSLDSCLTSSEGSLRD-HEMRNSQMGLRSLNFGAHMESTDLYNETRLK  739
                Q QA  P DCS+DSCLTSSE  LRD  EM N+Q+GLR LNFG    + D+ NETRL+
Sbjct  233   HNPQTQAIPPADCSMDSCLTSSERPLRDLREMHNNQIGLRPLNFGPC--TKDIENETRLQ  290

Query  738   QTEFRWCDDIWENRKYLSKMD--------EETKNNGLSVSTGLQGGKWNGNSNYSDRRFT  583
             QTE RW DD+ ENRK   KMD        +ET  + LS+  GLQG + N +S+Y D R  
Sbjct  291   QTELRWRDDLKENRKLFPKMDGDSEKEFTKETNWSNLSMDIGLQGERRNVSSSYFDGRLN  350

Query  582   GTDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNG  403
             G DAD+K F Q  DRSD+ KPEKQ +SQ Y+LPYF PKLDLNTDD+TD ASSCKQLDLNG
Sbjct  351   GIDADIKRFHQDADRSDSMKPEKQMSSQGYELPYFAPKLDLNTDDQTDAASSCKQLDLNG  410

Query  402   FSWN  391
             FSW+
Sbjct  411   FSWS  414



>ref|XP_009619712.1| PREDICTED: uncharacterized protein LOC104111672 isoform X1 [Nicotiana 
tomentosiformis]
Length=414

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/424 (70%), Positives = 331/424 (78%), Gaps = 20/424 (5%)
 Frame = -2

Query  1632  MYHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVE  1453
             MYHHH Q  +MHPST M  P ERHLF+Q  N +GDSGLVLSTDAKPRLKWT DLHERF+E
Sbjct  1     MYHHH-QAANMHPSTRMSFP-ERHLFLQAGNVNGDSGLVLSTDAKPRLKWTADLHERFIE  58

Query  1452  AVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMD  1273
             AVNQLGGADKATPKSVLK MGI GLTLYHLKSHLQKYRLSKNLHG AN      +S    
Sbjct  59    AVNQLGGADKATPKSVLKLMGIPGLTLYHLKSHLQKYRLSKNLHGQAN------ISGANK  112

Query  1272  AATGSDKIPEANGNHI-NSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRI  1096
             +A   +KI E+ G  + N  +IGP  N N+PISEAIQ+QIEVQRRLHEQLEVQRHLQLRI
Sbjct  113   SAASIEKICESTGTPMSNIPSIGPQQNNNIPISEAIQMQIEVQRRLHEQLEVQRHLQLRI  172

Query  1095  EAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGF  916
             EAQGKYLQAVLEKAQETLG Q+LG +GLEAAK QLS+LVSKVSNQCLNSAFS IKEL GF
Sbjct  173   EAQGKYLQAVLEKAQETLGTQNLGTIGLEAAKDQLSDLVSKVSNQCLNSAFSEIKELSGF  232

Query  915   CQQQAQATQPTDCSLDSCLTSSEGSLRD-HEMRNSQMGLRSLNFGAHMESTDLYNETRLK  739
                Q QAT P DCS+DSCLTSSE  LRD  EM NSQ+GLR LNFG    + D+ NETRL+
Sbjct  233   HTPQTQATPPADCSMDSCLTSSERPLRDLREMHNSQIGLRPLNFGPC--TKDIENETRLQ  290

Query  738   QTEFRWCDDIWENRKYLSKMD--------EETKNNGLSVSTGLQGGKWNGNSNYSDRRFT  583
             QTE RW DD+ ENRK   KMD        +ET  + LS++ GLQGGK N +S Y D R  
Sbjct  291   QTELRWRDDLKENRKLFPKMDGDSEKEFTKETSWSNLSMNIGLQGGKRNVSSTYFDGRLN  350

Query  582   GTDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNG  403
             G +AD KLF Q+ +RSD+ KPEKQ +SQEY+LPYF PKLDLNTDD+TD ASSCKQLDLNG
Sbjct  351   GINADSKLFHQSSERSDSMKPEKQISSQEYELPYFAPKLDLNTDDQTDAASSCKQLDLNG  410

Query  402   FSWN  391
             FSW+
Sbjct  411   FSWS  414



>ref|XP_009619713.1| PREDICTED: uncharacterized protein LOC104111672 isoform X2 [Nicotiana 
tomentosiformis]
Length=413

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/424 (70%), Positives = 331/424 (78%), Gaps = 21/424 (5%)
 Frame = -2

Query  1632  MYHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVE  1453
             MYHHH Q  +MHPST M  P ERHLF+Q  N +GDSGLVLSTDAKPRLKWT DLHERF+E
Sbjct  1     MYHHH-QAANMHPSTRMSFP-ERHLFLQAGNVNGDSGLVLSTDAKPRLKWTADLHERFIE  58

Query  1452  AVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMD  1273
             AVNQLGGADKATPKSVLK MGI GLTLYHLKSHLQKYRLSKNLHG AN S       G +
Sbjct  59    AVNQLGGADKATPKSVLKLMGIPGLTLYHLKSHLQKYRLSKNLHGQANIS-------GAN  111

Query  1272  AATGSDKIPEANGNHI-NSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRI  1096
              +   +KI E+ G  + N  +IGP  N N+PISEAIQ+QIEVQRRLHEQLEVQRHLQLRI
Sbjct  112   KSASIEKICESTGTPMSNIPSIGPQQNNNIPISEAIQMQIEVQRRLHEQLEVQRHLQLRI  171

Query  1095  EAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGF  916
             EAQGKYLQAVLEKAQETLG Q+LG +GLEAAK QLS+LVSKVSNQCLNSAFS IKEL GF
Sbjct  172   EAQGKYLQAVLEKAQETLGTQNLGTIGLEAAKDQLSDLVSKVSNQCLNSAFSEIKELSGF  231

Query  915   CQQQAQATQPTDCSLDSCLTSSEGSLRD-HEMRNSQMGLRSLNFGAHMESTDLYNETRLK  739
                Q QAT P DCS+DSCLTSSE  LRD  EM NSQ+GLR LNFG    + D+ NETRL+
Sbjct  232   HTPQTQATPPADCSMDSCLTSSERPLRDLREMHNSQIGLRPLNFGPC--TKDIENETRLQ  289

Query  738   QTEFRWCDDIWENRKYLSKMD--------EETKNNGLSVSTGLQGGKWNGNSNYSDRRFT  583
             QTE RW DD+ ENRK   KMD        +ET  + LS++ GLQGGK N +S Y D R  
Sbjct  290   QTELRWRDDLKENRKLFPKMDGDSEKEFTKETSWSNLSMNIGLQGGKRNVSSTYFDGRLN  349

Query  582   GTDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNG  403
             G +AD KLF Q+ +RSD+ KPEKQ +SQEY+LPYF PKLDLNTDD+TD ASSCKQLDLNG
Sbjct  350   GINADSKLFHQSSERSDSMKPEKQISSQEYELPYFAPKLDLNTDDQTDAASSCKQLDLNG  409

Query  402   FSWN  391
             FSW+
Sbjct  410   FSWS  413



>ref|XP_006339131.1| PREDICTED: uncharacterized protein LOC102602766 isoform X2 [Solanum 
tuberosum]
Length=414

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/425 (69%), Positives = 335/425 (79%), Gaps = 22/425 (5%)
 Frame = -2

Query  1632  MYHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVE  1453
             MYHHH Q  +MHPST M  P ERHLF+QG N +GDSGLVLSTDAKPRLKWT DLHERF+E
Sbjct  1     MYHHHHQASNMHPSTRMSFP-ERHLFLQGGNANGDSGLVLSTDAKPRLKWTPDLHERFIE  59

Query  1452  AVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMD  1273
             AV QLGGADKATPKSVLK MGI GLTLYHLKSHLQKYRLSKN HG AN S       G++
Sbjct  60    AVTQLGGADKATPKSVLKLMGIPGLTLYHLKSHLQKYRLSKNHHGQANLS-------GVN  112

Query  1272  AATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIE  1093
              A   +KI E+ G+  ++ +IGP  N N+PISEAIQ+QI+VQRRLHEQLEVQRHLQLRIE
Sbjct  113   KAASMEKICESTGSPTSNPSIGPQPNNNIPISEAIQMQIDVQRRLHEQLEVQRHLQLRIE  172

Query  1092  AQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFC  913
             AQGKYLQAVLEKAQETLG Q+LG +G EAAK QLS+LVSKVSNQCLNSAFS I+EL GF 
Sbjct  173   AQGKYLQAVLEKAQETLGTQNLGTIGFEAAKVQLSDLVSKVSNQCLNSAFSEIQELSGFH  232

Query  912   QQQAQATQP-TDCSLDSCLTSSEGSLRD-HEMRNSQMGLRSLNFGAHMESTDLYNETRLK  739
               Q QATQ   DCS+DSCLTSSEG LRD  EM N+Q+GLR+LNFG   E  ++ N+TRL+
Sbjct  233   TPQTQATQRLADCSMDSCLTSSEGPLRDLQEMHNNQLGLRTLNFGPCTE--EIENQTRLQ  290

Query  738   QTEFRWCDDIWENRKYLSKMDEETKN--------NGLSVSTGLQGGKWNGNSNYSDRRFT  583
             QT  RW DD+ ENR +  KMDE+T+         + LS++ G+QGGK N NS+Y D R  
Sbjct  291   QTALRWRDDLKENRLF-PKMDEDTEKEFAKETNWSNLSMNVGIQGGKRNVNSSYVDGRLN  349

Query  582   GTDADVKLFAQ-AVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLN  406
             G DAD+KLF Q A DRSD++KPEKQ + QEYKLPYF PKLDLNTDD+TD AS+CKQLDLN
Sbjct  350   GIDADIKLFHQAATDRSDSTKPEKQVSPQEYKLPYFAPKLDLNTDDQTDAASNCKQLDLN  409

Query  405   GFSWN  391
             GFSWN
Sbjct  410   GFSWN  414



>ref|XP_006339130.1| PREDICTED: uncharacterized protein LOC102602766 isoform X1 [Solanum 
tuberosum]
Length=415

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/425 (69%), Positives = 334/425 (79%), Gaps = 21/425 (5%)
 Frame = -2

Query  1632  MYHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVE  1453
             MYHHH Q  +MHPST M  P ERHLF+QG N +GDSGLVLSTDAKPRLKWT DLHERF+E
Sbjct  1     MYHHHHQASNMHPSTRMSFP-ERHLFLQGGNANGDSGLVLSTDAKPRLKWTPDLHERFIE  59

Query  1452  AVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMD  1273
             AV QLGGADKATPKSVLK MGI GLTLYHLKSHLQKYRLSKN HG AN      +S    
Sbjct  60    AVTQLGGADKATPKSVLKLMGIPGLTLYHLKSHLQKYRLSKNHHGQAN------LSGVNK  113

Query  1272  AATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIE  1093
             AA   +KI E+ G+  ++ +IGP  N N+PISEAIQ+QI+VQRRLHEQLEVQRHLQLRIE
Sbjct  114   AAASMEKICESTGSPTSNPSIGPQPNNNIPISEAIQMQIDVQRRLHEQLEVQRHLQLRIE  173

Query  1092  AQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFC  913
             AQGKYLQAVLEKAQETLG Q+LG +G EAAK QLS+LVSKVSNQCLNSAFS I+EL GF 
Sbjct  174   AQGKYLQAVLEKAQETLGTQNLGTIGFEAAKVQLSDLVSKVSNQCLNSAFSEIQELSGFH  233

Query  912   QQQAQATQP-TDCSLDSCLTSSEGSLRD-HEMRNSQMGLRSLNFGAHMESTDLYNETRLK  739
               Q QATQ   DCS+DSCLTSSEG LRD  EM N+Q+GLR+LNFG   E  ++ N+TRL+
Sbjct  234   TPQTQATQRLADCSMDSCLTSSEGPLRDLQEMHNNQLGLRTLNFGPCTE--EIENQTRLQ  291

Query  738   QTEFRWCDDIWENRKYLSKMDEETKN--------NGLSVSTGLQGGKWNGNSNYSDRRFT  583
             QT  RW DD+ ENR +  KMDE+T+         + LS++ G+QGGK N NS+Y D R  
Sbjct  292   QTALRWRDDLKENRLF-PKMDEDTEKEFAKETNWSNLSMNVGIQGGKRNVNSSYVDGRLN  350

Query  582   GTDADVKLFAQ-AVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLN  406
             G DAD+KLF Q A DRSD++KPEKQ + QEYKLPYF PKLDLNTDD+TD AS+CKQLDLN
Sbjct  351   GIDADIKLFHQAATDRSDSTKPEKQVSPQEYKLPYFAPKLDLNTDDQTDAASNCKQLDLN  410

Query  405   GFSWN  391
             GFSWN
Sbjct  411   GFSWN  415



>ref|XP_010312321.1| PREDICTED: uncharacterized protein LOC101256236 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010312322.1| PREDICTED: uncharacterized protein LOC101256236 isoform X1 [Solanum 
lycopersicum]
Length=416

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/422 (68%), Positives = 332/422 (79%), Gaps = 16/422 (4%)
 Frame = -2

Query  1632  MYHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVE  1453
             MYHHH Q KSMHPST M +P ERHLF+QG NG+GDSGLVLSTDAKPRLKWT DLHERF+E
Sbjct  1     MYHHHHQDKSMHPSTRMSVP-ERHLFLQGGNGNGDSGLVLSTDAKPRLKWTPDLHERFIE  59

Query  1452  AVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSS-SNKAMSSGM  1276
             AVNQLGGADKATPKSVLK MGIQGLTLYHLKSHLQKYRLSKNLHG AN+S +NKA+    
Sbjct  60    AVNQLGGADKATPKSVLKLMGIQGLTLYHLKSHLQKYRLSKNLHGQANASGANKAV----  115

Query  1275  DAATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRI  1096
              AA G ++I E +   +++ ++ P  N N+ ISEAIQ+QIEVQRRLHEQLEVQRHLQLRI
Sbjct  116   -AAAGVERISENSATCMSNPSMVPQPNKNIQISEAIQMQIEVQRRLHEQLEVQRHLQLRI  174

Query  1095  EAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGF  916
             EAQGKYLQ+VLEKAQETLGRQ++  +GLEA K QLSE VSK SNQCLNS F+ IKEL GF
Sbjct  175   EAQGKYLQSVLEKAQETLGRQNMETVGLEAVKVQLSEFVSKASNQCLNSPFTDIKELSGF  234

Query  915   CQQQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQ  736
               QQ QATQPTD S+DSCLTS +GSLRD+ M ++Q+GLR   F   +E  D+ N+TRL+Q
Sbjct  235   HSQQTQATQPTDRSIDSCLTSRDGSLRDNTMHDNQIGLRPFGFTPSIECKDIENDTRLQQ  294

Query  735   TEFRWCDDIWENRKYLSKMDE--------ETKNNGLSVSTGLQGGKWNGNSNYSDRRFTG  580
             TE RWCD++ ENR+  S M+E        ET  N LS+S GLQ  K NG+ N+SD  F G
Sbjct  295   TELRWCDNLKENRRLFSPMNEGREKTFTRETNCNNLSMSIGLQDEKLNGSMNHSDGNFNG  354

Query  579   TDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNGF  400
             T+ DVKLF Q  +RS+ S P++ K+SQEYKL YF PKLDLN  D+TD ASSCKQ DLNGF
Sbjct  355   TERDVKLFHQVTNRSE-SVPQRHKSSQEYKLSYFEPKLDLNMHDETDAASSCKQFDLNGF  413

Query  399   SW  394
             SW
Sbjct  414   SW  415



>ref|XP_010312232.1| PREDICTED: uncharacterized protein LOC101257914 isoform X2 [Solanum 
lycopersicum]
Length=414

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/425 (69%), Positives = 335/425 (79%), Gaps = 22/425 (5%)
 Frame = -2

Query  1632  MYHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVE  1453
             MYHHH Q  +MHPST M  P ERHLF+QG N +GDSGLVLSTDAKPRLKWT DLHERF+E
Sbjct  1     MYHHHHQAPNMHPSTRMSFP-ERHLFLQGGNANGDSGLVLSTDAKPRLKWTPDLHERFIE  59

Query  1452  AVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMD  1273
             AV QLGGADKATPKSVLK MGIQGLTLYHLKSHLQKYRLSKN HG AN S       G++
Sbjct  60    AVTQLGGADKATPKSVLKLMGIQGLTLYHLKSHLQKYRLSKNHHGQANIS-------GVN  112

Query  1272  AATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIE  1093
              A   +KI E+ G+  ++ +IG   N N+PISEAIQ+QI+VQRRLHEQLEVQRHLQLRIE
Sbjct  113   KAASMEKICESTGSPKSNPSIGHQPNNNIPISEAIQMQIDVQRRLHEQLEVQRHLQLRIE  172

Query  1092  AQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFC  913
             AQGKYLQAVLEKAQETLG Q+LG +GLEAAK QLS+LVSKVSNQCLNSAFS IKEL GF 
Sbjct  173   AQGKYLQAVLEKAQETLGTQNLGTIGLEAAKVQLSDLVSKVSNQCLNSAFSEIKELSGFH  232

Query  912   QQQAQATQP-TDCSLDSCLTSSEGSLRD-HEMRNSQMGLRSLNFGAHMESTDLYNETRLK  739
               Q QATQ   DCS+DSCLTSSEG LRD  EM N+Q+GLR+LNF    E  ++ N+TRL+
Sbjct  233   TPQTQATQRLADCSMDSCLTSSEGPLRDLQEMHNNQLGLRNLNFRPCTE--EIENQTRLQ  290

Query  738   QTEFRWCDDIWENRKYLSKMDEETKN--------NGLSVSTGLQGGKWNGNSNYSDRRFT  583
             QT  RW DD+ ENR +  K+DE+T+         + LS++ G+QGGK N NS+Y D R  
Sbjct  291   QTALRWRDDLKENRLF-PKIDEDTEKEFAKETNWSNLSMNVGIQGGKRNVNSSYVDERLN  349

Query  582   GTDADVKLFAQ-AVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLN  406
             G DAD+KLF Q A DRSD++KPEKQ + QEYKLPYF PKLDLNTDD+TD AS+CKQLDLN
Sbjct  350   GIDADIKLFHQTATDRSDSTKPEKQVSPQEYKLPYFAPKLDLNTDDQTDAASNCKQLDLN  409

Query  405   GFSWN  391
             GFSWN
Sbjct  410   GFSWN  414



>ref|XP_004249601.1| PREDICTED: uncharacterized protein LOC101256236 isoform X2 [Solanum 
lycopersicum]
Length=414

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/422 (68%), Positives = 330/422 (78%), Gaps = 18/422 (4%)
 Frame = -2

Query  1632  MYHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVE  1453
             MYHHH Q KSMHPST M +P ERHLF+QG NG+GDSGLVLSTDAKPRLKWT DLHERF+E
Sbjct  1     MYHHHHQDKSMHPSTRMSVP-ERHLFLQGGNGNGDSGLVLSTDAKPRLKWTPDLHERFIE  59

Query  1452  AVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSS-SNKAMSSGM  1276
             AVNQLGGADKATPKSVLK MGIQGLTLYHLKSHLQKYRLSKNLHG AN+S +NKA     
Sbjct  60    AVNQLGGADKATPKSVLKLMGIQGLTLYHLKSHLQKYRLSKNLHGQANASGANKA-----  114

Query  1275  DAATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRI  1096
               A G ++I E +   +++ ++ P  N N+ ISEAIQ+QIEVQRRLHEQLEVQRHLQLRI
Sbjct  115   --AAGVERISENSATCMSNPSMVPQPNKNIQISEAIQMQIEVQRRLHEQLEVQRHLQLRI  172

Query  1095  EAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGF  916
             EAQGKYLQ+VLEKAQETLGRQ++  +GLEA K QLSE VSK SNQCLNS F+ IKEL GF
Sbjct  173   EAQGKYLQSVLEKAQETLGRQNMETVGLEAVKVQLSEFVSKASNQCLNSPFTDIKELSGF  232

Query  915   CQQQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQ  736
               QQ QATQPTD S+DSCLTS +GSLRD+ M ++Q+GLR   F   +E  D+ N+TRL+Q
Sbjct  233   HSQQTQATQPTDRSIDSCLTSRDGSLRDNTMHDNQIGLRPFGFTPSIECKDIENDTRLQQ  292

Query  735   TEFRWCDDIWENRKYLSKMDE--------ETKNNGLSVSTGLQGGKWNGNSNYSDRRFTG  580
             TE RWCD++ ENR+  S M+E        ET  N LS+S GLQ  K NG+ N+SD  F G
Sbjct  293   TELRWCDNLKENRRLFSPMNEGREKTFTRETNCNNLSMSIGLQDEKLNGSMNHSDGNFNG  352

Query  579   TDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNGF  400
             T+ DVKLF Q  +RS+ S P++ K+SQEYKL YF PKLDLN  D+TD ASSCKQ DLNGF
Sbjct  353   TERDVKLFHQVTNRSE-SVPQRHKSSQEYKLSYFEPKLDLNMHDETDAASSCKQFDLNGF  411

Query  399   SW  394
             SW
Sbjct  412   SW  413



>ref|XP_010312230.1| PREDICTED: uncharacterized protein LOC101257914 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010312231.1| PREDICTED: uncharacterized protein LOC101257914 isoform X1 [Solanum 
lycopersicum]
Length=415

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/425 (69%), Positives = 334/425 (79%), Gaps = 21/425 (5%)
 Frame = -2

Query  1632  MYHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVE  1453
             MYHHH Q  +MHPST M  P ERHLF+QG N +GDSGLVLSTDAKPRLKWT DLHERF+E
Sbjct  1     MYHHHHQAPNMHPSTRMSFP-ERHLFLQGGNANGDSGLVLSTDAKPRLKWTPDLHERFIE  59

Query  1452  AVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMD  1273
             AV QLGGADKATPKSVLK MGIQGLTLYHLKSHLQKYRLSKN HG AN      +S    
Sbjct  60    AVTQLGGADKATPKSVLKLMGIQGLTLYHLKSHLQKYRLSKNHHGQAN------ISGVNK  113

Query  1272  AATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIE  1093
             AA   +KI E+ G+  ++ +IG   N N+PISEAIQ+QI+VQRRLHEQLEVQRHLQLRIE
Sbjct  114   AAASMEKICESTGSPKSNPSIGHQPNNNIPISEAIQMQIDVQRRLHEQLEVQRHLQLRIE  173

Query  1092  AQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFC  913
             AQGKYLQAVLEKAQETLG Q+LG +GLEAAK QLS+LVSKVSNQCLNSAFS IKEL GF 
Sbjct  174   AQGKYLQAVLEKAQETLGTQNLGTIGLEAAKVQLSDLVSKVSNQCLNSAFSEIKELSGFH  233

Query  912   QQQAQATQP-TDCSLDSCLTSSEGSLRD-HEMRNSQMGLRSLNFGAHMESTDLYNETRLK  739
               Q QATQ   DCS+DSCLTSSEG LRD  EM N+Q+GLR+LNF    E  ++ N+TRL+
Sbjct  234   TPQTQATQRLADCSMDSCLTSSEGPLRDLQEMHNNQLGLRNLNFRPCTE--EIENQTRLQ  291

Query  738   QTEFRWCDDIWENRKYLSKMDEETKN--------NGLSVSTGLQGGKWNGNSNYSDRRFT  583
             QT  RW DD+ ENR +  K+DE+T+         + LS++ G+QGGK N NS+Y D R  
Sbjct  292   QTALRWRDDLKENRLF-PKIDEDTEKEFAKETNWSNLSMNVGIQGGKRNVNSSYVDERLN  350

Query  582   GTDADVKLFAQ-AVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLN  406
             G DAD+KLF Q A DRSD++KPEKQ + QEYKLPYF PKLDLNTDD+TD AS+CKQLDLN
Sbjct  351   GIDADIKLFHQTATDRSDSTKPEKQVSPQEYKLPYFAPKLDLNTDDQTDAASNCKQLDLN  410

Query  405   GFSWN  391
             GFSWN
Sbjct  411   GFSWN  415



>ref|XP_006338933.1| PREDICTED: uncharacterized protein LOC102592272 isoform X1 [Solanum 
tuberosum]
 ref|XP_006338934.1| PREDICTED: uncharacterized protein LOC102592272 isoform X2 [Solanum 
tuberosum]
Length=416

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/422 (67%), Positives = 329/422 (78%), Gaps = 16/422 (4%)
 Frame = -2

Query  1632  MYHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVE  1453
             MYHHH Q KSMHPST M +P ERHLF+QG NG+GDSGLVLSTDAKPRLKWT DLHERF+E
Sbjct  1     MYHHHHQEKSMHPSTRMSVP-ERHLFLQGGNGNGDSGLVLSTDAKPRLKWTPDLHERFIE  59

Query  1452  AVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSS-SNKAMSSGM  1276
             AVNQLGGADKATPKSVLK MGIQGLTLYHLKSHLQKYRLSKNLHG AN+S +NKA+    
Sbjct  60    AVNQLGGADKATPKSVLKLMGIQGLTLYHLKSHLQKYRLSKNLHGQANASGTNKAV----  115

Query  1275  DAATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRI  1096
              A  G ++I E +   +++ ++ P  N N+ ISEAIQ+QIEVQRRLHEQLEVQRHLQLRI
Sbjct  116   -AVAGVERISENSATCMSNPSMVPQPNKNIQISEAIQMQIEVQRRLHEQLEVQRHLQLRI  174

Query  1095  EAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGF  916
             EAQGKYLQ+VLEKAQETLGRQ++  +GLEA K QLSE VSK SNQCLNS F  IKEL GF
Sbjct  175   EAQGKYLQSVLEKAQETLGRQNMETVGLEAVKVQLSEFVSKASNQCLNSPFPDIKELSGF  234

Query  915   CQQQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQ  736
               Q  QATQPTD S+DSCLTS +GSLRD+ M ++Q+GLR  +F   +E  D+ N+ RL+Q
Sbjct  235   HSQHTQATQPTDRSIDSCLTSRDGSLRDNTMHDNQIGLRPFDFTPSIECKDIENDARLQQ  294

Query  735   TEFRWCDDIWENRKYLSKMDE--------ETKNNGLSVSTGLQGGKWNGNSNYSDRRFTG  580
             TE RWCD++ ENR+  S M+E        ET  N LS+S GLQ  K NG+ N+SD  F G
Sbjct  295   TELRWCDNLKENRRLFSPMNEGREKTFTRETNCNNLSMSIGLQDEKLNGSMNHSDGSFNG  354

Query  579   TDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNGF  400
             T+ DVKLF Q  +RS+ S P++ K+SQEYKL YF PKLDLN  D+TD ASSCKQ DLNGF
Sbjct  355   TERDVKLFHQVTNRSE-SVPQRHKSSQEYKLSYFQPKLDLNMHDETDAASSCKQFDLNGF  413

Query  399   SW  394
             SW
Sbjct  414   SW  415



>ref|XP_009758039.1| PREDICTED: uncharacterized protein LOC104210771 isoform X3 [Nicotiana 
sylvestris]
Length=410

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/422 (68%), Positives = 327/422 (77%), Gaps = 22/422 (5%)
 Frame = -2

Query  1632  MYHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVE  1453
             MYHHHRQ KSMHPST M +  ERHLF+QG NG+GDSGLVLSTDAKPRLKWT DLHERF+E
Sbjct  1     MYHHHRQDKSMHPSTRMSIS-ERHLFLQGGNGNGDSGLVLSTDAKPRLKWTPDLHERFIE  59

Query  1452  AVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSS-SNKAMSSGM  1276
             AVNQLGGADKATPKSVLK MGIQGLTLYHLKSHLQKYRLSKNLHG AN+S +NKA+    
Sbjct  60    AVNQLGGADKATPKSVLKLMGIQGLTLYHLKSHLQKYRLSKNLHGQANASGANKAV----  115

Query  1275  DAATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRI  1096
              AATG D+I E +   +++ +IGP  N N+ ISEAIQIQIEVQRRLHEQLE      LRI
Sbjct  116   -AATGEDRISENSATCMSNPSIGPQPNKNIQISEAIQIQIEVQRRLHEQLE------LRI  168

Query  1095  EAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGF  916
             EAQGKYL AVLEKAQETLGRQD+G +GLEAAK QLSELVS VSNQCLN  FS IKEL  +
Sbjct  169   EAQGKYLHAVLEKAQETLGRQDMGTVGLEAAKVQLSELVSTVSNQCLNPTFSDIKELSRY  228

Query  915   CQQQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQ  736
               QQ QAT+  D S+DSCLTS EGSLRD+ M N+Q+GLR   F   +E  D+ N+TR++Q
Sbjct  229   SNQQTQATRLADRSIDSCLTSCEGSLRDNTMHNNQIGLRPFEFTPSIECEDIENDTRIQQ  288

Query  735   TEFRWCDDIWENRKYLSKMDE--------ETKNNGLSVSTGLQGGKWNGNSNYSDRRFTG  580
             T  RWCD++ E++K  S M+E        ET    LS+S GLQ GK NG+SN+SD +F G
Sbjct  289   TALRWCDNLKESKKLFSAMNEGKEKTFTTETNCKDLSMSIGLQDGKLNGSSNHSDGKFNG  348

Query  579   TDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNGF  400
             TD  V+LF QA +R D S PE+QK+SQEYKL YF PKLDLN  D+TD ASSCKQ DLNGF
Sbjct  349   TDTAVRLFHQAANRGD-SMPERQKSSQEYKLSYFAPKLDLNMHDETDAASSCKQFDLNGF  407

Query  399   SW  394
             SW
Sbjct  408   SW  409



>ref|XP_009630167.1| PREDICTED: uncharacterized protein LOC104120153 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009630168.1| PREDICTED: uncharacterized protein LOC104120153 isoform X1 [Nicotiana 
tomentosiformis]
Length=414

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/422 (67%), Positives = 324/422 (77%), Gaps = 18/422 (4%)
 Frame = -2

Query  1632  MYHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVE  1453
             MYHHH Q KSMHPST M +  ERHLF+QG NG+GDSGLVLSTDAKPRLKWT DLHERF+E
Sbjct  1     MYHHHHQDKSMHPSTRMSIS-ERHLFLQGGNGNGDSGLVLSTDAKPRLKWTPDLHERFIE  59

Query  1452  AVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSS-SNKAMSSGM  1276
             AVNQLGGADKATPKSVLK MGIQGLTLYHLKSHLQKYRLSKNLHG AN+S +NK      
Sbjct  60    AVNQLGGADKATPKSVLKLMGIQGLTLYHLKSHLQKYRLSKNLHGQANASGANKV-----  114

Query  1275  DAATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRI  1096
               A G D+I E +   +++ +IGP  N N+ ISEAIQIQIEVQRRLHEQLEVQRHLQLRI
Sbjct  115   --AAGEDRISENSATCMSNPSIGPQPNKNIQISEAIQIQIEVQRRLHEQLEVQRHLQLRI  172

Query  1095  EAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGF  916
             EAQGKYL AVLEKAQETLGRQD+G +GLEAAK QLSELVS VSNQCLN  FS I+E+ GF
Sbjct  173   EAQGKYLHAVLEKAQETLGRQDMGTVGLEAAKIQLSELVSTVSNQCLNPTFSDIQEISGF  232

Query  915   CQQQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQ  736
               QQ Q TQ  D S+DSCLTS EGSLRD+ M N+Q+GLR   F   +E  D+ N+TR++Q
Sbjct  233   SSQQTQTTQLADRSIDSCLTSCEGSLRDNTMHNNQIGLRPFEFTPSIECKDIENDTRIQQ  292

Query  735   TEFRWCDDIWENRKYLSKMDE--------ETKNNGLSVSTGLQGGKWNGNSNYSDRRFTG  580
             T  RWCD++ ENRK  S +DE        ET    LS+S GLQ G  +G+SN+SD +F  
Sbjct  293   TGLRWCDNLKENRKLFSAIDEGKEKAFTTETNCKNLSMSIGLQDGNLDGSSNHSDGKFNE  352

Query  579   TDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNGF  400
             T+  V+ F QA +R D S  E+QK+SQEYKL YF PKLDLN  D+TD ASSCKQ DLNGF
Sbjct  353   TNTAVRHFHQAANRGD-SMQERQKSSQEYKLSYFAPKLDLNIHDETDAASSCKQFDLNGF  411

Query  399   SW  394
             SW
Sbjct  412   SW  413



>ref|XP_009619714.1| PREDICTED: uncharacterized protein LOC104111672 isoform X3 [Nicotiana 
tomentosiformis]
Length=408

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/424 (69%), Positives = 325/424 (77%), Gaps = 26/424 (6%)
 Frame = -2

Query  1632  MYHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVE  1453
             MYHHH Q  +MHPST M  P ERHLF+Q  N +GDSGLVLSTDAKPRLKWT DLHERF+E
Sbjct  1     MYHHH-QAANMHPSTRMSFP-ERHLFLQAGNVNGDSGLVLSTDAKPRLKWTADLHERFIE  58

Query  1452  AVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMD  1273
             AVNQLGGADKATPKSVLK MGI GLTLYHLKSHLQKYRLSKNLHG AN      +S    
Sbjct  59    AVNQLGGADKATPKSVLKLMGIPGLTLYHLKSHLQKYRLSKNLHGQAN------ISGANK  112

Query  1272  AATGSDKIPEANGNHI-NSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRI  1096
             +A   +KI E+ G  + N  +IGP  N N+PISEAIQ+QIEVQRRLHEQLE      LRI
Sbjct  113   SAASIEKICESTGTPMSNIPSIGPQQNNNIPISEAIQMQIEVQRRLHEQLE------LRI  166

Query  1095  EAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGF  916
             EAQGKYLQAVLEKAQETLG Q+LG +GLEAAK QLS+LVSKVSNQCLNSAFS IKEL GF
Sbjct  167   EAQGKYLQAVLEKAQETLGTQNLGTIGLEAAKDQLSDLVSKVSNQCLNSAFSEIKELSGF  226

Query  915   CQQQAQATQPTDCSLDSCLTSSEGSLRD-HEMRNSQMGLRSLNFGAHMESTDLYNETRLK  739
                Q QAT P DCS+DSCLTSSE  LRD  EM NSQ+GLR LNFG    + D+ NETRL+
Sbjct  227   HTPQTQATPPADCSMDSCLTSSERPLRDLREMHNSQIGLRPLNFGPC--TKDIENETRLQ  284

Query  738   QTEFRWCDDIWENRKYLSKMD--------EETKNNGLSVSTGLQGGKWNGNSNYSDRRFT  583
             QTE RW DD+ ENRK   KMD        +ET  + LS++ GLQGGK N +S Y D R  
Sbjct  285   QTELRWRDDLKENRKLFPKMDGDSEKEFTKETSWSNLSMNIGLQGGKRNVSSTYFDGRLN  344

Query  582   GTDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNG  403
             G +AD KLF Q+ +RSD+ KPEKQ +SQEY+LPYF PKLDLNTDD+TD ASSCKQLDLNG
Sbjct  345   GINADSKLFHQSSERSDSMKPEKQISSQEYELPYFAPKLDLNTDDQTDAASSCKQLDLNG  404

Query  402   FSWN  391
             FSW+
Sbjct  405   FSWS  408



>ref|XP_009770706.1| PREDICTED: uncharacterized protein LOC104221350 isoform X3 [Nicotiana 
sylvestris]
Length=408

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/423 (69%), Positives = 323/423 (76%), Gaps = 26/423 (6%)
 Frame = -2

Query  1632  MYHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVE  1453
             MYH H Q  +MHPST M  P ERHLF+QG N +GDSGLVLSTDAKPRLKWT DLHERF+E
Sbjct  1     MYHQHHQTANMHPSTRMSFP-ERHLFLQGGNVNGDSGLVLSTDAKPRLKWTADLHERFIE  59

Query  1452  AVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHAN-SSSNKAMSSGM  1276
             AVNQLGGADKATPKSVLK MGIQGLTLYHLKSHLQKYRLSKNLHG AN S  NK      
Sbjct  60    AVNQLGGADKATPKSVLKLMGIQGLTLYHLKSHLQKYRLSKNLHGQANISGVNK------  113

Query  1275  DAATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRI  1096
              AA G +KI E+ G  ++  +IGP  N N+PI+EAIQ+QIEVQRRLHEQLE      LRI
Sbjct  114   -AAAGIEKICESTGTPMSHPSIGPQPNNNIPINEAIQMQIEVQRRLHEQLE------LRI  166

Query  1095  EAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGF  916
             EAQGKYLQAVLEKAQETLG Q+LG +GLEAAK QLS+LVSKVSNQCLNSAFS IKEL GF
Sbjct  167   EAQGKYLQAVLEKAQETLGTQNLGTIGLEAAKDQLSDLVSKVSNQCLNSAFSEIKELSGF  226

Query  915   CQQQAQATQPTDCSLDSCLTSSEGSLRD-HEMRNSQMGLRSLNFGAHMESTDLYNETRLK  739
                Q QA  P DCS+DSCLTSSE  LRD  EM N+Q+GLR LNFG    + D+ NETRL+
Sbjct  227   HNPQTQAIPPADCSMDSCLTSSERPLRDLREMHNNQIGLRPLNFGPC--TKDIENETRLQ  284

Query  738   QTEFRWCDDIWENRKYLSKMD--------EETKNNGLSVSTGLQGGKWNGNSNYSDRRFT  583
             QTE RW DD+ ENRK   KMD        +ET  + LS+  GLQG + N +S+Y D R  
Sbjct  285   QTELRWRDDLKENRKLFPKMDGDSEKEFTKETNWSNLSMDIGLQGERRNVSSSYFDGRLN  344

Query  582   GTDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNG  403
             G DAD+K F Q  DRSD+ KPEKQ +SQ Y+LPYF PKLDLNTDD+TD ASSCKQLDLNG
Sbjct  345   GIDADIKRFHQDADRSDSMKPEKQMSSQGYELPYFAPKLDLNTDDQTDAASSCKQLDLNG  404

Query  402   FSW  394
             FSW
Sbjct  405   FSW  407



>ref|XP_006339132.1| PREDICTED: uncharacterized protein LOC102602766 isoform X3 [Solanum 
tuberosum]
Length=409

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/425 (68%), Positives = 328/425 (77%), Gaps = 27/425 (6%)
 Frame = -2

Query  1632  MYHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVE  1453
             MYHHH Q  +MHPST M  P ERHLF+QG N +GDSGLVLSTDAKPRLKWT DLHERF+E
Sbjct  1     MYHHHHQASNMHPSTRMSFP-ERHLFLQGGNANGDSGLVLSTDAKPRLKWTPDLHERFIE  59

Query  1452  AVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMD  1273
             AV QLGGADKATPKSVLK MGI GLTLYHLKSHLQKYRLSKN HG AN      +S    
Sbjct  60    AVTQLGGADKATPKSVLKLMGIPGLTLYHLKSHLQKYRLSKNHHGQAN------LSGVNK  113

Query  1272  AATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIE  1093
             AA   +KI E+ G+  ++ +IGP  N N+PISEAIQ+QI+VQRRLHEQLE      LRIE
Sbjct  114   AAASMEKICESTGSPTSNPSIGPQPNNNIPISEAIQMQIDVQRRLHEQLE------LRIE  167

Query  1092  AQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFC  913
             AQGKYLQAVLEKAQETLG Q+LG +G EAAK QLS+LVSKVSNQCLNSAFS I+EL GF 
Sbjct  168   AQGKYLQAVLEKAQETLGTQNLGTIGFEAAKVQLSDLVSKVSNQCLNSAFSEIQELSGFH  227

Query  912   QQQAQATQP-TDCSLDSCLTSSEGSLRD-HEMRNSQMGLRSLNFGAHMESTDLYNETRLK  739
               Q QATQ   DCS+DSCLTSSEG LRD  EM N+Q+GLR+LNFG   E  ++ N+TRL+
Sbjct  228   TPQTQATQRLADCSMDSCLTSSEGPLRDLQEMHNNQLGLRTLNFGPCTE--EIENQTRLQ  285

Query  738   QTEFRWCDDIWENRKYLSKMDEETKN--------NGLSVSTGLQGGKWNGNSNYSDRRFT  583
             QT  RW DD+ ENR +  KMDE+T+         + LS++ G+QGGK N NS+Y D R  
Sbjct  286   QTALRWRDDLKENRLF-PKMDEDTEKEFAKETNWSNLSMNVGIQGGKRNVNSSYVDGRLN  344

Query  582   GTDADVKLFAQ-AVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLN  406
             G DAD+KLF Q A DRSD++KPEKQ + QEYKLPYF PKLDLNTDD+TD AS+CKQLDLN
Sbjct  345   GIDADIKLFHQAATDRSDSTKPEKQVSPQEYKLPYFAPKLDLNTDDQTDAASNCKQLDLN  404

Query  405   GFSWN  391
             GFSWN
Sbjct  405   GFSWN  409



>emb|CDP15424.1| unnamed protein product [Coffea canephora]
Length=415

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/422 (67%), Positives = 321/422 (76%), Gaps = 17/422 (4%)
 Frame = -2

Query  1632  MYHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVE  1453
             MYHHH+QGK++H S+ M +PPERHLF+QG NG GDSGLVLSTDAKPRLKWT DLHERF+E
Sbjct  1     MYHHHQQGKNIHSSSRMPIPPERHLFLQGGNGPGDSGLVLSTDAKPRLKWTPDLHERFIE  60

Query  1452  AVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMD  1273
             AVNQLGGADKATPKSVLK MGIQGLTLYHLKSHLQKYRLSKNLHG AN  +NKA      
Sbjct  61    AVNQLGGADKATPKSVLKLMGIQGLTLYHLKSHLQKYRLSKNLHGQANCGTNKA------  114

Query  1272  AATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIE  1093
                  D+IPE N   I + +IG  AN NL I EAIQ+QIEVQRRLHEQLEVQRHLQLRIE
Sbjct  115   --AAGDRIPETNAASIINPSIGSQANKNLHIGEAIQMQIEVQRRLHEQLEVQRHLQLRIE  172

Query  1092  AQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFC  913
             AQGKYLQAVLEKAQETLGRQ+LG +GLEAAK QLSELVSK+S+QCLNSAFS +KELPG C
Sbjct  173   AQGKYLQAVLEKAQETLGRQNLGSVGLEAAKVQLSELVSKMSDQCLNSAFSDMKELPGSC  232

Query  912   QQQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQT  733
              QQ Q  QPTDCS+DSCLTS EGSLRD EM N+QM LR LN    ME  ++ NE  L+  
Sbjct  233   PQQTQTPQPTDCSMDSCLTSCEGSLRDQEMHNNQMMLRPLNLRTDMEFNNMNNEASLQHA  292

Query  732   EFRWCDDIW-ENRKYLSKMDEETKN--------NGLSVSTGLQGGKWNGNSNYSDRRFTG  580
             E RWCDD+  E RK +S M+EE +           LS+S GLQGG+WN + +Y ++R   
Sbjct  293   ERRWCDDLMKEKRKLVSTMNEEAEKACAAEKNIGNLSMSIGLQGGRWNSHHSYLEKRGRE  352

Query  579   TDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNGF  400
              + ++K F Q  +R     PE Q+ S+EYKLP+F PKLDLNTDD  D  S CKQ DLNGF
Sbjct  353   AETEIKFFDQPHNRYGPIPPETQRPSEEYKLPFFAPKLDLNTDDGADAGSRCKQFDLNGF  412

Query  399   SW  394
             SW
Sbjct  413   SW  414



>ref|XP_010312323.1| PREDICTED: uncharacterized protein LOC101256236 isoform X3 [Solanum 
lycopersicum]
Length=410

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/422 (66%), Positives = 326/422 (77%), Gaps = 22/422 (5%)
 Frame = -2

Query  1632  MYHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVE  1453
             MYHHH Q KSMHPST M +P ERHLF+QG NG+GDSGLVLSTDAKPRLKWT DLHERF+E
Sbjct  1     MYHHHHQDKSMHPSTRMSVP-ERHLFLQGGNGNGDSGLVLSTDAKPRLKWTPDLHERFIE  59

Query  1452  AVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSS-SNKAMSSGM  1276
             AVNQLGGADKATPKSVLK MGIQGLTLYHLKSHLQKYRLSKNLHG AN+S +NKA+    
Sbjct  60    AVNQLGGADKATPKSVLKLMGIQGLTLYHLKSHLQKYRLSKNLHGQANASGANKAV----  115

Query  1275  DAATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRI  1096
              AA G ++I E +   +++ ++ P  N N+ ISEAIQ+QIEVQRRLHEQLE      LRI
Sbjct  116   -AAAGVERISENSATCMSNPSMVPQPNKNIQISEAIQMQIEVQRRLHEQLE------LRI  168

Query  1095  EAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGF  916
             EAQGKYLQ+VLEKAQETLGRQ++  +GLEA K QLSE VSK SNQCLNS F+ IKEL GF
Sbjct  169   EAQGKYLQSVLEKAQETLGRQNMETVGLEAVKVQLSEFVSKASNQCLNSPFTDIKELSGF  228

Query  915   CQQQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQ  736
               QQ QATQPTD S+DSCLTS +GSLRD+ M ++Q+GLR   F   +E  D+ N+TRL+Q
Sbjct  229   HSQQTQATQPTDRSIDSCLTSRDGSLRDNTMHDNQIGLRPFGFTPSIECKDIENDTRLQQ  288

Query  735   TEFRWCDDIWENRKYLSKMDE--------ETKNNGLSVSTGLQGGKWNGNSNYSDRRFTG  580
             TE RWCD++ ENR+  S M+E        ET  N LS+S GLQ  K NG+ N+SD  F G
Sbjct  289   TELRWCDNLKENRRLFSPMNEGREKTFTRETNCNNLSMSIGLQDEKLNGSMNHSDGNFNG  348

Query  579   TDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNGF  400
             T+ DVKLF Q  +RS+ S P++ K+SQEYKL YF PKLDLN  D+TD ASSCKQ DLNGF
Sbjct  349   TERDVKLFHQVTNRSE-SVPQRHKSSQEYKLSYFEPKLDLNMHDETDAASSCKQFDLNGF  407

Query  399   SW  394
             SW
Sbjct  408   SW  409



>ref|XP_004249439.1| PREDICTED: uncharacterized protein LOC101257914 isoform X3 [Solanum 
lycopersicum]
Length=409

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/425 (68%), Positives = 328/425 (77%), Gaps = 27/425 (6%)
 Frame = -2

Query  1632  MYHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVE  1453
             MYHHH Q  +MHPST M  P ERHLF+QG N +GDSGLVLSTDAKPRLKWT DLHERF+E
Sbjct  1     MYHHHHQAPNMHPSTRMSFP-ERHLFLQGGNANGDSGLVLSTDAKPRLKWTPDLHERFIE  59

Query  1452  AVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMD  1273
             AV QLGGADKATPKSVLK MGIQGLTLYHLKSHLQKYRLSKN HG AN      +S    
Sbjct  60    AVTQLGGADKATPKSVLKLMGIQGLTLYHLKSHLQKYRLSKNHHGQAN------ISGVNK  113

Query  1272  AATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIE  1093
             AA   +KI E+ G+  ++ +IG   N N+PISEAIQ+QI+VQRRLHEQLE      LRIE
Sbjct  114   AAASMEKICESTGSPKSNPSIGHQPNNNIPISEAIQMQIDVQRRLHEQLE------LRIE  167

Query  1092  AQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFC  913
             AQGKYLQAVLEKAQETLG Q+LG +GLEAAK QLS+LVSKVSNQCLNSAFS IKEL GF 
Sbjct  168   AQGKYLQAVLEKAQETLGTQNLGTIGLEAAKVQLSDLVSKVSNQCLNSAFSEIKELSGFH  227

Query  912   QQQAQATQP-TDCSLDSCLTSSEGSLRD-HEMRNSQMGLRSLNFGAHMESTDLYNETRLK  739
               Q QATQ   DCS+DSCLTSSEG LRD  EM N+Q+GLR+LNF    E  ++ N+TRL+
Sbjct  228   TPQTQATQRLADCSMDSCLTSSEGPLRDLQEMHNNQLGLRNLNFRPCTE--EIENQTRLQ  285

Query  738   QTEFRWCDDIWENRKYLSKMDEETKN--------NGLSVSTGLQGGKWNGNSNYSDRRFT  583
             QT  RW DD+ ENR +  K+DE+T+         + LS++ G+QGGK N NS+Y D R  
Sbjct  286   QTALRWRDDLKENRLF-PKIDEDTEKEFAKETNWSNLSMNVGIQGGKRNVNSSYVDERLN  344

Query  582   GTDADVKLFAQ-AVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLN  406
             G DAD+KLF Q A DRSD++KPEKQ + QEYKLPYF PKLDLNTDD+TD AS+CKQLDLN
Sbjct  345   GIDADIKLFHQTATDRSDSTKPEKQVSPQEYKLPYFAPKLDLNTDDQTDAASNCKQLDLN  404

Query  405   GFSWN  391
             GFSWN
Sbjct  405   GFSWN  409



>ref|XP_006338935.1| PREDICTED: uncharacterized protein LOC102592272 isoform X3 [Solanum 
tuberosum]
Length=410

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/422 (66%), Positives = 323/422 (77%), Gaps = 22/422 (5%)
 Frame = -2

Query  1632  MYHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVE  1453
             MYHHH Q KSMHPST M +P ERHLF+QG NG+GDSGLVLSTDAKPRLKWT DLHERF+E
Sbjct  1     MYHHHHQEKSMHPSTRMSVP-ERHLFLQGGNGNGDSGLVLSTDAKPRLKWTPDLHERFIE  59

Query  1452  AVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSS-SNKAMSSGM  1276
             AVNQLGGADKATPKSVLK MGIQGLTLYHLKSHLQKYRLSKNLHG AN+S +NKA+    
Sbjct  60    AVNQLGGADKATPKSVLKLMGIQGLTLYHLKSHLQKYRLSKNLHGQANASGTNKAV----  115

Query  1275  DAATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRI  1096
              A  G ++I E +   +++ ++ P  N N+ ISEAIQ+QIEVQRRLHEQLE      LRI
Sbjct  116   -AVAGVERISENSATCMSNPSMVPQPNKNIQISEAIQMQIEVQRRLHEQLE------LRI  168

Query  1095  EAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGF  916
             EAQGKYLQ+VLEKAQETLGRQ++  +GLEA K QLSE VSK SNQCLNS F  IKEL GF
Sbjct  169   EAQGKYLQSVLEKAQETLGRQNMETVGLEAVKVQLSEFVSKASNQCLNSPFPDIKELSGF  228

Query  915   CQQQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQ  736
               Q  QATQPTD S+DSCLTS +GSLRD+ M ++Q+GLR  +F   +E  D+ N+ RL+Q
Sbjct  229   HSQHTQATQPTDRSIDSCLTSRDGSLRDNTMHDNQIGLRPFDFTPSIECKDIENDARLQQ  288

Query  735   TEFRWCDDIWENRKYLSKMDE--------ETKNNGLSVSTGLQGGKWNGNSNYSDRRFTG  580
             TE RWCD++ ENR+  S M+E        ET  N LS+S GLQ  K NG+ N+SD  F G
Sbjct  289   TELRWCDNLKENRRLFSPMNEGREKTFTRETNCNNLSMSIGLQDEKLNGSMNHSDGSFNG  348

Query  579   TDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNGF  400
             T+ DVKLF Q  +RS+ S P++ K+SQEYKL YF PKLDLN  D+TD ASSCKQ DLNGF
Sbjct  349   TERDVKLFHQVTNRSE-SVPQRHKSSQEYKLSYFQPKLDLNMHDETDAASSCKQFDLNGF  407

Query  399   SW  394
             SW
Sbjct  408   SW  409



>ref|XP_009630169.1| PREDICTED: uncharacterized protein LOC104120153 isoform X2 [Nicotiana 
tomentosiformis]
Length=408

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/422 (66%), Positives = 318/422 (75%), Gaps = 24/422 (6%)
 Frame = -2

Query  1632  MYHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVE  1453
             MYHHH Q KSMHPST M +  ERHLF+QG NG+GDSGLVLSTDAKPRLKWT DLHERF+E
Sbjct  1     MYHHHHQDKSMHPSTRMSIS-ERHLFLQGGNGNGDSGLVLSTDAKPRLKWTPDLHERFIE  59

Query  1452  AVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSS-SNKAMSSGM  1276
             AVNQLGGADKATPKSVLK MGIQGLTLYHLKSHLQKYRLSKNLHG AN+S +NK      
Sbjct  60    AVNQLGGADKATPKSVLKLMGIQGLTLYHLKSHLQKYRLSKNLHGQANASGANKV-----  114

Query  1275  DAATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRI  1096
               A G D+I E +   +++ +IGP  N N+ ISEAIQIQIEVQRRLHEQLE      LRI
Sbjct  115   --AAGEDRISENSATCMSNPSIGPQPNKNIQISEAIQIQIEVQRRLHEQLE------LRI  166

Query  1095  EAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGF  916
             EAQGKYL AVLEKAQETLGRQD+G +GLEAAK QLSELVS VSNQCLN  FS I+E+ GF
Sbjct  167   EAQGKYLHAVLEKAQETLGRQDMGTVGLEAAKIQLSELVSTVSNQCLNPTFSDIQEISGF  226

Query  915   CQQQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQ  736
               QQ Q TQ  D S+DSCLTS EGSLRD+ M N+Q+GLR   F   +E  D+ N+TR++Q
Sbjct  227   SSQQTQTTQLADRSIDSCLTSCEGSLRDNTMHNNQIGLRPFEFTPSIECKDIENDTRIQQ  286

Query  735   TEFRWCDDIWENRKYLSKMDE--------ETKNNGLSVSTGLQGGKWNGNSNYSDRRFTG  580
             T  RWCD++ ENRK  S +DE        ET    LS+S GLQ G  +G+SN+SD +F  
Sbjct  287   TGLRWCDNLKENRKLFSAIDEGKEKAFTTETNCKNLSMSIGLQDGNLDGSSNHSDGKFNE  346

Query  579   TDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNGF  400
             T+  V+ F QA +R D S  E+QK+SQEYKL YF PKLDLN  D+TD ASSCKQ DLNGF
Sbjct  347   TNTAVRHFHQAANRGD-SMQERQKSSQEYKLSYFAPKLDLNIHDETDAASSCKQFDLNGF  405

Query  399   SW  394
             SW
Sbjct  406   SW  407



>ref|XP_011077862.1| PREDICTED: uncharacterized protein LOC105161758 [Sesamum indicum]
Length=413

 Score =   528 bits (1360),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 269/422 (64%), Positives = 313/422 (74%), Gaps = 19/422 (5%)
 Frame = -2

Query  1632  MYHHH-RQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFV  1456
             MYHH   QGK++H S  M +P ERHLF+QG NG GDSGLVLSTDAKPRLKWT DLHERFV
Sbjct  1     MYHHQSHQGKNIHSSARMSIPSERHLFLQGANGTGDSGLVLSTDAKPRLKWTPDLHERFV  60

Query  1455  EAVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGM  1276
             EAVNQLGGA+KATPKSVLK MGIQGLTLYHLKSHLQKYRLSKNLHG ANS SNK      
Sbjct  61    EAVNQLGGAEKATPKSVLKLMGIQGLTLYHLKSHLQKYRLSKNLHGQANSGSNKL-----  115

Query  1275  DAATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRI  1096
                + +D++PE NG H+++  I      N+ + EAIQ+QIEVQRRLHEQLEVQRHLQL+I
Sbjct  116   ---STADRVPEMNGTHMSNPTIAS-QTKNMHLGEAIQMQIEVQRRLHEQLEVQRHLQLQI  171

Query  1095  EAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGF  916
             EAQGKYLQAVLEKAQETLGRQ+LG MGLEAAK QLS+LVSKVS QCLNSAFSGIKEL   
Sbjct  172   EAQGKYLQAVLEKAQETLGRQNLGTMGLEAAKVQLSDLVSKVSTQCLNSAFSGIKELSDL  231

Query  915   CQQQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQ  736
             C Q+ Q +QPTD S DSCLTS +GS+RD +  N  +G++ +NF A  E    YNET L +
Sbjct  232   CLQKTQTSQPTDLSTDSCLTSCDGSMRDQDQYNP-IGVKPINFKAPTEPRVNYNETSLGK  290

Query  735   TEFRWCDDIWENRKYLSKMDEETKN--------NGLSVSTGLQGGKWNGNSNYSDRRFTG  580
             +E RW DD+ E   +LS  ++  +N        N LS+S GLQ  +WNGN NY ++ F G
Sbjct  291   SELRWPDDLKEGENFLSTANDSVENAFLTESNFNSLSMSIGLQSSEWNGNRNYPEKGFKG  350

Query  579   TDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNGF  400
              +A V  F Q+ D ++ S PEKQK   E KLP    KLDLNTDD+ +VAS CKQLDLNGF
Sbjct  351   AEAAVNFFNQSTDSNNISNPEKQKIPPELKLPLLSTKLDLNTDDQNNVASHCKQLDLNGF  410

Query  399   SW  394
              W
Sbjct  411   CW  412



>ref|XP_007030697.1| Homeodomain-like superfamily protein isoform 2 [Theobroma cacao]
 ref|XP_007030698.1| Homeodomain-like superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY11199.1| Homeodomain-like superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY11200.1| Homeodomain-like superfamily protein isoform 2 [Theobroma cacao]
Length=414

 Score =   509 bits (1312),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 264/428 (62%), Positives = 317/428 (74%), Gaps = 28/428 (7%)
 Frame = -2

Query  1632  MYHHHRQ--GKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERF  1459
             MYHHH Q  GK++HPS+ M +PPERHLF+QG NG GDSGLVLSTDAKPRLKWT DLHERF
Sbjct  1     MYHHHHQHQGKNIHPSSRMPIPPERHLFLQGGNGPGDSGLVLSTDAKPRLKWTPDLHERF  60

Query  1458  VEAVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSG  1279
             +EAVNQLGGADKATPK+V+K MGI GLTLYHLKSHLQKYRLSKNLHG AN+ SNK  +  
Sbjct  61    IEAVNQLGGADKATPKTVMKLMGIPGLTLYHLKSHLQKYRLSKNLHGQANNGSNKIGAVA  120

Query  1278  MDAATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLR  1099
             M      D++ EANG H+N+ +IGP AN  L I EA+Q+QIEVQRRLHEQLEVQRHLQLR
Sbjct  121   M----AGDRMSEANGTHVNNLSIGPQANNGLQIGEALQMQIEVQRRLHEQLEVQRHLQLR  176

Query  1098  IEAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPG  919
             IEAQGKYLQAVLEKAQETLGRQ+LG +GLEAAK QLSELVSKVSNQCLNSAFS +K+L G
Sbjct  177   IEAQGKYLQAVLEKAQETLGRQNLGSVGLEAAKVQLSELVSKVSNQCLNSAFSDLKDLQG  236

Query  918   FCQQQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNF-GAHMESTDLYNETRL  742
              C QQ QAT PTDCS+DSCLTS EGS ++ E+ N+ M LR  N  GA +E  ++  +  L
Sbjct  237   LCPQQTQATPPTDCSMDSCLTSCEGSQKEQEIHNNGMCLRPYNTSGALLEQREIAEDPLL  296

Query  741   KQTEFRWCDDIWENRKYLSKMDEETK---------NNGLSVSTGLQGGKWNG--NSNYSD  595
              QTE +  +DI EN+ +LS + ++ +         ++ LS+S GLQG K NG  +S++S+
Sbjct  297   PQTELKSFEDIKENKMFLSSLGKDAERRMFFADRSSSDLSMSVGLQGEKGNGGNSSSFSE  356

Query  594   RRFTGTDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQL  415
              +F G + D     +   R+D          +  +LPYF  KLDLN  ++ D ASSCKQ 
Sbjct  357   AKFKGRNEDDSFLDRGNKRAD----------EVNRLPYFATKLDLNVHEENDAASSCKQF  406

Query  414   DLNGFSWN  391
             DLNG SWN
Sbjct  407   DLNGLSWN  414



>ref|XP_011034346.1| PREDICTED: uncharacterized protein LOC105132500 isoform X1 [Populus 
euphratica]
Length=422

 Score =   509 bits (1310),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 264/426 (62%), Positives = 312/426 (73%), Gaps = 16/426 (4%)
 Frame = -2

Query  1632  MYHHHR-QGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFV  1456
             MYHHH+ QGKS+H S+ M +PPERHLF+QG NG GDSGLVLSTDAKPRLKWT DLHER +
Sbjct  1     MYHHHQHQGKSIHSSSRMAIPPERHLFLQGGNGPGDSGLVLSTDAKPRLKWTPDLHERVI  60

Query  1455  EAVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGM  1276
             EAVNQLGGADKATPK+V+K MGI GLTLYHLKSHLQKYRLSKNLHG A   S+K    G 
Sbjct  61    EAVNQLGGADKATPKTVMKLMGIPGLTLYHLKSHLQKYRLSKNLHGQATIGSSKI---GT  117

Query  1275  DAATGSDKIPEANGNHINSAN--IGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQL  1102
              A  G D++PEAN  HIN  N  IG   N +L  SEA+Q+QIEVQRRLHEQLEVQRHLQL
Sbjct  118   VAVVG-DRMPEANATHININNLSIGSQPNKSLHFSEALQMQIEVQRRLHEQLEVQRHLQL  176

Query  1101  RIEAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELP  922
             RIEAQGKYLQAVLEKAQETLGRQ+LG +GLEAAK QLSELVSKVS QCLNS FS + +L 
Sbjct  177   RIEAQGKYLQAVLEKAQETLGRQNLGTVGLEAAKVQLSELVSKVSTQCLNSTFSELNDLQ  236

Query  921   GFCQQQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRL  742
             G C QQ   TQP DCS+DSCLTS EGS ++ E+ N+ MGLR  N  A +E  ++  E  L
Sbjct  237   GLCPQQTPPTQPNDCSMDSCLTSCEGSQKEQEIHNTGMGLRPCNSNAFVEPKEITEEHAL  296

Query  741   KQTEFRWCDDIWENRKYLSKMDEETKN---------NGLSVSTGLQGGKWNGNSNYSDRR  589
             +QTE +W + + EN+ +L+ +  ET+          + LS+  GLQG K N +S++++ R
Sbjct  297   QQTELKWGEYLRENKMFLTSIGHETERRTFSAERSCSDLSIGVGLQGEKGNISSSFAEGR  356

Query  588   FTGTDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDL  409
             F G   D     Q   R D+ K E +K S  Y+L YF  KLDLN+ ++ D ASSCKQLDL
Sbjct  357   FKGMSEDDSFQDQTNKRDDSVKFENEKMSPGYRLSYFTTKLDLNSHEEIDAASSCKQLDL  416

Query  408   NGFSWN  391
             NGFSWN
Sbjct  417   NGFSWN  422



>ref|XP_002319702.2| myb family transcription factor family protein [Populus trichocarpa]
 gb|EEE95625.2| myb family transcription factor family protein [Populus trichocarpa]
Length=427

 Score =   507 bits (1305),  Expect = 7e-172, Method: Compositional matrix adjust.
 Identities = 264/431 (61%), Positives = 314/431 (73%), Gaps = 21/431 (5%)
 Frame = -2

Query  1632  MYHHHR-QGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFV  1456
             MYHHH+ QGKS+H S+ M +PPERHLF+QG NG GDSGLVLSTDAKPRLKWT DLHERF+
Sbjct  1     MYHHHQHQGKSIHSSSRMAIPPERHLFLQGGNGPGDSGLVLSTDAKPRLKWTPDLHERFI  60

Query  1455  EAVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGM  1276
             EAVNQLGGADKATPK+V+K MGI GLTLYHLKSHLQKYRLSKNLHG AN  S+K    G 
Sbjct  61    EAVNQLGGADKATPKTVMKLMGIPGLTLYHLKSHLQKYRLSKNLHGQANIGSSKI---GT  117

Query  1275  DAATGSDKIPEANGNHINSANIGP-------LANTNLPISEAIQIQIEVQRRLHEQLEVQ  1117
              A  G D++PEAN  HIN  N+         L + +L  SEA+Q+QIEVQRRLHEQLEVQ
Sbjct  118   VAVVG-DRMPEANATHININNLSIGSQPNKILKSRSLHFSEALQMQIEVQRRLHEQLEVQ  176

Query  1116  RHLQLRIEAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSG  937
             RHLQLRIEAQGKYLQAVLEKAQETLGRQ+LG +GLEAAK QLSELVSKVS QCLNS FS 
Sbjct  177   RHLQLRIEAQGKYLQAVLEKAQETLGRQNLGTVGLEAAKVQLSELVSKVSTQCLNSTFSE  236

Query  936   IKELPGFCQQQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLY  757
             + +L G C QQ   TQP DCS+DSCLTS EGS ++ E+ N  MGLR  N  A +E  ++ 
Sbjct  237   LNDLQGLCPQQTPPTQPNDCSMDSCLTSCEGSQKEQEIHNIGMGLRPCNSNALLEPKEIA  296

Query  756   NETRLKQTEFRWCDDIWENRKYLSKMDEETKN---------NGLSVSTGLQGGKWNGNSN  604
              E  L+QTE +W + + +N+ +L+ +  ET+          + LS+  GLQG K N NS+
Sbjct  297   EEHALQQTELKWGEYLRDNKMFLTSIGHETERRTFSAERSCSDLSIGVGLQGEKGNINSS  356

Query  603   YSDRRFTGTDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSC  424
             +++ RF G   D     Q   R+++ K E +K S  Y+L YF  KLDLN+ D+ D ASSC
Sbjct  357   FAEGRFKGMSEDDSFQDQTNKRAESVKFEDEKMSPGYRLSYFTTKLDLNSHDEIDAASSC  416

Query  423   KQLDLNGFSWN  391
             KQLDLNGFSWN
Sbjct  417   KQLDLNGFSWN  427



>ref|XP_002525443.1| transcription factor, putative [Ricinus communis]
 gb|EEF36933.1| transcription factor, putative [Ricinus communis]
Length=419

 Score =   506 bits (1304),  Expect = 7e-172, Method: Compositional matrix adjust.
 Identities = 268/426 (63%), Positives = 315/426 (74%), Gaps = 19/426 (4%)
 Frame = -2

Query  1632  MYHHHR-QGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFV  1456
             MYHHH+ QGKS+H S+ M +PPERHLF+QG NG GDSGLVLSTDAKPRLKWT DLHE F+
Sbjct  1     MYHHHQHQGKSVHSSSRMSIPPERHLFLQGGNGPGDSGLVLSTDAKPRLKWTSDLHEHFI  60

Query  1455  EAVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGM  1276
             EAVNQLGGADKATPK+V+K MGI GLTLYHLKSHLQKYRLSKNLHG ANS SNK    G 
Sbjct  61    EAVNQLGGADKATPKTVMKLMGIPGLTLYHLKSHLQKYRLSKNLHGQANSGSNKI---GT  117

Query  1275  DAATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRI  1096
              A  G D+I E N  HIN+ ++G   N  L I EA+Q+QIEVQRRLHEQLEVQRHLQLRI
Sbjct  118   GAVVG-DRISETNVTHINNLSMGTQTNKGLHIGEALQMQIEVQRRLHEQLEVQRHLQLRI  176

Query  1095  EAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGF  916
             EAQGKYLQ+VLEKAQETLGRQ+LG +GLEAAK QLSELVSKVS QCLNSAFS +KEL G 
Sbjct  177   EAQGKYLQSVLEKAQETLGRQNLGSIGLEAAKVQLSELVSKVSTQCLNSAFSELKELQGL  236

Query  915   CQQQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQ  736
             C QQ Q   PTDCS+DSCLTS EGS ++ E+ N+ MGLR  N  A +ES D+     L Q
Sbjct  237   CHQQTQTAPPTDCSMDSCLTSCEGSQKEQEIHNTGMGLRPYNGNALLESKDITEGHVLHQ  296

Query  735   TEFRWCDDIWENRKYLSKMDE---------ETKNNGLSVSTGLQGGKWNGN-SNYSDRRF  586
             TE +W +D+ +N+ +LS +           E   + LS++ GLQG   NGN S++S+ R+
Sbjct  297   TELKWSEDLKDNKMFLSPLGNNAARRNFAAERSTSDLSMTVGLQG--ENGNASSFSEGRY  354

Query  585   TGTDADVKLFAQAVDRS-DTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDL  409
                + D   F    ++S D+ K  K   SQ Y+LPYF  KLDLN+ ++ D ASSCKQLDL
Sbjct  355   KDRN-DGDSFPDQTNKSLDSVKLPKGDVSQGYRLPYFATKLDLNSHEEIDAASSCKQLDL  413

Query  408   NGFSWN  391
             NGFSWN
Sbjct  414   NGFSWN  419



>ref|XP_007030696.1| Homeodomain-like superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY11198.1| Homeodomain-like superfamily protein isoform 1 [Theobroma cacao]
Length=478

 Score =   509 bits (1310),  Expect = 7e-172, Method: Compositional matrix adjust.
 Identities = 264/428 (62%), Positives = 316/428 (74%), Gaps = 28/428 (7%)
 Frame = -2

Query  1632  MYHHHRQ--GKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERF  1459
             MYHHH Q  GK++HPS+ M +PPERHLF+QG NG GDSGLVLSTDAKPRLKWT DLHERF
Sbjct  65    MYHHHHQHQGKNIHPSSRMPIPPERHLFLQGGNGPGDSGLVLSTDAKPRLKWTPDLHERF  124

Query  1458  VEAVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSG  1279
             +EAVNQLGGADKATPK+V+K MGI GLTLYHLKSHLQKYRLSKNLHG AN+ SNK  +  
Sbjct  125   IEAVNQLGGADKATPKTVMKLMGIPGLTLYHLKSHLQKYRLSKNLHGQANNGSNKIGAVA  184

Query  1278  MDAATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLR  1099
             M      D++ EANG H+N+ +IGP AN  L I EA+Q+QIEVQRRLHEQLEVQRHLQLR
Sbjct  185   M----AGDRMSEANGTHVNNLSIGPQANNGLQIGEALQMQIEVQRRLHEQLEVQRHLQLR  240

Query  1098  IEAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPG  919
             IEAQGKYLQAVLEKAQETLGRQ+LG +GLEAAK QLSELVSKVSNQCLNSAFS +K+L G
Sbjct  241   IEAQGKYLQAVLEKAQETLGRQNLGSVGLEAAKVQLSELVSKVSNQCLNSAFSDLKDLQG  300

Query  918   FCQQQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNF-GAHMESTDLYNETRL  742
              C QQ QAT PTDCS+DSCLTS EGS ++ E+ N+ M LR  N  GA +E  ++  +  L
Sbjct  301   LCPQQTQATPPTDCSMDSCLTSCEGSQKEQEIHNNGMCLRPYNTSGALLEQREIAEDPLL  360

Query  741   KQTEFRWCDDIWENRKYLSKMDEETK---------NNGLSVSTGLQGGKWNG--NSNYSD  595
              QTE +  +DI EN+ +LS + ++ +         ++ LS+S GLQG K NG  +S++S+
Sbjct  361   PQTELKSFEDIKENKMFLSSLGKDAERRMFFADRSSSDLSMSVGLQGEKGNGGNSSSFSE  420

Query  594   RRFTGTDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQL  415
              +F G + D     +   R+D             +LPYF  KLDLN  ++ D ASSCKQ 
Sbjct  421   AKFKGRNEDDSFLDRGNKRADEVN----------RLPYFATKLDLNVHEENDAASSCKQF  470

Query  414   DLNGFSWN  391
             DLNG SWN
Sbjct  471   DLNGLSWN  478



>ref|XP_011034347.1| PREDICTED: uncharacterized protein LOC105132500 isoform X2 [Populus 
euphratica]
Length=421

 Score =   506 bits (1302),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 265/426 (62%), Positives = 312/426 (73%), Gaps = 17/426 (4%)
 Frame = -2

Query  1632  MYHHHR-QGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFV  1456
             MYHHH+ QGKS+H S+ M +PPERHLF+QG NG GDSGLVLSTDAKPRLKWT DLHER +
Sbjct  1     MYHHHQHQGKSIHSSSRMAIPPERHLFLQGGNGPGDSGLVLSTDAKPRLKWTPDLHERVI  60

Query  1455  EAVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGM  1276
             EAVNQLGGADKATPK+V+K MGI GLTLYHLKSHLQKYRLSKNLHG A   S+K    G 
Sbjct  61    EAVNQLGGADKATPKTVMKLMGIPGLTLYHLKSHLQKYRLSKNLHGQATIGSSKI---GT  117

Query  1275  DAATGSDKIPEANGNHINSAN--IGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQL  1102
              A  G D++PEAN  HIN  N  IG   N NL  SEA+Q+QIEVQRRLHEQLEVQRHLQL
Sbjct  118   VAVVG-DRMPEANATHININNLSIGSQPN-NLHFSEALQMQIEVQRRLHEQLEVQRHLQL  175

Query  1101  RIEAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELP  922
             RIEAQGKYLQAVLEKAQETLGRQ+LG +GLEAAK QLSELVSKVS QCLNS FS + +L 
Sbjct  176   RIEAQGKYLQAVLEKAQETLGRQNLGTVGLEAAKVQLSELVSKVSTQCLNSTFSELNDLQ  235

Query  921   GFCQQQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRL  742
             G C QQ   TQP DCS+DSCLTS EGS ++ E+ N+ MGLR  N  A +E  ++  E  L
Sbjct  236   GLCPQQTPPTQPNDCSMDSCLTSCEGSQKEQEIHNTGMGLRPCNSNAFVEPKEITEEHAL  295

Query  741   KQTEFRWCDDIWENRKYLSKMDEETKN---------NGLSVSTGLQGGKWNGNSNYSDRR  589
             +QTE +W + + EN+ +L+ +  ET+          + LS+  GLQG K N +S++++ R
Sbjct  296   QQTELKWGEYLRENKMFLTSIGHETERRTFSAERSCSDLSIGVGLQGEKGNISSSFAEGR  355

Query  588   FTGTDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDL  409
             F G   D     Q   R D+ K E +K S  Y+L YF  KLDLN+ ++ D ASSCKQLDL
Sbjct  356   FKGMSEDDSFQDQTNKRDDSVKFENEKMSPGYRLSYFTTKLDLNSHEEIDAASSCKQLDL  415

Query  408   NGFSWN  391
             NGFSWN
Sbjct  416   NGFSWN  421



>ref|XP_011094327.1| PREDICTED: uncharacterized protein LOC105174060 [Sesamum indicum]
Length=399

 Score =   504 bits (1298),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 263/416 (63%), Positives = 308/416 (74%), Gaps = 19/416 (5%)
 Frame = -2

Query  1632  MYHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVE  1453
             MYHHH QGK++  S+ M +PPERHLF+QG NG GDSGLVLSTDAKPRLKWT DLHERF+E
Sbjct  1     MYHHHHQGKNIQTSSRMSVPPERHLFLQGVNGTGDSGLVLSTDAKPRLKWTPDLHERFIE  60

Query  1452  AVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMD  1273
             AVNQLGGA+KATPKSVLK MGIQGLTLYHLKSHLQKYRLSKNLHG ANS SNK       
Sbjct  61    AVNQLGGAEKATPKSVLKLMGIQGLTLYHLKSHLQKYRLSKNLHGQANSGSNK-------  113

Query  1272  AATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIE  1093
              A   D++P AN  H+++ +       N+ + EAIQ+QIE QRRLHEQLEVQRHLQLRIE
Sbjct  114   -AAAGDRMPGANVTHMSNQHTANQTTKNMQLGEAIQMQIEAQRRLHEQLEVQRHLQLRIE  172

Query  1092  AQGKYLQAVLEKAQETLGRQ-DLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGF  916
             AQGKYLQ+VLEKAQETLG Q ++G +GLEAAK QLS+ +SKVS QCLNSAFSG+KEL   
Sbjct  173   AQGKYLQSVLEKAQETLGGQPNMGTIGLEAAKIQLSDFMSKVSAQCLNSAFSGMKELSDL  232

Query  915   CQQQAQATQPTDCSLDSCLTSS-EGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLK  739
             C QQ Q TQPTDCS +SCLTSS EGSLRD E+ N+ MG +   + A  E  D   ETR  
Sbjct  233   CLQQKQTTQPTDCSFESCLTSSFEGSLRDQELHNNLMGFKPTTYRAPAEQRDNETETR--  290

Query  738   QTEFRWCDDIWENRKYLSKMDEETKNNGLSVSTGLQGGKWNGNSNYSDRRFTGTDADVKL  559
              T F   +   E + +L+    ET ++ LS+S GLQ G WN + N+ + R    +AD+K 
Sbjct  291   -TFFSTANGTSE-KAFLA----ETNSSNLSMSIGLQSGTWNCSGNHPEERIKA-NADIKF  343

Query  558   FAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNGFSWN  391
             F+Q  D +D  K EKQKTS E KLP F  KLDLNTDD+ D ASSCK+LDLNGFSW+
Sbjct  344   FSQKTDNNDVMKLEKQKTSSELKLPLFSTKLDLNTDDENDAASSCKKLDLNGFSWS  399



>gb|KDP20269.1| hypothetical protein JCGZ_06855 [Jatropha curcas]
Length=417

 Score =   503 bits (1296),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 270/424 (64%), Positives = 314/424 (74%), Gaps = 17/424 (4%)
 Frame = -2

Query  1632  MYHHHR-QGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFV  1456
             MYHHH+ QGKS+H S+ M +PPERHLF+QG NG GDSGLVLSTDAKPRLKWT DLHERF+
Sbjct  1     MYHHHQHQGKSVHSSSRMPIPPERHLFLQGGNGPGDSGLVLSTDAKPRLKWTPDLHERFI  60

Query  1455  EAVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGM  1276
             EAVNQLGGADKATPK+V+K MGI GLTLYHLKSHLQKYRLSKNLHG ANS S+K  +   
Sbjct  61    EAVNQLGGADKATPKTVMKLMGIPGLTLYHLKSHLQKYRLSKNLHGQANSGSSKIGA---  117

Query  1275  DAATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRI  1096
              AA  SD++ EAN  H+N+ +IGP  N +L ISEA+Q+QIEVQRRLHEQLEVQRHLQLRI
Sbjct  118   -AAVTSDRMSEANVTHMNNLSIGPQTNKSLHISEALQMQIEVQRRLHEQLEVQRHLQLRI  176

Query  1095  EAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGF  916
             EAQGKYLQAVLEKAQETLGRQ+LG MGLEAAK QLSELVSKVS QCLNSAFS +KEL G 
Sbjct  177   EAQGKYLQAVLEKAQETLGRQNLGTMGLEAAKVQLSELVSKVSTQCLNSAFSELKELQGL  236

Query  915   CQQQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQ  736
             C QQ Q T PTDCS+DSCLTS EGS ++ E+ N+ MGLR  N  A +ES D+  E  L Q
Sbjct  237   CPQQTQTTPPTDCSVDSCLTSCEGSQKEQEIHNTGMGLRPYNGSALLESKDMAEEHMLHQ  296

Query  735   TEFRWCDDIWENRKYLSKMDEETKNNGL---------SVSTGLQGGKWNGNSNYSDRRFT  583
             TE +W +D   N+ +LS M    +             S+  GLQG   N  S +S+ R+ 
Sbjct  297   TELKWGED---NKMFLSPMGNNAERRIFSSERSSSDLSMRVGLQGESRNPCSGFSEGRYK  353

Query  582   GTDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNG  403
               + D K   Q    +D+ K + +  S  Y+LPYF  KLDLNT D+ D AS+CKQLDLNG
Sbjct  354   ERNDDDKFPDQTKKTADSVKLQNENISPGYRLPYFATKLDLNTHDEIDAASTCKQLDLNG  413

Query  402   FSWN  391
             FSWN
Sbjct  414   FSWN  417



>ref|XP_011034348.1| PREDICTED: uncharacterized protein LOC105132500 isoform X3 [Populus 
euphratica]
Length=417

 Score =   502 bits (1293),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 261/424 (62%), Positives = 311/424 (73%), Gaps = 17/424 (4%)
 Frame = -2

Query  1632  MYHHHR-QGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFV  1456
             MYHHH+ QGKS+H S+ M +PPERHLF+QG NG GDSGLVLSTDAKPRLKWT DLHER +
Sbjct  1     MYHHHQHQGKSIHSSSRMAIPPERHLFLQGGNGPGDSGLVLSTDAKPRLKWTPDLHERVI  60

Query  1455  EAVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGM  1276
             EAVNQLGGADKATPK+V+K MGI GLTLYHLKSHLQKYRLSKNLHG A   S+K    G 
Sbjct  61    EAVNQLGGADKATPKTVMKLMGIPGLTLYHLKSHLQKYRLSKNLHGQATIGSSKI---GT  117

Query  1275  DAATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRI  1096
              A  G D++PEAN  HIN   I  L+  + P +EA+Q+QIEVQRRLHEQLEVQRHLQLRI
Sbjct  118   VAVVG-DRMPEANATHIN---INNLSIGSQPNNEALQMQIEVQRRLHEQLEVQRHLQLRI  173

Query  1095  EAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGF  916
             EAQGKYLQAVLEKAQETLGRQ+LG +GLEAAK QLSELVSKVS QCLNS FS + +L G 
Sbjct  174   EAQGKYLQAVLEKAQETLGRQNLGTVGLEAAKVQLSELVSKVSTQCLNSTFSELNDLQGL  233

Query  915   CQQQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQ  736
             C QQ   TQP DCS+DSCLTS EGS ++ E+ N+ MGLR  N  A +E  ++  E  L+Q
Sbjct  234   CPQQTPPTQPNDCSMDSCLTSCEGSQKEQEIHNTGMGLRPCNSNAFVEPKEITEEHALQQ  293

Query  735   TEFRWCDDIWENRKYLSKMDEETKN---------NGLSVSTGLQGGKWNGNSNYSDRRFT  583
             TE +W + + EN+ +L+ +  ET+          + LS+  GLQG K N +S++++ RF 
Sbjct  294   TELKWGEYLRENKMFLTSIGHETERRTFSAERSCSDLSIGVGLQGEKGNISSSFAEGRFK  353

Query  582   GTDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNG  403
             G   D     Q   R D+ K E +K S  Y+L YF  KLDLN+ ++ D ASSCKQLDLNG
Sbjct  354   GMSEDDSFQDQTNKRDDSVKFENEKMSPGYRLSYFTTKLDLNSHEEIDAASSCKQLDLNG  413

Query  402   FSWN  391
             FSWN
Sbjct  414   FSWN  417



>ref|XP_002325408.2| myb family transcription factor family protein [Populus trichocarpa]
 gb|EEE99789.2| myb family transcription factor family protein [Populus trichocarpa]
Length=420

 Score =   497 bits (1280),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 257/424 (61%), Positives = 309/424 (73%), Gaps = 14/424 (3%)
 Frame = -2

Query  1632  MYHHHR-QGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFV  1456
             MY HH+ QGK++H S+   +PPERHLF+Q  NG GDSGLVLSTDAKPRLKWT DLHERF+
Sbjct  1     MYQHHQHQGKNIHSSSRNSIPPERHLFLQVGNGPGDSGLVLSTDAKPRLKWTPDLHERFI  60

Query  1455  EAVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGM  1276
             EAVNQLGGADKATPK+V+K MGI GLTLYHLKSHLQKYRLSKNLHG ANS SNK   SG 
Sbjct  61    EAVNQLGGADKATPKTVMKLMGIPGLTLYHLKSHLQKYRLSKNLHGQANSGSNK---SGT  117

Query  1275  DAATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRI  1096
              A  G D++PE N  HIN+ +IG   N +L  SEA+Q+QIEVQRRLHEQLEVQRHLQLRI
Sbjct  118   VAVVG-DRMPEVNATHINNLSIGSQTNKSLHFSEALQVQIEVQRRLHEQLEVQRHLQLRI  176

Query  1095  EAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGF  916
             EAQGKYLQ+VLEKAQETLGRQ+LG +GLEAAK QLSELVSKVS++CLNSAFS +K+L G 
Sbjct  177   EAQGKYLQSVLEKAQETLGRQNLGTVGLEAAKVQLSELVSKVSSKCLNSAFSELKDLQGL  236

Query  915   CQQQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQ  736
             C    Q T P DCS+DSCLTS EGS ++ E+ N+ MGLR  N  A +E   +  E  L+Q
Sbjct  237   CPPLTQPTHPNDCSMDSCLTSIEGSQKEQEIHNTGMGLRPYNGNALLEPKVIAGEHALQQ  296

Query  735   TEFRWCDDIWENRKYLSKMDEETKN---------NGLSVSTGLQGGKWNGNSNYSDRRFT  583
             TE +W +D  +N+ +LS M  +T           + LS+  GLQG + N +S++++ RF 
Sbjct  297   TELKWGEDQRDNKMFLSSMRNDTDRRTFSAERSCSNLSIGVGLQGERGNVSSSFAEARFK  356

Query  582   GTDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNG  403
             G   D     +   R D  K E +K S  Y+L Y+  KLDLN+  + D AS C+QLDLNG
Sbjct  357   GRSEDDSFQDKTNRRIDAIKLENEKLSPGYRLSYYATKLDLNSHGEIDAASGCRQLDLNG  416

Query  402   FSWN  391
             FSWN
Sbjct  417   FSWN  420



>ref|XP_002282324.1| PREDICTED: uncharacterized protein LOC100248614 [Vitis vinifera]
 ref|XP_010653833.1| PREDICTED: uncharacterized protein LOC100248614 [Vitis vinifera]
Length=418

 Score =   494 bits (1272),  Expect = 6e-167, Method: Compositional matrix adjust.
 Identities = 260/426 (61%), Positives = 311/426 (73%), Gaps = 23/426 (5%)
 Frame = -2

Query  1629  YHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEA  1450
             +HHH QGK++HPS+   + PER+LF+QG NG GDSGLVLSTDAKPRLKWT DLHERF+EA
Sbjct  3     HHHHHQGKNIHPSSRTPITPERNLFLQGGNGPGDSGLVLSTDAKPRLKWTPDLHERFIEA  62

Query  1449  VNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDA  1270
             VNQLGGADKATPK+V+K MGI GLTLYHLKSHLQKYRLSKNLHG ANS+++K +      
Sbjct  63    VNQLGGADKATPKTVMKLMGIPGLTLYHLKSHLQKYRLSKNLHGQANSATSKTVV-----  117

Query  1269  ATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEA  1090
                 +++PEANG  ++S NIG   N +L +SE +Q+ IE QRRLHEQLEVQRHLQLRIEA
Sbjct  118   ---GERMPEANGALMSSPNIGNQTNKSLHLSETLQM-IEAQRRLHEQLEVQRHLQLRIEA  173

Query  1089  QGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFCQ  910
             QGKYLQAVLEKAQETLGRQ+LG +GLEAAK QLSELVSKVS QCL+SAFS +KEL   C 
Sbjct  174   QGKYLQAVLEKAQETLGRQNLGAVGLEAAKVQLSELVSKVSTQCLHSAFSELKELQSLCP  233

Query  909   QQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAH-MESTDLYNETRLKQT  733
             QQ Q TQPTDCS+DSCLTS EGS R+ E+ N  MGLR    G+  +E+ D      L+ T
Sbjct  234   QQTQ-TQPTDCSMDSCLTSCEGSQREQEIHNCGMGLRPYTNGSTPLEAKDTAEPPGLQHT  292

Query  732   EFRWCDDIWENRKYLSKMDE---------ETKNNGLSVSTGLQGGKWNGNSNYSDRRFTG  580
               +WC+D  ENR+++S M           E  N+ LS+  GLQG K NG+++YS+ RF G
Sbjct  293   VLKWCEDTKENRQFISSMQRDAERRTMTAERSNSDLSMRIGLQGEKGNGSNSYSEGRFKG  352

Query  579   -TDAD--VKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDL  409
               +AD  V       D  ++ K E +K S  Y+LP FG KLDLN  D+ DV  SCKQ DL
Sbjct  353   RAEADNFVDRTNHGADSGNSVKQENEKMSHGYRLPCFGAKLDLNAHDENDVTLSCKQFDL  412

Query  408   NGFSWN  391
             NGFSWN
Sbjct  413   NGFSWN  418



>gb|KDO55093.1| hypothetical protein CISIN_1g013552mg [Citrus sinensis]
Length=399

 Score =   486 bits (1251),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 253/416 (61%), Positives = 302/416 (73%), Gaps = 19/416 (5%)
 Frame = -2

Query  1632  MYHHHR-QGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFV  1456
             MYHHH+ QGKSMH S+ M +P ERHLF+QG +G GDSGLVLSTDAKPRLKWT DLHERF+
Sbjct  1     MYHHHQNQGKSMHSSSRMPIPTERHLFLQGGSGPGDSGLVLSTDAKPRLKWTPDLHERFI  60

Query  1455  EAVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGM  1276
             EAVNQLGGADKATPK+V+K MGI GLTLYHLKSHLQKYRLSKNLHG AN  +NK ++   
Sbjct  61    EAVNQLGGADKATPKTVMKLMGIPGLTLYHLKSHLQKYRLSKNLHGQANIGNNKIVT---  117

Query  1275  DAATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRI  1096
                   +++PEAN  H+N+ +IGP  N +L ISE IQ+QIEVQRRLHEQLEVQRHLQLRI
Sbjct  118   ---VPGERMPEANATHMNNLSIGPQPNKSLHISETIQMQIEVQRRLHEQLEVQRHLQLRI  174

Query  1095  EAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGF  916
             EAQGKYLQAVLEKAQETLGRQ+LG  GLEAAK QLSELVSKVS QCLNS FS +KEL GF
Sbjct  175   EAQGKYLQAVLEKAQETLGRQNLGTAGLEAAKVQLSELVSKVSTQCLNSTFSDLKELQGF  234

Query  915   CQQQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQ  736
             C QQ QA QPTDCS+DSCLTS EGS +D E+ N  + LR  +    +E  ++  E  L+Q
Sbjct  235   CPQQPQANQPTDCSMDSCLTSCEGSQKDQEIHNGGVRLRPYHGTPTLEPKEIVEEPMLQQ  294

Query  735   TEFRWCDDIWENRKYLSKMDEETKNNGLSVSTGLQGGKWNGNSNYSDRRFTGTDADVKLF  556
             TE +W  D+ E+ K+LS + ++     LS+ +G          ++   RF  ++ D    
Sbjct  295   TELKWRKDLKES-KFLSSIGKDRGPGELSIGSG----------SFPAGRFKASNEDEHFQ  343

Query  555   AQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNT-DDKTDVASSCKQLDLNGFSWN  391
              Q   + + +K E +    EY+LP F  KLDLN  D + DVAS CKQ DLNGFSWN
Sbjct  344   DQTNKKPEGAKLENENLLPEYRLPCFSTKLDLNAHDHENDVASGCKQFDLNGFSWN  399



>gb|KDO55095.1| hypothetical protein CISIN_1g013552mg [Citrus sinensis]
Length=416

 Score =   486 bits (1251),  Expect = 7e-164, Method: Compositional matrix adjust.
 Identities = 254/427 (59%), Positives = 303/427 (71%), Gaps = 24/427 (6%)
 Frame = -2

Query  1632  MYHHHR-QGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFV  1456
             MYHHH+ QGKSMH S+ M +P ERHLF+QG +G GDSGLVLSTDAKPRLKWT DLHERF+
Sbjct  1     MYHHHQNQGKSMHSSSRMPIPTERHLFLQGGSGPGDSGLVLSTDAKPRLKWTPDLHERFI  60

Query  1455  EAVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGM  1276
             EAVNQLGGADKATPK+V+K MGI GLTLYHLKSHLQKYRLSKNLHG AN  +NK   +G+
Sbjct  61    EAVNQLGGADKATPKTVMKLMGIPGLTLYHLKSHLQKYRLSKNLHGQANIGNNKIAHTGI  120

Query  1275  -----------DAATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQ  1129
                              +++PEAN  H+N+ +IGP  N +L ISE IQ+QIEVQRRLHEQ
Sbjct  121   GGMKFKSSGVGPVTVPGERMPEANATHMNNLSIGPQPNKSLHISETIQMQIEVQRRLHEQ  180

Query  1128  LEVQRHLQLRIEAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNS  949
             LEVQRHLQLRIEAQGKYLQAVLEKAQETLGRQ+LG  GLEAAK QLSELVSKVS QCLNS
Sbjct  181   LEVQRHLQLRIEAQGKYLQAVLEKAQETLGRQNLGTAGLEAAKVQLSELVSKVSTQCLNS  240

Query  948   AFSGIKELPGFCQQQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMES  769
              FS +KEL GFC QQ QA QPTDCS+DSCLTS EGS +D E+ N  + LR  +    +E 
Sbjct  241   TFSDLKELQGFCPQQPQANQPTDCSMDSCLTSCEGSQKDQEIHNGGVRLRPYHGTPTLEP  300

Query  768   TDLYNETRLKQTEFRWCDDIWENRKYLSKMDEETKNNGLSVSTGLQGGKWNGNSNYSDRR  589
              ++  E  L+QTE +W  D+ E+ K+LS + ++     LS+ +G          ++   R
Sbjct  301   KEIVEEPMLQQTELKWRKDLKES-KFLSSIGKDRGPGELSIGSG----------SFPAGR  349

Query  588   FTGTDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNT-DDKTDVASSCKQLD  412
             F  ++ D     Q   + + +K E +    EY+LP F  KLDLN  D + DVAS CKQ D
Sbjct  350   FKASNEDEHFQDQTNKKPEGAKLENENLLPEYRLPCFSTKLDLNAHDHENDVASGCKQFD  409

Query  411   LNGFSWN  391
             LNGFSWN
Sbjct  410   LNGFSWN  416



>ref|XP_006443380.1| hypothetical protein CICLE_v10020171mg [Citrus clementina]
 ref|XP_006479082.1| PREDICTED: uncharacterized protein LOC102612777 isoform X1 [Citrus 
sinensis]
 ref|XP_006479083.1| PREDICTED: uncharacterized protein LOC102612777 isoform X2 [Citrus 
sinensis]
 gb|ESR56620.1| hypothetical protein CICLE_v10020171mg [Citrus clementina]
 gb|KDO55094.1| hypothetical protein CISIN_1g013552mg [Citrus sinensis]
Length=401

 Score =   485 bits (1248),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 255/416 (61%), Positives = 302/416 (73%), Gaps = 17/416 (4%)
 Frame = -2

Query  1632  MYHHHR-QGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFV  1456
             MYHHH+ QGKSMH S+ M +P ERHLF+QG +G GDSGLVLSTDAKPRLKWT DLHERF+
Sbjct  1     MYHHHQNQGKSMHSSSRMPIPTERHLFLQGGSGPGDSGLVLSTDAKPRLKWTPDLHERFI  60

Query  1455  EAVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGM  1276
             EAVNQLGGADKATPK+V+K MGI GLTLYHLKSHLQKYRLSKNLHG AN  +NK    G 
Sbjct  61    EAVNQLGGADKATPKTVMKLMGIPGLTLYHLKSHLQKYRLSKNLHGQANIGNNKI---GP  117

Query  1275  DAATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRI  1096
                 G +++PEAN  H+N+ +IGP  N +L ISE IQ+QIEVQRRLHEQLEVQRHLQLRI
Sbjct  118   VTVPG-ERMPEANATHMNNLSIGPQPNKSLHISETIQMQIEVQRRLHEQLEVQRHLQLRI  176

Query  1095  EAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGF  916
             EAQGKYLQAVLEKAQETLGRQ+LG  GLEAAK QLSELVSKVS QCLNS FS +KEL GF
Sbjct  177   EAQGKYLQAVLEKAQETLGRQNLGTAGLEAAKVQLSELVSKVSTQCLNSTFSDLKELQGF  236

Query  915   CQQQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQ  736
             C QQ QA QPTDCS+DSCLTS EGS +D E+ N  + LR  +    +E  ++  E  L+Q
Sbjct  237   CPQQPQANQPTDCSMDSCLTSCEGSQKDQEIHNGGVRLRPYHGTPTLEPKEIVEEPMLQQ  296

Query  735   TEFRWCDDIWENRKYLSKMDEETKNNGLSVSTGLQGGKWNGNSNYSDRRFTGTDADVKLF  556
             TE +W  D+ E+ K+LS + ++     LS+ +G          ++   RF  ++ D    
Sbjct  297   TELKWRKDLKES-KFLSSIGKDRGPGELSIGSG----------SFPAGRFKASNEDEHFQ  345

Query  555   AQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNT-DDKTDVASSCKQLDLNGFSWN  391
              Q   + + +K E +    EY+LP F  KLDLN  D + DVAS CKQ DLNGFSWN
Sbjct  346   DQTNKKPEGAKLENENLLPEYRLPCFSTKLDLNAHDHENDVASGCKQFDLNGFSWN  401



>ref|XP_011011687.1| PREDICTED: uncharacterized protein LOC105116174 isoform X1 [Populus 
euphratica]
 ref|XP_011011688.1| PREDICTED: uncharacterized protein LOC105116174 isoform X1 [Populus 
euphratica]
Length=409

 Score =   479 bits (1234),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 247/413 (60%), Positives = 299/413 (72%), Gaps = 13/413 (3%)
 Frame = -2

Query  1602  MHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEAVNQLGGADK  1423
             MH S+   +PPERHLF+Q  NG GDSGLVLSTDAKPRLKWT DLHERF+EAVNQLGGADK
Sbjct  1     MHSSSRNSIPPERHLFLQVGNGPGDSGLVLSTDAKPRLKWTPDLHERFIEAVNQLGGADK  60

Query  1422  ATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDAATGSDKIPE  1243
             ATPK+V+K MGI GLTLYHLKSHLQKYRLSKNLHG ANS SN+   SG  +  G D++PE
Sbjct  61    ATPKTVMKLMGIPGLTLYHLKSHLQKYRLSKNLHGQANSGSNR---SGTVSVVG-DRMPE  116

Query  1242  ANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVL  1063
              N   IN+  IG  AN +L  SEA+Q+QIEVQRRLHEQLEVQRHLQLRIEAQGKYLQ+VL
Sbjct  117   VNATRINNLTIGSQANRSLHFSEALQMQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQSVL  176

Query  1062  EKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFCQQQAQATQPT  883
             EKAQETLGRQ+LG +GLEAAK QLSELVSKVS++ LNSAFS +K+L G C QQ Q T P 
Sbjct  177   EKAQETLGRQNLGTVGLEAAKVQLSELVSKVSSKSLNSAFSELKDLQGLCPQQTQPTHPN  236

Query  882   DCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQTEFRWCDDIWE  703
             DCS+DSCLTS EGS ++ E+ N+ MGLR  N  A +E   +  E  L+Q E +W +D+ +
Sbjct  237   DCSMDSCLTSIEGSQKEQEIHNTGMGLRPYNGNALLEPKVIAGEHALQQAELKWGEDLRD  296

Query  702   NRKYLSKMDEETKN---------NGLSVSTGLQGGKWNGNSNYSDRRFTGTDADVKLFAQ  550
             ++ +LS +  +T+          + LS+  GLQG + N +S+++D RF     D      
Sbjct  297   DKMFLSSLKNDTERRTFSAERSCSNLSIGVGLQGERGNVSSSFADARFKRRSEDDSFQDT  356

Query  549   AVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNGFSWN  391
                R D  K E +K S  Y+L Y+  KLDLN+  + D AS C+QLDLNGFSWN
Sbjct  357   TNRRIDAIKLENEKLSPGYRLSYYATKLDLNSHGEIDAASGCRQLDLNGFSWN  409



>ref|XP_011011689.1| PREDICTED: uncharacterized protein LOC105116174 isoform X2 [Populus 
euphratica]
Length=408

 Score =   476 bits (1224),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 247/413 (60%), Positives = 299/413 (72%), Gaps = 14/413 (3%)
 Frame = -2

Query  1602  MHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEAVNQLGGADK  1423
             MH S+   +PPERHLF+Q  NG GDSGLVLSTDAKPRLKWT DLHERF+EAVNQLGGADK
Sbjct  1     MHSSSRNSIPPERHLFLQVGNGPGDSGLVLSTDAKPRLKWTPDLHERFIEAVNQLGGADK  60

Query  1422  ATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDAATGSDKIPE  1243
             ATPK+V+K MGI GLTLYHLKSHLQKYRLSKNLHG ANS SN+   SG  +  G D++PE
Sbjct  61    ATPKTVMKLMGIPGLTLYHLKSHLQKYRLSKNLHGQANSGSNR---SGTVSVVG-DRMPE  116

Query  1242  ANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVL  1063
              N   IN+  IG  AN+ L  SEA+Q+QIEVQRRLHEQLEVQRHLQLRIEAQGKYLQ+VL
Sbjct  117   VNATRINNLTIGSQANS-LHFSEALQMQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQSVL  175

Query  1062  EKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFCQQQAQATQPT  883
             EKAQETLGRQ+LG +GLEAAK QLSELVSKVS++ LNSAFS +K+L G C QQ Q T P 
Sbjct  176   EKAQETLGRQNLGTVGLEAAKVQLSELVSKVSSKSLNSAFSELKDLQGLCPQQTQPTHPN  235

Query  882   DCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQTEFRWCDDIWE  703
             DCS+DSCLTS EGS ++ E+ N+ MGLR  N  A +E   +  E  L+Q E +W +D+ +
Sbjct  236   DCSMDSCLTSIEGSQKEQEIHNTGMGLRPYNGNALLEPKVIAGEHALQQAELKWGEDLRD  295

Query  702   NRKYLSKMDEETKN---------NGLSVSTGLQGGKWNGNSNYSDRRFTGTDADVKLFAQ  550
             ++ +LS +  +T+          + LS+  GLQG + N +S+++D RF     D      
Sbjct  296   DKMFLSSLKNDTERRTFSAERSCSNLSIGVGLQGERGNVSSSFADARFKRRSEDDSFQDT  355

Query  549   AVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNGFSWN  391
                R D  K E +K S  Y+L Y+  KLDLN+  + D AS C+QLDLNGFSWN
Sbjct  356   TNRRIDAIKLENEKLSPGYRLSYYATKLDLNSHGEIDAASGCRQLDLNGFSWN  408



>ref|XP_006443379.1| hypothetical protein CICLE_v10020171mg [Citrus clementina]
 gb|ESR56619.1| hypothetical protein CICLE_v10020171mg [Citrus clementina]
 gb|KDO55096.1| hypothetical protein CISIN_1g013552mg [Citrus sinensis]
 gb|KDO55097.1| hypothetical protein CISIN_1g013552mg [Citrus sinensis]
Length=441

 Score =   476 bits (1225),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 257/452 (57%), Positives = 305/452 (67%), Gaps = 49/452 (11%)
 Frame = -2

Query  1632  MYHHHR-QGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFV  1456
             MYHHH+ QGKSMH S+ M +P ERHLF+QG +G GDSGLVLSTDAKPRLKWT DLHERF+
Sbjct  1     MYHHHQNQGKSMHSSSRMPIPTERHLFLQGGSGPGDSGLVLSTDAKPRLKWTPDLHERFI  60

Query  1455  EAVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKA-----  1291
             EAVNQLGGADKATPK+V+K MGI GLTLYHLKSHLQKYRLSKNLHG AN  +NK      
Sbjct  61    EAVNQLGGADKATPKTVMKLMGIPGLTLYHLKSHLQKYRLSKNLHGQANIGNNKIGKKTI  120

Query  1290  ------------------------------MSSGMDAAT-GSDKIPEANGNHINSANIGP  1204
                                            SSG+   T   +++PEAN  H+N+ +IGP
Sbjct  121   SQKSANYQKDQNCNTYLACKAHTGIGGMKFKSSGVGPVTVPGERMPEANATHMNNLSIGP  180

Query  1203  LANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVLEKAQETLGRQDLG  1024
               N +L ISE IQ+QIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVLEKAQETLGRQ+LG
Sbjct  181   QPNKSLHISETIQMQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVLEKAQETLGRQNLG  240

Query  1023  KMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFCQQQAQATQPTDCSLDSCLTSSEG  844
               GLEAAK QLSELVSKVS QCLNS FS +KEL GFC QQ QA QPTDCS+DSCLTS EG
Sbjct  241   TAGLEAAKVQLSELVSKVSTQCLNSTFSDLKELQGFCPQQPQANQPTDCSMDSCLTSCEG  300

Query  843   SLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQTEFRWCDDIWENRKYLSKMDEETK  664
             S +D E+ N  + LR  +    +E  ++  E  L+QTE +W  D+ E+ K+LS + ++  
Sbjct  301   SQKDQEIHNGGVRLRPYHGTPTLEPKEIVEEPMLQQTELKWRKDLKES-KFLSSIGKDRG  359

Query  663   NNGLSVSTGLQGGKWNGNSNYSDRRFTGTDADVKLFAQAVDRSDTSKPEKQKTSQEYKLP  484
                LS+ +G          ++   RF  ++ D     Q   + + +K E +    EY+LP
Sbjct  360   PGELSIGSG----------SFPAGRFKASNEDEHFQDQTNKKPEGAKLENENLLPEYRLP  409

Query  483   YFGPKLDLNT-DDKTDVASSCKQLDLNGFSWN  391
              F  KLDLN  D + DVAS CKQ DLNGFSWN
Sbjct  410   CFSTKLDLNAHDHENDVASGCKQFDLNGFSWN  441



>ref|XP_011011690.1| PREDICTED: uncharacterized protein LOC105116174 isoform X3 [Populus 
euphratica]
Length=404

 Score =   473 bits (1218),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 246/413 (60%), Positives = 297/413 (72%), Gaps = 18/413 (4%)
 Frame = -2

Query  1602  MHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEAVNQLGGADK  1423
             MH S+   +PPERHLF+Q  NG GDSGLVLSTDAKPRLKWT DLHERF+EAVNQLGGADK
Sbjct  1     MHSSSRNSIPPERHLFLQVGNGPGDSGLVLSTDAKPRLKWTPDLHERFIEAVNQLGGADK  60

Query  1422  ATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDAATGSDKIPE  1243
             ATPK+V+K MGI GLTLYHLKSHLQKYRLSKNLHG ANS SN+   SG  +  G D++PE
Sbjct  61    ATPKTVMKLMGIPGLTLYHLKSHLQKYRLSKNLHGQANSGSNR---SGTVSVVG-DRMPE  116

Query  1242  ANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVL  1063
              N   IN+  IG  AN     SEA+Q+QIEVQRRLHEQLEVQRHLQLRIEAQGKYLQ+VL
Sbjct  117   VNATRINNLTIGSQAN-----SEALQMQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQSVL  171

Query  1062  EKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFCQQQAQATQPT  883
             EKAQETLGRQ+LG +GLEAAK QLSELVSKVS++ LNSAFS +K+L G C QQ Q T P 
Sbjct  172   EKAQETLGRQNLGTVGLEAAKVQLSELVSKVSSKSLNSAFSELKDLQGLCPQQTQPTHPN  231

Query  882   DCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQTEFRWCDDIWE  703
             DCS+DSCLTS EGS ++ E+ N+ MGLR  N  A +E   +  E  L+Q E +W +D+ +
Sbjct  232   DCSMDSCLTSIEGSQKEQEIHNTGMGLRPYNGNALLEPKVIAGEHALQQAELKWGEDLRD  291

Query  702   NRKYLSKMDEETKN---------NGLSVSTGLQGGKWNGNSNYSDRRFTGTDADVKLFAQ  550
             ++ +LS +  +T+          + LS+  GLQG + N +S+++D RF     D      
Sbjct  292   DKMFLSSLKNDTERRTFSAERSCSNLSIGVGLQGERGNVSSSFADARFKRRSEDDSFQDT  351

Query  549   AVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNGFSWN  391
                R D  K E +K S  Y+L Y+  KLDLN+  + D AS C+QLDLNGFSWN
Sbjct  352   TNRRIDAIKLENEKLSPGYRLSYYATKLDLNSHGEIDAASGCRQLDLNGFSWN  404



>ref|XP_008240441.1| PREDICTED: uncharacterized protein LOC103338947 [Prunus mume]
Length=438

 Score =   471 bits (1212),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 251/410 (61%), Positives = 305/410 (74%), Gaps = 23/410 (6%)
 Frame = -2

Query  1578  MPPERHLFMQGE-NGHGDSGLVLSTDAKPRLKWTQDLHERFVEAVNQLGGADKATPKSVL  1402
             +PPERHLF+QG+ NG GDSGLVLSTDAKPRLKWT DLHERF+EAVNQLGGADKATPK+V+
Sbjct  38    IPPERHLFLQGDQNGPGDSGLVLSTDAKPRLKWTPDLHERFIEAVNQLGGADKATPKTVM  97

Query  1401  KQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDAATGSDKIPEANGNHIN  1222
             K MGI GLTLYHLKSHLQKYRLSKNLHGHA S ++K  +        ++++ EANG H++
Sbjct  98    KLMGIPGLTLYHLKSHLQKYRLSKNLHGHATSGTSKIGT----VPVAAERLSEANGTHMS  153

Query  1221  SANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVLEKAQETL  1042
             + + GP AN  L ISE +Q+QIEVQRRLHEQLEVQRHLQLRIEAQGKYLQ+VLEKAQETL
Sbjct  154   NMSTGPQANKGLHISETLQMQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQSVLEKAQETL  213

Query  1041  GRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFCQQQAQATQPTDCSLDSC  862
             GRQ+LG +GLEAAK QLSELVSKVS QCLNSAF+ +KEL G C QQ Q TQPTDCS+DSC
Sbjct  214   GRQNLGTVGLEAAKVQLSELVSKVSTQCLNSAFTELKELQGLCPQQTQTTQPTDCSMDSC  273

Query  861   LTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETR--LKQTEFRWCDDIWENRKYL  688
             LTS EGS +D E+ NS MGLR     A+    +L +E    L++TE +WC+++ EN   L
Sbjct  274   LTSCEGSKKDQEIHNSAMGLR-----ANYNGRELLDEKEPMLQKTELKWCEELKENNMLL  328

Query  687   SKMDE---------ETKNNGLSVSTGLQGGKWNGNSN-YSDRRFTGTDADVKLFAQAVDR  538
             S +           E +++ LS+S G QG +WN +SN  S+ R  G   D     +  +R
Sbjct  329   SSISNDAAKRIFPVERRSSDLSMSIGCQGERWNIDSNGNSEERLKGRSTDGSFLDRTNNR  388

Query  537   SDTSKPEKQKTSQEYK-LPYFGPKLDLNTDDKTDVASSCKQLDLNGFSWN  391
             +D++K E +K S+ Y+ +PYF  KLDLNT D  D  SSCKQ DLNGFSW+
Sbjct  389   ADSAKAETEKVSRGYRSVPYFAAKLDLNTHDDNDAPSSCKQFDLNGFSWS  438



>ref|XP_003540247.1| PREDICTED: uncharacterized protein LOC100810396 [Glycine max]
 gb|KHN27648.1| Myb family transcription factor APL [Glycine soja]
Length=420

 Score =   460 bits (1184),  Expect = 9e-154, Method: Compositional matrix adjust.
 Identities = 250/428 (58%), Positives = 313/428 (73%), Gaps = 24/428 (6%)
 Frame = -2

Query  1632  MYHHHR-QGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFV  1456
             MYHHH+ QGK++H S+ M +P ERH+F+Q  NG GDSGLVLSTDAKPRLKWT DLH RF+
Sbjct  1     MYHHHQHQGKNIHSSSRMPIPSERHMFLQTGNGSGDSGLVLSTDAKPRLKWTPDLHARFI  60

Query  1455  EAVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGM  1276
             EAVNQLGGADKATPK+V+K MGI GLTLYHLKSHLQKYRLSKNLHG +N+ + K  +S  
Sbjct  61    EAVNQLGGADKATPKTVMKLMGIPGLTLYHLKSHLQKYRLSKNLHGQSNNVTYKITTS--  118

Query  1275  DAATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRI  1096
              A+TG +++ E NG H+N  ++GP AN +L ISEA+Q+QIEVQRRL+EQLEVQRHLQLRI
Sbjct  119   -ASTG-ERLSETNGTHMNKLSLGPQANKDLHISEALQMQIEVQRRLNEQLEVQRHLQLRI  176

Query  1095  EAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGF  916
             EAQGKYLQ+VLEKAQETLGRQ+LG +G+EAAK QLSELVSKVS+QCLNSAF+  K+L GF
Sbjct  177   EAQGKYLQSVLEKAQETLGRQNLGVVGIEAAKVQLSELVSKVSSQCLNSAFTEPKDLQGF  236

Query  915   CQQQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLN---FGAHMESTDLYNETR  745
               QQ Q   P DCS+DSCLTSS+ S ++ E++N   GLR  N   F  H E+T+  N   
Sbjct  237   FPQQTQTNPPNDCSMDSCLTSSDRSQKEQEIQN---GLRHFNSHVFMEHKEATEAPN--N  291

Query  744   LKQTEFRWCDDIWENR--KYLSKMDE------ETKNNGLSVSTGLQGGKWNGNSNYSDRR  589
             L+  E +WC+D  +N     LSK +E      E+  N LS+S GL+    NG + Y +R 
Sbjct  292   LRNPELKWCEDGKKNTFLAPLSKNEERRNYAAESSPNNLSMSIGLERETENGINLYPERL  351

Query  588   FTGTDADVKLFAQAVDRSDTSKPEKQKTSQEYKLP--YF-GPKLDLNTDDKTDVASSCKQ  418
              T + +D +   +   + +T KP  +K SQ+Y+LP  YF   +LDLNT    + A++CKQ
Sbjct  352   ITESQSDGEFQHRNRIKPETLKPVDEKVSQDYRLPASYFAAARLDLNTHGDNEAATTCKQ  411

Query  417   LDLNGFSW  394
             LDLN FSW
Sbjct  412   LDLNRFSW  419



>ref|XP_010036186.1| PREDICTED: uncharacterized protein LOC104425247 isoform X1 [Eucalyptus 
grandis]
 gb|KCW47729.1| hypothetical protein EUGRSUZ_K01476 [Eucalyptus grandis]
Length=419

 Score =   457 bits (1177),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 244/425 (57%), Positives = 301/425 (71%), Gaps = 19/425 (4%)
 Frame = -2

Query  1632  MYHHHRQ-GKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFV  1456
             MYHH++  GK++ P + M +P +RH+F+QG NG GDSGLVLSTDAKPRLKWT DLHERFV
Sbjct  1     MYHHNQHLGKNISPPSRMPIPSDRHMFIQGGNGPGDSGLVLSTDAKPRLKWTPDLHERFV  60

Query  1455  EAVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGM  1276
             EAVNQLGGADKATPK+V+K MGI GLTLYHLKSHLQKYRLSKNLHG ANS +NK  +   
Sbjct  61    EAVNQLGGADKATPKTVMKLMGIPGLTLYHLKSHLQKYRLSKNLHGQANSGNNKIGT---  117

Query  1275  DAATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRI  1096
               A G D++PE NG+H+++ NI P  N NLP SEA+Q+QIEVQRRLHEQLEVQRHLQLRI
Sbjct  118   -VAVGGDRVPETNGSHVHNLNIVPQTNKNLPFSEALQMQIEVQRRLHEQLEVQRHLQLRI  176

Query  1095  EAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGF  916
             EAQGKYLQ+VLEKAQETLGRQ++G   LEA K QLSELVSKVS Q LNSAF  +KEL G 
Sbjct  177   EAQGKYLQSVLEKAQETLGRQNVGSASLEATKLQLSELVSKVSTQSLNSAFPDLKELQGL  236

Query  915   CQQQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAH-MESTDLYNETRLK  739
             C QQ Q   PTDCS+DSCLTS EGS +D E+ N+ +GLR  + G+  ++   + +E R +
Sbjct  237   CAQQIQTNPPTDCSVDSCLTSCEGSHKDQEIHNNGIGLRPYSGGSVLLDPKGITDEPRTE  296

Query  738   QTEFRWCDDIWENRKYLSKMDEETKNN--------GLSVSTGLQGGKWNGNSNYSDRRFT  583
             + EF+W  D+ E+R +LS   +E + +         LS+S GL+GG          +   
Sbjct  297   KIEFKWGGDLKEDRMFLSYGVKEMERSFPGGLGQGHLSMSIGLEGGLGCSEVKNKAKEVG  356

Query  582   GTDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDL--  409
             G+   V    +   R+D+   +  + S   +L YF  KLDLN  ++TDVASS KQ DL  
Sbjct  357   GS---VNFLERLHSRADSVNMDSNQRSCGNQLHYFEAKLDLNAREETDVASSGKQFDLNG  413

Query  408   NGFSW  394
             NGF W
Sbjct  414   NGFGW  418



>gb|KCW47730.1| hypothetical protein EUGRSUZ_K01476 [Eucalyptus grandis]
Length=417

 Score =   449 bits (1155),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 242/425 (57%), Positives = 299/425 (70%), Gaps = 21/425 (5%)
 Frame = -2

Query  1632  MYHHHRQ-GKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFV  1456
             MYHH++  GK++ P + M +P +RH+F+QG NG GDSGLVLSTDAKPRLKWT DLHERFV
Sbjct  1     MYHHNQHLGKNISPPSRMPIPSDRHMFIQGGNGPGDSGLVLSTDAKPRLKWTPDLHERFV  60

Query  1455  EAVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGM  1276
             EAVNQLGGADKATPK+V+K MGI GLTLYHLKSHLQKYRLSKNLHG ANS +NK  +   
Sbjct  61    EAVNQLGGADKATPKTVMKLMGIPGLTLYHLKSHLQKYRLSKNLHGQANSGNNKIGT---  117

Query  1275  DAATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRI  1096
               A G D++PE NG+H+++ NI P  N NLP SEA+Q+QIEVQRRLHEQLE  RHLQLRI
Sbjct  118   -VAVGGDRVPETNGSHVHNLNIVPQTNKNLPFSEALQMQIEVQRRLHEQLE--RHLQLRI  174

Query  1095  EAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGF  916
             EAQGKYLQ+VLEKAQETLGRQ++G   LEA K QLSELVSKVS Q LNSAF  +KEL G 
Sbjct  175   EAQGKYLQSVLEKAQETLGRQNVGSASLEATKLQLSELVSKVSTQSLNSAFPDLKELQGL  234

Query  915   CQQQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAH-MESTDLYNETRLK  739
             C QQ Q   PTDCS+DSCLTS EGS +D E+ N+ +GLR  + G+  ++   + +E R +
Sbjct  235   CAQQIQTNPPTDCSVDSCLTSCEGSHKDQEIHNNGIGLRPYSGGSVLLDPKGITDEPRTE  294

Query  738   QTEFRWCDDIWENRKYLSKMDEETKNN--------GLSVSTGLQGGKWNGNSNYSDRRFT  583
             + EF+W  D+ E+R +LS   +E + +         LS+S GL+GG          +   
Sbjct  295   KIEFKWGGDLKEDRMFLSYGVKEMERSFPGGLGQGHLSMSIGLEGGLGCSEVKNKAKEVG  354

Query  582   GTDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDL--  409
             G+   V    +   R+D+   +  + S   +L YF  KLDLN  ++TDVASS KQ DL  
Sbjct  355   GS---VNFLERLHSRADSVNMDSNQRSCGNQLHYFEAKLDLNAREETDVASSGKQFDLNG  411

Query  408   NGFSW  394
             NGF W
Sbjct  412   NGFGW  416



>ref|XP_010036188.1| PREDICTED: uncharacterized protein LOC104425247 isoform X2 [Eucalyptus 
grandis]
Length=414

 Score =   443 bits (1140),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 240/425 (56%), Positives = 298/425 (70%), Gaps = 24/425 (6%)
 Frame = -2

Query  1632  MYHHHRQ-GKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFV  1456
             MYHH++  GK++ P + M +P +RH+F+QG NG GDSGLVLSTDAKPRLKWT DLHERFV
Sbjct  1     MYHHNQHLGKNISPPSRMPIPSDRHMFIQGGNGPGDSGLVLSTDAKPRLKWTPDLHERFV  60

Query  1455  EAVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGM  1276
             EAVNQLGGADKATPK+V+K MGI GLTLYHLKSHLQKYRLSKNLHG ANS +NK  +   
Sbjct  61    EAVNQLGGADKATPKTVMKLMGIPGLTLYHLKSHLQKYRLSKNLHGQANSGNNKIGT---  117

Query  1275  DAATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRI  1096
               A G D++PE NG+H+++ NI P  N     +EA+Q+QIEVQRRLHEQLEVQRHLQLRI
Sbjct  118   -VAVGGDRVPETNGSHVHNLNIVPQTN-----NEALQMQIEVQRRLHEQLEVQRHLQLRI  171

Query  1095  EAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGF  916
             EAQGKYLQ+VLEKAQETLGRQ++G   LEA K QLSELVSKVS Q LNSAF  +KEL G 
Sbjct  172   EAQGKYLQSVLEKAQETLGRQNVGSASLEATKLQLSELVSKVSTQSLNSAFPDLKELQGL  231

Query  915   CQQQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAH-MESTDLYNETRLK  739
             C QQ Q   PTDCS+DSCLTS EGS +D E+ N+ +GLR  + G+  ++   + +E R +
Sbjct  232   CAQQIQTNPPTDCSVDSCLTSCEGSHKDQEIHNNGIGLRPYSGGSVLLDPKGITDEPRTE  291

Query  738   QTEFRWCDDIWENRKYLSKMDEETKNN--------GLSVSTGLQGGKWNGNSNYSDRRFT  583
             + EF+W  D+ E+R +LS   +E + +         LS+S GL+GG          +   
Sbjct  292   KIEFKWGGDLKEDRMFLSYGVKEMERSFPGGLGQGHLSMSIGLEGGLGCSEVKNKAKEVG  351

Query  582   GTDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDL--  409
             G+   V    +   R+D+   +  + S   +L YF  KLDLN  ++TDVASS KQ DL  
Sbjct  352   GS---VNFLERLHSRADSVNMDSNQRSCGNQLHYFEAKLDLNAREETDVASSGKQFDLNG  408

Query  408   NGFSW  394
             NGF W
Sbjct  409   NGFGW  413



>ref|XP_007202959.1| hypothetical protein PRUPE_ppa015076mg [Prunus persica]
 gb|EMJ04158.1| hypothetical protein PRUPE_ppa015076mg [Prunus persica]
Length=421

 Score =   440 bits (1132),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 245/409 (60%), Positives = 292/409 (71%), Gaps = 35/409 (9%)
 Frame = -2

Query  1578  MPPERHLFMQG-ENGHGDSGLVLSTDAKPRLKWTQDLHERFVEAVNQLGGADKATPKSVL  1402
             +PPERHL++QG +NG G+SGLVLSTDAKPRLKWT DLHERF+EAVNQLGGADKATPK+V+
Sbjct  35    IPPERHLYLQGDQNGPGESGLVLSTDAKPRLKWTPDLHERFIEAVNQLGGADKATPKTVM  94

Query  1401  KQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDAATGSDKIPEANGNHIN  1222
             K MGI GLTLYHLKSHLQKYRLSKNLHGHA S ++K     +D        P    N   
Sbjct  95    KLMGIPGLTLYHLKSHLQKYRLSKNLHGHATSGTSKI---ALD--------PNETYN---  140

Query  1221  SANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVLEKAQETL  1042
               N G L    L ISE +Q+QIEVQRRLHEQLEVQRHLQLRIEAQGKYLQ+VLEKAQETL
Sbjct  141   --NNGILNCRGLHISETLQMQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQSVLEKAQETL  198

Query  1041  GRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFCQQQAQATQPTDCSLDSC  862
             GRQ+LG +GLEAAK QLSELVSKVS QCLNSAF+ +KEL G C QQ Q TQPTDCS++SC
Sbjct  199   GRQNLGTVGLEAAKVQLSELVSKVSTQCLNSAFTELKELQGLCPQQTQTTQPTDCSMESC  258

Query  861   LTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETR--LKQTEFRWCDDIWENRKYL  688
             LTS EGS +D E+ NS MGLR     A+    +L +E    L++TE +WC+++ EN   L
Sbjct  259   LTSCEGSKKDQEIHNSAMGLR-----ANYNGRELLDEKEPMLQKTELKWCEELKENNMLL  313

Query  687   SKMDE---------ETKNNGLSVSTGLQGGKWNGNSNYSDRRFTGTDADVKLFAQAVDRS  535
             S +           E  ++ LS+S G QG +WN N N S+ R  G   DV    +  +R+
Sbjct  314   SSISNDAAKRMFPVERSSSDLSMSIGCQGERWNINGN-SEERLKGRSTDVSFLDRTNNRA  372

Query  534   DTSKPEKQKTSQEYK-LPYFGPKLDLNTDDKTDVASSCKQLDLNGFSWN  391
             D++K E +K S+  + +PYF  KLDLNT D  D  SSCKQ DLNGFSW+
Sbjct  373   DSAKAETEKVSRGCRSVPYFAAKLDLNTHDDNDAPSSCKQFDLNGFSWS  421



>ref|XP_010257717.1| PREDICTED: uncharacterized protein LOC104597705 isoform X1 [Nelumbo 
nucifera]
Length=404

 Score =   438 bits (1126),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 232/422 (55%), Positives = 289/422 (68%), Gaps = 28/422 (7%)
 Frame = -2

Query  1632  MYHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVE  1453
             MYHHH QGK+  PS+ M +           N  GD+GLVLSTDAKPRLKWT +LHERFVE
Sbjct  1     MYHHH-QGKTSFPSSRMSI-----------NVRGDTGLVLSTDAKPRLKWTPELHERFVE  48

Query  1452  AVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMD  1273
             AVNQLGG DKATPK+V+K MGI GLTLYHLKSHLQKYRLSKNLHG AN+  NK   +G  
Sbjct  49    AVNQLGGVDKATPKTVMKLMGISGLTLYHLKSHLQKYRLSKNLHGQANTGINKNAVAG--  106

Query  1272  AATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIE  1093
                  D+I EA+G  I++ ++    N +L ISEAIQ+QIEVQRRLHEQLEVQRHLQLRIE
Sbjct  107   -----DRISEASGAFISNTSLCSQTNKSLQISEAIQMQIEVQRRLHEQLEVQRHLQLRIE  161

Query  1092  AQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFC  913
             AQGKYLQ+VLEKAQETLGRQ+LG  GLEAAK QLSELVSKVS +CLNS  S +KEL    
Sbjct  162   AQGKYLQSVLEKAQETLGRQNLGSAGLEAAKVQLSELVSKVSTECLNSTLSELKELQDLH  221

Query  912   QQQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQT  733
              Q+ Q TQPTDCS+DSCLTS EGS +D E+ N  +GLRS      +   ++ +++RL+Q 
Sbjct  222   PQKTQTTQPTDCSMDSCLTSCEGSQKDQEIHNIGVGLRSYYSNTSLGQKEIVDDSRLEQP  281

Query  732   EFRWCDDIWENRKYLSKMDEETK---------NNGLSVSTGLQGGKWNGNSNYSDRRFTG  580
             E  W +D  EN+ + S    +T+         ++ L++S  + G KWN +S +++     
Sbjct  282   EHAWGEDQNENKMFCSSKGRDTERIMFPMKRNSSDLTMSIKVHGEKWNASSFFTEATTKE  341

Query  579   TDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNGF  400
              D D     Q   R   +  E +K S+ ++LP+  PKLDLN+ ++ D  S+CKQ DLNGF
Sbjct  342   GDEDDSFHYQTGARRPVTNVENEKMSKGFRLPHLTPKLDLNSQEENDSTSTCKQFDLNGF  401

Query  399   SW  394
             SW
Sbjct  402   SW  403



>ref|XP_007150070.1| hypothetical protein PHAVU_005G123900g [Phaseolus vulgaris]
 gb|ESW22064.1| hypothetical protein PHAVU_005G123900g [Phaseolus vulgaris]
Length=430

 Score =   438 bits (1126),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 237/436 (54%), Positives = 304/436 (70%), Gaps = 28/436 (6%)
 Frame = -2

Query  1632  MYHHHR-QGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFV  1456
             MYHHHR QGK++H ++ M +P ERH+F+Q  NG GDSGLVLSTDAKPRLKWT DLH RF+
Sbjct  1     MYHHHRHQGKNIHSTSRMPIPSERHMFLQTGNGSGDSGLVLSTDAKPRLKWTPDLHARFI  60

Query  1455  EAVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGM  1276
             EAVNQLGGADKATPK+V+K MGI GLTLYHLKSHLQKYRLSKNLHG +N+ ++K  +S  
Sbjct  61    EAVNQLGGADKATPKTVMKLMGISGLTLYHLKSHLQKYRLSKNLHGQSNNVTHKMTTS--  118

Query  1275  DAATGSDKIPEANGNHINSANIGPLANT----------NLPISEAIQIQIEVQRRLHEQL  1126
               AT  +++ E +G H++  ++GP AN           +L I EA+Q+QIEVQRRL+EQL
Sbjct  119   --ATTGERLSETSGTHMSKLSLGPQANNHANFQCLLSKDLHIGEALQMQIEVQRRLNEQL  176

Query  1125  EVQRHLQLRIEAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSA  946
             EVQ+HLQLRIEAQGKYLQ+VLEKAQ+TLGRQ+LG +GLE AK QLSELVSKVS+QCLNSA
Sbjct  177   EVQKHLQLRIEAQGKYLQSVLEKAQDTLGRQNLGIIGLETAKVQLSELVSKVSSQCLNSA  236

Query  945   FSGIKELPGFCQQQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMEST  766
             FS +KEL GFC QQ    QP DCS+DSCLTS +   ++ +++NS     S  F    EST
Sbjct  237   FSELKELQGFCPQQTHTNQPNDCSMDSCLTSCDILQKEQKIQNSLRQFNSHVFMEQKEST  296

Query  765   DLYNETRLKQTEFRWCDDIWENRKY--LSKMDE------ETKNNGLSVSTGLQGGKWNGN  610
             D  N   L+ +E +WCDD  +N     LSK +E      ET    LS+S GL+    N +
Sbjct  297   DARNN--LRNSELKWCDDGKKNTFLAPLSKTEERRKYAAETGPGNLSMSIGLERETENRS  354

Query  609   SNYSDRRFTGTDADVKLFAQAVDRSDTSKPEKQKTSQEYKLP--YF-GPKLDLNTDDKTD  439
             S Y +     + ++ +   +   +++T K   +K  Q+Y++P  YF   +LDLN     +
Sbjct  355   SMYPESLIKESQSEGEFQHRNRIKTETMKAVDEKVCQDYRMPASYFVATRLDLNNHGDNE  414

Query  438   VASSCKQLDLNGFSWN  391
              A++CKQLDLN FSW+
Sbjct  415   AATTCKQLDLNRFSWS  430



>ref|XP_010257718.1| PREDICTED: uncharacterized protein LOC104597705 isoform X2 [Nelumbo 
nucifera]
Length=403

 Score =   437 bits (1123),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 231/422 (55%), Positives = 289/422 (68%), Gaps = 29/422 (7%)
 Frame = -2

Query  1632  MYHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVE  1453
             MYHHH QGK+  PS+ M +           N  GD+GLVLSTDAKPRLKWT +LHERFVE
Sbjct  1     MYHHH-QGKTSFPSSRMSI-----------NVRGDTGLVLSTDAKPRLKWTPELHERFVE  48

Query  1452  AVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMD  1273
             AVNQLGG DKATPK+V+K MGI GLTLYHLKSHLQKYRLSKNLHG AN+  NK ++    
Sbjct  49    AVNQLGGVDKATPKTVMKLMGISGLTLYHLKSHLQKYRLSKNLHGQANTGINKNVAG---  105

Query  1272  AATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIE  1093
                  D+I EA+G  I++ ++    N +L ISEAIQ+QIEVQRRLHEQLEVQRHLQLRIE
Sbjct  106   -----DRISEASGAFISNTSLCSQTNKSLQISEAIQMQIEVQRRLHEQLEVQRHLQLRIE  160

Query  1092  AQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFC  913
             AQGKYLQ+VLEKAQETLGRQ+LG  GLEAAK QLSELVSKVS +CLNS  S +KEL    
Sbjct  161   AQGKYLQSVLEKAQETLGRQNLGSAGLEAAKVQLSELVSKVSTECLNSTLSELKELQDLH  220

Query  912   QQQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQT  733
              Q+ Q TQPTDCS+DSCLTS EGS +D E+ N  +GLRS      +   ++ +++RL+Q 
Sbjct  221   PQKTQTTQPTDCSMDSCLTSCEGSQKDQEIHNIGVGLRSYYSNTSLGQKEIVDDSRLEQP  280

Query  732   EFRWCDDIWENRKYLSKMDEETK---------NNGLSVSTGLQGGKWNGNSNYSDRRFTG  580
             E  W +D  EN+ + S    +T+         ++ L++S  + G KWN +S +++     
Sbjct  281   EHAWGEDQNENKMFCSSKGRDTERIMFPMKRNSSDLTMSIKVHGEKWNASSFFTEATTKE  340

Query  579   TDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNGF  400
              D D     Q   R   +  E +K S+ ++LP+  PKLDLN+ ++ D  S+CKQ DLNGF
Sbjct  341   GDEDDSFHYQTGARRPVTNVENEKMSKGFRLPHLTPKLDLNSQEENDSTSTCKQFDLNGF  400

Query  399   SW  394
             SW
Sbjct  401   SW  402



>ref|XP_007132437.1| hypothetical protein PHAVU_011G094300g [Phaseolus vulgaris]
 gb|ESW04431.1| hypothetical protein PHAVU_011G094300g [Phaseolus vulgaris]
Length=394

 Score =   435 bits (1119),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 235/421 (56%), Positives = 292/421 (69%), Gaps = 34/421 (8%)
 Frame = -2

Query  1632  MYHH-HRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFV  1456
             MY H   QGK++H S+ M +P ERH+F+   NG GDSGLVLSTDAKPRLKWT DLH RF+
Sbjct  1     MYTHLQHQGKNIHSSSRMPIPSERHMFLHTGNGSGDSGLVLSTDAKPRLKWTPDLHARFI  60

Query  1455  EAVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGM  1276
             EAV QLGGADKATPK+V+K MGI GLTLYHLKSHLQKYRLSK+LHG +N++++K   +  
Sbjct  61    EAVQQLGGADKATPKTVMKLMGISGLTLYHLKSHLQKYRLSKSLHGQSNNATHKICIN--  118

Query  1275  DAATGSDKIPEANGNHINSANIGPLANT-NLPISEAIQIQIEVQRRLHEQLEVQRHLQLR  1099
               A   +++ E NG H+N+ N+ P +N  +L ISEA+Q+QIEVQRRL+EQLEVQR LQLR
Sbjct  119   PGAATDERLRENNGTHVNNLNLAPQSNNKDLHISEALQMQIEVQRRLNEQLEVQRLLQLR  178

Query  1098  IEAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPG  919
             IEAQGKYLQAVLEKAQETLGRQ+LG +GLEAAK QLS+LVSKVS+QCLNSAF  +KEL G
Sbjct  179   IEAQGKYLQAVLEKAQETLGRQNLGVVGLEAAKLQLSDLVSKVSSQCLNSAFLEMKELQG  238

Query  918   FCQQQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLY---NET  748
             F   Q Q  QP DCS+DSCLTS E S ++ E++N  M LR  N    ME  ++    N  
Sbjct  239   FSPHQTQTNQPNDCSMDSCLTSCEVSQKEQEIQNGGMSLRPFNVHTFMERKEVIEGPNLN  298

Query  747   RLKQTEFRWCDDIWENRKYLSKMDEETKNNGLSVSTGLQGGKWNGNSNYSDRRFTGTDAD  568
              L  T+ +WCD +     +L+ +   + +N LS+S GL+G   NG               
Sbjct  299   NLPNTDLKWCDPV--KNTFLTPLSRRSPSN-LSMSIGLEGETENG---------------  340

Query  567   VKLFAQAVDRSDTSKPEKQKTSQEYKLPYF--GPKLDLNTDDKTDVASSCKQLDLNGFSW  394
                   +  R ++ KP  +K SQ+Y LP F   PKLDL T+DK +   SCK+LDLNGFSW
Sbjct  341   ------STIRKESVKPVAEKVSQDYGLPSFFAAPKLDLTTEDK-NTRKSCKELDLNGFSW  393

Query  393   N  391
             N
Sbjct  394   N  394



>gb|KHN32876.1| Myb family transcription factor APL [Glycine soja]
Length=400

 Score =   433 bits (1113),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 237/417 (57%), Positives = 302/417 (72%), Gaps = 36/417 (9%)
 Frame = -2

Query  1632  MYHHHR-QGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFV  1456
             MYHHH+ QGK++H S+ M +P ERH+F+Q  NG GDSGLVLSTDAKPRLKWT DLH RF+
Sbjct  1     MYHHHQHQGKNIHSSSRMPIPSERHMFLQAGNGSGDSGLVLSTDAKPRLKWTPDLHARFI  60

Query  1455  EAVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGM  1276
             EAVNQLGGADKATPK+V+K MGI GLTLYHLKSHLQKYRLSKNLHG +N+ ++K  +S  
Sbjct  61    EAVNQLGGADKATPKTVMKLMGIPGLTLYHLKSHLQKYRLSKNLHGQSNNVTHKITTS--  118

Query  1275  DAATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRI  1096
               AT  +++ E NG H+N  ++GP AN +L ISEA+Q+QIEVQRRL+EQLEVQRHLQLRI
Sbjct  119   --ATTGERLSETNGTHMNKLSLGPQANKDLHISEALQMQIEVQRRLNEQLEVQRHLQLRI  176

Query  1095  EAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGF  916
             EAQGKYLQ+VLEKAQETLGRQ+LG +GLEAAK QLSELVSKVS+QC NSAF+ +K+L GF
Sbjct  177   EAQGKYLQSVLEKAQETLGRQNLGIVGLEAAKVQLSELVSKVSSQCFNSAFTELKDLQGF  236

Query  915   CQQQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHM-----ESTDLYNE  751
             C QQ Q   P DCS+DSC+TS + S ++ E++N   GLR  +F +HM     E+ +  N 
Sbjct  237   CPQQPQTNPPNDCSMDSCITSCDRSQKEQEIQN---GLR--HFSSHMFMEQKEAKEAPN-  290

Query  750   TRLKQTEFRWCDDIWENRKYLSKM--DEETKN-------NGLSVSTGLQGGKWNGNSNYS  598
               L+  E +W DD  +N  +L+ +  +EE +N       + LS+S GL+    NG+S Y 
Sbjct  291   -NLRNPEIKWYDDGKKN-TFLAPLSKNEERRNYAAECSPSNLSMSIGLERETENGSSMYP  348

Query  597   DRRFTGTDADVKLFAQAVDRSDTSKPEKQKTSQEYKLP--YF-GPKLDLNTDDKTDV  436
             +R  T + +D ++  Q      T KP  +K SQ+Y+LP  YF   +LDLNT    +V
Sbjct  349   ERLITESPSDGRIKPQ------TMKPVDEKVSQDYRLPTSYFAAARLDLNTHGDNEV  399



>gb|EYU38638.1| hypothetical protein MIMGU_mgv1a008175mg [Erythranthe guttata]
Length=382

 Score =   428 bits (1101),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 226/416 (54%), Positives = 284/416 (68%), Gaps = 42/416 (10%)
 Frame = -2

Query  1623  HHRQGKSMHPSTNM-LMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEAV  1447
             +HRQGK++HPS+ M + P ER LF+QG NG+GDSGL+LSTDAKPRLKWT DLHERF+EAV
Sbjct  2     YHRQGKNIHPSSKMSIQPHERPLFLQGANGNGDSGLMLSTDAKPRLKWTADLHERFIEAV  61

Query  1446  NQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDAA  1267
             NQLGGA+KATPKSVLK MGI GLTLYHLKSHLQKYRLSK  +G A S +N       + A
Sbjct  62    NQLGGAEKATPKSVLKLMGIPGLTLYHLKSHLQKYRLSKTHYGQATSGNN-------NKA  114

Query  1266  TGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQ  1087
             + +D++PE    H ++ NI      N+ + EAIQ+QI VQ+RLHEQLEVQRHLQLRIEAQ
Sbjct  115   STADRVPEP---HTSNPNIATQTTKNIHLGEAIQMQINVQQRLHEQLEVQRHLQLRIEAQ  171

Query  1086  GKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFCQQ  907
             GKYL++VLEKAQET+G Q+LG                         AFSG+KEL     Q
Sbjct  172   GKYLESVLEKAQETIGSQNLG-------------------------AFSGMKELSDTSLQ  206

Query  906   QAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQTEF  727
             Q Q  Q  DCS+DSCL S EGS+ D E+ N+ +GL+  NF A MES     +T L++TE 
Sbjct  207   QRQKAQAADCSMDSCLNSFEGSVMDQELHNN-LGLKPFNFRASMESKVNDKDTSLQKTEL  265

Query  726   RWCDDIWENRKYLSKMDEETKN-----NGLSVSTGLQGGKWNGNSNYSDRRFTGTDADVK  562
              W +++ E+ KYLS+ +   +N     N LS++  L G +WNG+SNY +  F    AD K
Sbjct  266   MWRENLKESGKYLSRANNNVENAETNLNSLSMNIDLLGDQWNGDSNYREGTFKEAKADAK  325

Query  561   LFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNGFSW  394
              F    +RSD S+PEKQK S E KLP+    LDLNT+D+ ++AS+C +LDLNGFSW
Sbjct  326   FFDHNTNRSDLSRPEKQKASTELKLPFVSTNLDLNTNDENNIASNCTKLDLNGFSW  381



>ref|XP_004288533.1| PREDICTED: uncharacterized protein LOC101304811 [Fragaria vesca 
subsp. vesca]
Length=418

 Score =   426 bits (1096),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 230/420 (55%), Positives = 290/420 (69%), Gaps = 32/420 (8%)
 Frame = -2

Query  1611  GKSMHPSTN--MLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEAVNQL  1438
              K++H S++  M +PPE H  +Q E+   DSGLVLSTDAKPRLKWT DLHERF+EAVNQL
Sbjct  18    AKNIHSSSSNRMAIPPETHRLLQPESCPEDSGLVLSTDAKPRLKWTPDLHERFIEAVNQL  77

Query  1437  GGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDAATGS  1258
             GGADKATPK+V+K MGI GLTLYHLKSHLQKYRLSKNLH HANS     +   +  A   
Sbjct  78    GGADKATPKTVMKLMGIPGLTLYHLKSHLQKYRLSKNLHVHANSGGTTKI---VAVAVPG  134

Query  1257  DKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQGKY  1078
             ++I E NG H+N+ +IGP +N  + I+E +Q+QIEVQRRLH+QLEVQRHLQLRIEAQGKY
Sbjct  135   ERISEVNGTHMNNMSIGPQSNKGIHINETLQMQIEVQRRLHQQLEVQRHLQLRIEAQGKY  194

Query  1077  LQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFCQQQAQ  898
             LQ+VLEKAQETLGRQ+LG +GLEAAK QLSELVSKVS QCLNSAF+ +KE+ G C Q   
Sbjct  195   LQSVLEKAQETLGRQNLGTVGLEAAKVQLSELVSKVSTQCLNSAFTEMKEVQGSCPQNP-  253

Query  897   ATQPTDCSLDSCLTSSEGSLRDHEMR-NSQMGLRSLNFGAHMESTDLYNETRLKQTEFRW  721
                PTDCS++SCLTSSEGS +D E++ NS+MGLR+            YN +R+     + 
Sbjct  254   ---PTDCSMESCLTSSEGSKKDQEIQNNSRMGLRA------------YNSSRVLLESEKT  298

Query  720   CDDIWENRKYLSKMDE---------ETKNNGLSVSTGLQGGKWNGNSNYSDRRFTGTDAD  568
                + EN  ++S + +         E ++   S+S GL+    NG+   S+ RF   +  
Sbjct  299   MLHLKENSMFVSTLTKNADQRMFPSEPRSGDFSMSIGLEREILNGSHCNSEERFKARNTI  358

Query  567   VKLFAQAVDRSDTSKPEK-QKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNGFSWN  391
                     +R+D+ K ++ +K SQ Y  PYF  KLDLN+ D TD +SSCKQ DLN FSW+
Sbjct  359   DSFLDNKNNRADSVKVDQSRKVSQGYSGPYFAAKLDLNSHDDTDASSSCKQFDLNDFSWS  418



>ref|XP_010276422.1| PREDICTED: uncharacterized protein LOC104611172 [Nelumbo nucifera]
Length=415

 Score =   426 bits (1094),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 225/417 (54%), Positives = 289/417 (69%), Gaps = 22/417 (5%)
 Frame = -2

Query  1611  GKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEAVNQLGG  1432
             GK+  PS+ M +PPERHLF+Q  NG GD+GL+LSTDAKPRLKWT +LHERF+EAVNQLGG
Sbjct  9     GKTSFPSSTMSIPPERHLFLQNGNGRGDTGLILSTDAKPRLKWTPELHERFIEAVNQLGG  68

Query  1431  ADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDAATGSDK  1252
             ADKATPK+VLK MGI GLTLYHLKSHLQKYRLSKNLHG AN  +NK ++         D+
Sbjct  69    ADKATPKTVLKLMGIPGLTLYHLKSHLQKYRLSKNLHGQANMGTNKNVA--------GDR  120

Query  1251  IPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQ  1072
             I EA+G  +++ +     N NL ISEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQ
Sbjct  121   ISEASGALMSNTSPSSQTNKNLQISEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQ  180

Query  1071  AVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPG--FCQQQAQ  898
             +VLEKAQETLGRQ+LG +  +AAK Q  ELVSKVS +CLNS F  +KEL G   C QQ Q
Sbjct  181   SVLEKAQETLGRQNLGSVEFDAAKMQFPELVSKVSAECLNSTFPELKELQGLCLCPQQTQ  240

Query  897   ATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQTEFRWC  718
               QPTDCS+DSCLTS EGS +D E+ N ++GLR     A +   ++ +++R++Q E  W 
Sbjct  241   KMQPTDCSVDSCLTSCEGSQKDQEIHNIEVGLRPYQSSASLGLKEIVDDSRIEQPEPTWG  300

Query  717   DDIWENRKYLSKMDEETKN---------NGLSVSTGLQGGKWNGNSNYSDRRFTGTDADV  565
             +D+ EN+ + S +  + +          + LS ++ +QG   N +S++++ R    + D 
Sbjct  301   EDLNENKMFSSSIGRDAERIMFPMQRSCSSLSTTSRVQGENRNASSSFAEARTKEGNEDD  360

Query  564   KLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNGFSW  394
                 Q   R   +  E    S+ ++LP+   KLDLNT +  + +++ KQ DLNGFSW
Sbjct  361   SFLNQNSARRPVANLEN-DMSKGFRLPHLTAKLDLNTQE--NDSTTHKQFDLNGFSW  414



>ref|XP_003539830.1| PREDICTED: uncharacterized protein LOC100805237 isoformX1 [Glycine 
max]
 ref|XP_006592327.1| PREDICTED: uncharacterized protein LOC100805237 isoform X2 [Glycine 
max]
Length=405

 Score =   423 bits (1087),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 240/431 (56%), Positives = 297/431 (69%), Gaps = 43/431 (10%)
 Frame = -2

Query  1632  MY-HHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFV  1456
             MY H   QGK++H S+ M +P ER +F+Q  NG GDSGLVLSTDAKPRLKWT DLH RF+
Sbjct  1     MYTHQQHQGKNIHSSSRMPIPSERQMFLQTGNGSGDSGLVLSTDAKPRLKWTPDLHARFI  60

Query  1455  EAVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNK-AMSSG  1279
             EAV QLGGADKATPK+V+K +GI GLTLYHLKSHLQKYRLSK+LHG +N+ ++K  ++SG
Sbjct  61    EAVQQLGGADKATPKTVMKLIGIPGLTLYHLKSHLQKYRLSKSLHGQSNNMTHKITINSG  120

Query  1278  MDAATGSDKIPEANGNHINSANIGPLANT-NLPISEAIQIQIEVQRRLHEQLEVQRHLQL  1102
                A   +++ E NG H+NS N+ P +N  +L ISEA+ +QIE QRRL+EQLEVQR LQL
Sbjct  121   ---AATDERLRENNGTHMNSLNLAPQSNNKDLYISEALHMQIEEQRRLNEQLEVQRLLQL  177

Query  1101  RIEAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSG-IKEL  925
             RIEAQGKYLQAVLEKAQETLGRQ+LG +GLEA K QLSELVSKVS+QCLNSAFS  +KE+
Sbjct  178   RIEAQGKYLQAVLEKAQETLGRQNLGAVGLEATKLQLSELVSKVSSQCLNSAFSDRLKEI  237

Query  924   PGFC-QQQAQATQP--TDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLY-  757
              GF   QQ Q  QP   DCS+DSCLTS EGS ++ E++N  M LR  N    ME  ++  
Sbjct  238   QGFSPHQQTQTNQPNTNDCSMDSCLTSCEGSQKEQEIQNGGMSLRPFNVHTFMERKEVIE  297

Query  756   --NETRLKQTEFRWCDDIWENRKYLSKM----DEETKNNGLSVSTGLQGGKWNGNSNYSD  595
               N   L  T+  WCD + +N  +L+ +    D+ + +N LS+S GL+G   NG      
Sbjct  298   GPNLNNLPNTDLNWCDPVKKN-TFLTPLSMHADKRSPSN-LSMSIGLEGETENG------  349

Query  594   RRFTGTDADVKLFAQAVDRSDTSKPEKQKTSQEYKLP--YFGP-KLDLNTDDKTDVASSC  424
                            +  R+++ KP   K SQ+Y LP  YF   KLDL T+D  D  +SC
Sbjct  350   ---------------STIRTESVKPVADKVSQDYGLPSNYFAASKLDLTTEDNKDTKTSC  394

Query  423   KQLDLNGFSWN  391
             KQLDLNGFSWN
Sbjct  395   KQLDLNGFSWN  405



>gb|KHN21148.1| Myb family transcription factor APL [Glycine soja]
Length=401

 Score =   419 bits (1077),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 239/430 (56%), Positives = 294/430 (68%), Gaps = 45/430 (10%)
 Frame = -2

Query  1632  MY-HHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFV  1456
             MY H   QGK++H S+ M +P ER +F+Q  NG GDSGLVLSTDAKPRLKWT DLH RF+
Sbjct  1     MYTHQQHQGKNIHSSSRMPIPSERQMFLQTGNGSGDSGLVLSTDAKPRLKWTPDLHARFI  60

Query  1455  EAVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGM  1276
             EAV QLGGADKATPK+V+K +GI GLTLYHLKSHLQKYRLSK+LHG +N+     M+  +
Sbjct  61    EAVQQLGGADKATPKTVMKLIGIPGLTLYHLKSHLQKYRLSKSLHGQSNN-----MTHKI  115

Query  1275  DAATGSDKIPEANGNHINSANIGPLANT-NLPISEAIQIQIEVQRRLHEQLEVQRHLQLR  1099
              AAT  +++ E NG H+NS N+ P +N  +L ISEA+ +QIE QRRL+EQLEVQR LQLR
Sbjct  116   SAAT-DERLRENNGTHMNSLNLAPQSNNKDLYISEALHMQIEEQRRLNEQLEVQRLLQLR  174

Query  1098  IEAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSG-IKELP  922
             IEAQGKYLQAVLEKAQETLGRQ+LG +GLEA K QLSELVSKVS+QCLNSAFS  +KE+ 
Sbjct  175   IEAQGKYLQAVLEKAQETLGRQNLGAVGLEATKLQLSELVSKVSSQCLNSAFSDRLKEIQ  234

Query  921   GFC-QQQAQATQP--TDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLY--  757
             G    QQ Q  QP   DCS+DSCLTS EGS ++ E++N  M LR  N    ME  ++   
Sbjct  235   GCSPHQQTQTNQPNTNDCSMDSCLTSCEGSQKEQEIQNGGMSLRPFNVHTFMERKEVIEG  294

Query  756   -NETRLKQTEFRWCDDIWENRKYLSKM----DEETKNNGLSVSTGLQGGKWNGNSNYSDR  592
              N   L  T+  WCD + +N  +L+ +    D+ + +N LS+S GL+G   NG       
Sbjct  295   PNLNNLPNTDLNWCDPVKKN-TFLTPLSMHADKRSPSN-LSMSIGLEGETENG-------  345

Query  591   RFTGTDADVKLFAQAVDRSDTSKPEKQKTSQEYKLP--YFGP-KLDLNTDDKTDVASSCK  421
                           +  R+++ KP   K SQ+Y LP  YF   KLDL T+D  D  +SCK
Sbjct  346   --------------STIRTESVKPVADKVSQDYGLPSNYFAASKLDLTTEDNKDTKTSCK  391

Query  420   QLDLNGFSWN  391
             QLDLNGFSWN
Sbjct  392   QLDLNGFSWN  401



>ref|XP_009366424.1| PREDICTED: uncharacterized protein LOC103956200 isoform X2 [Pyrus 
x bretschneideri]
Length=453

 Score =   414 bits (1064),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 238/419 (57%), Positives = 292/419 (70%), Gaps = 35/419 (8%)
 Frame = -2

Query  1578  MPPERHLFMQGENGH---GDSGLVLSTDAKPRLKWTQDLHERFVEAVNQLGGADKATPKS  1408
             +P ER LF+Q  + +   GDSGLVLSTDAKPRLKWT DLHERF+EAVNQLGGADKATPK+
Sbjct  47    IPSERILFLQQGDQNSPAGDSGLVLSTDAKPRLKWTLDLHERFIEAVNQLGGADKATPKT  106

Query  1407  VLKQMGIQGLTLYHLKSHLQKYRLSKNLH-GHANSSSNKAMSSGMDAATGSDKIPEANGN  1231
             V+K MGI GLTLYHLKSHLQKYRLSKNLH GH  S   K  +  +  A G   I EANG+
Sbjct  107   VMKLMGIPGLTLYHLKSHLQKYRLSKNLHGGHVTSGPTKIGTVPVPVA-GESLISEANGS  165

Query  1230  HINSANIG--PLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVLEK  1057
              +++ +IG  P +N  L ++E +++QIEVQRRLHEQLEVQRHLQLRIEAQGKYLQ+VLEK
Sbjct  166   QMSTMSIGIAPQSNKGLHLNETLEMQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQSVLEK  225

Query  1056  AQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFCQQQAQAT-QPTD  880
             AQETLGRQ+LG +GLEAAK QLSELVSKVS   LNSAF+ +KE+ G C Q+ Q   QPTD
Sbjct  226   AQETLGRQNLGTVGLEAAKVQLSELVSKVS---LNSAFTELKEVQGLCPQKTQTNQQPTD  282

Query  879   CSLDSCLTSSEGSLRDH-EMRNSQMGLRSLNF----GAHMESTDLYNETR--LKQTEFRW  721
             CS+DSCLTS E S RD  ++ +S M LR  N+     A +E  +   + R  L+ T+  W
Sbjct  283   CSIDSCLTSCEVSRRDQDQIHSSGMPLRP-NYNGRAAALLEHKEAAQDQRPMLQNTQLNW  341

Query  720   CDDIWEN--RKYLSKMDEE------TKNNGLSVSTGLQGGKWNGNSNYSDRRFTGTDADV  565
             CDD+ EN  R  +SK  E+      T+++ LS+S GLQG  WN +S        G D D 
Sbjct  342   CDDLKENMFRSPISKDAEKRMFPAATRSSDLSMSIGLQGENWNIDSK-------GRDTDG  394

Query  564   KLFAQAVDRSDTSKPEKQKTSQEYK-LPYFGPKLDLNTDDKTDVASSCKQLDLNGFSWN  391
                 +   R+D++K E  K SQ Y+ +PYF  KLDLN  D  D +SSC+Q DLNGFSW+
Sbjct  395   SFLGRTNSRADSAKVEGVKVSQGYRSVPYFAAKLDLNAHDDNDTSSSCRQFDLNGFSWS  453



>ref|XP_010528768.1| PREDICTED: uncharacterized protein LOC104805787 [Tarenaya hassleriana]
Length=397

 Score =   411 bits (1056),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 232/410 (57%), Positives = 277/410 (68%), Gaps = 23/410 (6%)
 Frame = -2

Query  1614  QGKSMHPSTNM-LMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEAVNQL  1438
             QGK+M+ S+ M +  PERHLF+   NG GD GLVLSTDAKPRLKWT DLHERFVEAV+QL
Sbjct  3     QGKNMNSSSRMPVTAPERHLFLHPGNGPGDPGLVLSTDAKPRLKWTPDLHERFVEAVHQL  62

Query  1437  GGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDAATGS  1258
             GGADKATPK+V+K MGI GLTLYHLKSHLQKYRLSKN+HG AN+  ++     M      
Sbjct  63    GGADKATPKTVMKLMGIPGLTLYHLKSHLQKYRLSKNIHGQANNGVHRISVVAMSG----  118

Query  1257  DKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQGKY  1078
             DK PE+ G ++ + NIG   N N PI EAIQ+QIEVQRRLHEQLEVQRHLQ+++EAQGKY
Sbjct  119   DKRPESAGTNMANLNIGTQMNKNSPIGEAIQMQIEVQRRLHEQLEVQRHLQMQMEAQGKY  178

Query  1077  LQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFCQQQ--  904
             LQAVLEKAQE LGRQ+LG +GLEAAK QLSELVSKVSN+CL S  SG+KEL GFC QQ  
Sbjct  179   LQAVLEKAQEMLGRQNLGSVGLEAAKIQLSELVSKVSNECLRSRLSGMKELHGFCPQQRI  238

Query  903   AQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQTEFR  724
              QA +P DCSL+SCLT+ E S  + ++  S     SL F    +S D+  E  L+QTE  
Sbjct  239   RQAARPADCSLESCLTTCEASQMEEQLGLSTYSGSSLIF----KSKDIVEEPLLRQTELN  294

Query  723   WCDDIWENRKYLSKMD-EETKNNGLSVSTGLQGGKWNGNSNYSDRRFTGTDADVKLFAQA  547
             W  ++ ENR+   K     T + G S    L  G   G +N +D  +  T+ +    A  
Sbjct  295   WSGELKENRRLTGKESGRRTFSGGRSSVNDLSIGV--GPTNDADYAYGATENEASGSAGR  352

Query  546   VDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVA-SSCKQLDLNGF  400
             V          ++ S EY L YF  KLDLNT  +TD A   CKQLDLNGF
Sbjct  353   VS--------GERGSNEYNLSYFATKLDLNTGGETDSAMKGCKQLDLNGF  394



>ref|XP_009366423.1| PREDICTED: uncharacterized protein LOC103956200 isoform X1 [Pyrus 
x bretschneideri]
Length=455

 Score =   413 bits (1061),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 237/420 (56%), Positives = 291/420 (69%), Gaps = 35/420 (8%)
 Frame = -2

Query  1578  MPPERHLFMQGENGH---GDSGLVLSTDAKPRLKWTQDLHERFVEAVNQLGGADKATPKS  1408
             +P ER LF+Q  + +   GDSGLVLSTDAKPRLKWT DLHERF+EAVNQLGGADKATPK+
Sbjct  47    IPSERILFLQQGDQNSPAGDSGLVLSTDAKPRLKWTLDLHERFIEAVNQLGGADKATPKT  106

Query  1407  VLKQMGIQGLTLYHLKSHLQKYRLSKNLH-GHANSSSNKAMSSGMDA-ATGSDKIPEANG  1234
             V+K MGI GLTLYHLKSHLQKYRLSKNLH GH  S   K  +  +     G   I EANG
Sbjct  107   VMKLMGIPGLTLYHLKSHLQKYRLSKNLHGGHVTSGPTKIGTGTVPVPVAGESLISEANG  166

Query  1233  NHINSANIG--PLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVLE  1060
             + +++ +IG  P +N  L ++E +++QIEVQRRLHEQLEVQRHLQLRIEAQGKYLQ+VLE
Sbjct  167   SQMSTMSIGIAPQSNKGLHLNETLEMQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQSVLE  226

Query  1059  KAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFCQQQAQAT-QPT  883
             KAQETLGRQ+LG +GLEAAK QLSELVSKVS   LNSAF+ +KE+ G C Q+ Q   QPT
Sbjct  227   KAQETLGRQNLGTVGLEAAKVQLSELVSKVS---LNSAFTELKEVQGLCPQKTQTNQQPT  283

Query  882   DCSLDSCLTSSEGSLRDH-EMRNSQMGLRSLNF----GAHMESTDLYNETR--LKQTEFR  724
             DCS+DSCLTS E S RD  ++ +S M LR  N+     A +E  +   + R  L+ T+  
Sbjct  284   DCSIDSCLTSCEVSRRDQDQIHSSGMPLRP-NYNGRAAALLEHKEAAQDQRPMLQNTQLN  342

Query  723   WCDDIWEN--RKYLSKMDEE------TKNNGLSVSTGLQGGKWNGNSNYSDRRFTGTDAD  568
             WCDD+ EN  R  +SK  E+      T+++ LS+S GLQG  WN +S        G D D
Sbjct  343   WCDDLKENMFRSPISKDAEKRMFPAATRSSDLSMSIGLQGENWNIDSK-------GRDTD  395

Query  567   VKLFAQAVDRSDTSKPEKQKTSQEYK-LPYFGPKLDLNTDDKTDVASSCKQLDLNGFSWN  391
                  +   R+D++K E  K SQ Y+ +PYF  KLDLN  D  D +SSC+Q DLNGFSW+
Sbjct  396   GSFLGRTNSRADSAKVEGVKVSQGYRSVPYFAAKLDLNAHDDNDTSSSCRQFDLNGFSWS  455



>ref|XP_008360528.1| PREDICTED: uncharacterized protein LOC103424216 [Malus domestica]
Length=449

 Score =   411 bits (1057),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 230/420 (55%), Positives = 287/420 (68%), Gaps = 36/420 (9%)
 Frame = -2

Query  1569  ERHLFMQGENGH---GDSGLVLSTDAKPRLKWTQDLHERFVEAVNQLGGADKATPKSVLK  1399
             ERHLF+Q  + +   GDSGLVLSTDAKPRLKWT DLHERF+EAVNQLGGADKATPK+V+K
Sbjct  39    ERHLFLQQGDQNSPAGDSGLVLSTDAKPRLKWTPDLHERFIEAVNQLGGADKATPKTVMK  98

Query  1398  QMGIQGLTLYHLKSHLQKYRLSKNLHG-HANSSSNKAMSSGMDAATGSDKIPEANGNHIN  1222
              MGI GLTLYHLKSHLQKYRLSKNLHG H  SS  K     +  A G   I EANG+ ++
Sbjct  99    LMGIPGLTLYHLKSHLQKYRLSKNLHGGHVTSSLTKIGPVPVSVA-GERLISEANGSQMS  157

Query  1221  --SANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVLEKAQE  1048
               S  I P +N  L ISE +++QIEVQRRLHEQLEVQRHLQLRIE+QGKYLQ+VLEKAQE
Sbjct  158   TMSTGIAPQSNKGLHISETLEMQIEVQRRLHEQLEVQRHLQLRIESQGKYLQSVLEKAQE  217

Query  1047  TLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFCQQQAQAT-QPTDCSL  871
             TLGRQ+LG +GLEAA+ QLSELVS VS QCLNS+F+ +KEL G C QQ Q   QP DCS+
Sbjct  218   TLGRQNLGXVGLEAAQVQLSELVSTVSTQCLNSSFTELKELQGLCPQQTQMNQQPADCSM  277

Query  870   DSCLTSSEGSLRDH-EMRNSQMGLRSLNFGAHMESTDLYNETRLKQ-------TEFRWCD  715
             DSCLT  EGS +D  ++ +S + LR  N+   + +     +T   Q       ++  WC+
Sbjct  278   DSCLTFCEGSKKDQDQIHSSGVPLRP-NYNGRVTAVLEQKDTERAQPPMLQNTSQLNWCE  336

Query  714   DIWENRKYLSKMDE----------ETKNNGLSVSTGLQGGKWNGNSNYSDRRFTGTDADV  565
             D+ EN  ++S + +          ET+++ LS+S GLQG +WN +S        G D+D 
Sbjct  337   DMKENNMFISSISKDAEKRMFPAAETRSSDLSMSIGLQGERWNIDSK-------GRDSDD  389

Query  564   KLFAQA-VDRSDTSKPEKQKTSQEYK-LPYFGPKLDLNTDDKTDVASSCKQLDLNGFSWN  391
                 +    R+D++K +  K S  Y+ +PYF  KLDLN  D  D +SSC+Q DLNGFSW+
Sbjct  390   SFLERTNSSRADSAKVKGAKVSXGYRSVPYFAAKLDLNAHDDNDASSSCRQFDLNGFSWS  449



>ref|XP_008386803.1| PREDICTED: uncharacterized protein LOC103449296 isoform X1 [Malus 
domestica]
Length=451

 Score =   411 bits (1057),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 234/420 (56%), Positives = 289/420 (69%), Gaps = 35/420 (8%)
 Frame = -2

Query  1578  MPPERHLFMQGENGH---GDSGLVLSTDAKPRLKWTQDLHERFVEAVNQLGGADKATPKS  1408
             +P ERHLF+Q  + +   GDSGLVLSTDAKPRLKWT DLHERF+EAVNQLGGADKATPK+
Sbjct  43    IPSERHLFLQQGDQNSPAGDSGLVLSTDAKPRLKWTLDLHERFIEAVNQLGGADKATPKT  102

Query  1407  VLKQMGIQGLTLYHLKSHLQKYRLSKNLH-GHANSSSNKAMSSGMDAATGSDK-IPEANG  1234
             V+K MGI GLTLYHLKSHLQKYRLSKNLH GH  S   K  +  +  +   ++ I EANG
Sbjct  103   VMKLMGIPGLTLYHLKSHLQKYRLSKNLHGGHVTSGPTKIGTGTVPVSEAGERLISEANG  162

Query  1233  NHINSANIG--PLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVLE  1060
             + +++ +IG  P +N  L ++E +++QIEVQRRLHEQLEVQRHLQLRIEAQGKYLQ+VLE
Sbjct  163   SQMSTMSIGIAPQSNKGLHLNETLEMQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQSVLE  222

Query  1059  KAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFCQQQAQAT-QPT  883
             KAQETLGRQ+LG +GLEAAK QLSELVSKVS   LNSAF+ +KEL G C Q+ Q   QPT
Sbjct  223   KAQETLGRQNLGTVGLEAAKVQLSELVSKVS---LNSAFTELKELQGLCPQKTQTNQQPT  279

Query  882   DCSLDSCLTSSEGSLRDH-EMRNSQMGLRSLNFGAHMESTDLYNET------RLKQTEFR  724
             DCS+DSCLTS EG  RD  ++ +S M LR  N+     +   + E        L+ T+  
Sbjct  280   DCSIDSCLTSCEGLRRDQDQIHSSGMPLRP-NYSGRAAALLEHKEAAQDQXPMLQNTQLN  338

Query  723   WCDDIWENRKY--LSKMDEE------TKNNGLSVSTGLQGGKWNGNSNYSDRRFTGTDAD  568
              CDD+ EN     +SK  E+      T+++ LS+S GLQG  WN +S        G D D
Sbjct  339   LCDDLKENMXLSSISKDAEKRMFPAATRSSDLSMSIGLQGENWNIDSK-------GRDTD  391

Query  567   VKLFAQAVDRSDTSKPEKQKTSQEYK-LPYFGPKLDLNTDDKTDVASSCKQLDLNGFSWN  391
                  +   R+D++K E  K SQ Y+ +PYF  KLDLN  D  D +SSC+Q DLNGFSW+
Sbjct  392   GSFLGRTNSRADSAKVEGAKVSQGYRSVPYFAAKLDLNAXDDNDTSSSCRQFDLNGFSWS  451



>ref|XP_008386804.1| PREDICTED: uncharacterized protein LOC103449296 isoform X2 [Malus 
domestica]
Length=449

 Score =   411 bits (1056),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 236/419 (56%), Positives = 288/419 (69%), Gaps = 35/419 (8%)
 Frame = -2

Query  1578  MPPERHLFMQGENGH---GDSGLVLSTDAKPRLKWTQDLHERFVEAVNQLGGADKATPKS  1408
             +P ERHLF+Q  + +   GDSGLVLSTDAKPRLKWT DLHERF+EAVNQLGGADKATPK+
Sbjct  43    IPSERHLFLQQGDQNSPAGDSGLVLSTDAKPRLKWTLDLHERFIEAVNQLGGADKATPKT  102

Query  1407  VLKQMGIQGLTLYHLKSHLQKYRLSKNLH-GHANSSSNKAMSSGMDAATGSDKIPEANGN  1231
             V+K MGI GLTLYHLKSHLQKYRLSKNLH GH  S   K  +  +  A G   I EANG+
Sbjct  103   VMKLMGIPGLTLYHLKSHLQKYRLSKNLHGGHVTSGPTKIGTVPVSEA-GERLISEANGS  161

Query  1230  HINSANIG--PLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVLEK  1057
              +++ +IG  P +N  L ++E +++QIEVQRRLHEQLEVQRHLQLRIEAQGKYLQ+VLEK
Sbjct  162   QMSTMSIGIAPQSNKGLHLNETLEMQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQSVLEK  221

Query  1056  AQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFCQQQAQAT-QPTD  880
             AQETLGRQ+LG +GLEAAK QLSELVSKVS   LNSAF+ +KEL G C Q+ Q   QPTD
Sbjct  222   AQETLGRQNLGTVGLEAAKVQLSELVSKVS---LNSAFTELKELQGLCPQKTQTNQQPTD  278

Query  879   CSLDSCLTSSEGSLRDH-EMRNSQMGLRSLNFGAHMESTDLYNET------RLKQTEFRW  721
             CS+DSCLTS EG  RD  ++ +S M LR  N+     +   + E        L+ T+   
Sbjct  279   CSIDSCLTSCEGLRRDQDQIHSSGMPLRP-NYSGRAAALLEHKEAAQDQXPMLQNTQLNL  337

Query  720   CDDIWENRKY--LSKMDEE------TKNNGLSVSTGLQGGKWNGNSNYSDRRFTGTDADV  565
             CDD+ EN     +SK  E+      T+++ LS+S GLQG  WN +S        G D D 
Sbjct  338   CDDLKENMXLSSISKDAEKRMFPAATRSSDLSMSIGLQGENWNIDSK-------GRDTDG  390

Query  564   KLFAQAVDRSDTSKPEKQKTSQEYK-LPYFGPKLDLNTDDKTDVASSCKQLDLNGFSWN  391
                 +   R+D++K E  K SQ Y+ +PYF  KLDLN  D  D +SSC+Q DLNGFSW+
Sbjct  391   SFLGRTNSRADSAKVEGAKVSQGYRSVPYFAAKLDLNAXDDNDTSSSCRQFDLNGFSWS  449



>ref|XP_009353160.1| PREDICTED: uncharacterized protein LOC103944419 [Pyrus x bretschneideri]
Length=447

 Score =   407 bits (1045),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 232/423 (55%), Positives = 291/423 (69%), Gaps = 36/423 (9%)
 Frame = -2

Query  1578  MPPERHLFMQGENGH---GDSGLVLSTDAKPRLKWTQDLHERFVEAVNQLGGADKATPKS  1408
             +P ERHLF+Q  + +   GDSGLVLSTDAKPRLKWT DLHERF+EAVNQLGGADKATPK+
Sbjct  34    IPSERHLFLQQGDQNSPAGDSGLVLSTDAKPRLKWTPDLHERFIEAVNQLGGADKATPKT  93

Query  1407  VLKQMGIQGLTLYHLKSHLQKYRLSKNLHG-HANSSSNKAMSSGMDAATGSDKIPEANGN  1231
             V+K MGI GLTLYHLKSHLQKYRLSKNLHG H  SS  K     +  A G   I EANG+
Sbjct  94    VMKLMGIPGLTLYHLKSHLQKYRLSKNLHGGHVTSSLTKIGPVPVSVA-GERLISEANGS  152

Query  1230  HIN--SANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVLEK  1057
              ++  S  I P +N  L I+E +++QIEVQRRLHEQLEVQRHLQLRIE+QGKYLQ+VLEK
Sbjct  153   QMSTTSTGIAPQSNKGLHITETLEMQIEVQRRLHEQLEVQRHLQLRIESQGKYLQSVLEK  212

Query  1056  AQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFC-QQQAQATQPTD  880
             AQETLGRQ+LG +GLEAA+ QLSELVSKVS QCLNS+F+ +KEL G C QQ     QPTD
Sbjct  213   AQETLGRQNLGTVGLEAAQVQLSELVSKVSTQCLNSSFTDLKELQGLCPQQTQTNQQPTD  272

Query  879   CSLDSCLTSSEGSLRDH-EMRNSQMGLRSLNFGAHMESTDLYNETRLKQ-------TEFR  724
             CS+DSCLT  EGS +D  ++ +S + LR  N+   + +     +T   Q       ++  
Sbjct  273   CSMDSCLTFCEGSKKDQDQIHSSGVPLRP-NYNGRVTAVLEQKDTERAQPPMLQNTSQLN  331

Query  723   WCDDIWENRKYLSKMDE----------ETKNNGLSVSTGLQGGKWNGNSNYSDRRFTGTD  574
             WC+D+ EN  ++S + +          ET+++ LS+S GLQG +WN +S        G D
Sbjct  332   WCEDMKENNMFISSISKDAEKRMFPAAETRSSDLSMSIGLQGERWNLDSK-------GRD  384

Query  573   ADVKLFAQA-VDRSDTSKPEKQKTSQEYK-LPYFGPKLDLNTDDKTDVASSCKQLDLNGF  400
             +D     +    R+D++K +  K SQ Y+ +PYF  KLDLN  D  D +SSC+Q DLNGF
Sbjct  385   SDGSFLERTNSSRADSAKVKGAKVSQGYRSVPYFAAKLDLNAHDDNDASSSCRQFDLNGF  444

Query  399   SWN  391
             SW+
Sbjct  445   SWS  447



>gb|KHG01106.1| Myb family transcription factor APL [Gossypium arboreum]
Length=361

 Score =   400 bits (1027),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 224/397 (56%), Positives = 270/397 (68%), Gaps = 37/397 (9%)
 Frame = -2

Query  1584  MLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEAVNQLGGADKATPKSV  1405
             M +  ERHLF+QG+  HGDSGL+LSTDAKPRLKWT DLHERF+EAVNQLGGADKATPK+V
Sbjct  1     MAVHNERHLFLQGD--HGDSGLMLSTDAKPRLKWTPDLHERFIEAVNQLGGADKATPKTV  58

Query  1404  LKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDAATGSDKIPEANGNHI  1225
             +K MGI GLTLYHLKSHLQKYRLSKNLHG  N+ S K  +  M       ++ EANG+ I
Sbjct  59    MKLMGIPGLTLYHLKSHLQKYRLSKNLHGQTNNGSTKIGAVAM----AGKRMSEANGSPI  114

Query  1224  NSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVLEKAQET  1045
             NS +IGP AN  + I EA+Q+QIEVQRRLHEQLEVQRHLQLRIEAQGKYLQ+VLEKAQET
Sbjct  115   NSLSIGPQANKGIQIGEALQMQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQSVLEKAQET  174

Query  1044  LGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFCQQQAQATQPTDCSLDS  865
             L RQ+LG +GLEAAK QLSELVSKVSNQCLNSAF  +K+L G C QQ Q   P DCS+DS
Sbjct  175   LHRQNLGTVGLEAAKLQLSELVSKVSNQCLNSAFPDLKDLRGLCCQQTQPNPPNDCSMDS  234

Query  864   CLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQTEFRWCDDIWENRKYLS  685
             CLTS EGS RD E+ N+ M LR+ N   H +   ++++T  K +E +   +  ++ + + 
Sbjct  235   CLTSCEGSQRDQEIHNNGMRLRTCN--THKDPL-MHHQTETKTSENKTMGNDDDDDRRMF  291

Query  684   KMDEETKNNGLSVSTGLQGGKWNGNSNYSDRRFTGTDADVKLFAQAVDRSDTSKPEKQKT  505
               D    +  LS+S GL+G      S +  R    +  DV                 ++ 
Sbjct  292   FADRNCSD--LSMSVGLRG------SFFQARNEEHSFLDVG---------------NKRV  328

Query  504   SQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNGFSW  394
                 +LPYF  KLDLN D+K      CKQ DLNG SW
Sbjct  329   DSVNRLPYFATKLDLNVDEK-----HCKQFDLNGLSW  360



>ref|XP_010558713.1| PREDICTED: uncharacterized protein LOC104827266 isoform X1 [Tarenaya 
hassleriana]
Length=397

 Score =   398 bits (1022),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 222/422 (53%), Positives = 271/422 (64%), Gaps = 36/422 (9%)
 Frame = -2

Query  1629  YHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEA  1450
             YH+  Q K+   +  M MP ERH F++G N  GDSGL+LSTDAKPRLKWT DLHERFVEA
Sbjct  3     YHNQHQAKNTISTPRMPMPSERHPFLRGGNSPGDSGLILSTDAKPRLKWTPDLHERFVEA  62

Query  1449  VNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDA  1270
             VNQLGGADKATPK+++K MGI GLTLYHLKSHLQKYRLSKNL+G ANS SNK    G+  
Sbjct  63    VNQLGGADKATPKAIMKVMGIPGLTLYHLKSHLQKYRLSKNLNGQANSVSNKM---GL-M  118

Query  1269  ATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEA  1090
             A   +  P+ +  H  S +IGP  N NLPISEA+QIQIEVQRRLHEQLEVQRHLQLRIEA
Sbjct  119   AMAEEMSPDTSEIHTESLSIGPQTNKNLPISEALQIQIEVQRRLHEQLEVQRHLQLRIEA  178

Query  1089  QGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFCQ  910
             QGKYLQAVLEKAQETLG+Q+LG  G+EAAK QLSEL SKVS +  N+ F   KEL     
Sbjct  179   QGKYLQAVLEKAQETLGKQNLGTAGIEAAKVQLSELASKVSAEYSNANFVEPKELQSLHP  238

Query  909   QQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQTE  730
             QQ Q T P D SLDS L S EG+ R  +M  +++GLR     +  E  ++  E   ++ E
Sbjct  239   QQMQMTYPPDFSLDSSLASREGTQRSPKMLENRLGLRPYLSDSTTEQKEIAEEPLFQRME  298

Query  729   FRWCDDIWENRKYLSKM--DEETK-------NNGLSVSTGLQGGKWNGNSNYSDRRFTGT  577
               W + + EN+ Y+S M  D ET+          LS+  GL G + +GN++Y++ R    
Sbjct  299   LTWREGLRENKTYISPMADDRETRLSSSERCPGNLSIGVGLHGHRGHGNADYAEERI---  355

Query  576   DADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNGFS  397
               D +   + +D +                     +LDLNT D     +  KQ DLNGFS
Sbjct  356   KKDEERIQKGLDSTT--------------------ELDLNTHDGNYGTARPKQFDLNGFS  395

Query  396   WN  391
             WN
Sbjct  396   WN  397



>ref|XP_006599432.1| PREDICTED: uncharacterized protein LOC100789797 isoform X4 [Glycine 
max]
 gb|KHN32749.1| Myb family transcription factor APL [Glycine soja]
Length=415

 Score =   395 bits (1015),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 227/427 (53%), Positives = 282/427 (66%), Gaps = 29/427 (7%)
 Frame = -2

Query  1629  YHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEA  1450
             Y   +Q K+MH +  M  P ERH+ +QG NG GD GLVLSTDAKPRLKWT DLHERF+EA
Sbjct  3     YQQQQQAKNMH-ALRMHSPTERHMMLQGGNGAGDPGLVLSTDAKPRLKWTPDLHERFIEA  61

Query  1449  VNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDA  1270
             VNQLGGADKATPK+VLK MGI GLTLYHLKSHLQKYR+SKN+HG  N+S+NK ++S M+A
Sbjct  62    VNQLGGADKATPKTVLKLMGIPGLTLYHLKSHLQKYRISKNMHGQTNTSNNK-IASTMEA  120

Query  1269  ATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEA  1090
             ATG   I EA+G  +   +IG   N N  I++A+Q+QIEVQRRLHEQLEVQRHLQLRIEA
Sbjct  121   ATG---ISEASGVQMKHLSIGLQTNKNSEINDALQMQIEVQRRLHEQLEVQRHLQLRIEA  177

Query  1089  QGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFCQ  910
             QGKYLQAVLEKAQETLGRQ+LG  G+EAAK QLSEL S+VS Q L+S FS +KEL     
Sbjct  178   QGKYLQAVLEKAQETLGRQNLGAEGVEAAKVQLSELASRVSPQSLDSKFSELKELQVLWP  237

Query  909   QQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQTE  730
             QQ Q  Q TDCS+ S L  SE S RD E  +  + LR+ N      S     E+   + +
Sbjct  238   QQTQEGQATDCSMGSFLNYSEESQRDRETHSMNLNLRACNGPPFSVSKGCAEESMHLKPD  297

Query  729   FRWCDDIWENRKYLSKMD----------EETKNNGLSVSTGLQGGKWNGNSNYSDRRFTG  580
             +R CD++ EN  +LS              E  ++ LS++ G+Q           +  F  
Sbjct  298   YRLCDEVKENMMFLSSSSNSKVVKGDFLSERPSSLLSMNVGVQ----------EEENFGR  347

Query  579   TDADVKLFAQAVDRSDTSK-PEK---QKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLD  412
             T    +   +  + ++T + P K   +K SQ+Y+L  F  KLDLN+ D  D +S C+Q D
Sbjct  348   TTVPKEEGWKRRESTETGRVPVKLNYEKISQDYRLANFDVKLDLNSHDDNDASSHCQQFD  407

Query  411   LNGFSWN  391
             LNGFSWN
Sbjct  408   LNGFSWN  414



>gb|EYU35496.1| hypothetical protein MIMGU_mgv1a025925mg [Erythranthe guttata]
Length=402

 Score =   393 bits (1010),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 234/422 (55%), Positives = 287/422 (68%), Gaps = 47/422 (11%)
 Frame = -2

Query  1614  QGKSMHPSTNMLMPPERHLFMQG---ENGHGD-SGLVLSTDAKPRLKWTQDLHERFVEAV  1447
             QGK++  ST M +P ERHLF+QG    N +GD SGLVLSTDAKPRLKWT DLH+RF+EAV
Sbjct  12    QGKNIQASTRMSIPSERHLFLQGPTSSNNNGDQSGLVLSTDAKPRLKWTPDLHQRFIEAV  71

Query  1446  NQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDAA  1267
             NQLGGADKATPKSVLK MGIQGLTLYHLKSHLQKYRLSK+L+G AN+ SNK+        
Sbjct  72    NQLGGADKATPKSVLKLMGIQGLTLYHLKSHLQKYRLSKSLNGQANTVSNKS--------  123

Query  1266  TGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQ  1087
                      N    N+     L   N+ I EA+Q+QIEVQRRLHEQLEVQRHLQLRIEAQ
Sbjct  124   --------GNKTLFNNRLSYLLQRPNMHIGEALQMQIEVQRRLHEQLEVQRHLQLRIEAQ  175

Query  1086  GKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFCQ-  910
             GKYLQ+VLEKAQETLG Q++G +GLEAAK QLS+LVSKVS QC +SAFS +KEL   C  
Sbjct  176   GKYLQSVLEKAQETLGGQNMGTVGLEAAKVQLSDLVSKVSTQCFSSAFSDMKELSDLCMS  235

Query  909   QQAQATQPTDCSLDSCLTSS-EGSLRDHE--MRNSQMGL---RSLNFGAHMESTDLYNE-  751
             QQ QA +PTDCS+DSCLTSS EGS+RD E  + N+ MGL    +L F  + E  D  ++ 
Sbjct  236   QQKQANKPTDCSIDSCLTSSFEGSIRDQEVVLYNNLMGLNDKHALGFRTNTEERDRKDDG  295

Query  750   TRLKQTEFRWCDDIWENRKYLSKMDEETKNNGLSVSTGLQGG-KWNGNSNYSDRRFTGTD  574
              R ++      DD+  +R +++        N LS+S G++GG +WN +  Y      GT+
Sbjct  296   ARWREETKESGDDV--DRGFIN------SGNNLSMSIGIEGGDQWNDSGKY-----YGTE  342

Query  573   ADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCK--QLDLNGF  400
                 +F +  D SD     K + S++ K+P F  +LDLNT  + + ASS K  QLDLNGF
Sbjct  343   ---DMFNKGDDGSDGKLLMKTERSEKTKMPLFSTRLDLNTGSENNAASSYKHHQLDLNGF  399

Query  399   SW  394
             SW
Sbjct  400   SW  401



>ref|XP_006574748.1| PREDICTED: uncharacterized protein LOC100786282 isoform X2 [Glycine 
max]
Length=415

 Score =   392 bits (1008),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 229/430 (53%), Positives = 280/430 (65%), Gaps = 35/430 (8%)
 Frame = -2

Query  1629  YHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEA  1450
             Y   +Q K+MH +  M  P ERH+ MQG NG GDSGLVLSTDAKPRLKWT DLHERF+EA
Sbjct  3     YQQQQQAKNMH-ALRMHSPTERHMMMQGGNGSGDSGLVLSTDAKPRLKWTPDLHERFIEA  61

Query  1449  VNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDA  1270
             VNQLGGADKATPK+VLK MGI GLTLYHLKSHLQKYR+SKN+HG  N+S+NK ++S M+A
Sbjct  62    VNQLGGADKATPKTVLKLMGIPGLTLYHLKSHLQKYRISKNMHGQTNTSNNK-IASTMEA  120

Query  1269  ATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEA  1090
             A    +I EA+G  +   +IG   N N  I++A+Q+QIEVQRRLHEQLEVQRHLQLRIEA
Sbjct  121   AA---RISEASGVQMKHLSIGLQTNKNSEINDALQMQIEVQRRLHEQLEVQRHLQLRIEA  177

Query  1089  QGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFCQ  910
             QGKYLQAVLEKAQETLGRQ++G  G+EA K QLSEL S+VS Q L+S FS +KEL     
Sbjct  178   QGKYLQAVLEKAQETLGRQNIGAEGVEATKVQLSELASRVSPQSLDSRFSELKELQVLWP  237

Query  909   QQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQTE  730
             QQ Q  Q TDCS+ S LT SE S RD E  N  + LR+ N      S     E+   + +
Sbjct  238   QQTQEGQATDCSMGSFLTYSEESQRDRETHNMNLNLRAYNGPPFSVSKGSVEESMHLKPD  297

Query  729   FRWCDDIWENRKYLSKMD----------EETKNNGLSVSTGLQGGKWNGNSN------YS  598
                CD++ EN  +LS              E  ++ LS++ G+Q  +  G +       + 
Sbjct  298   HTLCDEVKENLMFLSSSSDSKVVKGDFLSERPSSLLSMNEGVQEEENFGRTTVPKEEGWK  357

Query  597   DRRFTGTD-ADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCK  421
              R+ T T  A VKL               +K SQ+Y+L  F  KLDLN+ D  D +S C+
Sbjct  358   GRKSTETGRAPVKL-------------NHEKISQDYRLANFEVKLDLNSHDDNDASSHCQ  404

Query  420   QLDLNGFSWN  391
             Q DLNGFSWN
Sbjct  405   QFDLNGFSWN  414



>ref|XP_006599431.1| PREDICTED: uncharacterized protein LOC100789797 isoform X3 [Glycine 
max]
Length=416

 Score =   390 bits (1003),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 227/428 (53%), Positives = 282/428 (66%), Gaps = 30/428 (7%)
 Frame = -2

Query  1629  YHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEA  1450
             Y   +Q K+MH +  M  P ERH+ +QG NG GD GLVLSTDAKPRLKWT DLHERF+EA
Sbjct  3     YQQQQQAKNMH-ALRMHSPTERHMMLQGGNGAGDPGLVLSTDAKPRLKWTPDLHERFIEA  61

Query  1449  VNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQ-KYRLSKNLHGHANSSSNKAMSSGMD  1273
             VNQLGGADKATPK+VLK MGI GLTLYHLKSHLQ KYR+SKN+HG  N+S+NK ++S M+
Sbjct  62    VNQLGGADKATPKTVLKLMGIPGLTLYHLKSHLQQKYRISKNMHGQTNTSNNK-IASTME  120

Query  1272  AATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIE  1093
             AATG   I EA+G  +   +IG   N N  I++A+Q+QIEVQRRLHEQLEVQRHLQLRIE
Sbjct  121   AATG---ISEASGVQMKHLSIGLQTNKNSEINDALQMQIEVQRRLHEQLEVQRHLQLRIE  177

Query  1092  AQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFC  913
             AQGKYLQAVLEKAQETLGRQ+LG  G+EAAK QLSEL S+VS Q L+S FS +KEL    
Sbjct  178   AQGKYLQAVLEKAQETLGRQNLGAEGVEAAKVQLSELASRVSPQSLDSKFSELKELQVLW  237

Query  912   QQQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQT  733
              QQ Q  Q TDCS+ S L  SE S RD E  +  + LR+ N      S     E+   + 
Sbjct  238   PQQTQEGQATDCSMGSFLNYSEESQRDRETHSMNLNLRACNGPPFSVSKGCAEESMHLKP  297

Query  732   EFRWCDDIWENRKYLSKMD----------EETKNNGLSVSTGLQGGKWNGNSNYSDRRFT  583
             ++R CD++ EN  +LS              E  ++ LS++ G+Q           +  F 
Sbjct  298   DYRLCDEVKENMMFLSSSSNSKVVKGDFLSERPSSLLSMNVGVQ----------EEENFG  347

Query  582   GTDADVKLFAQAVDRSDTSK-PEK---QKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQL  415
              T    +   +  + ++T + P K   +K SQ+Y+L  F  KLDLN+ D  D +S C+Q 
Sbjct  348   RTTVPKEEGWKRRESTETGRVPVKLNYEKISQDYRLANFDVKLDLNSHDDNDASSHCQQF  407

Query  414   DLNGFSWN  391
             DLNGFSWN
Sbjct  408   DLNGFSWN  415



>ref|XP_006599430.1| PREDICTED: uncharacterized protein LOC100789797 isoform X2 [Glycine 
max]
Length=416

 Score =   390 bits (1003),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 227/428 (53%), Positives = 282/428 (66%), Gaps = 30/428 (7%)
 Frame = -2

Query  1629  YHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEA  1450
             Y   +Q K+MH +  M  P ERH+ +QG NG GD GLVLSTDAKPRLKWT DLHERF+EA
Sbjct  3     YQQQQQAKNMH-ALRMHSPTERHMMLQGGNGAGDPGLVLSTDAKPRLKWTPDLHERFIEA  61

Query  1449  VNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDA  1270
             VNQLGGADKATPK+VLK MGI GLTLYHLKSHLQKYR+SKN+HG  N+S+NK ++S M+A
Sbjct  62    VNQLGGADKATPKTVLKLMGIPGLTLYHLKSHLQKYRISKNMHGQTNTSNNK-IASTMEA  120

Query  1269  ATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLE-VQRHLQLRIE  1093
             ATG   I EA+G  +   +IG   N N  I++A+Q+QIEVQRRLHEQLE VQRHLQLRIE
Sbjct  121   ATG---ISEASGVQMKHLSIGLQTNKNSEINDALQMQIEVQRRLHEQLEQVQRHLQLRIE  177

Query  1092  AQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFC  913
             AQGKYLQAVLEKAQETLGRQ+LG  G+EAAK QLSEL S+VS Q L+S FS +KEL    
Sbjct  178   AQGKYLQAVLEKAQETLGRQNLGAEGVEAAKVQLSELASRVSPQSLDSKFSELKELQVLW  237

Query  912   QQQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQT  733
              QQ Q  Q TDCS+ S L  SE S RD E  +  + LR+ N      S     E+   + 
Sbjct  238   PQQTQEGQATDCSMGSFLNYSEESQRDRETHSMNLNLRACNGPPFSVSKGCAEESMHLKP  297

Query  732   EFRWCDDIWENRKYLSKMD----------EETKNNGLSVSTGLQGGKWNGNSNYSDRRFT  583
             ++R CD++ EN  +LS              E  ++ LS++ G+Q           +  F 
Sbjct  298   DYRLCDEVKENMMFLSSSSNSKVVKGDFLSERPSSLLSMNVGVQ----------EEENFG  347

Query  582   GTDADVKLFAQAVDRSDTSK-PEK---QKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQL  415
              T    +   +  + ++T + P K   +K SQ+Y+L  F  KLDLN+ D  D +S C+Q 
Sbjct  348   RTTVPKEEGWKRRESTETGRVPVKLNYEKISQDYRLANFDVKLDLNSHDDNDASSHCQQF  407

Query  414   DLNGFSWN  391
             DLNGFSWN
Sbjct  408   DLNGFSWN  415



>ref|XP_010558714.1| PREDICTED: uncharacterized protein LOC104827266 isoform X2 [Tarenaya 
hassleriana]
Length=395

 Score =   389 bits (999),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 220/422 (52%), Positives = 269/422 (64%), Gaps = 38/422 (9%)
 Frame = -2

Query  1629  YHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEA  1450
             YH+  Q K+   +  M MP ERH F++G N  GDSGL+LSTDAKPRLKWT DLHERFVEA
Sbjct  3     YHNQHQAKNTISTPRMPMPSERHPFLRGGNSPGDSGLILSTDAKPRLKWTPDLHERFVEA  62

Query  1449  VNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDA  1270
             VNQLGGADKATPK+++K MGI GLTLYHLKSHLQKYRLSKNL+G ANS SNK    G+  
Sbjct  63    VNQLGGADKATPKAIMKVMGIPGLTLYHLKSHLQKYRLSKNLNGQANSVSNKM---GL-M  118

Query  1269  ATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEA  1090
             A   +  P+ +  H  S +IGP  N NLPISEA+QIQIEVQRRLHEQLE  RHLQLRIEA
Sbjct  119   AMAEEMSPDTSEIHTESLSIGPQTNKNLPISEALQIQIEVQRRLHEQLE--RHLQLRIEA  176

Query  1089  QGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFCQ  910
             QGKYLQAVLEKAQETLG+Q+LG  G+EAAK QLSEL SKVS +  N+ F   KEL     
Sbjct  177   QGKYLQAVLEKAQETLGKQNLGTAGIEAAKVQLSELASKVSAEYSNANFVEPKELQSLHP  236

Query  909   QQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQTE  730
             QQ Q T P D SLDS L S EG+ R  +M  +++GLR     +  E  ++  E   ++ E
Sbjct  237   QQMQMTYPPDFSLDSSLASREGTQRSPKMLENRLGLRPYLSDSTTEQKEIAEEPLFQRME  296

Query  729   FRWCDDIWENRKYLSKM--DEETK-------NNGLSVSTGLQGGKWNGNSNYSDRRFTGT  577
               W + + EN+ Y+S M  D ET+          LS+  GL G + +GN++Y++ R    
Sbjct  297   LTWREGLRENKTYISPMADDRETRLSSSERCPGNLSIGVGLHGHRGHGNADYAEERI---  353

Query  576   DADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNGFS  397
               D +   + +D +                     +LDLNT D     +  KQ DLNGFS
Sbjct  354   KKDEERIQKGLDSTT--------------------ELDLNTHDGNYGTARPKQFDLNGFS  393

Query  396   WN  391
             WN
Sbjct  394   WN  395



>ref|XP_010672723.1| PREDICTED: uncharacterized protein LOC104889245 isoform X4 [Beta 
vulgaris subsp. vulgaris]
Length=382

 Score =   387 bits (995),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 225/417 (54%), Positives = 273/417 (65%), Gaps = 40/417 (10%)
 Frame = -2

Query  1632  MYHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVE  1453
             MYHHH Q  +M+PS  +  P ER LF+QG NG  DS LVLSTDAKPRLKWT DLHERFVE
Sbjct  1     MYHHHSQA-NMYPSPRISAPQERQLFLQGGNGSRDSNLVLSTDAKPRLKWTPDLHERFVE  59

Query  1452  AVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMD  1273
             AVNQLGGADKATPK+V+K MGI GLTLYHLKSHLQKYRLSKN+HG  +S +NK +     
Sbjct  60    AVNQLGGADKATPKTVMKLMGIPGLTLYHLKSHLQKYRLSKNIHGQTSSGANKTV-----  114

Query  1272  AATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIE  1093
                 SDK+ E + +H +S NI    N NL I+EA+Q+QIEVQRRLHEQLEVQR LQLRIE
Sbjct  115   -VMSSDKMQETSPSHTSSINIAHQPNKNLHINEALQMQIEVQRRLHEQLEVQRRLQLRIE  173

Query  1092  AQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGI-KELPGF  916
             AQGKYLQAVLEKAQETLG+Q++G +GLEAAK QLSELVSKVSNQCLN AF+ + +E  G 
Sbjct  174   AQGKYLQAVLEKAQETLGKQNIGVVGLEAAKLQLSELVSKVSNQCLNLAFAEMAEEQQGL  233

Query  915   C-QQQAQATQPT-DCSLDSCLTSSEGS-LRDHEMRNSQMGLRSLNFGAHMESTDLYNETR  745
             C +QQ Q  +P  DCSLDSCLTS +G  LR+ +M NS++GLR  N    +E  +     +
Sbjct  234   CPKQQIQPHKPMGDCSLDSCLTSCDGPQLREQDMHNSELGLRPYNDTRFLEGNEFNENLK  293

Query  744   LKQTEFRWCDDIWENRKYLSKMDEETKNNGLSVSTGLQGGKWNGNSNYSDRRFTGTDADV  565
                T         +  K + +M  E   + LS+S G+             RR T  + + 
Sbjct  294   EHATILFPTTTQQDTAKMMFRM--EGACSDLSMSVGI-------------RRDTRDELEQ  338

Query  564   KLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNGFSW  394
               F              Q  ++ YKL  F  +LDLN  D+ DV S+ + LDLNG SW
Sbjct  339   STF--------------QLDNKNYKLGSFSGELDLNARDEPDVPSTIRHLDLNGLSW  381



>ref|XP_006574747.1| PREDICTED: uncharacterized protein LOC100786282 isoform X1 [Glycine 
max]
Length=416

 Score =   388 bits (997),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 229/431 (53%), Positives = 280/431 (65%), Gaps = 36/431 (8%)
 Frame = -2

Query  1629  YHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEA  1450
             Y   +Q K+MH +  M  P ERH+ MQG NG GDSGLVLSTDAKPRLKWT DLHERF+EA
Sbjct  3     YQQQQQAKNMH-ALRMHSPTERHMMMQGGNGSGDSGLVLSTDAKPRLKWTPDLHERFIEA  61

Query  1449  VNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDA  1270
             VNQLGGADKATPK+VLK MGI GLTLYHLKSHLQKYR+SKN+HG  N+S+NK ++S M+A
Sbjct  62    VNQLGGADKATPKTVLKLMGIPGLTLYHLKSHLQKYRISKNMHGQTNTSNNK-IASTMEA  120

Query  1269  ATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLE-VQRHLQLRIE  1093
             A    +I EA+G  +   +IG   N N  I++A+Q+QIEVQRRLHEQLE VQRHLQLRIE
Sbjct  121   AA---RISEASGVQMKHLSIGLQTNKNSEINDALQMQIEVQRRLHEQLEQVQRHLQLRIE  177

Query  1092  AQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFC  913
             AQGKYLQAVLEKAQETLGRQ++G  G+EA K QLSEL S+VS Q L+S FS +KEL    
Sbjct  178   AQGKYLQAVLEKAQETLGRQNIGAEGVEATKVQLSELASRVSPQSLDSRFSELKELQVLW  237

Query  912   QQQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQT  733
              QQ Q  Q TDCS+ S LT SE S RD E  N  + LR+ N      S     E+   + 
Sbjct  238   PQQTQEGQATDCSMGSFLTYSEESQRDRETHNMNLNLRAYNGPPFSVSKGSVEESMHLKP  297

Query  732   EFRWCDDIWENRKYLSKMD----------EETKNNGLSVSTGLQGGKWNGNSN------Y  601
             +   CD++ EN  +LS              E  ++ LS++ G+Q  +  G +       +
Sbjct  298   DHTLCDEVKENLMFLSSSSDSKVVKGDFLSERPSSLLSMNEGVQEEENFGRTTVPKEEGW  357

Query  600   SDRRFTGTD-ADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSC  424
               R+ T T  A VKL               +K SQ+Y+L  F  KLDLN+ D  D +S C
Sbjct  358   KGRKSTETGRAPVKL-------------NHEKISQDYRLANFEVKLDLNSHDDNDASSHC  404

Query  423   KQLDLNGFSWN  391
             +Q DLNGFSWN
Sbjct  405   QQFDLNGFSWN  415



>ref|XP_010938143.1| PREDICTED: uncharacterized protein LOC105057276 [Elaeis guineensis]
Length=417

 Score =   388 bits (996),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 217/427 (51%), Positives = 271/427 (63%), Gaps = 23/427 (5%)
 Frame = -2

Query  1632  MYHH-HRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFV  1456
             MYHH H QG S   S+    PPERHLF+QG +  G+SGLVLSTDAKPRLKWT +LHERF+
Sbjct  1     MYHHQHHQGPSNLLSSRATFPPERHLFLQGGSVPGESGLVLSTDAKPRLKWTPELHERFI  60

Query  1455  EAVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGM  1276
             EAVNQLGG DKATPK+V++ MGI GLTLYHLKSHLQKYRLSK+L   AN+ + K +  G 
Sbjct  61    EAVNQLGGPDKATPKTVMRLMGIPGLTLYHLKSHLQKYRLSKSLQAQANTGTTKNVVGGT  120

Query  1275  DAATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRI  1096
              A    D+  E NG+ I++       N  + I EA+Q+QIEVQRRLHEQLEVQRHLQLRI
Sbjct  121   LAP---DRTAEGNGSLISNTTAASQTNKTMQIGEALQMQIEVQRRLHEQLEVQRHLQLRI  177

Query  1095  EAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGF  916
             EAQGKYLQ+VLEKAQETLG+Q+ G  GLEAAK QLSELVSKVSN+CLN+AF G++E+PG 
Sbjct  178   EAQGKYLQSVLEKAQETLGKQNFGSAGLEAAKVQLSELVSKVSNECLNTAFPGLQEIPGL  237

Query  915   CQQQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQ  736
                QA A Q  DCS+DSCLTS EGS ++ E  N  MG    N  +H        +T L+Q
Sbjct  238   HTVQAHAAQFADCSVDSCLTSCEGSQKEQERYNVCMGTYLGN--SHPCLQQFKADTGLEQ  295

Query  735   TEFRWCDDIWENRKYLSKMDEETKNNGLSVSTGLQGGKWN--------GNSNYSDRRFTG  580
                 W  D+ E + +   +  +++ N   V    +    N         NS  SD R   
Sbjct  296   AHLAWHGDLKEQKTFSLSIVRDSEANFFPVQRDSRTLSMNIKAEREKVDNSTVSDARRKE  355

Query  579   TDADVKLFAQAVDRSDTSKPE----KQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLD  412
              D       +A  + ++ +P     K K S  + LP    +LDLN  ++ D   +CK+ D
Sbjct  356   RDGK-----EAFLKPNSKRPAVLQGKGKESNGFGLPTLTTQLDLNAHEQNDDPPNCKEFD  410

Query  411   LNGFSWN  391
             LNG SW+
Sbjct  411   LNGLSWS  417



>ref|NP_197325.1| myb-related protein 1 [Arabidopsis thaliana]
 ref|NP_974798.1| myb-related protein 1 [Arabidopsis thaliana]
 dbj|BAB09482.1| transfactor-like protein [Arabidopsis thaliana]
 gb|AED92523.1| myb-related protein 1 [Arabidopsis thaliana]
 gb|AED92524.1| myb-related protein 1 [Arabidopsis thaliana]
Length=402

 Score =   387 bits (994),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 224/428 (52%), Positives = 277/428 (65%), Gaps = 43/428 (10%)
 Frame = -2

Query  1629  YHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEA  1450
             YH+  QGKS+  S+ M +  ERH F++G NG GDSGL+LSTDAKPRLKWT DLHERFVEA
Sbjct  3     YHNQHQGKSILSSSRMPISSERHPFLRG-NGTGDSGLILSTDAKPRLKWTPDLHERFVEA  61

Query  1449  VNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDA  1270
             VNQLGG DKATPK+++K MGI GLTLYHLKSHLQKYRLSKNL+G ANSS NK     M  
Sbjct  62    VNQLGGGDKATPKTIMKVMGIPGLTLYHLKSHLQKYRLSKNLNGQANSSLNKTSVMTM--  119

Query  1269  ATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEA  1090
                 +  PE + +H  S +IGP  + NLPIS+A+Q+QIEVQRRLHEQLEVQRHLQLRIEA
Sbjct  120   --VEENPPEVDESHSESLSIGPQPSMNLPISDALQMQIEVQRRLHEQLEVQRHLQLRIEA  177

Query  1089  QGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFCQ  910
             QGKYLQ++LEKAQETLGRQ+LG  G+EA KAQLSELVSKVS    +S+F   KEL     
Sbjct  178   QGKYLQSILEKAQETLGRQNLGAAGIEATKAQLSELVSKVSADYPDSSFLEPKELQNLHH  237

Query  909   QQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQTE  730
             QQ Q T P + SLDSCLTSSEG+ +  +M ++++GLR+    +  E  ++  E    + E
Sbjct  238   QQMQKTYPPNSSLDSCLTSSEGTQKAPKMLDNRLGLRTYIGDSTSEQKEIMEEPFFHRME  297

Query  729   FRWCDD--IWE--NRKYLSKM--------DEETKNNG-LSVSTGLQG--GKWNGNSNYSD  595
               W ++  + E  NR YLS M            ++ G LS+  GL    G+ + NS Y++
Sbjct  298   LTWAEEESLRENHNRPYLSTMVNNAEPRISSSRRSPGRLSIGVGLHEHRGRSSNNSEYTE  357

Query  594   RRFTGTDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQL  415
              RF   + D KL                +T+           LDLNT D+    +  KQ 
Sbjct  358   ERFNENNEDCKLETHT------------RTA-----------LDLNTHDENYGTTRPKQF  394

Query  414   DLNGFSWN  391
             DLNGFSWN
Sbjct  395   DLNGFSWN  402



>gb|AAO30084.1| transfactor-like protein [Arabidopsis thaliana]
Length=402

 Score =   386 bits (992),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 223/428 (52%), Positives = 277/428 (65%), Gaps = 43/428 (10%)
 Frame = -2

Query  1629  YHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEA  1450
             YH+  QGKS+  S+ M +  ERH F++G NG GDSGL+LSTDAKPRLKWT DLHERFVEA
Sbjct  3     YHNQHQGKSILSSSRMPISSERHPFLRG-NGTGDSGLILSTDAKPRLKWTPDLHERFVEA  61

Query  1449  VNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDA  1270
             VNQLGG DKATPK+++K MGI GLTLYHLKSHLQKYRLSKNL+G ANSS NK     M  
Sbjct  62    VNQLGGGDKATPKTIMKVMGIPGLTLYHLKSHLQKYRLSKNLNGQANSSLNKTSVMTM--  119

Query  1269  ATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEA  1090
                 +  PE + +H  S +IGP  + NLPIS+A+Q+QIEVQRRLHEQLEVQRHLQLRIEA
Sbjct  120   --VEENPPEVDESHSESLSIGPQPSMNLPISDALQMQIEVQRRLHEQLEVQRHLQLRIEA  177

Query  1089  QGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFCQ  910
             QGKYLQ++LEKAQETLGRQ+LG  G+EA KAQLSELVSKVS    +S+F   KEL     
Sbjct  178   QGKYLQSILEKAQETLGRQNLGAAGIEATKAQLSELVSKVSADYPDSSFLEPKELQNLHH  237

Query  909   QQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQTE  730
             QQ Q T P + SLDSCLTSSEG+ +  +M ++++GLR+    +  E  ++  E    + E
Sbjct  238   QQMQKTYPPNSSLDSCLTSSEGTQKAPKMLDNRLGLRTYIGDSTSEQKEIMEEPFFHRME  297

Query  729   FRWCDD--IWE--NRKYLSKM--------DEETKNNG-LSVSTGLQG--GKWNGNSNYSD  595
               W ++  + E  NR YLS M            ++ G LS+  GL    G+ + NS Y++
Sbjct  298   LTWAEEESLRENHNRPYLSTMVNNAEPRISSSRRSPGRLSIGVGLHEHRGRSSNNSEYTE  357

Query  594   RRFTGTDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQL  415
              RF   + D KL                +T+           +DLNT D+    +  KQ 
Sbjct  358   ERFNENNEDCKLETHT------------RTA-----------IDLNTHDENYGTTRPKQF  394

Query  414   DLNGFSWN  391
             DLNGFSWN
Sbjct  395   DLNGFSWN  402



>gb|AAK68818.1| transfactor-like protein [Arabidopsis thaliana]
Length=402

 Score =   386 bits (992),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 223/428 (52%), Positives = 277/428 (65%), Gaps = 43/428 (10%)
 Frame = -2

Query  1629  YHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEA  1450
             YH+  QGKS+  S+ M +  ERH F++G NG GDSGL+LSTDAKPRLKWT DLHERFVEA
Sbjct  3     YHNQHQGKSILSSSRMPISSERHPFLRG-NGTGDSGLILSTDAKPRLKWTPDLHERFVEA  61

Query  1449  VNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDA  1270
             VNQLGG DKATPK+++K MGI GLTLYHLKSHLQKYRLSKNL+G ANSS NK     M  
Sbjct  62    VNQLGGGDKATPKTIMKVMGIPGLTLYHLKSHLQKYRLSKNLNGQANSSLNKTSVMTM--  119

Query  1269  ATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEA  1090
                 +  PE + +H  S +IGP  + NLPIS+A+Q+QIEVQRRLHEQLEVQRHLQLRIEA
Sbjct  120   --VEENPPEVDESHSESLSIGPQPSMNLPISDALQMQIEVQRRLHEQLEVQRHLQLRIEA  177

Query  1089  QGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFCQ  910
             QGKYLQ++LEKAQETLGRQ+LG  G+EA KAQLSELVSKVS    +S+F   KEL     
Sbjct  178   QGKYLQSILEKAQETLGRQNLGAAGIEATKAQLSELVSKVSADYPDSSFLEPKELQNLHH  237

Query  909   QQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQTE  730
             QQ Q T P + SLDSCLTSSEG+ +  +M ++++GLR+    +  E  ++  E    + E
Sbjct  238   QQMQKTYPPNSSLDSCLTSSEGTQKAPKMLDNRLGLRTYIGDSTSEQKEIMEEPFFHRME  297

Query  729   FRWCDD--IWE--NRKYLSKM--------DEETKNNG-LSVSTGLQG--GKWNGNSNYSD  595
               W ++  + E  NR YLS M            ++ G LS+  GL    G+ + NS Y++
Sbjct  298   LTWAEEESLRENHNRPYLSTMVNNAEPRISSSRRSPGRLSIGVGLHEHRGRSSNNSEYTE  357

Query  594   RRFTGTDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQL  415
              RF   + D KL                +T+           +DLNT D+    +  KQ 
Sbjct  358   ERFNENNEDCKLETHT------------RTA-----------IDLNTHDENYGTARPKQF  394

Query  414   DLNGFSWN  391
             DLNGFSWN
Sbjct  395   DLNGFSWN  402



>ref|XP_006599429.1| PREDICTED: uncharacterized protein LOC100789797 isoform X1 [Glycine 
max]
Length=417

 Score =   386 bits (992),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 227/429 (53%), Positives = 282/429 (66%), Gaps = 31/429 (7%)
 Frame = -2

Query  1629  YHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEA  1450
             Y   +Q K+MH +  M  P ERH+ +QG NG GD GLVLSTDAKPRLKWT DLHERF+EA
Sbjct  3     YQQQQQAKNMH-ALRMHSPTERHMMLQGGNGAGDPGLVLSTDAKPRLKWTPDLHERFIEA  61

Query  1449  VNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQ-KYRLSKNLHGHANSSSNKAMSSGMD  1273
             VNQLGGADKATPK+VLK MGI GLTLYHLKSHLQ KYR+SKN+HG  N+S+NK ++S M+
Sbjct  62    VNQLGGADKATPKTVLKLMGIPGLTLYHLKSHLQQKYRISKNMHGQTNTSNNK-IASTME  120

Query  1272  AATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLE-VQRHLQLRI  1096
             AATG   I EA+G  +   +IG   N N  I++A+Q+QIEVQRRLHEQLE VQRHLQLRI
Sbjct  121   AATG---ISEASGVQMKHLSIGLQTNKNSEINDALQMQIEVQRRLHEQLEQVQRHLQLRI  177

Query  1095  EAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGF  916
             EAQGKYLQAVLEKAQETLGRQ+LG  G+EAAK QLSEL S+VS Q L+S FS +KEL   
Sbjct  178   EAQGKYLQAVLEKAQETLGRQNLGAEGVEAAKVQLSELASRVSPQSLDSKFSELKELQVL  237

Query  915   CQQQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQ  736
               QQ Q  Q TDCS+ S L  SE S RD E  +  + LR+ N      S     E+   +
Sbjct  238   WPQQTQEGQATDCSMGSFLNYSEESQRDRETHSMNLNLRACNGPPFSVSKGCAEESMHLK  297

Query  735   TEFRWCDDIWENRKYLSKMD----------EETKNNGLSVSTGLQGGKWNGNSNYSDRRF  586
              ++R CD++ EN  +LS              E  ++ LS++ G+Q           +  F
Sbjct  298   PDYRLCDEVKENMMFLSSSSNSKVVKGDFLSERPSSLLSMNVGVQ----------EEENF  347

Query  585   TGTDADVKLFAQAVDRSDTSK-PEK---QKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQ  418
               T    +   +  + ++T + P K   +K SQ+Y+L  F  KLDLN+ D  D +S C+Q
Sbjct  348   GRTTVPKEEGWKRRESTETGRVPVKLNYEKISQDYRLANFDVKLDLNSHDDNDASSHCQQ  407

Query  417   LDLNGFSWN  391
              DLNGFSWN
Sbjct  408   FDLNGFSWN  416



>ref|XP_003539165.1| PREDICTED: uncharacterized protein LOC100781878 [Glycine max]
Length=414

 Score =   386 bits (991),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 238/438 (54%), Positives = 298/438 (68%), Gaps = 48/438 (11%)
 Frame = -2

Query  1632  MY--HHHRQGKSMHPSTN---MLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLH  1468
             MY  H   QGK++H S++   M +P ERH+F+Q  NG GDSGLVLSTDAKPRLKWT DLH
Sbjct  1     MYSTHQQHQGKNIHSSSSSSRMPIPSERHMFLQTGNGSGDSGLVLSTDAKPRLKWTPDLH  60

Query  1467  ERFVEAVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNK-A  1291
              RF+EAV QLGGADKATPK+V+K MGI GLTLYHLKSHLQKYRLSK+LHG +N++++K  
Sbjct  61    ARFIEAVQQLGGADKATPKTVMKLMGIPGLTLYHLKSHLQKYRLSKSLHGQSNNATHKIT  120

Query  1290  MSSGMDAATGSDKIPEANGNHI-NSANIGPLA-NTNLPISEAIQIQIEVQRRLHEQLEVQ  1117
             ++SG   +   +++ E N  H+ N+ N+ P + N +L ISEA+Q+QIEVQRRL+EQL+VQ
Sbjct  121   INSG---SATDERLRENNETHVMNNLNLAPQSINKDLHISEALQMQIEVQRRLNEQLQVQ  177

Query  1116  RHLQLRIEAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSG  937
             R LQLRIEAQGKYLQAVLEKAQETLGRQ+LG +GLEAAK QLSELVSKVS+QCLNSAFS 
Sbjct  178   RLLQLRIEAQGKYLQAVLEKAQETLGRQNLGVVGLEAAKLQLSELVSKVSSQCLNSAFSE  237

Query  936   IKELPGFC-----QQQAQATQPT---DCSLDSCLTSSEGSLR--DHEMRNSQMGLRSLNF  787
             +KE+ GF      Q Q    QP    DCS+DSCLTS EGS +    E++N  M L   N 
Sbjct  238   LKEIQGFSPHHQKQTQTNNNQPINANDCSMDSCLTSCEGSSQKDQQEIQNRGMNLIPFNV  297

Query  786   GAHMESTDLYNETRLKQTEFRWCDDIWENRKYLSK--MDEETKNNGLSVSTGLQGGKWNG  613
                ME  +L N   L  T+ +WCD + +N  +L++  M  E   + LS+S GL  G+   
Sbjct  298   HTFMEGPNLNN---LPNTDLKWCDPVKKNNTFLTRLSMHAERSPSNLSMSIGLLEGETTE  354

Query  612   NSNYSDRRFTGTDADVKLFAQAVDRSDTSKPE-KQKTSQEYKLP--YFGP-KLDLNTDDK  445
             N +                   + R+++ KP   +K SQ+Y LP  YF   KLD  T+D 
Sbjct  355   NRS------------------TIVRTESIKPAVAEKVSQDYGLPSNYFAASKLDQTTEDN  396

Query  444   TDVASSCKQLDLNGFSWN  391
              D  +SCKQLDLNGFSWN
Sbjct  397   KDTKTSCKQLDLNGFSWN  414



>ref|XP_003596817.1| Two-component response regulator ARR18 [Medicago truncatula]
 gb|AES67068.1| myb-like transcription factor family protein [Medicago truncatula]
 gb|AFK46743.1| unknown [Medicago truncatula]
Length=389

 Score =   384 bits (985),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 229/421 (54%), Positives = 281/421 (67%), Gaps = 39/421 (9%)
 Frame = -2

Query  1632  MYHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVE  1453
             MYHHH QGK++H S+ M +P ERH+F+Q  NG  DSGLVLSTDAKPRLKWT DLH RF+E
Sbjct  1     MYHHHHQGKNIHSSSRMSIPSERHMFLQTGNGSSDSGLVLSTDAKPRLKWTPDLHARFIE  60

Query  1452  AVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMD  1273
             AVNQLGGADKATPK+V+K MGI GLTLYHLKSHLQKYRLSKNLHG   SSSN        
Sbjct  61    AVNQLGGADKATPKTVMKLMGIPGLTLYHLKSHLQKYRLSKNLHGQ--SSSNVTHKINTH  118

Query  1272  AATGSD-KIPEANGNHINSANIGPLANTN--LPISEAIQIQIEVQRRLHEQLEVQRHLQL  1102
             A + SD ++ E NG H+N   +GP  N N  L ISEA+Q+QIEVQRRL+EQLEVQRHLQL
Sbjct  119   ATSVSDERLSETNGTHMNKLTLGPQTNNNKDLHISEALQMQIEVQRRLNEQLEVQRHLQL  178

Query  1101  RIEAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELP  922
             RIEAQGKYLQ+VLEKAQETLGRQ+LG +GLEAAK QLSELVSKVS+QCLNS FS +KEL 
Sbjct  179   RIEAQGKYLQSVLEKAQETLGRQNLGIVGLEAAKVQLSELVSKVSSQCLNSTFSEMKELQ  238

Query  921   GFCQQQAQATQPTDCSLD-SCLTSSEGSLRDHE-MRNSQMGLRSLNFGAHMESTDLYNET  748
             GFC       QP D S+D SCLTSS+ S ++ E ++N   GLR      +  +  ++ E 
Sbjct  239   GFC------PQPNDGSMDSSCLTSSDRSQKEQEIIQNGGFGLRHF---NNNNNNHVFMER  289

Query  747   RLKQ-TEFRWCDDIWENRKYLSKMDEETKNNGLSVSTGLQGGKWNGNSNYSDRRFTGTDA  571
             + +Q TE         N + L    EE K N  +  T L      GN+N  +R       
Sbjct  290   KEQQATELAGSVQNLRNNEVLKWCVEEVKKNS-NFLTPL------GNNNELERNHGNLSM  342

Query  570   DVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNT-DDKTDVASSCKQLDLNGFSW  394
             ++ +     +  D  + +++ T+          +LDLN+  D  + A++CKQLDLN FSW
Sbjct  343   NIGV----ENHLDIGEFQQRNTA----------RLDLNSRGDNNEGATTCKQLDLNRFSW  388

Query  393   N  391
             N
Sbjct  389   N  389



>ref|XP_010672722.1| PREDICTED: uncharacterized protein LOC104889245 isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=383

 Score =   383 bits (983),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 225/418 (54%), Positives = 273/418 (65%), Gaps = 41/418 (10%)
 Frame = -2

Query  1632  MYHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVE  1453
             MYHHH Q  +M+PS  +  P ER LF+QG NG  DS LVLSTDAKPRLKWT DLHERFVE
Sbjct  1     MYHHHSQA-NMYPSPRISAPQERQLFLQGGNGSRDSNLVLSTDAKPRLKWTPDLHERFVE  59

Query  1452  AVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQ-KYRLSKNLHGHANSSSNKAMSSGM  1276
             AVNQLGGADKATPK+V+K MGI GLTLYHLKSHLQ KYRLSKN+HG  +S +NK +    
Sbjct  60    AVNQLGGADKATPKTVMKLMGIPGLTLYHLKSHLQQKYRLSKNIHGQTSSGANKTV----  115

Query  1275  DAATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRI  1096
                  SDK+ E + +H +S NI    N NL I+EA+Q+QIEVQRRLHEQLEVQR LQLRI
Sbjct  116   --VMSSDKMQETSPSHTSSINIAHQPNKNLHINEALQMQIEVQRRLHEQLEVQRRLQLRI  173

Query  1095  EAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGI-KELPG  919
             EAQGKYLQAVLEKAQETLG+Q++G +GLEAAK QLSELVSKVSNQCLN AF+ + +E  G
Sbjct  174   EAQGKYLQAVLEKAQETLGKQNIGVVGLEAAKLQLSELVSKVSNQCLNLAFAEMAEEQQG  233

Query  918   FC-QQQAQATQPT-DCSLDSCLTSSEGS-LRDHEMRNSQMGLRSLNFGAHMESTDLYNET  748
              C +QQ Q  +P  DCSLDSCLTS +G  LR+ +M NS++GLR  N    +E  +     
Sbjct  234   LCPKQQIQPHKPMGDCSLDSCLTSCDGPQLREQDMHNSELGLRPYNDTRFLEGNEFNENL  293

Query  747   RLKQTEFRWCDDIWENRKYLSKMDEETKNNGLSVSTGLQGGKWNGNSNYSDRRFTGTDAD  568
             +   T         +  K + +M  E   + LS+S G+             RR T  + +
Sbjct  294   KEHATILFPTTTQQDTAKMMFRM--EGACSDLSMSVGI-------------RRDTRDELE  338

Query  567   VKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNGFSW  394
                F              Q  ++ YKL  F  +LDLN  D+ DV S+ + LDLNG SW
Sbjct  339   QSTF--------------QLDNKNYKLGSFSGELDLNARDEPDVPSTIRHLDLNGLSW  382



>ref|XP_006287896.1| hypothetical protein CARUB_v10001129mg [Capsella rubella]
 gb|EOA20794.1| hypothetical protein CARUB_v10001129mg [Capsella rubella]
Length=396

 Score =   382 bits (982),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 224/430 (52%), Positives = 278/430 (65%), Gaps = 53/430 (12%)
 Frame = -2

Query  1629  YHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEA  1450
             YH+  QGKS+  S+ M +  ERH F++G NG GDSGL+LSTDAKPRLKWT DLHERFVEA
Sbjct  3     YHNQHQGKSILSSSRMPITSERHPFLRG-NGTGDSGLILSTDAKPRLKWTPDLHERFVEA  61

Query  1449  VNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDA  1270
             VNQLGG DKATPK+++K MGI GLTLYHLKSHLQKYRLSKNL+G A+SS NK     M  
Sbjct  62    VNQLGGGDKATPKTIMKVMGIPGLTLYHLKSHLQKYRLSKNLNGQASSSLNKTSVMTMV-  120

Query  1269  ATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEA  1090
                 + +PEA+  H  S +IGP  + NLPIS+A+Q+QIEVQRRLHEQLEVQRHLQLRIEA
Sbjct  121   ---EENLPEADEGHSESLSIGPQPSMNLPISDALQMQIEVQRRLHEQLEVQRHLQLRIEA  177

Query  1089  QGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFCQ  910
             QGKYLQ++LEKAQETLGRQ+LG  G+EA KAQLSELVSKVS +  +S+F           
Sbjct  178   QGKYLQSILEKAQETLGRQNLGAAGIEATKAQLSELVSKVSAEYPDSSFLE-------AH  230

Query  909   QQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQTE  730
             QQ Q T P + SLDSCLTSSEG+ +  +MR +++GLR+    +  E  ++  E   ++ E
Sbjct  231   QQMQTTYPPNSSLDSCLTSSEGTQKAPKMRENRLGLRTYIGDSTSEQKEVMEEPFFRRME  290

Query  729   FRWCDD--IWE--NRKYLSKM--DEETKNNG-------LSVSTGL---QGGKWNGNSNYS  598
               W ++  + E  NR YLS M  + E +N+        LS+  GL   + G  N NS Y+
Sbjct  291   LTWAEEESLRENNNRPYLSTMVNNTEPRNSSSRRSPGRLSMGVGLHEHREGSGN-NSEYA  349

Query  597   DRRFTGTDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNT-DDKTDVASSCK  421
             + RF+    D KL                         + G  LDLNT D+     +  K
Sbjct  350   EERFSENGEDCKLET-----------------------HTGTTLDLNTHDENYGTTTRPK  386

Query  420   QLDLNGFSWN  391
             Q DLNGFSWN
Sbjct  387   QFDLNGFSWN  396



>ref|XP_010492826.1| PREDICTED: uncharacterized protein LOC104770152 isoform X1 [Camelina 
sativa]
Length=409

 Score =   381 bits (978),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 228/439 (52%), Positives = 275/439 (63%), Gaps = 58/439 (13%)
 Frame = -2

Query  1629  YHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEA  1450
             Y H  QGKS+  S+ M +P ERH F++G NG GDSGL+LSTDAKPRLKWT DLHERFVEA
Sbjct  3     YQHQHQGKSILSSSRMPIPSERHPFLRG-NGTGDSGLILSTDAKPRLKWTPDLHERFVEA  61

Query  1449  VNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDA  1270
             VNQLGG DKATPK+++K MGI GLTLYHLKSHLQKYRLSKNL+G ANSS NK     M  
Sbjct  62    VNQLGGGDKATPKTIMKVMGIPGLTLYHLKSHLQKYRLSKNLNGQANSSLNKTSVMTMV-  120

Query  1269  ATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEA  1090
                 + +PEA  +H  S +IGP  + NLPIS+A+Q+QIEVQRRLHEQLEVQRHLQLRIEA
Sbjct  121   ---EENLPEAEESHSESLSIGPQPSMNLPISDALQMQIEVQRRLHEQLEVQRHLQLRIEA  177

Query  1089  QGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGF-C  913
             QGKYLQ++LEKAQETLGRQ+LG  G+EA KAQLSELVSKVS +   S+F   KE+     
Sbjct  178   QGKYLQSILEKAQETLGRQNLGAAGIEATKAQLSELVSKVSAEYPESSFLEPKEVQNLRH  237

Query  912   QQQAQATQPTDCSLDSCLTSSEGSLRDHEM-RNSQMGLRSLNFGAHMESTDLYNETRLKQ  736
             QQQ Q T P + SLDSCLTSSEG+ +  +M  N+++GLR+    +  E  ++  E    +
Sbjct  238   QQQMQTTYPPNSSLDSCLTSSEGTQKAPKMLENNRLGLRTYIGDSTSEQKEVMEEPFFHR  297

Query  735   TEFRWCDD--IWENR----KYLSKMDEETKNNG-------------LSVSTGLQ----GG  625
              E  W ++  I EN      Y+S M     NN              LS+  GLQ    GG
Sbjct  298   MELTWAEEESIRENNNRQPPYISTM---VNNNAEPRVSSSRRSPGRLSIGVGLQHEHRGG  354

Query  624   KWNGNSNYSDRRFTGTDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNT-DD  448
               N NS Y+  RF       K+                +T+           LDLNT D+
Sbjct  355   SSN-NSEYTQERFNENGESCKMETHT------------RTT-----------LDLNTHDE  390

Query  447   KTDVASSCKQLDLNGFSWN  391
                  +  KQ DLNGFSWN
Sbjct  391   NYGTTTRTKQFDLNGFSWN  409



>ref|XP_010558715.1| PREDICTED: uncharacterized protein LOC104827266 isoform X3 [Tarenaya 
hassleriana]
Length=391

 Score =   379 bits (973),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 216/422 (51%), Positives = 265/422 (63%), Gaps = 42/422 (10%)
 Frame = -2

Query  1629  YHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEA  1450
             YH+  Q K+   +  M MP ERH F++G N  GDSGL+LSTDAKPRLKWT DLHERFVEA
Sbjct  3     YHNQHQAKNTISTPRMPMPSERHPFLRGGNSPGDSGLILSTDAKPRLKWTPDLHERFVEA  62

Query  1449  VNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDA  1270
             VNQLGGADKATPK+++K MGI GLTLYHLKSHLQKYRLSKNL+G ANS SNK    G+  
Sbjct  63    VNQLGGADKATPKAIMKVMGIPGLTLYHLKSHLQKYRLSKNLNGQANSVSNKM---GL-M  118

Query  1269  ATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEA  1090
             A   +  P+ +  H  S +IGP  N NLPISEA+QIQIEVQRRLHEQLE      LRIEA
Sbjct  119   AMAEEMSPDTSEIHTESLSIGPQTNKNLPISEALQIQIEVQRRLHEQLE------LRIEA  172

Query  1089  QGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFCQ  910
             QGKYLQAVLEKAQETLG+Q+LG  G+EAAK QLSEL SKVS +  N+ F   KEL     
Sbjct  173   QGKYLQAVLEKAQETLGKQNLGTAGIEAAKVQLSELASKVSAEYSNANFVEPKELQSLHP  232

Query  909   QQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQTE  730
             QQ Q T P D SLDS L S EG+ R  +M  +++GLR     +  E  ++  E   ++ E
Sbjct  233   QQMQMTYPPDFSLDSSLASREGTQRSPKMLENRLGLRPYLSDSTTEQKEIAEEPLFQRME  292

Query  729   FRWCDDIWENRKYLSKM--DEETK-------NNGLSVSTGLQGGKWNGNSNYSDRRFTGT  577
               W + + EN+ Y+S M  D ET+          LS+  GL G + +GN++Y++ R    
Sbjct  293   LTWREGLRENKTYISPMADDRETRLSSSERCPGNLSIGVGLHGHRGHGNADYAEERI---  349

Query  576   DADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNGFS  397
               D +   + +D +                     +LDLNT D     +  KQ DLNGFS
Sbjct  350   KKDEERIQKGLDSTT--------------------ELDLNTHDGNYGTARPKQFDLNGFS  389

Query  396   WN  391
             WN
Sbjct  390   WN  391



>ref|NP_974799.1| myb-related protein 1 [Arabidopsis thaliana]
 gb|AED92527.1| myb-related protein 1 [Arabidopsis thaliana]
Length=400

 Score =   378 bits (971),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 222/428 (52%), Positives = 275/428 (64%), Gaps = 45/428 (11%)
 Frame = -2

Query  1629  YHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEA  1450
             YH+  QGKS+  S+ M +  ERH F++G NG GDSGL+LSTDAKPRLKWT DLHERFVEA
Sbjct  3     YHNQHQGKSILSSSRMPISSERHPFLRG-NGTGDSGLILSTDAKPRLKWTPDLHERFVEA  61

Query  1449  VNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDA  1270
             VNQLGG DKATPK+++K MGI GLTLYHLKSHLQKYRLSKNL+G ANSS NK     M  
Sbjct  62    VNQLGGGDKATPKTIMKVMGIPGLTLYHLKSHLQKYRLSKNLNGQANSSLNKTSVMTM--  119

Query  1269  ATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEA  1090
                 +  PE + +H  S +IGP  + NLPIS+A+Q+QIEVQRRLHEQLE  RHLQLRIEA
Sbjct  120   --VEENPPEVDESHSESLSIGPQPSMNLPISDALQMQIEVQRRLHEQLE--RHLQLRIEA  175

Query  1089  QGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFCQ  910
             QGKYLQ++LEKAQETLGRQ+LG  G+EA KAQLSELVSKVS    +S+F   KEL     
Sbjct  176   QGKYLQSILEKAQETLGRQNLGAAGIEATKAQLSELVSKVSADYPDSSFLEPKELQNLHH  235

Query  909   QQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQTE  730
             QQ Q T P + SLDSCLTSSEG+ +  +M ++++GLR+    +  E  ++  E    + E
Sbjct  236   QQMQKTYPPNSSLDSCLTSSEGTQKAPKMLDNRLGLRTYIGDSTSEQKEIMEEPFFHRME  295

Query  729   FRWCDD--IWE--NRKYLSKM--------DEETKNNG-LSVSTGLQG--GKWNGNSNYSD  595
               W ++  + E  NR YLS M            ++ G LS+  GL    G+ + NS Y++
Sbjct  296   LTWAEEESLRENHNRPYLSTMVNNAEPRISSSRRSPGRLSIGVGLHEHRGRSSNNSEYTE  355

Query  594   RRFTGTDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQL  415
              RF   + D KL                +T+           LDLNT D+    +  KQ 
Sbjct  356   ERFNENNEDCKLETHT------------RTA-----------LDLNTHDENYGTTRPKQF  392

Query  414   DLNGFSWN  391
             DLNGFSWN
Sbjct  393   DLNGFSWN  400



>ref|XP_010921323.1| PREDICTED: uncharacterized protein LOC105044924 [Elaeis guineensis]
Length=418

 Score =   379 bits (972),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 205/423 (48%), Positives = 274/423 (65%), Gaps = 14/423 (3%)
 Frame = -2

Query  1632  MYHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVE  1453
             MYHHH QG S   ++    PPERHLF+QG +  G+SGLVLSTDAKPRLKWT +LHERF+E
Sbjct  1     MYHHHHQGHSNLLASRTTFPPERHLFLQGGSVPGESGLVLSTDAKPRLKWTPELHERFIE  60

Query  1452  AVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMD  1273
             AVNQLGGADKATPKS+++ MGI GLTLYHLKSHLQKYRLSK L   AN+ + K +   + 
Sbjct  61    AVNQLGGADKATPKSIMRLMGIPGLTLYHLKSHLQKYRLSKTLQAQANAGTTKNV---IG  117

Query  1272  AATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIE  1093
                G+++  E NG+ I++       N  + I+EA+Q+QIEVQRRLHEQLEVQRHLQLRIE
Sbjct  118   CTLGANRTAEGNGSLISNTTAASQTNKTMLINEALQMQIEVQRRLHEQLEVQRHLQLRIE  177

Query  1092  AQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFC  913
             AQGKYLQ+VLEKAQETLG+Q+LG  GLEAAK QLSELVSKVS++CLN+AF  ++E+ G  
Sbjct  178   AQGKYLQSVLEKAQETLGKQNLGSAGLEAAKVQLSELVSKVSHECLNTAFPSLEEISGLH  237

Query  912   QQQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQT  733
               QA   Q TDCS+DSCLTS EGS ++ E      GL +    + +       +T L++ 
Sbjct  238   TLQAHGAQFTDCSVDSCLTSCEGSQKEQETNYVGRGLSTYPGNSPICLQQFRADTELERA  297

Query  732   EFRWCDDIWENRKYLSKMDEETKNNG---------LSVSTGLQGGKWNGNSNYSDRRFTG  580
             +     D  E + + S + ++++            LS++   Q  K + ++ +  ++   
Sbjct  298   QPARHADFNEQKTFSSFIVQDSEGTALPARRDSRTLSINKKAQREKGDSSTVFEAQQRER  357

Query  579   TDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNGF  400
                D   F +A  +      E++K S  + LP    +LDLN  ++ +   + KQ DLNGF
Sbjct  358   NSEDA--FLEASRKRPAVLQEREKESNGFGLPSMTTQLDLNAHEENEGPPNSKQFDLNGF  415

Query  399   SWN  391
             SW+
Sbjct  416   SWS  418



>ref|XP_010104961.1| Myb family transcription factor APL [Morus notabilis]
 gb|EXC02650.1| Myb family transcription factor APL [Morus notabilis]
Length=444

 Score =   379 bits (974),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 236/442 (53%), Positives = 284/442 (64%), Gaps = 57/442 (13%)
 Frame = -2

Query  1578  MPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEAVNQLGGADKATPKSVLK  1399
             +PPERHLF+QG NG  DSGLVLSTDAKPRLKWT DLHE FVEAVNQLGGADKATPK+V+K
Sbjct  12    IPPERHLFLQGGNGPRDSGLVLSTDAKPRLKWTPDLHEHFVEAVNQLGGADKATPKTVMK  71

Query  1398  QMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDAATGSDKIPEANGNHINS  1219
              MGI GLTLYHLKSHLQKYRLSKNLHG ANS + K  + G  AA   D+I EA+ N +N+
Sbjct  72    LMGIPGLTLYHLKSHLQKYRLSKNLHGQANSGTTKIGTVGGVAA---DRISEASANQLNN  128

Query  1218  ANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVLEKAQETLG  1039
              +IGP AN    ISE +Q+QIEVQRRLHEQLEVQRHLQLR+EAQGKYLQAVLEKAQETLG
Sbjct  129   LSIGPQANKGFHISETLQMQIEVQRRLHEQLEVQRHLQLRMEAQGKYLQAVLEKAQETLG  188

Query  1038  RQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELP-GFCQQ-----QAQAT-----  892
             RQ+LG +GLEAAK QLSELVSKVS QCLNSAF+ +KE+  G C+Q     Q Q T     
Sbjct  189   RQNLGAVGLEAAKVQLSELVSKVSTQCLNSAFAELKEVQGGLCRQPNSSNQTQGTVLIRQ  248

Query  891   -QP-TDCSLDSCLTSSEGSLRDHEM-RNSQMG---LRSLNFGAHMESTDLYNETRLKQTE  730
              QP  DCS+DSCLTS EGS +D E+  N+  G   LR  N  A   +++ +        E
Sbjct  249   QQPNNDCSMDSCLTSCEGSQKDQEIAHNTSSGIVQLRPYNNAATTSTSNAF-------LE  301

Query  729   FRWCDDIWENRKYLSKMD----EETKNNGLSVSTGLQGGKWNG--NSNYSD-RRFTGTDA  571
              +WC+D  ++  +LS+      E + N G        GG   G   S YS   RF GT +
Sbjct  302   PKWCNDAKDSVMFLSETRMFPVERSSNTGGLSIGIGLGGGEKGGDTSTYSQGVRFRGTGS  361

Query  570   DVKLFAQAVDRSDTSKP-------EKQKTSQEYKLP-YFGPK--LDLNT-----------  454
                +    VDR+ T+         +K    Q  ++  YF     LDLN+           
Sbjct  362   SWDVDEDFVDRNTTTASARSAGFHDKASDHQACRVANYFATNKVLDLNSHDHDHHDHDHE  421

Query  453   -DDKTDVASSC-KQLDLNGFSW  394
               ++   +S+C KQ+DLNGF W
Sbjct  422   NQNENHSSSTCYKQIDLNGFGW  443



>ref|XP_008793331.1| PREDICTED: uncharacterized protein LOC103709655 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008793332.1| PREDICTED: uncharacterized protein LOC103709655 isoform X1 [Phoenix 
dactylifera]
Length=417

 Score =   378 bits (970),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 208/424 (49%), Positives = 276/424 (65%), Gaps = 17/424 (4%)
 Frame = -2

Query  1632  MYHH-HRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFV  1456
             MYHH H QG S   ++ +  PPERHLF+QG +  G+SGLVLSTDAKPRLKWT +LHERF+
Sbjct  1     MYHHQHHQGPSNLLASRVSFPPERHLFLQGGSVPGESGLVLSTDAKPRLKWTPELHERFI  60

Query  1455  EAVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGM  1276
             EAVNQLGG DKATPK+V++ MGI GLTLYHLKSHLQKYRLSK+L    N+ + K +   +
Sbjct  61    EAVNQLGGPDKATPKTVMRLMGIPGLTLYHLKSHLQKYRLSKSLQAQPNTGTTKNV---I  117

Query  1275  DAATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRI  1096
                  +D+  E NG+ +++  +    N  + ISEA+Q+QIEVQRRLHEQLEVQRHLQLRI
Sbjct  118   GCPLAADRTAEGNGSLMSNTTVASQTNKTMQISEALQMQIEVQRRLHEQLEVQRHLQLRI  177

Query  1095  EAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGF  916
             EAQGKYLQ+VLEKAQETLG+Q+LG  GLEAAK QLSELVSKVSN+CLN+ F G++E+ GF
Sbjct  178   EAQGKYLQSVLEKAQETLGKQNLGSAGLEAAKVQLSELVSKVSNECLNTTFPGLEEISGF  237

Query  915   CQQQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQ  736
                QA A Q  DCS++S LTS EGS ++ E  N  MG    N  +H        +T L+Q
Sbjct  238   HTLQAHAAQFADCSVNSYLTSCEGSQKEQEKYNVSMGTYLGN--SHPCLQQFRADTGLEQ  295

Query  735   TEFRWCDDIWENRKYLSKMDEETK---------NNGLSVSTGLQGGKWNGNSNYSDRRFT  583
              +  W  D+ E + +   + ++++         +  L+++   +  K +G++    RR  
Sbjct  296   AQLAWHGDLNEQKTFSPSILQDSEVTFFPVQRDSRTLTMNIKAEREKVDGSTVSDARRKE  355

Query  582   GTDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNG  403
                 D   F +   +   +  E+ K S  + L     +LDLN  ++ D   +CKQ DLNG
Sbjct  356   KDSKDA--FLERNSKRPAALQERGKESNGFGLQSVTTQLDLNAHEENDGPPNCKQFDLNG  413

Query  402   FSWN  391
             FSW+
Sbjct  414   FSWS  417



>ref|XP_010454048.1| PREDICTED: uncharacterized protein LOC104735880 isoform X1 [Camelina 
sativa]
 ref|XP_010454049.1| PREDICTED: uncharacterized protein LOC104735880 isoform X1 [Camelina 
sativa]
Length=408

 Score =   377 bits (969),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 227/436 (52%), Positives = 282/436 (65%), Gaps = 53/436 (12%)
 Frame = -2

Query  1629  YHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEA  1450
             YH+  QGKS+  S+ M +P ERH F++G NG GDSGL+LSTDAKPRLKWT DLHERFVEA
Sbjct  3     YHNQHQGKSILSSSRMPIPSERHPFLRG-NGTGDSGLILSTDAKPRLKWTPDLHERFVEA  61

Query  1449  VNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDA  1270
             VNQLGG DKATPK+++K MGI GLTLYHLKSHLQKYRLSKNL+G ANSS NK     M  
Sbjct  62    VNQLGGGDKATPKTIMKVMGIPGLTLYHLKSHLQKYRLSKNLNGQANSSLNKTSVMTMV-  120

Query  1269  ATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEA  1090
                 + +PEA  +H  S +IGP  + NLPIS+A+Q+QIEVQRRLHEQLEVQRHLQLRIEA
Sbjct  121   ---EENLPEAEESHSESLSIGPQPSMNLPISDALQMQIEVQRRLHEQLEVQRHLQLRIEA  177

Query  1089  QGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGF-C  913
             QGKYLQ++LEKAQETLGRQ+LG  G+EA KAQLSELVSKVS +  +S+F   KE+     
Sbjct  178   QGKYLQSILEKAQETLGRQNLGAAGIEATKAQLSELVSKVSAEYPDSSFLEPKEVQKLRH  237

Query  912   QQQAQATQ-PTDCSLDSCLTSSEGSLRDHEM-RNSQMGLRSLNFGAHMESTDLYNETRLK  739
             QQQ Q T  P + SLDSCLTSSEG+ +  +M  N+++GLR+    +  E  ++  E    
Sbjct  238   QQQMQTTNYPPNSSLDSCLTSSEGTQKAPKMLENNRLGLRTYIGDSTSEQKEVMEEPFFH  297

Query  738   QTEFRWCDD--IWEN----RKYLSKM---DEETKNNG-------LSVSTGLQ----GGKW  619
             + E  W ++  I EN    + Y+S M   + E + +        LS+  GLQ    GG  
Sbjct  298   RMELTWAEEESIRENNNRPQPYISTMVNSNAEARISSSRRSPGRLSIGVGLQHEHRGGSS  357

Query  618   NGNSNYSDRRFTGTDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTD  439
             N NS Y+  RF       K+                +T+           LDLNT D+ +
Sbjct  358   N-NSEYTQERFNENGEGCKMETHT------------RTT-----------LDLNTHDE-N  392

Query  438   VASSCKQLDLNGFSWN  391
               ++ KQ DLNGFSWN
Sbjct  393   YGTTTKQFDLNGFSWN  408



>ref|XP_007151824.1| hypothetical protein PHAVU_004G078200g [Phaseolus vulgaris]
 gb|ESW23818.1| hypothetical protein PHAVU_004G078200g [Phaseolus vulgaris]
Length=411

 Score =   377 bits (969),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 215/427 (50%), Positives = 272/427 (64%), Gaps = 33/427 (8%)
 Frame = -2

Query  1629  YHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEA  1450
             Y   +Q ++MH +  M  P ERH+ MQG NG GDSGLVLSTDAKPRLKWT DLHERF+EA
Sbjct  3     YQQQQQPRNMH-ALRMNSPTERHMIMQGGNGTGDSGLVLSTDAKPRLKWTPDLHERFIEA  61

Query  1449  VNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDA  1270
             VNQLGGADKATPK+VLK MGI GLTLYHLKSHLQKYR+SKN+HG  N+ +NK  ++G   
Sbjct  62    VNQLGGADKATPKTVLKLMGIPGLTLYHLKSHLQKYRISKNMHGQTNTGNNKIEATG---  118

Query  1269  ATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEA  1090
                  ++ EA+G  +   +IG   N N  I++A+Q+QIEVQRRLHEQLEVQRHLQLRIEA
Sbjct  119   -----RMSEASGIQMKHLSIGLQTNKNSEINDALQMQIEVQRRLHEQLEVQRHLQLRIEA  173

Query  1089  QGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFCQ  910
             QGKYLQAVLEKAQETLGRQ+LG  G+EAAK QLSEL S+VS+Q L++ FS +KEL G   
Sbjct  174   QGKYLQAVLEKAQETLGRQNLGAEGVEAAKVQLSELASRVSSQSLDTKFSELKELQGLWP  233

Query  909   QQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQTE  730
              Q Q  Q TDCS+ S LT SE S R+ E  N  + L + N      S     E+   +  
Sbjct  234   HQTQEGQATDCSMGSFLTYSEESQRNRETHNMSLNLIAYNGPPFSVSKGCVEESVHLKPG  293

Query  729   FRWCDDIWENRKYLSKMD----------EETKNNGLSVSTGLQGGKWNGNSNYSDRRFTG  580
                 +++ EN  +LS             +E  ++ LS++ G+            + +F  
Sbjct  294   LTLSEEVKENMMFLSSTSDSKVVKGDFLQERPSSLLSMNVGV----------LEEEKFGR  343

Query  579   TDADVKLFAQAVDRSDTS----KPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLD  412
             T    +   +  D ++T     K   +K S +Y+L  F  KLDLN+ D  D +S C+Q D
Sbjct  344   TTLSKEEGWKVRDSTETERMAVKLNHEKISTDYRLANFEVKLDLNSHDANDASSHCQQFD  403

Query  411   LNGFSWN  391
             LNGFSWN
Sbjct  404   LNGFSWN  410



>ref|XP_009120994.1| PREDICTED: myb family transcription factor APL isoform X1 [Brassica 
rapa]
 ref|XP_009120995.1| PREDICTED: myb family transcription factor APL isoform X1 [Brassica 
rapa]
 emb|CDY38499.1| BnaA10g16590D [Brassica napus]
Length=392

 Score =   377 bits (967),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 218/424 (51%), Positives = 277/424 (65%), Gaps = 45/424 (11%)
 Frame = -2

Query  1629  YHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEA  1450
             YH+  QGKS+  S+ M +P ERH F++G NG GDSGL+LSTDAKPRLKWT DLHERFVEA
Sbjct  3     YHNQHQGKSLLSSSRMPIPSERHPFLRG-NGPGDSGLILSTDAKPRLKWTPDLHERFVEA  61

Query  1449  VNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDA  1270
             VNQLGG +KATPK+++K MGI GLTLYHLKSHLQKYRLSKNL+G ANSS NK     M  
Sbjct  62    VNQLGGGEKATPKTIMKVMGIPGLTLYHLKSHLQKYRLSKNLNGQANSSLNKTSVMTMV-  120

Query  1269  ATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEA  1090
                 +  PEA+ +H  S +IGP  + NLPIS+A+Q+QIEVQRRLHEQLEVQRHLQLRIEA
Sbjct  121   ---EENTPEADESHSESLSIGPQPSMNLPISDALQMQIEVQRRLHEQLEVQRHLQLRIEA  177

Query  1089  QGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFCQ  910
             QGKYLQA+LEKAQETLGRQ+LG  G+EA KAQLSELVSKVS++  +++F  ++ L    Q
Sbjct  178   QGKYLQAILEKAQETLGRQNLGPAGIEATKAQLSELVSKVSSEYPDASFLELQNL--HHQ  235

Query  909   QQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQTE  730
             Q   A  P + SL+SCLTSSEG+ +  +M  +++GLR+    +  E  ++  E    + E
Sbjct  236   QMQTAYPPQNSSLESCLTSSEGNQKAPKMLENRLGLRTYLGDSSSEQKEIMEEPFFHRME  295

Query  729   FRWCDD-----IWE-NRKYLSKMDEETKNN-----GLSVSTGLQGGKWNGNSNYSDRRFT  583
               W ++     I E NR YLS M+    ++      LS+  GLQ  +      Y++ R+ 
Sbjct  296   LTWAEEEEEEGIRENNRPYLSAMEPRNSSSRRSPGRLSIGVGLQEHR----GGYTEERYR  351

Query  582   GTDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNG  403
                 D K+      R+ T+                   LDLNT D+T   +  KQ DLNG
Sbjct  352   ENGEDCKVET----RTSTA-------------------LDLNTHDETYGTTRPKQFDLNG  388

Query  402   FSWN  391
             FSW+
Sbjct  389   FSWS  392



>ref|XP_010420567.1| PREDICTED: uncharacterized protein LOC104706130 isoform X1 [Camelina 
sativa]
 ref|XP_010420568.1| PREDICTED: uncharacterized protein LOC104706130 isoform X1 [Camelina 
sativa]
Length=408

 Score =   377 bits (967),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 227/439 (52%), Positives = 276/439 (63%), Gaps = 59/439 (13%)
 Frame = -2

Query  1629  YHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEA  1450
             YH+  QGKS+  S+ M +P ERH F++G NG GDSGL+LSTDAKPRLKWT DLHERFVEA
Sbjct  3     YHNQHQGKSILSSSRMPIPSERHPFLRG-NGTGDSGLILSTDAKPRLKWTPDLHERFVEA  61

Query  1449  VNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDA  1270
             VNQLGG DKATPK+++K MGI GLTLYHLKSHLQKYRLSKN +G ANS  NK     M  
Sbjct  62    VNQLGGGDKATPKTIMKVMGIPGLTLYHLKSHLQKYRLSKNPNGQANSGLNKTSVMTMV-  120

Query  1269  ATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEA  1090
                 + +PEA  +H  S +IGP  + NLPIS+A+Q+QIEVQRRLHEQLEVQRHLQLRIEA
Sbjct  121   ---EENLPEAEESHSESLSIGPQPSMNLPISDALQMQIEVQRRLHEQLEVQRHLQLRIEA  177

Query  1089  QGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGF-C  913
             QGKYLQ++LEKAQETLGRQ+LG  G+EA KAQLSELVSKVS +  +S+F   KE+     
Sbjct  178   QGKYLQSILEKAQETLGRQNLGAAGIEATKAQLSELVSKVSAEYPDSSFLEPKEVQKLRH  237

Query  912   QQQAQATQPTDCSLDSCLTSSEGSLRDHEM-RNSQMGLRSLNFGAHMESTDLYNETRLKQ  736
             QQQ Q T P + SLDSCLTSSEG+ +  +M  N+++GLR+    +  E  ++  E    +
Sbjct  238   QQQMQTTYPPNSSLDSCLTSSEGTQKAPKMLENNRLGLRTYIGDSTSEQKEVMEEPFFHR  297

Query  735   TEFRWCDD--IWENR----KYLSKMDEETKNNG-------------LSVSTGLQ----GG  625
              E  W ++  I EN      Y+S M     NNG             LS+  GLQ    GG
Sbjct  298   MELTWAEEESIRENNNRPPPYISTM----VNNGEARVLSSRRSPGRLSIGVGLQHEHRGG  353

Query  624   KWNGNSNYSDRRFTGTDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNT-DD  448
               N NS Y+  RF       K+                +T+           LDLNT D+
Sbjct  354   SSN-NSEYTQERFNENGEGCKMETHT------------RTT-----------LDLNTHDE  389

Query  447   KTDVASSCKQLDLNGFSWN  391
                  +  KQ DLNGFSWN
Sbjct  390   NYGTTTRTKQFDLNGFSWN  408



>ref|XP_010485773.1| PREDICTED: uncharacterized protein LOC104764039 [Camelina sativa]
Length=408

 Score =   377 bits (967),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 224/430 (52%), Positives = 277/430 (64%), Gaps = 41/430 (10%)
 Frame = -2

Query  1629  YHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEA  1450
             Y +  QGK++  S+ M +  ER+ F++G N  G+SGL+LSTDAKPRLKWT DLHERF+EA
Sbjct  3     YQNQHQGKNILSSSRMHITTERNPFLRG-NSPGESGLILSTDAKPRLKWTPDLHERFIEA  61

Query  1449  VNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNK-AMSSGMD  1273
             VNQLGGADKATPK+++K MGI GLTLYHLKSHLQKYRLSKNL+G ANS  NK  M + M+
Sbjct  62    VNQLGGADKATPKTIMKVMGIPGLTLYHLKSHLQKYRLSKNLNGQANSGLNKIGMMTMME  121

Query  1272  AATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIE  1093
                  +K P+ +     + +IGP  N N PISEA+Q+QIEVQRRLHEQLEVQRHLQLRIE
Sbjct  122   -----EKTPDVDEIQSENLSIGPQPNMNSPISEALQMQIEVQRRLHEQLEVQRHLQLRIE  176

Query  1092  AQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFC  913
             AQGKYLQ+VLEKAQETLGRQ+LG  G+EAAK QLSELVSKVS +  NS+F   KEL   C
Sbjct  177   AQGKYLQSVLEKAQETLGRQNLGAAGIEAAKVQLSELVSKVSAEYPNSSFLEPKELQNLC  236

Query  912   QQQAQATQ-PTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQ  736
              QQ Q T  P DCSL+SCLTSSEG+ +   + N+++GLR+    +  E  +   E   ++
Sbjct  237   PQQIQTTTYPPDCSLESCLTSSEGTQKT--LENNRIGLRTYLGDSTSEQKENIEEPLFQR  294

Query  735   TEFRWCDDIWENRKYLSKMDEETKNN---------GLSVSTG-LQGGKWN----GNSNYS  598
              E  W + +  N  YLS M  ET+            LS+  G LQG K +    GN+ Y+
Sbjct  295   MELTWTEGLRGNNPYLSTMVSETEQRIPYSERSPGRLSIGVGLLQGHKGHHHQQGNNEYT  354

Query  597   DRRFTGTDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTD-DKTDVASSCK  421
             D RF                 D S+  K +T    K      +LDLNT  +     +  K
Sbjct  355   DERF----------------KDKSEDHKFETRNHRKGMDSATELDLNTHVESYSTTTRTK  398

Query  420   QLDLNGFSWN  391
             Q DLNGFSWN
Sbjct  399   QFDLNGFSWN  408



>ref|XP_010463875.1| PREDICTED: uncharacterized protein LOC104744509 isoform X1 [Camelina 
sativa]
Length=409

 Score =   376 bits (965),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 222/431 (52%), Positives = 276/431 (64%), Gaps = 42/431 (10%)
 Frame = -2

Query  1629  YHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEA  1450
             Y +  QGK++  S+ M +  ER+ F++G N  G+SGL+LSTDAKPRLKWT DLHERF+EA
Sbjct  3     YQNQHQGKNILSSSRMHITTERNPFLRG-NSPGESGLILSTDAKPRLKWTPDLHERFIEA  61

Query  1449  VNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNK-AMSSGMD  1273
             VNQLGGADKATPK+++K MGI GLTLYHLKSHLQKYRLSKNL+G ANS  NK  M + M+
Sbjct  62    VNQLGGADKATPKTIMKVMGIPGLTLYHLKSHLQKYRLSKNLNGQANSGLNKIGMMTMME  121

Query  1272  AATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIE  1093
                  +K P+ +     + +IGP  N N PISEA+Q+QIEVQRRLHEQLEVQRHLQLRIE
Sbjct  122   -----EKTPDVDEIQSENLSIGPQPNMNSPISEALQMQIEVQRRLHEQLEVQRHLQLRIE  176

Query  1092  AQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFC  913
             AQGKYLQ+VLEKAQETLGRQ+LG  G+EAAK QLSELVSKVS +  NS+F   KEL   C
Sbjct  177   AQGKYLQSVLEKAQETLGRQNLGAAGIEAAKVQLSELVSKVSAEYPNSSFLEPKELQNLC  236

Query  912   QQQAQATQ-PTDCSLDSCLTSSEGSLRDHEMRNSQMGLRS-LNFGAHMESTDLYNETRLK  739
              QQ Q T  P DCSL+SCLTSSEG+ +   + N+++GLR+ L      +  ++  E   +
Sbjct  237   PQQIQTTTYPPDCSLESCLTSSEGTQKT--LENNRIGLRTYLGDSTSEQKENMEEEPLFQ  294

Query  738   QTEFRWCDDI-WENRKYLSKMDEETKNN---------GLSVSTGLQGGKWN----GNSNY  601
             + E  W + +   N  YLS M  ET+            LS+  GLQG K +    GN+ Y
Sbjct  295   RMELTWTEGLRGNNNPYLSTMVSETEQRIPYSERSPGRLSIGVGLQGHKGHHHQQGNNEY  354

Query  600   SDRRFTGTDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTD-DKTDVASSC  424
             ++ RF     D K   +   +   S  E                LDLNT  +     +  
Sbjct  355   TEERFKDKSEDHKFETRNHRKGTDSATE----------------LDLNTHVESYSTTTRT  398

Query  423   KQLDLNGFSWN  391
             KQ DLNGFSWN
Sbjct  399   KQFDLNGFSWN  409



>ref|XP_002873879.1| hypothetical protein ARALYDRAFT_488696 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50138.1| hypothetical protein ARALYDRAFT_488696 [Arabidopsis lyrata subsp. 
lyrata]
Length=385

 Score =   375 bits (962),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 218/409 (53%), Positives = 264/409 (65%), Gaps = 45/409 (11%)
 Frame = -2

Query  1569  ERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEAVNQLGGADKATPKSVLKQMG  1390
             ERH F++G NG GDSGL+LSTDAKPRLKWT DLHERFVEAVNQLGG DKATPK+++K MG
Sbjct  6     ERHPFLRG-NGTGDSGLILSTDAKPRLKWTPDLHERFVEAVNQLGGGDKATPKTIMKVMG  64

Query  1389  IQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDAATGSDKIPEANGNHINSANI  1210
             I GLTLYHLKSHLQKYRLSKNL+G ANSS NK     M      +  PE + +H  S +I
Sbjct  65    IPGLTLYHLKSHLQKYRLSKNLNGQANSSLNKTSVMTM----VEENPPEVDESHSESLSI  120

Query  1209  GPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVLEKAQETLGRQD  1030
             GP    NLPIS+A+Q+QIEVQRRLHEQLEVQRHLQLRIEAQGKYLQ++LEKAQETLGRQ+
Sbjct  121   GPQPTMNLPISDALQMQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQSILEKAQETLGRQN  180

Query  1029  LGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFCQQQAQATQPTDCSLDSCLTSS  850
             LG  G+EA KAQLSELVSKVS +  +S+F   KEL     QQ Q T P + SLDSCLTSS
Sbjct  181   LGAAGIEATKAQLSELVSKVSAEYPDSSFLEPKELQNLRHQQMQTTYPPNSSLDSCLTSS  240

Query  849   EGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQTEFRWCDD--IWE--NRKYLSK  682
             EG+ +  +M ++++GLR+    +  E  ++  E    + E  W ++  + E  NR YLS 
Sbjct  241   EGNQKARKMLDNRLGLRTYIGDSTSEQKEIMEEPFFHRMELTWAEEESLRENNNRPYLST  300

Query  681   MDEETKNN---------GLSVSTGL---QGGKWNGNSNYSDRRFTGTDADVKLFAQAVDR  538
             M   T+            LS+  GL   +GG  N NS Y++ RF     D KL       
Sbjct  301   MVNNTEPRISSSRRSPGRLSIGVGLHEHRGGSSN-NSEYTEERFNENGEDCKLETHT---  356

Query  537   SDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNGFSWN  391
                      +T+           LDLNT D+    +  KQ DLNGFSWN
Sbjct  357   ---------RTA-----------LDLNTRDENYGTTRPKQFDLNGFSWN  385



>ref|NP_001118567.1| myb family transcription factor [Arabidopsis thaliana]
 gb|AAF05867.1|AC011698_18 transfactor-like [Arabidopsis thaliana]
 gb|AEE74029.1| myb family transcription factor [Arabidopsis thaliana]
Length=394

 Score =   375 bits (962),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 217/424 (51%), Positives = 272/424 (64%), Gaps = 43/424 (10%)
 Frame = -2

Query  1629  YHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEA  1450
             Y +  QGK++  S+ M +  ERH F++G N  GDSGL+LSTDAKPRLKWT DLHERF+EA
Sbjct  3     YQNQHQGKNILSSSRMHITSERHPFLRG-NSPGDSGLILSTDAKPRLKWTPDLHERFIEA  61

Query  1449  VNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNK-AMSSGMD  1273
             VNQLGGADKATPK+++K MGI GLTLYHLKSHLQKYRLSKNL+G AN+S NK  + + M+
Sbjct  62    VNQLGGADKATPKTIMKVMGIPGLTLYHLKSHLQKYRLSKNLNGQANNSFNKIGIMTMME  121

Query  1272  AATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIE  1093
                  +K P+A+     + +IGP  N N PI EA+Q+QIEVQRRLHEQLEVQRHLQLRIE
Sbjct  122   -----EKTPDADEIQSENLSIGPQPNKNSPIGEALQMQIEVQRRLHEQLEVQRHLQLRIE  176

Query  1092  AQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFC  913
             AQGKYLQ+VLEKAQETLGRQ+LG  G+EAAK QLSELVSKVS +  NS+F   KEL   C
Sbjct  177   AQGKYLQSVLEKAQETLGRQNLGAAGIEAAKVQLSELVSKVSAEYPNSSFLEPKELQNLC  236

Query  912   QQQAQATQPTDCSLDSCLTSSEGSLRDHEM-RNSQMGLRSLNFGAHMESTDLYNETRLKQ  736
              QQ Q   P DCSL+SCLTSSEG+ ++ +M  N+++GLR+    +  E  ++  E   ++
Sbjct  237   SQQMQTNYPPDCSLESCLTSSEGTQKNSKMLENNRLGLRTYIGDSTSEQKEIMEEPLFQR  296

Query  735   TEFRWCDDIWENRKYLSKMDEETKNN---------GLSVSTGLQGGKWNGNSNYSDRRFT  583
              E  W + +  N  YLS M  E +            LS+  GL G K         +   
Sbjct  297   MELTWTEGLRGN-PYLSTMVSEAEQRISYSERSPGRLSIGVGLHGHK--------SQHQQ  347

Query  582   GTDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNG  403
             G + D KL  +     D++                  +LDLNT  +    +  KQ DLNG
Sbjct  348   GNNEDHKLETRNRKGMDSTT-----------------ELDLNTHVENYCTTRTKQFDLNG  390

Query  402   FSWN  391
             FSWN
Sbjct  391   FSWN  394



>ref|XP_010492827.1| PREDICTED: uncharacterized protein LOC104770152 isoform X2 [Camelina 
sativa]
Length=407

 Score =   372 bits (956),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 226/439 (51%), Positives = 273/439 (62%), Gaps = 60/439 (14%)
 Frame = -2

Query  1629  YHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEA  1450
             Y H  QGKS+  S+ M +P ERH F++G NG GDSGL+LSTDAKPRLKWT DLHERFVEA
Sbjct  3     YQHQHQGKSILSSSRMPIPSERHPFLRG-NGTGDSGLILSTDAKPRLKWTPDLHERFVEA  61

Query  1449  VNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDA  1270
             VNQLGG DKATPK+++K MGI GLTLYHLKSHLQKYRLSKNL+G ANSS NK     M  
Sbjct  62    VNQLGGGDKATPKTIMKVMGIPGLTLYHLKSHLQKYRLSKNLNGQANSSLNKTSVMTMV-  120

Query  1269  ATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEA  1090
                 + +PEA  +H  S +IGP  + NLPIS+A+Q+QIEVQRRLHEQLE  RHLQLRIEA
Sbjct  121   ---EENLPEAEESHSESLSIGPQPSMNLPISDALQMQIEVQRRLHEQLE--RHLQLRIEA  175

Query  1089  QGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGF-C  913
             QGKYLQ++LEKAQETLGRQ+LG  G+EA KAQLSELVSKVS +   S+F   KE+     
Sbjct  176   QGKYLQSILEKAQETLGRQNLGAAGIEATKAQLSELVSKVSAEYPESSFLEPKEVQNLRH  235

Query  912   QQQAQATQPTDCSLDSCLTSSEGSLRDHEM-RNSQMGLRSLNFGAHMESTDLYNETRLKQ  736
             QQQ Q T P + SLDSCLTSSEG+ +  +M  N+++GLR+    +  E  ++  E    +
Sbjct  236   QQQMQTTYPPNSSLDSCLTSSEGTQKAPKMLENNRLGLRTYIGDSTSEQKEVMEEPFFHR  295

Query  735   TEFRWCDD--IWENRK----YLSKMDEETKNNG-------------LSVSTGLQ----GG  625
              E  W ++  I EN      Y+S M     NN              LS+  GLQ    GG
Sbjct  296   MELTWAEEESIRENNNRQPPYISTM---VNNNAEPRVSSSRRSPGRLSIGVGLQHEHRGG  352

Query  624   KWNGNSNYSDRRFTGTDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNT-DD  448
               N NS Y+  RF       K+                +T+           LDLNT D+
Sbjct  353   SSN-NSEYTQERFNENGESCKMETHT------------RTT-----------LDLNTHDE  388

Query  447   KTDVASSCKQLDLNGFSWN  391
                  +  KQ DLNGFSWN
Sbjct  389   NYGTTTRTKQFDLNGFSWN  407



>ref|XP_010517765.1| PREDICTED: uncharacterized protein LOC104793136 isoform X1 [Camelina 
sativa]
Length=407

 Score =   371 bits (952),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 223/430 (52%), Positives = 277/430 (64%), Gaps = 42/430 (10%)
 Frame = -2

Query  1629  YHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEA  1450
             Y +  QGK++  S+ M +  ER+ F++G N  G+SGL+LSTDAKPRLKWT DLHERF+EA
Sbjct  3     YQNQHQGKNILSSSRMHITTERNPFLRG-NSPGESGLILSTDAKPRLKWTPDLHERFIEA  61

Query  1449  VNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNK-AMSSGMD  1273
             VNQLGGADKATPK+++K MGI GLTLYHLKSHLQKYRLSKNL+G ANS  NK  M + M+
Sbjct  62    VNQLGGADKATPKTIMKVMGIPGLTLYHLKSHLQKYRLSKNLNGQANSGLNKIGMMTMME  121

Query  1272  AATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIE  1093
                  +K P+ +     + +IGP  N N PISEA+Q+QIEVQRRLHEQLEVQRHLQLRIE
Sbjct  122   -----EKTPDVDEIQSENLSIGPQPNMNSPISEALQMQIEVQRRLHEQLEVQRHLQLRIE  176

Query  1092  AQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFC  913
             AQGKYLQ+VLEKAQETLGRQ+LG  G+EAAK QLSELVSKVS +  NS+F   KEL    
Sbjct  177   AQGKYLQSVLEKAQETLGRQNLGAAGIEAAKVQLSELVSKVSAEYPNSSFLEPKELQNLR  236

Query  912   QQQAQATQ-PTDCSLDSCLTSSEGSLRDHEMRNSQMGLRS-LNFGAHMESTDLYNETRLK  739
              QQ Q T  P DCSL+SCLTSSEG+ +   + N+++GLR+ L      +  ++  E   +
Sbjct  237   PQQIQTTTYPPDCSLESCLTSSEGTQKT--LENNRIGLRTYLGDSTSEQKENMEEEPLFQ  294

Query  738   QTEFRWCDDIWENRKYLSKMDEETKNN---------GLSVSTGLQGGKWN----GNSNYS  598
             + E  W + +  N  YLS M  ET+            LS+  GLQG K +    GN+ Y+
Sbjct  295   RMELTWREGLRGN-PYLSTMVSETEQRISYSERSPGRLSIGVGLQGHKGHHHQQGNNEYT  353

Query  597   DRRFTGTDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTD-DKTDVASSCK  421
             D RF                 D S+  K +T    K      +LDLNT  +     +  K
Sbjct  354   DERF----------------KDKSEDHKFETRNHRKGMDSATELDLNTHVESYSTTTRTK  397

Query  420   QLDLNGFSWN  391
             Q DLNGFSWN
Sbjct  398   QFDLNGFSWN  407



>ref|XP_006297889.1| hypothetical protein CARUB_v10013932mg [Capsella rubella]
 gb|EOA30787.1| hypothetical protein CARUB_v10013932mg [Capsella rubella]
Length=383

 Score =   369 bits (946),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 215/411 (52%), Positives = 267/411 (65%), Gaps = 41/411 (10%)
 Frame = -2

Query  1584  MLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEAVNQLGGADKATPKSV  1405
             M +  ER+ F++G N  GDSGL+LSTDAKPRLKWT DLHERF+EAVNQLGGADKATPK++
Sbjct  1     MHISSERNHFLRG-NSPGDSGLILSTDAKPRLKWTPDLHERFIEAVNQLGGADKATPKTI  59

Query  1404  LKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNK-AMSSGMDAATGSDKIPEANGNH  1228
             +K MGI GLTLYHLKSHLQKYRLSKNL+G ANS  NK  M + M+     +K P+ +   
Sbjct  60    MKVMGIPGLTLYHLKSHLQKYRLSKNLNGQANSGLNKIGMMTMME-----EKTPDVDEIQ  114

Query  1227  INSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVLEKAQE  1048
               + +IGP  N N PI+EA+Q+QIEVQRRLHEQLEVQRHLQLRIEAQGKYLQ+VLEKAQE
Sbjct  115   SENLSIGPQLNKNSPINEALQMQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQSVLEKAQE  174

Query  1047  TLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFCQQQAQATQPTDCSLD  868
             TLGRQ+LG  G+EAAK QLSELVSKVS +  NS+F   KE+   C QQ Q   P DCSL+
Sbjct  175   TLGRQNLGAAGIEAAKVQLSELVSKVSAEYPNSSFLEPKEVQNLCPQQGQTAYPPDCSLE  234

Query  867   SCLTSSEGSLRDHEM-RNSQMGLRSLNFGAHMESTDLYNETRLKQTEFRWCDDIWENRKY  691
             SCLTSSEG+ ++ +M  N+++GLR+    +  E  +   E   ++ E  W + +  N  Y
Sbjct  235   SCLTSSEGTQKNPKMLENNRLGLRTYLGDSTSEQKENMEEPLFQRMELTWTEGLRGN-PY  293

Query  690   LSKMDEETKNN---------GLSVSTGLQG--GKWNGNSNYSDRRFTGTDADVKLFAQAV  544
             LS M  ET+            LS+  GLQG  G   GN+ Y+D+                
Sbjct  294   LSTMVSETEQRVSYSERSPGRLSIGVGLQGHKGHQQGNNEYTDK----------------  337

Query  543   DRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNGFSWN  391
                  S+  K +T    K      +LDLNT  +   ++  KQ DLNGFSWN
Sbjct  338   -----SEDHKFETRNHRKGTDSTTELDLNTHVENYSSTRTKQFDLNGFSWN  383



>emb|CDY54047.1| BnaC09g54190D [Brassica napus]
Length=393

 Score =   368 bits (944),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 214/425 (50%), Positives = 272/425 (64%), Gaps = 46/425 (11%)
 Frame = -2

Query  1629  YHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEA  1450
             YH+  QGKS+  S+ M +P ERH F++G NG GDSGL+LSTDAKPRLKWT DLHERFV+A
Sbjct  3     YHNQHQGKSILSSSRMSIPSERHPFLRG-NGPGDSGLILSTDAKPRLKWTPDLHERFVDA  61

Query  1449  VNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDA  1270
             VNQLGG +KATPK+++K MGI GLTLYHLKSHLQKYRLSKNL+G ANSS NK     M  
Sbjct  62    VNQLGGGEKATPKTIMKVMGIPGLTLYHLKSHLQKYRLSKNLNGQANSSLNKTSVMTMV-  120

Query  1269  ATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEA  1090
                 +  PEA+ +H  S +IGP  + NLPIS+A+Q+QIEVQRRLHEQLEVQRHLQLRIEA
Sbjct  121   ---EENTPEADESHSESLSIGPQPSMNLPISDALQMQIEVQRRLHEQLEVQRHLQLRIEA  177

Query  1089  QGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFCQ  910
             QGKYLQA+LEKAQETLGRQ+LG  G+EA KAQLSELVSKVS++  +++F  ++ L    Q
Sbjct  178   QGKYLQAILEKAQETLGRQNLGPAGIEATKAQLSELVSKVSSEYPDASFLELQNL--HHQ  235

Query  909   QQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQTE  730
             Q   A  P + SL+SCLTSSEG+ +  +M  + +GLR+    +  E  ++  E    + E
Sbjct  236   QMQTAYPPPNSSLESCLTSSEGNQKAPKMLENGLGLRTYLGDSSSEQKEIMEEPFFHRME  295

Query  729   FRWCDDIWE-------NRKYLSKMDEETKNN-----GLSVSTGLQGGKWNGNSNYSDRRF  586
               W  +  E       NR YLS M+     +      LS+  GLQ  +      Y++ R+
Sbjct  296   LTWAAEEEEEGFRENNNRPYLSAMEPRNSTSRRSPGRLSIGVGLQEHR----GGYTEERY  351

Query  585   TGTDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLN  406
                  D K+      R+ T+                   LDLNT ++T   +  KQ DLN
Sbjct  352   RENGGDCKVET----RTSTA-------------------LDLNTHEETYGTTRPKQFDLN  388

Query  405   GFSWN  391
              FSW+
Sbjct  389   SFSWS  393



>ref|NP_850842.1| myb-related protein 1 [Arabidopsis thaliana]
 ref|NP_974797.1| myb-related protein 1 [Arabidopsis thaliana]
 gb|AAK01148.1|AF291817_1 MYR1 [Arabidopsis thaliana]
 gb|AED92525.1| myb-related protein 1 [Arabidopsis thaliana]
 gb|AED92526.1| myb-related protein 1 [Arabidopsis thaliana]
Length=396

 Score =   368 bits (944),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 218/428 (51%), Positives = 271/428 (63%), Gaps = 49/428 (11%)
 Frame = -2

Query  1629  YHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEA  1450
             YH+  QGKS+  S+ M +  ERH F++G NG GDSGL+LSTDAKPRLKWT DLHERFVEA
Sbjct  3     YHNQHQGKSILSSSRMPISSERHPFLRG-NGTGDSGLILSTDAKPRLKWTPDLHERFVEA  61

Query  1449  VNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDA  1270
             VNQLGG DKATPK+++K MGI GLTLYHLKSHLQKYRLSKNL+G ANSS NK     M  
Sbjct  62    VNQLGGGDKATPKTIMKVMGIPGLTLYHLKSHLQKYRLSKNLNGQANSSLNKTSVMTM--  119

Query  1269  ATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEA  1090
                 +  PE + +H  S +IGP  + NLPIS+A+Q+QIEVQRRLHEQLE      LRIEA
Sbjct  120   --VEENPPEVDESHSESLSIGPQPSMNLPISDALQMQIEVQRRLHEQLE------LRIEA  171

Query  1089  QGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFCQ  910
             QGKYLQ++LEKAQETLGRQ+LG  G+EA KAQLSELVSKVS    +S+F   KEL     
Sbjct  172   QGKYLQSILEKAQETLGRQNLGAAGIEATKAQLSELVSKVSADYPDSSFLEPKELQNLHH  231

Query  909   QQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQTE  730
             QQ Q T P + SLDSCLTSSEG+ +  +M ++++GLR+    +  E  ++  E    + E
Sbjct  232   QQMQKTYPPNSSLDSCLTSSEGTQKAPKMLDNRLGLRTYIGDSTSEQKEIMEEPFFHRME  291

Query  729   FRWCDD--IWE--NRKYLSKM--------DEETKNNG-LSVSTGLQG--GKWNGNSNYSD  595
               W ++  + E  NR YLS M            ++ G LS+  GL    G+ + NS Y++
Sbjct  292   LTWAEEESLRENHNRPYLSTMVNNAEPRISSSRRSPGRLSIGVGLHEHRGRSSNNSEYTE  351

Query  594   RRFTGTDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQL  415
              RF   + D KL                +T+           LDLNT D+    +  KQ 
Sbjct  352   ERFNENNEDCKLETHT------------RTA-----------LDLNTHDENYGTTRPKQF  388

Query  414   DLNGFSWN  391
             DLNGFSWN
Sbjct  389   DLNGFSWN  396



>ref|XP_010672721.1| PREDICTED: uncharacterized protein LOC104889245 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=421

 Score =   369 bits (946),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 225/456 (49%), Positives = 273/456 (60%), Gaps = 79/456 (17%)
 Frame = -2

Query  1632  MYHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVE  1453
             MYHHH Q  +M+PS  +  P ER LF+QG NG  DS LVLSTDAKPRLKWT DLHERFVE
Sbjct  1     MYHHHSQA-NMYPSPRISAPQERQLFLQGGNGSRDSNLVLSTDAKPRLKWTPDLHERFVE  59

Query  1452  AVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMD  1273
             AVNQLGGADKATPK+V+K MGI GLTLYHLKSHLQKYRLSKN+HG  +S +NK +     
Sbjct  60    AVNQLGGADKATPKTVMKLMGIPGLTLYHLKSHLQKYRLSKNIHGQTSSGANKTV-----  114

Query  1272  AATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLE----------  1123
                 SDK+ E + +H +S NI    N NL I+EA+Q+QIEVQRRLHEQLE          
Sbjct  115   -VMSSDKMQETSPSHTSSINIAHQPNKNLHINEALQMQIEVQRRLHEQLEVLDPVYFQFK  173

Query  1122  -----------------------------VQRHLQLRIEAQGKYLQAVLEKAQETLGRQD  1030
                                          VQR LQLRIEAQGKYLQAVLEKAQETLG+Q+
Sbjct  174   QNGLSPKAETTTAAQNLQRHHPKNSRDKDVQRRLQLRIEAQGKYLQAVLEKAQETLGKQN  233

Query  1029  LGKMGLEAAKAQLSELVSKVSNQCLNSAFSGI-KELPGFC-QQQAQATQPT-DCSLDSCL  859
             +G +GLEAAK QLSELVSKVSNQCLN AF+ + +E  G C +QQ Q  +P  DCSLDSCL
Sbjct  234   IGVVGLEAAKLQLSELVSKVSNQCLNLAFAEMAEEQQGLCPKQQIQPHKPMGDCSLDSCL  293

Query  858   TSSEGS-LRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQTEFRWCDDIWENRKYLSK  682
             TS +G  LR+ +M NS++GLR  N    +E  +     +   T         +  K + +
Sbjct  294   TSCDGPQLREQDMHNSELGLRPYNDTRFLEGNEFNENLKEHATILFPTTTQQDTAKMMFR  353

Query  681   MDEETKNNGLSVSTGLQGGKWNGNSNYSDRRFTGTDADVKLFAQAVDRSDTSKPEKQKTS  502
             M  E   + LS+S G+             RR T  + +   F              Q  +
Sbjct  354   M--EGACSDLSMSVGI-------------RRDTRDELEQSTF--------------QLDN  384

Query  501   QEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNGFSW  394
             + YKL  F  +LDLN  D+ DV S+ + LDLNG SW
Sbjct  385   KNYKLGSFSGELDLNARDEPDVPSTIRHLDLNGLSW  420



>ref|XP_009120996.1| PREDICTED: myb family transcription factor APL isoform X2 [Brassica 
rapa]
Length=390

 Score =   367 bits (943),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 216/424 (51%), Positives = 275/424 (65%), Gaps = 47/424 (11%)
 Frame = -2

Query  1629  YHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEA  1450
             YH+  QGKS+  S+ M +P ERH F++G NG GDSGL+LSTDAKPRLKWT DLHERFVEA
Sbjct  3     YHNQHQGKSLLSSSRMPIPSERHPFLRG-NGPGDSGLILSTDAKPRLKWTPDLHERFVEA  61

Query  1449  VNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDA  1270
             VNQLGG +KATPK+++K MGI GLTLYHLKSHLQKYRLSKNL+G ANSS NK     M  
Sbjct  62    VNQLGGGEKATPKTIMKVMGIPGLTLYHLKSHLQKYRLSKNLNGQANSSLNKTSVMTMV-  120

Query  1269  ATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEA  1090
                 +  PEA+ +H  S +IGP  + NLPIS+A+Q+QIEVQRRLHEQLE  RHLQLRIEA
Sbjct  121   ---EENTPEADESHSESLSIGPQPSMNLPISDALQMQIEVQRRLHEQLE--RHLQLRIEA  175

Query  1089  QGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFCQ  910
             QGKYLQA+LEKAQETLGRQ+LG  G+EA KAQLSELVSKVS++  +++F  ++ L    Q
Sbjct  176   QGKYLQAILEKAQETLGRQNLGPAGIEATKAQLSELVSKVSSEYPDASFLELQNL--HHQ  233

Query  909   QQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQTE  730
             Q   A  P + SL+SCLTSSEG+ +  +M  +++GLR+    +  E  ++  E    + E
Sbjct  234   QMQTAYPPQNSSLESCLTSSEGNQKAPKMLENRLGLRTYLGDSSSEQKEIMEEPFFHRME  293

Query  729   FRWCDD-----IWE-NRKYLSKMDEETKNN-----GLSVSTGLQGGKWNGNSNYSDRRFT  583
               W ++     I E NR YLS M+    ++      LS+  GLQ  +      Y++ R+ 
Sbjct  294   LTWAEEEEEEGIRENNRPYLSAMEPRNSSSRRSPGRLSIGVGLQEHR----GGYTEERYR  349

Query  582   GTDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNG  403
                 D K+      R+ T+                   LDLNT D+T   +  KQ DLNG
Sbjct  350   ENGEDCKVET----RTSTA-------------------LDLNTHDETYGTTRPKQFDLNG  386

Query  402   FSWN  391
             FSW+
Sbjct  387   FSWS  390



>ref|XP_002884424.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60683.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=394

 Score =   367 bits (943),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 217/423 (51%), Positives = 268/423 (63%), Gaps = 41/423 (10%)
 Frame = -2

Query  1629  YHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEA  1450
             Y +  QGK++  S+ M +  ERH F++G N  GDSGL+LSTDAKPRLKWT DLHERF+EA
Sbjct  3     YQNQHQGKNVLSSSRMHITSERHPFLRG-NSPGDSGLILSTDAKPRLKWTPDLHERFIEA  61

Query  1449  VNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDA  1270
             VNQLGGADKATPK+++K MGI GLTLYHLKSHLQKYRLSKNL+G ANSS NK    GM  
Sbjct  62    VNQLGGADKATPKTIMKVMGIPGLTLYHLKSHLQKYRLSKNLNGQANSSFNKI---GMMT  118

Query  1269  ATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEA  1090
                 ++ P+A+ +   S +IGP  N N PI EA+Q+QIEVQRRLHEQLEVQRHLQLRIEA
Sbjct  119   ML-EEQTPDADESQSESLSIGPQPNKNSPIGEALQMQIEVQRRLHEQLEVQRHLQLRIEA  177

Query  1089  QGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFCQ  910
             QGKYLQ+VLEKAQETLG+Q+LG  G+EAAK QLSELVSKVS +  NS+    KEL   C 
Sbjct  178   QGKYLQSVLEKAQETLGKQNLGAAGIEAAKVQLSELVSKVSAEYPNSSILEPKELQNLCS  237

Query  909   QQAQATQPTDCSLDSCLTSSEGSLRDHEM-RNSQMGLRSLNFGAHMESTDLYNETRLKQT  733
             QQ Q T   DCSL+SCLTSSEG+ ++ +M  N+++GLR+    +  E  ++  E   ++ 
Sbjct  238   QQMQTTYLPDCSLESCLTSSEGTQKNLKMLENNRLGLRTYLGDSTSEQKEIMEEQLFQRR  297

Query  732   EFRWCDDIWENRKYLSKMDEETKNN---------GLSVSTGLQGGKWNGNSNYSDRRFTG  580
             E  W +    N  YLS M  E +            LS+  GL G K         +   G
Sbjct  298   ELTWTEGRRGN-PYLSAMVSEAEQRISYSERSPGRLSIGVGLHGHK--------SQHQQG  348

Query  579   TDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNGF  400
              + D KL  +     D++                  +LDLNT  +       KQ DLNGF
Sbjct  349   NNEDHKLETRNRKGMDSTT-----------------ELDLNTHVENFCTKRTKQFDLNGF  391

Query  399   SWN  391
             SWN
Sbjct  392   SWN  394



>ref|XP_010420569.1| PREDICTED: uncharacterized protein LOC104706130 isoform X2 [Camelina 
sativa]
Length=406

 Score =   368 bits (944),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 225/439 (51%), Positives = 274/439 (62%), Gaps = 61/439 (14%)
 Frame = -2

Query  1629  YHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEA  1450
             YH+  QGKS+  S+ M +P ERH F++G NG GDSGL+LSTDAKPRLKWT DLHERFVEA
Sbjct  3     YHNQHQGKSILSSSRMPIPSERHPFLRG-NGTGDSGLILSTDAKPRLKWTPDLHERFVEA  61

Query  1449  VNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDA  1270
             VNQLGG DKATPK+++K MGI GLTLYHLKSHLQKYRLSKN +G ANS  NK     M  
Sbjct  62    VNQLGGGDKATPKTIMKVMGIPGLTLYHLKSHLQKYRLSKNPNGQANSGLNKTSVMTMV-  120

Query  1269  ATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEA  1090
                 + +PEA  +H  S +IGP  + NLPIS+A+Q+QIEVQRRLHEQLE  RHLQLRIEA
Sbjct  121   ---EENLPEAEESHSESLSIGPQPSMNLPISDALQMQIEVQRRLHEQLE--RHLQLRIEA  175

Query  1089  QGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGF-C  913
             QGKYLQ++LEKAQETLGRQ+LG  G+EA KAQLSELVSKVS +  +S+F   KE+     
Sbjct  176   QGKYLQSILEKAQETLGRQNLGAAGIEATKAQLSELVSKVSAEYPDSSFLEPKEVQKLRH  235

Query  912   QQQAQATQPTDCSLDSCLTSSEGSLRDHEM-RNSQMGLRSLNFGAHMESTDLYNETRLKQ  736
             QQQ Q T P + SLDSCLTSSEG+ +  +M  N+++GLR+    +  E  ++  E    +
Sbjct  236   QQQMQTTYPPNSSLDSCLTSSEGTQKAPKMLENNRLGLRTYIGDSTSEQKEVMEEPFFHR  295

Query  735   TEFRWCDD--IWENR----KYLSKMDEETKNNG-------------LSVSTGLQ----GG  625
              E  W ++  I EN      Y+S M     NNG             LS+  GLQ    GG
Sbjct  296   MELTWAEEESIRENNNRPPPYISTM----VNNGEARVLSSRRSPGRLSIGVGLQHEHRGG  351

Query  624   KWNGNSNYSDRRFTGTDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNT-DD  448
               N NS Y+  RF       K+                +T+           LDLNT D+
Sbjct  352   SSN-NSEYTQERFNENGEGCKMETHT------------RTT-----------LDLNTHDE  387

Query  447   KTDVASSCKQLDLNGFSWN  391
                  +  KQ DLNGFSWN
Sbjct  388   NYGTTTRTKQFDLNGFSWN  406



>ref|NP_974216.1| myb family transcription factor [Arabidopsis thaliana]
 gb|AEE74028.1| myb family transcription factor [Arabidopsis thaliana]
Length=393

 Score =   366 bits (940),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 215/424 (51%), Positives = 270/424 (64%), Gaps = 44/424 (10%)
 Frame = -2

Query  1629  YHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEA  1450
             Y +  QGK++  S+ M +  ERH F++G N  GDSGL+LSTDAKPRLKWT DLHERF+EA
Sbjct  3     YQNQHQGKNILSSSRMHITSERHPFLRG-NSPGDSGLILSTDAKPRLKWTPDLHERFIEA  61

Query  1449  VNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNK-AMSSGMD  1273
             VNQLGGAD  TPK+++K MGI GLTLYHLKSHLQKYRLSKNL+G AN+S NK  + + M+
Sbjct  62    VNQLGGAD-TTPKTIMKVMGIPGLTLYHLKSHLQKYRLSKNLNGQANNSFNKIGIMTMME  120

Query  1272  AATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIE  1093
                  +K P+A+     + +IGP  N N PI EA+Q+QIEVQRRLHEQLEVQRHLQLRIE
Sbjct  121   -----EKTPDADEIQSENLSIGPQPNKNSPIGEALQMQIEVQRRLHEQLEVQRHLQLRIE  175

Query  1092  AQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFC  913
             AQGKYLQ+VLEKAQETLGRQ+LG  G+EAAK QLSELVSKVS +  NS+F   KEL   C
Sbjct  176   AQGKYLQSVLEKAQETLGRQNLGAAGIEAAKVQLSELVSKVSAEYPNSSFLEPKELQNLC  235

Query  912   QQQAQATQPTDCSLDSCLTSSEGSLRDHEM-RNSQMGLRSLNFGAHMESTDLYNETRLKQ  736
              QQ Q   P DCSL+SCLTSSEG+ ++ +M  N+++GLR+    +  E  ++  E   ++
Sbjct  236   SQQMQTNYPPDCSLESCLTSSEGTQKNSKMLENNRLGLRTYIGDSTSEQKEIMEEPLFQR  295

Query  735   TEFRWCDDIWENRKYLSKMDEETKNN---------GLSVSTGLQGGKWNGNSNYSDRRFT  583
              E  W + +  N  YLS M  E +            LS+  GL G K         +   
Sbjct  296   MELTWTEGLRGN-PYLSTMVSEAEQRISYSERSPGRLSIGVGLHGHK--------SQHQQ  346

Query  582   GTDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNG  403
             G + D KL  +     D++                  +LDLNT  +    +  KQ DLNG
Sbjct  347   GNNEDHKLETRNRKGMDSTT-----------------ELDLNTHVENYCTTRTKQFDLNG  389

Query  402   FSWN  391
             FSWN
Sbjct  390   FSWN  393



>gb|ADO32622.1| myb family transcription factor [Arabidopsis thaliana]
Length=392

 Score =   365 bits (938),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 215/424 (51%), Positives = 270/424 (64%), Gaps = 45/424 (11%)
 Frame = -2

Query  1629  YHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEA  1450
             Y +  QGK++  S+ M +  ERH F++G N  GDSGL+LSTDAKPRLKWT DLHERF+EA
Sbjct  3     YQNQHQGKNILSSSRMHITSERHPFLRG-NSPGDSGLILSTDAKPRLKWTPDLHERFIEA  61

Query  1449  VNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNK-AMSSGMD  1273
             VNQLGGADKATPK+++K MGI GLTLYHLKSHLQKYRLSKNL+G AN+S NK  + + M+
Sbjct  62    VNQLGGADKATPKTIMKVMGIPGLTLYHLKSHLQKYRLSKNLNGQANNSFNKIGIMTMME  121

Query  1272  AATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIE  1093
                  +K P+A+     + +IGP  N N PI EA+Q+QIEVQRRLHEQLE  RHLQLRIE
Sbjct  122   -----EKTPDADEIQSENLSIGPQPNKNSPIGEALQMQIEVQRRLHEQLE--RHLQLRIE  174

Query  1092  AQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFC  913
             AQGKYLQ+VLEKAQETLGRQ+LG  G+EAAK QLSELVSKVS +  NS+F   KEL   C
Sbjct  175   AQGKYLQSVLEKAQETLGRQNLGAAGIEAAKVQLSELVSKVSAEYPNSSFLEPKELQNLC  234

Query  912   QQQAQATQPTDCSLDSCLTSSEGSLRDHEM-RNSQMGLRSLNFGAHMESTDLYNETRLKQ  736
              QQ Q   P DCSL+SCLTSSEG+ ++ +M  N+++GLR+    +  E  ++  E   ++
Sbjct  235   SQQMQTNYPPDCSLESCLTSSEGTQKNSKMLENNRLGLRTYIGDSTSEQKEIMEEPLFQR  294

Query  735   TEFRWCDDIWENRKYLSKMDEETKNN---------GLSVSTGLQGGKWNGNSNYSDRRFT  583
              E  W + +  N  YLS M  E +            LS+  GL G K         +   
Sbjct  295   MELTWTEGLRGN-PYLSTMVSEAEQRISYSERSPGRLSIGVGLHGHK--------SQHQQ  345

Query  582   GTDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNG  403
             G + D KL  +     D++                  +LDLNT  +    +  KQ DLNG
Sbjct  346   GNNEDHKLETRNRKGMDSTT-----------------ELDLNTHVENYCTTRTKQFDLNG  388

Query  402   FSWN  391
             FSWN
Sbjct  389   FSWN  392



>ref|XP_006400372.1| hypothetical protein EUTSA_v10013729mg [Eutrema salsugineum]
 gb|ESQ41825.1| hypothetical protein EUTSA_v10013729mg [Eutrema salsugineum]
Length=399

 Score =   365 bits (937),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 220/430 (51%), Positives = 270/430 (63%), Gaps = 50/430 (12%)
 Frame = -2

Query  1629  YHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEA  1450
             YH+  QGKS+  S+ M +  ERH F++G N  GDSGL+LSTDAKPRLKWT DLHERFVEA
Sbjct  3     YHNQHQGKSILSSSRMPISSERHPFLRG-NDTGDSGLILSTDAKPRLKWTPDLHERFVEA  61

Query  1449  VNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDA  1270
             VNQLGG DKATPK+++K MGI GLTLYHLKSHLQKYRLSKNL+G ANSS NK     M  
Sbjct  62    VNQLGGGDKATPKTIMKVMGIPGLTLYHLKSHLQKYRLSKNLNGQANSSLNKTSVMTMV-  120

Query  1269  ATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEA  1090
                 +  PEA+ +H  S +IGP  + NLPIS+A+Q+QIEVQRRLHEQLEVQRHLQLRIEA
Sbjct  121   ---EENTPEADESHGESLSIGPQPSINLPISDALQMQIEVQRRLHEQLEVQRHLQLRIEA  177

Query  1089  QGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFCQ  910
             QGKYLQA+L KAQETLGRQ+LG    EA KAQLSELVSK S +  +++F   K++     
Sbjct  178   QGKYLQAILLKAQETLGRQNLGP---EATKAQLSELVSKASAEYPDTSFLEPKQVQTLGH  234

Query  909   QQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQTE  730
             QQ Q T P + SL+SCLTSSEG+L+  +M  + +GLR+    +  E  ++  E   ++ E
Sbjct  235   QQMQTTYPQNSSLESCLTSSEGALKPPKMLENGLGLRTYIGDSTSEQKEIMEEPFFQRME  294

Query  729   FRWCDDIWENRKYLSKMDEETKNNG--------------LSVSTGLQ---GGKWNGNSNY  601
               W ++   NR YLS +     NN               LS+  GL     G  +GNS Y
Sbjct  295   LTWGEEEGHNRSYLSTIGH--NNNAEQRTLSSRRRSPGRLSIGVGLHEQNRGGGSGNSGY  352

Query  600   SDRRFTGTDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCK  421
             ++ RF     D KL      R+ T+                   LDLNT D     +  K
Sbjct  353   TEERFNENGEDCKLET----RTRTA-------------------LDLNTHDDNYGTTRPK  389

Query  420   QLDLNGFSWN  391
             Q DLNGFSWN
Sbjct  390   QFDLNGFSWN  399



>ref|XP_009130413.1| PREDICTED: two-component response regulator ARR18 isoform X1 
[Brassica rapa]
Length=392

 Score =   364 bits (935),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 219/425 (52%), Positives = 268/425 (63%), Gaps = 47/425 (11%)
 Frame = -2

Query  1629  YHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEA  1450
             Y +  QGKS+  S+ M +  ERH F++G N  GDSGL+LSTDAKPRLKWT DLHERF+EA
Sbjct  3     YQNQHQGKSILSSSRMHLASERHPFLRGGNSPGDSGLILSTDAKPRLKWTPDLHERFIEA  62

Query  1449  VNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDA  1270
             VNQLGGADKATPK+++K MGI GLTLYHLKSHLQKYRLSKNL+G ANS  NK    GM  
Sbjct  63    VNQLGGADKATPKTIMKVMGIPGLTLYHLKSHLQKYRLSKNLNGQANSGLNKI---GMMT  119

Query  1269  ATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEA  1090
                 +K P+A+     S +IGP  N N PI EA+Q+QIEVQRRLHEQLEVQRHLQLRIEA
Sbjct  120   MI-EEKSPDADEIQSESLSIGPQPNKNSPIGEALQMQIEVQRRLHEQLEVQRHLQLRIEA  178

Query  1089  QGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFCQ  910
             QGKYLQ+VLEKAQETLGRQ+L   G+EAAK QLSELVSKVS +  N++F   KE    C 
Sbjct  179   QGKYLQSVLEKAQETLGRQNLSPAGIEAAKVQLSELVSKVSAEYPNTSFLDPKEFQNLCP  238

Query  909   QQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQTE  730
             QQ Q   P     DSCLTSSEG+ ++ +M    +GLR+    +  E  ++  E   ++ E
Sbjct  239   QQMQTAYPQ----DSCLTSSEGAQKNPKM----LGLRTYLGDSTSEQKEVIEEPLFQRME  290

Query  729   FRWCDDIWENRKYLSKM--DEETK-------NNGLSVSTGLQG--GKWNGNSNYS-DRRF  586
               W + +  N  YLS M  D E +        + L++  G+ G  G   G++ Y+ D RF
Sbjct  291   LTWNEGLRGN-PYLSTMVTDAEQRVSYSERSPSTLTMGVGMHGHRGHQQGSNEYNKDERF  349

Query  585   TGTDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLN  406
                           D+S+  K E Q T  E         LDLNT  +    +  KQ DLN
Sbjct  350   N-------------DKSEDHKLETQSTKTE---------LDLNTHVENCCTTRPKQFDLN  387

Query  405   GFSWN  391
             GFSWN
Sbjct  388   GFSWN  392



>ref|XP_010672720.1| PREDICTED: uncharacterized protein LOC104889245 isoform X1 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010672724.1| PREDICTED: uncharacterized protein LOC104889245 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=422

 Score =   364 bits (935),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 225/457 (49%), Positives = 273/457 (60%), Gaps = 80/457 (18%)
 Frame = -2

Query  1632  MYHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVE  1453
             MYHHH Q  +M+PS  +  P ER LF+QG NG  DS LVLSTDAKPRLKWT DLHERFVE
Sbjct  1     MYHHHSQA-NMYPSPRISAPQERQLFLQGGNGSRDSNLVLSTDAKPRLKWTPDLHERFVE  59

Query  1452  AVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHL-QKYRLSKNLHGHANSSSNKAMSSGM  1276
             AVNQLGGADKATPK+V+K MGI GLTLYHLKSHL QKYRLSKN+HG  +S +NK +    
Sbjct  60    AVNQLGGADKATPKTVMKLMGIPGLTLYHLKSHLQQKYRLSKNIHGQTSSGANKTV----  115

Query  1275  DAATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLE---------  1123
                  SDK+ E + +H +S NI    N NL I+EA+Q+QIEVQRRLHEQLE         
Sbjct  116   --VMSSDKMQETSPSHTSSINIAHQPNKNLHINEALQMQIEVQRRLHEQLEVLDPVYFQF  173

Query  1122  ------------------------------VQRHLQLRIEAQGKYLQAVLEKAQETLGRQ  1033
                                           VQR LQLRIEAQGKYLQAVLEKAQETLG+Q
Sbjct  174   KQNGLSPKAETTTAAQNLQRHHPKNSRDKDVQRRLQLRIEAQGKYLQAVLEKAQETLGKQ  233

Query  1032  DLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGI-KELPGFC-QQQAQATQPT-DCSLDSC  862
             ++G +GLEAAK QLSELVSKVSNQCLN AF+ + +E  G C +QQ Q  +P  DCSLDSC
Sbjct  234   NIGVVGLEAAKLQLSELVSKVSNQCLNLAFAEMAEEQQGLCPKQQIQPHKPMGDCSLDSC  293

Query  861   LTSSEGS-LRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQTEFRWCDDIWENRKYLS  685
             LTS +G  LR+ +M NS++GLR  N    +E  +     +   T         +  K + 
Sbjct  294   LTSCDGPQLREQDMHNSELGLRPYNDTRFLEGNEFNENLKEHATILFPTTTQQDTAKMMF  353

Query  684   KMDEETKNNGLSVSTGLQGGKWNGNSNYSDRRFTGTDADVKLFAQAVDRSDTSKPEKQKT  505
             +M  E   + LS+S G+             RR T  + +   F              Q  
Sbjct  354   RM--EGACSDLSMSVGI-------------RRDTRDELEQSTF--------------QLD  384

Query  504   SQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNGFSW  394
             ++ YKL  F  +LDLN  D+ DV S+ + LDLNG SW
Sbjct  385   NKNYKLGSFSGELDLNARDEPDVPSTIRHLDLNGLSW  421



>ref|XP_006287895.1| hypothetical protein CARUB_v10001129mg [Capsella rubella]
 gb|EOA20793.1| hypothetical protein CARUB_v10001129mg [Capsella rubella]
Length=390

 Score =   363 bits (931),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 218/430 (51%), Positives = 272/430 (63%), Gaps = 59/430 (14%)
 Frame = -2

Query  1629  YHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEA  1450
             YH+  QGKS+  S+ M +  ERH F++G NG GDSGL+LSTDAKPRLKWT DLHERFVEA
Sbjct  3     YHNQHQGKSILSSSRMPITSERHPFLRG-NGTGDSGLILSTDAKPRLKWTPDLHERFVEA  61

Query  1449  VNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDA  1270
             VNQLGG DKATPK+++K MGI GLTLYHLKSHLQKYRLSKNL+G A+SS NK     M  
Sbjct  62    VNQLGGGDKATPKTIMKVMGIPGLTLYHLKSHLQKYRLSKNLNGQASSSLNKTSVMTMV-  120

Query  1269  ATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEA  1090
                 + +PEA+  H  S +IGP  + NLPIS+A+Q+QIEVQRRLHEQLE      LRIEA
Sbjct  121   ---EENLPEADEGHSESLSIGPQPSMNLPISDALQMQIEVQRRLHEQLE------LRIEA  171

Query  1089  QGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFCQ  910
             QGKYLQ++LEKAQETLGRQ+LG  G+EA KAQLSELVSKVS +  +S+F           
Sbjct  172   QGKYLQSILEKAQETLGRQNLGAAGIEATKAQLSELVSKVSAEYPDSSFLE-------AH  224

Query  909   QQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQTE  730
             QQ Q T P + SLDSCLTSSEG+ +  +MR +++GLR+    +  E  ++  E   ++ E
Sbjct  225   QQMQTTYPPNSSLDSCLTSSEGTQKAPKMRENRLGLRTYIGDSTSEQKEVMEEPFFRRME  284

Query  729   FRWCDD--IWE--NRKYLSKM--DEETKNNG-------LSVSTGL---QGGKWNGNSNYS  598
               W ++  + E  NR YLS M  + E +N+        LS+  GL   + G  N NS Y+
Sbjct  285   LTWAEEESLRENNNRPYLSTMVNNTEPRNSSSRRSPGRLSMGVGLHEHREGSGN-NSEYA  343

Query  597   DRRFTGTDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNT-DDKTDVASSCK  421
             + RF+    D KL                         + G  LDLNT D+     +  K
Sbjct  344   EERFSENGEDCKLET-----------------------HTGTTLDLNTHDENYGTTTRPK  380

Query  420   QLDLNGFSWN  391
             Q DLNGFSWN
Sbjct  381   QFDLNGFSWN  390



>ref|XP_010492828.1| PREDICTED: two-component response regulator ARR2-like isoform 
X3 [Camelina sativa]
Length=403

 Score =   362 bits (929),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 222/439 (51%), Positives = 269/439 (61%), Gaps = 64/439 (15%)
 Frame = -2

Query  1629  YHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEA  1450
             Y H  QGKS+  S+ M +P ERH F++G NG GDSGL+LSTDAKPRLKWT DLHERFVEA
Sbjct  3     YQHQHQGKSILSSSRMPIPSERHPFLRG-NGTGDSGLILSTDAKPRLKWTPDLHERFVEA  61

Query  1449  VNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDA  1270
             VNQLGG DKATPK+++K MGI GLTLYHLKSHLQKYRLSKNL+G ANSS NK     M  
Sbjct  62    VNQLGGGDKATPKTIMKVMGIPGLTLYHLKSHLQKYRLSKNLNGQANSSLNKTSVMTMV-  120

Query  1269  ATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEA  1090
                 + +PEA  +H  S +IGP  + NLPIS+A+Q+QIEVQRRLHEQLE      LRIEA
Sbjct  121   ---EENLPEAEESHSESLSIGPQPSMNLPISDALQMQIEVQRRLHEQLE------LRIEA  171

Query  1089  QGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGF-C  913
             QGKYLQ++LEKAQETLGRQ+LG  G+EA KAQLSELVSKVS +   S+F   KE+     
Sbjct  172   QGKYLQSILEKAQETLGRQNLGAAGIEATKAQLSELVSKVSAEYPESSFLEPKEVQNLRH  231

Query  912   QQQAQATQPTDCSLDSCLTSSEGSLRDHEM-RNSQMGLRSLNFGAHMESTDLYNETRLKQ  736
             QQQ Q T P + SLDSCLTSSEG+ +  +M  N+++GLR+    +  E  ++  E    +
Sbjct  232   QQQMQTTYPPNSSLDSCLTSSEGTQKAPKMLENNRLGLRTYIGDSTSEQKEVMEEPFFHR  291

Query  735   TEFRWCDD--IWENR----KYLSKMDEETKNNG-------------LSVSTGLQ----GG  625
              E  W ++  I EN      Y+S M     NN              LS+  GLQ    GG
Sbjct  292   MELTWAEEESIRENNNRQPPYISTM---VNNNAEPRVSSSRRSPGRLSIGVGLQHEHRGG  348

Query  624   KWNGNSNYSDRRFTGTDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNT-DD  448
               N NS Y+  RF       K+                +T+           LDLNT D+
Sbjct  349   SSN-NSEYTQERFNENGESCKMETHT------------RTT-----------LDLNTHDE  384

Query  447   KTDVASSCKQLDLNGFSWN  391
                  +  KQ DLNGFSWN
Sbjct  385   NYGTTTRTKQFDLNGFSWN  403



>emb|CDY42899.1| BnaC05g47520D [Brassica napus]
Length=372

 Score =   359 bits (922),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 214/414 (52%), Positives = 262/414 (63%), Gaps = 45/414 (11%)
 Frame = -2

Query  1629  YHHHRQGKSMHPSTNMLMPPERHLFMQG-ENGHGDSGLVLSTDAKPRLKWTQDLHERFVE  1453
             Y +  QGKS+  S+ M +P ERH F++G  N  GDSGL+LSTDAKPRLKWT DLHERF+E
Sbjct  3     YQNQHQGKSILSSSRMHLPSERHPFLRGGNNSPGDSGLILSTDAKPRLKWTPDLHERFIE  62

Query  1452  AVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMD  1273
             AVNQLGGADKATPK+++K MGI GLTLYHLKSHLQKYRLSKNL+G ANS  NK    GM 
Sbjct  63    AVNQLGGADKATPKTIMKVMGIPGLTLYHLKSHLQKYRLSKNLNGQANSGLNKI---GMM  119

Query  1272  AATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIE  1093
                  +K P+A+     S +IGP  N N PISEA+Q+QIEVQRRLHEQLEVQRHLQLRIE
Sbjct  120   TMI-EEKSPDADEIQSESLSIGPQPNKNSPISEALQMQIEVQRRLHEQLEVQRHLQLRIE  178

Query  1092  AQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFC  913
             AQGKYLQ+VLEKAQETLGRQ+L   G+EAAK QLSELVSKVS +  N++F   KE    C
Sbjct  179   AQGKYLQSVLEKAQETLGRQNLSPAGIEAAKVQLSELVSKVSAEYPNTSFLDPKEFQNLC  238

Query  912   QQQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQT  733
              QQ Q   P     DSCLTSSEG+ ++ +M    +GLR+    +  E  ++  E   ++ 
Sbjct  239   PQQMQTAYPQ----DSCLTSSEGAQKNPKM----LGLRTYLGDSTSEQKEVIEEPLFQRM  290

Query  732   EFRWCDDIWENRKYLSKMDEETKNNGLSVSTGLQGGKWNGNSNYSDRRFTGTDADVKLFA  553
             E  W + +  N  YLS M  + +   +S+  G+ G + +   N ++        D KL  
Sbjct  291   ELTWTEGLRGN-PYLSTMVSDAEQR-ISLGVGMHGHRGHQQGNNAE--------DHKL--  338

Query  552   QAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNGFSWN  391
                        E Q T  E         LDLNT  +    +  KQ DLNGFSWN
Sbjct  339   -----------ETQSTKTE---------LDLNTHVENYCTTRPKQFDLNGFSWN  372



>emb|CDY66489.1| BnaA01g37390D [Brassica napus]
Length=384

 Score =   360 bits (923),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 222/427 (52%), Positives = 272/427 (64%), Gaps = 59/427 (14%)
 Frame = -2

Query  1629  YHHHRQGKSMHPSTNMLMPPERH-LFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVE  1453
             Y +  QGKS+  S+ M +P ERH  F++G N  G SGL+LSTDAKPRLKWT DLHERF+E
Sbjct  3     YQNQHQGKSILSSSRMHLPSERHHQFLRGGNSPGGSGLILSTDAKPRLKWTPDLHERFIE  62

Query  1452  AVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNK-AMSSGM  1276
             AVNQLGGADKATPK+++K MGI GLTLYHLKSHLQKYRLSKNL+G ANS  NK  M + M
Sbjct  63    AVNQLGGADKATPKTIMKVMGIPGLTLYHLKSHLQKYRLSKNLNGQANSGLNKIGMMTMM  122

Query  1275  DAATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRI  1096
             +     +K P+A+     + +IGP  N N PISEA+ +QIEVQRRLHEQLEVQRHLQL+I
Sbjct  123   E-----EKSPDADEIQSETLSIGPQPNKNSPISEALHMQIEVQRRLHEQLEVQRHLQLKI  177

Query  1095  EAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGF  916
             EAQGKYLQ+VLEKAQETLG+Q+LG+ GLEAAK  LSE VSKVS +  N++F   KE    
Sbjct  178   EAQGKYLQSVLEKAQETLGKQNLGEAGLEAAKVHLSEFVSKVSAEYPNTSFLEQKEFRNL  237

Query  915   CQQQAQATQPTDCSLDSCLTSSEGSLRDHE-MRNSQMGLRSLNFGAHMESTDLYNETRLK  739
             C QQ Q   P DCSL+SCLTSSEG+ ++ + + N+++GLR+   G   +ST    E   K
Sbjct  238   CTQQMQ---PPDCSLESCLTSSEGAQKNPKTLENNRLGLRTY-LG---DSTSEQKEPMFK  290

Query  738   QTEFRWCDDIWENRKYLSKM--DEETK-------NNGLSVSTGLQG--GKWNGNSNYSDR  592
             + E  W + +  N  YLS M  D E +        + LS+  G+ G  G   GN+N    
Sbjct  291   RMELTWTEGLRGN-PYLSTMVSDAEQRVSYSDRSPDRLSIGVGMHGHRGHQQGNNN----  345

Query  591   RFTGTDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLD  412
                    D KL             E Q T+ E         LDLNT       +  KQLD
Sbjct  346   ------EDHKL-------------ETQGTTTE---------LDLNTQVDNYCTTRPKQLD  377

Query  411   LNGFSWN  391
             LNGFSWN
Sbjct  378   LNGFSWN  384



>ref|XP_004487497.1| PREDICTED: uncharacterized protein LOC101506129 isoform X1 [Cicer 
arietinum]
Length=410

 Score =   360 bits (925),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 225/425 (53%), Positives = 281/425 (66%), Gaps = 43/425 (10%)
 Frame = -2

Query  1611  GKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEAVNQLGG  1432
             GK++H S+ M +P ERH+F+Q  NG  DSGLVLSTDAKPRLKWT DLH RF+EAVNQLGG
Sbjct  11    GKNIHSSSRMSIPSERHMFLQTGNGSSDSGLVLSTDAKPRLKWTPDLHARFIEAVNQLGG  70

Query  1431  ADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDAATGSDK  1252
             ADKATPK+V+K MGI GLTLYHLKSHLQKYRLSKNLHG +N+++     +   A +G+D+
Sbjct  71    ADKATPKTVMKLMGIPGLTLYHLKSHLQKYRLSKNLHGQSNNNNVTHKITDTHATSGTDE  130

Query  1251  --IPEANGNHINS-ANIGPLANT-NLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQG  1084
               + E NG H+N    +GP  N  ++ ISEA+Q+QIEVQRRL+EQLEVQRHLQLRIEAQG
Sbjct  131   RSLSETNGTHMNKLITLGPQTNNKDIHISEALQMQIEVQRRLNEQLEVQRHLQLRIEAQG  190

Query  1083  KYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGF----  916
             KYLQ+VLEKAQETLGRQ+LG +GLEAAK QLSELVSKVS+Q LNSAFS +KEL GF    
Sbjct  191   KYLQSVLEKAQETLGRQNLGIVGLEAAKVQLSELVSKVSSQSLNSAFSEMKELQGFNNPQ  250

Query  915   CQQQAQATQPTDCSLD-SCLTSSEGSLRDHE---MRNSQMGLRSLNFGA---HMESTDL-  760
              Q Q    QP DCS+D SCLTSS+ S ++ +         GLR  N       ME  +L 
Sbjct  251   QQTQITTNQPNDCSMDSSCLTSSDRSQKEQQEIIQNGGGFGLRHFNNNNNHLFMERKELQ  310

Query  759   -YNETRLKQTE-FRWCDDIWENRKYLSKMDEETKNNGLSVSTGLQGGKWNGNSNYSDRRF  586
                ET ++ +E  +WC D       + K      +  LS+S G++      +S+   +R 
Sbjct  311   QVTETNIRNSEVLKWCSD------EVKKNTSTNFHGNLSMSIGVE-----SHSDGEFQRT  359

Query  585   TGTDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLN  406
             + TD  +KL   A+D        K + S  Y   +   +LDLN+  + D    CKQLDLN
Sbjct  360   SRTDQTMKL---AMD------DHKMQPSNSY---FSTSRLDLNS--RGDNNEGCKQLDLN  405

Query  405   GFSWN  391
              FSWN
Sbjct  406   RFSWN  410



>ref|XP_010931456.1| PREDICTED: uncharacterized protein LOC105052369 [Elaeis guineensis]
Length=425

 Score =   361 bits (926),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 205/429 (48%), Positives = 265/429 (62%), Gaps = 14/429 (3%)
 Frame = -2

Query  1650  SITDSNMYHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDL  1471
             SI    MY  H QGK    S+    PPERHLF+QG N  G+SGL+LSTDAKPRLKWT +L
Sbjct  2     SIHQQEMYRQH-QGKHDLFSSRAAFPPERHLFLQGGNSPGNSGLILSTDAKPRLKWTPEL  60

Query  1470  HERFVEAVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKA  1291
             H+RF+EAVNQLGGADKATPK+V+K MGI GLTLYHLKSHLQKYRLSKNL    N+ S   
Sbjct  61    HQRFIEAVNQLGGADKATPKTVMKLMGIPGLTLYHLKSHLQKYRLSKNLQAQVNTGSINN  120

Query  1290  MSSGMDAATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRH  1111
             ++  M AA   D+    +G+ ++  NI   +N  + IS+A+Q+ IE QR+LHEQLEVQRH
Sbjct  121   VTGSMIAA---DRTSGVSGSLMDDTNIVSHSNKTMQISKALQMNIEAQRQLHEQLEVQRH  177

Query  1110  LQLRIEAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIK  931
             LQLRIEAQGKYLQ+VLEKAQETLG+Q +  +GLEAAK QLSELVSKVS +C  +AF  +K
Sbjct  178   LQLRIEAQGKYLQSVLEKAQETLGKQSMDSVGLEAAKVQLSELVSKVSKECFGTAFQSLK  237

Query  930   ELPGFCQQQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNE  751
             E       Q Q TQ  D S D CL S E   +D E  N  +GLR+    +   +  L  +
Sbjct  238   ESSSLHTLQGQTTQFADYSGDGCLISCEEFQKDQETHNVCVGLRTCPSNSLPCTQQLGKD  297

Query  750   TRLKQTEFRWCDDIWEN---------RKYLSKMDEETKNNGLSVSTGLQGGKWNGNSNYS  598
             + L+QT F W  ++ ++         +  +S +  + ++N +S +  +QG      S + 
Sbjct  298   STLEQTRFAWGGNVNQHSLLHSSTVKKSEMSIVPVDGESNIVSKNIKVQGENRCSISIFE  357

Query  597   DRRFTGTDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQ  418
              RR  G D           +      E++K   E+ LP    +LDLN+ D  D    C+Q
Sbjct  358   ARR-KGIDGYDSYLELPNCKKAAVMQEREKQLNEFALPCLTSQLDLNSHDHNDPPPGCRQ  416

Query  417   LDLNGFSWN  391
              DLNGFSW+
Sbjct  417   FDLNGFSWS  425



>gb|KDO55098.1| hypothetical protein CISIN_1g013552mg [Citrus sinensis]
Length=324

 Score =   357 bits (916),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 193/339 (57%), Positives = 233/339 (69%), Gaps = 16/339 (5%)
 Frame = -2

Query  1404  LKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDAATGSDKIPEANGNHI  1225
             +K MGI GLTLYHLKSHLQKYRLSKNLHG AN  +NK    G     G +++PEAN  H+
Sbjct  1     MKLMGIPGLTLYHLKSHLQKYRLSKNLHGQANIGNNKI---GPVTVPG-ERMPEANATHM  56

Query  1224  NSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVLEKAQET  1045
             N+ +IGP  N +L ISE IQ+QIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVLEKAQET
Sbjct  57    NNLSIGPQPNKSLHISETIQMQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVLEKAQET  116

Query  1044  LGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFCQQQAQATQPTDCSLDS  865
             LGRQ+LG  GLEAAK QLSELVSKVS QCLNS FS +KEL GFC QQ QA QPTDCS+DS
Sbjct  117   LGRQNLGTAGLEAAKVQLSELVSKVSTQCLNSTFSDLKELQGFCPQQPQANQPTDCSMDS  176

Query  864   CLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQTEFRWCDDIWENRKYLS  685
             CLTS EGS +D E+ N  + LR  +    +E  ++  E  L+QTE +W  D+ E+ K+LS
Sbjct  177   CLTSCEGSQKDQEIHNGGVRLRPYHGTPTLEPKEIVEEPMLQQTELKWRKDLKES-KFLS  235

Query  684   KMDEETKNNGLSVSTGLQGGKWNGNSNYSDRRFTGTDADVKLFAQAVDRSDTSKPEKQKT  505
              + ++     LS+ +G          ++   RF  ++ D     Q   + + +K E +  
Sbjct  236   SIGKDRGPGELSIGSG----------SFPAGRFKASNEDEHFQDQTNKKPEGAKLENENL  285

Query  504   SQEYKLPYFGPKLDLNT-DDKTDVASSCKQLDLNGFSWN  391
               EY+LP F  KLDLN  D + DVAS CKQ DLNGFSWN
Sbjct  286   LPEYRLPCFSTKLDLNAHDHENDVASGCKQFDLNGFSWN  324



>ref|XP_004487498.1| PREDICTED: uncharacterized protein LOC101506129 isoform X2 [Cicer 
arietinum]
Length=409

 Score =   359 bits (922),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 226/425 (53%), Positives = 280/425 (66%), Gaps = 44/425 (10%)
 Frame = -2

Query  1611  GKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEAVNQLGG  1432
             GK++H S+ M +P ERH+F+Q  NG  DSGLVLSTDAKPRLKWT DLH RF+EAVNQLGG
Sbjct  11    GKNIHSSSRMSIPSERHMFLQTGNGSSDSGLVLSTDAKPRLKWTPDLHARFIEAVNQLGG  70

Query  1431  ADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDAATGSDK  1252
             ADKATPK+V+K MGI GLTLYHLKSHLQKYRLSKNLHG +N ++N        A +G+D+
Sbjct  71    ADKATPKTVMKLMGIPGLTLYHLKSHLQKYRLSKNLHGQSN-NNNVTHKINTHATSGTDE  129

Query  1251  --IPEANGNHINS-ANIGPLANT-NLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQG  1084
               + E NG H+N    +GP  N  ++ ISEA+Q+QIEVQRRL+EQLEVQRHLQLRIEAQG
Sbjct  130   RSLSETNGTHMNKLITLGPQTNNKDIHISEALQMQIEVQRRLNEQLEVQRHLQLRIEAQG  189

Query  1083  KYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGF----  916
             KYLQ+VLEKAQETLGRQ+LG +GLEAAK QLSELVSKVS+Q LNSAFS +KEL GF    
Sbjct  190   KYLQSVLEKAQETLGRQNLGIVGLEAAKVQLSELVSKVSSQSLNSAFSEMKELQGFNNPQ  249

Query  915   CQQQAQATQPTDCSLD-SCLTSSEGSLRDHE---MRNSQMGLRSLNFGA---HMESTDL-  760
              Q Q    QP DCS+D SCLTSS+ S ++ +         GLR  N       ME  +L 
Sbjct  250   QQTQITTNQPNDCSMDSSCLTSSDRSQKEQQEIIQNGGGFGLRHFNNNNNHLFMERKELQ  309

Query  759   -YNETRLKQTE-FRWCDDIWENRKYLSKMDEETKNNGLSVSTGLQGGKWNGNSNYSDRRF  586
                ET ++ +E  +WC D       + K      +  LS+S G++      +S+   +R 
Sbjct  310   QVTETNIRNSEVLKWCSD------EVKKNTSTNFHGNLSMSIGVE-----SHSDGEFQRT  358

Query  585   TGTDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLN  406
             + TD  +KL   A+D        K + S  Y   +   +LDLN+  + D    CKQLDLN
Sbjct  359   SRTDQTMKL---AMD------DHKMQPSNSY---FSTSRLDLNS--RGDNNEGCKQLDLN  404

Query  405   GFSWN  391
              FSWN
Sbjct  405   RFSWN  409



>ref|XP_009102100.1| PREDICTED: uncharacterized protein LOC103828237 [Brassica rapa]
Length=394

 Score =   358 bits (919),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 223/427 (52%), Positives = 276/427 (65%), Gaps = 49/427 (11%)
 Frame = -2

Query  1629  YHHHRQGKSMHPSTNMLMPPERH-LFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVE  1453
             Y +  QGKS+  S+ M +P ERH  F++G N  G SGL+LSTDAKPRLKWT DLHERF+E
Sbjct  3     YQNQHQGKSILSSSRMHLPSERHHQFLRGGNSLGGSGLILSTDAKPRLKWTPDLHERFIE  62

Query  1452  AVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNK-AMSSGM  1276
             AVNQLGGADKATPK+++K MGI GLTLYHLKSHLQKYRLSKNL+G ANS  NK  M + M
Sbjct  63    AVNQLGGADKATPKTIMKVMGIPGLTLYHLKSHLQKYRLSKNLNGQANSGLNKIGMMTMM  122

Query  1275  DAATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRI  1096
             +     +K P+A+     + +IGP  N N PISEA+ +QIEVQRRLHEQLEVQRHLQL+I
Sbjct  123   E-----EKSPDADEIQSETLSIGPQPNKNSPISEALHMQIEVQRRLHEQLEVQRHLQLKI  177

Query  1095  EAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGF  916
             EAQGKYLQ+VLEKAQETLG+Q+LG+ GLEAAK  LSE VSKVS +  N++F   KE    
Sbjct  178   EAQGKYLQSVLEKAQETLGKQNLGEAGLEAAKVHLSEFVSKVSAEYPNTSFLEQKEFRNL  237

Query  915   CQQQAQATQPTDCSLDSCLTSSEGSLRDHE-MRNSQMGLRSLNFGAHMESTDLYNETRLK  739
             C QQ    QP DCSL+SCLTSSEG+ ++ + + N+++GLR+   G   +ST    E   K
Sbjct  238   CTQQM---QPPDCSLESCLTSSEGAQKNPKTLENNRLGLRTY-LG---DSTSEQKEPMFK  290

Query  738   QTEFRWCDDIWENRKYLSKM--DEETK-------NNGLSVSTGLQG--GKWNGNSNYSDR  592
             + E  W + +  N  YLS M  D E +        + LS+  G+ G  G   GN+ + D 
Sbjct  291   RMELTWTEGLRGN-PYLSTMVSDAEQRVSYSDRSPDRLSIGVGMHGHRGHQQGNNKFKDE  349

Query  591   RFTGTDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLD  412
             RF              D+ +  K E Q T+ E         LDLNT       +  KQLD
Sbjct  350   RFN-------------DKGEDHKLETQGTTTE---------LDLNTQVDNYCTTRPKQLD  387

Query  411   LNGFSWN  391
             LNGFSWN
Sbjct  388   LNGFSWN  394



>ref|XP_010454050.1| PREDICTED: uncharacterized protein LOC104735880 isoform X2 [Camelina 
sativa]
Length=402

 Score =   358 bits (919),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 221/436 (51%), Positives = 276/436 (63%), Gaps = 59/436 (14%)
 Frame = -2

Query  1629  YHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEA  1450
             YH+  QGKS+  S+ M +P ERH F++G NG GDSGL+LSTDAKPRLKWT DLHERFVEA
Sbjct  3     YHNQHQGKSILSSSRMPIPSERHPFLRG-NGTGDSGLILSTDAKPRLKWTPDLHERFVEA  61

Query  1449  VNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDA  1270
             VNQLGG DKATPK+++K MGI GLTLYHLKSHLQKYRLSKNL+G ANSS NK     M  
Sbjct  62    VNQLGGGDKATPKTIMKVMGIPGLTLYHLKSHLQKYRLSKNLNGQANSSLNKTSVMTMV-  120

Query  1269  ATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEA  1090
                 + +PEA  +H  S +IGP  + NLPIS+A+Q+QIEVQRRLHEQLE      LRIEA
Sbjct  121   ---EENLPEAEESHSESLSIGPQPSMNLPISDALQMQIEVQRRLHEQLE------LRIEA  171

Query  1089  QGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGF-C  913
             QGKYLQ++LEKAQETLGRQ+LG  G+EA KAQLSELVSKVS +  +S+F   KE+     
Sbjct  172   QGKYLQSILEKAQETLGRQNLGAAGIEATKAQLSELVSKVSAEYPDSSFLEPKEVQKLRH  231

Query  912   QQQAQATQ-PTDCSLDSCLTSSEGSLRDHEM-RNSQMGLRSLNFGAHMESTDLYNETRLK  739
             QQQ Q T  P + SLDSCLTSSEG+ +  +M  N+++GLR+    +  E  ++  E    
Sbjct  232   QQQMQTTNYPPNSSLDSCLTSSEGTQKAPKMLENNRLGLRTYIGDSTSEQKEVMEEPFFH  291

Query  738   QTEFRWCDD--IWEN----RKYLSKM---DEETKNNG-------LSVSTGLQ----GGKW  619
             + E  W ++  I EN    + Y+S M   + E + +        LS+  GLQ    GG  
Sbjct  292   RMELTWAEEESIRENNNRPQPYISTMVNSNAEARISSSRRSPGRLSIGVGLQHEHRGGSS  351

Query  618   NGNSNYSDRRFTGTDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTD  439
             N NS Y+  RF       K+                +T+           LDLNT D+ +
Sbjct  352   N-NSEYTQERFNENGEGCKMETHT------------RTT-----------LDLNTHDE-N  386

Query  438   VASSCKQLDLNGFSWN  391
               ++ KQ DLNGFSWN
Sbjct  387   YGTTTKQFDLNGFSWN  402



>ref|XP_009120997.1| PREDICTED: myb family transcription factor APL isoform X3 [Brassica 
rapa]
Length=386

 Score =   357 bits (917),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 212/424 (50%), Positives = 271/424 (64%), Gaps = 51/424 (12%)
 Frame = -2

Query  1629  YHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEA  1450
             YH+  QGKS+  S+ M +P ERH F++G NG GDSGL+LSTDAKPRLKWT DLHERFVEA
Sbjct  3     YHNQHQGKSLLSSSRMPIPSERHPFLRG-NGPGDSGLILSTDAKPRLKWTPDLHERFVEA  61

Query  1449  VNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDA  1270
             VNQLGG +KATPK+++K MGI GLTLYHLKSHLQKYRLSKNL+G ANSS NK     M  
Sbjct  62    VNQLGGGEKATPKTIMKVMGIPGLTLYHLKSHLQKYRLSKNLNGQANSSLNKTSVMTMV-  120

Query  1269  ATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEA  1090
                 +  PEA+ +H  S +IGP  + NLPIS+A+Q+QIEVQRRLHEQLE      LRIEA
Sbjct  121   ---EENTPEADESHSESLSIGPQPSMNLPISDALQMQIEVQRRLHEQLE------LRIEA  171

Query  1089  QGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFCQ  910
             QGKYLQA+LEKAQETLGRQ+LG  G+EA KAQLSELVSKVS++  +++F  ++ L    Q
Sbjct  172   QGKYLQAILEKAQETLGRQNLGPAGIEATKAQLSELVSKVSSEYPDASFLELQNL--HHQ  229

Query  909   QQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQTE  730
             Q   A  P + SL+SCLTSSEG+ +  +M  +++GLR+    +  E  ++  E    + E
Sbjct  230   QMQTAYPPQNSSLESCLTSSEGNQKAPKMLENRLGLRTYLGDSSSEQKEIMEEPFFHRME  289

Query  729   FRWCDD-----IWE-NRKYLSKMDEETKNN-----GLSVSTGLQGGKWNGNSNYSDRRFT  583
               W ++     I E NR YLS M+    ++      LS+  GLQ  +      Y++ R+ 
Sbjct  290   LTWAEEEEEEGIRENNRPYLSAMEPRNSSSRRSPGRLSIGVGLQEHR----GGYTEERYR  345

Query  582   GTDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNG  403
                 D K+      R+ T+                   LDLNT D+T   +  KQ DLNG
Sbjct  346   ENGEDCKVET----RTSTA-------------------LDLNTHDETYGTTRPKQFDLNG  382

Query  402   FSWN  391
             FSW+
Sbjct  383   FSWS  386



>ref|XP_010420570.1| PREDICTED: uncharacterized protein LOC104706130 isoform X3 [Camelina 
sativa]
Length=402

 Score =   358 bits (918),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 221/439 (50%), Positives = 270/439 (62%), Gaps = 65/439 (15%)
 Frame = -2

Query  1629  YHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEA  1450
             YH+  QGKS+  S+ M +P ERH F++G NG GDSGL+LSTDAKPRLKWT DLHERFVEA
Sbjct  3     YHNQHQGKSILSSSRMPIPSERHPFLRG-NGTGDSGLILSTDAKPRLKWTPDLHERFVEA  61

Query  1449  VNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDA  1270
             VNQLGG DKATPK+++K MGI GLTLYHLKSHLQKYRLSKN +G ANS  NK     M  
Sbjct  62    VNQLGGGDKATPKTIMKVMGIPGLTLYHLKSHLQKYRLSKNPNGQANSGLNKTSVMTMV-  120

Query  1269  ATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEA  1090
                 + +PEA  +H  S +IGP  + NLPIS+A+Q+QIEVQRRLHEQLE      LRIEA
Sbjct  121   ---EENLPEAEESHSESLSIGPQPSMNLPISDALQMQIEVQRRLHEQLE------LRIEA  171

Query  1089  QGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGF-C  913
             QGKYLQ++LEKAQETLGRQ+LG  G+EA KAQLSELVSKVS +  +S+F   KE+     
Sbjct  172   QGKYLQSILEKAQETLGRQNLGAAGIEATKAQLSELVSKVSAEYPDSSFLEPKEVQKLRH  231

Query  912   QQQAQATQPTDCSLDSCLTSSEGSLRDHEM-RNSQMGLRSLNFGAHMESTDLYNETRLKQ  736
             QQQ Q T P + SLDSCLTSSEG+ +  +M  N+++GLR+    +  E  ++  E    +
Sbjct  232   QQQMQTTYPPNSSLDSCLTSSEGTQKAPKMLENNRLGLRTYIGDSTSEQKEVMEEPFFHR  291

Query  735   TEFRWCDD--IWENR----KYLSKMDEETKNNG-------------LSVSTGLQ----GG  625
              E  W ++  I EN      Y+S M     NNG             LS+  GLQ    GG
Sbjct  292   MELTWAEEESIRENNNRPPPYISTM----VNNGEARVLSSRRSPGRLSIGVGLQHEHRGG  347

Query  624   KWNGNSNYSDRRFTGTDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNT-DD  448
               N NS Y+  RF       K+                +T+           LDLNT D+
Sbjct  348   SSN-NSEYTQERFNENGEGCKMETHT------------RTT-----------LDLNTHDE  383

Query  447   KTDVASSCKQLDLNGFSWN  391
                  +  KQ DLNGFSWN
Sbjct  384   NYGTTTRTKQFDLNGFSWN  402



>ref|XP_010463876.1| PREDICTED: uncharacterized protein LOC104744509 isoform X2 [Camelina 
sativa]
Length=403

 Score =   357 bits (916),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 216/431 (50%), Positives = 270/431 (63%), Gaps = 48/431 (11%)
 Frame = -2

Query  1629  YHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEA  1450
             Y +  QGK++  S+ M +  ER+ F++G N  G+SGL+LSTDAKPRLKWT DLHERF+EA
Sbjct  3     YQNQHQGKNILSSSRMHITTERNPFLRG-NSPGESGLILSTDAKPRLKWTPDLHERFIEA  61

Query  1449  VNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNK-AMSSGMD  1273
             VNQLGGADKATPK+++K MGI GLTLYHLKSHLQKYRLSKNL+G ANS  NK  M + M+
Sbjct  62    VNQLGGADKATPKTIMKVMGIPGLTLYHLKSHLQKYRLSKNLNGQANSGLNKIGMMTMME  121

Query  1272  AATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIE  1093
                  +K P+ +     + +IGP  N N PISEA+Q+QIEVQRRLHEQLE      LRIE
Sbjct  122   -----EKTPDVDEIQSENLSIGPQPNMNSPISEALQMQIEVQRRLHEQLE------LRIE  170

Query  1092  AQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFC  913
             AQGKYLQ+VLEKAQETLGRQ+LG  G+EAAK QLSELVSKVS +  NS+F   KEL   C
Sbjct  171   AQGKYLQSVLEKAQETLGRQNLGAAGIEAAKVQLSELVSKVSAEYPNSSFLEPKELQNLC  230

Query  912   QQQAQATQ-PTDCSLDSCLTSSEGSLRDHEMRNSQMGLRS-LNFGAHMESTDLYNETRLK  739
              QQ Q T  P DCSL+SCLTSSEG+ +   + N+++GLR+ L      +  ++  E   +
Sbjct  231   PQQIQTTTYPPDCSLESCLTSSEGTQKT--LENNRIGLRTYLGDSTSEQKENMEEEPLFQ  288

Query  738   QTEFRWCDDI-WENRKYLSKMDEETKNN---------GLSVSTGLQGGKWN----GNSNY  601
             + E  W + +   N  YLS M  ET+            LS+  GLQG K +    GN+ Y
Sbjct  289   RMELTWTEGLRGNNNPYLSTMVSETEQRIPYSERSPGRLSIGVGLQGHKGHHHQQGNNEY  348

Query  600   SDRRFTGTDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTD-DKTDVASSC  424
             ++ RF     D K   +   +   S  E                LDLNT  +     +  
Sbjct  349   TEERFKDKSEDHKFETRNHRKGTDSATE----------------LDLNTHVESYSTTTRT  392

Query  423   KQLDLNGFSWN  391
             KQ DLNGFSWN
Sbjct  393   KQFDLNGFSWN  403



>ref|XP_006408230.1| hypothetical protein EUTSA_v10020861mg [Eutrema salsugineum]
 gb|ESQ49683.1| hypothetical protein EUTSA_v10020861mg [Eutrema salsugineum]
Length=401

 Score =   357 bits (915),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 219/434 (50%), Positives = 266/434 (61%), Gaps = 56/434 (13%)
 Frame = -2

Query  1629  YHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEA  1450
             Y +H QGK++  S+ M +  ERH F++G N  GDSGL+LSTDAKPRLKWT DLHERF+EA
Sbjct  3     YQNHHQGKNILSSSRMHLNSERHPFLRGGNSPGDSGLILSTDAKPRLKWTPDLHERFIEA  62

Query  1449  VNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDA  1270
             VNQLGGADKATPK+++K MGI GLTLYHLKSHLQKYRLSKNL+G ANS  NK     M  
Sbjct  63    VNQLGGADKATPKTIMKVMGIPGLTLYHLKSHLQKYRLSKNLNGQANSGLNKIGVMTM--  120

Query  1269  ATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEA  1090
                 +K P+A+     S +IGP  N N PISEA+Q+QIEVQRRLHEQLEVQRHLQLRIEA
Sbjct  121   --MEEKTPDADEIQSESLSIGPQPNKNSPISEALQMQIEVQRRLHEQLEVQRHLQLRIEA  178

Query  1089  QGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPG-FC  913
             QGKYLQ+VLEKAQETLGRQ+LG  GLEAAK Q+SELVSKVS    NS+    KEL    C
Sbjct  179   QGKYLQSVLEKAQETLGRQNLGAAGLEAAKVQISELVSKVSADYPNSSLLEPKELQNLLC  238

Query  912   QQQAQATQPTDCSLDSCLTSSEGSLRDHEMR------NSQMGLRSLNFGAHMESTDLYNE  751
              Q  Q +   DCSLDSCLTSSEG+   HE        N  +GLR+    +  E   +  E
Sbjct  239   AQHMQTSYRPDCSLDSCLTSSEGA---HEKNPKTLESNRSVGLRTYLGDSTSEQKVINEE  295

Query  750   TRLKQTEFRWCDDIWENRKYLSKM----------DEETKNNG-LSVSTGLQGGKWN---G  613
                ++ E  W   +  N  YLS M           E +++ G LS+  G+ G + +   G
Sbjct  296   PLFQRMELTWTQGLRGN-PYLSTMVSDAEQRISYSERSRSPGRLSIGVGMHGHRGHHQQG  354

Query  612   NSNYSDRRFTGTDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVA  433
             N+                  +  D S+  K E +  + E         LDLNT+ +    
Sbjct  355   NN------------------ECKDESEDHKLETRSKTTE---------LDLNTNVENYCT  387

Query  432   SSCKQLDLNGFSWN  391
             +  KQ DLNG SWN
Sbjct  388   THPKQFDLNGLSWN  401



>ref|NP_187053.2| myb family transcription factor [Arabidopsis thaliana]
 gb|AAL67103.1| AT3g04030/T11I18_14 [Arabidopsis thaliana]
 gb|AAN28854.1| At3g04030/T11I18_14 [Arabidopsis thaliana]
 gb|AEE74027.1| myb family transcription factor [Arabidopsis thaliana]
Length=388

 Score =   356 bits (913),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 211/424 (50%), Positives = 266/424 (63%), Gaps = 49/424 (12%)
 Frame = -2

Query  1629  YHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEA  1450
             Y +  QGK++  S+ M +  ERH F++G N  GDSGL+LSTDAKPRLKWT DLHERF+EA
Sbjct  3     YQNQHQGKNILSSSRMHITSERHPFLRG-NSPGDSGLILSTDAKPRLKWTPDLHERFIEA  61

Query  1449  VNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNK-AMSSGMD  1273
             VNQLGGADKATPK+++K MGI GLTLYHLKSHLQKYRLSKNL+G AN+S NK  + + M+
Sbjct  62    VNQLGGADKATPKTIMKVMGIPGLTLYHLKSHLQKYRLSKNLNGQANNSFNKIGIMTMME  121

Query  1272  AATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIE  1093
                  +K P+A+     + +IGP  N N PI EA+Q+QIEVQRRLHEQLE      LRIE
Sbjct  122   -----EKTPDADEIQSENLSIGPQPNKNSPIGEALQMQIEVQRRLHEQLE------LRIE  170

Query  1092  AQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFC  913
             AQGKYLQ+VLEKAQETLGRQ+LG  G+EAAK QLSELVSKVS +  NS+F   KEL   C
Sbjct  171   AQGKYLQSVLEKAQETLGRQNLGAAGIEAAKVQLSELVSKVSAEYPNSSFLEPKELQNLC  230

Query  912   QQQAQATQPTDCSLDSCLTSSEGSLRDHEM-RNSQMGLRSLNFGAHMESTDLYNETRLKQ  736
              QQ Q   P DCSL+SCLTSSEG+ ++ +M  N+++GLR+    +  E  ++  E   ++
Sbjct  231   SQQMQTNYPPDCSLESCLTSSEGTQKNSKMLENNRLGLRTYIGDSTSEQKEIMEEPLFQR  290

Query  735   TEFRWCDDIWENRKYLSKMDEETKNN---------GLSVSTGLQGGKWNGNSNYSDRRFT  583
              E  W + +  N  YLS M  E +            LS+  GL G K         +   
Sbjct  291   MELTWTEGLRGN-PYLSTMVSEAEQRISYSERSPGRLSIGVGLHGHK--------SQHQQ  341

Query  582   GTDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNG  403
             G + D KL  +     D++                  +LDLNT  +    +  KQ DLNG
Sbjct  342   GNNEDHKLETRNRKGMDSTT-----------------ELDLNTHVENYCTTRTKQFDLNG  384

Query  402   FSWN  391
             FSWN
Sbjct  385   FSWN  388



>ref|XP_009130414.1| PREDICTED: two-component response regulator ARR18 isoform X2 
[Brassica rapa]
Length=390

 Score =   355 bits (912),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 217/425 (51%), Positives = 266/425 (63%), Gaps = 49/425 (12%)
 Frame = -2

Query  1629  YHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEA  1450
             Y +  QGKS+  S+ M +  ERH F++G N  GDSGL+LSTDAKPRLKWT DLHERF+EA
Sbjct  3     YQNQHQGKSILSSSRMHLASERHPFLRGGNSPGDSGLILSTDAKPRLKWTPDLHERFIEA  62

Query  1449  VNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDA  1270
             VNQLGGADKATPK+++K MGI GLTLYHLKSHLQKYRLSKNL+G ANS  NK    GM  
Sbjct  63    VNQLGGADKATPKTIMKVMGIPGLTLYHLKSHLQKYRLSKNLNGQANSGLNKI---GMMT  119

Query  1269  ATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEA  1090
                 +K P+A+     S +IGP  N N PI EA+Q+QIEVQRRLHEQLE  RHLQLRIEA
Sbjct  120   MI-EEKSPDADEIQSESLSIGPQPNKNSPIGEALQMQIEVQRRLHEQLE--RHLQLRIEA  176

Query  1089  QGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFCQ  910
             QGKYLQ+VLEKAQETLGRQ+L   G+EAAK QLSELVSKVS +  N++F   KE    C 
Sbjct  177   QGKYLQSVLEKAQETLGRQNLSPAGIEAAKVQLSELVSKVSAEYPNTSFLDPKEFQNLCP  236

Query  909   QQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQTE  730
             QQ Q   P     DSCLTSSEG+ ++ +M    +GLR+    +  E  ++  E   ++ E
Sbjct  237   QQMQTAYPQ----DSCLTSSEGAQKNPKM----LGLRTYLGDSTSEQKEVIEEPLFQRME  288

Query  729   FRWCDDIWENRKYLSKM--DEETK-------NNGLSVSTGLQG--GKWNGNSNYS-DRRF  586
               W + +  N  YLS M  D E +        + L++  G+ G  G   G++ Y+ D RF
Sbjct  289   LTWNEGLRGN-PYLSTMVTDAEQRVSYSERSPSTLTMGVGMHGHRGHQQGSNEYNKDERF  347

Query  585   TGTDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLN  406
                           D+S+  K E Q T  E         LDLNT  +    +  KQ DLN
Sbjct  348   N-------------DKSEDHKLETQSTKTE---------LDLNTHVENCCTTRPKQFDLN  385

Query  405   GFSWN  391
             GFSWN
Sbjct  386   GFSWN  390



>emb|CDY50877.1| BnaA05g37380D [Brassica napus]
Length=381

 Score =   353 bits (907),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 214/417 (51%), Positives = 259/417 (62%), Gaps = 42/417 (10%)
 Frame = -2

Query  1629  YHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEA  1450
             Y +  QGKS+  S+ M +  ERH F++G N  GDSGL+LSTDAKPRLKWT DLHERF+EA
Sbjct  3     YQNQHQGKSILSSSRMHLASERHPFLRGGNSPGDSGLILSTDAKPRLKWTPDLHERFIEA  62

Query  1449  VNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDA  1270
             VNQLGGADKATPK+++K MGI GLTLYHLKSHLQKYRLSKNL+G ANS  NK    GM  
Sbjct  63    VNQLGGADKATPKTIMKVMGIPGLTLYHLKSHLQKYRLSKNLNGQANSGLNKI---GMMT  119

Query  1269  ATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEA  1090
                 +K P+A+     S +IGP  N N PI EA+Q+QIEVQRRLHEQLEVQRHLQLRIEA
Sbjct  120   MI-EEKSPDADEIQSESLSIGPQPNKNSPIGEALQMQIEVQRRLHEQLEVQRHLQLRIEA  178

Query  1089  QGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFCQ  910
             QGKYLQ+VLEKAQETLGRQ+L   G+EAAK QLSELVSKVS +  N++F   KE    C 
Sbjct  179   QGKYLQSVLEKAQETLGRQNLSPAGIEAAKVQLSELVSKVSAEYPNTSFLDPKEFQNLCP  238

Query  909   QQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQTE  730
             QQ Q   P     DSCLTSSEG+ ++ +M    +GLR+    +  E  ++  E   ++ E
Sbjct  239   QQMQTAYPQ----DSCLTSSEGAQKNPKM----LGLRTYLGDSTSEQKEVIEEPLFQRME  290

Query  729   FRWCDDIWENRKYLSKM----DEETKNNGLSVSTGLQGGKWNGNSNYSDRRFTGTDADVK  562
               W + +  N  YLS M    ++    +  S ST   G   +G+  +        D D K
Sbjct  291   LTWNEGLRGN-PYLSTMVTDAEQRVSYSERSPSTLTMGVGMHGHRGHQQ---GSNDEDHK  346

Query  561   LFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNGFSWN  391
             L             E Q T  E         LDLNT  +    +  KQ DLNGFSWN
Sbjct  347   L-------------ETQSTKTE---------LDLNTHVENCCTTRPKQFDLNGFSWN  381



>ref|XP_006829830.1| hypothetical protein AMTR_s00119p00095480 [Amborella trichopoda]
 gb|ERM97246.1| hypothetical protein AMTR_s00119p00095480 [Amborella trichopoda]
Length=412

 Score =   353 bits (907),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 210/429 (49%), Positives = 263/429 (61%), Gaps = 32/429 (7%)
 Frame = -2

Query  1632  MYHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVE  1453
             MY+   QGK+   S+   MPPER L + G N  GD GLVLSTDAKPRLKWT +LHERFVE
Sbjct  1     MYY---QGKNCFSSSRATMPPERPLLLHGANIQGDPGLVLSTDAKPRLKWTPELHERFVE  57

Query  1452  AVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMD  1273
             AV QLGGADKATPK+V++ MGI GLTLYHLKSHLQKYRLSKNL   +N S          
Sbjct  58    AVAQLGGADKATPKNVMRVMGIPGLTLYHLKSHLQKYRLSKNLRSQSNGSDKNG------  111

Query  1272  AATGSDKIPEANGNHINSANIGPLANTN--LPISEAIQIQIEVQRRLHEQLEVQRHLQLR  1099
              A  ++++   NG H+  AN+  ++ TN  L I+EA+Q+ IEVQRRLHEQLEVQRHLQLR
Sbjct  112   PAAAAERMSHTNGPHMGMANMA-VSGTNKGLQINEALQMHIEVQRRLHEQLEVQRHLQLR  170

Query  1098  IEAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPG  919
             IEAQGKYLQ+VLEKAQETL +Q+ G  GLEA +AQ+SELVS+VS +CLNSAFSG+ E P 
Sbjct  171   IEAQGKYLQSVLEKAQETLAKQNPGSSGLEATRAQISELVSQVSAECLNSAFSGLTEAPS  230

Query  918   FCQQQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMES----TDLYNE  751
                QQAQ +   DCS+DSCLTS EG  +D E +N  +GL     G H  S         E
Sbjct  231   LNNQQAQKSHLADCSMDSCLTSCEGPQKDQETQNISIGL-----GYHSNSLLWQKAEREE  285

Query  750   TRLKQTEFRWCDDIWENRKYLS----KMDEETKNNGLSVSTGLQGGKWNGNSNYSDRR--  589
              R+++      + + + + Y      KM   T + G +++     G     S  SD R  
Sbjct  286   FRVQRPNHSTGESLKDTKHYSPSPERKMHLLTSSFGDTINNVRAPGDKGACSTNSDARRK  345

Query  588   ---FTGTDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQ  418
                F G   +         R  T   + ++T    +L      LDLN  D+ D +S CK+
Sbjct  346   ERGFEGACGEPPRKRSVASR--TQALDIEQTEVFDRLSNHTAVLDLNAHDENDASSECKE  403

Query  417   LDLNGFSWN  391
              DLNGFSW+
Sbjct  404   FDLNGFSWS  412



>ref|XP_010517842.1| PREDICTED: uncharacterized protein LOC104793136 isoform X2 [Camelina 
sativa]
Length=401

 Score =   352 bits (902),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 217/430 (50%), Positives = 271/430 (63%), Gaps = 48/430 (11%)
 Frame = -2

Query  1629  YHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEA  1450
             Y +  QGK++  S+ M +  ER+ F++G N  G+SGL+LSTDAKPRLKWT DLHERF+EA
Sbjct  3     YQNQHQGKNILSSSRMHITTERNPFLRG-NSPGESGLILSTDAKPRLKWTPDLHERFIEA  61

Query  1449  VNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNK-AMSSGMD  1273
             VNQLGGADKATPK+++K MGI GLTLYHLKSHLQKYRLSKNL+G ANS  NK  M + M+
Sbjct  62    VNQLGGADKATPKTIMKVMGIPGLTLYHLKSHLQKYRLSKNLNGQANSGLNKIGMMTMME  121

Query  1272  AATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIE  1093
                  +K P+ +     + +IGP  N N PISEA+Q+QIEVQRRLHEQLE      LRIE
Sbjct  122   -----EKTPDVDEIQSENLSIGPQPNMNSPISEALQMQIEVQRRLHEQLE------LRIE  170

Query  1092  AQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFC  913
             AQGKYLQ+VLEKAQETLGRQ+LG  G+EAAK QLSELVSKVS +  NS+F   KEL    
Sbjct  171   AQGKYLQSVLEKAQETLGRQNLGAAGIEAAKVQLSELVSKVSAEYPNSSFLEPKELQNLR  230

Query  912   QQQAQATQ-PTDCSLDSCLTSSEGSLRDHEMRNSQMGLRS-LNFGAHMESTDLYNETRLK  739
              QQ Q T  P DCSL+SCLTSSEG+ +   + N+++GLR+ L      +  ++  E   +
Sbjct  231   PQQIQTTTYPPDCSLESCLTSSEGTQKT--LENNRIGLRTYLGDSTSEQKENMEEEPLFQ  288

Query  738   QTEFRWCDDIWENRKYLSKMDEETKNN---------GLSVSTGLQGGKWN----GNSNYS  598
             + E  W + +  N  YLS M  ET+            LS+  GLQG K +    GN+ Y+
Sbjct  289   RMELTWREGLRGN-PYLSTMVSETEQRISYSERSPGRLSIGVGLQGHKGHHHQQGNNEYT  347

Query  597   DRRFTGTDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTD-DKTDVASSCK  421
             D RF                 D S+  K +T    K      +LDLNT  +     +  K
Sbjct  348   DERF----------------KDKSEDHKFETRNHRKGMDSATELDLNTHVESYSTTTRTK  391

Query  420   QLDLNGFSWN  391
             Q DLNGFSWN
Sbjct  392   QFDLNGFSWN  401



>ref|XP_009406834.1| PREDICTED: uncharacterized protein LOC103989646 isoform X2 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009406835.1| PREDICTED: uncharacterized protein LOC103989646 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=417

 Score =   348 bits (893),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 201/424 (47%), Positives = 261/424 (62%), Gaps = 17/424 (4%)
 Frame = -2

Query  1632  MYHHH-RQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFV  1456
             M+ H   QG +   S     P ER LF+Q  N  G+ GLVLSTDAKPRLKW  +LHERFV
Sbjct  1     MFQHQPHQGHNNLLSPRTTFPSERQLFLQRGNTTGEPGLVLSTDAKPRLKWNPELHERFV  60

Query  1455  EAVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGM  1276
             EAVNQLGGADKATPK++++ MGI GLTLYHLKSHLQKYRL KNL    N+ S K +   +
Sbjct  61    EAVNQLGGADKATPKTIMRLMGIPGLTLYHLKSHLQKYRLGKNLLAQTNTGSTKNV---I  117

Query  1275  DAATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRI  1096
                  ++K  E NG+   S NI    N  + I+EA+Q+QIEVQR+LHEQLEVQRHLQL+I
Sbjct  118   GCTLAAEKTSEGNGS---SMNIAAPTNKTMQINEALQMQIEVQRQLHEQLEVQRHLQLQI  174

Query  1095  EAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGF  916
             EAQGKYLQ+VLEKAQETLG+Q+LG  GLE AK QLSELVSKVS +C +  F G++E P  
Sbjct  175   EAQGKYLQSVLEKAQETLGKQNLGSAGLEVAKFQLSELVSKVSGECFSDPFPGLEENPRL  234

Query  915   CQQQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQ  736
                Q    Q  DCS+DSCLTSSEGS ++ +   + MGLR  +    +        TRL+Q
Sbjct  235   HMFQLNPAQLADCSVDSCLTSSEGSQKEQDTHAAIMGLRVSHQDFPLYVKQFGEHTRLEQ  294

Query  735   TEFRWCDDIWENRKYLSKMDEETKN---------NGLSVSTGLQGGKWNGNSNYSDRRFT  583
             T+  W  D+ +   + S +  +++          N +  S   Q    +  +    R+  
Sbjct  295   TQNAWHGDLSKQTTFTSSILRDSQRASFPIQRDLNIIQASVKPQREIRDSGTVPEARKKD  354

Query  582   GTDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNG  403
               D D+ L   +  R+   K E +K +  ++LP     L+L   + ++ ASSCK+ DLNG
Sbjct  355   RDDEDMFLEHTSSKRAAV-KQESRKQTDGFELPCLTTDLELKIHEGSEGASSCKKFDLNG  413

Query  402   FSWN  391
             FSWN
Sbjct  414   FSWN  417



>dbj|BAJ34163.1| unnamed protein product [Thellungiella halophila]
Length=393

 Score =   345 bits (886),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 214/430 (50%), Positives = 264/430 (61%), Gaps = 56/430 (13%)
 Frame = -2

Query  1629  YHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEA  1450
             YH+  QGKS+  S+ M +  ERH F++G N  GDSGL+LSTDAKPRLKWT DLHERFVEA
Sbjct  3     YHNQHQGKSILSSSRMPISSERHPFLRG-NDTGDSGLILSTDAKPRLKWTPDLHERFVEA  61

Query  1449  VNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDA  1270
             VNQLGG DKATPK+++K MGI GLTLYHLKSHLQKYRLSKNL+G ANSS NK     M  
Sbjct  62    VNQLGGGDKATPKTIMKVMGIPGLTLYHLKSHLQKYRLSKNLNGQANSSLNKTSVMTMV-  120

Query  1269  ATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEA  1090
                 +  PEA+ +H  S +IGP  + NLPIS+A+Q+QIEVQRRLHEQLE      LRIEA
Sbjct  121   ---EENTPEADESHGESLSIGPQPSINLPISDALQMQIEVQRRLHEQLE------LRIEA  171

Query  1089  QGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFCQ  910
             QGKYLQA+L KAQETLGRQ+LG    EA KAQLSELVSK S +  +++F   K++     
Sbjct  172   QGKYLQAILLKAQETLGRQNLGP---EATKAQLSELVSKASAEYPDTSFLEPKQVQTLGH  228

Query  909   QQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQTE  730
             QQ Q T P + SL+SCLTSSEG+L+  +M  + +GLR+    +  E  ++  E   ++ E
Sbjct  229   QQMQTTYPQNSSLESCLTSSEGALKPPKMLENGLGLRTYIGDSTSEQKEIMEEPFFQRME  288

Query  729   FRWCDDIWENRKYLSKMDEETKNNG--------------LSVSTGLQ---GGKWNGNSNY  601
               W ++   NR YLS +     NN               LS+  GL     G  +GNS Y
Sbjct  289   LTWGEEEGHNRSYLSTIGH--NNNAEQRTLSSRRRSPGRLSIGVGLHEQNRGGGSGNSGY  346

Query  600   SDRRFTGTDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCK  421
             ++ RF     D KL      R+ T+                   LDLNT D     +  K
Sbjct  347   TEERFNENGEDCKLET----RTRTA-------------------LDLNTHDDNYGTTRPK  383

Query  420   QLDLNGFSWN  391
             Q DLNGFSWN
Sbjct  384   QFDLNGFSWN  393



>ref|XP_009130415.1| PREDICTED: uncharacterized protein LOC103855210 isoform X3 [Brassica 
rapa]
Length=386

 Score =   345 bits (885),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 213/425 (50%), Positives = 262/425 (62%), Gaps = 53/425 (12%)
 Frame = -2

Query  1629  YHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEA  1450
             Y +  QGKS+  S+ M +  ERH F++G N  GDSGL+LSTDAKPRLKWT DLHERF+EA
Sbjct  3     YQNQHQGKSILSSSRMHLASERHPFLRGGNSPGDSGLILSTDAKPRLKWTPDLHERFIEA  62

Query  1449  VNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDA  1270
             VNQLGGADKATPK+++K MGI GLTLYHLKSHLQKYRLSKNL+G ANS  NK    GM  
Sbjct  63    VNQLGGADKATPKTIMKVMGIPGLTLYHLKSHLQKYRLSKNLNGQANSGLNKI---GMMT  119

Query  1269  ATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEA  1090
                 +K P+A+     S +IGP  N N PI EA+Q+QIEVQRRLHEQLE      LRIEA
Sbjct  120   MI-EEKSPDADEIQSESLSIGPQPNKNSPIGEALQMQIEVQRRLHEQLE------LRIEA  172

Query  1089  QGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFCQ  910
             QGKYLQ+VLEKAQETLGRQ+L   G+EAAK QLSELVSKVS +  N++F   KE    C 
Sbjct  173   QGKYLQSVLEKAQETLGRQNLSPAGIEAAKVQLSELVSKVSAEYPNTSFLDPKEFQNLCP  232

Query  909   QQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQTE  730
             QQ Q   P     DSCLTSSEG+ ++ +M    +GLR+    +  E  ++  E   ++ E
Sbjct  233   QQMQTAYPQ----DSCLTSSEGAQKNPKM----LGLRTYLGDSTSEQKEVIEEPLFQRME  284

Query  729   FRWCDDIWENRKYLSKM--DEETK-------NNGLSVSTGLQG--GKWNGNSNYS-DRRF  586
               W + +  N  YLS M  D E +        + L++  G+ G  G   G++ Y+ D RF
Sbjct  285   LTWNEGLRGN-PYLSTMVTDAEQRVSYSERSPSTLTMGVGMHGHRGHQQGSNEYNKDERF  343

Query  585   TGTDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLN  406
                           D+S+  K E Q T  E         LDLNT  +    +  KQ DLN
Sbjct  344   N-------------DKSEDHKLETQSTKTE---------LDLNTHVENCCTTRPKQFDLN  381

Query  405   GFSWN  391
             GFSWN
Sbjct  382   GFSWN  386



>emb|CDY66978.1| BnaCnng52990D [Brassica napus]
Length=381

 Score =   344 bits (883),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 213/419 (51%), Positives = 263/419 (63%), Gaps = 46/419 (11%)
 Frame = -2

Query  1629  YHHHRQGKSMHPSTNMLMPPERH-LFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVE  1453
             Y +  QGKS+  S+ M +P ERH  F++G N  GDSGL+LSTDAKPRLKWT DLHERF+E
Sbjct  3     YQNQHQGKSILSSSRMHLPSERHHQFLRGRNSPGDSGLILSTDAKPRLKWTPDLHERFIE  62

Query  1452  AVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNK-AMSSGM  1276
             AVNQLGGADKATPK+++K MGI GLTLYHLKSHLQKYRLSKNL+G ANS  NK  M + M
Sbjct  63    AVNQLGGADKATPKTIMKVMGIPGLTLYHLKSHLQKYRLSKNLNGQANSGLNKIGMMTMM  122

Query  1275  DAATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRI  1096
             +     +K P+A+     S +IGP  N N PISEA+ +QIEVQRRLHEQLEVQRHLQL+I
Sbjct  123   E-----EKSPDADEIQSESLSIGPQPNKNSPISEALHMQIEVQRRLHEQLEVQRHLQLKI  177

Query  1095  EAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGF  916
             EAQGKYLQ+VLEKAQETLG+Q+LG+ GLEAAK  LSE VSKVS +  N++F   KE    
Sbjct  178   EAQGKYLQSVLEKAQETLGKQNLGEAGLEAAKVHLSEFVSKVSAEYPNTSFLEQKEFQNL  237

Query  915   CQQQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQ  736
             C Q+    QP D SL SCLTSSE + ++ ++  ++  LR+   G   +ST    E   ++
Sbjct  238   CTQRM---QPPDFSLKSCLTSSERAQKNPKILENK--LRTY-LG---DSTSEKKEPMFQR  288

Query  735   TEFRWCDDIWENRKYLSKMDEETKNNGLSVSTGLQGGKWNGNSNYSDRRFTGTDADVKLF  556
              E  W + +  N  +LS M          VS   Q        +YS+R        V + 
Sbjct  289   MELTWTEGLRRN-PHLSTM----------VSDAEQ------RVSYSERSPARLSIGVGMH  331

Query  555   A----QAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNGFSWN  391
                  Q V+  +  K E Q T+ E         LDLNT       +  KQ DLNGFSWN
Sbjct  332   GHRDHQQVNNDEDHKIETQGTTTE---------LDLNTRVDNYCTTRPKQFDLNGFSWN  381



>ref|XP_009406832.1| PREDICTED: uncharacterized protein LOC103989646 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009406833.1| PREDICTED: uncharacterized protein LOC103989646 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=419

 Score =   345 bits (884),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 201/425 (47%), Positives = 262/425 (62%), Gaps = 17/425 (4%)
 Frame = -2

Query  1632  MYHHH-RQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFV  1456
             M+ H   QG +   S     P ER LF+Q  N  G+ GLVLSTDAKPRLKW  +LHERFV
Sbjct  1     MFQHQPHQGHNNLLSPRTTFPSERQLFLQRGNTTGEPGLVLSTDAKPRLKWNPELHERFV  60

Query  1455  EAVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGM  1276
             EAVNQLGGADKATPK++++ MGI GLTLYHLKSHLQKYRL KNL    N+ S K +   +
Sbjct  61    EAVNQLGGADKATPKTIMRLMGIPGLTLYHLKSHLQKYRLGKNLLAQTNTGSTKNV---I  117

Query  1275  DAATGSDKIPEANGNHINSANIGPLAN-TNLPISEAIQIQIEVQRRLHEQLEVQRHLQLR  1099
                  ++K  E NG+ +N A   P  N   + I+EA+Q+QIEVQR+LHEQLEVQRHLQL+
Sbjct  118   GCTLAAEKTSEGNGSSMNIA--APTNNFRTMQINEALQMQIEVQRQLHEQLEVQRHLQLQ  175

Query  1098  IEAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPG  919
             IEAQGKYLQ+VLEKAQETLG+Q+LG  GLE AK QLSELVSKVS +C +  F G++E P 
Sbjct  176   IEAQGKYLQSVLEKAQETLGKQNLGSAGLEVAKFQLSELVSKVSGECFSDPFPGLEENPR  235

Query  918   FCQQQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLK  739
                 Q    Q  DCS+DSCLTSSEGS ++ +   + MGLR  +    +        TRL+
Sbjct  236   LHMFQLNPAQLADCSVDSCLTSSEGSQKEQDTHAAIMGLRVSHQDFPLYVKQFGEHTRLE  295

Query  738   QTEFRWCDDIWENRKYLSKMDEETKN---------NGLSVSTGLQGGKWNGNSNYSDRRF  586
             QT+  W  D+ +   + S +  +++          N +  S   Q    +  +    R+ 
Sbjct  296   QTQNAWHGDLSKQTTFTSSILRDSQRASFPIQRDLNIIQASVKPQREIRDSGTVPEARKK  355

Query  585   TGTDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLN  406
                D D+ L   +  R+   K E +K +  ++LP     L+L   + ++ ASSCK+ DLN
Sbjct  356   DRDDEDMFLEHTSSKRAAV-KQESRKQTDGFELPCLTTDLELKIHEGSEGASSCKKFDLN  414

Query  405   GFSWN  391
             GFSWN
Sbjct  415   GFSWN  419



>gb|KCW47731.1| hypothetical protein EUGRSUZ_K01476 [Eucalyptus grandis]
Length=342

 Score =   338 bits (868),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 187/348 (54%), Positives = 234/348 (67%), Gaps = 18/348 (5%)
 Frame = -2

Query  1404  LKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDAATGSDKIPEANGNHI  1225
             +K MGI GLTLYHLKSHLQKYRLSKNLHG ANS +NK  +     A G D++PE NG+H+
Sbjct  1     MKLMGIPGLTLYHLKSHLQKYRLSKNLHGQANSGNNKIGT----VAVGGDRVPETNGSHV  56

Query  1224  NSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVLEKAQET  1045
             ++ NI P  N NLP SEA+Q+QIEVQRRLHEQLEVQRHLQLRIEAQGKYLQ+VLEKAQET
Sbjct  57    HNLNIVPQTNKNLPFSEALQMQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQSVLEKAQET  116

Query  1044  LGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFCQQQAQATQPTDCSLDS  865
             LGRQ++G   LEA K QLSELVSKVS Q LNSAF  +KEL G C QQ Q   PTDCS+DS
Sbjct  117   LGRQNVGSASLEATKLQLSELVSKVSTQSLNSAFPDLKELQGLCAQQIQTNPPTDCSVDS  176

Query  864   CLTSSEGSLRDHEMRNSQMGLRSLNFGAH-MESTDLYNETRLKQTEFRWCDDIWENRKYL  688
             CLTS EGS +D E+ N+ +GLR  + G+  ++   + +E R ++ EF+W  D+ E+R +L
Sbjct  177   CLTSCEGSHKDQEIHNNGIGLRPYSGGSVLLDPKGITDEPRTEKIEFKWGGDLKEDRMFL  236

Query  687   SKMDEETKNN--------GLSVSTGLQGGKWNGNSNYSDRRFTGTDADVKLFAQAVDRSD  532
             S   +E + +         LS+S GL+GG          +   G+   V    +   R+D
Sbjct  237   SYGVKEMERSFPGGLGQGHLSMSIGLEGGLGCSEVKNKAKEVGGS---VNFLERLHSRAD  293

Query  531   TSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDL--NGFSW  394
             +   +  + S   +L YF  KLDLN  ++TDVASS KQ DL  NGF W
Sbjct  294   SVNMDSNQRSCGNQLHYFEAKLDLNAREETDVASSGKQFDLNGNGFGW  341



>emb|CBI29923.3| unnamed protein product [Vitis vinifera]
Length=305

 Score =   337 bits (863),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 171/235 (73%), Positives = 198/235 (84%), Gaps = 9/235 (4%)
 Frame = -2

Query  1629  YHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEA  1450
             +HHH QGK++HPS+   + PER+LF+QG NG GDSGLVLSTDAKPRLKWT DLHERF+EA
Sbjct  3     HHHHHQGKNIHPSSRTPITPERNLFLQGGNGPGDSGLVLSTDAKPRLKWTPDLHERFIEA  62

Query  1449  VNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDA  1270
             VNQLGGADKATPK+V+K MGI GLTLYHLKSHLQKYRLSKNLHG ANS+++K +      
Sbjct  63    VNQLGGADKATPKTVMKLMGIPGLTLYHLKSHLQKYRLSKNLHGQANSATSKTVV-----  117

Query  1269  ATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEA  1090
                 +++PEANG  ++S NIG   N +L +SE +Q+ IE QRRLHEQLEVQRHLQLRIEA
Sbjct  118   ---GERMPEANGALMSSPNIGNQTNKSLHLSETLQM-IEAQRRLHEQLEVQRHLQLRIEA  173

Query  1089  QGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKEL  925
             QGKYLQAVLEKAQETLGRQ+LG +GLEAAK QLSELVSKVS QCL+SAFS +KEL
Sbjct  174   QGKYLQAVLEKAQETLGRQNLGAVGLEAAKVQLSELVSKVSTQCLHSAFSELKEL  228


 Score = 65.9 bits (159),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 50/96 (52%), Gaps = 22/96 (23%)
 Frame = -2

Query  675  EETKNNGLSVSTGLQGGKWNGNSNYSDRRFTG-TDADVKLFAQAVDRSDTSKPEKQKTSQ  499
            +E  N G+ +     G   NG+++YS+ RF G  +AD  +                  S 
Sbjct  231  QEIHNCGMGLRPYTNG---NGSNSYSEGRFKGRAEADNFM------------------SH  269

Query  498  EYKLPYFGPKLDLNTDDKTDVASSCKQLDLNGFSWN  391
             Y+LP FG KLDLN  D+ DV  SCKQ DLNGFSWN
Sbjct  270  GYRLPCFGAKLDLNAHDENDVTLSCKQFDLNGFSWN  305



>ref|XP_009380592.1| PREDICTED: uncharacterized protein LOC103968945 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=397

 Score =   339 bits (870),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 195/407 (48%), Positives = 255/407 (63%), Gaps = 31/407 (8%)
 Frame = -2

Query  1593  STNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEAVNQLGGADKATP  1414
             S     P E+HL +QG +   DSGLVLSTDAKPRLKWT +LHERF+EAVNQLGGADKATP
Sbjct  16    SCRTAFPAEKHLLLQGGSIPEDSGLVLSTDAKPRLKWTAELHERFIEAVNQLGGADKATP  75

Query  1413  KSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDAATGSDKIPEANG  1234
             KSV++ MGI GLTLYHLKSHLQKYRLSKNL   AN +      S +     +++  E NG
Sbjct  76    KSVMRLMGIPGLTLYHLKSHLQKYRLSKNLQAQANGAE-----SVIGCKLAAERTSEGNG  130

Query  1233  NHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVLEKA  1054
             +  ++ NI P +N   PI+EA+Q+QIEVQRRL EQLEVQRHLQLRIEAQGKYLQ+VLEKA
Sbjct  131   SRASNTNIIPQSNKTYPINEALQMQIEVQRRLQEQLEVQRHLQLRIEAQGKYLQSVLEKA  190

Query  1053  QETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFCQQQAQATQPTDCS  874
             QETLG+Q LG  GLEAAK  LS+LV KVSN+C ++A +G++E+P     Q    Q  D S
Sbjct  191   QETLGKQHLGTPGLEAAKVHLSQLVFKVSNECFSNALTGLEEIPAPNTLQVHPPQLADFS  250

Query  873   LDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQTEFRWCDDIWENRK  694
             + SCLTSS+GS +D +M N +  LR+           ++   RL+ ++  WC  + E++ 
Sbjct  251   VQSCLTSSQGSQKDLDMANFRRSLRAY----------MHENARLEGSQSAWC-YLNEHKT  299

Query  693   YLSKMDEETKNNGLSVSTGLQGGKWNGNSNYSDRRFTGTDADVKLFAQAVDRSD------  532
             + S M  +++     V   +        S    R     + +    AQ  +RSD      
Sbjct  300   FPSSMFGDSERTSFKVEDFV--------SPLPVRPRVEREGEAGSDAQQTERSDPNGKRT  351

Query  531   TSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNGFSWN  391
               + E+ K S  + L     +LDLN D+  + A++ K  DLNGFSW+
Sbjct  352   AEQQERGKQSDSFGLAGHTAQLDLNADEDDEGATNSK-FDLNGFSWS  397



>ref|XP_008807359.1| PREDICTED: probable transcription factor KAN4 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008807360.1| PREDICTED: probable transcription factor KAN4 isoform X1 [Phoenix 
dactylifera]
Length=330

 Score =   337 bits (863),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 174/312 (56%), Positives = 221/312 (71%), Gaps = 4/312 (1%)
 Frame = -2

Query  1632  MYHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVE  1453
             MYH H QGK+   S+    PPERHL++QG N  G+SGL+LSTDAKPRLKWT +LH+RF+E
Sbjct  1     MYHQH-QGKNDLFSSRAAFPPERHLYLQGGNAPGNSGLILSTDAKPRLKWTPELHQRFIE  59

Query  1452  AVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMD  1273
             AVNQLGGADKATPK+V++ MGI GLTLYHLKSHLQKYRLSKNL    N+ S K ++  + 
Sbjct  60    AVNQLGGADKATPKTVMRLMGIPGLTLYHLKSHLQKYRLSKNLQAQVNTGSTKNVTGSVI  119

Query  1272  AATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIE  1093
             AA   D+  E +G   ++ NI   +N  + IS+A+Q+ IE QR+LHEQLEVQRHLQLRIE
Sbjct  120   AA---DRTSEVSGALTDTTNIVSHSNKTMQISKALQMNIEAQRQLHEQLEVQRHLQLRIE  176

Query  1092  AQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFC  913
             AQGKYLQ+VLEKAQETLG+  +G +GLEAAK QLSEL SKVS +C  +AF  +KE     
Sbjct  177   AQGKYLQSVLEKAQETLGKPSVGSVGLEAAKVQLSELASKVSKECFGTAFPSLKESSSLH  236

Query  912   QQQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQT  733
               Q Q TQ +D S DSCLTS E   +D E  N  +GL +    + + +  +  +  L+Q 
Sbjct  237   TLQGQTTQFSDYSGDSCLTSCEEFQKDRETHNVCVGLGTCPSNSPLCTQQIGKDPTLEQN  296

Query  732   EFRWCDDIWENR  697
             +F WC ++ E+R
Sbjct  297   QFMWCGNVNEHR  308



>ref|XP_009380600.1| PREDICTED: uncharacterized protein LOC103968945 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=390

 Score =   338 bits (867),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 195/407 (48%), Positives = 253/407 (62%), Gaps = 38/407 (9%)
 Frame = -2

Query  1593  STNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEAVNQLGGADKATP  1414
             S     P E+HL +QG +   DSGLVLSTDAKPRLKWT +LHERF+EAVNQLGGADKATP
Sbjct  16    SCRTAFPAEKHLLLQGGSIPEDSGLVLSTDAKPRLKWTAELHERFIEAVNQLGGADKATP  75

Query  1413  KSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDAATGSDKIPEANG  1234
             KSV++ MGI GLTLYHLKSHLQKYRLSKNL   AN             A  +++  E NG
Sbjct  76    KSVMRLMGIPGLTLYHLKSHLQKYRLSKNLQAQAN------------GAESAERTSEGNG  123

Query  1233  NHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVLEKA  1054
             +  ++ NI P +N   PI+EA+Q+QIEVQRRL EQLEVQRHLQLRIEAQGKYLQ+VLEKA
Sbjct  124   SRASNTNIIPQSNKTYPINEALQMQIEVQRRLQEQLEVQRHLQLRIEAQGKYLQSVLEKA  183

Query  1053  QETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFCQQQAQATQPTDCS  874
             QETLG+Q LG  GLEAAK  LS+LV KVSN+C ++A +G++E+P     Q    Q  D S
Sbjct  184   QETLGKQHLGTPGLEAAKVHLSQLVFKVSNECFSNALTGLEEIPAPNTLQVHPPQLADFS  243

Query  873   LDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQTEFRWCDDIWENRK  694
             + SCLTSS+GS +D +M N +  LR+           ++   RL+ ++  WC  + E++ 
Sbjct  244   VQSCLTSSQGSQKDLDMANFRRSLRAY----------MHENARLEGSQSAWC-YLNEHKT  292

Query  693   YLSKMDEETKNNGLSVSTGLQGGKWNGNSNYSDRRFTGTDADVKLFAQAVDRSD------  532
             + S M  +++     V   +        S    R     + +    AQ  +RSD      
Sbjct  293   FPSSMFGDSERTSFKVEDFV--------SPLPVRPRVEREGEAGSDAQQTERSDPNGKRT  344

Query  531   TSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNGFSWN  391
               + E+ K S  + L     +LDLN D+  + A++ K  DLNGFSW+
Sbjct  345   AEQQERGKQSDSFGLAGHTAQLDLNADEDDEGATNSK-FDLNGFSWS  390



>ref|XP_008792509.1| PREDICTED: uncharacterized protein LOC103709092 [Phoenix dactylifera]
Length=411

 Score =   338 bits (866),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 194/422 (46%), Positives = 261/422 (62%), Gaps = 19/422 (5%)
 Frame = -2

Query  1632  MYHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVE  1453
             MY  H QG++   S+    PP     +QGEN  G SGL LSTDAKPRLKWT +LH+RF+E
Sbjct  1     MYRQH-QGQNDLFSSKAAFPP----VLQGENAPGSSGLFLSTDAKPRLKWTPELHQRFIE  55

Query  1452  AVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMD  1273
             AVNQLGGADKATPK+V++ M I GLTLYHLKSHLQKYRLSKN    A++ + K  S    
Sbjct  56    AVNQLGGADKATPKTVMRLMSIPGLTLYHLKSHLQKYRLSKNFQAQASTETTKKGS----  111

Query  1272  AATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIE  1093
              A  +D+  E +G+ I + NI   +N  + ISEA+Q+QIEVQR+LHEQLEVQRHLQLRIE
Sbjct  112   -AIAADRTSEVSGSLIGNTNIASHSNKTMQISEALQMQIEVQRQLHEQLEVQRHLQLRIE  170

Query  1092  AQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFC  913
             AQGKYLQ+VLEKAQETL +Q +G +GLEAAK QLS+LVS+VSN+C+ +AF  ++E     
Sbjct  171   AQGKYLQSVLEKAQETLDKQSVGSVGLEAAKMQLSDLVSEVSNECMGTAFPSLRESSSLH  230

Query  912   QQQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQT  733
               Q Q  Q  D   +SCLTS +   +D +  + ++GLR+    + + +  +  ++ L QT
Sbjct  231   TLQGQTAQVADYLGNSCLTSYKELQKDRQTHHVRVGLRTYPGNSQLCTQQIGEDSTLAQT  290

Query  732   EFRWCDDIWENRKYLSKMDEET--------KNNGLSVSTGLQGGKWNGNSNYSDRRFTGT  577
              F  C ++ ENR   S   +E+        ++N LS S   + G+  G+ + S+ +    
Sbjct  291   CFARCGNVNENRMLPSSTVKESEMTIFLVEESNILSKSVKPE-GENGGSISISEAKQNEG  349

Query  576   DADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNGFS  397
             D +         R    + E       + LP    +LDLN  D  + +  CKQ DLNGFS
Sbjct  350   DGEDTCLEMPNGRRSAVQQESGNQLNGFALPCLTVQLDLNARDDNNPSLGCKQFDLNGFS  409

Query  396   WN  391
             W+
Sbjct  410   WS  411



>ref|XP_009400147.1| PREDICTED: uncharacterized protein LOC103984394 [Musa acuminata 
subsp. malaccensis]
Length=2557

 Score =   364 bits (935),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 207/425 (49%), Positives = 275/425 (65%), Gaps = 22/425 (5%)
 Frame = -2

Query  1632  MYHHHRQGKSMHP-STNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFV  1456
             MYH H+QG   +  S+    P ERHL +QG     +SGLVLSTDAKPRLKWT +LHERF+
Sbjct  2144  MYHQHQQGGHNNILSSRTAFPAERHLLLQGGRIPEESGLVLSTDAKPRLKWTPELHERFI  2203

Query  1455  EAVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGM  1276
             EAV+QLGGADKATPKSV++ MGI GLTLYHLKSHLQKYRLSKNL   A+S S K +++G 
Sbjct  2204  EAVDQLGGADKATPKSVMRLMGIPGLTLYHLKSHLQKYRLSKNLQAQASSGSAK-IATGC  2262

Query  1275  DAATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRI  1096
                 G  +  E NG  + S NI P +N N+PI+EA+Q+QIEVQRRL EQLEVQRHLQLRI
Sbjct  2263  KLVAG--RTAEGNGLLLGSTNIIPQSNKNIPINEALQMQIEVQRRLQEQLEVQRHLQLRI  2320

Query  1095  EAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGF  916
             EAQGKYLQ+VLEKAQETLG+Q+LG  GLEAAK QLSELVSKVSN+C ++AF G++E+   
Sbjct  2321  EAQGKYLQSVLEKAQETLGKQNLGSPGLEAAKVQLSELVSKVSNECFSNAFPGLEEIRNP  2380

Query  915   CQQQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQ  736
                Q   +Q  DCS +SCLTSSEGS +D +M N    LR+   G  +    ++ +TRL+ 
Sbjct  2381  NTLQVNPSQLADCSAESCLTSSEGSQKDQDMTNFHRSLRAYGGGLPLCRQQMHQDTRLET  2440

Query  735   TEFRWCDDIWENRKYLSKMDEETKNNGLSV---------STGLQGGKWNGNSNYSDRRFT  583
             T+  WC  + + + + S +  +++    SV         S   +GG  +  +   +R   
Sbjct  2441  TQSAWC-YLNDQKTFPSSILGDSERTTFSVQDFATHPVSSKAQRGGGADSEAQQKER---  2496

Query  582   GTDADVKLFAQAVDRSDTS-KPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLN  406
                ++  +F +  +    + + ++ K S  + +P    +LDLN D+  +     K  DLN
Sbjct  2497  ---SEEHMFLEHPNNKRVAGQQDRGKQSNSFGMPGHTAQLDLNADEDNEGDRDSK-FDLN  2552

Query  405   GFSWN  391
             GF W+
Sbjct  2553  GFGWS  2557



>ref|XP_010524965.1| PREDICTED: uncharacterized protein LOC104802861 isoform X1 [Tarenaya 
hassleriana]
Length=383

 Score =   335 bits (859),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 197/407 (48%), Positives = 249/407 (61%), Gaps = 33/407 (8%)
 Frame = -2

Query  1584  MLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEAVNQLGGADKATPKSV  1405
             M +P ERH F++G N  GDSGL+LSTDAKPRLKWT DLHERFV+AVNQL GADKATPK++
Sbjct  1     MPIPYERHPFLRGVNDPGDSGLILSTDAKPRLKWTPDLHERFVKAVNQLDGADKATPKAI  60

Query  1404  LKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDAATGSDKIPEANGNHI  1225
             +K MG+ GLTLYHLKSHLQKYRLSKNL+G AN    +        A   +K  +AN  H 
Sbjct  61    MKVMGVPGLTLYHLKSHLQKYRLSKNLNGQANYQKYQKYRL---VAMAEEKSHDANEIHT  117

Query  1224  NSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVLEKAQET  1045
              S +IG     NLPISEA+Q+Q+EVQ+RLHEQLE  RHLQLRIEA GKYLQAVLEKA ET
Sbjct  118   ESFSIGQPTEKNLPISEALQMQVEVQQRLHEQLE--RHLQLRIEAHGKYLQAVLEKAHET  175

Query  1044  LGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFCQQQAQATQPTDCSLDS  865
             LG+Q+LG  G+EAAK QLSEL SKVS +  ++ F   KEL     QQ + T P+ CSLDS
Sbjct  176   LGKQNLGTDGIEAAKVQLSELASKVSAEYSHTTFQEPKELQSLHPQQME-TYPSVCSLDS  234

Query  864   CLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQTEFRWCDDIWENRKYLS  685
              LTS E +    ++  +++GLR  +  +  E  ++  +   ++ E  W +   E R Y S
Sbjct  235   SLTSRERNQTIPKIVENRLGLRPYHGDSKSEQKEISEQQLFQRLELAWSEGQRETRTYFS  294

Query  684   KMDEETKNN---------GLSVSTGLQGGKWNGNSNYSDRRFTGTDADVKLFAQAVDRSD  532
              M  +T+            LS+  GL G K   N+ Y++ R T  D D K   +     D
Sbjct  295   TMVNDTEARISSSERSLGNLSIGIGLYGQKGQENTGYTEER-TKKDEDCKFETRNQKGMD  353

Query  531   TSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNGFSWN  391
             ++                  +LDLNT  +    +  KQ DLNGFSWN
Sbjct  354   STT-----------------ELDLNTHGENYDTARPKQFDLNGFSWN  383



>ref|XP_010054431.1| PREDICTED: myb family transcription factor APL isoform X2 [Eucalyptus 
grandis]
 gb|KCW89848.1| hypothetical protein EUGRSUZ_A02082 [Eucalyptus grandis]
Length=377

 Score =   332 bits (852),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 204/410 (50%), Positives = 248/410 (60%), Gaps = 44/410 (11%)
 Frame = -2

Query  1611  GKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEAVNQLGG  1432
             GK+ HPS+ M +  ERHL +Q  NG GDSGL+LSTDAKPRLKWT DLH+RFVEAVNQLGG
Sbjct  9     GKNFHPSSRMSILSERHLLLQAANGPGDSGLILSTDAKPRLKWTTDLHKRFVEAVNQLGG  68

Query  1431  ADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDAATGSDK  1252
             ADKATPKS+LK MGI GLTLYHLKSHLQKYRLSKNLHG A + +N+A++          K
Sbjct  69    ADKATPKSILKAMGIPGLTLYHLKSHLQKYRLSKNLHGQATNGTNRAVAEV--------K  120

Query  1251  IPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQ  1072
             + EANG H+N+++IG   N NL ISEA Q+QIEVQRRLHEQ+E QRH+QL IEAQGKYLQ
Sbjct  121   VSEANGPHLNNSSIGIQVNKNLHISEAFQVQIEVQRRLHEQMEAQRHMQLHIEAQGKYLQ  180

Query  1071  AVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFCQQQAQAT  892
             AVLEKAQETLGR D G +GLEAAK QLSELVSKVS   L+S F  + ++      Q Q  
Sbjct  181   AVLEKAQETLGRHDSGSVGLEAAKYQLSELVSKVSADSLSSTFPDVVDIH---LHQMQMN  237

Query  891   QPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQTEFRWCDD  712
             Q TD SLDSCLT  E   +D E        R  +    +  +D+ ++ R  QT      +
Sbjct  238   QNTDGSLDSCLT-CERPQKDREEDVDGSRSRDHHPNPFLLPSDIADDRRRGQT----VPE  292

Query  711   IWENRKYLSKMDEETKNNGLSVSTGLQGGKWNGNSNYSDRRFTGTDADVKLFA---QAVD  541
               E R   +  D  T     S S G  G                 D  +KL +    + D
Sbjct  293   DAEERVKRAICDLSTTCGYRSSSEGTNG---------------RVDEKIKLASPRRTSDD  337

Query  540   RSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNGFSWN  391
              + + +  ++  S  Y       KLDLN  D+          DLNGF W+
Sbjct  338   ETGSIEAGREGLSLGYGSSRLRSKLDLNVRDE----------DLNGFGWS  377



>gb|KEH25609.1| myb-like transcription factor family protein [Medicago truncatula]
Length=397

 Score =   333 bits (853),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 193/388 (50%), Positives = 251/388 (65%), Gaps = 37/388 (10%)
 Frame = -2

Query  1521  LVLSTDAKPRLKWTQDLHERFVEAVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKY  1342
             LVLSTDAKPRLKWT DLHERF+EAVNQLGGADKATPK+VLK MGI GLTLYHLKSHLQKY
Sbjct  35    LVLSTDAKPRLKWTPDLHERFIEAVNQLGGADKATPKTVLKLMGIPGLTLYHLKSHLQKY  94

Query  1341  RLSKNLHGHANSSSNKAMSSGMDAATGSDKIPEANGNHINSANIGPLANTNLPISEAIQI  1162
             R+S++++G  N+ S+K   +   +   + ++ E++G H+   NIG   N N  I+EA+ +
Sbjct  95    RISRSMNGQTNTGSSKIAPT---SEVVTSRMSESSGIHMKDLNIGLQTNKNSDINEALNM  151

Query  1161  QIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSEL  982
             QIEVQRRLHEQLEVQRHLQLRIEAQGKYLQ+VLEKA+ETLGRQ+LG MGL+AAK QLSEL
Sbjct  152   QIEVQRRLHEQLEVQRHLQLRIEAQGKYLQSVLEKAKETLGRQNLGAMGLDAAKVQLSEL  211

Query  981   VSKVSNQCLNSAFSGIKELPGFCQQQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGL  802
              S+VS + L+S FS +KE+     QQ Q  +  D S+ S LT+SE S RD E+ N     
Sbjct  212   ASRVSTENLDSKFSELKEMNVLWAQQTQEGETIDYSMGSFLTNSEDSQRDQEIHN-----  266

Query  801   RSLNFGAHMESTDLYNETRLKQTEFRWCDDIWENRKYLSKMDE----------ETKNNGL  652
             +S+NF A       YN T         C+++ EN  +LS  ++          E  ++ L
Sbjct  267   KSMNFRA-------YNGT--------LCEEVKENMMFLSSSNDKVLKGSDEVPERTSSLL  311

Query  651   SVSTGLQGGKWNGNSNYSDRRFTGTDADVKLFAQAVDRSDTS-KPEKQKTSQEYKLPYFG  475
             S++ G+   +     N S     G +   +   +++D S    K    K SQ+Y+L  F 
Sbjct  312   SMNIGVHEEENFWRRNISKEDLEGEEWKRR---KSIDTSGVQLKLNSDKISQDYRLANFD  368

Query  474   PKLDLNTDDKTDVASSCKQLDLNGFSWN  391
              KLDLN+ D    +S  ++ DLNGFSWN
Sbjct  369   MKLDLNSHDDNGASSHSQKFDLNGFSWN  396



>ref|XP_010524967.1| PREDICTED: uncharacterized protein LOC104802861 isoform X3 [Tarenaya 
hassleriana]
Length=379

 Score =   332 bits (850),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 196/407 (48%), Positives = 248/407 (61%), Gaps = 37/407 (9%)
 Frame = -2

Query  1584  MLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEAVNQLGGADKATPKSV  1405
             M +P ERH F++G N  GDSGL+LSTDAKPRLKWT DLHERFV+AVNQL GADKATPK++
Sbjct  1     MPIPYERHPFLRGVNDPGDSGLILSTDAKPRLKWTPDLHERFVKAVNQLDGADKATPKAI  60

Query  1404  LKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDAATGSDKIPEANGNHI  1225
             +K MG+ GLTLYHLKSHLQKYRLSKNL+G AN    +            +K  +AN  H 
Sbjct  61    MKVMGVPGLTLYHLKSHLQKYRLSKNLNGQANYQKYQKYRL-------EEKSHDANEIHT  113

Query  1224  NSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVLEKAQET  1045
              S +IG     NLPISEA+Q+Q+EVQ+RLHEQLE  RHLQLRIEA GKYLQAVLEKA ET
Sbjct  114   ESFSIGQPTEKNLPISEALQMQVEVQQRLHEQLE--RHLQLRIEAHGKYLQAVLEKAHET  171

Query  1044  LGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFCQQQAQATQPTDCSLDS  865
             LG+Q+LG  G+EAAK QLSEL SKVS +  ++ F   KEL     QQ + T P+ CSLDS
Sbjct  172   LGKQNLGTDGIEAAKVQLSELASKVSAEYSHTTFQEPKELQSLHPQQME-TYPSVCSLDS  230

Query  864   CLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQTEFRWCDDIWENRKYLS  685
              LTS E +    ++  +++GLR  +  +  E  ++  +   ++ E  W +   E R Y S
Sbjct  231   SLTSRERNQTIPKIVENRLGLRPYHGDSKSEQKEISEQQLFQRLELAWSEGQRETRTYFS  290

Query  684   KMDEETKNN---------GLSVSTGLQGGKWNGNSNYSDRRFTGTDADVKLFAQAVDRSD  532
              M  +T+            LS+  GL G K   N+ Y++ R T  D D K   +     D
Sbjct  291   TMVNDTEARISSSERSLGNLSIGIGLYGQKGQENTGYTEER-TKKDEDCKFETRNQKGMD  349

Query  531   TSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNGFSWN  391
             ++                  +LDLNT  +    +  KQ DLNGFSWN
Sbjct  350   STT-----------------ELDLNTHGENYDTARPKQFDLNGFSWN  379



>ref|XP_004489714.1| PREDICTED: uncharacterized protein LOC101512896 isoform X1 [Cicer 
arietinum]
 ref|XP_004489715.1| PREDICTED: uncharacterized protein LOC101512896 isoform X2 [Cicer 
arietinum]
Length=397

 Score =   330 bits (845),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 206/419 (49%), Positives = 267/419 (64%), Gaps = 31/419 (7%)
 Frame = -2

Query  1629  YHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEA  1450
             Y+HH+Q ++MH          R     G NG GDSGLVLSTDAKPRLKWT DLHERF+EA
Sbjct  3     YNHHQQARNMHAL--------RMQIQGGGNGSGDSGLVLSTDAKPRLKWTTDLHERFIEA  54

Query  1449  VNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNK-AMSSGMD  1273
             VNQLGGADKATPK+VLK MGI GLTLYHLKSHLQKYR+SK ++G  N+ S+K A+++ + 
Sbjct  55    VNQLGGADKATPKTVLKLMGIPGLTLYHLKSHLQKYRISKTMNGQTNTGSSKIALTTEV-  113

Query  1272  AATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIE  1093
                 S ++ EA+G H+   +IG   N N  I+EA  +Q+EVQRRLHEQLEVQ+HLQLRIE
Sbjct  114   ----SSRMSEASGIHMKHLSIGLQTNKNSEINEAFNMQMEVQRRLHEQLEVQKHLQLRIE  169

Query  1092  AQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFC  913
             AQGKYLQ+VLEKA+ETLG Q+LG MGL+ AK QLS+  S+VSN+ L+S F G+KEL    
Sbjct  170   AQGKYLQSVLEKAKETLGTQNLGTMGLDDAKVQLSKFTSRVSNENLDSKFLGLKELHVHW  229

Query  912   QQQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQT  733
              QQ +  +  D S+ S LT+SE S RD EM N  M L     G   E  D   E    + 
Sbjct  230   PQQTREDETIDYSMGSFLTNSEDSQRDQEMHNKGMKL-----GVSKECVD---EPMPLKN  281

Query  732   EFRWCDDIWENRKYLSKMDEETKNNGLSVSTGLQG-GKWNGNSNYSDRRFTGTDADVKLF  556
             +F  C+   EN  ++S  +     +GL+ S  L   G  +   N   R  +  D   + +
Sbjct  282   DFTLCEKEKENVMFVSSSNHRVLKDGLTTSLLLMNVGGVHEKENMWKRTISKEDLKGEEW  341

Query  555   AQAVDRSDTS----KPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNGFSWN  391
              + ++  +T+    K    K SQ+Y+L  F  KLDLN++   D +S C++ DLNGFSWN
Sbjct  342   KR-INNIETNGVQLKLNSDKISQDYRLANFEVKLDLNSN---DASSQCQKFDLNGFSWN  396



>ref|XP_010054416.1| PREDICTED: myb family transcription factor APL isoform X1 [Eucalyptus 
grandis]
 ref|XP_010054424.1| PREDICTED: myb family transcription factor APL isoform X1 [Eucalyptus 
grandis]
Length=378

 Score =   328 bits (841),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 204/411 (50%), Positives = 248/411 (60%), Gaps = 45/411 (11%)
 Frame = -2

Query  1611  GKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEAVNQLGG  1432
             GK+ HPS+ M +  ERHL +Q  NG GDSGL+LSTDAKPRLKWT DLH+RFVEAVNQLGG
Sbjct  9     GKNFHPSSRMSILSERHLLLQAANGPGDSGLILSTDAKPRLKWTTDLHKRFVEAVNQLGG  68

Query  1431  ADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDAATGSDK  1252
             ADKATPKS+LK MGI GLTLYHLKSHLQKYRLSKNLHG A + +N+A++          K
Sbjct  69    ADKATPKSILKAMGIPGLTLYHLKSHLQKYRLSKNLHGQATNGTNRAVAEV--------K  120

Query  1251  IPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLE-VQRHLQLRIEAQGKYL  1075
             + EANG H+N+++IG   N NL ISEA Q+QIEVQRRLHEQ+E  QRH+QL IEAQGKYL
Sbjct  121   VSEANGPHLNNSSIGIQVNKNLHISEAFQVQIEVQRRLHEQMEQAQRHMQLHIEAQGKYL  180

Query  1074  QAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFCQQQAQA  895
             QAVLEKAQETLGR D G +GLEAAK QLSELVSKVS   L+S F  + ++      Q Q 
Sbjct  181   QAVLEKAQETLGRHDSGSVGLEAAKYQLSELVSKVSADSLSSTFPDVVDIH---LHQMQM  237

Query  894   TQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQTEFRWCD  715
              Q TD SLDSCLT  E   +D E        R  +    +  +D+ ++ R  QT      
Sbjct  238   NQNTDGSLDSCLT-CERPQKDREEDVDGSRSRDHHPNPFLLPSDIADDRRRGQT----VP  292

Query  714   DIWENRKYLSKMDEETKNNGLSVSTGLQGGKWNGNSNYSDRRFTGTDADVKLFA---QAV  544
             +  E R   +  D  T     S S G  G                 D  +KL +    + 
Sbjct  293   EDAEERVKRAICDLSTTCGYRSSSEGTNG---------------RVDEKIKLASPRRTSD  337

Query  543   DRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNGFSWN  391
             D + + +  ++  S  Y       KLDLN  D+          DLNGF W+
Sbjct  338   DETGSIEAGREGLSLGYGSSRLRSKLDLNVRDE----------DLNGFGWS  378



>ref|XP_004489716.1| PREDICTED: uncharacterized protein LOC101512896 isoform X3 [Cicer 
arietinum]
Length=393

 Score =   328 bits (841),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 205/418 (49%), Positives = 262/418 (63%), Gaps = 33/418 (8%)
 Frame = -2

Query  1629  YHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEA  1450
             Y+HH+Q ++MH          R     G NG GDSGLVLSTDAKPRLKWT DLHERF+EA
Sbjct  3     YNHHQQARNMHAL--------RMQIQGGGNGSGDSGLVLSTDAKPRLKWTTDLHERFIEA  54

Query  1449  VNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDA  1270
             VNQLGGADKATPK+VLK MGI GLTLYHLKSHLQKYR+SK ++G  N+ S+K        
Sbjct  55    VNQLGGADKATPKTVLKLMGIPGLTLYHLKSHLQKYRISKTMNGQTNTGSSKI-------  107

Query  1269  ATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEA  1090
                S ++ EA+G H+   +IG   N N  I+EA  +Q+EVQRRLHEQLEVQ+HLQLRIEA
Sbjct  108   -EVSSRMSEASGIHMKHLSIGLQTNKNSEINEAFNMQMEVQRRLHEQLEVQKHLQLRIEA  166

Query  1089  QGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFCQ  910
             QGKYLQ+VLEKA+ETLG Q+LG MGL+ AK QLS+  S+VSN+ L+S F G+KEL     
Sbjct  167   QGKYLQSVLEKAKETLGTQNLGTMGLDDAKVQLSKFTSRVSNENLDSKFLGLKELHVHWP  226

Query  909   QQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQTE  730
             QQ +  +  D S+ S LT+SE S RD EM N  M L     G   E  D   E    + +
Sbjct  227   QQTREDETIDYSMGSFLTNSEDSQRDQEMHNKGMKL-----GVSKECVD---EPMPLKND  278

Query  729   FRWCDDIWENRKYLSKMDEETKNNGLSVSTGLQG-GKWNGNSNYSDRRFTGTDADVKLFA  553
             F  C+   EN  ++S  +     +GL+ S  L   G  +   N   R  +  D   + + 
Sbjct  279   FTLCEKEKENVMFVSSSNHRVLKDGLTTSLLLMNVGGVHEKENMWKRTISKEDLKGEEWK  338

Query  552   QAVDRSDTS----KPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNGFSWN  391
             + ++  +T+    K    K SQ+Y+L  F  KLDLN++   D +S C++ DLNGFSWN
Sbjct  339   R-INNIETNGVQLKLNSDKISQDYRLANFEVKLDLNSN---DASSQCQKFDLNGFSWN  392



>ref|XP_010922889.1| PREDICTED: uncharacterized protein LOC105046091 [Elaeis guineensis]
 ref|XP_010922890.1| PREDICTED: uncharacterized protein LOC105046091 [Elaeis guineensis]
Length=413

 Score =   328 bits (841),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 190/422 (45%), Positives = 256/422 (61%), Gaps = 17/422 (4%)
 Frame = -2

Query  1632  MYHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVE  1453
             MY  H QG++   S+    PP     +Q  N  G SGL LSTDAKPRLKWT +LH+RF+E
Sbjct  1     MYRQH-QGQNDLFSSRAAFPP----VLQAGNAPGSSGLFLSTDAKPRLKWTPELHQRFIE  55

Query  1452  AVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMD  1273
             AVNQLGGAD+ATPK+V++ M I GLTLYHLKSHLQKYRLSKN    A S + K +   + 
Sbjct  56    AVNQLGGADRATPKTVMRLMSIPGLTLYHLKSHLQKYRLSKNFQAQACSGTTKKVIGSVI  115

Query  1272  AATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIE  1093
             AA   D+  E +G  I++ NI   +   + ISEA+Q+QIEVQR+LHEQLEVQRHLQLRIE
Sbjct  116   AA---DRTSEVSGPLISNTNIASHSYKTMQISEALQMQIEVQRQLHEQLEVQRHLQLRIE  172

Query  1092  AQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFC  913
             AQGKYLQ+VLEKAQETLG+Q +G +GL+AAK QLSELV++VSN+C+ +AF  ++E     
Sbjct  173   AQGKYLQSVLEKAQETLGKQSVGSIGLDAAKVQLSELVNEVSNECIGTAFPSLRESSSLH  232

Query  912   QQQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQT  733
               + QA Q  D   DSCLTS +   +D +  +  +GLR+    + + +  +  ++ L QT
Sbjct  233   TLKGQAAQFADYLGDSCLTSYKDLQKDRQTHHVSVGLRTYPGNSPLHTQQIGEDSTLAQT  292

Query  732   EFRWCDDIWENRKYLSKMDEET--------KNNGLSVSTGLQGGKWNGNSNYSDRRFTGT  577
              F WC ++ E+R   S   +E+        ++N L  S   +G    G+ + S+ +    
Sbjct  293   CFAWCGNVNESRTLPSSRVKESEMTIFPVKESNILPKSVKPEGENI-GSISLSEAKQNEG  351

Query  576   DADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNGFS  397
             D +         R    + E       + LP    +LDLN  D  D +   K  DLNGFS
Sbjct  352   DGEDPCLEMPNGRRSAVQQESTNQLNGFALPCLTVQLDLNARDDNDRSLGSKLFDLNGFS  411

Query  396   WN  391
             W+
Sbjct  412   WS  413



>ref|XP_008465332.1| PREDICTED: chromatin modification-related protein EAF1 isoform 
X2 [Cucumis melo]
Length=398

 Score =   327 bits (839),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 218/459 (47%), Positives = 259/459 (56%), Gaps = 108/459 (24%)
 Frame = -2

Query  1632  MYHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSG--LVLSTDAKPRLKWTQDLHERF  1459
             MYHH  +GKS+H S       ERH+F+QG    G     LVLSTDAKPRLKWT DLH+RF
Sbjct  1     MYHHQHRGKSIHSS-------ERHMFLQGGGNGGGGDSGLVLSTDAKPRLKWTPDLHDRF  53

Query  1458  VEAVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHAN--SSSNKAMS  1285
             VEAVNQLGGADKATPK+V+K MGI GLTLYHLKSHLQKYRLSKNLHG AN  S +NK   
Sbjct  54    VEAVNQLGGADKATPKTVMKIMGIPGLTLYHLKSHLQKYRLSKNLHGQANGGSGTNK---  110

Query  1284  SGMDAATGSDKIPEANG-------NHINSANIGP----LANTNLPISEAIQIQIEVQRRL  1138
             +G  A +   ++ EANG          NS  +GP     +N NL ISE IQ+QIEVQ+RL
Sbjct  111   TGTVAVSVDQRLGEANGAAAAAAAARTNSIVVGPQPSSQSNKNLQISETIQMQIEVQKRL  170

Query  1137  HEQLEVQRHLQLRIEAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQC  958
             HEQLEVQRHLQLRIE QGKYLQ VLEKAQETLGRQ+LG +GLEAAK QLSELVSKVS QC
Sbjct  171   HEQLEVQRHLQLRIETQGKYLQTVLEKAQETLGRQNLGTVGLEAAKVQLSELVSKVSTQC  230

Query  957   LNSAFSGI---KELPGFCQQQAQATQPTDCSLDSCLTSSEGSLRDHE------------M  823
             L +AF  +    +    C Q  Q +QP DCS+DSCLTSSEG  +D +            +
Sbjct  231   LTAAFPELHNQSQSQRVCAQ--QQSQPPDCSMDSCLTSSEGGSKDQQAAQQQQQQQQVLL  288

Query  822   RNSQMGLRSLNFGAHMESTDLYNETRLKQTEFRWCDDIWENRKYLSKMDEETKNNGLSVS  643
              NS + LR                              + +R      D     +GLS+S
Sbjct  289   HNSHLALRP-----------------------------YADRASSGAPDHSL--HGLSMS  317

Query  642   TGLQGGK------WNGNSNYSDRRFTGTDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPY  481
              GL  G+      +NG S    +R  G+    K   +AV   +T                
Sbjct  318   IGLVQGEKAGTEAYNGYSTSEGQRLFGSKRTTK---EAVLEKETG---------------  359

Query  480   FGPKLDLNTDDKTDVASS-----------CKQLDLNGFS  397
             F  ++DLN   +  + SS           CK  DLNGFS
Sbjct  360   FRYRMDLNNAGEDQLISSNSNNDHTSSTTCKMFDLNGFS  398



>ref|XP_009414233.1| PREDICTED: uncharacterized protein LOC103995386 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=409

 Score =   327 bits (837),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 192/433 (44%), Positives = 269/433 (62%), Gaps = 43/433 (10%)
 Frame = -2

Query  1632  MYHHHRQGKSMHPSTNMLMPPERHLFMQ-GENGHGDSGLVLSTDAKPRLKWTQDLHERFV  1456
             MYHH+ Q  S   S+    P +  L +Q G +   +SGLVLSTDAKPRLKWT +LHERF+
Sbjct  1     MYHHYHQSHSNIFSSRETFPADGQLLLQRGGSAPEESGLVLSTDAKPRLKWTSELHERFI  60

Query  1455  EAVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGM  1276
             EAVNQLGGADKATPK+V++ MGI GLTLYHLKSHLQKYRLSKNL   ANS S K++   +
Sbjct  61    EAVNQLGGADKATPKTVMRLMGIPGLTLYHLKSHLQKYRLSKNLQAQANSGSTKSV---I  117

Query  1275  DAATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRI  1096
                  +++  + NG+ + + +  P +N +  I+EA+Q+QIEVQR+L E LEVQR+LQL+I
Sbjct  118   GCTLAAERTIDVNGSFMVNTSTMPQSNKSFQINEALQMQIEVQRQLQEHLEVQRNLQLQI  177

Query  1095  EAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGF  916
             EAQGKYLQ+VLEKAQETLG+Q+LG  G+E AK QL ELVSK+S++C ++AF G +E+PG 
Sbjct  178   EAQGKYLQSVLEKAQETLGKQNLGSPGVEDAKVQLCELVSKISSECFSNAFQGSEEIPGL  237

Query  915   CQQQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQ  736
                +   +QP DCS++SCLTS EGS      +++   LRS N    +    ++  +RL+ 
Sbjct  238   NTSELHPSQPVDCSVESCLTSFEGS------QSACKSLRSCNGSLPLCQQQVHENSRLEN  291

Query  735   TEFRWCDDIWENRKYLSKMDEETKNNGL-----------SVSTGLQGGKWNGNSNYSDRR  589
             T+  WC  + E++ + S    +++               S+ T  +GG            
Sbjct  292   TQSAWC-YLHEHKTFSSSSLGDSERTSFAAQKDFETLPTSIKTQNEGG------------  338

Query  588   FTGTDADVKLFAQ---AVDRSDTSKPEKQ----KTSQEYKLPYFGPKLDLNTDDKTDVAS  430
              TG++A  K       +V+  ++S+P  Q    K S  + L     +LDLN  +  +  +
Sbjct  339   -TGSEAQGKESDDENISVEHPNSSRPADQQGRGKQSDRFGLLTHTAQLDLNAHEDNEGGT  397

Query  429   SCKQLDLNGFSWN  391
             S +  DLNGFSW+
Sbjct  398   SSR-FDLNGFSWS  409



>ref|XP_010524966.1| PREDICTED: uncharacterized protein LOC104802861 isoform X2 [Tarenaya 
hassleriana]
Length=379

 Score =   325 bits (832),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 193/407 (47%), Positives = 245/407 (60%), Gaps = 37/407 (9%)
 Frame = -2

Query  1584  MLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEAVNQLGGADKATPKSV  1405
             M +P ERH F++G N  GDSGL+LSTDAKPRLKWT DLHERFV+AVNQL GADKATPK++
Sbjct  1     MPIPYERHPFLRGVNDPGDSGLILSTDAKPRLKWTPDLHERFVKAVNQLDGADKATPKAI  60

Query  1404  LKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDAATGSDKIPEANGNHI  1225
             +K MG+ GLTLYHLKSHLQKYRLSKNL+G AN    +        A   +K  +AN  H 
Sbjct  61    MKVMGVPGLTLYHLKSHLQKYRLSKNLNGQANYQKYQKYRL---VAMAEEKSHDANEIHT  117

Query  1224  NSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVLEKAQET  1045
              S +IG     NLPISEA+Q+Q+EVQ+RLHEQLE      LRIEA GKYLQAVLEKA ET
Sbjct  118   ESFSIGQPTEKNLPISEALQMQVEVQQRLHEQLE------LRIEAHGKYLQAVLEKAHET  171

Query  1044  LGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFCQQQAQATQPTDCSLDS  865
             LG+Q+LG  G+EAAK QLSEL SKVS +  ++ F   KEL     QQ + T P+ CSLDS
Sbjct  172   LGKQNLGTDGIEAAKVQLSELASKVSAEYSHTTFQEPKELQSLHPQQME-TYPSVCSLDS  230

Query  864   CLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQTEFRWCDDIWENRKYLS  685
              LTS E +    ++  +++GLR  +  +  E  ++  +   ++ E  W +   E R Y S
Sbjct  231   SLTSRERNQTIPKIVENRLGLRPYHGDSKSEQKEISEQQLFQRLELAWSEGQRETRTYFS  290

Query  684   KMDEETKNN---------GLSVSTGLQGGKWNGNSNYSDRRFTGTDADVKLFAQAVDRSD  532
              M  +T+            LS+  GL G K   N+ Y++ R T  D D K   +     D
Sbjct  291   TMVNDTEARISSSERSLGNLSIGIGLYGQKGQENTGYTEER-TKKDEDCKFETRNQKGMD  349

Query  531   TSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNGFSWN  391
             ++                  +LDLNT  +    +  KQ DLNGFSWN
Sbjct  350   STT-----------------ELDLNTHGENYDTARPKQFDLNGFSWN  379



>ref|XP_004141144.1| PREDICTED: uncharacterized protein LOC101206445 [Cucumis sativus]
 ref|XP_004158336.1| PREDICTED: uncharacterized protein LOC101225289 [Cucumis sativus]
Length=390

 Score =   324 bits (831),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 215/439 (49%), Positives = 262/439 (60%), Gaps = 76/439 (17%)
 Frame = -2

Query  1632  MYHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSG--LVLSTDAKPRLKWTQDLHERF  1459
             MYHH  +GKS+H S       ERH+F+QG    G     LVLSTDAKPRLKWT DLH+RF
Sbjct  1     MYHHQHRGKSIHSS-------ERHMFLQGGGNGGGGDSGLVLSTDAKPRLKWTPDLHDRF  53

Query  1458  VEAVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHAN--SSSNKAMS  1285
             VEAVNQLGGADKATPK+V+K MGI GLTLYHLKSHLQKYRLSKNLHG AN  S +NK   
Sbjct  54    VEAVNQLGGADKATPKTVMKIMGIPGLTLYHLKSHLQKYRLSKNLHGQANGGSGTNK---  110

Query  1284  SGMDAATGSDKIPEANG----NHINSANIGP----LANTNLPISEAIQIQIEVQRRLHEQ  1129
             +G  A +   ++ EANG       ++  +GP     +N +L ISE IQ+QIEVQ+RLHEQ
Sbjct  111   TGTVAVSVDQRLGEANGAAAAARTSNIVVGPQPTSQSNKSLQISETIQMQIEVQKRLHEQ  170

Query  1128  LEVQRHLQLRIEAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNS  949
             LEVQRHLQLRIEAQGKYLQ VLEKAQETLGRQ+LG +GLEAAK QLSELVSKVS QCL +
Sbjct  171   LEVQRHLQLRIEAQGKYLQTVLEKAQETLGRQNLGTVGLEAAKVQLSELVSKVSTQCLTA  230

Query  948   AFSGI---KELPGFCQQQAQATQPTDCSLDSCLTSSEGSLRDHE--------MRNSQMGL  802
             AF  +    +    C Q  Q +QP DCS+DSCLTSSEG  +D +        + NS + L
Sbjct  231   AFPELHNQSQSQRVCAQ--QQSQPPDCSMDSCLTSSEGGSKDQQAQQQQHVLLHNSHLAL  288

Query  801   RSLNFGAHMESTDLYNETRLKQTEFRWCDDIWENRKYLSKMDEETKNNGLSVSTGLQGGK  622
             R                              + +R      D     +GLS+S GL  G+
Sbjct  289   RP-----------------------------YADRASSGAPDHSL--HGLSMSIGLVQGE  317

Query  621   WNGNSNYSDRRFTGTDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLD--LNTDD  448
               G   Y+      T    +LF     R+  +  EK+ T   Y++       D  +++++
Sbjct  318   KAGPEGYNGY---STSEGQRLFGS--KRTKDAVMEKE-TGFRYRMDLNNAGEDQLISSNN  371

Query  447   KTDVASS--CKQLDLNGFS  397
               D  SS  CK  DLNGFS
Sbjct  372   NNDHTSSTTCKMFDLNGFS  390



>ref|XP_009414234.1| PREDICTED: uncharacterized protein LOC103995386 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=407

 Score =   325 bits (832),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 195/433 (45%), Positives = 269/433 (62%), Gaps = 45/433 (10%)
 Frame = -2

Query  1632  MYHHHRQGKSMHPSTNMLMPPERHLFMQ-GENGHGDSGLVLSTDAKPRLKWTQDLHERFV  1456
             MYHH+ Q  S   S+    P +  L +Q G +   +SGLVLSTDAKPRLKWT +LHERF+
Sbjct  1     MYHHYHQSHSNIFSSRETFPADGQLLLQRGGSAPEESGLVLSTDAKPRLKWTSELHERFI  60

Query  1455  EAVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGM  1276
             EAVNQLGGADKATPK+V++ MGI GLTLYHLKSHLQKYRLSKNL   ANS S K   SG 
Sbjct  61    EAVNQLGGADKATPKTVMRLMGIPGLTLYHLKSHLQKYRLSKNLQAQANSGSTK---SGC  117

Query  1275  DAATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRI  1096
               A  +++  + NG+ + + +  P +N +  I+EA+Q+QIEVQR+L E LEVQR+LQL+I
Sbjct  118   TLA--AERTIDVNGSFMVNTSTMPQSNKSFQINEALQMQIEVQRQLQEHLEVQRNLQLQI  175

Query  1095  EAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGF  916
             EAQGKYLQ+VLEKAQETLG+Q+LG  G+E AK QL ELVSK+S++C ++AF G +E+PG 
Sbjct  176   EAQGKYLQSVLEKAQETLGKQNLGSPGVEDAKVQLCELVSKISSECFSNAFQGSEEIPGL  235

Query  915   CQQQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQ  736
                +   +QP DCS++SCLTS EGS      +++   LRS N    +    ++  +RL+ 
Sbjct  236   NTSELHPSQPVDCSVESCLTSFEGS------QSACKSLRSCNGSLPLCQQQVHENSRLEN  289

Query  735   TEFRWCDDIWENRKYLSKMDEETKNNGL-----------SVSTGLQGGKWNGNSNYSDRR  589
             T+  WC  + E++ + S    +++               S+ T  +GG            
Sbjct  290   TQSAWC-YLHEHKTFSSSSLGDSERTSFAAQKDFETLPTSIKTQNEGG------------  336

Query  588   FTGTDADVKLFAQ---AVDRSDTSKPEKQ----KTSQEYKLPYFGPKLDLNTDDKTDVAS  430
              TG++A  K       +V+  ++S+P  Q    K S  + L     +LDLN  +  +  +
Sbjct  337   -TGSEAQGKESDDENISVEHPNSSRPADQQGRGKQSDRFGLLTHTAQLDLNAHEDNEGGT  395

Query  429   SCKQLDLNGFSWN  391
             S +  DLNGFSW+
Sbjct  396   SSR-FDLNGFSWS  407



>ref|XP_004489717.1| PREDICTED: uncharacterized protein LOC101512896 isoform X4 [Cicer 
arietinum]
Length=385

 Score =   323 bits (828),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 205/425 (48%), Positives = 264/425 (62%), Gaps = 55/425 (13%)
 Frame = -2

Query  1629  YHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEA  1450
             Y+HH+Q ++MH          R     G NG GDSGLVLSTDAKPRLKWT DLHERF+EA
Sbjct  3     YNHHQQARNMHAL--------RMQIQGGGNGSGDSGLVLSTDAKPRLKWTTDLHERFIEA  54

Query  1449  VNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNK-AMSSGMD  1273
             VNQLGGADKATPK+VLK MGI GLTLYHLKSHLQKYR+SK ++G  N+ S+K A+++ + 
Sbjct  55    VNQLGGADKATPKTVLKLMGIPGLTLYHLKSHLQKYRISKTMNGQTNTGSSKIALTTEV-  113

Query  1272  AATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIE  1093
                 S ++ EA+G H+   +IG   N N  I+EA  +Q+EVQRRLHEQLEVQ+HLQLRIE
Sbjct  114   ----SSRMSEASGIHMKHLSIGLQTNKNSEINEAFNMQMEVQRRLHEQLEVQKHLQLRIE  169

Query  1092  AQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFC  913
             AQGKYLQ+VLEKA+ETLG Q+LG MGL+ AK QLS+  S+VSN+ L+S F G+KEL    
Sbjct  170   AQGKYLQSVLEKAKETLGTQNLGTMGLDDAKVQLSKFTSRVSNENLDSKFLGLKELHVHW  229

Query  912   QQQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQT  733
              QQ +  +  D S+ S LT+SE S RD EM N  M L     G   E  D   E    + 
Sbjct  230   PQQTREDETIDYSMGSFLTNSEDSQRDQEMHNKGMKL-----GVSKECVD---EPMPLKN  281

Query  732   EFRWCDDIWENRKYLSKMDEETKNNGL---------SVST-GLQGGKWNGNSNYSDRRFT  583
             +F  C+   EN  ++S  +      G+         ++S   L+G +W        +R  
Sbjct  282   DFTLCEKEKENVMFVSSSNHRVLKGGVHEKENMWKRTISKEDLKGEEW--------KRIN  333

Query  582   GTDAD-VKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLN  406
               + + V+L           K    K SQ+Y+L  F  KLDLN++   D +S C++ DLN
Sbjct  334   NIETNGVQL-----------KLNSDKISQDYRLANFEVKLDLNSN---DASSQCQKFDLN  379

Query  405   GFSWN  391
             GFSWN
Sbjct  380   GFSWN  384



>ref|XP_008465330.1| PREDICTED: uncharacterized protein LOC103502977 isoform X1 [Cucumis 
melo]
 ref|XP_008465331.1| PREDICTED: uncharacterized protein LOC103502977 isoform X1 [Cucumis 
melo]
Length=404

 Score =   324 bits (830),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 218/462 (47%), Positives = 258/462 (56%), Gaps = 108/462 (23%)
 Frame = -2

Query  1632  MYHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSG--LVLSTDAKPRLKWTQDLHERF  1459
             MYHH  +GKS+H S       ERH+F+QG    G     LVLSTDAKPRLKWT DLH+RF
Sbjct  1     MYHHQHRGKSIHSS-------ERHMFLQGGGNGGGGDSGLVLSTDAKPRLKWTPDLHDRF  53

Query  1458  VEAVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHAN--SSSNK---  1294
             VEAVNQLGGADKATPK+V+K MGI GLTLYHLKSHLQKYRLSKNLHG AN  S +NK   
Sbjct  54    VEAVNQLGGADKATPKTVMKIMGIPGLTLYHLKSHLQKYRLSKNLHGQANGGSGTNKTGM  113

Query  1293  AMSSGMDAATGSDKIPEANG-------NHINSANIGP----LANTNLPISEAIQIQIEVQ  1147
                 G  A +   ++ EANG          NS  +GP     +N NL ISE IQ+QIEVQ
Sbjct  114   GWRVGTVAVSVDQRLGEANGAAAAAAAARTNSIVVGPQPSSQSNKNLQISETIQMQIEVQ  173

Query  1146  RRLHEQLEVQRHLQLRIEAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVS  967
             +RLHEQLEVQRHLQLRIE QGKYLQ VLEKAQETLGRQ+LG +GLEAAK QLSELVSKVS
Sbjct  174   KRLHEQLEVQRHLQLRIETQGKYLQTVLEKAQETLGRQNLGTVGLEAAKVQLSELVSKVS  233

Query  966   NQCLNSAFSGI---KELPGFCQQQAQATQPTDCSLDSCLTSSEGSLRDHE----------  826
              QCL +AF  +    +    C Q  Q +QP DCS+DSCLTSSEG  +D +          
Sbjct  234   TQCLTAAFPELHNQSQSQRVCAQ--QQSQPPDCSMDSCLTSSEGGSKDQQAAQQQQQQQQ  291

Query  825   --MRNSQMGLRSLNFGAHMESTDLYNETRLKQTEFRWCDDIWENRKYLSKMDEETKNNGL  652
               + NS + LR                              + +R      D     +GL
Sbjct  292   VLLHNSHLALRP-----------------------------YADRASSGAPDHSL--HGL  320

Query  651   SVSTGLQGGK------WNGNSNYSDRRFTGTDADVKLFAQAVDRSDTSKPEKQKTSQEYK  490
             S+S GL  G+      +NG S    +R  G+    K   +AV   +T             
Sbjct  321   SMSIGLVQGEKAGTEAYNGYSTSEGQRLFGSKRTTK---EAVLEKETG------------  365

Query  489   LPYFGPKLDLNTDDKTDVASS-----------CKQLDLNGFS  397
                F  ++DLN   +  + SS           CK  DLNGFS
Sbjct  366   ---FRYRMDLNNAGEDQLISSNSNNDHTSSTTCKMFDLNGFS  404



>gb|KGN59767.1| hypothetical protein Csa_3G844850 [Cucumis sativus]
Length=396

 Score =   322 bits (826),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 215/442 (49%), Positives = 262/442 (59%), Gaps = 76/442 (17%)
 Frame = -2

Query  1632  MYHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSG--LVLSTDAKPRLKWTQDLHERF  1459
             MYHH  +GKS+H S       ERH+F+QG    G     LVLSTDAKPRLKWT DLH+RF
Sbjct  1     MYHHQHRGKSIHSS-------ERHMFLQGGGNGGGGDSGLVLSTDAKPRLKWTPDLHDRF  53

Query  1458  VEAVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHAN--SSSNKAMS  1285
             VEAVNQLGGADKATPK+V+K MGI GLTLYHLKSHLQKYRLSKNLHG AN  S +NK  +
Sbjct  54    VEAVNQLGGADKATPKTVMKIMGIPGLTLYHLKSHLQKYRLSKNLHGQANGGSGTNKTGT  113

Query  1284  S---GMDAATGSDKIPEANG----NHINSANIGP----LANTNLPISEAIQIQIEVQRRL  1138
                 G  A +   ++ EANG       ++  +GP     +N +L ISE IQ+QIEVQ+RL
Sbjct  114   GWRVGTVAVSVDQRLGEANGAAAAARTSNIVVGPQPTSQSNKSLQISETIQMQIEVQKRL  173

Query  1137  HEQLEVQRHLQLRIEAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQC  958
             HEQLEVQRHLQLRIEAQGKYLQ VLEKAQETLGRQ+LG +GLEAAK QLSELVSKVS QC
Sbjct  174   HEQLEVQRHLQLRIEAQGKYLQTVLEKAQETLGRQNLGTVGLEAAKVQLSELVSKVSTQC  233

Query  957   LNSAFSGI---KELPGFCQQQAQATQPTDCSLDSCLTSSEGSLRDHE--------MRNSQ  811
             L +AF  +    +    C Q  Q +QP DCS+DSCLTSSEG  +D +        + NS 
Sbjct  234   LTAAFPELHNQSQSQRVCAQ--QQSQPPDCSMDSCLTSSEGGSKDQQAQQQQHVLLHNSH  291

Query  810   MGLRSLNFGAHMESTDLYNETRLKQTEFRWCDDIWENRKYLSKMDEETKNNGLSVSTGLQ  631
             + LR                              + +R      D     +GLS+S GL 
Sbjct  292   LALRP-----------------------------YADRASSGAPDHSL--HGLSMSIGLV  320

Query  630   GGKWNGNSNYSDRRFTGTDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLD--LN  457
              G+  G   Y+      T    +LF     R+  +  EK+ T   Y++       D  ++
Sbjct  321   QGEKAGPEGYNGY---STSEGQRLFGS--KRTKDAVMEKE-TGFRYRMDLNNAGEDQLIS  374

Query  456   TDDKTDVASS--CKQLDLNGFS  397
             +++  D  SS  CK  DLNGFS
Sbjct  375   SNNNNDHTSSTTCKMFDLNGFS  396



>ref|XP_009416347.1| PREDICTED: uncharacterized protein LOC103996985 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=379

 Score =   318 bits (815),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 183/417 (44%), Positives = 247/417 (59%), Gaps = 41/417 (10%)
 Frame = -2

Query  1632  MYHHH-RQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFV  1456
             MY H   Q  +   S+ +  P ER LF+Q  +  G+SGLVLST+AKPRLKW  +LH RF+
Sbjct  1     MYQHQPHQSHNNLISSRIAAPSERQLFLQRGSTTGESGLVLSTEAKPRLKWNPELHARFI  60

Query  1455  EAVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGM  1276
             EAVNQLGGADKATPK++++ MGI GLTLYHLKSHLQKYRL KNL    N  S K +    
Sbjct  61    EAVNQLGGADKATPKTIMRLMGIPGLTLYHLKSHLQKYRLGKNLQAQTNIRSTKNI---F  117

Query  1275  DAATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRI  1096
               +  +++ PE NG+   S NI    N  + I+EA   QIEVQ++LHEQLEVQRHLQ+RI
Sbjct  118   GCSLAAERTPEDNGS---SRNIAAPTNKTMQINEAFTKQIEVQKQLHEQLEVQRHLQVRI  174

Query  1095  EAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGF  916
             EAQG+YLQ VLEKAQE L +Q LG +GLE AK QLSELV+KVS +C  ++F G++E+P  
Sbjct  175   EAQGRYLQLVLEKAQERLEKQSLGSVGLEVAKVQLSELVTKVSGECFGNSFLGVEEIPVL  234

Query  915   CQQQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSL--NFGAHMESTDLYNETRL  742
                Q       DCS+DSCLT S+ S ++ +  ++ +G+R+   +  + M+    + E +L
Sbjct  235   HMSQLTPAHFADCSVDSCLT-SDRSQKEQDTHDTTIGIRACHKDLPSCMKQ---FGEDKL  290

Query  741   KQTEFRWCDDIWENRKYLSKMDEETKNNGLSVSTGLQGGKWNGNSNYSDRRFTGTDADVK  562
             +QT+  WC D+ E + + S  + + K N                    DR          
Sbjct  291   EQTQHAWCGDLNEQKIFSSVPEVQRKENN------------------EDR----------  322

Query  561   LFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNGFSWN  391
             L           + E +K S  + L     +L+L   +  + AS CKQ +LNGFSWN
Sbjct  323   LLEHPSSNRSVVRQETKKQSDGFGLSCLTTELELKIHEDDEGASGCKQFELNGFSWN  379



>ref|XP_002467933.1| hypothetical protein SORBIDRAFT_01g036680 [Sorghum bicolor]
 gb|EER94931.1| hypothetical protein SORBIDRAFT_01g036680 [Sorghum bicolor]
Length=353

 Score =   316 bits (809),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 166/302 (55%), Positives = 211/302 (70%), Gaps = 13/302 (4%)
 Frame = -2

Query  1632  MYHHHRQ--GKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERF  1459
             MYHH +Q    S   S+    PPERH+ +QG +   +SGLVLSTDAKPRLKWT +LHERF
Sbjct  1     MYHHQQQLQSHSHFLSSRQTFPPERHMILQGGSIPAESGLVLSTDAKPRLKWTPELHERF  60

Query  1458  VEAVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSG  1279
             VEAVNQLGG DKATPK++++ MG+ GLTLYHLKSHLQKYRLSKN+H  AN  + K +   
Sbjct  61    VEAVNQLGGPDKATPKTIMRLMGVPGLTLYHLKSHLQKYRLSKNIHAQANGGNAKNV---  117

Query  1278  MDAATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLR  1099
             +  A   +K PE NG+  +  N+G   N ++ I EA+Q+QIEVQRRLHEQLEVQRHLQLR
Sbjct  118   VGCAMAMEKPPEGNGSPASHLNLGTQTNKSVHIGEALQMQIEVQRRLHEQLEVQRHLQLR  177

Query  1098  IEAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPG  919
             IEAQGKYLQ+VLEKAQETL +Q+ G +G+E AK QLSELVSKVS +CL  +F+G +E+ G
Sbjct  178   IEAQGKYLQSVLEKAQETLSKQNAGSVGVETAKMQLSELVSKVSTECLQHSFTGFEEIEG  237

Query  918   FCQQQAQATQPTDCSLDSCLTSSEGSLRDHEM--------RNSQMGLRSLNFGAHMESTD  763
                 Q    Q  D S+DSCLT+ +GS +D ++        R  ++G  + +  A     D
Sbjct  238   SQILQGHTIQLGDGSVDSCLTACDGSQKDQDILSISLSAHRGKEIGGMAFDMQAKERRED  297

Query  762   LY  757
             L+
Sbjct  298   LF  299



>ref|XP_006654563.1| PREDICTED: uncharacterized protein LOC102706285 isoform X1 [Oryza 
brachyantha]
 ref|XP_006654564.1| PREDICTED: uncharacterized protein LOC102706285 isoform X2 [Oryza 
brachyantha]
Length=413

 Score =   317 bits (812),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 193/433 (45%), Positives = 264/433 (61%), Gaps = 39/433 (9%)
 Frame = -2

Query  1632  MYHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVE  1453
             MYH H QG+S   +T    P ERHLF+ G N  GDSGLVLSTDAKPRLKWT +LH+RFV+
Sbjct  1     MYHQH-QGRSDLFTTRTSFPMERHLFLHGGNTQGDSGLVLSTDAKPRLKWTPELHQRFVD  59

Query  1452  AVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNK-AMSSGM  1276
             AVNQLGGA+KATPK+V++ MGI GLTLYHLKSHLQKYRLSKNL G  N  + K A+    
Sbjct  60    AVNQLGGAEKATPKTVMRLMGIPGLTLYHLKSHLQKYRLSKNLQGQTNVGTTKNALGGCT  119

Query  1275  DAATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRI  1096
             D A   D+IP  +   + SAN  P A   + I EA+Q+QIEVQR+L+EQLEVQRHLQLRI
Sbjct  120   DVA---DRIPGTSALAMASANAIPQAEKTIQIGEALQMQIEVQRQLNEQLEVQRHLQLRI  176

Query  1095  EAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGF  916
             EAQGKYLQAVLE+AQETLG+Q+LG   LE AK ++SELVS+VSN+CL++A + I+E  G 
Sbjct  177   EAQGKYLQAVLEQAQETLGKQNLGPASLEDAKVKISELVSQVSNECLSNAVTEIRESSGI  236

Query  915   CQQQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQ  736
                + +  Q  + S ++CL+++EG +++H +++  +        A+ +ST L+ + R + 
Sbjct  237   HGLEPRQIQFVESSANNCLSAAEGFIKEHRLQSHGV------LKAYDDST-LFCQKRSQD  289

Query  735   TEFRWCDDIWENRKYLSKMDEETKNNGLSVSTGLQGGKWNGNSNYSDRRFTGTDADVKLF  556
              + ++          L++   E +   L   T     + N +       +  T  +    
Sbjct  290   QDSQYS---------LNRSLSERRTGQLYGGTEYHKAEGNESDTEVLHEYIATQKNGGGS  340

Query  555   AQA---------VDRSDTSKPEKQKTSQEY----KLPYF-----GPKLDLNTDDKTDVAS  430
               +         V++    +P  ++ + EY    KL  F     G KLDLNT +  D   
Sbjct  341   TTSSTSGSKEVNVEKLYLDEPSCKRQAVEYRRESKLLDFEQQSSGKKLDLNTHNIDDNDQ  400

Query  429   SCKQLDLNGFSWN  391
               +  DLNGFSW+
Sbjct  401   GYRHFDLNGFSWS  413



>ref|XP_004984520.1| PREDICTED: uncharacterized protein LOC101781076 isoform X2 [Setaria 
italica]
 ref|XP_004984521.1| PREDICTED: uncharacterized protein LOC101781076 isoform X3 [Setaria 
italica]
Length=351

 Score =   313 bits (802),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 161/272 (59%), Positives = 198/272 (73%), Gaps = 5/272 (2%)
 Frame = -2

Query  1632  MYHHHRQ--GKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERF  1459
             MYHH +Q    S   S+    PPERHL +QG +   + GLVLSTDAKPRLKWT +LHERF
Sbjct  1     MYHHQQQLQSHSHFLSSRQTSPPERHLLLQGGSIPAEPGLVLSTDAKPRLKWTPELHERF  60

Query  1458  VEAVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSG  1279
             V+AVNQLGG DKATPK++++ MG+ GLTLYHLKSHLQKYRLSKN+H  AN  + K M   
Sbjct  61    VDAVNQLGGPDKATPKTIMRLMGVPGLTLYHLKSHLQKYRLSKNVHAQANGGNAKNM---  117

Query  1278  MDAATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLR  1099
             +      +K PE N +  +  N+G   N ++ I EA+Q+QIEVQRRLHEQLEVQRHLQLR
Sbjct  118   VGCTMAMEKPPEGNSSPASHINLGTQTNKSVHIGEALQMQIEVQRRLHEQLEVQRHLQLR  177

Query  1098  IEAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPG  919
             IEAQGKYLQ+VLEKAQETL +Q+ G +GLE AK QLSELVSKVS +CL  AF+G +E+ G
Sbjct  178   IEAQGKYLQSVLEKAQETLAKQNAGSVGLETAKMQLSELVSKVSTECLQHAFTGFEEMEG  237

Query  918   FCQQQAQATQPTDCSLDSCLTSSEGSLRDHEM  823
                 Q    Q  D S+DSCLT+ +GS +D ++
Sbjct  238   SQMAQGHTMQLGDGSVDSCLTACDGSQKDQDI  269



>ref|XP_009416343.1| PREDICTED: uncharacterized protein LOC103996985 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009416345.1| PREDICTED: uncharacterized protein LOC103996985 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009416346.1| PREDICTED: uncharacterized protein LOC103996985 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=381

 Score =   313 bits (803),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 183/418 (44%), Positives = 247/418 (59%), Gaps = 41/418 (10%)
 Frame = -2

Query  1632  MYHHH-RQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFV  1456
             MY H   Q  +   S+ +  P ER LF+Q  +  G+SGLVLST+AKPRLKW  +LH RF+
Sbjct  1     MYQHQPHQSHNNLISSRIAAPSERQLFLQRGSTTGESGLVLSTEAKPRLKWNPELHARFI  60

Query  1455  EAVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGM  1276
             EAVNQLGGADKATPK++++ MGI GLTLYHLKSHLQKYRL KNL    N  S K +    
Sbjct  61    EAVNQLGGADKATPKTIMRLMGIPGLTLYHLKSHLQKYRLGKNLQAQTNIRSTKNI---F  117

Query  1275  DAATGSDKIPEANGNHINSANIGPLAN-TNLPISEAIQIQIEVQRRLHEQLEVQRHLQLR  1099
               +  +++ PE NG+  N A   P  N   + I+EA   QIEVQ++LHEQLEVQRHLQ+R
Sbjct  118   GCSLAAERTPEDNGSSRNIA--APTNNFRTMQINEAFTKQIEVQKQLHEQLEVQRHLQVR  175

Query  1098  IEAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPG  919
             IEAQG+YLQ VLEKAQE L +Q LG +GLE AK QLSELV+KVS +C  ++F G++E+P 
Sbjct  176   IEAQGRYLQLVLEKAQERLEKQSLGSVGLEVAKVQLSELVTKVSGECFGNSFLGVEEIPV  235

Query  918   FCQQQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSL--NFGAHMESTDLYNETR  745
                 Q       DCS+DSCLT S+ S ++ +  ++ +G+R+   +  + M+    + E +
Sbjct  236   LHMSQLTPAHFADCSVDSCLT-SDRSQKEQDTHDTTIGIRACHKDLPSCMKQ---FGEDK  291

Query  744   LKQTEFRWCDDIWENRKYLSKMDEETKNNGLSVSTGLQGGKWNGNSNYSDRRFTGTDADV  565
             L+QT+  WC D+ E + + S  + + K N                    DR         
Sbjct  292   LEQTQHAWCGDLNEQKIFSSVPEVQRKENN------------------EDR---------  324

Query  564   KLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNGFSWN  391
              L           + E +K S  + L     +L+L   +  + AS CKQ +LNGFSWN
Sbjct  325   -LLEHPSSNRSVVRQETKKQSDGFGLSCLTTELELKIHEDDEGASGCKQFELNGFSWN  381



>ref|XP_009406837.1| PREDICTED: protein PHR1-LIKE 1-like isoform X4 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009406838.1| PREDICTED: protein PHR1-LIKE 1-like isoform X4 [Musa acuminata 
subsp. malaccensis]
Length=386

 Score =   313 bits (803),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 191/424 (45%), Positives = 247/424 (58%), Gaps = 48/424 (11%)
 Frame = -2

Query  1632  MYHHH-RQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFV  1456
             M+ H   QG +   S     P ER LF+Q  N  G+ GLVLSTDAKPRLKW  +LHERFV
Sbjct  1     MFQHQPHQGHNNLLSPRTTFPSERQLFLQRGNTTGEPGLVLSTDAKPRLKWNPELHERFV  60

Query  1455  EAVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGM  1276
             EAVNQLGGADKATPK++++ MGI GLTLYHLKSHLQKYRL KNL    N+ S K +   +
Sbjct  61    EAVNQLGGADKATPKTIMRLMGIPGLTLYHLKSHLQKYRLGKNLLAQTNTGSTKNV---I  117

Query  1275  DAATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRI  1096
                  ++K  E NG   +S NI    N  + I+EA+Q+QIEVQR+LHEQLEVQRHLQL+I
Sbjct  118   GCTLAAEKTSEGNG---SSMNIAAPTNKTMQINEALQMQIEVQRQLHEQLEVQRHLQLQI  174

Query  1095  EAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGF  916
             EAQGKYLQ+VLEKAQETLG+Q+LG  GLE AK QLSELVSKV                  
Sbjct  175   EAQGKYLQSVLEKAQETLGKQNLGSAGLEVAKFQLSELVSKV------------------  216

Query  915   CQQQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQ  736
                          S+DSCLTSSEGS ++ +   + MGLR  +    +        TRL+Q
Sbjct  217   -------------SVDSCLTSSEGSQKEQDTHAAIMGLRVSHQDFPLYVKQFGEHTRLEQ  263

Query  735   TEFRWCDDIWENRKYLSKMDEETKN---------NGLSVSTGLQGGKWNGNSNYSDRRFT  583
             T+  W  D+ +   + S +  +++          N +  S   Q    +  +    R+  
Sbjct  264   TQNAWHGDLSKQTTFTSSILRDSQRASFPIQRDLNIIQASVKPQREIRDSGTVPEARKKD  323

Query  582   GTDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNG  403
               D D+ L   +  R+   K E +K +  ++LP     L+L   + ++ ASSCK+ DLNG
Sbjct  324   RDDEDMFLEHTSSKRAAV-KQESRKQTDGFELPCLTTDLELKIHEGSEGASSCKKFDLNG  382

Query  402   FSWN  391
             FSWN
Sbjct  383   FSWN  386



>tpg|DAA45112.1| TPA: putative MYB DNA-binding domain superfamily protein [Zea 
mays]
Length=359

 Score =   311 bits (798),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 160/277 (58%), Positives = 200/277 (72%), Gaps = 5/277 (2%)
 Frame = -2

Query  1647  ITDSNMYHHHRQ--GKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQD  1474
             ++   MYHH +Q    S   S+    PPERH+ +QG +   + GLVLSTDAKPRLKWT +
Sbjct  1     MSSCQMYHHQQQLQSHSHFLSSRQTFPPERHMLLQGGSIPAEPGLVLSTDAKPRLKWTPE  60

Query  1473  LHERFVEAVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNK  1294
             LHERFVEAVNQLGG DKATPK++++ MG+ GLTLYHLKSHLQKYRLSKN+H  AN  + K
Sbjct  61    LHERFVEAVNQLGGPDKATPKTIMRLMGVPGLTLYHLKSHLQKYRLSKNIHAQANGVNAK  120

Query  1293  AMSSGMDAATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQR  1114
              +   +      DK  E NG+  +  N+G   N ++ I EA+Q+QIEVQRRLHEQLEVQR
Sbjct  121   NV---IGCTMAMDKPLEGNGSPASHLNLGTQTNKSVHIGEALQMQIEVQRRLHEQLEVQR  177

Query  1113  HLQLRIEAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGI  934
             HLQLRIEAQGKYLQ+VLEKAQETL +Q+ G +G+E AK QLSELVSKVS +CL  AF+G 
Sbjct  178   HLQLRIEAQGKYLQSVLEKAQETLSKQNAGSVGVETAKMQLSELVSKVSTECLQHAFTGF  237

Query  933   KELPGFCQQQAQATQPTDCSLDSCLTSSEGSLRDHEM  823
             +E+ G    Q    Q  D S+DSCLT+ +GS +D ++
Sbjct  238   EEIDGSQILQGHTIQLGDGSVDSCLTACDGSQKDQDI  274



>ref|XP_008655182.1| PREDICTED: myb family transcription factor APL-like [Zea mays]
Length=361

 Score =   311 bits (796),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 160/272 (59%), Positives = 198/272 (73%), Gaps = 5/272 (2%)
 Frame = -2

Query  1632  MYHHHRQ--GKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERF  1459
             MYHH +Q    S   S+    PPERH+ +QG +   + GLVLSTDAKPRLKWT +LHERF
Sbjct  8     MYHHQQQLQSHSHFLSSRQTFPPERHMLLQGGSIPAEPGLVLSTDAKPRLKWTPELHERF  67

Query  1458  VEAVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSG  1279
             VEAVNQLGG DKATPK++++ MG+ GLTLYHLKSHLQKYRLSKN+H  AN  + K +   
Sbjct  68    VEAVNQLGGPDKATPKTIMRLMGVPGLTLYHLKSHLQKYRLSKNIHAQANGVNAKNV---  124

Query  1278  MDAATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLR  1099
             +      DK  E NG+  +  N+G   N ++ I EA+Q+QIEVQRRLHEQLEVQRHLQLR
Sbjct  125   IGCTMAMDKPLEGNGSPASHLNLGTQTNKSVHIGEALQMQIEVQRRLHEQLEVQRHLQLR  184

Query  1098  IEAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPG  919
             IEAQGKYLQ+VLEKAQETL +Q+ G +G+E AK QLSELVSKVS +CL  AF+G +E+ G
Sbjct  185   IEAQGKYLQSVLEKAQETLSKQNAGSVGVETAKMQLSELVSKVSTECLQHAFTGFEEIDG  244

Query  918   FCQQQAQATQPTDCSLDSCLTSSEGSLRDHEM  823
                 Q    Q  D S+DSCLT+ +GS +D ++
Sbjct  245   SQILQGHTIQLGDGSVDSCLTACDGSQKDQDI  276



>ref|NP_001049984.1| Os03g0325500 [Oryza sativa Japonica Group]
 gb|ABF95708.1| transfactor, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF11898.1| Os03g0325500 [Oryza sativa Japonica Group]
 gb|EAZ26768.1| hypothetical protein OsJ_10679 [Oryza sativa Japonica Group]
Length=354

 Score =   310 bits (795),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 164/273 (60%), Positives = 203/273 (74%), Gaps = 8/273 (3%)
 Frame = -2

Query  1632  MYHHHRQGKS---MHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHER  1462
             MYHH +Q +S   + PS     P ERHL MQG +  G+SGLVLSTDAKPRLKWT +LHER
Sbjct  1     MYHHQQQLQSHNQLLPSRQSF-PSERHLLMQGGSVSGESGLVLSTDAKPRLKWTPELHER  59

Query  1461  FVEAVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSS  1282
             FVEAVNQLGG +KATPK++++ MG+ GLTLYHLKSHLQKYRLSKNLH  AN+ + K   +
Sbjct  60    FVEAVNQLGGPEKATPKTIMRLMGVPGLTLYHLKSHLQKYRLSKNLHAQANAGNVK---N  116

Query  1281  GMDAATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQL  1102
              +   T ++K  EANG+ ++  N+G   N ++ I EA+Q+QIEVQRRLHEQLEVQRHLQL
Sbjct  117   ALVCTTATEKPSEANGSPVSHLNLGTQTNKSVHIGEALQMQIEVQRRLHEQLEVQRHLQL  176

Query  1101  RIEAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELP  922
             RIEAQGKYLQ+VLEKAQETL +Q+ G +GLE AK +LSELVSKVS +CL  AFSG  E+ 
Sbjct  177   RIEAQGKYLQSVLEKAQETLAKQNAGSVGLETAKMELSELVSKVSTECLQHAFSGF-EIE  235

Query  921   GFCQQQAQATQPTDCSLDSCLTSSEGSLRDHEM  823
                  Q       D S+DSCLT+ +GS +D ++
Sbjct  236   SSQMLQGHTMHLGDGSVDSCLTACDGSQKDQDI  268



>ref|XP_009406836.1| PREDICTED: protein PHR1-LIKE 1-like isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=388

 Score =   310 bits (794),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 191/425 (45%), Positives = 248/425 (58%), Gaps = 48/425 (11%)
 Frame = -2

Query  1632  MYHHH-RQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFV  1456
             M+ H   QG +   S     P ER LF+Q  N  G+ GLVLSTDAKPRLKW  +LHERFV
Sbjct  1     MFQHQPHQGHNNLLSPRTTFPSERQLFLQRGNTTGEPGLVLSTDAKPRLKWNPELHERFV  60

Query  1455  EAVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGM  1276
             EAVNQLGGADKATPK++++ MGI GLTLYHLKSHLQKYRL KNL    N+ S K +   +
Sbjct  61    EAVNQLGGADKATPKTIMRLMGIPGLTLYHLKSHLQKYRLGKNLLAQTNTGSTKNV---I  117

Query  1275  DAATGSDKIPEANGNHINSANIGPLAN-TNLPISEAIQIQIEVQRRLHEQLEVQRHLQLR  1099
                  ++K  E NG+ +N A   P  N   + I+EA+Q+QIEVQR+LHEQLEVQRHLQL+
Sbjct  118   GCTLAAEKTSEGNGSSMNIA--APTNNFRTMQINEALQMQIEVQRQLHEQLEVQRHLQLQ  175

Query  1098  IEAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPG  919
             IEAQGKYLQ+VLEKAQETLG+Q+LG  GLE AK QLSELVSKV                 
Sbjct  176   IEAQGKYLQSVLEKAQETLGKQNLGSAGLEVAKFQLSELVSKV-----------------  218

Query  918   FCQQQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLK  739
                           S+DSCLTSSEGS ++ +   + MGLR  +    +        TRL+
Sbjct  219   --------------SVDSCLTSSEGSQKEQDTHAAIMGLRVSHQDFPLYVKQFGEHTRLE  264

Query  738   QTEFRWCDDIWENRKYLSKMDEETKN---------NGLSVSTGLQGGKWNGNSNYSDRRF  586
             QT+  W  D+ +   + S +  +++          N +  S   Q    +  +    R+ 
Sbjct  265   QTQNAWHGDLSKQTTFTSSILRDSQRASFPIQRDLNIIQASVKPQREIRDSGTVPEARKK  324

Query  585   TGTDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLN  406
                D D+ L   +  R+   K E +K +  ++LP     L+L   + ++ ASSCK+ DLN
Sbjct  325   DRDDEDMFLEHTSSKRAAV-KQESRKQTDGFELPCLTTDLELKIHEGSEGASSCKKFDLN  383

Query  405   GFSWN  391
             GFSWN
Sbjct  384   GFSWN  388



>ref|XP_006443378.1| hypothetical protein CICLE_v10020171mg [Citrus clementina]
 gb|ESR56618.1| hypothetical protein CICLE_v10020171mg [Citrus clementina]
Length=294

 Score =   306 bits (785),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 166/304 (55%), Positives = 205/304 (67%), Gaps = 13/304 (4%)
 Frame = -2

Query  1296  KAMSSGMDAAT-GSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEV  1120
             K  SSG+   T   +++PEAN  H+N+ +IGP  N +L ISE IQ+QIEVQRRLHEQLEV
Sbjct  2     KFKSSGVGPVTVPGERMPEANATHMNNLSIGPQPNKSLHISETIQMQIEVQRRLHEQLEV  61

Query  1119  QRHLQLRIEAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFS  940
             QRHLQLRIEAQGKYLQAVLEKAQETLGRQ+LG  GLEAAK QLSELVSKVS QCLNS FS
Sbjct  62    QRHLQLRIEAQGKYLQAVLEKAQETLGRQNLGTAGLEAAKVQLSELVSKVSTQCLNSTFS  121

Query  939   GIKELPGFCQQQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDL  760
              +KEL GFC QQ QA QPTDCS+DSCLTS EGS +D E+ N  + LR  +    +E  ++
Sbjct  122   DLKELQGFCPQQPQANQPTDCSMDSCLTSCEGSQKDQEIHNGGVRLRPYHGTPTLEPKEI  181

Query  759   YNETRLKQTEFRWCDDIWENRKYLSKMDEETKNNGLSVSTGLQGGKWNGNSNYSDRRFTG  580
               E  L+QTE +W  D+ E+ K+LS + ++     LS+ +G          ++   RF  
Sbjct  182   VEEPMLQQTELKWRKDLKES-KFLSSIGKDRGPGELSIGSG----------SFPAGRFKA  230

Query  579   TDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNT-DDKTDVASSCKQLDLNG  403
             ++ D     Q   + + +K E +    EY+LP F  KLDLN  D + DVAS CKQ DLNG
Sbjct  231   SNEDEHFQDQTNKKPEGAKLENENLLPEYRLPCFSTKLDLNAHDHENDVASGCKQFDLNG  290

Query  402   FSWN  391
             FSWN
Sbjct  291   FSWN  294



>ref|XP_008656404.1| PREDICTED: uncharacterized protein LOC103635802 [Zea mays]
 ref|XP_008656405.1| PREDICTED: uncharacterized protein LOC103635802 [Zea mays]
Length=410

 Score =   310 bits (795),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 189/436 (43%), Positives = 259/436 (59%), Gaps = 50/436 (11%)
 Frame = -2

Query  1632  MYHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVE  1453
             MYH H QG S   +T    P E+H F++G N  GDSGLVLSTDAKPRLKWT +LH+RFV+
Sbjct  1     MYHQH-QGPSELFTTRTSFPMEQHPFLRGGNAQGDSGLVLSTDAKPRLKWTPELHQRFVD  59

Query  1452  AVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMD  1273
             AVNQLGG +KATPK+V++ MGI GLTLYHLKSHLQKYRLSKNL   AN+S++K   + + 
Sbjct  60    AVNQLGGEEKATPKTVMRLMGIPGLTLYHLKSHLQKYRLSKNLQAQANASTSKNGCTPV-  118

Query  1272  AATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIE  1093
                 +D+IP      ++S N+ P A   + I EA+Q+QI+VQR+L+EQLEVQRHLQLRIE
Sbjct  119   ----ADRIPGTTAATMSSTNVLPQAEKTIQIGEALQMQIQVQRQLNEQLEVQRHLQLRIE  174

Query  1092  AQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFC  913
             AQGKYLQAVLE+AQETLG+Q+LG   LE AK ++SELVS+VSN+C ++A + +KE     
Sbjct  175   AQGKYLQAVLEQAQETLGKQNLGPANLEDAKIKISELVSQVSNECFSNAITDVKESSSVH  234

Query  912   QQQAQATQPTDCSLDSCLTSSEGSLRDHEMRN----------------------SQMGL-  802
             + +    +  + S +S L+ +EG +++H++++                      +Q  L 
Sbjct  235   RLEPIQIEFVESSTNSYLSVAEGFIKEHKLQHHGVLKAYDDSSLFCRKRSHEHETQFALN  294

Query  801   RSLNFGAHMESTDLYNETRLKQTEFRWCDDIWENRKYLSKMDEETKNNGLSVSTGLQGGK  622
             RSL   +      L NE    + EF +  D     +Y +      KN   S ++   G K
Sbjct  295   RSL---SEHRMAHLQNEEGYHKAEFGYESDTEMAHEYTAPQ----KNGRCSTTSSASGSK  347

Query  621   WNGNSNYSDRRFTGTDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKT  442
              +    Y + +        K   QAV+    SK        +++ P    KLDLNT +  
Sbjct  348   VDAEKLYLEEQ--------KCARQAVEYPRESK------LVDFEHPCSVNKLDLNTHNVD  393

Query  441   DVASSCKQLDLNGFSW  394
             D   + +  DLNGFSW
Sbjct  394   DTNQAYRHFDLNGFSW  409



>gb|EAY89836.1| hypothetical protein OsI_11384 [Oryza sativa Indica Group]
Length=405

 Score =   310 bits (794),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 163/273 (60%), Positives = 203/273 (74%), Gaps = 8/273 (3%)
 Frame = -2

Query  1632  MYHHHRQGKS---MHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHER  1462
             MYHH +Q +S   + PS     P ERHL MQG +  G+SGLVLSTDAKPRLKWT +LHER
Sbjct  52    MYHHQQQLQSHNQLLPSRQSF-PSERHLLMQGGSVSGESGLVLSTDAKPRLKWTPELHER  110

Query  1461  FVEAVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSS  1282
             FVEAVNQLGG +KATPK++++ MG+ GLTLYHLKSHLQKYRLSKNLH  AN+ + K   +
Sbjct  111   FVEAVNQLGGPEKATPKTIMRLMGVPGLTLYHLKSHLQKYRLSKNLHAQANAGNVK---N  167

Query  1281  GMDAATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQL  1102
              +   T ++K  EANG+ ++  N+G   N ++ I EA+Q+QIEVQRR+HEQLEVQRHLQL
Sbjct  168   ALVCTTATEKPSEANGSPVSHLNLGTQTNKSVHIGEALQMQIEVQRRVHEQLEVQRHLQL  227

Query  1101  RIEAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELP  922
             RIEAQGKYLQ+VLEKAQETL +Q+ G +GLE AK +LSELVSKVS +CL  AFSG  E+ 
Sbjct  228   RIEAQGKYLQSVLEKAQETLAKQNAGSVGLETAKMELSELVSKVSTECLQHAFSGF-EIE  286

Query  921   GFCQQQAQATQPTDCSLDSCLTSSEGSLRDHEM  823
                  Q       D S+DSCLT+ +GS +D ++
Sbjct  287   SSQMLQGHTMHLGDGSVDSCLTACDGSQKDQDI  319



>gb|KDO55099.1| hypothetical protein CISIN_1g013552mg [Citrus sinensis]
Length=277

 Score =   302 bits (774),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 161/288 (56%), Positives = 197/288 (68%), Gaps = 12/288 (4%)
 Frame = -2

Query  1251  IPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQ  1072
             +PEAN  H+N+ +IGP  N +L ISE IQ+QIEVQRRLHEQLEVQRHLQLRIEAQGKYLQ
Sbjct  1     MPEANATHMNNLSIGPQPNKSLHISETIQMQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQ  60

Query  1071  AVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFCQQQAQAT  892
             AVLEKAQETLGRQ+LG  GLEAAK QLSELVSKVS QCLNS FS +KEL GFC QQ QA 
Sbjct  61    AVLEKAQETLGRQNLGTAGLEAAKVQLSELVSKVSTQCLNSTFSDLKELQGFCPQQPQAN  120

Query  891   QPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQTEFRWCDD  712
             QPTDCS+DSCLTS EGS +D E+ N  + LR  +    +E  ++  E  L+QTE +W  D
Sbjct  121   QPTDCSMDSCLTSCEGSQKDQEIHNGGVRLRPYHGTPTLEPKEIVEEPMLQQTELKWRKD  180

Query  711   IWENRKYLSKMDEETKNNGLSVSTGLQGGKWNGNSNYSDRRFTGTDADVKLFAQAVDRSD  532
             + E+ K+LS + ++     LS+ +G          ++   RF  ++ D     Q   + +
Sbjct  181   LKES-KFLSSIGKDRGPGELSIGSG----------SFPAGRFKASNEDEHFQDQTNKKPE  229

Query  531   TSKPEKQKTSQEYKLPYFGPKLDLNT-DDKTDVASSCKQLDLNGFSWN  391
              +K E +    EY+LP F  KLDLN  D + DVAS CKQ DLNGFSWN
Sbjct  230   GAKLENENLLPEYRLPCFSTKLDLNAHDHENDVASGCKQFDLNGFSWN  277



>ref|XP_004961696.1| PREDICTED: uncharacterized protein LOC101755514 isoform X1 [Setaria 
italica]
 ref|XP_004961697.1| PREDICTED: uncharacterized protein LOC101755514 isoform X2 [Setaria 
italica]
 ref|XP_004961698.1| PREDICTED: uncharacterized protein LOC101755514 isoform X3 [Setaria 
italica]
Length=412

 Score =   306 bits (784),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 192/424 (45%), Positives = 258/424 (61%), Gaps = 22/424 (5%)
 Frame = -2

Query  1632  MYHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVE  1453
             MYH H QG S   +T    P E+HLF++G N  GDSGLVLSTDAKPRLKWT +LH+RFV+
Sbjct  1     MYHQH-QGPSELFTTRTSFPMEQHLFLRGGNAQGDSGLVLSTDAKPRLKWTPELHQRFVD  59

Query  1452  AVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMD  1273
             AVNQLGGA+KATPK+V++ MGI GLTLYHLKSHLQKYRLSKNL   AN S++K   + + 
Sbjct  60    AVNQLGGAEKATPKTVMRLMGIPGLTLYHLKSHLQKYRLSKNLQAQANVSTSK---NAIG  116

Query  1272  AATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIE  1093
                 +D++P  +   ++S N  P A   + I EA+Q+QIEVQR+L+EQLEVQRHLQLRIE
Sbjct  117   CTNIADRMPGTSAPTMSSTNAIPQAEKTIQIGEALQMQIEVQRQLNEQLEVQRHLQLRIE  176

Query  1092  AQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFC  913
             AQGKYLQAVLE+AQETLG+Q+LG   LE AK ++SELVS+VSN+C ++A + IKE     
Sbjct  177   AQGKYLQAVLEQAQETLGKQNLGPANLEDAKIKISELVSQVSNECFSNAITDIKESSSVH  236

Query  912   QQQAQATQPTDCSLDSCLTSSEGSLRDHEMR---------NSQMGLRSLNFGAHMESTDL  760
             + + +  Q  + S ++ LT++EG +++H +          +S +  R    G+H   T L
Sbjct  237   RLEPKQIQFVESSTNNYLTAAEGFIKEHRLHHHGVLKAHDDSSLFCRK---GSHEHETPL  293

Query  759   YNETRLKQTEFRWCDDIWENRKYLSKMDEETKNNGLSVSTGLQGGKWNGNSNYSDRRFTG  580
                  L  +E R      EN    SK +   +N+       +   K  G S  S    + 
Sbjct  294   ALNRSL--SERRMAHLQIENG--YSKAELGYENDTEMAPEYIGPPKNGGGSTSSSASGSK  349

Query  579   TDADVKLFAQA-VDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNG  403
              DA+     +    R     P + K   ++     G KLDLNT +  D   + +  DLNG
Sbjct  350   GDAEKPYLEEPNCTRQAVEYPRESKLL-DFGHSCPGKKLDLNTHNVDDTDQAYRHFDLNG  408

Query  402   FSWN  391
             FSW+
Sbjct  409   FSWS  412



>ref|XP_004984519.1| PREDICTED: uncharacterized protein LOC101781076 isoform X1 [Setaria 
italica]
Length=378

 Score =   305 bits (781),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 162/296 (55%), Positives = 199/296 (67%), Gaps = 26/296 (9%)
 Frame = -2

Query  1632  MYHHHRQ--GKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERF  1459
             MYHH +Q    S   S+    PPERHL +QG +   + GLVLSTDAKPRLKWT +LHERF
Sbjct  1     MYHHQQQLQSHSHFLSSRQTSPPERHLLLQGGSIPAEPGLVLSTDAKPRLKWTPELHERF  60

Query  1458  VEAVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHAN----------  1309
             V+AVNQLGG DKATPK++++ MG+ GLTLYHLKSHLQKYRLSKN+H  AN          
Sbjct  61    VDAVNQLGGPDKATPKTIMRLMGVPGLTLYHLKSHLQKYRLSKNVHAQANGGNAKNSKYN  120

Query  1308  --------------SSSNKAMSSGMDAATGSDKIPEANGNHINSANIGPLANTNLPISEA  1171
                           S+     SS +      +K PE N +  +  N+G   N ++ I EA
Sbjct  121   ILRLPSSYQPPIKLSTERPFCSSVVGCTMAMEKPPEGNSSPASHINLGTQTNKSVHIGEA  180

Query  1170  IQIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQL  991
             +Q+QIEVQRRLHEQLEVQRHLQLRIEAQGKYLQ+VLEKAQETL +Q+ G +GLE AK QL
Sbjct  181   LQMQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQSVLEKAQETLAKQNAGSVGLETAKMQL  240

Query  990   SELVSKVSNQCLNSAFSGIKELPGFCQQQAQATQPTDCSLDSCLTSSEGSLRDHEM  823
             SELVSKVS +CL  AF+G +E+ G    Q    Q  D S+DSCLT+ +GS +D ++
Sbjct  241   SELVSKVSTECLQHAFTGFEEMEGSQMAQGHTMQLGDGSVDSCLTACDGSQKDQDI  296



>ref|XP_003568222.1| PREDICTED: uncharacterized protein LOC100842130 [Brachypodium 
distachyon]
 ref|XP_010231241.1| PREDICTED: uncharacterized protein LOC100842130 [Brachypodium 
distachyon]
Length=406

 Score =   305 bits (781),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 189/425 (44%), Positives = 259/425 (61%), Gaps = 30/425 (7%)
 Frame = -2

Query  1632  MYHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVE  1453
             MYH H QG S   ST    P ERHLF+ G +   DSGLVLSTDAKPRLKWT +LH+RFV+
Sbjct  1     MYHQH-QGPSELFSTRTTFPMERHLFLHGGSTQ-DSGLVLSTDAKPRLKWTPELHQRFVD  58

Query  1452  AVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMD  1273
             AVNQLGGA+KATPK+V++ MGI GLTLYHLKSHLQKYRLSKNL    N  + K   + + 
Sbjct  59    AVNQLGGAEKATPKTVMRLMGIPGLTLYHLKSHLQKYRLSKNLQAQVNVGTTK---NAIG  115

Query  1272  AATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIE  1093
              A  +D +P  +   + + N+ P A   + I EA+Q+QIEVQR+L+EQLEVQRHLQLRIE
Sbjct  116   CAVVADSMPATSTPAMTNTNVIPQAEKTIQIGEALQMQIEVQRQLNEQLEVQRHLQLRIE  175

Query  1092  AQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFC  913
             AQGKYLQ+VLE+AQE+LG+Q+LG   LE AK ++SELVS+VSN+C ++A + IKE     
Sbjct  176   AQGKYLQSVLEQAQESLGKQNLGPANLEDAKIKISELVSQVSNECFSNAVTDIKESSRMH  235

Query  912   QQQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLY-NETRLKQ  736
             + + +  Q  + S ++CLT++EG + +H + +  +        A+ +S+ LY  ++   +
Sbjct  236   RLEPRQIQFVESSTNNCLTAAEGYINEHRLHSHGV------LKAYDDSSILYRKQSHGHE  289

Query  735   TEFRWCDDIWENRK-YLSKMDEETKNN-GLSVSTGLQ-----GGKWNGNSNYSDRRFTGT  577
              +F     + E R  +L  + E  K   G    T +Q       K  G S  S    T  
Sbjct  290   YQFPLNRSLSERRMGHLHNVKEYHKAELGSESDTEIQQEYITPQKNVGGSTTSSASGTKE  349

Query  576   DADVKLFAQAVDRSDTSKPEKQKTSQEY---KLPYFGPKLDLNTDDKTDVASSCKQLDLN  406
                 KL+ +        +P  ++ + +Y   + P  G KLDLNT +  D     +  DLN
Sbjct  350   GDIKKLYLE--------EPSCKRRAMDYPSFERPNSGKKLDLNTHNTDDSDQGFRHFDLN  401

Query  405   GFSWN  391
             GFSW+
Sbjct  402   GFSWS  406



>ref|XP_002441286.1| hypothetical protein SORBIDRAFT_09g023830 [Sorghum bicolor]
 gb|EES19716.1| hypothetical protein SORBIDRAFT_09g023830 [Sorghum bicolor]
Length=393

 Score =   303 bits (777),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 184/416 (44%), Positives = 250/416 (60%), Gaps = 47/416 (11%)
 Frame = -2

Query  1569  ERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEAVNQLGGADKATPKSVLKQMG  1390
             E+HLF++G N  GDSGLVLSTDAKPRLKWT +LH+RFV+AVNQLGGA+KATPK+V++ MG
Sbjct  2     EQHLFLRGGNAQGDSGLVLSTDAKPRLKWTPELHQRFVDAVNQLGGAEKATPKTVMRLMG  61

Query  1389  IQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDAATGSDKIPEANGNHINSANI  1210
             I GLTLYHLKSHLQKYRLSKNL   AN S++K   + +   + +D+IP  +   ++S N+
Sbjct  62    IPGLTLYHLKSHLQKYRLSKNLQAQANVSTSK---NAIGCTSVADRIPGTSAATMSSTNV  118

Query  1209  GPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVLEKAQETLGRQD  1030
              P A   + I EA+Q+QIEVQR+L+EQLEVQRHLQLRIEAQGKYLQAVLE+AQETLG+Q+
Sbjct  119   VPQAEKTIQIGEALQMQIEVQRQLNEQLEVQRHLQLRIEAQGKYLQAVLEQAQETLGKQN  178

Query  1029  LGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFCQQQAQATQPTDCSLDSCLTSS  850
             LG   LE AK ++SELVS+VS +C ++A + +K      + + +  Q  + S +S L+ +
Sbjct  179   LGPANLEDAKIKISELVSQVSTECFSNAITDVKGSSSVHRLEPRQIQFVESSTNSYLSVA  238

Query  849   EGSLRDHEMRN----------------------SQMGL-RSLNFGAHMESTDLYNETRLK  739
             EG +++H +++                      +Q  L RSL   +      L NE    
Sbjct  239   EGFIKEHRLQHHGVLKAYDDSSLFCRKRSHEHETQFALNRSL---SERRMAHLQNEEGYS  295

Query  738   QTEFRWCDDIWENRKYLSKMDEETKNNGLSVSTGLQGGKWNGNSNYSDRRFTGTDADVKL  559
             + EF +  D     +Y     E  KN G S ++   G K +    Y             L
Sbjct  296   KAEFGYESDTEMAHEYA----EPQKNGGGSTTSSASGSKVDAEKLY-------------L  338

Query  558   FAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNGFSWN  391
               Q   R     P + K   +++ P  G KLDLNT +  D   + +  DLNGFSW+
Sbjct  339   EEQNCARQAVEYPRESKLV-DFEHPCSGKKLDLNTHNVDDTDQAYRHFDLNGFSWS  393



>ref|XP_006650017.1| PREDICTED: myb family transcription factor APL-like [Oryza brachyantha]
Length=355

 Score =   301 bits (772),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 181/404 (45%), Positives = 234/404 (58%), Gaps = 79/404 (20%)
 Frame = -2

Query  1578  MPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEAVNQLGGADKATPKSVLK  1399
              P ERHL MQG +  G+SGLVLSTDAKPRLKWT +LHERFVEAVNQLGG +KATPK++++
Sbjct  21    FPSERHLLMQGGSVPGESGLVLSTDAKPRLKWTPELHERFVEAVNQLGGPEKATPKTIMR  80

Query  1398  QMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDAATGSDKIPEANGNHINS  1219
              MG+ GLTLYHLKSHLQKYRLSKNLH  AN  + K   + +   T ++K  E N + ++ 
Sbjct  81    LMGVPGLTLYHLKSHLQKYRLSKNLHAQANVGNVK---NALVCTTATEKPSEGNRSPVSH  137

Query  1218  ANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVLEKAQETLG  1039
               +G   N ++ I EA+Q+QIEVQRRLHEQLEVQRHLQLRIEAQGKYLQ+VLEKAQETL 
Sbjct  138   LTLGTQTNKSVHIGEALQMQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQSVLEKAQETLA  197

Query  1038  RQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFCQQQAQATQPTDCSLDSCL  859
             +Q+ G +GLE AK +LSELVSKVS +CL  AFSG +E+      Q       D S+DSCL
Sbjct  198   KQNAGSVGLETAKMELSELVSKVSTECLQHAFSGFEEIESSQMLQGHTMHLGDGSVDSCL  257

Query  858   TSSEGSLRDHEMRNSQMG------LRSLNFGAHMESTDLYNETRLKQTEFRWCDDIWEN-  700
             T  +GS +D ++ +  +       +  ++F  H++               R  +D++ N 
Sbjct  258   TVCDGSQKDQDILSISLSAQKGKEIGCMSFDMHVKE--------------RGSEDLFLNK  303

Query  699   --RKYLSKMDEETKNNGLSVSTGLQGGKWNGNSNYSDRRFTGTDADVKLFAQAVDRSDTS  526
               R+  +  +   + +G S+S   Q  K + N N                       DT 
Sbjct  304   LSRRPSNHQERCERRDGFSMSC--QATKLDLNMN-----------------------DT-  337

Query  525   KPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNGFSW  394
                           Y GPK              CK+ DLNGFSW
Sbjct  338   --------------YGGPK-------------HCKKFDLNGFSW  354



>ref|XP_008649803.1| PREDICTED: uncharacterized protein LOC103630521 [Zea mays]
 ref|XP_008649804.1| PREDICTED: uncharacterized protein LOC103630521 [Zea mays]
 gb|AFW78445.1| putative MYB DNA-binding domain superfamily protein [Zea mays]
Length=414

 Score =   303 bits (775),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 182/422 (43%), Positives = 259/422 (61%), Gaps = 16/422 (4%)
 Frame = -2

Query  1632  MYHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVE  1453
             MYH H QG S   +T    P E+HLF++G N  GDSGLVLSTDAKPRLKWT +LH+RFV+
Sbjct  1     MYHQH-QGLSELFTTRTSFPMEQHLFLRGGNAQGDSGLVLSTDAKPRLKWTPELHQRFVD  59

Query  1452  AVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMD  1273
             AVNQLGGA+KATPK+V++ MGI GLTLYHLKSHLQKYRLSKNL   AN S++K   + + 
Sbjct  60    AVNQLGGAEKATPKTVMRLMGIPGLTLYHLKSHLQKYRLSKNLQAQANVSTSK---NAIG  116

Query  1272  AATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIE  1093
               + +D+IP  +   ++S N+ P A   + I EA+Q+QIEVQR+L+EQLEVQRHLQLRIE
Sbjct  117   CTSIADRIPGTSAATMSSTNVVPQAEKTIQIGEALQMQIEVQRQLNEQLEVQRHLQLRIE  176

Query  1092  AQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFC  913
             AQGKYLQAVLE+AQETLG+Q+LG   LE AK ++S+LVS+VS +C ++A + +K      
Sbjct  177   AQGKYLQAVLEQAQETLGKQNLGPANLEDAKIKISQLVSQVSTECFSNAITDVKGSSSVH  236

Query  912   QQQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQ-MGLRSLNFGAHMESTDLYNETRLKQ  736
             + + +  Q  + S +S L+ +EG +++  +++ Q  G+   + G+ +      +E    +
Sbjct  237   RLEPRQIQFVESSTNSYLSVAEGFIKEQRLQHQQHHGVLKAHDGSSLFCRKRPHE---HE  293

Query  735   TEFRWCDDIWENRKYLSKMDEETKNNGLSVSTGLQ-GGKWNGNSNYSDRRFTG-----TD  574
             T+F     + E R    + DE+         +  +   ++    N      +       D
Sbjct  294   TQFALNRSLSERRMAHLQNDEQYSKAEFGYESDTEIVHEYTAPQNGGGSTTSSASGSKVD  353

Query  573   AD-VKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNGFS  397
             A+ + L  Q   R     P + K   +++    G KLDLNT +  D   + +  DLN FS
Sbjct  354   AEKLYLEEQKCARQVAEYPRESKLI-DFENSCSGKKLDLNTHNVDDTDQAYRHFDLNDFS  412

Query  396   WN  391
             W+
Sbjct  413   WS  414



>gb|AFW82346.1| putative MYB DNA-binding domain superfamily protein [Zea mays]
Length=393

 Score =   301 bits (772),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 180/415 (43%), Positives = 249/415 (60%), Gaps = 47/415 (11%)
 Frame = -2

Query  1569  ERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEAVNQLGGADKATPKSVLKQMG  1390
             E+H F++G N  GDSGLVLSTDAKPRLKWT +LH+RFV+AVNQLGG +KATPK+V++ MG
Sbjct  2     EQHPFLRGGNAQGDSGLVLSTDAKPRLKWTPELHQRFVDAVNQLGGEEKATPKTVMRLMG  61

Query  1389  IQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDAATGSDKIPEANGNHINSANI  1210
             I GLTLYHLKSHLQKYRLSKNL   AN+S++K   + +     +D+IP      ++S N+
Sbjct  62    IPGLTLYHLKSHLQKYRLSKNLQAQANASTSK---NAIGCTPVADRIPGTTAATMSSTNV  118

Query  1209  GPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVLEKAQETLGRQD  1030
              P A   + I EA+Q+QI+VQR+L+EQLEVQRHLQLRIEAQGKYLQAVLE+AQETLG+Q+
Sbjct  119   LPQAEKTIQIGEALQMQIQVQRQLNEQLEVQRHLQLRIEAQGKYLQAVLEQAQETLGKQN  178

Query  1029  LGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFCQQQAQATQPTDCSLDSCLTSS  850
             LG   LE AK ++SELVS+VSN+C ++A + +KE     + +    +  + S +S L+ +
Sbjct  179   LGPANLEDAKIKISELVSQVSNECFSNAITDVKESSSVHRLEPIQIEFVESSTNSYLSVA  238

Query  849   EGSLRDHEMRN----------------------SQMGL-RSLNFGAHMESTDLYNETRLK  739
             EG +++H++++                      +Q  L RSL   +      L NE    
Sbjct  239   EGFIKEHKLQHHGVLKAYDDSSLFCRKRSHEHETQFALNRSL---SEHRMAHLQNEEGYH  295

Query  738   QTEFRWCDDIWENRKYLSKMDEETKNNGLSVSTGLQGGKWNGNSNYSDRRFTGTDADVKL  559
             + EF +  D     +Y +      KN   S ++   G K +    Y + +        K 
Sbjct  296   KAEFGYESDTEMAHEYTAPQ----KNGRCSTTSSASGSKVDAEKLYLEEQ--------KC  343

Query  558   FAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNGFSW  394
               QAV+    SK        +++ P    KLDLNT +  D   + +  DLNGFSW
Sbjct  344   ARQAVEYPRESK------LVDFEHPCSVNKLDLNTHNVDDTNQAYRHFDLNGFSW  392



>ref|XP_003558005.1| PREDICTED: uncharacterized protein LOC100837299 [Brachypodium 
distachyon]
Length=350

 Score =   297 bits (761),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 161/272 (59%), Positives = 201/272 (74%), Gaps = 9/272 (3%)
 Frame = -2

Query  1632  MYHHHRQGK--SMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERF  1459
             MYHH +Q +  S   S+    P ERHL +QG    G+SGLVLSTDAKPRLKWT +LH+RF
Sbjct  1     MYHHQQQLQRHSQLLSSRQTFPSERHLLLQGGIVPGESGLVLSTDAKPRLKWTPELHDRF  60

Query  1458  VEAVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSG  1279
             VEAVNQLGG DKATPK++++ MG+ GLTLYHLKSHLQKYRLSKNLH  AN  +++ +   
Sbjct  61    VEAVNQLGGPDKATPKTIMRLMGVPGLTLYHLKSHLQKYRLSKNLHAQANVGNSRNV---  117

Query  1278  MDAATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLR  1099
             +     ++K  E NG+ + S ++G   N ++ I EA+Q+QIEVQRRLHEQLEVQRHLQLR
Sbjct  118   VGCTMATEKHSEGNGSPV-SHHLGAQTNKSMHIGEALQMQIEVQRRLHEQLEVQRHLQLR  176

Query  1098  IEAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPG  919
             IEAQGKYLQ+VLEKA ETL +Q+ G   LE AK QLSELVSKVS +CL++AF+G +E+ G
Sbjct  177   IEAQGKYLQSVLEKAHETLAKQNTGSASLENAKMQLSELVSKVSTECLHNAFTGFEEIQG  236

Query  918   FCQQQAQATQPTDCSLDSCLTSSEGSLRDHEM  823
                Q  Q  Q  D S+DSCLT+ E S RD ++
Sbjct  237   --SQMLQTMQLGDGSVDSCLTACE-SQRDQDI  265



>gb|EEE64175.1| hypothetical protein OsJ_19007 [Oryza sativa Japonica Group]
Length=411

 Score =   299 bits (766),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 158/272 (58%), Positives = 204/272 (75%), Gaps = 5/272 (2%)
 Frame = -2

Query  1632  MYHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVE  1453
             MYH H QG+S   +T    P ERHLF+ G N  GDSGLVLSTDAKPRLKWT +LH+RFV+
Sbjct  1     MYHQH-QGRSDLFTTRTSFPMERHLFLHGGNTQGDSGLVLSTDAKPRLKWTPELHQRFVD  59

Query  1452  AVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMD  1273
             AVNQLGGA+KATPK+V++ MGI GLTLYHLKSHLQKYRLSKNL G AN  + K   + + 
Sbjct  60    AVNQLGGAEKATPKTVMRLMGIPGLTLYHLKSHLQKYRLSKNLQGQANVGTTK---NALG  116

Query  1272  AATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIE  1093
                 +D+IP  +   + SA+  P A   + I EA+Q+QIEVQR+L+EQLEVQRHLQLRIE
Sbjct  117   CTGVADRIPGTSALAMASASAIPQAEKTIQIGEALQMQIEVQRQLNEQLEVQRHLQLRIE  176

Query  1092  AQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFC  913
             AQGKYLQAVLE+AQETLG+Q+LG   LE AK ++SELVS+VSN+CL++A + I+E     
Sbjct  177   AQGKYLQAVLEQAQETLGKQNLGPASLEDAKIKISELVSQVSNECLSNAVTEIRESSSIH  236

Query  912   QQQAQATQPTDCSLDSCLTSSEGSLRDHEMRN  817
             + + +  Q  + S ++CLT++EG  ++H ++N
Sbjct  237   RLEPRQIQFVESSANNCLTAAEG-FKEHRLQN  267



>dbj|BAJ98170.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=349

 Score =   290 bits (743),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 155/272 (57%), Positives = 195/272 (72%), Gaps = 11/272 (4%)
 Frame = -2

Query  1632  MYHHHRQGKSMHP--STNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERF  1459
             MYHH +Q +S     ++    P ERHL +QG    G+SGL+LSTDAKPRLKWT +LH+RF
Sbjct  1     MYHHQQQLQSHGQLLASRQTFPSERHLLLQGGIIPGESGLILSTDAKPRLKWTPELHDRF  60

Query  1458  VEAVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSG  1279
             VEAVNQLGG DKATPK++++ MG+ GLTLYHLKSHLQKYRLSKNLH  AN  +++   + 
Sbjct  61    VEAVNQLGGPDKATPKTIMRLMGVPGLTLYHLKSHLQKYRLSKNLHAQANVGNSR---TA  117

Query  1278  MDAATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLR  1099
             +     ++K  E NG     + +G   NT    +EA+Q+QIEVQRRLHEQLEVQRHLQLR
Sbjct  118   VGCTVATEKQSEGNG-----SPVGHHLNTQTN-NEALQMQIEVQRRLHEQLEVQRHLQLR  171

Query  1098  IEAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPG  919
             IEAQGKYLQ+VLEKA ETL +Q+ G  GLE AK QLSELVSKVS +C ++AF+ + +  G
Sbjct  172   IEAQGKYLQSVLEKAHETLAKQNTGSGGLETAKMQLSELVSKVSTECFHNAFTSLGDNDG  231

Query  918   FCQQQAQATQPTDCSLDSCLTSSEGSLRDHEM  823
                 +    Q  D S+DSCLT+ EGS RD ++
Sbjct  232   SVMLRRHTMQLADGSVDSCLTACEGSQRDQDI  263



>ref|NP_001055886.1| Os05g0488600 [Oryza sativa Japonica Group]
 dbj|BAF17800.1| Os05g0488600 [Oryza sativa Japonica Group]
 gb|EAY98498.1| hypothetical protein OsI_20411 [Oryza sativa Indica Group]
Length=392

 Score =   287 bits (734),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 149/251 (59%), Positives = 193/251 (77%), Gaps = 4/251 (2%)
 Frame = -2

Query  1569  ERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEAVNQLGGADKATPKSVLKQMG  1390
             ERHLF+ G N  GDSGLVLSTDAKPRLKWT +LH+RFV+AVNQLGGA+KATPK+V++ MG
Sbjct  2     ERHLFLHGGNTQGDSGLVLSTDAKPRLKWTPELHQRFVDAVNQLGGAEKATPKTVMRLMG  61

Query  1389  IQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDAATGSDKIPEANGNHINSANI  1210
             I GLTLYHLKSHLQKYRLSKNL G AN  + K   + +     +D+IP  +   + SA+ 
Sbjct  62    IPGLTLYHLKSHLQKYRLSKNLQGQANVGTTK---NALGCTGVADRIPGTSALAMASASA  118

Query  1209  GPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVLEKAQETLGRQD  1030
              P A   + I EA+Q+QIEVQR+L+EQLEVQRHLQLRIEAQGKYLQAVLE+AQETLG+Q+
Sbjct  119   IPQAEKTIQIGEALQMQIEVQRQLNEQLEVQRHLQLRIEAQGKYLQAVLEQAQETLGKQN  178

Query  1029  LGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFCQQQAQATQPTDCSLDSCLTSS  850
             LG   LE AK ++SELVS+VSN+CL++A + I+E     + + +  Q  + S ++CLT++
Sbjct  179   LGPASLEDAKIKISELVSQVSNECLSNAVTEIRESSSIHRLEPRQIQFVESSANNCLTAA  238

Query  849   EGSLRDHEMRN  817
             EG  ++H ++N
Sbjct  239   EG-FKEHRLQN  248



>ref|XP_004489718.1| PREDICTED: uncharacterized protein LOC101512896 isoform X5 [Cicer 
arietinum]
Length=368

 Score =   284 bits (727),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 190/419 (45%), Positives = 246/419 (59%), Gaps = 60/419 (14%)
 Frame = -2

Query  1629  YHHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEA  1450
             Y+HH+Q ++MH          R     G NG GDSGLVLSTDAKPRLKWT DLHERF+EA
Sbjct  3     YNHHQQARNMHAL--------RMQIQGGGNGSGDSGLVLSTDAKPRLKWTTDLHERFIEA  54

Query  1449  VNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNK-AMSSGMD  1273
             VNQLGGADKATPK+VLK MGI GLTLYHLKSHLQKYR+SK ++G  N+ S+K A+++ + 
Sbjct  55    VNQLGGADKATPKTVLKLMGIPGLTLYHLKSHLQKYRISKTMNGQTNTGSSKIALTTEV-  113

Query  1272  AATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIE  1093
                 S ++ EA+G H+   +IG   N N  I+EA  +Q+EVQRRLHEQLEVQ+HLQLRIE
Sbjct  114   ----SSRMSEASGIHMKHLSIGLQTNKNSEINEAFNMQMEVQRRLHEQLEVQKHLQLRIE  169

Query  1092  AQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFC  913
             AQGKYLQ+VLEKA+ETLG Q+LG                             +KEL    
Sbjct  170   AQGKYLQSVLEKAKETLGTQNLG-----------------------------LKELHVHW  200

Query  912   QQQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQT  733
              QQ +  +  D S+ S LT+SE S RD EM N  M L     G   E  D   E    + 
Sbjct  201   PQQTREDETIDYSMGSFLTNSEDSQRDQEMHNKGMKL-----GVSKECVD---EPMPLKN  252

Query  732   EFRWCDDIWENRKYLSKMDEETKNNGLSVSTGLQG-GKWNGNSNYSDRRFTGTDADVKLF  556
             +F  C+   EN  ++S  +     +GL+ S  L   G  +   N   R  +  D   + +
Sbjct  253   DFTLCEKEKENVMFVSSSNHRVLKDGLTTSLLLMNVGGVHEKENMWKRTISKEDLKGEEW  312

Query  555   AQAVDRSDTS----KPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNGFSWN  391
              + ++  +T+    K    K SQ+Y+L  F  KLDLN++D    +S C++ DLNGFSWN
Sbjct  313   KR-INNIETNGVQLKLNSDKISQDYRLANFEVKLDLNSND---ASSQCQKFDLNGFSWN  367



>gb|EPS73715.1| hypothetical protein M569_01040, partial [Genlisea aurea]
Length=200

 Score =   276 bits (707),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 146/202 (72%), Positives = 165/202 (82%), Gaps = 8/202 (4%)
 Frame = -2

Query  1569  ERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEAVNQLGGADKATPKSVLKQMG  1390
             E+HLFM+  NG GD+GLVLSTDAKPRLKWT DLH+RF+EAVNQLGGA+KATPKSVLK MG
Sbjct  6     EKHLFMK--NGSGDTGLVLSTDAKPRLKWTPDLHQRFIEAVNQLGGAEKATPKSVLKLMG  63

Query  1389  IQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDAATGSDKIPE-ANGNHINSAN  1213
             IQGLTLYHLKSHLQKYRLSK LHG    +SNK   SGM+ ATG    P   N  H ++ N
Sbjct  64    IQGLTLYHLKSHLQKYRLSKTLHG--QQASNK---SGMNTATGDRTTPSPTNIPHASNPN  118

Query  1212  IGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVLEKAQETLGRQ  1033
                  N NL + EAIQ+QIEVQRRLHEQLEVQRHLQLRIEAQGKYL++VLEKAQET+G Q
Sbjct  119   SALQTNKNLHLGEAIQMQIEVQRRLHEQLEVQRHLQLRIEAQGKYLESVLEKAQETMGTQ  178

Query  1032  DLGKMGLEAAKAQLSELVSKVS  967
             +LG + LEAAK QLS+L+SKVS
Sbjct  179   NLGTISLEAAKLQLSDLMSKVS  200



>ref|XP_006297891.1| hypothetical protein CARUB_v10013932mg [Capsella rubella]
 gb|EOA30789.1| hypothetical protein CARUB_v10013932mg [Capsella rubella]
Length=324

 Score =   278 bits (710),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 171/351 (49%), Positives = 215/351 (61%), Gaps = 40/351 (11%)
 Frame = -2

Query  1404  LKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNK-AMSSGMDAATGSDKIPEANGNH  1228
             +K MGI GLTLYHLKSHLQKYRLSKNL+G ANS  NK  M + M+     +K P+ +   
Sbjct  1     MKVMGIPGLTLYHLKSHLQKYRLSKNLNGQANSGLNKIGMMTMME-----EKTPDVDEIQ  55

Query  1227  INSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVLEKAQE  1048
               + +IGP  N N PI+EA+Q+QIEVQRRLHEQLEVQRHLQLRIEAQGKYLQ+VLEKAQE
Sbjct  56    SENLSIGPQLNKNSPINEALQMQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQSVLEKAQE  115

Query  1047  TLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFCQQQAQATQPTDCSLD  868
             TLGRQ+LG  G+EAAK QLSELVSKVS +  NS+F   KE+   C QQ Q   P DCSL+
Sbjct  116   TLGRQNLGAAGIEAAKVQLSELVSKVSAEYPNSSFLEPKEVQNLCPQQGQTAYPPDCSLE  175

Query  867   SCLTSSEGSLRDHEM-RNSQMGLRSLNFGAHMESTDLYNETRLKQTEFRWCDDIWENRKY  691
             SCLTSSEG+ ++ +M  N+++GLR+    +  E  +   E   ++ E  W + +  N  Y
Sbjct  176   SCLTSSEGTQKNPKMLENNRLGLRTYLGDSTSEQKENMEEPLFQRMELTWTEGLRGN-PY  234

Query  690   LSKMDEETKNN---------GLSVSTGLQG--GKWNGNSNYSDRRFTGTDADVKLFAQAV  544
             LS M  ET+            LS+  GLQG  G   GN+ Y+D+                
Sbjct  235   LSTMVSETEQRVSYSERSPGRLSIGVGLQGHKGHQQGNNEYTDK----------------  278

Query  543   DRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNGFSWN  391
                  S+  K +T    K      +LDLNT  +   ++  KQ DLNGFSWN
Sbjct  279   -----SEDHKFETRNHRKGTDSTTELDLNTHVENYSSTRTKQFDLNGFSWN  324



>ref|XP_009416349.1| PREDICTED: uncharacterized protein LOC103996985 isoform X4 [Musa 
acuminata subsp. malaccensis]
Length=349

 Score =   278 bits (711),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 173/416 (42%), Positives = 224/416 (54%), Gaps = 69/416 (17%)
 Frame = -2

Query  1632  MYHHH-RQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFV  1456
             MY H   Q  +   S+ +  P ER LF+Q  +  G+SGLVLST+AKPRLKW  +LH RF+
Sbjct  1     MYQHQPHQSHNNLISSRIAAPSERQLFLQRGSTTGESGLVLSTEAKPRLKWNPELHARFI  60

Query  1455  EAVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGM  1276
             EAVNQLGGADKATPK++++ MGI GLTLYHLKSHLQKYRL KNL    N  S K +    
Sbjct  61    EAVNQLGGADKATPKTIMRLMGIPGLTLYHLKSHLQKYRLGKNLQAQTNIRSTKNI---F  117

Query  1275  DAATGSDKIPEANGNHINSANIGPLAN-TNLPISEAIQIQIEVQRRLHEQLEVQRHLQLR  1099
               +  +++ PE NG+  N A   P  N   + I+EA   QIEVQ++LHEQLEVQRHLQ+R
Sbjct  118   GCSLAAERTPEDNGSSRNIA--APTNNFRTMQINEAFTKQIEVQKQLHEQLEVQRHLQVR  175

Query  1098  IEAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPG  919
             IEAQG+YLQ VLEKAQE L +Q LG +GLE AK QLSELV+KVS+ CL S  S       
Sbjct  176   IEAQGRYLQLVLEKAQERLEKQSLGSVGLEVAKVQLSELVTKVSDSCLTSDRS-------  228

Query  918   FCQQQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLK  739
                Q+ Q T  T   + +C       ++                         + E +L+
Sbjct  229   ---QKEQDTHDTTIGIRACHKDLPSCMKQ------------------------FGEDKLE  261

Query  738   QTEFRWCDDIWENRKYLSKMDEETKNNGLSVSTGLQGGKWNGNSNYSDRRFTGTDADVKL  559
             QT+  WC D+ E + + S  + + K N                    DR          L
Sbjct  262   QTQHAWCGDLNEQKIFSSVPEVQRKENN------------------EDR----------L  293

Query  558   FAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNGFSWN  391
                        + E +K S  + L     +L+L   +  + AS CKQ +LNGFSWN
Sbjct  294   LEHPSSNRSVVRQETKKQSDGFGLSCLTTELELKIHEDDEGASGCKQFELNGFSWN  349



>ref|XP_009416348.1| PREDICTED: protein PHR1-LIKE 1-like isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=350

 Score =   278 bits (711),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 174/418 (42%), Positives = 232/418 (56%), Gaps = 72/418 (17%)
 Frame = -2

Query  1632  MYHHH-RQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFV  1456
             MY H   Q  +   S+ +  P ER LF+Q  +  G+SGLVLST+AKPRLKW  +LH RF+
Sbjct  1     MYQHQPHQSHNNLISSRIAAPSERQLFLQRGSTTGESGLVLSTEAKPRLKWNPELHARFI  60

Query  1455  EAVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGM  1276
             EAVNQLGGADKATPK++++ MGI GLTLYHLKSHLQKYRL KNL    N  S K +    
Sbjct  61    EAVNQLGGADKATPKTIMRLMGIPGLTLYHLKSHLQKYRLGKNLQAQTNIRSTKNI---F  117

Query  1275  DAATGSDKIPEANGNHINSANIGPLAN-TNLPISEAIQIQIEVQRRLHEQLEVQRHLQLR  1099
               +  +++ PE NG+  N A   P  N   + I+EA   QIEVQ++LHEQLEVQRHLQ+R
Sbjct  118   GCSLAAERTPEDNGSSRNIA--APTNNFRTMQINEAFTKQIEVQKQLHEQLEVQRHLQVR  175

Query  1098  IEAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPG  919
             IEAQG+YLQ VLEKAQE L +Q LG +GLE AK QLSELV+KV                 
Sbjct  176   IEAQGRYLQLVLEKAQERLEKQSLGSVGLEVAKVQLSELVTKV-----------------  218

Query  918   FCQQQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSL--NFGAHMESTDLYNETR  745
                           S+DSCLT S+ S ++ +  ++ +G+R+   +  + M+    + E +
Sbjct  219   --------------SVDSCLT-SDRSQKEQDTHDTTIGIRACHKDLPSCMKQ---FGEDK  260

Query  744   LKQTEFRWCDDIWENRKYLSKMDEETKNNGLSVSTGLQGGKWNGNSNYSDRRFTGTDADV  565
             L+QT+  WC D+ E + + S  + + K N                    DR         
Sbjct  261   LEQTQHAWCGDLNEQKIFSSVPEVQRKENN------------------EDR---------  293

Query  564   KLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNGFSWN  391
              L           + E +K S  + L     +L+L   +  + AS CKQ +LNGFSWN
Sbjct  294   -LLEHPSSNRSVVRQETKKQSDGFGLSCLTTELELKIHEDDEGASGCKQFELNGFSWN  350



>ref|XP_004958726.1| PREDICTED: myb family transcription factor APL-like isoform X1 
[Setaria italica]
 ref|XP_004958727.1| PREDICTED: myb family transcription factor APL-like isoform X2 
[Setaria italica]
Length=346

 Score =   270 bits (689),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 156/278 (56%), Positives = 190/278 (68%), Gaps = 25/278 (9%)
 Frame = -2

Query  1632  MYHHHR-QGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFV  1456
             MYH  +  G + H S+   +PPE+   +QG    GD+GLVLSTDAKPRLKWT +LHERFV
Sbjct  1     MYHQQQLHGHNQHLSSRPGLPPEKQFLLQG----GDAGLVLSTDAKPRLKWTPELHERFV  56

Query  1455  EAVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGM  1276
             EAV QLGG DKATPK++++ MGI GLTLYHLKSHLQKYRLSKNL   AN+++ K +   +
Sbjct  57    EAVQQLGGPDKATPKTIMRLMGIPGLTLYHLKSHLQKYRLSKNLQAQANATNAKNV---L  113

Query  1275  DAATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRI  1096
                TG+DK  E NG+  +  N  P  N ++ ISEA+Q+QIEVQRRLHEQLEVQRHLQLRI
Sbjct  114   GCRTGTDKPCERNGSPASHLNTEPQINRSMHISEALQMQIEVQRRLHEQLEVQRHLQLRI  173

Query  1095  EAQGKYLQAVLEKAQETLGRQ----DLGKMGLEAAKA--QLSELVSKVS-NQCLNSAFSG  937
             EAQGKYLQ+VLEKAQE L +Q    D G +G  AA    QLSEL+S+ S  +C       
Sbjct  174   EAQGKYLQSVLEKAQEALAKQNVDLDAGVLGAAAAAETQQLSELISRASATKCAQHEHFH  233

Query  936   IKELPGFCQQQAQATQPTDCSLDSCLTSSEGSLRDHEM  823
              + L G            D S+DSCLT+ EGS RDH+M
Sbjct  234   HQHLGGV----------GDGSVDSCLTACEGSQRDHDM  261



>ref|XP_008793334.1| PREDICTED: uncharacterized protein LOC103709655 isoform X2 [Phoenix 
dactylifera]
Length=340

 Score =   267 bits (683),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 154/347 (44%), Positives = 213/347 (61%), Gaps = 16/347 (5%)
 Frame = -2

Query  1404  LKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDAATGSDKIPEANGNHI  1225
             ++ MGI GLTLYHLKSHLQKYRLSK+L    N+ + K +   +     +D+  E NG+ +
Sbjct  1     MRLMGIPGLTLYHLKSHLQKYRLSKSLQAQPNTGTTKNV---IGCPLAADRTAEGNGSLM  57

Query  1224  NSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVLEKAQET  1045
             ++  +    N  + ISEA+Q+QIEVQRRLHEQLEVQRHLQLRIEAQGKYLQ+VLEKAQET
Sbjct  58    SNTTVASQTNKTMQISEALQMQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQSVLEKAQET  117

Query  1044  LGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFCQQQAQATQPTDCSLDS  865
             LG+Q+LG  GLEAAK QLSELVSKVSN+CLN+ F G++E+ GF   QA A Q  DCS++S
Sbjct  118   LGKQNLGSAGLEAAKVQLSELVSKVSNECLNTTFPGLEEISGFHTLQAHAAQFADCSVNS  177

Query  864   CLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQTEFRWCDDIWENRKYLS  685
              LTS EGS ++ E  N  MG    N  +H        +T L+Q +  W  D+ E + +  
Sbjct  178   YLTSCEGSQKEQEKYNVSMGTYLGN--SHPCLQQFRADTGLEQAQLAWHGDLNEQKTFSP  235

Query  684   KMDEETK---------NNGLSVSTGLQGGKWNGNSNYSDRRFTGTDADVKLFAQAVDRSD  532
              + ++++         +  L+++   +  K +G++    RR      D   F +   +  
Sbjct  236   SILQDSEVTFFPVQRDSRTLTMNIKAEREKVDGSTVSDARRKEKDSKDA--FLERNSKRP  293

Query  531   TSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNGFSWN  391
              +  E+ K S  + L     +LDLN  ++ D   +CKQ DLNGFSW+
Sbjct  294   AALQERGKESNGFGLQSVTTQLDLNAHEENDGPPNCKQFDLNGFSWS  340



>gb|EMS63697.1| Myb family transcription factor APL [Triticum urartu]
Length=369

 Score =   263 bits (673),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 146/276 (53%), Positives = 188/276 (68%), Gaps = 9/276 (3%)
 Frame = -2

Query  1632  MYHHHRQGKSMHP--STNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERF  1459
             MYHH +Q +S +   ++    P ERHL +QG    G+SGL+LSTDAKPRLKWT +LH+RF
Sbjct  11    MYHHQQQLQSHNQLLASRQTFPSERHLLLQGGIIPGESGLILSTDAKPRLKWTPELHDRF  70

Query  1458  VEAVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSG  1279
             VEAVNQLGG DKATPK++++ MG+ GLTLYHLKSHLQKYRLSKNLH  AN   N   ++G
Sbjct  71    VEAVNQLGGPDKATPKTIMRLMGVPGLTLYHLKSHLQKYRLSKNLHVQAN-VGNSRTAAG  129

Query  1278  MDAATGSDKIPEANGN----HINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRH  1111
                AT  +K  E NG+    H+N+     +   ++     I I  +  R+    + VQRH
Sbjct  130   CTIAT--EKQSEGNGSPVGHHLNTQTNKRVMKEHVRKIRKIVINCKSLRQHFLYIPVQRH  187

Query  1110  LQLRIEAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIK  931
             LQLRIEAQGKYLQ+VLEKA ETL +Q+ G  GLE AK QLSELVSKVS +C ++AF+  +
Sbjct  188   LQLRIEAQGKYLQSVLEKAHETLAKQNTGSGGLETAKMQLSELVSKVSTECFHNAFTSFE  247

Query  930   ELPGFCQQQAQATQPTDCSLDSCLTSSEGSLRDHEM  823
             E+ G    + Q  Q  D S+DSCLT+ EGS +D ++
Sbjct  248   EIEGSQMLRRQTMQLGDGSVDSCLTACEGSQKDQDI  283



>ref|XP_006297890.1| hypothetical protein CARUB_v10013932mg [Capsella rubella]
 gb|EOA30788.1| hypothetical protein CARUB_v10013932mg [Capsella rubella]
Length=318

 Score =   258 bits (660),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 165/351 (47%), Positives = 209/351 (60%), Gaps = 46/351 (13%)
 Frame = -2

Query  1404  LKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNK-AMSSGMDAATGSDKIPEANGNH  1228
             +K MGI GLTLYHLKSHLQKYRLSKNL+G ANS  NK  M + M+     +K P+ +   
Sbjct  1     MKVMGIPGLTLYHLKSHLQKYRLSKNLNGQANSGLNKIGMMTMME-----EKTPDVDEIQ  55

Query  1227  INSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVLEKAQE  1048
               + +IGP  N N PI+EA+Q+QIEVQRRLHEQLE      LRIEAQGKYLQ+VLEKAQE
Sbjct  56    SENLSIGPQLNKNSPINEALQMQIEVQRRLHEQLE------LRIEAQGKYLQSVLEKAQE  109

Query  1047  TLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFCQQQAQATQPTDCSLD  868
             TLGRQ+LG  G+EAAK QLSELVSKVS +  NS+F   KE+   C QQ Q   P DCSL+
Sbjct  110   TLGRQNLGAAGIEAAKVQLSELVSKVSAEYPNSSFLEPKEVQNLCPQQGQTAYPPDCSLE  169

Query  867   SCLTSSEGSLRDHEM-RNSQMGLRSLNFGAHMESTDLYNETRLKQTEFRWCDDIWENRKY  691
             SCLTSSEG+ ++ +M  N+++GLR+    +  E  +   E   ++ E  W + +  N  Y
Sbjct  170   SCLTSSEGTQKNPKMLENNRLGLRTYLGDSTSEQKENMEEPLFQRMELTWTEGLRGN-PY  228

Query  690   LSKMDEETKNN---------GLSVSTGLQG--GKWNGNSNYSDRRFTGTDADVKLFAQAV  544
             LS M  ET+            LS+  GLQG  G   GN+ Y+D+                
Sbjct  229   LSTMVSETEQRVSYSERSPGRLSIGVGLQGHKGHQQGNNEYTDK----------------  272

Query  543   DRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNGFSWN  391
                  S+  K +T    K      +LDLNT  +   ++  KQ DLNGFSWN
Sbjct  273   -----SEDHKFETRNHRKGTDSTTELDLNTHVENYSSTRTKQFDLNGFSWN  318



>gb|EMT31949.1| Myb family transcription factor APL [Aegilops tauschii]
Length=408

 Score =   260 bits (665),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 140/276 (51%), Positives = 187/276 (68%), Gaps = 9/276 (3%)
 Frame = -2

Query  1632  MYHHHRQGKSMHP--STNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERF  1459
             MYHH +Q +S +   ++    P ERHL +QG    G+SGL+LSTDAKPRLKWT +LH+RF
Sbjct  50    MYHHQQQLQSHNQLLASRQTFPSERHLLLQGGIIPGESGLILSTDAKPRLKWTPELHDRF  109

Query  1458  VEAVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSG  1279
             VEAVNQLGG DKATPK++++ MG+ GLTLYHLKSHLQKYRLSKNLH  AN  +++   + 
Sbjct  110   VEAVNQLGGPDKATPKTIMRLMGVPGLTLYHLKSHLQKYRLSKNLHVQANVGNSR---TA  166

Query  1278  MDAATGSDKIPEANGN----HINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRH  1111
             +     ++K  E NG+    H+N+     +   ++       I  +  R+    + VQRH
Sbjct  167   VGCTIATEKQSEGNGSPVSHHLNTQTNKRVMKEHVRKIRKFVINCKSLRQHFLYIPVQRH  226

Query  1110  LQLRIEAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIK  931
             LQLRIEAQGKYL++VLEKA ETL +Q+ G  GLE AK QLSELVSKVS +C ++AF+  +
Sbjct  227   LQLRIEAQGKYLRSVLEKAHETLAKQNTGSGGLETAKIQLSELVSKVSTECFHNAFTSFE  286

Query  930   ELPGFCQQQAQATQPTDCSLDSCLTSSEGSLRDHEM  823
             E+ G    + Q  Q  D S+DSCLT+ EGS +D ++
Sbjct  287   EIEGSQMLRRQTMQLGDGSVDSCLTACEGSQKDQDI  322



>gb|ACN39843.1| unknown [Picea sitchensis]
Length=392

 Score =   249 bits (636),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 134/249 (54%), Positives = 169/249 (68%), Gaps = 22/249 (9%)
 Frame = -2

Query  1554  MQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEAVNQLGGADKATPKSVLKQMGIQGLT  1375
             ++G N  GD+ LVL+TD KPRL+WT +LHERFV+AV QLGG DKATPK++++ MG++GLT
Sbjct  26    LEGTNLPGDACLVLTTDPKPRLRWTTELHERFVDAVTQLGGPDKATPKTIMRAMGVKGLT  85

Query  1374  LYHLKSHLQKYRLSKNLHGHANSSSNK---AMSSGMDAATGSDKIPEANGNHINSANIGP  1204
             LYHLKSHLQKYRL K      +  SNK    ++ G  A+T S           +S  I  
Sbjct  86    LYHLKSHLQKYRLGKQPFKEFSDQSNKDASCLTEGQGASTCS-----------SSKMINQ  134

Query  1203  LANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVLEKAQETLGRQDLG  1024
               N +  I+EA+++Q+EVQRRLHEQLEVQRHLQLRIEAQGKYLQ++LEKA + L  Q + 
Sbjct  135   DVNESFQITEALRVQMEVQRRLHEQLEVQRHLQLRIEAQGKYLQSILEKACQALTDQTIA  194

Query  1023  KMGLEAAKAQLSELVSKVSNQCLNSAFSGI--KELPGFCQQQA------QATQPTDCSLD  868
               GLEAA+ +LSEL  KVSN CL+S F  +    LP   Q         Q TQ TDCS+D
Sbjct  195   SAGLEAARQELSELAMKVSNGCLSSPFEDVNLPSLPEIPQIHVDESTLHQQTQLTDCSVD  254

Query  867   SCLTSSEGS  841
             SCLTS+E +
Sbjct  255   SCLTSNEST  263



>ref|XP_002463407.1| hypothetical protein SORBIDRAFT_02g043320 [Sorghum bicolor]
 gb|EER99928.1| hypothetical protein SORBIDRAFT_02g043320 [Sorghum bicolor]
Length=352

 Score =   246 bits (627),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 144/266 (54%), Positives = 180/266 (68%), Gaps = 11/266 (4%)
 Frame = -2

Query  1632  MYHHHR-QGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFV  1456
             MYH  +    + H S+   +PPE+   +QG    GD+GLVLSTDAKPRLKWT +LHERFV
Sbjct  1     MYHQQQLHNHNQHLSSRPGLPPEKQFLLQGG---GDAGLVLSTDAKPRLKWTPELHERFV  57

Query  1455  EAVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGM  1276
             EAV+QLGG DKATPK++++ MGI GLTLYHLKSHLQKYRLSKNL   AN+ + K   + +
Sbjct  58    EAVHQLGGPDKATPKTIMRLMGIPGLTLYHLKSHLQKYRLSKNLQAQANAVNAK---NAL  114

Query  1275  DAATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRI  1096
                TG+D   E +G+     N+ P  N ++ ISEA+Q+QIEVQRRLHEQLEVQRHLQLRI
Sbjct  115   SCRTGTDNPCEGSGSPPPHLNLEPQINRSMHISEALQMQIEVQRRLHEQLEVQRHLQLRI  174

Query  1095  EAQGKYLQAVLEKAQETLGRQDLGKM-GLEAAKAQLSELVSKVSNQCLNSAFSGIKELPG  919
             EAQGKYLQ+VLEKAQE L +     + G E +  QLSEL+S+ +           ++   
Sbjct  175   EAQGKYLQSVLEKAQEALAKHSGVHLDGGETSTQQLSELISRAT---ATRRAHVQQDHQH  231

Query  918   FCQQQAQATQPTDCSLDSCLTSSEGS  841
               Q Q Q     D S+DSCLT+ EGS
Sbjct  232   QHQHQHQRHLGGDGSVDSCLTACEGS  257



>ref|XP_009416351.1| PREDICTED: uncharacterized protein LOC103996985 isoform X6 [Musa 
acuminata subsp. malaccensis]
Length=334

 Score =   240 bits (612),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 156/417 (37%), Positives = 215/417 (52%), Gaps = 86/417 (21%)
 Frame = -2

Query  1632  MYHHH-RQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFV  1456
             MY H   Q  +   S+ +  P ER LF+Q  +  G+SGLVLST+AKPRLKW  +LH RF+
Sbjct  1     MYQHQPHQSHNNLISSRIAAPSERQLFLQRGSTTGESGLVLSTEAKPRLKWNPELHARFI  60

Query  1455  EAVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGM  1276
             EAVNQLGGAD            I G +L                                
Sbjct  61    EAVNQLGGAD------------IFGCSL--------------------------------  76

Query  1275  DAATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRI  1096
                  +++ PE NG+   S NI    N  + I+EA   QIEVQ++LHEQLEVQRHLQ+RI
Sbjct  77    ----AAERTPEDNGS---SRNIAAPTNKTMQINEAFTKQIEVQKQLHEQLEVQRHLQVRI  129

Query  1095  EAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGF  916
             EAQG+YLQ VLEKAQE L +Q LG +GLE AK QLSELV+KVS +C  ++F G++E+P  
Sbjct  130   EAQGRYLQLVLEKAQERLEKQSLGSVGLEVAKVQLSELVTKVSGECFGNSFLGVEEIPVL  189

Query  915   CQQQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSL--NFGAHMESTDLYNETRL  742
                Q       DCS+DSCLT S+ S ++ +  ++ +G+R+   +  + M+    + E +L
Sbjct  190   HMSQLTPAHFADCSVDSCLT-SDRSQKEQDTHDTTIGIRACHKDLPSCMKQ---FGEDKL  245

Query  741   KQTEFRWCDDIWENRKYLSKMDEETKNNGLSVSTGLQGGKWNGNSNYSDRRFTGTDADVK  562
             +QT+  WC D+ E + + S  + + K N                    DR          
Sbjct  246   EQTQHAWCGDLNEQKIFSSVPEVQRKENN------------------EDR----------  277

Query  561   LFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNGFSWN  391
             L           + E +K S  + L     +L+L   +  + AS CKQ +LNGFSWN
Sbjct  278   LLEHPSSNRSVVRQETKKQSDGFGLSCLTTELELKIHEDDEGASGCKQFELNGFSWN  334



>ref|XP_010524968.1| PREDICTED: uncharacterized protein LOC104802861 isoform X4 [Tarenaya 
hassleriana]
 ref|XP_010524969.1| PREDICTED: uncharacterized protein LOC104802861 isoform X4 [Tarenaya 
hassleriana]
Length=323

 Score =   238 bits (608),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 152/347 (44%), Positives = 197/347 (57%), Gaps = 33/347 (10%)
 Frame = -2

Query  1404  LKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDAATGSDKIPEANGNHI  1225
             +K MG+ GLTLYHLKSHLQKYRLSKNL+G AN    +        A   +K  +AN  H 
Sbjct  1     MKVMGVPGLTLYHLKSHLQKYRLSKNLNGQANYQKYQKYRL---VAMAEEKSHDANEIHT  57

Query  1224  NSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVLEKAQET  1045
              S +IG     NLPISEA+Q+Q+EVQ+RLHEQLE  RHLQLRIEA GKYLQAVLEKA ET
Sbjct  58    ESFSIGQPTEKNLPISEALQMQVEVQQRLHEQLE--RHLQLRIEAHGKYLQAVLEKAHET  115

Query  1044  LGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFCQQQAQATQPTDCSLDS  865
             LG+Q+LG  G+EAAK QLSEL SKVS +  ++ F   KEL     QQ + T P+ CSLDS
Sbjct  116   LGKQNLGTDGIEAAKVQLSELASKVSAEYSHTTFQEPKELQSLHPQQME-TYPSVCSLDS  174

Query  864   CLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQTEFRWCDDIWENRKYLS  685
              LTS E +    ++  +++GLR  +  +  E  ++  +   ++ E  W +   E R Y S
Sbjct  175   SLTSRERNQTIPKIVENRLGLRPYHGDSKSEQKEISEQQLFQRLELAWSEGQRETRTYFS  234

Query  684   KMDEETKNN---------GLSVSTGLQGGKWNGNSNYSDRRFTGTDADVKLFAQAVDRSD  532
              M  +T+            LS+  GL G K   N+ Y++ R T  D D K   +     D
Sbjct  235   TMVNDTEARISSSERSLGNLSIGIGLYGQKGQENTGYTEER-TKKDEDCKFETRNQKGMD  293

Query  531   TSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNGFSWN  391
             ++                  +LDLNT  +    +  KQ DLNGFSWN
Sbjct  294   ST-----------------TELDLNTHGENYDTARPKQFDLNGFSWN  323



>ref|XP_008781220.1| PREDICTED: uncharacterized protein LOC103701054 isoform X1 [Phoenix 
dactylifera]
Length=318

 Score =   238 bits (606),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 127/232 (55%), Positives = 162/232 (70%), Gaps = 3/232 (1%)
 Frame = -2

Query  1404  LKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDAATGSDKIPEANGNHI  1225
             ++ MGI GLTLYHLKSHLQKYRLSKNL   AN+ + K +     AA   ++  E NG+ +
Sbjct  1     MRLMGIPGLTLYHLKSHLQKYRLSKNLQSQANTGTTKNVVGCTLAA---NRTGEGNGSLM  57

Query  1224  NSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVLEKAQET  1045
             ++       N  + ISEA+Q+QIEVQRRLHEQLEVQRHLQLRIEAQG+YLQ+VLEKAQET
Sbjct  58    SNTTAASQTNKTMLISEALQMQIEVQRRLHEQLEVQRHLQLRIEAQGQYLQSVLEKAQET  117

Query  1044  LGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFCQQQAQATQPTDCSLDS  865
             LG+Q+LG  GLEAAK QLSELVSKVS++CLN+AF G++E+ G    QA A Q TDCS+DS
Sbjct  118   LGKQNLGSTGLEAAKVQLSELVSKVSHECLNTAFPGLEEISGLHPLQAHAAQFTDCSVDS  177

Query  864   CLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQTEFRWCDDI  709
             CLTS EGS ++ E     +GL +    + +       +T L++ +  W  D 
Sbjct  178   CLTSCEGSQKEQETNYVGVGLSTYPGNSPLCLQQFRADTELERAQPAWHADF  229



>gb|ACU20177.1| unknown [Glycine max]
Length=206

 Score =   232 bits (592),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 126/200 (63%), Positives = 155/200 (78%), Gaps = 7/200 (4%)
 Frame = -2

Query  1632  MY-HHHRQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFV  1456
             MY H   QGK++H S+ M +P ER +F+Q  NG GDSGLVLSTDAKPRLKWT DLH RF+
Sbjct  1     MYTHQQHQGKNIHSSSRMPIPSERQMFLQTGNGSGDSGLVLSTDAKPRLKWTPDLHARFI  60

Query  1455  EAVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNK-AMSSG  1279
             EAV QLGGADKATPK+V+K +GI GLTLYHLKSHLQKYRLSK+LHG +N+ ++K  ++SG
Sbjct  61    EAVQQLGGADKATPKTVMKLIGIPGLTLYHLKSHLQKYRLSKSLHGQSNNMTHKITINSG  120

Query  1278  MDAATGSDKIPEANGNHINSANIGPLANT-NLPISEAIQIQIEVQRRLHEQLEVQRHLQL  1102
                A   +++ E NG H+NS N+ P +N  +L ISEA+ +QIE QRRL+EQLEVQR LQL
Sbjct  121   ---AATDERLRENNGTHMNSLNLAPQSNNKDLYISEALHMQIEEQRRLNEQLEVQRLLQL  177

Query  1101  RIEAQGKYLQAVLEKAQETL  1042
             RIE + +   AVLEKAQE L
Sbjct  178   RIELK-EIPSAVLEKAQEHL  196



>ref|XP_008781221.1| PREDICTED: uncharacterized protein LOC103701054 isoform X2 [Phoenix 
dactylifera]
Length=316

 Score =   236 bits (602),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 127/232 (55%), Positives = 163/232 (70%), Gaps = 5/232 (2%)
 Frame = -2

Query  1404  LKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDAATGSDKIPEANGNHI  1225
             ++ MGI GLTLYHLKSHLQKYRLSKNL   AN+ + K   +G   A  +++  E NG+ +
Sbjct  1     MRLMGIPGLTLYHLKSHLQKYRLSKNLQSQANTGTTK---NGCTLA--ANRTGEGNGSLM  55

Query  1224  NSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVLEKAQET  1045
             ++       N  + ISEA+Q+QIEVQRRLHEQLEVQRHLQLRIEAQG+YLQ+VLEKAQET
Sbjct  56    SNTTAASQTNKTMLISEALQMQIEVQRRLHEQLEVQRHLQLRIEAQGQYLQSVLEKAQET  115

Query  1044  LGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFCQQQAQATQPTDCSLDS  865
             LG+Q+LG  GLEAAK QLSELVSKVS++CLN+AF G++E+ G    QA A Q TDCS+DS
Sbjct  116   LGKQNLGSTGLEAAKVQLSELVSKVSHECLNTAFPGLEEISGLHPLQAHAAQFTDCSVDS  175

Query  864   CLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQTEFRWCDDI  709
             CLTS EGS ++ E     +GL +    + +       +T L++ +  W  D 
Sbjct  176   CLTSCEGSQKEQETNYVGVGLSTYPGNSPLCLQQFRADTELERAQPAWHADF  227



>ref|NP_001060674.1| Os07g0685300 [Oryza sativa Japonica Group]
 dbj|BAF22588.1| Os07g0685300 [Oryza sativa Japonica Group]
 gb|EEE67838.1| hypothetical protein OsJ_25625 [Oryza sativa Japonica Group]
Length=345

 Score =   236 bits (603),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 125/203 (62%), Positives = 151/203 (74%), Gaps = 4/203 (2%)
 Frame = -2

Query  1644  TDSNMYHHHR-QGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLH  1468
             T+  MYH  + Q  S H S+   +PPE+   +QG      SGLVLSTDAKPRLKWT +LH
Sbjct  4     TEQMMYHQQQVQSDSQHLSSRPGLPPEKQFLLQG-GADSSSGLVLSTDAKPRLKWTSELH  62

Query  1467  ERFVEAVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAM  1288
             ERFVEAVNQLGG DKATPK++++ MGI GLTLYHLKSHLQKYRLSKNL   AN+S  + +
Sbjct  63    ERFVEAVNQLGGPDKATPKTIMRLMGIPGLTLYHLKSHLQKYRLSKNLQSQANASRAQGV  122

Query  1287  SSGMDAATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHL  1108
                  + T  DK  E NG+  +  ++    N+++ I+EA+Q+QIEVQRRLHEQLEVQRHL
Sbjct  123   LGC--STTEIDKPCEGNGSPASHLDLETQTNSSMHINEALQMQIEVQRRLHEQLEVQRHL  180

Query  1107  QLRIEAQGKYLQAVLEKAQETLG  1039
             QLRIEAQGKYLQ+VLEKAQE LG
Sbjct  181   QLRIEAQGKYLQSVLEKAQEALG  203



>ref|XP_010257629.1| PREDICTED: uncharacterized protein LOC104597653 isoform X1 [Nelumbo 
nucifera]
Length=371

 Score =   236 bits (603),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 170/384 (44%), Positives = 230/384 (60%), Gaps = 50/384 (13%)
 Frame = -2

Query  1524  GLVLSTDAKPRLKWTQDLHERFVEAVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQK  1345
             GL+LSTDAKPRLKWT +LH+RFV AV +LGGADKATPK++++ M + GLTLYHLKSHLQK
Sbjct  12    GLILSTDAKPRLKWTPELHQRFVVAVTELGGADKATPKALMRVMDVPGLTLYHLKSHLQK  71

Query  1344  YRLSKNLHGHANSSSNK-----AMSSGMDAATGSDKIPEANGNHINSANIG----PLANT  1192
             YRL K+    + S S +     +M+  M+A  G DK  E  G + +   IG    P+ N 
Sbjct  72    YRLGKSQQSESYSDSRQEVFLISMTDLMEADYG-DK--EVRGGYFSGELIGRTPTPI-NE  127

Query  1191  NLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVLEKAQETLGRQDLGKMGL  1012
             +L I++A+Q+Q+EVQ++LHEQ+EVQRHLQLRIEAQGKYLQ+VL+KAQETL   +   +GL
Sbjct  128   SLKIAQALQMQMEVQKKLHEQIEVQRHLQLRIEAQGKYLQSVLKKAQETLAGYNSSSLGL  187

Query  1011  EAAKAQLSELVSKVSNQCLNSAFSGIKELPGFCQQQA--QATQPTDCSLDSCLTSSEGSL  838
             EAAKA+LS+L S V N+C +S+FSG+ E  GF  Q+   Q+ +  DCS+DS LTSS+ S 
Sbjct  188   EAAKAELSQLASMVDNRCPSSSFSGLTEAGGFSLQEVGKQSMRGMDCSMDSSLTSSDSSG  247

Query  837   RDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQTEFRWCDDIWENRKYLSKMDEETKNN  658
             R  E  NSQ     L  G   +     N  RL         +++ N  +L K D   + +
Sbjct  248   RKDE--NSQ----KLESGHPHDCNRHSNAARLM--------EMYPNEGHLCKSDPSDRLH  293

Query  657   GLSVSTGLQGGKWNGNSNYSDRRFTGTDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYF  478
             G       Q   W   S  SD        D+ +      RS T    K+K   +      
Sbjct  294   G-------QKRSW---STISD--------DISVDQPTAKRSPT---HKEKLGGQCTKLGL  332

Query  477   GPKLDLNTDDKTDVASSCKQLDLN  406
               KLDLN+  ++++ S C++ DLN
Sbjct  333   TDKLDLNSQYQSEMESGCQEFDLN  356



>ref|XP_009416350.1| PREDICTED: uncharacterized protein LOC103996985 isoform X5 [Musa 
acuminata subsp. malaccensis]
Length=336

 Score =   235 bits (599),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 156/419 (37%), Positives = 215/419 (51%), Gaps = 88/419 (21%)
 Frame = -2

Query  1632  MYHHH-RQGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFV  1456
             MY H   Q  +   S+ +  P ER LF+Q  +  G+SGLVLST+AKPRLKW  +LH RF+
Sbjct  1     MYQHQPHQSHNNLISSRIAAPSERQLFLQRGSTTGESGLVLSTEAKPRLKWNPELHARFI  60

Query  1455  EAVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGM  1276
             EAVNQLGGAD            I G +L                                
Sbjct  61    EAVNQLGGAD------------IFGCSL--------------------------------  76

Query  1275  DAATGSDKIPEANGNHINSANIGPLANT--NLPISEAIQIQIEVQRRLHEQLEVQRHLQL  1102
                  +++ PE NG+   S NI    N    + I+EA   QIEVQ++LHEQLEVQRHLQ+
Sbjct  77    ----AAERTPEDNGS---SRNIAAPTNNFRTMQINEAFTKQIEVQKQLHEQLEVQRHLQV  129

Query  1101  RIEAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELP  922
             RIEAQG+YLQ VLEKAQE L +Q LG +GLE AK QLSELV+KVS +C  ++F G++E+P
Sbjct  130   RIEAQGRYLQLVLEKAQERLEKQSLGSVGLEVAKVQLSELVTKVSGECFGNSFLGVEEIP  189

Query  921   GFCQQQAQATQPTDCSLDSCLTSSEGSLRDHEMRNSQMGLRSL--NFGAHMESTDLYNET  748
                  Q       DCS+DSCLT S+ S ++ +  ++ +G+R+   +  + M+    + E 
Sbjct  190   VLHMSQLTPAHFADCSVDSCLT-SDRSQKEQDTHDTTIGIRACHKDLPSCMKQ---FGED  245

Query  747   RLKQTEFRWCDDIWENRKYLSKMDEETKNNGLSVSTGLQGGKWNGNSNYSDRRFTGTDAD  568
             +L+QT+  WC D+ E + + S  + + K N                    DR        
Sbjct  246   KLEQTQHAWCGDLNEQKIFSSVPEVQRKENN------------------EDR--------  279

Query  567   VKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNGFSWN  391
               L           + E +K S  + L     +L+L   +  + AS CKQ +LNGFSWN
Sbjct  280   --LLEHPSSNRSVVRQETKKQSDGFGLSCLTTELELKIHEDDEGASGCKQFELNGFSWN  336



>dbj|BAC83815.1| transfactor-like protein [Oryza sativa Japonica Group]
Length=339

 Score =   235 bits (599),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 125/199 (63%), Positives = 149/199 (75%), Gaps = 4/199 (2%)
 Frame = -2

Query  1632  MYHHHR-QGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFV  1456
             MYH  + Q  S H S+   +PPE+   +QG      SGLVLSTDAKPRLKWT +LHERFV
Sbjct  2     MYHQQQVQSDSQHLSSRPGLPPEKQFLLQG-GADSSSGLVLSTDAKPRLKWTSELHERFV  60

Query  1455  EAVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGM  1276
             EAVNQLGG DKATPK++++ MGI GLTLYHLKSHLQKYRLSKNL   AN+S  +A     
Sbjct  61    EAVNQLGGPDKATPKTIMRLMGIPGLTLYHLKSHLQKYRLSKNLQSQANAS--RAQGVLG  118

Query  1275  DAATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRI  1096
              + T  DK  E NG+  +  ++    N+++ I+EA+Q+QIEVQRRLHEQLEVQRHLQLRI
Sbjct  119   CSTTEIDKPCEGNGSPASHLDLETQTNSSMHINEALQMQIEVQRRLHEQLEVQRHLQLRI  178

Query  1095  EAQGKYLQAVLEKAQETLG  1039
             EAQGKYLQ+VLEKAQE LG
Sbjct  179   EAQGKYLQSVLEKAQEALG  197



>ref|XP_010257647.1| PREDICTED: uncharacterized protein LOC104597653 isoform X3 [Nelumbo 
nucifera]
Length=364

 Score =   234 bits (598),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 169/379 (45%), Positives = 227/379 (60%), Gaps = 47/379 (12%)
 Frame = -2

Query  1524  GLVLSTDAKPRLKWTQDLHERFVEAVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQK  1345
             GL+LSTDAKPRLKWT +LH+RFV AV +LGGADKATPK++++ M + GLTLYHLKSHLQK
Sbjct  12    GLILSTDAKPRLKWTPELHQRFVVAVTELGGADKATPKALMRVMDVPGLTLYHLKSHLQK  71

Query  1344  YRLSKNLHGHANSSSNKAMSSGMDAATGSDKIPEANGNHINSANIG----PLANTNLPIS  1177
             YRL K+    + S S +     M+A  G DK  E  G + +   IG    P+ N +L I+
Sbjct  72    YRLGKSQQSESYSDSRQ--EDLMEADYG-DK--EVRGGYFSGELIGRTPTPI-NESLKIA  125

Query  1176  EAIQIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKA  997
             +A+Q+Q+EVQ++LHEQ+EVQRHLQLRIEAQGKYLQ+VL+KAQETL   +   +GLEAAKA
Sbjct  126   QALQMQMEVQKKLHEQIEVQRHLQLRIEAQGKYLQSVLKKAQETLAGYNSSSLGLEAAKA  185

Query  996   QLSELVSKVSNQCLNSAFSGIKELPGFCQQQA--QATQPTDCSLDSCLTSSEGSLRDHEM  823
             +LS+L S V N+C +S+FSG+ E  GF  Q+   Q+ +  DCS+DS LTSS+ S R  E 
Sbjct  186   ELSQLASMVDNRCPSSSFSGLTEAGGFSLQEVGKQSMRGMDCSMDSSLTSSDSSGRKDE-  244

Query  822   RNSQMGLRSLNFGAHMESTDLYNETRLKQTEFRWCDDIWENRKYLSKMDEETKNNGLSVS  643
              NSQ     L  G   +     N  RL         +++ N  +L K D   + +G    
Sbjct  245   -NSQ----KLESGHPHDCNRHSNAARLM--------EMYPNEGHLCKSDPSDRLHG----  287

Query  642   TGLQGGKWNGNSNYSDRRFTGTDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYFGPKLD  463
                Q   W   S  SD        D+ +      RS T    K+K   +        KLD
Sbjct  288   ---QKRSW---STISD--------DISVDQPTAKRSPT---HKEKLGGQCTKLGLTDKLD  330

Query  462   LNTDDKTDVASSCKQLDLN  406
             LN+  ++++ S C++ DLN
Sbjct  331   LNSQYQSEMESGCQEFDLN  349



>ref|XP_009414235.1| PREDICTED: uncharacterized protein LOC103995386 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=332

 Score =   233 bits (595),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 144/356 (40%), Positives = 212/356 (60%), Gaps = 42/356 (12%)
 Frame = -2

Query  1404  LKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDAATGSDKIPEANGNHI  1225
             ++ MGI GLTLYHLKSHLQKYRLSKNL   ANS S K++   +     +++  + NG+ +
Sbjct  1     MRLMGIPGLTLYHLKSHLQKYRLSKNLQAQANSGSTKSV---IGCTLAAERTIDVNGSFM  57

Query  1224  NSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVLEKAQET  1045
              + +  P +N +  I+EA+Q+QIEVQR+L E LEVQR+LQL+IEAQGKYLQ+VLEKAQET
Sbjct  58    VNTSTMPQSNKSFQINEALQMQIEVQRQLQEHLEVQRNLQLQIEAQGKYLQSVLEKAQET  117

Query  1044  LGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFCQQQAQATQPTDCSLDS  865
             LG+Q+LG  G+E AK QL ELVSK+S++C ++AF G +E+PG    +   +QP DCS++S
Sbjct  118   LGKQNLGSPGVEDAKVQLCELVSKISSECFSNAFQGSEEIPGLNTSELHPSQPVDCSVES  177

Query  864   CLTSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQTEFRWCDDIWENRKYLS  685
             CLTS EGS      +++   LRS N    +    ++  +RL+ T+  WC  + E++ + S
Sbjct  178   CLTSFEGS------QSACKSLRSCNGSLPLCQQQVHENSRLENTQSAWC-YLHEHKTFSS  230

Query  684   KMDEETKNNGL-----------SVSTGLQGGKWNGNSNYSDRRFTGTDADVKLFAQ---A  547
                 +++               S+ T  +GG             TG++A  K       +
Sbjct  231   SSLGDSERTSFAAQKDFETLPTSIKTQNEGG-------------TGSEAQGKESDDENIS  277

Query  546   VDRSDTSKPEKQ----KTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNGFSWN  391
             V+  ++S+P  Q    K S  + L     +LDLN  +  +  +S +  DLNGFSW+
Sbjct  278   VEHPNSSRPADQQGRGKQSDRFGLLTHTAQLDLNAHEDNEGGTSSR-FDLNGFSWS  332



>gb|EEC82707.1| hypothetical protein OsI_27377 [Oryza sativa Indica Group]
Length=345

 Score =   232 bits (592),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 125/203 (62%), Positives = 150/203 (74%), Gaps = 4/203 (2%)
 Frame = -2

Query  1644  TDSNMYHHHR-QGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLH  1468
             T+  MYH  + Q  S H S+   + PE+   +QG      SGLVLSTDAKPRLKWT +LH
Sbjct  4     TEQMMYHQQQVQSDSQHLSSRPGLSPEKQFLLQG-GADSSSGLVLSTDAKPRLKWTSELH  62

Query  1467  ERFVEAVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAM  1288
             ERFVEAVNQLGG DKATPK++++ MGI GLTLYHLKSHLQKYRLSKNL   AN+S  +A 
Sbjct  63    ERFVEAVNQLGGPDKATPKTIMRLMGIPGLTLYHLKSHLQKYRLSKNLQSQANAS--RAQ  120

Query  1287  SSGMDAATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHL  1108
                  + T  DK  E NG+  +  ++    N+++ I+EA+Q+QIEVQRRLHEQLEVQRHL
Sbjct  121   GVLGCSTTEIDKPCEGNGSPASHLDLETQTNSSMHINEALQMQIEVQRRLHEQLEVQRHL  180

Query  1107  QLRIEAQGKYLQAVLEKAQETLG  1039
             QLRIEAQGKYLQ+VLEKAQE LG
Sbjct  181   QLRIEAQGKYLQSVLEKAQEALG  203



>ref|XP_010939806.1| PREDICTED: uncharacterized protein LOC105058550 isoform X1 [Elaeis 
guineensis]
Length=306

 Score =   231 bits (588),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 128/234 (55%), Positives = 159/234 (68%), Gaps = 21/234 (9%)
 Frame = -2

Query  1551  QGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEAVNQLGGADKATPKSVLKQMGIQGLTL  1372
             QGEN     GLVLS DAKPRLKWTQ LH+RFV+AV+QLGGADKATPKS+++ MG+ G+TL
Sbjct  9     QGEN----RGLVLSVDAKPRLKWTQQLHQRFVDAVSQLGGADKATPKSLMRAMGVPGVTL  64

Query  1371  YHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDAATGSDKIPEANGNHINSANIGPLANT  1192
             YHLKSHLQKYRL+KN + +   + NK      D    S+   +   + I+        N 
Sbjct  65    YHLKSHLQKYRLAKNRNTNT-PNENKI----QDCVAASNLTIDNEASQIDQEKTPARLNE  119

Query  1191  NLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVLEKAQETLGRQDLGKMGL  1012
              +     +Q+QIEVQR+L EQ+EVQRHLQLRIEAQGKYLQ+VL KAQETL       +G+
Sbjct  120   TM-----VQMQIEVQRKLQEQIEVQRHLQLRIEAQGKYLQSVLRKAQETLAGYSSNSLGM  174

Query  1011  EAAKAQLSELVSKVSNQCLNSAFSGIKELPGFCQQQAQATQPTDCSLDSCLTSS  850
             EAAKA+LSELVS V  +CL+S+FS    +P       +  +  DCS DSCLTSS
Sbjct  175   EAAKAELSELVSAVETECLSSSFSQGSLIP-------KRAEHADCSTDSCLTSS  221



>ref|XP_010939808.1| PREDICTED: myb family transcription factor APL-like isoform X3 
[Elaeis guineensis]
Length=301

 Score =   230 bits (587),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 128/234 (55%), Positives = 159/234 (68%), Gaps = 21/234 (9%)
 Frame = -2

Query  1551  QGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEAVNQLGGADKATPKSVLKQMGIQGLTL  1372
             QGEN     GLVLS DAKPRLKWTQ LH+RFV+AV+QLGGADKATPKS+++ MG+ G+TL
Sbjct  4     QGEN----RGLVLSVDAKPRLKWTQQLHQRFVDAVSQLGGADKATPKSLMRAMGVPGVTL  59

Query  1371  YHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDAATGSDKIPEANGNHINSANIGPLANT  1192
             YHLKSHLQKYRL+KN + +   + NK      D    S+   +   + I+        N 
Sbjct  60    YHLKSHLQKYRLAKNRNTNT-PNENKI----QDCVAASNLTIDNEASQIDQEKTPARLNE  114

Query  1191  NLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVLEKAQETLGRQDLGKMGL  1012
              +     +Q+QIEVQR+L EQ+EVQRHLQLRIEAQGKYLQ+VL KAQETL       +G+
Sbjct  115   TM-----VQMQIEVQRKLQEQIEVQRHLQLRIEAQGKYLQSVLRKAQETLAGYSSNSLGM  169

Query  1011  EAAKAQLSELVSKVSNQCLNSAFSGIKELPGFCQQQAQATQPTDCSLDSCLTSS  850
             EAAKA+LSELVS V  +CL+S+FS    +P       +  +  DCS DSCLTSS
Sbjct  170   EAAKAELSELVSAVETECLSSSFSQGSLIP-------KRAEHADCSTDSCLTSS  216



>ref|XP_008802582.1| PREDICTED: myb family transcription factor APL-like isoform X2 
[Phoenix dactylifera]
Length=302

 Score =   230 bits (587),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 126/230 (55%), Positives = 154/230 (67%), Gaps = 18/230 (8%)
 Frame = -2

Query  1536  HGDS-GLVLSTDAKPRLKWTQDLHERFVEAVNQLGGADKATPKSVLKQMGIQGLTLYHLK  1360
             HGD  GLVLS DAKPRLKWTQ LH RFV+AV+QLGGADKATPKS+++ MG+ GLTLYHLK
Sbjct  4     HGDDRGLVLSVDAKPRLKWTQQLHRRFVDAVSQLGGADKATPKSLMRAMGVPGLTLYHLK  63

Query  1359  SHLQKYRLSKNLHGHANSSSNKAMSSGMDAATGSDKIPEANGNHINSANIGPLANTNLPI  1180
             SHLQKYRL+KN   +    + +      D    S    E    HI+        +  +  
Sbjct  64    SHLQKYRLAKNRDTNTPGDNKQK-----DCKATSTTTMENEAAHIDQEKTPAQFDETM--  116

Query  1179  SEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVLEKAQETLGRQDLGKMGLEAAK  1000
                +Q+QIEVQR+L EQ+EVQRHLQLRIEAQGKYL++VL KAQETL       +G+EAAK
Sbjct  117   ---VQMQIEVQRKLQEQIEVQRHLQLRIEAQGKYLRSVLRKAQETLAGYTSNSLGVEAAK  173

Query  999   AQLSELVSKVSNQCLNSAFSGIKELPGFCQQQAQATQPTDCSLDSCLTSS  850
             A+LSELVS V  +CL+S+FS    +P       +  +  DCS DSCLTSS
Sbjct  174   AELSELVSAVETECLSSSFSQGSLIP-------KRAEHADCSTDSCLTSS  216



>ref|XP_008802581.1| PREDICTED: myb family transcription factor APL-like isoform X1 
[Phoenix dactylifera]
Length=303

 Score =   230 bits (587),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 128/230 (56%), Positives = 155/230 (67%), Gaps = 17/230 (7%)
 Frame = -2

Query  1536  HGDS-GLVLSTDAKPRLKWTQDLHERFVEAVNQLGGADKATPKSVLKQMGIQGLTLYHLK  1360
             HGD  GLVLS DAKPRLKWTQ LH RFV+AV+QLGGADKATPKS+++ MG+ GLTLYHLK
Sbjct  4     HGDDRGLVLSVDAKPRLKWTQQLHRRFVDAVSQLGGADKATPKSLMRAMGVPGLTLYHLK  63

Query  1359  SHLQKYRLSKNLHGHANSSSNKAMSSGMDAATGSDKIPEANGNHINSANIGPLANTNLPI  1180
             SHLQKYRL+KN   +     NK  +   D    S    E    HI+        +  +  
Sbjct  64    SHLQKYRLAKNRDTN-TPGDNKQKA---DCKATSTTTMENEAAHIDQEKTPAQFDETM--  117

Query  1179  SEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVLEKAQETLGRQDLGKMGLEAAK  1000
                +Q+QIEVQR+L EQ+EVQRHLQLRIEAQGKYL++VL KAQETL       +G+EAAK
Sbjct  118   ---VQMQIEVQRKLQEQIEVQRHLQLRIEAQGKYLRSVLRKAQETLAGYTSNSLGVEAAK  174

Query  999   AQLSELVSKVSNQCLNSAFSGIKELPGFCQQQAQATQPTDCSLDSCLTSS  850
             A+LSELVS V  +CL+S+FS    +P       +  +  DCS DSCLTSS
Sbjct  175   AELSELVSAVETECLSSSFSQGSLIP-------KRAEHADCSTDSCLTSS  217



>ref|XP_006658148.1| PREDICTED: myb family transcription factor APL-like [Oryza brachyantha]
Length=353

 Score =   231 bits (590),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 151/199 (76%), Gaps = 4/199 (2%)
 Frame = -2

Query  1632  MYHHHR-QGKSMHPSTNMLMPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFV  1456
             MYH  + Q ++ H S+  ++PPE+   +QG      SGLVLSTDAKPRLKWT +LHERFV
Sbjct  7     MYHQQQIQSENQHLSSRPVLPPEKQFLLQG-GTDSSSGLVLSTDAKPRLKWTSELHERFV  65

Query  1455  EAVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGM  1276
             +AV QLGG DKATPK++++ MGI GLTLYHLKSHLQKYRLSKNL   AN+S  + +    
Sbjct  66    DAVTQLGGPDKATPKTIMRLMGIPGLTLYHLKSHLQKYRLSKNLQSQANASRAQGVLGC-  124

Query  1275  DAATGSDKIPEANGNHINSANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRI  1096
              +A  +DK  E NG+  +  ++    ++++ ISEA+Q+QIEVQRRLHEQLEVQRHLQLRI
Sbjct  125   -SAMETDKPCEGNGSPASHLDLEMQTSSSVHISEALQMQIEVQRRLHEQLEVQRHLQLRI  183

Query  1095  EAQGKYLQAVLEKAQETLG  1039
             EAQGKYLQ+VLEKAQE LG
Sbjct  184   EAQGKYLQSVLEKAQEALG  202



>ref|XP_010241363.1| PREDICTED: myb family transcription factor APL-like isoform X1 
[Nelumbo nucifera]
Length=305

 Score =   229 bits (585),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 121/244 (50%), Positives = 165/244 (68%), Gaps = 15/244 (6%)
 Frame = -2

Query  1554  MQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEAVNQLGGADKATPKSVLKQMGIQGLT  1375
             ++G N  GD+ LVL+TD KPRL+WT +LHERFV+AV QLGG DKATPK++++ MG++GLT
Sbjct  21    LEGTNLPGDACLVLTTDPKPRLRWTAELHERFVDAVTQLGGPDKATPKTIMRTMGVKGLT  80

Query  1374  LYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDAATGSDKIPEANGNHINSANIGPLAN  1195
             LYHLKSHLQKYRL K        SS  A  S +  + G+     +  + + + ++    N
Sbjct  81    LYHLKSHLQKYRLGKQSCKEFTESSKDA--SSVAESQGAVSSSSSASSRMMAQDL----N  134

Query  1194  TNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVLEKAQETLGRQDLGKMG  1015
                 ++EA+++Q+EVQRRLHEQLEVQRHL LRIEAQGKYLQ++LEKA + L  Q +  +G
Sbjct  135   DGYQVTEALRVQMEVQRRLHEQLEVQRHLHLRIEAQGKYLQSILEKACKALNEQTIASVG  194

Query  1014  LEAAKAQLSELVSKVSNQCLNSA------FSGIKELPGFCQQQAQATQPT---DCSLDSC  862
             LEAA+ +LSEL  KVSN CL            + E+    ++++ +  PT   DCS+DSC
Sbjct  195   LEAARQELSELAIKVSNDCLGMVPLDTIKMPSLSEIAAALEEKSASNGPTRIGDCSVDSC  254

Query  861   LTSS  850
             LTS+
Sbjct  255   LTST  258



>ref|XP_010241364.1| PREDICTED: myb family transcription factor APL-like isoform X2 
[Nelumbo nucifera]
Length=300

 Score =   229 bits (583),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 120/244 (49%), Positives = 164/244 (67%), Gaps = 20/244 (8%)
 Frame = -2

Query  1554  MQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEAVNQLGGADKATPKSVLKQMGIQGLT  1375
             ++G N  GD+ LVL+TD KPRL+WT +LHERFV+AV QLGG DKATPK++++ MG++GLT
Sbjct  21    LEGTNLPGDACLVLTTDPKPRLRWTAELHERFVDAVTQLGGPDKATPKTIMRTMGVKGLT  80

Query  1374  LYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDAATGSDKIPEANGNHINSANIGPLAN  1195
             LYHLKSHLQKYRL K        S  +   S  D + G+     +  + + + ++    N
Sbjct  81    LYHLKSHLQKYRLGKQ-------SCKEFTESSKDESQGAVSSSSSASSRMMAQDL----N  129

Query  1194  TNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVLEKAQETLGRQDLGKMG  1015
                 ++EA+++Q+EVQRRLHEQLEVQRHL LRIEAQGKYLQ++LEKA + L  Q +  +G
Sbjct  130   DGYQVTEALRVQMEVQRRLHEQLEVQRHLHLRIEAQGKYLQSILEKACKALNEQTIASVG  189

Query  1014  LEAAKAQLSELVSKVSNQCLNSA------FSGIKELPGFCQQQAQATQPT---DCSLDSC  862
             LEAA+ +LSEL  KVSN CL            + E+    ++++ +  PT   DCS+DSC
Sbjct  190   LEAARQELSELAIKVSNDCLGMVPLDTIKMPSLSEIAAALEEKSASNGPTRIGDCSVDSC  249

Query  861   LTSS  850
             LTS+
Sbjct  250   LTST  253



>ref|XP_010257637.1| PREDICTED: uncharacterized protein LOC104597653 isoform X2 [Nelumbo 
nucifera]
Length=369

 Score =   228 bits (581),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 168/384 (44%), Positives = 228/384 (59%), Gaps = 52/384 (14%)
 Frame = -2

Query  1524  GLVLSTDAKPRLKWTQDLHERFVEAVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQK  1345
             GL+LSTDAKPRLKWT +LH+RFV AV +LGGADKATPK++++ M + GLTLYHLKSHLQK
Sbjct  12    GLILSTDAKPRLKWTPELHQRFVVAVTELGGADKATPKALMRVMDVPGLTLYHLKSHLQK  71

Query  1344  YRLSKNLHGHANSSSNK-----AMSSGMDAATGSDKIPEANGNHINSANIG----PLANT  1192
             YRL K+    + S S +     +M+  M+A  G DK  E  G + +   IG    P+ N 
Sbjct  72    YRLGKSQQSESYSDSRQEVFLISMTDLMEADYG-DK--EVRGGYFSGELIGRTPTPI-NE  127

Query  1191  NLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVLEKAQETLGRQDLGKMGL  1012
             +L I++A+Q+Q+EVQ++LHEQ+E  RHLQLRIEAQGKYLQ+VL+KAQETL   +   +GL
Sbjct  128   SLKIAQALQMQMEVQKKLHEQIE--RHLQLRIEAQGKYLQSVLKKAQETLAGYNSSSLGL  185

Query  1011  EAAKAQLSELVSKVSNQCLNSAFSGIKELPGFCQQQA--QATQPTDCSLDSCLTSSEGSL  838
             EAAKA+LS+L S V N+C +S+FSG+ E  GF  Q+   Q+ +  DCS+DS LTSS+ S 
Sbjct  186   EAAKAELSQLASMVDNRCPSSSFSGLTEAGGFSLQEVGKQSMRGMDCSMDSSLTSSDSSG  245

Query  837   RDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQTEFRWCDDIWENRKYLSKMDEETKNN  658
             R  E  NSQ     L  G   +     N  RL         +++ N  +L K D   + +
Sbjct  246   RKDE--NSQ----KLESGHPHDCNRHSNAARLM--------EMYPNEGHLCKSDPSDRLH  291

Query  657   GLSVSTGLQGGKWNGNSNYSDRRFTGTDADVKLFAQAVDRSDTSKPEKQKTSQEYKLPYF  478
             G       Q   W   S  SD        D+ +      RS T    K+K   +      
Sbjct  292   G-------QKRSW---STISD--------DISVDQPTAKRSPT---HKEKLGGQCTKLGL  330

Query  477   GPKLDLNTDDKTDVASSCKQLDLN  406
               KLDLN+  ++++ S C++ DLN
Sbjct  331   TDKLDLNSQYQSEMESGCQEFDLN  354



>ref|XP_009416352.1| PREDICTED: uncharacterized protein LOC103996985 isoform X7 [Musa 
acuminata subsp. malaccensis]
Length=304

 Score =   225 bits (574),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 138/341 (40%), Positives = 191/341 (56%), Gaps = 40/341 (12%)
 Frame = -2

Query  1404  LKQMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDAATGSDKIPEANGNHI  1225
             ++ MGI GLTLYHLKSHLQKYRL KNL    N  S K +      +  +++ PE NG+  
Sbjct  1     MRLMGIPGLTLYHLKSHLQKYRLGKNLQAQTNIRSTKNI---FGCSLAAERTPEDNGSSR  57

Query  1224  NSANIGPLAN-TNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVLEKAQE  1048
             N A   P  N   + I+EA   QIEVQ++LHEQLEVQRHLQ+RIEAQG+YLQ VLEKAQE
Sbjct  58    NIA--APTNNFRTMQINEAFTKQIEVQKQLHEQLEVQRHLQVRIEAQGRYLQLVLEKAQE  115

Query  1047  TLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFCQQQAQATQPTDCSLD  868
              L +Q LG +GLE AK QLSELV+KVS +C  ++F G++E+P     Q       DCS+D
Sbjct  116   RLEKQSLGSVGLEVAKVQLSELVTKVSGECFGNSFLGVEEIPVLHMSQLTPAHFADCSVD  175

Query  867   SCLTSSEGSLRDHEMRNSQMGLRSL--NFGAHMESTDLYNETRLKQTEFRWCDDIWENRK  694
             SCLT S+ S ++ +  ++ +G+R+   +  + M+    + E +L+QT+  WC D+ E + 
Sbjct  176   SCLT-SDRSQKEQDTHDTTIGIRACHKDLPSCMKQ---FGEDKLEQTQHAWCGDLNEQKI  231

Query  693   YLSKMDEETKNNGLSVSTGLQGGKWNGNSNYSDRRFTGTDADVKLFAQAVDRSDTSKPEK  514
             + S  + + K N                    DR          L           + E 
Sbjct  232   FSSVPEVQRKENN------------------EDR----------LLEHPSSNRSVVRQET  263

Query  513   QKTSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNGFSWN  391
             +K S  + L     +L+L   +  + AS CKQ +LNGFSWN
Sbjct  264   KKQSDGFGLSCLTTELELKIHEDDEGASGCKQFELNGFSWN  304



>ref|XP_010939807.1| PREDICTED: uncharacterized protein LOC105058550 isoform X2 [Elaeis 
guineensis]
Length=304

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 126/234 (54%), Positives = 157/234 (67%), Gaps = 23/234 (10%)
 Frame = -2

Query  1551  QGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEAVNQLGGADKATPKSVLKQMGIQGLTL  1372
             QGEN     GLVLS DAKPRLKWTQ LH+RFV+AV+QLGGADKATPKS+++ MG+ G+TL
Sbjct  9     QGEN----RGLVLSVDAKPRLKWTQQLHQRFVDAVSQLGGADKATPKSLMRAMGVPGVTL  64

Query  1371  YHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDAATGSDKIPEANGNHINSANIGPLANT  1192
             YHLKSHLQKYRL+KN + +   + NK      D    S+   +   + I+        N 
Sbjct  65    YHLKSHLQKYRLAKNRNTNT-PNENKI----QDCVAASNLTIDNEASQIDQEKTPARLNE  119

Query  1191  NLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVLEKAQETLGRQDLGKMGL  1012
              +     +Q+QIEVQR+L EQ+E  RHLQLRIEAQGKYLQ+VL KAQETL       +G+
Sbjct  120   TM-----VQMQIEVQRKLQEQIE--RHLQLRIEAQGKYLQSVLRKAQETLAGYSSNSLGM  172

Query  1011  EAAKAQLSELVSKVSNQCLNSAFSGIKELPGFCQQQAQATQPTDCSLDSCLTSS  850
             EAAKA+LSELVS V  +CL+S+FS    +P       +  +  DCS DSCLTSS
Sbjct  173   EAAKAELSELVSAVETECLSSSFSQGSLIP-------KRAEHADCSTDSCLTSS  219



>ref|XP_010264110.1| PREDICTED: myb family transcription factor APL-like isoform X2 
[Nelumbo nucifera]
Length=306

 Score =   222 bits (565),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 120/248 (48%), Positives = 165/248 (67%), Gaps = 15/248 (6%)
 Frame = -2

Query  1554  MQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEAVNQLGGADKATPKSVLKQMGIQGLT  1375
             ++G N  GD+ LVL+TD KPRL+WT +LHERFV+AV QLGG DKATPK++++ MG++GLT
Sbjct  21    LEGTNLPGDACLVLTTDPKPRLRWTAELHERFVDAVTQLGGPDKATPKTIMRTMGVKGLT  80

Query  1374  LYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDAATGSDKIPEANGNHINSANIGPLAN  1195
             LYHLKSHLQKYRL K      + SS  A  S +  + G+     +  + +   ++    N
Sbjct  81    LYHLKSHLQKYRLGKQSCKEFSDSSKDA--SCVAESQGTVSSSSSASSRMMPQDL----N  134

Query  1194  TNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVLEKAQETLGRQDLGKMG  1015
                 ++EA+++Q+EVQRRLHEQLEVQRHL LRIEAQGKYLQ++LEKA + L  Q +   G
Sbjct  135   DGYQVTEALRVQMEVQRRLHEQLEVQRHLHLRIEAQGKYLQSILEKACKALNEQAVVSAG  194

Query  1014  LEAAKAQLSELVSKVSNQCLNSA------FSGIKELPGFCQQQAQATQPT---DCSLDSC  862
             LEA + +LSEL  KVSN CL            + EL    ++++ ++ P    DCS++SC
Sbjct  195   LEATRQELSELAIKVSNDCLGVVPLDTIKMPTLSELAATLEEKSASSGPAQVGDCSVNSC  254

Query  861   LTSSEGSL  838
             LTS+  S+
Sbjct  255   LTSTGSSV  262



>ref|XP_008802584.1| PREDICTED: myb family transcription factor APL-like isoform X3 
[Phoenix dactylifera]
Length=301

 Score =   221 bits (564),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 126/230 (55%), Positives = 153/230 (67%), Gaps = 19/230 (8%)
 Frame = -2

Query  1536  HGDS-GLVLSTDAKPRLKWTQDLHERFVEAVNQLGGADKATPKSVLKQMGIQGLTLYHLK  1360
             HGD  GLVLS DAKPRLKWTQ LH RFV+AV+QLGGADKATPKS+++ MG+ GLTLYHLK
Sbjct  4     HGDDRGLVLSVDAKPRLKWTQQLHRRFVDAVSQLGGADKATPKSLMRAMGVPGLTLYHLK  63

Query  1359  SHLQKYRLSKNLHGHANSSSNKAMSSGMDAATGSDKIPEANGNHINSANIGPLANTNLPI  1180
             SHLQKYRL+KN   +     NK  +   D    S    E    HI+        +  +  
Sbjct  64    SHLQKYRLAKNRDTN-TPGDNKQKA---DCKATSTTTMENEAAHIDQEKTPAQFDETM--  117

Query  1179  SEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVLEKAQETLGRQDLGKMGLEAAK  1000
                +Q+QIEVQR+L EQ+E  RHLQLRIEAQGKYL++VL KAQETL       +G+EAAK
Sbjct  118   ---VQMQIEVQRKLQEQIE--RHLQLRIEAQGKYLRSVLRKAQETLAGYTSNSLGVEAAK  172

Query  999   AQLSELVSKVSNQCLNSAFSGIKELPGFCQQQAQATQPTDCSLDSCLTSS  850
             A+LSELVS V  +CL+S+FS    +P       +  +  DCS DSCLTSS
Sbjct  173   AELSELVSAVETECLSSSFSQGSLIP-------KRAEHADCSTDSCLTSS  215



>emb|CDO99459.1| unnamed protein product [Coffea canephora]
Length=325

 Score =   222 bits (565),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 119/245 (49%), Positives = 158/245 (64%), Gaps = 11/245 (4%)
 Frame = -2

Query  1560  LFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEAVNQLGGADKATPKSVLKQMGIQG  1381
             + + G N  GD+ LVL+TD KPRL+WT +LHERFV+AV QLGG DKATPK++++ MG++G
Sbjct  45    MSLDGTNLPGDACLVLTTDPKPRLRWTAELHERFVDAVTQLGGPDKATPKTIMRTMGVKG  104

Query  1380  LTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDAATGSDKIPEANGNHINSANIGPL  1201
             LTLYHLKSHLQKYRL K        +S  A        TGS           +S  I   
Sbjct  105   LTLYHLKSHLQKYRLGKQACKETTENSKDASCVAESQDTGSSTC-------ASSRMIAQD  157

Query  1200  ANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVLEKAQETLGRQDLGK  1021
              N    ++EA+++Q+EVQRRLHEQLEVQR LQLRIEAQGKYLQ++LEKA + L    +  
Sbjct  158   INDGYQVTEALRVQMEVQRRLHEQLEVQRRLQLRIEAQGKYLQSILEKACKALNDHAVAS  217

Query  1020  MGLEAAKAQLSELVSKVSNQCLN-SAFSGIKELPGFCQQQAQATQPT---DCSLDSCLTS  853
              GLEAA+ +LSEL  KV++ C   ++   + E+    + +  +  P    DCS+DSCLTS
Sbjct  218   AGLEAAREELSELAIKVASDCQGMTSVPPLSEVAPGMENKTPSNLPARIGDCSIDSCLTS  277

Query  852   SEGSL  838
             +E  +
Sbjct  278   NESPV  282



>ref|XP_002323774.2| myb family transcription factor family protein [Populus trichocarpa]
 gb|ABK94861.1| unknown [Populus trichocarpa]
 gb|EEF03907.2| myb family transcription factor family protein [Populus trichocarpa]
Length=309

 Score =   221 bits (562),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 119/244 (49%), Positives = 160/244 (66%), Gaps = 13/244 (5%)
 Frame = -2

Query  1554  MQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEAVNQLGGADKATPKSVLKQMGIQGLT  1375
             + G N  GD+ LVL+TD KPRL+WT +LHERFV+AV QLGG DKATPK++++ MG++GLT
Sbjct  20    LDGINLPGDACLVLTTDPKPRLRWTAELHERFVDAVTQLGGPDKATPKTIMRTMGVKGLT  79

Query  1374  LYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDAATGSDKIPEANGNHINSANIGPLAN  1195
             LYHLKSHLQKYRL K        S++ +   G+ A + ++     +    +S  I    N
Sbjct  80    LYHLKSHLQKYRLGKQ---SCKESTDNSKDVGI-APSVAESQDTGSSTSASSRMIAQDLN  135

Query  1194  TNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVLEKAQETLGRQDLGKMG  1015
                 ++EA+++Q+EVQRRLHEQLEVQ HLQLRIEAQGKYLQ++LEKA + L  Q +   G
Sbjct  136   DGYQVTEALRVQMEVQRRLHEQLEVQHHLQLRIEAQGKYLQSILEKACKALNDQAVATAG  195

Query  1014  LEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFCQQQAQ---------ATQPTDCSLDSC  862
             LEAA+ +LSEL  KVSN+C   A     ++P   +  A            +  DCS++SC
Sbjct  196   LEAAREELSELAIKVSNECAGIAPLDTMKMPSLSELAAALGNRNASNVPARIGDCSVESC  255

Query  861   LTSS  850
             LTS+
Sbjct  256   LTST  259



>gb|KHG14403.1| Myb family transcription factor APL [Gossypium arboreum]
Length=303

 Score =   220 bits (561),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 119/248 (48%), Positives = 159/248 (64%), Gaps = 16/248 (6%)
 Frame = -2

Query  1554  MQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEAVNQLGGADKATPKSVLKQMGIQGLT  1375
             + G N  GD+ LVL+TD KPRL+WT +LHERFV+AV QLGG DKATPK++++ MG++GLT
Sbjct  21    LDGTNLPGDACLVLTTDPKPRLRWTAELHERFVDAVTQLGGPDKATPKTIMRTMGVKGLT  80

Query  1374  LYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDAATGSDKIPEANGNHINSANIGPLAN  1195
             LYHLKSHLQKYRL K        S+ ++  +  DA++ +++    +    +S  I    N
Sbjct  81    LYHLKSHLQKYRLGKQ-------SAKESTDNSKDASSIAERQDTGSSTTASSRMIAQDVN  133

Query  1194  TNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVLEKAQETLGRQDLGKMG  1015
                 ++EA+++Q+EVQR+LHEQLEVQR LQLRIEAQGKYLQ++LEKA   L  +     G
Sbjct  134   DGYQVTEALRVQMEVQRKLHEQLEVQRRLQLRIEAQGKYLQSILEKACTALNDEAAASTG  193

Query  1014  LEAAKAQLSELVSKVSNQCL------NSAFSGIKELPGFCQQQAQATQPT---DCSLDSC  862
             LEAA+ +LSEL  KVSN C       N     + E     + +     PT   DCS++S 
Sbjct  194   LEAAREELSELAIKVSNDCQGMIPLDNIKLPSLSEFTAALENKTAFNMPTRIGDCSIESF  253

Query  861   LTSSEGSL  838
             LTSS   L
Sbjct  254   LTSSRSPL  261



>ref|XP_010066903.1| PREDICTED: myb family transcription factor APL [Eucalyptus grandis]
 gb|KCW64948.1| hypothetical protein EUGRSUZ_G02494 [Eucalyptus grandis]
Length=353

 Score =   221 bits (564),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 122/211 (58%), Positives = 152/211 (72%), Gaps = 7/211 (3%)
 Frame = -2

Query  1548  GENGHGDSGLVLSTDAKPRLKWTQDLHERFVEAVNQLGGADKATPKSVLKQMGIQGLTLY  1369
             G   H    LVLSTDAKPRLKWT +LH RFVEAV QLGGADKATPKS+++ MGI GLTLY
Sbjct  2     GLQNHQKMNLVLSTDAKPRLKWTPELHHRFVEAVMQLGGADKATPKSLMRAMGIPGLTLY  61

Query  1368  HLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDAATGSDKIPEANGNHINSANIGPLA---  1198
             HLKSHLQKYRL K+     + S       G   AT + ++  A+  + N+  I P     
Sbjct  62    HLKSHLQKYRLGKS---QQSESCIDTKQEGEFYATENKEVQSAD-EYQNTEIIDPSTFQM  117

Query  1197  NTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVLEKAQETLGRQDLGKM  1018
             N +L I++A+Q+Q+EVQR+LHEQ+EVQ+HLQLRIEAQGKYLQ+VL KAQETL R +   +
Sbjct  118   NESLQIAQALQMQMEVQRKLHEQIEVQKHLQLRIEAQGKYLQSVLRKAQETLARYNNSPV  177

Query  1017  GLEAAKAQLSELVSKVSNQCLNSAFSGIKEL  925
             G++AAKA+LS+LVS VS+ C  S FS + EL
Sbjct  178   GIDAAKAELSQLVSMVSSGCPGSPFSELTEL  208



>ref|XP_008802586.1| PREDICTED: myb family transcription factor APL-like isoform X5 
[Phoenix dactylifera]
Length=203

 Score =   216 bits (551),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 117/200 (59%), Positives = 141/200 (71%), Gaps = 10/200 (5%)
 Frame = -2

Query  1536  HGDS-GLVLSTDAKPRLKWTQDLHERFVEAVNQLGGADKATPKSVLKQMGIQGLTLYHLK  1360
             HGD  GLVLS DAKPRLKWTQ LH RFV+AV+QLGGADKATPKS+++ MG+ GLTLYHLK
Sbjct  4     HGDDRGLVLSVDAKPRLKWTQQLHRRFVDAVSQLGGADKATPKSLMRAMGVPGLTLYHLK  63

Query  1359  SHLQKYRLSKNLHGHANSSSNKAMSSGMDAATGSDKIPEANGNHINSANIGPLANTNLPI  1180
             SHLQKYRL+KN   +     NK  +   D    S    E    HI+        +  +  
Sbjct  64    SHLQKYRLAKNRDTN-TPGDNKQKA---DCKATSTTTMENEAAHIDQEKTPAQFDETM--  117

Query  1179  SEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVLEKAQETLGRQDLGKMGLEAAK  1000
                +Q+QIEVQR+L EQ+EVQRHLQLRIEAQGKYL++VL KAQETL       +G+EAAK
Sbjct  118   ---VQMQIEVQRKLQEQIEVQRHLQLRIEAQGKYLRSVLRKAQETLAGYTSNSLGVEAAK  174

Query  999   AQLSELVSKVSNQCLNSAFS  940
             A+LSELVS V  +CL+S+FS
Sbjct  175   AELSELVSAVETECLSSSFS  194



>ref|XP_011017283.1| PREDICTED: uncharacterized protein LOC105120679 [Populus euphratica]
Length=322

 Score =   220 bits (561),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 123/225 (55%), Positives = 157/225 (70%), Gaps = 16/225 (7%)
 Frame = -2

Query  1536  HGDSGLVLSTDAKPRLKWTQDLHERFVEAVNQLGGADKATPKSVLKQMGIQGLTLYHLKS  1357
             H    LVLSTDAKPRLKWTQ+LH+RFVEAVNQLGGADKATPKS+++ MGI GLTLYHLKS
Sbjct  5     HQSMNLVLSTDAKPRLKWTQELHQRFVEAVNQLGGADKATPKSLMRVMGIPGLTLYHLKS  64

Query  1356  HLQKYRLSKN----LHGHANSSSNKAMSSGMD-----AATGSDKIPEANGNHINSANIGP  1204
             HLQKYRL K+    +   +    +K + S  D     A T S +   ++GNH       P
Sbjct  65    HLQKYRLGKSQQSLISIESKQEDDKEIQSSDDHFKESAVTRSSRGICSDGNH------HP  118

Query  1203  LANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVLEKAQETLGRQDLG  1024
             + N +  I++A+Q+Q+EVQR+LHEQ+EVQRHLQLRIEAQGKYLQ VL+KAQETL   +  
Sbjct  119   I-NESFQIAQALQMQMEVQRKLHEQIEVQRHLQLRIEAQGKYLQTVLKKAQETLAGYNSS  177

Query  1023  KMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFCQQQAQATQ  889
              MG+E AKA+L  L S V++ C +S+ S + E  G   ++ + TQ
Sbjct  178   SMGIELAKAELCRLASMVNSGCPSSSISELTETGGSILKEIERTQ  222



>ref|XP_006369801.1| hypothetical protein POPTR_0001s32200g [Populus trichocarpa]
 gb|ERP66370.1| hypothetical protein POPTR_0001s32200g [Populus trichocarpa]
Length=307

 Score =   219 bits (558),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 121/244 (50%), Positives = 161/244 (66%), Gaps = 13/244 (5%)
 Frame = -2

Query  1554  MQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEAVNQLGGADKATPKSVLKQMGIQGLT  1375
             + G N  GD+ LVL+TD KPRL+WT +LHERFV+AV QLGG DKATPK++++ MG++GLT
Sbjct  20    LDGTNLPGDACLVLTTDPKPRLRWTAELHERFVDAVAQLGGPDKATPKTIMRTMGVKGLT  79

Query  1374  LYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDAATGSDKIPEANGNHINSANIGPLAN  1195
             LYHLKSHLQKYRL K        S++ +   G+ AA+ ++     +    +S  I    N
Sbjct  80    LYHLKSHLQKYRLGKQ---SCKESTDNSKDVGI-AASVAESQDTGSSTSASSRMIAQDLN  135

Query  1194  TNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVLEKAQETLGRQDLGKMG  1015
                 ++EA+++Q+EVQRRLHEQLEVQR LQLRIEAQGKYLQ++LEKA + L  Q +   G
Sbjct  136   DGYQVTEALRVQMEVQRRLHEQLEVQRRLQLRIEAQGKYLQSILEKACKALNDQAVATAG  195

Query  1014  LEAAKAQLSELVSKVSNQCLNSA------FSGIKELPGFCQQQAQATQPT---DCSLDSC  862
             LEAA+ +LSEL  KVSN+    A         I EL    + +  +  P    DCS++SC
Sbjct  196   LEAAREELSELAIKVSNERAGIAPLDTMKMPSISELAAALENKHASNVPARVGDCSVESC  255

Query  861   LTSS  850
             LTS+
Sbjct  256   LTST  259



>gb|KCW64949.1| hypothetical protein EUGRSUZ_G02494 [Eucalyptus grandis]
Length=352

 Score =   220 bits (561),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 121/210 (58%), Positives = 151/210 (72%), Gaps = 6/210 (3%)
 Frame = -2

Query  1548  GENGHGDSGLVLSTDAKPRLKWTQDLHERFVEAVNQLGGADKATPKSVLKQMGIQGLTLY  1369
             G   H    LVLSTDAKPRLKWT +LH RFVEAV QLGGADKATPKS+++ MGI GLTLY
Sbjct  2     GLQNHQKMNLVLSTDAKPRLKWTPELHHRFVEAVMQLGGADKATPKSLMRAMGIPGLTLY  61

Query  1368  HLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDAATGSDKIPEANGNHINSANIGP--LAN  1195
             HLKSHLQKYRL K+     + S       G   AT + ++  A+  + N+  I P     
Sbjct  62    HLKSHLQKYRLGKS---QQSESCIDTKQEGEFYATENKEVQSAD-EYQNTEIIDPSTFQM  117

Query  1194  TNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVLEKAQETLGRQDLGKMG  1015
              +L I++A+Q+Q+EVQR+LHEQ+EVQ+HLQLRIEAQGKYLQ+VL KAQETL R +   +G
Sbjct  118   NDLQIAQALQMQMEVQRKLHEQIEVQKHLQLRIEAQGKYLQSVLRKAQETLARYNNSPVG  177

Query  1014  LEAAKAQLSELVSKVSNQCLNSAFSGIKEL  925
             ++AAKA+LS+LVS VS+ C  S FS + EL
Sbjct  178   IDAAKAELSQLVSMVSSGCPGSPFSELTEL  207



>ref|XP_011045654.1| PREDICTED: myb family transcription factor APL [Populus euphratica]
Length=307

 Score =   218 bits (556),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 121/244 (50%), Positives = 161/244 (66%), Gaps = 13/244 (5%)
 Frame = -2

Query  1554  MQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEAVNQLGGADKATPKSVLKQMGIQGLT  1375
             + G N  GD+ LVL+TD KPRL+WT +LHERFV+AV QLGG DKATPK++++ MG++GLT
Sbjct  20    LDGINLPGDACLVLTTDPKPRLRWTAELHERFVDAVAQLGGPDKATPKTIMRTMGVKGLT  79

Query  1374  LYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDAATGSDKIPEANGNHINSANIGPLAN  1195
             LYHLKSHLQKYRL K        S++ +   G+ AA+ ++     +    +S  I    N
Sbjct  80    LYHLKSHLQKYRLGKQ---SCKESTDNSKDVGI-AASVAESQDTGSSTSASSRMIAQDLN  135

Query  1194  TNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVLEKAQETLGRQDLGKMG  1015
                 ++EA+++Q+EVQRRLHEQLEVQR LQLRIEAQGKYLQ++LEKA + L  Q +   G
Sbjct  136   DGYQVTEALRVQMEVQRRLHEQLEVQRRLQLRIEAQGKYLQSILEKACKALNDQAVATAG  195

Query  1014  LEAAKAQLSELVSKVSNQCLNSA------FSGIKELPGFCQQQAQATQPT---DCSLDSC  862
             LEAA+ +LSEL  KVSN+    A         I EL    + +  +  P    DCS++SC
Sbjct  196   LEAAREELSELAIKVSNERAGIAPLDTRKMPSISELAAALENKHASNVPARVGDCSVESC  255

Query  861   LTSS  850
             LTS+
Sbjct  256   LTST  259



>ref|XP_008339891.1| PREDICTED: protein PHR1-LIKE 1-like [Malus domestica]
Length=338

 Score =   219 bits (558),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 128/236 (54%), Positives = 164/236 (69%), Gaps = 16/236 (7%)
 Frame = -2

Query  1521  LVLSTDAKPRLKWTQDLHERFVEAVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKY  1342
             LVLSTDAKPRLKWT +LH+RFVEAVNQLGGADKATPKS+++ MGI GLTLYHLKSHLQKY
Sbjct  13    LVLSTDAKPRLKWTPELHQRFVEAVNQLGGADKATPKSLMRMMGIHGLTLYHLKSHLQKY  72

Query  1341  RLSKNLHGHANSSSN----KAMSSGMDAATGSDKIPEANGNHINSANIGPLANTNLPISE  1174
             RL K+      +       K + S  D   G+D I + + + IN +         L I+ 
Sbjct  73    RLGKSQQSENCADXRQEDYKELQSS-DGHFGAD-ISDEDHSQINES---------LQIAR  121

Query  1173  AIQIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQ  994
             ++Q+Q+EVQR+LHEQ+EVQRHLQLRIEAQGKYLQ+VL+KAQETL       +G+E AKA+
Sbjct  122   SLQLQMEVQRQLHEQIEVQRHLQLRIEAQGKYLQSVLKKAQETLSGYTSSSVGVELAKAE  181

Query  993   LSELVSKVSNQCLNSAFSGIKELPGFCQQQAQATQPTDCSLDSCLTSSEGSLRDHE  826
             L++LVS V+N C +S+FS + E      +  +  Q    S++S LTSSE S R+ E
Sbjct  182   LTQLVSMVNNGCPSSSFSELTETGTPTLKDVERKQ-MRGSMESSLTSSERSGREDE  236



>gb|KHG25334.1| Myb family transcription factor APL [Gossypium arboreum]
Length=309

 Score =   218 bits (556),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 121/219 (55%), Positives = 152/219 (69%), Gaps = 18/219 (8%)
 Frame = -2

Query  1521  LVLSTDAKPRLKWTQDLHERFVEAVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKY  1342
             LVLSTDAKPRLKWT +LH+RFV+A+NQLGG DKATPKSV++ MGI GLTLYHLKSHLQKY
Sbjct  3     LVLSTDAKPRLKWTPELHQRFVDAINQLGGPDKATPKSVMRVMGIPGLTLYHLKSHLQKY  62

Query  1341  RLSKNLHGHANSSSNKAMSSGMDAATGSDKIPEANGNHI--NSANIGPLANTNLPISEAI  1168
             RL K+L    N++  K + S             +NGN I   S  I    N +L I +A+
Sbjct  63    RLGKSL---GNNTDYKEIQS-------------SNGNFIRDTSDGIHGQMNESLQIPQAL  106

Query  1167  QIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLS  988
              +Q+EVQR+LHEQ+EVQRHLQLRIEAQGKYLQ VL+KAQETL        G E A+A+LS
Sbjct  107   HMQMEVQRKLHEQIEVQRHLQLRIEAQGKYLQTVLKKAQETLAGYSSSSAGAELARAELS  166

Query  987   ELVSKVSNQCLNSAFSGIKELPGFCQQQAQATQPTDCSL  871
             +LVS V+  C +S+FS + E+ G    + +  + T CS+
Sbjct  167   QLVSMVNTGCTSSSFSELTEVGGSSIIERKPMRGTTCSM  205



>ref|XP_008783889.1| PREDICTED: myb family transcription factor APL-like isoform X1 
[Phoenix dactylifera]
Length=306

 Score =   218 bits (555),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 123/233 (53%), Positives = 153/233 (66%), Gaps = 17/233 (7%)
 Frame = -2

Query  1542  NGHGDSGLVLSTDAKPRLKWTQDLHERFVEAVNQLGGADKATPKSVLKQMGIQGLTLYHL  1363
             N   + GLVLS DAKPRLKWT+ LHE F +AV+QLGGADKATPKS+++ MG+ GLTLYHL
Sbjct  8     NQGNNRGLVLSVDAKPRLKWTRQLHECFADAVSQLGGADKATPKSLMRTMGVPGLTLYHL  67

Query  1362  KSHLQKYRLSKNLHGHANSSSNKAMSSGMDAATGSDKIPEANGNHINSANIGPLANTNLP  1183
             KSHLQKYRL+KN   +  +   K      D    ++K  E    HI+        N  + 
Sbjct  68    KSHLQKYRLAKNRDTNTANDDRKE-----DCEAANNKTVENEAVHIDEGKTPAHFNGTM-  121

Query  1182  ISEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVLEKAQETLGRQDLGKMGLEAA  1003
                 +Q+QIEVQR+L EQ+EVQRHLQLRIEAQGKYLQ+VL KA ETL       +G+EAA
Sbjct  122   ----LQMQIEVQRKLQEQIEVQRHLQLRIEAQGKYLQSVLRKAHETLASCSSNSLGVEAA  177

Query  1002  KAQLSELVSKVSNQCLNSAFSGIKELPGFCQQQAQATQPTDCSLDSCLTSSEG  844
             KA+LSEL+S V  +CL+S+ S    +P       +  +  DCS DSCLTSS G
Sbjct  178   KAELSELLSAVETECLSSSLSLGSLIP-------KRAELADCSTDSCLTSSLG  223



>ref|XP_006840145.1| hypothetical protein AMTR_s00089p00057120 [Amborella trichopoda]
 gb|ERN01820.1| hypothetical protein AMTR_s00089p00057120 [Amborella trichopoda]
Length=291

 Score =   217 bits (553),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 122/246 (50%), Positives = 165/246 (67%), Gaps = 22/246 (9%)
 Frame = -2

Query  1554  MQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEAVNQLGGADKATPKSVLKQMGIQGLT  1375
             ++G N  GD+ LVL+TD KPRL+WT +LHERFV+AV QLGG DKATPK++++ MG++GLT
Sbjct  21    LEGTNLPGDACLVLTTDPKPRLRWTAELHERFVDAVTQLGGPDKATPKTIMRTMGVKGLT  80

Query  1374  LYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDAATGSDKIPEANGNHINSANIGPLAN  1195
             LYHLKSHLQKYRL K        S  +   +  + + G+     ++ + + S ++    N
Sbjct  81    LYHLKSHLQKYRLGKQ-------SCKEFTDNSKEESQGTTS---SSSSKLASQDM----N  126

Query  1194  TNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVLEKAQETLGRQDLGKMG  1015
                 ++EA+++ +EVQRRLHEQLEVQ+HLQLRIEAQGKYLQ++LEKA + L  Q +   G
Sbjct  127   EGYQVTEALRVHMEVQRRLHEQLEVQKHLQLRIEAQGKYLQSILEKACKALADQTVASAG  186

Query  1014  LEAAKAQLSELVSKVSNQCLN--SAFSGIKELP---GFC---QQQAQATQPTDCSLDSCL  859
             LEAA+ +LS LV KVSN CL+  S F  +  LP     C   ++  +  Q  DCS DSC 
Sbjct  187   LEAARQELSALVIKVSNGCLSAPSEFLNLPILPEMASVCVDDKKLNRQAQMADCSADSCA  246

Query  858   TSSEGS  841
             TS+E S
Sbjct  247   TSNESS  252



>ref|XP_008802585.1| PREDICTED: myb family transcription factor APL-like isoform X4 
[Phoenix dactylifera]
Length=280

 Score =   217 bits (552),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 117/200 (59%), Positives = 141/200 (71%), Gaps = 10/200 (5%)
 Frame = -2

Query  1536  HGDS-GLVLSTDAKPRLKWTQDLHERFVEAVNQLGGADKATPKSVLKQMGIQGLTLYHLK  1360
             HGD  GLVLS DAKPRLKWTQ LH RFV+AV+QLGGADKATPKS+++ MG+ GLTLYHLK
Sbjct  4     HGDDRGLVLSVDAKPRLKWTQQLHRRFVDAVSQLGGADKATPKSLMRAMGVPGLTLYHLK  63

Query  1359  SHLQKYRLSKNLHGHANSSSNKAMSSGMDAATGSDKIPEANGNHINSANIGPLANTNLPI  1180
             SHLQKYRL+KN   +     NK  +   D    S    E    HI+        +  +  
Sbjct  64    SHLQKYRLAKNRDTN-TPGDNKQKA---DCKATSTTTMENEAAHIDQEKTPAQFDETM--  117

Query  1179  SEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVLEKAQETLGRQDLGKMGLEAAK  1000
                +Q+QIEVQR+L EQ+EVQRHLQLRIEAQGKYL++VL KAQETL       +G+EAAK
Sbjct  118   ---VQMQIEVQRKLQEQIEVQRHLQLRIEAQGKYLRSVLRKAQETLAGYTSNSLGVEAAK  174

Query  999   AQLSELVSKVSNQCLNSAFS  940
             A+LSELVS V  +CL+S+FS
Sbjct  175   AELSELVSAVETECLSSSFS  194



>ref|XP_002300173.2| myb family transcription factor family protein [Populus trichocarpa]
 gb|EEE84978.2| myb family transcription factor family protein [Populus trichocarpa]
Length=303

 Score =   218 bits (554),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 122/245 (50%), Positives = 161/245 (66%), Gaps = 19/245 (8%)
 Frame = -2

Query  1554  MQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEAVNQLGGADKATPKSVLKQMGIQGLT  1375
             + G N  GD+ LVL+TD KPRL+WT +LHERFV+AV QLGG DKATPK++++ MG++GLT
Sbjct  20    LDGTNLPGDACLVLTTDPKPRLRWTAELHERFVDAVAQLGGPDKATPKTIMRTMGVKGLT  79

Query  1374  LYHLKSHLQKYRLSK-NLHGHANSSSNKAMSSGMDAATGSDKIPEANGNHINSANIGPLA  1198
             LYHLKSHLQKYRL K +     ++S + +++   D  TGS           +S  I    
Sbjct  80    LYHLKSHLQKYRLGKQSCKESTDNSKDASVAESQD--TGS-------STSASSRMIAQDL  130

Query  1197  NTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVLEKAQETLGRQDLGKM  1018
             N    ++EA+++Q+EVQRRLHEQLEVQR LQLRIEAQGKYLQ++LEKA + L  Q +   
Sbjct  131   NDGYQVTEALRVQMEVQRRLHEQLEVQRRLQLRIEAQGKYLQSILEKACKALNDQAVATA  190

Query  1017  GLEAAKAQLSELVSKVSNQCLNSA------FSGIKELPGFCQQQAQATQPT---DCSLDS  865
             GLEAA+ +LSEL  KVSN+    A         I EL    + +  +  P    DCS++S
Sbjct  191   GLEAAREELSELAIKVSNERAGIAPLDTMKMPSISELAAALENKHASNVPARVGDCSVES  250

Query  864   CLTSS  850
             CLTS+
Sbjct  251   CLTST  255



>ref|XP_006493809.1| PREDICTED: myb family transcription factor APL-like isoform X1 
[Citrus sinensis]
 gb|KDO61175.1| hypothetical protein CISIN_1g021481mg [Citrus sinensis]
Length=306

 Score =   217 bits (552),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 123/262 (47%), Positives = 163/262 (62%), Gaps = 23/262 (9%)
 Frame = -2

Query  1554  MQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEAVNQLGGADKATPKSVLKQMGIQGLT  1375
             + G N  GD+ LVL+TD KPRL+WT +LH+RFV+AV QLGG DKATPK++++ MG++GLT
Sbjct  22    LDGTNLPGDACLVLTTDPKPRLRWTAELHDRFVDAVTQLGGPDKATPKTIMRTMGVKGLT  81

Query  1374  LYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDAATGSDKIPEANGNHINSANIGPLAN  1195
             LYHLKSHLQKYRL K        +S        D +  ++     +    ++  +    N
Sbjct  82    LYHLKSHLQKYRLGKQACKETTENSK-------DVSCVAESQDTGSSTTSSTRMVAQDPN  134

Query  1194  TNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVLEKAQETLGRQDLGKMG  1015
                 ++EA+++Q+EVQRRLHEQLEVQR LQLRIEAQGKYLQ++LEKA + L  Q +   G
Sbjct  135   DGYQVTEALRVQMEVQRRLHEQLEVQRRLQLRIEAQGKYLQSILEKACKALNDQAIVAAG  194

Query  1014  LEAAKAQLSELVSKVSNQCL------NSAFSGIKELPGFCQQQAQATQPT---DCSLDSC  862
             LEAA+ +LSEL  KVSN C       N     I EL    + +  +T P    DCS++SC
Sbjct  195   LEAAREELSELAIKVSNDCQGMVPLENIKMPSISELAAALESKNASTIPARIGDCSVESC  254

Query  861   LTSSEGSLRDHEMRNSQMGLRS  796
             LTS+   +       S MGL S
Sbjct  255   LTSTSSPV-------SPMGLGS  269



>gb|KDO61174.1| hypothetical protein CISIN_1g021481mg [Citrus sinensis]
Length=312

 Score =   217 bits (553),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 123/262 (47%), Positives = 165/262 (63%), Gaps = 17/262 (6%)
 Frame = -2

Query  1554  MQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEAVNQLGGADKATPKSVLKQMGIQGLT  1375
             + G N  GD+ LVL+TD KPRL+WT +LH+RFV+AV QLGG DKATPK++++ MG++GLT
Sbjct  22    LDGTNLPGDACLVLTTDPKPRLRWTAELHDRFVDAVTQLGGPDKATPKTIMRTMGVKGLT  81

Query  1374  LYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDAATGSDKIPEANGNHINSANIGPLAN  1195
             LYHLKSHLQKYRL K        +S K     ++ +  ++     +    ++  +    N
Sbjct  82    LYHLKSHLQKYRLGKQACKETTENS-KDDYVALEVSCVAESQDTGSSTTSSTRMVAQDPN  140

Query  1194  TNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVLEKAQETLGRQDLGKMG  1015
                 ++EA+++Q+EVQRRLHEQLEVQR LQLRIEAQGKYLQ++LEKA + L  Q +   G
Sbjct  141   DGYQVTEALRVQMEVQRRLHEQLEVQRRLQLRIEAQGKYLQSILEKACKALNDQAIVAAG  200

Query  1014  LEAAKAQLSELVSKVSNQCL------NSAFSGIKELPGFCQQQAQATQPT---DCSLDSC  862
             LEAA+ +LSEL  KVSN C       N     I EL    + +  +T P    DCS++SC
Sbjct  201   LEAAREELSELAIKVSNDCQGMVPLENIKMPSISELAAALESKNASTIPARIGDCSVESC  260

Query  861   LTSSEGSLRDHEMRNSQMGLRS  796
             LTS+   +       S MGL S
Sbjct  261   LTSTSSPV-------SPMGLGS  275



>ref|XP_002518104.1| transcription factor, putative [Ricinus communis]
 gb|EEF44237.1| transcription factor, putative [Ricinus communis]
Length=303

 Score =   216 bits (551),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 122/244 (50%), Positives = 158/244 (65%), Gaps = 17/244 (7%)
 Frame = -2

Query  1554  MQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEAVNQLGGADKATPKSVLKQMGIQGLT  1375
             + G N  GD+ LVL+TD KPRL+WT +LHERFV+AV QLGG DKATPK++++ MG++GLT
Sbjct  20    LDGTNLPGDACLVLTTDPKPRLRWTAELHERFVDAVTQLGGPDKATPKTIMRTMGVKGLT  79

Query  1374  LYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDAATGSDKIPEANGNHINSANIGPLAN  1195
             LYHLKSHLQKYRL +     +N +S  A S      TGS     +         I    N
Sbjct  80    LYHLKSHLQKYRLGRQSCKESNENSKDA-SVAESQDTGSSTSTSSR-------MIAQDVN  131

Query  1194  TNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVLEKAQETLGRQDLGKMG  1015
                 ++EA+++Q+EVQRRLHEQLEVQR LQLRIEAQGKYLQ++LEKA + L  Q     G
Sbjct  132   DGYQVTEALRVQMEVQRRLHEQLEVQRRLQLRIEAQGKYLQSILEKACKALNDQAAVSAG  191

Query  1014  LEAAKAQLSELVSKVSNQCL------NSAFSGIKELPGFCQQQAQATQPT---DCSLDSC  862
             LEAA+ +LSEL  KVSN+C       N     + EL    + ++ +  P    DCS++SC
Sbjct  192   LEAAREELSELAIKVSNECQGIVPADNMKMPSLSELAVALESKSTSNLPARIGDCSVESC  251

Query  861   LTSS  850
             LTS+
Sbjct  252   LTST  255



>ref|XP_010264109.1| PREDICTED: myb family transcription factor APL-like isoform X1 
[Nelumbo nucifera]
Length=330

 Score =   217 bits (552),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 122/266 (46%), Positives = 167/266 (63%), Gaps = 27/266 (10%)
 Frame = -2

Query  1554  MQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEAVNQLGGADKATPKSVLKQMGIQGLT  1375
             ++G N  GD+ LVL+TD KPRL+WT +LHERFV+AV QLGG DKATPK++++ MG++GLT
Sbjct  21    LEGTNLPGDACLVLTTDPKPRLRWTAELHERFVDAVTQLGGPDKATPKTIMRTMGVKGLT  80

Query  1374  LYHLKSHLQKYRLSKNLHGHANSSSNKAMSS-----------------GMDAATGSDKIP  1246
             LYHLKSHLQKYRL K      + SS    +S                 G  A+  ++   
Sbjct  81    LYHLKSHLQKYRLGKQSCKEFSDSSKDGTTSCGLCWLNKMFTHSVILHGFTASCVAESQG  140

Query  1245  EANGNHINSANIGPL-ANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQA  1069
               + +   S+ + P   N    ++EA+++Q+EVQRRLHEQLEVQRHL LRIEAQGKYLQ+
Sbjct  141   TVSSSSSASSRMMPQDLNDGYQVTEALRVQMEVQRRLHEQLEVQRHLHLRIEAQGKYLQS  200

Query  1068  VLEKAQETLGRQDLGKMGLEAAKAQLSELVSKVSNQCLNSA------FSGIKELPGFCQQ  907
             +LEKA + L  Q +   GLEA + +LSEL  KVSN CL            + EL    ++
Sbjct  201   ILEKACKALNEQAVVSAGLEATRQELSELAIKVSNDCLGVVPLDTIKMPTLSELAATLEE  260

Query  906   QAQATQPT---DCSLDSCLTSSEGSL  838
             ++ ++ P    DCS++SCLTS+  S+
Sbjct  261   KSASSGPAQVGDCSVNSCLTSTGSSV  286



>ref|XP_010233783.1| PREDICTED: myb family transcription factor APL-like [Brachypodium 
distachyon]
Length=321

 Score =   216 bits (550),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 111/181 (61%), Positives = 136/181 (75%), Gaps = 4/181 (2%)
 Frame = -2

Query  1578  MPPERHLFMQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEAVNQLGGADKATPKSVLK  1399
             + PE+    QG+ G GDSGL+LSTDAKPRLKWT +LHERFVEAVNQLGG DKATPK++++
Sbjct  22    LSPEKKFLRQGQ-GRGDSGLILSTDAKPRLKWTSELHERFVEAVNQLGGPDKATPKTIMR  80

Query  1398  QMGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDAATGSDKIPEANGNHINS  1219
              MGI GLTLYHLKSHLQK+RL KNL   A   + K +   +   T +DK  E +G+  + 
Sbjct  81    VMGIPGLTLYHLKSHLQKFRLGKNLQTQAAVVNVKNV---LGFVTATDKACEGHGSPADH  137

Query  1218  ANIGPLANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVLEKAQETLG  1039
              N     + ++ ISE +Q+QIEVQRRLHEQ+EVQRHLQLRIEAQGKYL +VLEKAQE L 
Sbjct  138   LNRETGTSKSMHISETLQMQIEVQRRLHEQIEVQRHLQLRIEAQGKYLHSVLEKAQEALA  197

Query  1038  R  1036
             +
Sbjct  198   K  198



>ref|XP_011041879.1| PREDICTED: myb family transcription factor APL-like [Populus 
euphratica]
Length=309

 Score =   216 bits (549),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 118/248 (48%), Positives = 161/248 (65%), Gaps = 13/248 (5%)
 Frame = -2

Query  1554  MQGENGHGDSGLVLSTDAKPRLKWTQDLHERFVEAVNQLGGADKATPKSVLKQMGIQGLT  1375
             + G N  GD+ LVL+TD KPRL+WT +LHERFV+AV QLGG DKATPK++++ MG++GLT
Sbjct  20    LDGINLPGDACLVLTTDPKPRLRWTAELHERFVDAVTQLGGPDKATPKTIMRTMGVKGLT  79

Query  1374  LYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDAATGSDKIPEANGNHINSANIGPLAN  1195
             LYHLKSHLQKYRL K        S++ +   G+ A + ++     +    +S  I    N
Sbjct  80    LYHLKSHLQKYRLGKQ---SCKESTDNSKDVGI-APSVAESQDTGSSTSTSSRMIAQDLN  135

Query  1194  TNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVLEKAQETLGRQDLGKMG  1015
                 ++EA+++Q+EVQRRLHEQLEVQ HLQLRIEAQGKYLQ++LEKA + L  + +   G
Sbjct  136   DGYQVTEALRVQMEVQRRLHEQLEVQHHLQLRIEAQGKYLQSILEKACKALNDRAVATAG  195

Query  1014  LEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFCQQQAQ---------ATQPTDCSLDSC  862
             LEAA+ +LSEL  KVSN+C   A     ++P   +  A            +  DCS++SC
Sbjct  196   LEAAREELSELAIKVSNECAGIAPLDTMKMPSLSELAAALGNRNASNVPARIGDCSVESC  255

Query  861   LTSSEGSL  838
             LTS+   +
Sbjct  256   LTSTSSPI  263



>gb|KDO82944.1| hypothetical protein CISIN_1g017978mg [Citrus sinensis]
Length=354

 Score =   216 bits (551),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 120/215 (56%), Positives = 150/215 (70%), Gaps = 13/215 (6%)
 Frame = -2

Query  1521  LVLSTDAKPRLKWTQDLHERFVEAVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKY  1342
             LVLSTDAKPRLKWT +LH+RFV+AVN LGG DKATPKS+++ MGI GLTLYHLKSHLQKY
Sbjct  10    LVLSTDAKPRLKWTPELHQRFVDAVNHLGGPDKATPKSLMRVMGIPGLTLYHLKSHLQKY  69

Query  1341  RLSKNLHGHANSSSNKAMSSGMDAATGSDKIPEANGNHINSANIGPLANTNLPISEAIQI  1162
             RL K+ H  A    NK +    +  + SD        H+N        N +L I++A+Q+
Sbjct  70    RLGKSQHVEA-CIDNKQVVEYKETQSSSD-------GHVNRNISDGTLNQSLQIAQALQV  121

Query  1161  QIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSEL  982
             Q+EVQR+LHEQ+EVQRHLQLRIEAQGKYLQ+VL+KAQETL        G+E AKA+LS+L
Sbjct  122   QMEVQRKLHEQIEVQRHLQLRIEAQGKYLQSVLKKAQETLAGYSSSSAGVELAKAELSQL  181

Query  981   VSKVSNQCLNSAFS-----GIKELPGFCQQQAQAT  892
             VS VS  C +S+ S     G   L  F ++Q ++T
Sbjct  182   VSMVSMGCPSSSVSELTEAGTSSLKDFERKQIRST  216



>ref|XP_010054436.1| PREDICTED: myb family transcription factor APL isoform X3 [Eucalyptus 
grandis]
Length=298

 Score =   214 bits (546),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 150/339 (44%), Positives = 187/339 (55%), Gaps = 45/339 (13%)
 Frame = -2

Query  1395  MGIQGLTLYHLKSHLQKYRLSKNLHGHANSSSNKAMSSGMDAATGSDKIPEANGNHINSA  1216
             MGI GLTLYHLKSHLQKYRLSKNLHG A + +N+A++          K+ EANG H+N++
Sbjct  1     MGIPGLTLYHLKSHLQKYRLSKNLHGQATNGTNRAVAEV--------KVSEANGPHLNNS  52

Query  1215  NIGPLANTNLPISEAIQIQIEVQRRLHEQLE-VQRHLQLRIEAQGKYLQAVLEKAQETLG  1039
             +IG   N NL ISEA Q+QIEVQRRLHEQ+E  QRH+QL IEAQGKYLQAVLEKAQETLG
Sbjct  53    SIGIQVNKNLHISEAFQVQIEVQRRLHEQMEQAQRHMQLHIEAQGKYLQAVLEKAQETLG  112

Query  1038  RQDLGKMGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFCQQQAQATQPTDCSLDSCL  859
             R D G +GLEAAK QLSELVSKVS   L+S F  + ++      Q Q  Q TD SLDSCL
Sbjct  113   RHDSGSVGLEAAKYQLSELVSKVSADSLSSTFPDVVDIH---LHQMQMNQNTDGSLDSCL  169

Query  858   TSSEGSLRDHEMRNSQMGLRSLNFGAHMESTDLYNETRLKQTEFRWCDDIWENRKYLSKM  679
             T  E   +D E        R  +    +  +D+ ++ R  QT      +  E R   +  
Sbjct  170   T-CERPQKDREEDVDGSRSRDHHPNPFLLPSDIADDRRRGQT----VPEDAEERVKRAIC  224

Query  678   DEETKNNGLSVSTGLQGGKWNGNSNYSDRRFTGTDADVKLFA---QAVDRSDTSKPEKQK  508
             D  T     S S G  G                 D  +KL +    + D + + +  ++ 
Sbjct  225   DLSTTCGYRSSSEGTNG---------------RVDEKIKLASPRRTSDDETGSIEAGREG  269

Query  507   TSQEYKLPYFGPKLDLNTDDKTDVASSCKQLDLNGFSWN  391
              S  Y       KLDLN  D+          DLNGF W+
Sbjct  270   LSLGYGSSRLRSKLDLNVRDE----------DLNGFGWS  298



>ref|XP_007158649.1| hypothetical protein PHAVU_002G170700g [Phaseolus vulgaris]
 gb|ESW30643.1| hypothetical protein PHAVU_002G170700g [Phaseolus vulgaris]
Length=341

 Score =   216 bits (549),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 115/204 (56%), Positives = 145/204 (71%), Gaps = 11/204 (5%)
 Frame = -2

Query  1521  LVLSTDAKPRLKWTQDLHERFVEAVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKY  1342
             LVLSTDAKPRLKWT +LH+RF EA+NQLGGA+KATPKS+++ MGI GLTLYHLKSHLQKY
Sbjct  13    LVLSTDAKPRLKWTPELHQRFTEAINQLGGAEKATPKSLMRVMGIPGLTLYHLKSHLQKY  72

Query  1341  RLSKNLHGHANSSSNKAMSSGMDAATG--SDKIPEANGNHINSANIGPLANTNLPISEAI  1168
             RL K+      S +N+   S + ++ G  S +I     N +N          NL I+EA+
Sbjct  73    RLGKSPPLETCSDNNQQGFSEIQSSDGHCSPEISTGTQNQMNE---------NLKIAEAL  123

Query  1167  QIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLS  988
             Q+Q+EVQR+L+EQ+EVQRHLQLRIEAQGKYLQ+VL KA ETL R      G+E AK++LS
Sbjct  124   QMQMEVQRKLYEQIEVQRHLQLRIEAQGKYLQSVLSKAHETLARYSSSTTGIELAKSELS  183

Query  987   ELVSKVSNQCLNSAFSGIKELPGF  916
             +LVS ++N C  S  S + E  G 
Sbjct  184   QLVSIMNNACPTSPISELTETRGL  207



>ref|XP_010937171.1| PREDICTED: myb family transcription factor APL-like isoform X3 
[Elaeis guineensis]
Length=301

 Score =   214 bits (546),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 119/231 (52%), Positives = 152/231 (66%), Gaps = 17/231 (7%)
 Frame = -2

Query  1542  NGHGDSGLVLSTDAKPRLKWTQDLHERFVEAVNQLGGADKATPKSVLKQMGIQGLTLYHL  1363
             N   + GLVLS DAKPRLKWT+ LHE F +AV+QLGGADKATPKS+++ MG+ GLTLYHL
Sbjct  3     NQGNNRGLVLSVDAKPRLKWTRQLHECFTDAVSQLGGADKATPKSLMRNMGVPGLTLYHL  62

Query  1362  KSHLQKYRLSKNLHGHANSSSNKAMSSGMDAATGSDKIPEANGNHINSANIGPLANTNLP  1183
             KSHLQKYRL+K+   +  +   K      D    ++K  E    HI+        +  + 
Sbjct  63    KSHLQKYRLAKSRDTNTANDDRKD-----DCEAANNKTIENEAAHIDEEKTPAQFDETM-  116

Query  1182  ISEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVLEKAQETLGRQDLGKMGLEAA  1003
                 +Q+Q+EVQR+L EQ+EVQRHLQLRIEAQGKYLQ+VL KAQE L       +G+EAA
Sbjct  117   ----LQMQMEVQRKLQEQIEVQRHLQLRIEAQGKYLQSVLRKAQEALASYSSNSLGVEAA  172

Query  1002  KAQLSELVSKVSNQCLNSAFSGIKELPGFCQQQAQATQPTDCSLDSCLTSS  850
             KA+LSEL+S V  +CL+S+ S    +P       +  +  DCS DSCLTSS
Sbjct  173   KAELSELLSAVETECLSSSLSQGSLIP-------KRAEHADCSTDSCLTSS  216



>ref|XP_010937169.1| PREDICTED: myb family transcription factor APL-like isoform X1 
[Elaeis guineensis]
Length=306

 Score =   214 bits (545),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 119/231 (52%), Positives = 152/231 (66%), Gaps = 17/231 (7%)
 Frame = -2

Query  1542  NGHGDSGLVLSTDAKPRLKWTQDLHERFVEAVNQLGGADKATPKSVLKQMGIQGLTLYHL  1363
             N   + GLVLS DAKPRLKWT+ LHE F +AV+QLGGADKATPKS+++ MG+ GLTLYHL
Sbjct  8     NQGNNRGLVLSVDAKPRLKWTRQLHECFTDAVSQLGGADKATPKSLMRNMGVPGLTLYHL  67

Query  1362  KSHLQKYRLSKNLHGHANSSSNKAMSSGMDAATGSDKIPEANGNHINSANIGPLANTNLP  1183
             KSHLQKYRL+K+   +  +   K      D    ++K  E    HI+        +  + 
Sbjct  68    KSHLQKYRLAKSRDTNTANDDRKD-----DCEAANNKTIENEAAHIDEEKTPAQFDETM-  121

Query  1182  ISEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVLEKAQETLGRQDLGKMGLEAA  1003
                 +Q+Q+EVQR+L EQ+EVQRHLQLRIEAQGKYLQ+VL KAQE L       +G+EAA
Sbjct  122   ----LQMQMEVQRKLQEQIEVQRHLQLRIEAQGKYLQSVLRKAQEALASYSSNSLGVEAA  177

Query  1002  KAQLSELVSKVSNQCLNSAFSGIKELPGFCQQQAQATQPTDCSLDSCLTSS  850
             KA+LSEL+S V  +CL+S+ S    +P       +  +  DCS DSCLTSS
Sbjct  178   KAELSELLSAVETECLSSSLSQGSLIP-------KRAEHADCSTDSCLTSS  221



>gb|KDO82943.1| hypothetical protein CISIN_1g017978mg [Citrus sinensis]
Length=353

 Score =   216 bits (549),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 121/215 (56%), Positives = 151/215 (70%), Gaps = 14/215 (7%)
 Frame = -2

Query  1521  LVLSTDAKPRLKWTQDLHERFVEAVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKY  1342
             LVLSTDAKPRLKWT +LH+RFV+AVN LGG DKATPKS+++ MGI GLTLYHLKSHLQKY
Sbjct  10    LVLSTDAKPRLKWTPELHQRFVDAVNHLGGPDKATPKSLMRVMGIPGLTLYHLKSHLQKY  69

Query  1341  RLSKNLHGHANSSSNKAMSSGMDAATGSDKIPEANGNHINSANIGPLANTNLPISEAIQI  1162
             RL K+ H  A    NK +    +  + SD        H+N  NI      +L I++A+Q+
Sbjct  70    RLGKSQHVEA-CIDNKQVVEYKETQSSSD-------GHVNR-NISDGTLNHLQIAQALQV  120

Query  1161  QIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLSEL  982
             Q+EVQR+LHEQ+EVQRHLQLRIEAQGKYLQ+VL+KAQETL        G+E AKA+LS+L
Sbjct  121   QMEVQRKLHEQIEVQRHLQLRIEAQGKYLQSVLKKAQETLAGYSSSSAGVELAKAELSQL  180

Query  981   VSKVSNQCLNSAFS-----GIKELPGFCQQQAQAT  892
             VS VS  C +S+ S     G   L  F ++Q ++T
Sbjct  181   VSMVSMGCPSSSVSELTEAGTSSLKDFERKQIRST  215



>ref|XP_010108678.1| Myb family transcription factor APL [Morus notabilis]
 gb|EXC19989.1| Myb family transcription factor APL [Morus notabilis]
Length=349

 Score =   215 bits (547),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 116/200 (58%), Positives = 144/200 (72%), Gaps = 11/200 (6%)
 Frame = -2

Query  1521  LVLSTDAKPRLKWTQDLHERFVEAVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKY  1342
             LVLSTDAKPRLKWT +LH RFVEAVNQLGGADKATPKS+++ MGI GLTLYHLKSHLQKY
Sbjct  8     LVLSTDAKPRLKWTPELHHRFVEAVNQLGGADKATPKSLMRVMGIPGLTLYHLKSHLQKY  67

Query  1341  RLSKNLHGHANSSSNKAMSSGMDAATGSDKIPEANGNHINSANIGPLANTN--LPISEAI  1168
             RL K         S ++ +   D      +I  ++G+     N G  +  N  L I+EA+
Sbjct  68    RLGK---------SQQSENCSDDKQEDYKEIQGSDGHFNREINDGSQSEINESLKIAEAL  118

Query  1167  QIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQLS  988
             Q+Q+EVQR+LHEQ+EVQRHLQLRIEAQGKYLQ+VL+KAQETL       MG+E AK +LS
Sbjct  119   QLQMEVQRKLHEQIEVQRHLQLRIEAQGKYLQSVLKKAQETLAGYSSSSMGVEFAKTELS  178

Query  987   ELVSKVSNQCLNSAFSGIKE  928
              L++ V+  C +S+FS + E
Sbjct  179   RLLNMVNTGCQSSSFSELTE  198



>ref|XP_011013317.1| PREDICTED: uncharacterized protein LOC105117364 [Populus euphratica]
Length=327

 Score =   214 bits (544),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 118/224 (53%), Positives = 158/224 (71%), Gaps = 9/224 (4%)
 Frame = -2

Query  1536  HGDSGLVLSTDAKPRLKWTQDLHERFVEAVNQLGGADKATPKSVLKQMGIQGLTLYHLKS  1357
             H +  LVLSTD KPRLKWTQ+LH+RFVEAV+QLGGAD+ATPKS+++ M I GLTLYHLKS
Sbjct  5     HQNMNLVLSTDGKPRLKWTQELHQRFVEAVDQLGGADRATPKSLMRVMEIPGLTLYHLKS  64

Query  1356  HLQKYRLSKNLHGHANSSSNKAMSSGMDA--ATGSD------KIPEANGNHINSANIGPL  1201
             HLQKYRL K+     +S +N+ +    DA    GSD         +++G   +  N  P+
Sbjct  65    HLQKYRLGKSQQSLISSENNQEVLFVADAKEIQGSDDHFQESAFIQSSGGICSDGNQHPI  124

Query  1200  ANTNLPISEAIQIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVLEKAQETLGRQDLGK  1021
              N +  I++A+Q+Q+EV+R+LHEQ+EVQRHLQLRIEAQGKYLQ+VL+KAQETL   +   
Sbjct  125   -NGSFQIAQALQMQMEVKRKLHEQIEVQRHLQLRIEAQGKYLQSVLKKAQETLAGYNSYS  183

Query  1020  MGLEAAKAQLSELVSKVSNQCLNSAFSGIKELPGFCQQQAQATQ  889
             MG+E AK++LS LVS  ++ C +S+ S + E  G   +  + TQ
Sbjct  184   MGVELAKSELSRLVSMANSGCPSSSISDLTETGGSSLRDMERTQ  227



>gb|KDO82946.1| hypothetical protein CISIN_1g017978mg [Citrus sinensis]
Length=357

 Score =   214 bits (546),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 124/219 (57%), Positives = 154/219 (70%), Gaps = 18/219 (8%)
 Frame = -2

Query  1521  LVLSTDAKPRLKWTQDLHERFVEAVNQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKY  1342
             LVLSTDAKPRLKWT +LH+RFV+AVN LGG DKATPKS+++ MGI GLTLYHLKSHLQKY
Sbjct  10    LVLSTDAKPRLKWTPELHQRFVDAVNHLGGPDKATPKSLMRVMGIPGLTLYHLKSHLQKY  69

Query  1341  RLSKNLHGHANSSSNKAMSSGMDAATGSDKIPEANGNHINSANI--GPL--ANTNLPISE  1174
             RL K+ H  A    NK +    +  + SD        H+N  NI  G L   N +L I++
Sbjct  70    RLGKSQHVEA-CIDNKQVVEYKETQSSSD-------GHVNR-NISDGTLNQLNESLQIAQ  120

Query  1173  AIQIQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQAVLEKAQETLGRQDLGKMGLEAAKAQ  994
             A+Q+Q+EVQR+LHEQ+EVQRHLQLRIEAQGKYLQ+VL+KAQETL        G+E AKA+
Sbjct  121   ALQVQMEVQRKLHEQIEVQRHLQLRIEAQGKYLQSVLKKAQETLAGYSSSSAGVELAKAE  180

Query  993   LSELVSKVSNQCLNSAFS-----GIKELPGFCQQQAQAT  892
             LS+LVS VS  C +S+ S     G   L  F ++Q ++T
Sbjct  181   LSQLVSMVSMGCPSSSVSELTEAGTSSLKDFERKQIRST  219



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5097750019822