BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c1068_g1_i1 len=2892 path=[2870:0-1420 4291:1421-2891]

Length=2892
                                                                      Score     E

ref|XP_011088459.1|  PREDICTED: V-type proton ATPase subunit a3-like   1270   0.0     
emb|CDP20651.1|  unnamed protein product                               1270   0.0     
ref|XP_006362018.1|  PREDICTED: vacuolar proton ATPase a3-like         1268   0.0     
ref|XP_009602232.1|  PREDICTED: V-type proton ATPase subunit a2-like   1267   0.0     
ref|XP_009785999.1|  PREDICTED: V-type proton ATPase subunit a2-like   1266   0.0     
ref|XP_004230865.1|  PREDICTED: V-type proton ATPase subunit a3        1266   0.0     
gb|KHG13921.1|  Vacuolar proton translocating ATPase subunit           1263   0.0     
ref|XP_007042075.1|  Vacuolar proton ATPase A3 isoform 2               1253   0.0     
gb|EYU37836.1|  hypothetical protein MIMGU_mgv1a001455mg               1252   0.0     
ref|XP_007042074.1|  Vacuolar proton ATPase A3 isoform 1               1252   0.0     
ref|XP_011092832.1|  PREDICTED: V-type proton ATPase subunit a3-like   1242   0.0     
ref|XP_010271518.1|  PREDICTED: V-type proton ATPase subunit a2-l...   1241   0.0     
gb|KDP41742.1|  hypothetical protein JCGZ_26760                        1241   0.0     
ref|XP_002265086.1|  PREDICTED: V-type proton ATPase subunit a3        1241   0.0     Vitis vinifera
ref|XP_010096180.1|  Vacuolar proton translocating ATPase 100 kDa...   1240   0.0     
ref|XP_010934090.1|  PREDICTED: V-type proton ATPase subunit a3-like   1238   0.0     
ref|XP_008783594.1|  PREDICTED: vacuolar proton ATPase a3-like         1232   0.0     
ref|XP_006487336.1|  PREDICTED: vacuolar proton ATPase a3-like         1231   0.0     
ref|XP_010437006.1|  PREDICTED: V-type proton ATPase subunit a3-like   1229   0.0     
ref|XP_006423404.1|  hypothetical protein CICLE_v10027828mg            1229   0.0     
ref|XP_010431861.1|  PREDICTED: V-type proton ATPase subunit a3-like   1228   0.0     
gb|KDO49485.1|  hypothetical protein CISIN_1g003392mg                  1227   0.0     
ref|XP_006411705.1|  hypothetical protein EUTSA_v10024425mg            1227   0.0     
ref|XP_009401931.1|  PREDICTED: vacuolar proton ATPase a3-like         1226   0.0     
ref|XP_010446444.1|  PREDICTED: V-type proton ATPase subunit a3        1225   0.0     
emb|CDY41958.1|  BnaA01g05300D                                         1225   0.0     
ref|XP_009109504.1|  PREDICTED: vacuolar proton ATPase a3              1222   0.0     
emb|CDY42603.1|  BnaC01g00150D                                         1221   0.0     
ref|XP_006404587.1|  hypothetical protein EUTSA_v10000048mg            1221   0.0     
gb|KDO49484.1|  hypothetical protein CISIN_1g003392mg                  1220   0.0     
ref|XP_002512965.1|  vacuolar proton atpase, putative                  1220   0.0     Ricinus communis
ref|XP_003537855.1|  PREDICTED: vacuolar proton ATPase a3-like         1220   0.0     
ref|XP_010555275.1|  PREDICTED: V-type proton ATPase subunit a3-like   1219   0.0     
ref|XP_002313024.2|  vacuolar proton ATPase family protein             1218   0.0     Populus trichocarpa [western balsam poplar]
gb|KHN39818.1|  V-type proton ATPase 116 kDa subunit a isoform 1       1217   0.0     
ref|XP_008448072.1|  PREDICTED: vacuolar proton ATPase a3              1217   0.0     
ref|XP_010531458.1|  PREDICTED: V-type proton ATPase subunit a2        1217   0.0     
ref|XP_006286207.1|  hypothetical protein CARUB_v10007773mg            1217   0.0     
ref|XP_004148529.1|  PREDICTED: vacuolar proton ATPase a3-like         1217   0.0     
ref|XP_003540986.1|  PREDICTED: vacuolar proton ATPase a3-like         1216   0.0     
ref|XP_011047706.1|  PREDICTED: V-type proton ATPase subunit a3        1216   0.0     
ref|XP_007199708.1|  hypothetical protein PRUPE_ppa001492mg            1213   0.0     
ref|XP_008236967.1|  PREDICTED: vacuolar proton ATPase a3              1213   0.0     
ref|XP_002306128.1|  vacuolar proton ATPase family protein             1211   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_010028630.1|  PREDICTED: V-type proton ATPase subunit a2        1211   0.0     
ref|XP_003607000.1|  V-type proton ATPase 116 kDa subunit a isoform    1211   0.0     
ref|XP_011037174.1|  PREDICTED: V-type proton ATPase subunit a3-like   1207   0.0     
emb|CDY12118.1|  BnaC03g60340D                                         1207   0.0     
ref|XP_004507485.1|  PREDICTED: vacuolar proton ATPase a2-like         1207   0.0     
gb|KFK30491.1|  hypothetical protein AALP_AA7G268500                   1206   0.0     
ref|XP_009149095.1|  PREDICTED: LOW QUALITY PROTEIN: vacuolar pro...   1206   0.0     
gb|KHG13283.1|  Vacuolar proton translocating ATPase subunit           1205   0.0     
ref|XP_010918984.1|  PREDICTED: V-type proton ATPase subunit a3 i...   1204   0.0     
emb|CDY15895.1|  BnaA04g12160D                                         1204   0.0     
gb|KHN25411.1|  Vacuolar proton translocating ATPase 100 kDa subunit   1202   0.0     
emb|CDX99594.1|  BnaC04g33510D                                         1201   0.0     
ref|XP_009140276.1|  PREDICTED: vacuolar proton ATPase a2-like         1200   0.0     
ref|XP_002866830.1|  VHA-A3                                            1199   0.0     
emb|CDX82029.1|  BnaC08g35720D                                         1197   0.0     
gb|EEE50667.1|  hypothetical protein OsJ_30905                         1196   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_007131786.1|  hypothetical protein PHAVU_011G041500g            1196   0.0     
ref|XP_009769606.1|  PREDICTED: V-type proton ATPase subunit a2-like   1196   0.0     
ref|NP_568051.1|  vacuolar proton ATPase A3                            1196   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_009373024.1|  PREDICTED: vacuolar proton ATPase a3-like         1194   0.0     
ref|XP_009373002.1|  PREDICTED: vacuolar proton ATPase a3              1194   0.0     
ref|XP_010690814.1|  PREDICTED: V-type proton ATPase subunit a3        1192   0.0     
gb|ABB46970.1|  V-type ATPase 116kDa subunit family protein, expr...   1192   0.0     Oryza sativa Japonica Group [Japonica rice]
emb|CAD27718.1|  putative vacuolar ATPase subunit 100 kDa subunit      1192   0.0     Mesembryanthemum crystallinum
ref|XP_003558337.1|  PREDICTED: V-type proton ATPase subunit a3-like   1191   0.0     
ref|XP_010918981.1|  PREDICTED: V-type proton ATPase subunit a3 i...   1189   0.0     
ref|XP_006649752.1|  PREDICTED: vacuolar proton ATPase a3-like         1186   0.0     
ref|XP_009598988.1|  PREDICTED: V-type proton ATPase subunit a2-like   1185   0.0     
ref|XP_006356756.1|  PREDICTED: vacuolar proton ATPase a2-like         1185   0.0     
ref|XP_009117405.1|  PREDICTED: vacuolar proton ATPase a2              1184   0.0     
gb|EEC66656.1|  hypothetical protein OsI_32928                         1183   0.0     Oryza sativa Indica Group [Indian rice]
ref|XP_007017673.1|  Vacuolar proton ATPase A3 isoform 1               1181   0.0     
ref|XP_004984994.1|  PREDICTED: vacuolar proton ATPase a3-like         1181   0.0     
gb|AEH95770.1|  vacuolar ATPase subunit A                              1180   0.0     
emb|CAE45587.1|  vacuolar proton-ATPase subunit-like protein           1179   0.0     Lotus japonicus
dbj|BAF98583.1|  CM0216.490.nc                                         1177   0.0     Lotus japonicus
ref|XP_006661663.1|  PREDICTED: vacuolar proton ATPase a3-like         1177   0.0     
dbj|BAJ53179.1|  JHL18I08.13                                           1176   0.0     
ref|XP_004243162.1|  PREDICTED: V-type proton ATPase subunit a2-like   1176   0.0     
emb|CAB38828.1|  putative proton pump                                  1174   0.0     Arabidopsis thaliana [mouse-ear cress]
gb|AAL78104.1|AC093568_14  Putative proton pump                        1174   0.0     Oryza sativa [red rice]
ref|XP_002468170.1|  hypothetical protein SORBIDRAFT_01g040970         1174   0.0     Sorghum bicolor [broomcorn]
dbj|BAJ89139.1|  predicted protein                                     1172   0.0     
ref|XP_004291813.1|  PREDICTED: vacuolar proton ATPase a3-like         1172   0.0     
ref|XP_010061010.1|  PREDICTED: V-type proton ATPase subunit a3-l...   1170   0.0     
gb|KHG00114.1|  Vacuolar proton translocating ATPase subunit           1169   0.0     
ref|XP_002510470.1|  vacuolar proton atpase, putative                  1169   0.0     Ricinus communis
ref|XP_002878553.1|  predicted protein                                 1168   0.0     
ref|NP_179736.1|  vacuolar proton ATPase A2                            1168   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_011083638.1|  PREDICTED: V-type proton ATPase subunit a3-like   1167   0.0     
ref|NP_001049572.1|  Os03g0251500                                      1166   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_004290287.1|  PREDICTED: vacuolar proton ATPase a3-like         1166   0.0     
ref|XP_010664756.1|  PREDICTED: V-type proton ATPase subunit a2-l...   1165   0.0     
ref|XP_010271519.1|  PREDICTED: V-type proton ATPase subunit a2-l...   1165   0.0     
gb|AAK96647.1|  At2g21410/F3K23.17                                     1164   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_006828785.1|  hypothetical protein AMTR_s00001p00110790         1161   0.0     
ref|XP_006293690.1|  hypothetical protein CARUB_v10022648mg            1160   0.0     
ref|XP_008653566.1|  PREDICTED: vacuolar proton ATPase a3              1159   0.0     
ref|XP_008221327.1|  PREDICTED: vacuolar proton ATPase a3-like         1159   0.0     
ref|XP_008660336.1|  PREDICTED: vacuolar proton ATPase a3-like         1150   0.0     
ref|XP_003573831.1|  PREDICTED: V-type proton ATPase subunit a3-like   1147   0.0     
ref|XP_004152666.1|  PREDICTED: vacuolar proton ATPase a3-like         1145   0.0     
ref|XP_002300733.1|  hypothetical protein POPTR_0002s03010g            1144   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_011028942.1|  PREDICTED: V-type proton ATPase subunit a2-l...   1139   0.0     
ref|XP_002307693.1|  hypothetical protein POPTR_0005s25550g            1137   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_011045160.1|  PREDICTED: V-type proton ATPase subunit a2-like   1137   0.0     
emb|CDP07451.1|  unnamed protein product                               1135   0.0     
ref|XP_004500962.1|  PREDICTED: vacuolar proton ATPase a2-like         1134   0.0     
ref|XP_010918985.1|  PREDICTED: V-type proton ATPase subunit a3 i...   1134   0.0     
ref|XP_007158764.1|  hypothetical protein PHAVU_002G179900g            1132   0.0     
ref|XP_011028941.1|  PREDICTED: V-type proton ATPase subunit a2-l...   1132   0.0     
ref|XP_007042076.1|  Vacuolar proton ATPase A3 isoform 3               1126   0.0     
ref|XP_010431556.1|  PREDICTED: V-type proton ATPase subunit a2-like   1124   0.0     
ref|XP_010472132.1|  PREDICTED: V-type proton ATPase subunit a2 i...   1113   0.0     
gb|EMT24018.1|  Vacuolar proton translocating ATPase 100 kDa subunit   1109   0.0     
dbj|BAJ94235.1|  predicted protein                                     1108   0.0     
ref|XP_007017675.1|  Vacuolar proton ATPase A3 isoform 3               1097   0.0     
ref|XP_007017676.1|  Vacuolar proton ATPase A3 isoform 4               1094   0.0     
ref|XP_003527676.1|  PREDICTED: vacuolar proton ATPase a3-like         1087   0.0     
gb|EMT31646.1|  Vacuolar proton translocating ATPase 100 kDa subunit   1078   0.0     
ref|XP_010061011.1|  PREDICTED: V-type proton ATPase subunit a3-l...   1077   0.0     
gb|EPS59200.1|  hypothetical protein M569_15610                        1072   0.0     
ref|XP_010672374.1|  PREDICTED: V-type proton ATPase subunit a3-like   1071   0.0     
gb|KCW55396.1|  hypothetical protein EUGRSUZ_I01306                    1070   0.0     
ref|XP_006293691.1|  hypothetical protein CARUB_v10022648mg            1057   0.0     
gb|KCW55395.1|  hypothetical protein EUGRSUZ_I01306                    1026   0.0     
ref|XP_010472136.1|  PREDICTED: V-type proton ATPase subunit a2 i...   1023   0.0     
ref|XP_010472134.1|  PREDICTED: V-type proton ATPase subunit a2 i...   1023   0.0     
ref|XP_010472131.1|  PREDICTED: V-type proton ATPase subunit a2 i...   1023   0.0     
ref|XP_010472133.1|  PREDICTED: V-type proton ATPase subunit a2 i...   1023   0.0     
ref|XP_001768891.1|  predicted protein                                 1019   0.0     
emb|CDY13818.1|  BnaA09g43200D                                         1017   0.0     
gb|KDP44125.1|  hypothetical protein JCGZ_05592                        1014   0.0     
ref|XP_002282009.1|  PREDICTED: V-type proton ATPase subunit a1        1013   0.0     Vitis vinifera
ref|XP_007017674.1|  Vacuolar proton ATPase A2 isoform 2               1010   0.0     
ref|XP_008463888.1|  PREDICTED: vacuolar proton ATPase a1              1007   0.0     
gb|KEH36223.1|  vacuolar proton ATPase a3-like protein                 1006   0.0     
ref|XP_006424665.1|  hypothetical protein CICLE_v10027830mg            1006   0.0     
ref|XP_004149561.1|  PREDICTED: vacuolar proton ATPase a1-like         1005   0.0     
ref|XP_007015509.1|  Vacuolar proton ATPase A1 isoform 3               1004   0.0     
ref|XP_001763380.1|  predicted protein                                 1003   0.0     
ref|XP_010922514.1|  PREDICTED: V-type proton ATPase subunit a1        1002   0.0     
ref|XP_007015511.1|  Vacuolar proton ATPase A1 isoform 5                999   0.0     
ref|XP_010043691.1|  PREDICTED: V-type proton ATPase subunit a1 i...    998   0.0     
ref|XP_010032049.1|  PREDICTED: V-type proton ATPase subunit a1-l...    997   0.0     
ref|XP_008358210.1|  PREDICTED: vacuolar proton ATPase a1               996   0.0     
ref|XP_011028943.1|  PREDICTED: V-type proton ATPase subunit a2-l...    995   0.0     
ref|XP_006594994.1|  PREDICTED: vacuolar proton ATPase a1-like is...    994   0.0     
ref|XP_003547511.1|  PREDICTED: vacuolar proton ATPase a1-like          993   0.0     
gb|KHN22210.1|  Vacuolar proton translocating ATPase 100 kDa subunit    993   0.0     
gb|KHN33443.1|  V-type proton ATPase 116 kDa subunit a isoform 1        992   0.0     
ref|XP_009352397.1|  PREDICTED: vacuolar proton ATPase a1-like          992   0.0     
ref|XP_008224871.1|  PREDICTED: vacuolar proton ATPase a1-like          992   0.0     
ref|XP_010032050.1|  PREDICTED: V-type proton ATPase subunit a1-l...    991   0.0     
ref|XP_009358259.1|  PREDICTED: vacuolar proton ATPase a1-like          991   0.0     
dbj|BAC41321.1|  hypothetical protein                                   989   0.0     Lotus japonicus
ref|XP_007204941.1|  hypothetical protein PRUPE_ppa001470mg             989   0.0     
ref|XP_004251275.1|  PREDICTED: V-type proton ATPase subunit a1         989   0.0     
ref|XP_009795362.1|  PREDICTED: V-type proton ATPase subunit a1-like    989   0.0     
ref|XP_009346583.1|  PREDICTED: vacuolar proton ATPase a1-like          988   0.0     
ref|XP_008783707.1|  PREDICTED: vacuolar proton ATPase a1-like is...    988   0.0     
emb|CDP08938.1|  unnamed protein product                                988   0.0     
ref|XP_001752776.1|  predicted protein                                  988   0.0     
gb|KHG00921.1|  Vacuolar proton translocating ATPase subunit            987   0.0     
ref|XP_004294683.1|  PREDICTED: vacuolar proton ATPase a1-like          987   0.0     
ref|XP_009617904.1|  PREDICTED: V-type proton ATPase subunit a1-like    986   0.0     
ref|XP_010244988.1|  PREDICTED: V-type proton ATPase subunit a1-like    985   0.0     
ref|XP_006366398.1|  PREDICTED: vacuolar proton ATPase a1-like          984   0.0     
ref|XP_004487144.1|  PREDICTED: vacuolar proton ATPase a1-like          983   0.0     
ref|XP_010521779.1|  PREDICTED: V-type proton ATPase subunit a1         982   0.0     
ref|XP_007150235.1|  hypothetical protein PHAVU_005G137800g             982   0.0     
ref|XP_010664757.1|  PREDICTED: V-type proton ATPase subunit a3-l...    981   0.0     
ref|XP_003538035.1|  PREDICTED: vacuolar proton ATPase a1-like          980   0.0     
ref|XP_002532256.1|  vacuolar proton atpase, putative                   979   0.0     Ricinus communis
ref|XP_007132168.1|  hypothetical protein PHAVU_011G071600g             979   0.0     
ref|XP_009606445.1|  PREDICTED: V-type proton ATPase subunit a1-l...    979   0.0     
ref|XP_010253515.1|  PREDICTED: V-type proton ATPase subunit a1-like    978   0.0     
ref|XP_010542602.1|  PREDICTED: V-type proton ATPase subunit a1         978   0.0     
ref|XP_010691625.1|  PREDICTED: V-type proton ATPase subunit a1         977   0.0     
ref|XP_003539739.1|  PREDICTED: vacuolar proton ATPase a1-like          977   0.0     
ref|XP_009759132.1|  PREDICTED: V-type proton ATPase subunit a1-l...    976   0.0     
ref|XP_004241262.1|  PREDICTED: V-type proton ATPase subunit a1-like    976   0.0     
gb|AES67400.2|  vacuolar proton ATPase a3-like protein                  976   0.0     
ref|XP_007015507.1|  Vacuolar proton ATPase A1 isoform 1                976   0.0     
ref|XP_006843249.1|  hypothetical protein AMTR_s00080p00100430          975   0.0     
ref|XP_011089858.1|  PREDICTED: V-type proton ATPase subunit a1 i...    974   0.0     
ref|XP_004970481.1|  PREDICTED: vacuolar proton ATPase a1-like          973   0.0     
gb|KHN05709.1|  V-type proton ATPase 116 kDa subunit a isoform 1        971   0.0     
ref|XP_002988745.1|  hypothetical protein SELMODRAFT_184043             970   0.0     
gb|AES88702.2|  vacuolar proton ATPase a3-like protein                  969   0.0     
gb|EYU18884.1|  hypothetical protein MIMGU_mgv1a001442mg                969   0.0     
ref|XP_002986306.1|  hypothetical protein SELMODRAFT_182335             969   0.0     
ref|XP_006365749.1|  PREDICTED: vacuolar proton ATPase a1-like is...    968   0.0     
ref|XP_004505946.1|  PREDICTED: vacuolar proton ATPase a1-like          968   0.0     
ref|XP_002456592.1|  hypothetical protein SORBIDRAFT_03g038990          968   0.0     Sorghum bicolor [broomcorn]
ref|XP_011089368.1|  PREDICTED: V-type proton ATPase subunit a1-l...    967   0.0     
ref|XP_008805029.1|  PREDICTED: vacuolar proton ATPase a1-like          967   0.0     
ref|NP_001044718.2|  Os01g0834200                                       966   0.0     Oryza sativa Japonica Group [Japonica rice]
gb|KHG14971.1|  vatM                                                    965   0.0     
ref|XP_009410597.1|  PREDICTED: vacuolar proton ATPase a1               964   0.0     
ref|XP_006409880.1|  hypothetical protein EUTSA_v10016255mg             963   0.0     
ref|XP_010510601.1|  PREDICTED: V-type proton ATPase subunit a1-like    962   0.0     
ref|XP_003597149.1|  V-type proton ATPase 116 kDa subunit a isoform     962   0.0     
ref|XP_010414511.1|  PREDICTED: V-type proton ATPase subunit a1         962   0.0     
ref|XP_006644966.1|  PREDICTED: vacuolar proton ATPase a1-like          961   0.0     
ref|XP_009133874.1|  PREDICTED: vacuolar proton ATPase a1-like          961   0.0     
ref|XP_008657093.1|  PREDICTED: vacuolar proton ATPase a1               960   0.0     
ref|XP_006293692.1|  hypothetical protein CARUB_v10022649mg             959   0.0     
ref|XP_006404588.1|  hypothetical protein EUTSA_v10000048mg             959   0.0     
ref|XP_010112349.1|  V-type proton ATPase 116 kDa subunit a isofo...    957   0.0     
emb|CDY63878.1|  BnaCnng42810D                                          954   0.0     
ref|XP_009140911.1|  PREDICTED: vacuolar proton ATPase a1               954   0.0     
emb|CDX83292.1|  BnaA03g22140D                                          953   0.0     
ref|XP_003564548.1|  PREDICTED: V-type proton ATPase subunit a1         953   0.0     
ref|XP_009103695.1|  PREDICTED: vacuolar proton ATPase a1-like          952   0.0     
ref|XP_001781151.1|  predicted protein                                  950   0.0     
ref|XP_002879161.1|  VHA-A1                                             948   0.0     
gb|KHG14972.1|  vatM                                                    944   0.0     
ref|NP_850122.1|  vacuolar proton ATPase A1                             944   0.0     Arabidopsis thaliana [mouse-ear cress]
emb|CDM85023.1|  unnamed protein product                                942   0.0     
gb|EYU36217.1|  hypothetical protein MIMGU_mgv1a001612mg                939   0.0     
ref|XP_006365750.1|  PREDICTED: vacuolar proton ATPase a1-like is...    939   0.0     
gb|EEC71752.1|  hypothetical protein OsI_04326                          938   0.0     Oryza sativa Indica Group [Indian rice]
ref|XP_002978460.1|  hypothetical protein SELMODRAFT_109102             935   0.0     
ref|XP_002970298.1|  hypothetical protein SELMODRAFT_93837              933   0.0     
emb|CDY53381.1|  BnaA04g16460D                                          928   0.0     
emb|CDY15756.1|  BnaC04g15680D                                          925   0.0     
gb|KEH39308.1|  vacuolar proton ATPase a3-like protein                  917   0.0     
ref|XP_010043693.1|  PREDICTED: V-type proton ATPase subunit a1 i...    914   0.0     
ref|XP_008445568.1|  PREDICTED: vacuolar proton ATPase a3-like          912   0.0     
emb|CDY04571.1|  BnaA07g13970D                                          907   0.0     
emb|CDX77187.1|  BnaC04g39820D                                          905   0.0     
gb|EEE55633.1|  hypothetical protein OsJ_03980                          903   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_008783708.1|  PREDICTED: vacuolar proton ATPase a1-like is...    899   0.0     
gb|AAD21487.2|  putative vacuolar proton-ATPase subunit                 899   0.0     Arabidopsis thaliana [mouse-ear cress]
gb|EPS62244.1|  hypothetical protein M569_12548                         891   0.0     
gb|KHN22033.1|  V-type proton ATPase 116 kDa subunit a isoform 1        889   0.0     
ref|XP_006365751.1|  PREDICTED: vacuolar proton ATPase a1-like is...    885   0.0     
ref|XP_008348897.1|  PREDICTED: vacuolar proton ATPase a3-like          884   0.0     
ref|XP_007015508.1|  Vacuolar proton ATPase A1 isoform 2                880   0.0     
ref|XP_001769505.1|  predicted protein                                  869   0.0     
ref|XP_007225586.1|  hypothetical protein PRUPE_ppa001483m1g            860   0.0     
gb|KDO73121.1|  hypothetical protein CISIN_1g003454mg                   849   0.0     
ref|XP_004165227.1|  PREDICTED: LOW QUALITY PROTEIN: vacuolar pro...    836   0.0     
ref|XP_007015512.1|  Vacuolar proton ATPase A1 isoform 6                835   0.0     
gb|EMT21067.1|  hypothetical protein F775_21366                         827   0.0     
dbj|BAF02018.1|  hypothetical protein                                   815   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_009606446.1|  PREDICTED: V-type proton ATPase subunit a1-l...    820   0.0     
ref|XP_009759133.1|  PREDICTED: V-type proton ATPase subunit a1-l...    816   0.0     
ref|XP_011089859.1|  PREDICTED: V-type proton ATPase subunit a1 i...    813   0.0     
gb|KEH39307.1|  vacuolar proton ATPase a3-like protein                  811   0.0     
ref|XP_001695223.1|  vacuolar proton translocating ATPase subunit A     814   0.0     Chlamydomonas reinhardtii
ref|XP_002947070.1|  hypothetical protein VOLCADRAFT_79461              813   0.0     
ref|XP_002508239.1|  H+-or Na+-translocating f-type, v-type and A...    808   0.0     Micromonas commoda
ref|XP_011089369.1|  PREDICTED: V-type proton ATPase subunit a1-l...    803   0.0     
ref|XP_005648060.1|  V0/A0 complex, 116-kDa subunit of ATPase           808   0.0     
ref|XP_005849093.1|  hypothetical protein CHLNCDRAFT_34870              800   0.0     
ref|XP_001692167.1|  vacuolar proton ATPase subunit A                   789   0.0     Chlamydomonas reinhardtii
ref|XP_008783709.1|  PREDICTED: vacuolar proton ATPase a1-like is...    781   0.0     
dbj|BAD73786.1|  putative vacuolar-type H(+)-ATPase                     761   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_001419233.1|  F-ATPase family transporter: protons (vacuolar)    762   0.0     Ostreococcus lucimarinus CCE9901
gb|KFM23260.1|  V-type proton ATPase 116 kDa subunit a isoform 1        762   0.0     
dbj|BAJ99586.1|  predicted protein                                      716   0.0     
ref|XP_003058929.1|  H+-or Na+-translocating f-type, v-type and A...    715   0.0     
ref|XP_004356732.1|  vacuolar proton ATPase, putative                   681   0.0     
ref|XP_006473899.1|  PREDICTED: LOW QUALITY PROTEIN: vacuolar pro...    656   0.0     
gb|KHN45895.1|  Vacuolar proton translocating ATPase 100 kDa subunit    652   0.0     
ref|XP_003080962.1|  putative vacuolar proton-ATPase subunit (ISS)      660   0.0     
gb|ESA08168.1|  hypothetical protein GLOINDRAFT_349227                  657   0.0     
dbj|GAM28112.1|  hypothetical protein SAMD00019534_112880               654   0.0     
gb|EXX54132.1|  Vph1p                                                   655   0.0     
gb|EFA74721.1|  vacuolar proton ATPase 100-kDa subunit                  653   0.0     Heterostelium album PN500
gb|EXX54130.1|  Vph1p                                                   654   0.0     
ref|XP_007515546.1|  predicted protein                                  652   0.0     
ref|XP_001698738.1|  hypothetical protein CHLREDRAFT_131895             646   0.0     Chlamydomonas reinhardtii
ref|XP_008240574.1|  PREDICTED: vacuolar proton ATPase a1-like          637   0.0     
dbj|GAM28107.1|  hypothetical protein SAMD00019534_112830               637   0.0     
emb|CDH55586.1|  hypothetical protein RO3G_04819                        623   0.0     
ref|XP_004351790.1|  vacuolar proton ATPase                             618   0.0     
emb|CDS09709.1|  hypothetical protein LRAMOSA02386                      617   0.0     
ref|XP_003289866.1|  vacuolar proton ATPase 100-kDa subunit             615   0.0     
ref|XP_001634544.1|  predicted protein                                  614   0.0     
gb|KFH67121.1|  V-type H+-transporting ATPase subunit I                 612   0.0     
ref|XP_006679086.1|  hypothetical protein BATDEDRAFT_33255              612   0.0     
gb|KFH67090.1|  V-type H+-transporting ATPase subunit I                 609   0.0     
ref|XP_001745401.1|  hypothetical protein                               607   0.0     
ref|XP_002592159.1|  hypothetical protein BRAFLDRAFT_125140             607   0.0     
ref|NP_001100061.1|  V-type proton ATPase 116 kDa subunit a isofo...    606   0.0     
ref|XP_009046497.1|  hypothetical protein LOTGIDRAFT_156984             604   0.0     
ref|NP_001090714.1|  V-type proton ATPase 116 kDa subunit a isofo...    605   0.0     
ref|XP_006236358.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    604   0.0     
ref|XP_005059716.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    604   0.0     
emb|CEG71923.1|  Putative V-type H-transporting ATPase subunit I        603   0.0     
gb|EPB85344.1|  V-type H+-transporting ATPase subunit I                 602   0.0     
ref|XP_008223647.1|  PREDICTED: vacuolar proton ATPase a1-like          589   0.0     
ref|XP_008821701.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    603   0.0     
ref|XP_010007637.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    603   0.0     
ref|XP_005059713.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    602   0.0     
ref|XP_006990495.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    602   0.0     
ref|XP_007642027.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    602   0.0     
ref|XP_004317797.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    600   0.0     
ref|XP_005668863.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    600   0.0     
ref|NP_536715.3|  V-type proton ATPase 116 kDa subunit a isoform 4      601   0.0     
gb|AAL30435.1|AF326316_1  H-ATPase accessory subunit a4                 600   0.0     
ref|XP_006773933.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    599   0.0     
ref|XP_005531525.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    601   0.0     
ref|XP_006532118.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    599   0.0     
ref|XP_005082467.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    600   0.0     
ref|XP_008269731.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    599   0.0     
ref|XP_005429637.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    600   0.0     
ref|XP_005394520.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    599   0.0     
ref|XP_005059712.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    600   0.0     
gb|EIE80114.1|  hypothetical protein RO3G_04819                         599   0.0     
gb|AAN45855.1|AF435090_1  vacuolar proton translocating ATPase a4...    599   0.0     
gb|ADL59935.1|  vacuolar ATPase                                         600   0.0     
ref|NP_001080294.1|  V-type proton ATPase 116 kDa subunit a isofo...    599   0.0     
ref|XP_004282868.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    599   0.0     
ref|XP_007177146.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    599   0.0     
ref|XP_007177145.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    600   0.0     
ref|XP_003340358.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    599   0.0     
ref|XP_005059715.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    599   0.0     
ref|XP_006156073.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    598   0.0     
ref|XP_006175247.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    599   0.0     
ref|XP_004272203.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    599   0.0     
ref|XP_005875790.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    597   0.0     
gb|EDL13645.1|  ATPase, H+ transporting, lysosomal V0 subunit A4        597   0.0     
ref|XP_007177141.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    600   0.0     
ref|XP_007256336.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    598   0.0     
ref|XP_006264756.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    598   0.0     
ref|XP_005059714.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    598   0.0     
ref|XP_005232765.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    598   0.0     
ref|XP_005668859.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    598   0.0     
ref|XP_006773934.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    597   0.0     
ref|XP_004390348.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    598   0.0     
ref|XP_007177144.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    599   0.0     
ref|XP_005151807.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    598   0.0     
ref|XP_005429639.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    598   0.0     
ref|XP_004594429.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    598   0.0     
ref|XP_006019618.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    598   0.0     
ref|XP_007449906.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    597   0.0     
ref|XP_007102205.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    597   0.0     
ref|XP_007482239.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    597   0.0     
ref|XP_007177847.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    597   0.0     
ref|XP_001105743.2|  PREDICTED: v-type proton ATPase 116 kDa subu...    597   0.0     
ref|XP_005429638.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    597   0.0     
ref|XP_002197932.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    597   0.0     
ref|XP_006092423.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    597   0.0     
ref|XP_007908561.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    597   0.0     
ref|XP_004608848.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    597   0.0     
ref|XP_006247358.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    597   0.0     
ref|XP_003414291.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    597   0.0     
ref|XP_006175246.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    597   0.0     
ref|XP_004684215.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    596   0.0     
gb|EHH17718.1|  hypothetical protein EGK_14179                          596   0.0     
ref|XP_008055032.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    596   0.0     
ref|XP_007907681.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    596   0.0     
gb|EHH52542.1|  hypothetical protein EGM_12998                          596   0.0     
ref|XP_007177846.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    596   0.0     
ref|XP_007643328.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    596   0.0     
ref|XP_008147573.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    596   0.0     
ref|NP_001229980.1|  V-type proton ATPase 116 kDa subunit a isofo...    596   0.0     
ref|XP_003996934.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    595   0.0     
ref|XP_007449905.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    596   0.0     
ref|XP_005394517.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    595   0.0     
ref|XP_004608847.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    596   0.0     
gb|AAB49621.1|  vacuolar proton ATPase 100-kDa subunit                  595   0.0     
ref|XP_005875787.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    595   0.0     
ref|XP_006247357.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    595   0.0     
ref|XP_005513640.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    595   0.0     
ref|XP_005550957.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    595   0.0     
ref|XP_004599172.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    595   0.0     
sp|Q54E04.2|VATM_DICDI  RecName: Full=Vacuolar proton translocati...    594   0.0     
ref|XP_007177749.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    595   0.0     
gb|AAI09306.1|  ATPase, H+ transporting, lysosomal V0 subunit a4        595   0.0     
gb|KFQ26628.1|  V-type proton ATPase 116 kDa subunit a isoform 4        595   0.0     
ref|XP_004655416.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    595   0.0     
ref|XP_003772494.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    595   0.0     
ref|XP_005405509.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    595   0.0     
ref|XP_003261445.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    595   0.0     
ref|XP_010629996.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    595   0.0     
ref|NP_065683.2|  V-type proton ATPase 116 kDa subunit a isoform 4      595   0.0     
ref|XP_007907680.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    595   0.0     
ref|XP_006532116.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    595   0.0     
ref|XP_001494274.2|  PREDICTED: V-type proton ATPase 116 kDa subu...    595   0.0     
ref|XP_003420265.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    595   0.0     
ref|XP_002719445.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    594   0.0     
gb|AAF59919.1|AF218250_1  vacuolar proton-translocating ATPase 10...    594   0.0     
ref|XP_010209439.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    594   0.0     
ref|XP_009553685.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    594   0.0     
gb|AAG11415.1|AF245517_1  vacuolar proton pump 116 kDa accessory ...    594   0.0     
ref|XP_004012977.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    594   0.0     
ref|XP_006138122.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    594   0.0     
ref|XP_008147572.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    594   0.0     
ref|XP_006861227.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    594   0.0     
ref|XP_008833522.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    594   0.0     
ref|XP_003318871.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    594   0.0     
ref|XP_006055806.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    594   0.0     
ref|XP_005365893.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    594   0.0     
ref|XP_005405508.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    594   0.0     
ref|XP_007955949.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    594   0.0     
ref|XP_004346266.1|  ATPase                                             595   0.0     
ref|XP_004430767.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    594   0.0     
ref|XP_009202211.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    594   0.0     
gb|EMC78428.1|  V-type proton ATPase 116 kDa subunit a isoform 1        594   0.0     
ref|XP_005321935.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    594   0.0     
ref|XP_005394516.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    594   0.0     
ref|XP_010209438.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    594   0.0     
ref|XP_008269729.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    594   0.0     
ref|XP_004382449.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    593   0.0     
ref|XP_008148708.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    593   0.0     
ref|XP_004772741.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    593   0.0     
ref|XP_005550951.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    593   0.0     
ref|XP_002922182.1|  PREDICTED: v-type proton ATPase 116 kDa subu...    593   0.0     
ref|XP_005139906.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    593   0.0     
ref|XP_003929798.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    593   0.0     
ref|XP_010384427.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    593   0.0     
ref|XP_009553684.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    593   0.0     
ref|XP_010192740.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    593   0.0     
ref|XP_007558200.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    593   0.0     
ref|XP_003475561.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    593   0.0     
ref|XP_009992436.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    593   0.0     
ref|XP_629892.1|  vacuolar proton ATPase 100-kDa subunit                592   0.0     
gb|EHH24986.1|  hypothetical protein EGK_08735                          592   0.0     
ref|XP_859219.1|  PREDICTED: V-type proton ATPase 116 kDa subunit...    592   0.0     
ref|XP_007466662.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    592   0.0     
ref|XP_008517419.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    593   0.0     
ref|XP_003913126.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    592   0.0     
ref|XP_010633812.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    592   0.0     
ref|XP_008995860.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    592   0.0     
ref|XP_007955948.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    592   0.0     
ref|XP_008833520.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    592   0.0     
ref|XP_004633839.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    592   0.0     
ref|XP_008699514.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    592   0.0     
ref|XP_008570095.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    592   0.0     
ref|XP_005875045.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    592   0.0     
ref|XP_008503922.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    592   0.0     
ref|XP_007535066.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    592   0.0     
ref|XP_009992435.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    592   0.0     
ref|XP_004410596.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    591   0.0     
ref|XP_004416745.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    591   0.0     
ref|XP_008995858.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    591   0.0     
ref|XP_003913127.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    591   0.0     
gb|EXX54133.1|  Vph1p                                                   589   0.0     
ref|XP_006777185.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    591   0.0     
ref|XP_003791634.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    591   0.0     
ref|XP_010633810.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    591   0.0     
ref|XP_008503920.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    591   0.0     
emb|CAI56709.1|  hypothetical protein                                   591   0.0     
ref|XP_006156072.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    591   0.0     
ref|XP_010354608.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    590   0.0     
gb|KEH39309.1|  vacuolar proton ATPase a3-like protein                  578   0.0     
ref|XP_006113186.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    590   0.0     
ref|XP_539895.2|  PREDICTED: V-type proton ATPase 116 kDa subunit...    590   0.0     
ref|NP_001123492.1|  V-type proton ATPase 116 kDa subunit a isofo...    590   0.0     
ref|XP_511508.2|  PREDICTED: V-type proton ATPase 116 kDa subunit...    590   0.0     
ref|XP_002914245.1|  PREDICTED: v-type proton ATPase 116 kDa subu...    590   0.0     
ref|XP_010338670.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    590   0.0     
ref|XP_004462194.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    590   0.0     
ref|XP_007082697.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    590   0.0     
ref|XP_001499338.3|  PREDICTED: V-type proton ATPase 116 kDa subu...    591   0.0     
ref|XP_007558197.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    590   0.0     
ref|XP_007118876.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    590   0.0     
ref|XP_002109493.1|  hypothetical protein TRIADDRAFT_63670              590   0.0     
ref|XP_009001243.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    590   0.0     
gb|KFM64427.1|  V-type proton ATPase subunit a isoform 1                589   0.0     
ref|XP_002723058.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    589   0.0     
ref|XP_003786383.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    589   0.0     
ref|XP_005257516.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    589   0.0     
ref|XP_003813933.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    589   0.0     
ref|XP_006532114.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    590   0.0     
ref|XP_006532112.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    590   0.0     
ref|XP_003786384.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    589   0.0     
ref|XP_005796756.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    588   0.0     
ref|XP_006113183.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    589   0.0     
ref|XP_010945786.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    588   0.0     
ref|XP_003222523.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    588   0.0     
ref|XP_003467036.2|  PREDICTED: V-type proton ATPase 116 kDa subu...    590   0.0     
ref|XP_006910547.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    588   0.0     
ref|XP_006185400.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    588   0.0     
emb|CAD88271.1|  vacuolar H+ATPase subunit a1                           588   0.0     
ref|XP_006210081.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    588   0.0     
ref|XP_004886983.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    587   0.0     
ref|XP_005332469.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    587   0.0     
ref|XP_003134678.3|  PREDICTED: V-type proton ATPase 116 kDa subu...    587   0.0     
ref|XP_004629107.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    587   0.0     
ref|XP_008111614.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    587   0.0     
ref|XP_007525243.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    587   0.0     
ref|XP_005796757.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    587   0.0     
ref|XP_004608287.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    587   0.0     
ref|XP_004008145.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    587   0.0     
ref|XP_010162740.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    586   0.0     
ref|XP_006532113.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    587   0.0     
gb|KFM81327.1|  V-type proton ATPase subunit a isoform 1                585   0.0     
ref|XP_006532115.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    587   0.0     
ref|XP_005002510.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    587   0.0     
ref|XP_004570416.1|  PREDICTED: V-type proton ATPase 116 kDa subu...    585   0.0     



>ref|XP_011088459.1| PREDICTED: V-type proton ATPase subunit a3-like [Sesamum indicum]
Length=817

 Score =  1270 bits (3286),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 659/818 (81%), Positives = 737/818 (90%), Gaps = 2/818 (0%)
 Frame = -2

Query  2771  LGGRG-GCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRT  2595
             +G RG GC PPMDL RSEPMQL+QLIIP+ESA L+V+Y+GDLGLIQFKDLNAEKSPFQRT
Sbjct  1     MGERGRGCCPPMDLMRSEPMQLLQLIIPVESAHLAVSYIGDLGLIQFKDLNAEKSPFQRT  60

Query  2594  YAAQIKRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINA  2415
             YA QIKR GEMARKLRFF+DQMSK G++ +A S TQ     DDLEVKLGDLEAEL+EINA
Sbjct  61    YAIQIKRCGEMARKLRFFRDQMSKVGLTPTARSATQAITSLDDLEVKLGDLEAELVEINA  120

Query  2414  NNDKLQRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDM  2235
             N +KLQRS+NEL EYKLVLQK GEFF+SA  S+        +S  G ESLE PLLSE + 
Sbjct  121   NGEKLQRSYNELAEYKLVLQKAGEFFNSA-LSSAEAHHREYASNQGGESLETPLLSEQET  179

Query  2234  SADTSKQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKN  2055
              AD SKQV+LGFI+GLVP++KSMAFERILFRATRGNV L+Q+ VDE VIDP+SGEKVEKN
Sbjct  180   FADPSKQVKLGFITGLVPRDKSMAFERILFRATRGNVFLKQATVDEPVIDPVSGEKVEKN  239

Query  2054  VFLVFYSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILH  1875
             VF+VF+SGERAKNKILKIC+AFGANRY F E+L KQ+Q+ITEVSG++SEL+T IDAG++H
Sbjct  240   VFVVFFSGERAKNKILKICEAFGANRYAFTEDLSKQSQMITEVSGRLSELQTTIDAGLVH  299

Query  1874  RGNLLQSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQ  1695
             RGNLLQ+I EQF++WN+LVR+EK+IYHTLNMLSIDVTKKCLVAEGWSP  AT EIQDAL 
Sbjct  300   RGNLLQAIGEQFEQWNLLVRKEKAIYHTLNMLSIDVTKKCLVAEGWSPVFATKEIQDALH  359

Query  1694  RAGHDSNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVT  1515
             RA  DSNS++ +IF+VL TRE PPTYF+TNKFTSAFQEIVDAYGVAKYQEANPGVFTIVT
Sbjct  360   RATLDSNSQVDSIFQVLHTREMPPTYFRTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVT  419

Query  1514  FPFLFAVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIY  1335
             FPFLFAVMFGDWGHGICLLLATLYF+IREKKLSSQKLGDI EMTFGGRYVI++MALFSIY
Sbjct  420   FPFLFAVMFGDWGHGICLLLATLYFIIREKKLSSQKLGDIMEMTFGGRYVIMLMALFSIY  479

Query  1334  TGFIYNEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPF  1155
             TG IYNEFFSV FELF  SAYVCRDP+C DATT+GLIKARDTY FGVDPAWHGTRSELPF
Sbjct  480   TGLIYNEFFSVPFELFAPSAYVCRDPACRDATTVGLIKARDTYPFGVDPAWHGTRSELPF  539

Query  1154  LNSLKMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLII  975
             LNSLKMK+SILLGVAQMNLGIILSYFNA +F++ +N W QFIPQ+IFLN+LFGYLSVLII
Sbjct  540   LNSLKMKMSILLGVAQMNLGIILSYFNAQFFKNSLNTWFQFIPQMIFLNSLFGYLSVLII  599

Query  974   VKWCTGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFI  795
             +KWCTGS+ADLYHVMIYMFL PT++LGEN+LFPGQKT Q+VL+LLALVSVPWMLLPKPF+
Sbjct  600   IKWCTGSKADLYHVMIYMFLSPTDELGENELFPGQKTIQIVLLLLALVSVPWMLLPKPFL  659

Query  794   LKSQHNRHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSN  615
             LK QH+RH G+SYAP+ D +ESL  + +HDS  HEEFEFSE+FVHQLIHTIEFVLGAVSN
Sbjct  660   LKMQHDRHHGESYAPLPDAEESLQSEANHDSHGHEEFEFSEIFVHQLIHTIEFVLGAVSN  719

Query  614   TASYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLS  435
             TASYLRLWALSLAHSELS+VFYEKVLLLAWGYNNIIIL+VG IIFI AT+GVLLVMETLS
Sbjct  720   TASYLRLWALSLAHSELSSVFYEKVLLLAWGYNNIIILIVGIIIFICATVGVLLVMETLS  779

Query  434   AFLHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             AFLHALRLHWVEFQNKFYEGDGYKF PFSF L+D EE+
Sbjct  780   AFLHALRLHWVEFQNKFYEGDGYKFYPFSFALLDYEEE  817



>emb|CDP20651.1| unnamed protein product [Coffea canephora]
Length=820

 Score =  1270 bits (3286),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 659/821 (80%), Positives = 747/821 (91%), Gaps = 1/821 (0%)
 Frame = -2

Query  2783  MAERLGGRGGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPF  2604
             MAER GG GGC PPMDL RSEPMQLVQLIIP ESA L++ YLG+LGL+QFKDLNAEKSPF
Sbjct  1     MAERRGG-GGCCPPMDLMRSEPMQLVQLIIPAESAHLTIDYLGELGLVQFKDLNAEKSPF  59

Query  2603  QRTYAAQIKRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIE  2424
             QRTYA QI+R GEMARKLRFF+DQ+S+AG+S    S ++  +  DDLE+KLG+LEAEL+E
Sbjct  60    QRTYATQIRRCGEMARKLRFFRDQISRAGLSLPTGSVSEAVLNLDDLEIKLGELEAELVE  119

Query  2423  INANNDKLQRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllse  2244
             INAN++KLQRS+NELVEYKLVLQK GEFF SA+ SAEAQQ+EY SSQS EESLE PLL++
Sbjct  120   INANSEKLQRSYNELVEYKLVLQKAGEFFQSAQRSAEAQQREYASSQSAEESLETPLLAD  179

Query  2243  PDMSADTSKQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKV  2064
              +   D SKQV+LG ISGLVP+EKSMAFERI+FRATRGNV LRQ+ V+E V DP+SGEKV
Sbjct  180   QETVTDPSKQVKLGSISGLVPREKSMAFERIIFRATRGNVFLRQAVVEELVTDPLSGEKV  239

Query  2063  EKNVFLVFYSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAG  1884
             EKNVF+VF+SGERAKNKILKIC+AFGANRYPF E+L KQAQ ITEVSG++ ELKT IDAG
Sbjct  240   EKNVFVVFFSGERAKNKILKICEAFGANRYPFNEDLSKQAQAITEVSGRLLELKTTIDAG  299

Query  1883  ILHRGNLLQSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQD  1704
             ++HRGNLLQSI EQF++WN+LVRREKSIYHTLNMLS DVTKKCLVAEGWSP  AT +IQD
Sbjct  300   LVHRGNLLQSIGEQFEQWNLLVRREKSIYHTLNMLSFDVTKKCLVAEGWSPIFATKQIQD  359

Query  1703  ALQRAGHDSNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFT  1524
             ALQRA +DSNS++GAIFRVL TRE+PPTYF+TNK TSAFQEIVDAYGVAKYQEANPGVFT
Sbjct  360   ALQRATYDSNSQVGAIFRVLHTREAPPTYFRTNKVTSAFQEIVDAYGVAKYQEANPGVFT  419

Query  1523  IVTFPFLFAVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALF  1344
             IVTFPFLFAVMFGDWGHGICLL+ TL+ +IRE+K SS+KLGDI EMTFGGRYVIL+M+LF
Sbjct  420   IVTFPFLFAVMFGDWGHGICLLVTTLFLIIRERKYSSEKLGDIMEMTFGGRYVILLMSLF  479

Query  1343  SIYTGFIYNEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSE  1164
             SIYTG IYNEFFS+ FELFGRSAY CRD SCS+ATT+GLIKARDTY FGVDPAWHGTRSE
Sbjct  480   SIYTGLIYNEFFSLPFELFGRSAYACRDASCSEATTVGLIKARDTYPFGVDPAWHGTRSE  539

Query  1163  LPFLNSLKMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSV  984
             LPFLNSLKMK+SIL+GVAQMNLGIILS+ NA +FR+ +N WCQF+P++IFLN LFGYLS+
Sbjct  540   LPFLNSLKMKMSILIGVAQMNLGIILSFCNALFFRNSINVWCQFVPEMIFLNGLFGYLSI  599

Query  983   LIIVKWCTGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPK  804
             LII+KW TGSQADLYHVMIYMFLGPT+DLGENQLFPGQKTTQ+VLVLLAL+SVPWML+PK
Sbjct  600   LIIIKWWTGSQADLYHVMIYMFLGPTDDLGENQLFPGQKTTQIVLVLLALISVPWMLIPK  659

Query  803   PFILKSQHNRHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGA  624
             PF+LK +H+RH G SYAP+QD +ESLLV+ + DS  H EFEFSE+FVHQLIHTIEFVLGA
Sbjct  660   PFLLKLEHDRHHGHSYAPLQDTEESLLVETNQDSHGHGEFEFSEIFVHQLIHTIEFVLGA  719

Query  623   VSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVME  444
             VSNTASYLRLWALSLAHSELS+VFYEKVLLLAWG+NN+IIL+VG I+FIFAT+GVLLVME
Sbjct  720   VSNTASYLRLWALSLAHSELSSVFYEKVLLLAWGFNNVIILIVGIIVFIFATVGVLLVME  779

Query  443   TLSAFLHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             TLSAFLHALRLHWVEFQNKFYEGDGYKF PFSF L+++EED
Sbjct  780   TLSAFLHALRLHWVEFQNKFYEGDGYKFHPFSFALLNDEED  820



>ref|XP_006362018.1| PREDICTED: vacuolar proton ATPase a3-like [Solanum tuberosum]
Length=820

 Score =  1268 bits (3282),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 659/821 (80%), Positives = 741/821 (90%), Gaps = 2/821 (0%)
 Frame = -2

Query  2783  MAERLGGRGGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPF  2604
             MAE+ GG  GC PPMDLFRSE MQLVQ+IIP ESA  ++ YLG++GLIQFKDLNAEKSPF
Sbjct  1     MAEQTGG--GCCPPMDLFRSESMQLVQIIIPNESAHRTIDYLGEIGLIQFKDLNAEKSPF  58

Query  2603  QRTYAAQIKRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIE  2424
             QRTYA QIKR GEMARKLR FK+QMSKAG+ +S+ S TQ  + FDDLEVKLG+LE+ELIE
Sbjct  59    QRTYANQIKRCGEMARKLRLFKEQMSKAGLLSSSMSATQVDLSFDDLEVKLGELESELIE  118

Query  2423  INANNDKLQRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllse  2244
             +NAN DKLQRS+NELVEY+LVLQK GEFFH A+SSAEA  +E  S+Q+GE+SLE PLLSE
Sbjct  119   MNANGDKLQRSYNELVEYRLVLQKAGEFFHIAQSSAEALHREQASNQTGEQSLETPLLSE  178

Query  2243  PDMSADTSKQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKV  2064
              +   D SKQV+LGFI+GLVP+EKSMAFERILFRATRGNV LRQ+ V+E VIDP+SGEKV
Sbjct  179   QEAVTDPSKQVKLGFITGLVPREKSMAFERILFRATRGNVYLRQAVVEEPVIDPVSGEKV  238

Query  2063  EKNVFLVFYSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAG  1884
             EKNVF VF+SGERAK+KILKIC+AFGANRY   E+LGKQAQ+ITEVSG+ISELKT IDAG
Sbjct  239   EKNVFAVFFSGERAKSKILKICEAFGANRYSVPEDLGKQAQMITEVSGRISELKTTIDAG  298

Query  1883  ILHRGNLLQSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQD  1704
             ++HRGNLLQ+I EQ+DRWN+L R+EKSIYHTLNMLSIDVTKKCLVAEGWSP  AT +IQD
Sbjct  299   LVHRGNLLQTIGEQYDRWNILARKEKSIYHTLNMLSIDVTKKCLVAEGWSPVFATNQIQD  358

Query  1703  ALQRAGHDSNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFT  1524
             ALQRA HDSNSE+GAIFRVL TRE PPTYF+TNKFTS+FQ+IVDAYGVAKYQEANPGV+T
Sbjct  359   ALQRATHDSNSEVGAIFRVLRTREMPPTYFQTNKFTSSFQDIVDAYGVAKYQEANPGVYT  418

Query  1523  IVTFPFLFAVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALF  1344
             IVTFPFLFAVMFGDWGHGICLLLAT++FL  EKK SSQKLGDI EMTFGGRYVI MM+LF
Sbjct  419   IVTFPFLFAVMFGDWGHGICLLLATMFFLFNEKKFSSQKLGDIMEMTFGGRYVIFMMSLF  478

Query  1343  SIYTGFIYNEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSE  1164
             SIYTG +YNEFFSV FELFG+SAY CRDPSC D+TT GLIK RDTY FGVDPAWHG+RSE
Sbjct  479   SIYTGLVYNEFFSVPFELFGKSAYGCRDPSCRDSTTAGLIKVRDTYPFGVDPAWHGSRSE  538

Query  1163  LPFLNSLKMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSV  984
             LP+LNSLKMK+SIL+GVAQMNLGIILS+FN  +FR+GVN WCQF+PQ+IFLNALFGYLSV
Sbjct  539   LPYLNSLKMKMSILIGVAQMNLGIILSFFNGLFFRNGVNIWCQFVPQMIFLNALFGYLSV  598

Query  983   LIIVKWCTGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPK  804
             LII+KWCTGS+ADLYHVMIYMFL PT++LGEN+LFPGQK TQLVL+L ALV+VPWML PK
Sbjct  599   LIIMKWCTGSKADLYHVMIYMFLSPTDELGENELFPGQKMTQLVLLLSALVAVPWMLFPK  658

Query  803   PFILKSQHNRHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGA  624
             PF+LK+QH RHQGQSY  +Q+ +ESLLV+ + DS  H EFEFSE+FVHQLIHTIEFVLGA
Sbjct  659   PFLLKAQHERHQGQSYTALQEAEESLLVESNDDSGHHGEFEFSEIFVHQLIHTIEFVLGA  718

Query  623   VSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVME  444
             VSNTASYLRLWALSLAHSELS+VFYEKVLLLAWGYNNIIIL+VG I+F+FAT+GVLLVME
Sbjct  719   VSNTASYLRLWALSLAHSELSSVFYEKVLLLAWGYNNIIILIVGIIVFVFATVGVLLVME  778

Query  443   TLSAFLHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             TLSAFLHALRLHWVEFQNKFYEGDGYKF PFSF L+D  ED
Sbjct  779   TLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFKLIDVGED  819



>ref|XP_009602232.1| PREDICTED: V-type proton ATPase subunit a2-like [Nicotiana tomentosiformis]
Length=819

 Score =  1267 bits (3278),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 671/821 (82%), Positives = 746/821 (91%), Gaps = 2/821 (0%)
 Frame = -2

Query  2783  MAERLGGRGGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPF  2604
             MAE+ GGRG C PPMDLFRSE MQLVQ+IIPIESA  ++ YLG++GLIQFKDLNAEKSPF
Sbjct  1     MAEQ-GGRGCC-PPMDLFRSEAMQLVQIIIPIESAHRTIDYLGEIGLIQFKDLNAEKSPF  58

Query  2603  QRTYAAQIKRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIE  2424
             QRTYA QIKR GEMARKLR FK+QMSKAG+ +S+ S TQ  + FDDLEVKLG+LEAELIE
Sbjct  59    QRTYATQIKRCGEMARKLRLFKEQMSKAGLLSSSTSSTQVDLSFDDLEVKLGELEAELIE  118

Query  2423  INANNDKLQRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllse  2244
             INAN DKLQRS+NELVEYKLVLQK GEFF  A+SSAEAQ +E  S+Q+GE+SLE PLL++
Sbjct  119   INANGDKLQRSYNELVEYKLVLQKAGEFFRKAQSSAEAQLREQASNQTGEQSLETPLLTD  178

Query  2243  PDMSADTSKQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKV  2064
              +  AD SKQV+LGFI+GLVP+EKSMAFERILFRATRGNV LRQ+ V+E V DP+SGEKV
Sbjct  179   QEAVADPSKQVKLGFITGLVPREKSMAFERILFRATRGNVFLRQAVVEEPVTDPVSGEKV  238

Query  2063  EKNVFLVFYSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAG  1884
             EKNVF VF+SGERAK K+LKIC+AFGANRY   E+LGKQAQ+ITEVSG+ISELKT IDAG
Sbjct  239   EKNVFAVFFSGERAKTKVLKICEAFGANRYSVTEDLGKQAQMITEVSGRISELKTTIDAG  298

Query  1883  ILHRGNLLQSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQD  1704
             +LHRGNLLQ+I EQ+DRWN+LVR+EKS+YHTLNMLSIDVTKKCLVAEGWSP  AT +IQD
Sbjct  299   LLHRGNLLQTIGEQYDRWNILVRKEKSVYHTLNMLSIDVTKKCLVAEGWSPVFATKQIQD  358

Query  1703  ALQRAGHDSNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFT  1524
             ALQRA HDSNSE+GAIFRVL TRE PPTYF+TNKFTS+FQEIVDAYGVAKYQEANPGV+T
Sbjct  359   ALQRATHDSNSEVGAIFRVLRTREMPPTYFQTNKFTSSFQEIVDAYGVAKYQEANPGVYT  418

Query  1523  IVTFPFLFAVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALF  1344
             IVTFPFLFAVMFGDWGHGICLLLATL+ LIREKKLSSQKLGDI EMTFGGRYVI MM+LF
Sbjct  419   IVTFPFLFAVMFGDWGHGICLLLATLFLLIREKKLSSQKLGDIMEMTFGGRYVIFMMSLF  478

Query  1343  SIYTGFIYNEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSE  1164
             SIYTG IYNEFFSV FELFGRSAY CRDPSC D+T+ GLIK RDTY FGVDPAWHGTRSE
Sbjct  479   SIYTGLIYNEFFSVPFELFGRSAYGCRDPSCRDSTSAGLIKVRDTYPFGVDPAWHGTRSE  538

Query  1163  LPFLNSLKMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSV  984
             LP+LNSLKMK+SILLGVAQMNLGI LS+FNA +FRSG+N WCQF+PQIIFLNALFGYLSV
Sbjct  539   LPYLNSLKMKMSILLGVAQMNLGIFLSFFNALFFRSGINIWCQFVPQIIFLNALFGYLSV  598

Query  983   LIIVKWCTGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPK  804
             LIIVKWCTGS+ADLYHVMIYMFL PT++LGENQLF GQKTTQLVL+  ALV+VPWMLLPK
Sbjct  599   LIIVKWCTGSKADLYHVMIYMFLSPTDELGENQLFAGQKTTQLVLLFSALVAVPWMLLPK  658

Query  803   PFILKSQHNRHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGA  624
             PF+LK+QH RHQGQSY  +Q+ +ESLLV+ S DS  HEEFEFSEVFVHQLIHTIEFVLGA
Sbjct  659   PFLLKAQHERHQGQSYTALQEAEESLLVESSDDSGHHEEFEFSEVFVHQLIHTIEFVLGA  718

Query  623   VSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVME  444
             VSNTASYLRLWALSLAHSELS+VFYEKVLLLAWG+NN+ IL++G I+FIFAT+GVLLVME
Sbjct  719   VSNTASYLRLWALSLAHSELSSVFYEKVLLLAWGFNNVFILIIGIIVFIFATVGVLLVME  778

Query  443   TLSAFLHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             TLSAFLHALRLHWVEFQNKFYEGDGYKF PFSF L+D E++
Sbjct  779   TLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFSLIDGEDE  819



>ref|XP_009785999.1| PREDICTED: V-type proton ATPase subunit a2-like [Nicotiana sylvestris]
Length=819

 Score =  1266 bits (3276),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 673/821 (82%), Positives = 744/821 (91%), Gaps = 2/821 (0%)
 Frame = -2

Query  2783  MAERLGGRGGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPF  2604
             MAE+ GGRG C PPMDLFRSE MQLVQ+IIPIESA  +V YLG++GLIQFKDLNAEKSPF
Sbjct  1     MAEQ-GGRGCC-PPMDLFRSEAMQLVQIIIPIESAHRTVDYLGEIGLIQFKDLNAEKSPF  58

Query  2603  QRTYAAQIKRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIE  2424
             QRTYA QIKR GEMARKLR FK+QMSKAG+ +S+ S TQ  + FDDLEVKLG+LEAELIE
Sbjct  59    QRTYATQIKRCGEMARKLRLFKEQMSKAGLLSSSTSSTQVDLSFDDLEVKLGELEAELIE  118

Query  2423  INANNDKLQRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllse  2244
             INAN DKLQRS+NELVEYKLVLQK GEFF  A+SSAEA  +E  S+Q+GE+SLE PLLS+
Sbjct  119   INANGDKLQRSYNELVEYKLVLQKAGEFFRKAQSSAEALLREQASNQTGEQSLETPLLSD  178

Query  2243  PDMSADTSKQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKV  2064
              +  AD SKQV+LGFI+GLVP+EKSMAFERILFRATRGNV LRQ+ V+E V DP+SGEKV
Sbjct  179   QEAVADPSKQVKLGFITGLVPREKSMAFERILFRATRGNVFLRQAVVEEPVTDPVSGEKV  238

Query  2063  EKNVFLVFYSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAG  1884
             EKNVF VF+SGERAK KILKIC+AFGANRY   E+LGKQAQ+ITEVSG+ISELKT ID G
Sbjct  239   EKNVFAVFFSGERAKTKILKICEAFGANRYSVTEDLGKQAQMITEVSGRISELKTTIDVG  298

Query  1883  ILHRGNLLQSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQD  1704
             +LHRGNLLQ+I EQ+DRWN+LVR+EKS+YHTLNMLSIDVTKKCLVAEGWSP  AT +IQD
Sbjct  299   MLHRGNLLQTIGEQYDRWNILVRKEKSVYHTLNMLSIDVTKKCLVAEGWSPVFATKQIQD  358

Query  1703  ALQRAGHDSNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFT  1524
             ALQRA HDSNSE+GAIFRVL TRE PPTYF+TNKFTS+FQEIVDAYGVAKYQEANPGV+T
Sbjct  359   ALQRATHDSNSEVGAIFRVLRTREMPPTYFQTNKFTSSFQEIVDAYGVAKYQEANPGVYT  418

Query  1523  IVTFPFLFAVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALF  1344
             IVTFPFLFAVMFGDWGHGICLLLATL+ LIREKKLSSQKLGDI EMTFGGRYVI MM+LF
Sbjct  419   IVTFPFLFAVMFGDWGHGICLLLATLFLLIREKKLSSQKLGDIMEMTFGGRYVIFMMSLF  478

Query  1343  SIYTGFIYNEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSE  1164
             SIYTG IYNEFFSV FELFGRSAY CRDPSC D+T+ GLIK RDTY FGVDPAWHGTRSE
Sbjct  479   SIYTGLIYNEFFSVPFELFGRSAYGCRDPSCRDSTSAGLIKVRDTYPFGVDPAWHGTRSE  538

Query  1163  LPFLNSLKMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSV  984
             LP+LNSLKMK+SILLGVAQMNLGI LS+FNA +FRSG+N WCQF+PQIIFLNALFGYLSV
Sbjct  539   LPYLNSLKMKMSILLGVAQMNLGIFLSFFNALFFRSGINIWCQFVPQIIFLNALFGYLSV  598

Query  983   LIIVKWCTGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPK  804
             LIIVKWCTGS+ADLYHVMIYMFL PT++LGENQLF GQKTTQLVL+  ALV+VPWMLLPK
Sbjct  599   LIIVKWCTGSKADLYHVMIYMFLSPTDELGENQLFAGQKTTQLVLLFSALVAVPWMLLPK  658

Query  803   PFILKSQHNRHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGA  624
             PF+LK+QH RHQGQSY  +Q+ +ESLLV+ S DS  HEEFEFSEVFVHQLIHTIEFVLGA
Sbjct  659   PFLLKAQHERHQGQSYTALQEAEESLLVESSDDSGHHEEFEFSEVFVHQLIHTIEFVLGA  718

Query  623   VSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVME  444
             VSNTASYLRLWALSLAHSELS+VFYEKVLLLAWG+NN+ IL++G I+FIFAT+GVLLVME
Sbjct  719   VSNTASYLRLWALSLAHSELSSVFYEKVLLLAWGFNNVFILIIGIIVFIFATVGVLLVME  778

Query  443   TLSAFLHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             TLSAFLHALRLHWVEFQNKFYEGDGYKF PFSF LVD E++
Sbjct  779   TLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFSLVDGEDE  819



>ref|XP_004230865.1| PREDICTED: V-type proton ATPase subunit a3 [Solanum lycopersicum]
Length=820

 Score =  1266 bits (3276),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 660/821 (80%), Positives = 740/821 (90%), Gaps = 2/821 (0%)
 Frame = -2

Query  2783  MAERLGGRGGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPF  2604
             MAE+ GG  GC PPMDLFRSE MQLVQ+IIP ESA  ++ YLG++GLIQFKDLNAEKSPF
Sbjct  1     MAEQTGG--GCCPPMDLFRSESMQLVQIIIPNESAHRTIDYLGEIGLIQFKDLNAEKSPF  58

Query  2603  QRTYAAQIKRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIE  2424
             QRTYA QIKR GEMARKLR FK+QMSKAG+ +S+ S TQ  + FDDLEVKLG+LE+ELIE
Sbjct  59    QRTYANQIKRCGEMARKLRLFKEQMSKAGLLSSSTSATQVDLSFDDLEVKLGELESELIE  118

Query  2423  INANNDKLQRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllse  2244
             +NAN DKLQRS+NELVEY+LVL+K GEFFH A+SSAEA  +E  S+Q+GE+SLE PLLSE
Sbjct  119   MNANGDKLQRSYNELVEYRLVLKKAGEFFHIAQSSAEALHREQASNQTGEQSLETPLLSE  178

Query  2243  PDMSADTSKQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKV  2064
              +   D SKQV+LGFI+GLVP+EKSMAFERILFRATRGNV LRQ+ V+E VIDP+SGEKV
Sbjct  179   QEAVTDPSKQVKLGFITGLVPREKSMAFERILFRATRGNVYLRQAVVEEPVIDPVSGEKV  238

Query  2063  EKNVFLVFYSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAG  1884
             EKNVF VF+SGERAK+KILKIC+AFGANRY   E+LGKQAQ+ITEVSG+ISELKT IDAG
Sbjct  239   EKNVFAVFFSGERAKSKILKICEAFGANRYSVPEDLGKQAQMITEVSGRISELKTTIDAG  298

Query  1883  ILHRGNLLQSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQD  1704
             ++HRGNLL++I E +DRWN+L R+EKSIYHTLNMLSIDVTKKCLVAEGWSP  AT +IQD
Sbjct  299   LVHRGNLLRTIGEHYDRWNILARKEKSIYHTLNMLSIDVTKKCLVAEGWSPVFATKQIQD  358

Query  1703  ALQRAGHDSNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFT  1524
             ALQRA HDSNSE+GAIFRVL TRE PPTYF+TNKFTS+FQ+IVDAYGVAKYQEANPGV+T
Sbjct  359   ALQRATHDSNSEVGAIFRVLRTREMPPTYFQTNKFTSSFQDIVDAYGVAKYQEANPGVYT  418

Query  1523  IVTFPFLFAVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALF  1344
             IVTFPFLFAVMFGDWGHGICLLLAT++FL  EKK SSQKLGDI EMTFGGRYVI MM+LF
Sbjct  419   IVTFPFLFAVMFGDWGHGICLLLATMFFLFNEKKFSSQKLGDIMEMTFGGRYVIFMMSLF  478

Query  1343  SIYTGFIYNEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSE  1164
             SIYTG +YNEFFSV FELFG+SAY CRDPSC D+TT GLIK RDTY FGVDPAWHG+RSE
Sbjct  479   SIYTGLVYNEFFSVPFELFGKSAYGCRDPSCRDSTTAGLIKVRDTYPFGVDPAWHGSRSE  538

Query  1163  LPFLNSLKMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSV  984
             LP+LNSLKMK+SIL+GVAQMNLGIILS+FNA +FR+GVN WCQFIPQ+IFLNALFGYLSV
Sbjct  539   LPYLNSLKMKMSILIGVAQMNLGIILSFFNALFFRNGVNIWCQFIPQMIFLNALFGYLSV  598

Query  983   LIIVKWCTGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPK  804
             LIIVKWCTGS+ADLYHVMIYMFL PT++LGENQLF GQK TQLVL+L ALV+VPWML PK
Sbjct  599   LIIVKWCTGSKADLYHVMIYMFLSPTDELGENQLFAGQKMTQLVLLLSALVAVPWMLFPK  658

Query  803   PFILKSQHNRHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGA  624
             PF+LK+QH RHQGQSY  +Q+ +ESLLV+ + DS  H EFEFSE+FVHQLIHTIEFVLGA
Sbjct  659   PFLLKAQHERHQGQSYTALQEAEESLLVESNDDSGHHGEFEFSEIFVHQLIHTIEFVLGA  718

Query  623   VSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVME  444
             VSNTASYLRLWALSLAHSELS+VFYEKVLLLAWGYNNIIIL+VG I+FIFAT+GVLLVME
Sbjct  719   VSNTASYLRLWALSLAHSELSSVFYEKVLLLAWGYNNIIILIVGIIVFIFATVGVLLVME  778

Query  443   TLSAFLHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             TLSAFLHALRLHWVEFQNKFYEGDGYKF PFSF L+D  ED
Sbjct  779   TLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFKLIDLGED  819



>gb|KHG13921.1| Vacuolar proton translocating ATPase subunit [Gossypium arboreum]
Length=821

 Score =  1263 bits (3269),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 662/821 (81%), Positives = 742/821 (90%), Gaps = 4/821 (0%)
 Frame = -2

Query  2771  LGGRGG-CFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRT  2595
             +G RGG C PPMDLFRSE MQLVQLIIP+ESA L+V+YLGDLGLIQFKDLN++KSPFQRT
Sbjct  1     MGDRGGGCCPPMDLFRSEAMQLVQLIIPMESAHLTVSYLGDLGLIQFKDLNSDKSPFQRT  60

Query  2594  YAAQIKRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINA  2415
             YAAQIKR GEMARKLRFFK+QM KAG S SA S  +  I FDDLEVKLG+LEAEL+E+NA
Sbjct  61    YAAQIKRCGEMARKLRFFKEQMLKAGFSPSAKSLGETNIGFDDLEVKLGELEAELVEMNA  120

Query  2414  NNDKLQRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDM  2235
             N DKLQR +NEL+EYKLVLQK GEFF SA+ SA AQQ+E  S Q G+++LE PLL E + 
Sbjct  121   NGDKLQRGYNELLEYKLVLQKAGEFFTSAQRSATAQQREMESQQMGDQTLETPLLREQET  180

Query  2234  SADTSKQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKN  2055
             + D SKQV+LGFI+GLVP+EKSMAFERILFRATRGNV L+Q   +E + DP+SGEK+EKN
Sbjct  181   TTDLSKQVKLGFITGLVPREKSMAFERILFRATRGNVFLKQVPAEEPITDPVSGEKMEKN  240

Query  2054  VFLVFYSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILH  1875
             VF+VFYSGERAKNKILKIC+AFGANRYPFAE+LGKQA +ITEVSG+ISELKT IDAG+L 
Sbjct  241   VFVVFYSGERAKNKILKICEAFGANRYPFAEDLGKQALMITEVSGRISELKTTIDAGLLQ  300

Query  1874  RGNLLQSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQ  1695
             R NLL++I +QF++WN+ V+ EKSIYHTLNMLS+DVTKKCLVAEGWSP  AT +IQ+ALQ
Sbjct  301   RDNLLRTIGDQFEQWNLKVKTEKSIYHTLNMLSLDVTKKCLVAEGWSPVFATKQIQEALQ  360

Query  1694  RAGHDSNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVT  1515
             RA  DSNS++GAIF+VL TRESPPTYF+TNKFTSAFQEIVDAYGVAKYQEANPGV+TIVT
Sbjct  361   RAAFDSNSQVGAIFQVLHTRESPPTYFRTNKFTSAFQEIVDAYGVAKYQEANPGVYTIVT  420

Query  1514  FPFLFAVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIY  1335
             FPFLFAVMFGDWGHGICLLLATLYF++REKKLSSQKLGDITEMTFGGRYVI+MM+LFSIY
Sbjct  421   FPFLFAVMFGDWGHGICLLLATLYFIVREKKLSSQKLGDITEMTFGGRYVIMMMSLFSIY  480

Query  1334  TGFIYNEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPF  1155
             TG +YNEFFSV FELFGRSAY CRD SC DATT+GLIK RDTY FGVDPAWHG+RSELPF
Sbjct  481   TGLVYNEFFSVPFELFGRSAYACRDLSCRDATTVGLIKVRDTYPFGVDPAWHGSRSELPF  540

Query  1154  LNSLKMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLII  975
             LNSLKMK+SILLGVAQMNLGIILSYFNA +FR+ +N W QFIPQ+IFLN+LFGYLS LII
Sbjct  541   LNSLKMKMSILLGVAQMNLGIILSYFNAIFFRNSLNVWFQFIPQMIFLNSLFGYLSFLII  600

Query  974   VKWCTGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFI  795
             VKWCTGSQADLYH++IYMFL PT++LGENQLFPGQK TQ VL+LLALVSVPWMLLPKPF+
Sbjct  601   VKWCTGSQADLYHILIYMFLSPTDELGENQLFPGQKITQQVLLLLALVSVPWMLLPKPFL  660

Query  794   LKSQH-NRHQGQSYAPIQDLDESLLvdgshds--sdheefefsevfvHQLIHTIEFVLGA  624
             LK QH NRHQGQSYAP++  DE+LL   ++DS   DHEEFEFSEVFVHQLIHTIEFVLGA
Sbjct  661   LKRQHENRHQGQSYAPLESTDETLLSVANNDSHGHDHEEFEFSEVFVHQLIHTIEFVLGA  720

Query  623   VSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVME  444
             VSNTASYLRLWALSLAHSELS VFYEKVLLLAWGYNNIIIL+VG I+FIFAT+GVLL+ME
Sbjct  721   VSNTASYLRLWALSLAHSELSVVFYEKVLLLAWGYNNIIILIVGIIVFIFATVGVLLIME  780

Query  443   TLSAFLHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             TLSAFLHALRLHWVEFQNKFYEGDGYKF PFSF L+D+E+D
Sbjct  781   TLSAFLHALRLHWVEFQNKFYEGDGYKFYPFSFALLDDEDD  821



>ref|XP_007042075.1| Vacuolar proton ATPase A3 isoform 2 [Theobroma cacao]
 gb|EOX97906.1| Vacuolar proton ATPase A3 isoform 2 [Theobroma cacao]
Length=820

 Score =  1253 bits (3243),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 655/816 (80%), Positives = 739/816 (91%), Gaps = 2/816 (0%)
 Frame = -2

Query  2762  RGGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQ  2583
             RGGC PPMDLFRSEPMQLVQLIIPIESA L+VAYLGDLG++QFKDLN+EKSPFQRTYAAQ
Sbjct  5     RGGCCPPMDLFRSEPMQLVQLIIPIESAHLTVAYLGDLGILQFKDLNSEKSPFQRTYAAQ  64

Query  2582  IKRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDK  2403
             IK+ GEMARK+RFFK+QM KAG S S  S+ +  I  DDLEVKLG+LEAELIE+NAN +K
Sbjct  65    IKKCGEMARKMRFFKEQMVKAGFSPSTKSEARGDIDVDDLEVKLGELEAELIEMNANGEK  124

Query  2402  LQRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADT  2223
             LQRS+NELVEYKLVLQK GEFF SA+ SA AQQ+E  S Q GEES+E PLL + + + D 
Sbjct  125   LQRSYNELVEYKLVLQKAGEFFASAQHSAVAQQREMESRQMGEESIETPLLQDQETTIDL  184

Query  2222  SKQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLV  2043
             SKQV+LGFI+GLVP+EKSMAFERILFRATRGNVLL+Q  V++ V DP+SGEK+EKNVF+V
Sbjct  185   SKQVKLGFITGLVPREKSMAFERILFRATRGNVLLKQVPVEDPVTDPVSGEKMEKNVFVV  244

Query  2042  FYSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNL  1863
             FYSGERAKNKILKIC+AFGANRYPFAE+LGKQA +ITEVSG+I+ELKT IDAG  HR NL
Sbjct  245   FYSGERAKNKILKICEAFGANRYPFAEDLGKQALMITEVSGRITELKTTIDAGSYHRDNL  304

Query  1862  LQSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGH  1683
             L++I +QF++WN+ V++EKSIYHTLNMLS+DVTKKCLVAEGWSP  AT ++Q++LQRA  
Sbjct  305   LRTIGDQFEQWNLKVKKEKSIYHTLNMLSLDVTKKCLVAEGWSPVFATKQVQESLQRAAF  364

Query  1682  DSNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFL  1503
             DSNS++GAIF+VL TRESPPTYF+TNKFTSAFQEIVDAYGVAKYQEANPGV+TI+TFPFL
Sbjct  365   DSNSQVGAIFQVLSTRESPPTYFRTNKFTSAFQEIVDAYGVAKYQEANPGVYTIITFPFL  424

Query  1502  FAVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFI  1323
             FAVMFGDWGHGICLLLATL+F++REKKLSSQKLGDITEMTFGGRYVI+MMALFSIYTG I
Sbjct  425   FAVMFGDWGHGICLLLATLFFIVREKKLSSQKLGDITEMTFGGRYVIMMMALFSIYTGLI  484

Query  1322  YNEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSL  1143
             YNEFFSV FELFGRSAY CRD +C DA+T+GLIK R+TY FGVDPAWHGTRSELPFLNSL
Sbjct  485   YNEFFSVPFELFGRSAYACRDLTCRDASTVGLIKVRETYPFGVDPAWHGTRSELPFLNSL  544

Query  1142  KMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWC  963
             KMK+SILLGVAQMNLGIILSYFNA +F S +N W QFIPQ+IFLN+LFGYLS+LIIVKWC
Sbjct  545   KMKMSILLGVAQMNLGIILSYFNATFFGSSLNVWFQFIPQMIFLNSLFGYLSLLIIVKWC  604

Query  962   TGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQ  783
             TGSQADLYHVMIYMFL PT++LGENQLFPGQKT QLVL+LLALVSVPWMLLP+PF+LK Q
Sbjct  605   TGSQADLYHVMIYMFLSPTDELGENQLFPGQKTVQLVLLLLALVSVPWMLLPRPFLLKKQ  664

Query  782   HNRHQGQSYAPIQDLDESLLvdgshds--sdheefefsevfvHQLIHTIEFVLGAVSNTA  609
             H  HQGQSY P++  D++L  + ++DS    HEEFEFSEVFVHQLIHTIEFVLGAVSNTA
Sbjct  665   HENHQGQSYTPLESTDDTLHSEANNDSHGHGHEEFEFSEVFVHQLIHTIEFVLGAVSNTA  724

Query  608   SYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAF  429
             SYLRLWALSLAHSELS VFYEKVLLLAWG+NNIIIL+VG IIFIFAT+GVLLVMETLSAF
Sbjct  725   SYLRLWALSLAHSELSVVFYEKVLLLAWGFNNIIILIVGIIIFIFATVGVLLVMETLSAF  784

Query  428   LHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             LHALRLHWVEFQNKFYEGDGYKF PFSF L+ +E+D
Sbjct  785   LHALRLHWVEFQNKFYEGDGYKFYPFSFALLGDEDD  820



>gb|EYU37836.1| hypothetical protein MIMGU_mgv1a001455mg [Erythranthe guttata]
Length=816

 Score =  1252 bits (3239),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 657/821 (80%), Positives = 730/821 (89%), Gaps = 5/821 (1%)
 Frame = -2

Query  2783  MAERLGGRGGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPF  2604
             M ER  GRG C P MDL RSE MQLVQLIIPIESA L+V+YLGDLGLIQFKDLNAEKSPF
Sbjct  1     MEER--GRGCC-PSMDLMRSEAMQLVQLIIPIESAHLAVSYLGDLGLIQFKDLNAEKSPF  57

Query  2603  QRTYAAQIKRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIE  2424
             QRTYA QIKR GEMARKLRFF+DQM KAG+   A S TQ  I  DDLEVKLGDLEAELIE
Sbjct  58    QRTYAIQIKRCGEMARKLRFFRDQMLKAGLPPPAISGTQPIITLDDLEVKLGDLEAELIE  117

Query  2423  INANNDKLQRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllse  2244
             INAN  KLQRS+NEL EYKLVLQK G+FFHSA   + A++ +   SQSGEESLE PLLSE
Sbjct  118   INANGSKLQRSYNELAEYKLVLQKAGDFFHSA--LSSAEELQREHSQSGEESLETPLLSE  175

Query  2243  PDMSADTSKQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKV  2064
                + D SKQV+LGFI+GLVP+EKSMAFERILFRATRGNV L+Q+ +DE VIDP +G+KV
Sbjct  176   QGTTTDPSKQVKLGFITGLVPREKSMAFERILFRATRGNVFLKQATIDEPVIDPGTGDKV  235

Query  2063  EKNVFLVFYSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAG  1884
             EKNVF +F+SGERA+ KILKIC+AFGANRY   E+LGKQ+Q+ITEVSG++SELKT IDAG
Sbjct  236   EKNVFAIFFSGERARVKILKICEAFGANRYSCNEDLGKQSQMITEVSGRLSELKTTIDAG  295

Query  1883  ILHRGNLLQSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQD  1704
             ++HRGNLLQ+I EQF++WN++VR+EK+IYHTLNMLSIDVTKKCLVAEGWSP  A  ++QD
Sbjct  296   LVHRGNLLQTIGEQFEQWNLMVRKEKAIYHTLNMLSIDVTKKCLVAEGWSPVFAVKQVQD  355

Query  1703  ALQRAGHDSNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFT  1524
             AL RA HDSNS++ AIF+VL TRE PPT+F+TNKFT+AFQEIVDAYGVAKYQEANPGVFT
Sbjct  356   ALHRATHDSNSQVNAIFQVLRTREMPPTFFRTNKFTTAFQEIVDAYGVAKYQEANPGVFT  415

Query  1523  IVTFPFLFAVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALF  1344
             IVTFPFLFAVMFGDWGHGICLLLAT YF+IREKKLSSQKLGDI EMTFGGRYVI++MALF
Sbjct  416   IVTFPFLFAVMFGDWGHGICLLLATSYFIIREKKLSSQKLGDIMEMTFGGRYVIMLMALF  475

Query  1343  SIYTGFIYNEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSE  1164
             SIYTG IYNEFFSV FELF RSAYVCRDP C D+TTIGLI ARDTY FGVDPAWHGTRSE
Sbjct  476   SIYTGLIYNEFFSVPFELFARSAYVCRDPECRDSTTIGLIMARDTYPFGVDPAWHGTRSE  535

Query  1163  LPFLNSLKMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSV  984
             LPFLNSLKMK+SILLGVAQMNLGI+LS+FNA +F++ +N W QFIPQIIFLN+LFGYLS+
Sbjct  536   LPFLNSLKMKMSILLGVAQMNLGIVLSFFNAQFFKNRINTWFQFIPQIIFLNSLFGYLSI  595

Query  983   LIIVKWCTGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPK  804
             LII+KWCTGS+ADLYHVMIYMFL PT+DLGENQLF GQK TQLVL+LLA VSVPWMLLPK
Sbjct  596   LIIIKWCTGSKADLYHVMIYMFLSPTDDLGENQLFSGQKMTQLVLLLLAFVSVPWMLLPK  655

Query  803   PFILKSQHNRHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGA  624
             PF+LK QHNRHQG +YAP+QD +ESL    +HDS  HEEFEFSEVFVHQLIHTIEFVLGA
Sbjct  656   PFLLKMQHNRHQGGAYAPLQDSEESLQSGANHDSHGHEEFEFSEVFVHQLIHTIEFVLGA  715

Query  623   VSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVME  444
             VSNTASYLRLWALSLAHSELS+VFYEKVL LAWGYNN+IIL+VG IIFI AT+GVLLVME
Sbjct  716   VSNTASYLRLWALSLAHSELSSVFYEKVLQLAWGYNNVIILIVGIIIFICATVGVLLVME  775

Query  443   TLSAFLHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             TLSAFLHALRLHWVEFQNKFYEGDGYKF PFSF L+D EE+
Sbjct  776   TLSAFLHALRLHWVEFQNKFYEGDGYKFYPFSFSLIDIEEE  816



>ref|XP_007042074.1| Vacuolar proton ATPase A3 isoform 1 [Theobroma cacao]
 gb|EOX97905.1| Vacuolar proton ATPase A3 isoform 1 [Theobroma cacao]
Length=821

 Score =  1252 bits (3239),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 656/817 (80%), Positives = 741/817 (91%), Gaps = 3/817 (0%)
 Frame = -2

Query  2762  RGGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQ  2583
             RGGC PPMDLFRSEPMQLVQLIIPIESA L+VAYLGDLG++QFKDLN+EKSPFQRTYAAQ
Sbjct  5     RGGCCPPMDLFRSEPMQLVQLIIPIESAHLTVAYLGDLGILQFKDLNSEKSPFQRTYAAQ  64

Query  2582  IKRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDK  2403
             IK+ GEMARK+RFFK+QM KAG S S  S+ +  I  DDLEVKLG+LEAELIE+NAN +K
Sbjct  65    IKKCGEMARKMRFFKEQMVKAGFSPSTKSEARGDIDVDDLEVKLGELEAELIEMNANGEK  124

Query  2402  LQRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADT  2223
             LQRS+NELVEYKLVLQK GEFF SA+ SA AQQ+E  S Q GEES+E PLL + + + D 
Sbjct  125   LQRSYNELVEYKLVLQKAGEFFASAQHSAVAQQREMESRQMGEESIETPLLQDQETTIDL  184

Query  2222  SKQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLV  2043
             SKQV+LGFI+GLVP+EKSMAFERILFRATRGNVLL+Q  V++ V DP+SGEK+EKNVF+V
Sbjct  185   SKQVKLGFITGLVPREKSMAFERILFRATRGNVLLKQVPVEDPVTDPVSGEKMEKNVFVV  244

Query  2042  FYSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNL  1863
             FYSGERAKNKILKIC+AFGANRYPFAE+LGKQA +ITEVSG+I+ELKT IDAG  HR NL
Sbjct  245   FYSGERAKNKILKICEAFGANRYPFAEDLGKQALMITEVSGRITELKTTIDAGSYHRDNL  304

Query  1862  LQSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGH  1683
             L++I +QF++WN+ V++EKSIYHTLNMLS+DVTKKCLVAEGWSP  AT ++Q++LQRA  
Sbjct  305   LRTIGDQFEQWNLKVKKEKSIYHTLNMLSLDVTKKCLVAEGWSPVFATKQVQESLQRAAF  364

Query  1682  DSNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFL  1503
             DSNS++GAIF+VL TRESPPTYF+TNKFTSAFQEIVDAYGVAKYQEANPGV+TI+TFPFL
Sbjct  365   DSNSQVGAIFQVLSTRESPPTYFRTNKFTSAFQEIVDAYGVAKYQEANPGVYTIITFPFL  424

Query  1502  FAVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFI  1323
             FAVMFGDWGHGICLLLATL+F++REKKLSSQKLGDITEMTFGGRYVI+MMALFSIYTG I
Sbjct  425   FAVMFGDWGHGICLLLATLFFIVREKKLSSQKLGDITEMTFGGRYVIMMMALFSIYTGLI  484

Query  1322  YNEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSL  1143
             YNEFFSV FELFGRSAY CRD +C DA+T+GLIK R+TY FGVDPAWHGTRSELPFLNSL
Sbjct  485   YNEFFSVPFELFGRSAYACRDLTCRDASTVGLIKVRETYPFGVDPAWHGTRSELPFLNSL  544

Query  1142  KMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWC  963
             KMK+SILLGVAQMNLGIILSYFNA +F S +N W QFIPQ+IFLN+LFGYLS+LIIVKWC
Sbjct  545   KMKMSILLGVAQMNLGIILSYFNATFFGSSLNVWFQFIPQMIFLNSLFGYLSLLIIVKWC  604

Query  962   TGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQ  783
             TGSQADLYHVMIYMFL PT++LGENQLFPGQKT QLVL+LLALVSVPWMLLP+PF+LK Q
Sbjct  605   TGSQADLYHVMIYMFLSPTDELGENQLFPGQKTVQLVLLLLALVSVPWMLLPRPFLLKKQ  664

Query  782   H-NRHQGQSYAPIQDLDESLLvdgshds--sdheefefsevfvHQLIHTIEFVLGAVSNT  612
             H N+HQGQSY P++  D++L  + ++DS    HEEFEFSEVFVHQLIHTIEFVLGAVSNT
Sbjct  665   HENQHQGQSYTPLESTDDTLHSEANNDSHGHGHEEFEFSEVFVHQLIHTIEFVLGAVSNT  724

Query  611   ASYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSA  432
             ASYLRLWALSLAHSELS VFYEKVLLLAWG+NNIIIL+VG IIFIFAT+GVLLVMETLSA
Sbjct  725   ASYLRLWALSLAHSELSVVFYEKVLLLAWGFNNIIILIVGIIIFIFATVGVLLVMETLSA  784

Query  431   FLHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             FLHALRLHWVEFQNKFYEGDGYKF PFSF L+ +E+D
Sbjct  785   FLHALRLHWVEFQNKFYEGDGYKFYPFSFALLGDEDD  821



>ref|XP_011092832.1| PREDICTED: V-type proton ATPase subunit a3-like [Sesamum indicum]
Length=819

 Score =  1242 bits (3214),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 660/821 (80%), Positives = 741/821 (90%), Gaps = 2/821 (0%)
 Frame = -2

Query  2783  MAERLGGRGGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPF  2604
             M ER  GRGGC PPMDL RSEPMQLVQLI+P+ESA L+V+YLGDLGLIQ KDLNAEKSPF
Sbjct  1     MGER--GRGGCCPPMDLMRSEPMQLVQLILPVESAHLAVSYLGDLGLIQIKDLNAEKSPF  58

Query  2603  QRTYAAQIKRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIE  2424
             QRTYA QIKR GEM+RKLRFF+DQMSKAG++ +  S  QD +  DDLEVKLGDL+AEL+E
Sbjct  59    QRTYAIQIKRCGEMSRKLRFFRDQMSKAGLAPTTRSLPQDVLNLDDLEVKLGDLDAELVE  118

Query  2423  INANNDKLQRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllse  2244
             INAN +KLQRS+NEL+EYKLVLQK GEFF+SA SSAEA+Q+EY S QSGEESLE PLLSE
Sbjct  119   INANGEKLQRSYNELMEYKLVLQKAGEFFNSALSSAEARQREYASHQSGEESLETPLLSE  178

Query  2243  PDMSADTSKQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKV  2064
              + + D SK V+LGFI+GLV +EKSMAFERILFRATRGNV L+Q+ VDE VIDP+SGEKV
Sbjct  179   LETANDLSKHVKLGFIAGLVTREKSMAFERILFRATRGNVFLKQAVVDEPVIDPVSGEKV  238

Query  2063  EKNVFLVFYSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAG  1884
             EKNVF+VF+SGERAKNKILKIC+AFGANRY F+E++ K+ Q+ITEVSG++SELK+ IDAG
Sbjct  239   EKNVFVVFFSGERAKNKILKICEAFGANRYSFSEDVSKKTQMITEVSGRLSELKSTIDAG  298

Query  1883  ILHRGNLLQSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQD  1704
              +HRGNLLQ+I EQF++WN+LVR+EK+IYHTLNMLSIDVTKKCLVAEGWSP  AT +IQ+
Sbjct  299   AVHRGNLLQTIGEQFEQWNLLVRKEKAIYHTLNMLSIDVTKKCLVAEGWSPVFATKQIQE  358

Query  1703  ALQRAGHDSNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFT  1524
             AL RA HDS S++ AIF+VL TRE PPTYF+TNKF SAFQEIVDAYGVAKYQEANPGVFT
Sbjct  359   ALHRATHDSKSQVDAIFQVLYTREMPPTYFRTNKFNSAFQEIVDAYGVAKYQEANPGVFT  418

Query  1523  IVTFPFLFAVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALF  1344
             IVTFPFLFAVMFGDWGHGICLLLATLYF++REKKLSSQKLGDI EMTFGGRYVI++MA+F
Sbjct  419   IVTFPFLFAVMFGDWGHGICLLLATLYFIVREKKLSSQKLGDIMEMTFGGRYVIMLMAIF  478

Query  1343  SIYTGFIYNEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSE  1164
             SIYTGFIYNEFFSV FELF  SAY CRDPSC D+TT+GLIK RDTY FGVDPAWHGTRSE
Sbjct  479   SIYTGFIYNEFFSVPFELFASSAYACRDPSCRDSTTVGLIKVRDTYPFGVDPAWHGTRSE  538

Query  1163  LPFLNSLKMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSV  984
             LPFLNSLKMK+SILLGVAQMNLGII+S+FNA +F++ +N W QFIPQIIFLN+LFGYLSV
Sbjct  539   LPFLNSLKMKMSILLGVAQMNLGIIMSFFNALFFKNSLNVWFQFIPQIIFLNSLFGYLSV  598

Query  983   LIIVKWCTGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPK  804
             LII+KWCTGSQADLYHVMIYMFL PT++LGENQLFPGQKT QLVL+LLALVSVPWMLLPK
Sbjct  599   LIIIKWCTGSQADLYHVMIYMFLSPTDELGENQLFPGQKTAQLVLLLLALVSVPWMLLPK  658

Query  803   PFILKSQHNRHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGA  624
             PF+LK QH+R QG SYAP+ D +ESL    +HDS  HEEFEFSEVFVHQLIHTIEFVLGA
Sbjct  659   PFLLKLQHSRQQGDSYAPLPDAEESLRSAANHDSHSHEEFEFSEVFVHQLIHTIEFVLGA  718

Query  623   VSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVME  444
             VSNTASYLRLWALSLAHSELS VFYEKVLLLAWGYNN++IL+VG I+FI AT+GVLLVME
Sbjct  719   VSNTASYLRLWALSLAHSELSVVFYEKVLLLAWGYNNVVILIVGIIVFICATVGVLLVME  778

Query  443   TLSAFLHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             TLSAFLHALRLHWVEFQNKFYEGDGYKF PFS  L+D EE+
Sbjct  779   TLSAFLHALRLHWVEFQNKFYEGDGYKFYPFSLALLDHEEE  819



>ref|XP_010271518.1| PREDICTED: V-type proton ATPase subunit a2-like isoform X1 [Nelumbo 
nucifera]
Length=817

 Score =  1241 bits (3212),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 643/816 (79%), Positives = 737/816 (90%), Gaps = 1/816 (0%)
 Frame = -2

Query  2765  GRGGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAA  2586
             G GGC P M+LFRSEPMQLVQLIIPIESA LS++YLG+LGL+QFKDLNAEKSPFQRTYA 
Sbjct  2     GEGGCCPSMELFRSEPMQLVQLIIPIESAHLSISYLGELGLVQFKDLNAEKSPFQRTYAT  61

Query  2585  QIKRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANND  2406
             QIKR GEMARKLRFFK+QM+KAG++ S    T+  I  D+LE KLG+LE ELIEINAN+D
Sbjct  62    QIKRCGEMARKLRFFKEQMTKAGLTPSTRPLTRVDIDLDNLETKLGELETELIEINANSD  121

Query  2405  KLQRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSAD  2226
             KLQR+++EL+EYKLVL+K GEFF+SA+SSA AQ++E  + Q GE S+++PLL E +MS D
Sbjct  122   KLQRTYSELLEYKLVLRKAGEFFYSAQSSATAQKREIDARQMGEVSIDSPLLLEQEMSID  181

Query  2225  TSKQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFL  2046
              SKQV+LG++SGLVP+E SMAFERILFRATRGNV LRQ+ ++E V+DP+SGEKVEKNVF+
Sbjct  182   PSKQVKLGYVSGLVPRENSMAFERILFRATRGNVFLRQAVIEEPVMDPMSGEKVEKNVFV  241

Query  2045  VFYSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGN  1866
             VFYSGERAK KILKIC+AFGANRYPF E++GKQ Q++TEVSGKISELKT ID G++HR N
Sbjct  242   VFYSGERAKAKILKICEAFGANRYPFTEDVGKQGQMLTEVSGKISELKTTIDVGLMHRDN  301

Query  1865  LLQSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAG  1686
             LL++I+ QF++W++L R+EKSIYHTLNMLS DVTKKCLVAEGWSP  A  +IQDAL+RA 
Sbjct  302   LLKAISYQFEQWSLLARKEKSIYHTLNMLSFDVTKKCLVAEGWSPVFAINQIQDALKRAT  361

Query  1685  HDSNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPF  1506
              DSNS++G+IF+VL T+ESPPTYF+TNKFTSAFQEIVDAYGVAKY EANPGV+TI+TFPF
Sbjct  362   FDSNSQVGSIFQVLHTKESPPTYFRTNKFTSAFQEIVDAYGVAKYLEANPGVYTIITFPF  421

Query  1505  LFAVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGF  1326
             LFAVMFGDWGHGICLLLATL+F+IREKKLS+QKLGDITEMTFGGRYVI+MMALFSIYTG 
Sbjct  422   LFAVMFGDWGHGICLLLATLFFIIREKKLSTQKLGDITEMTFGGRYVIMMMALFSIYTGL  481

Query  1325  IYNEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNS  1146
             IYNEFFSV FELFGRSAY CRDPSCSD+TT+GLIK R TY FGVDPAW+GTRSELPFLNS
Sbjct  482   IYNEFFSVPFELFGRSAYACRDPSCSDSTTVGLIKVRGTYPFGVDPAWYGTRSELPFLNS  541

Query  1145  LKMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKW  966
             LKMK+SIL+GVAQMNLGI+LSYFNA ++ S +N W QF+PQIIFLN+LFGYLS+LIIVKW
Sbjct  542   LKMKMSILIGVAQMNLGIVLSYFNAKFYGSNLNIWYQFVPQIIFLNSLFGYLSLLIIVKW  601

Query  965   CTGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKS  786
             CTGSQADLYHVMIYMFL PT+DLGENQLF GQKT Q+VL+LLALV+VPWMLLPKPF+LK 
Sbjct  602   CTGSQADLYHVMIYMFLSPTDDLGENQLFAGQKTLQMVLLLLALVAVPWMLLPKPFLLKK  661

Query  785   QHN-RHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTA  609
             QH  RHQGQSYA +Q  D+S  V+  HDS  HEEFEFSEVFVHQLIHTIEFVLGAVSNTA
Sbjct  662   QHQERHQGQSYALLQSTDDSFEVEAHHDSHGHEEFEFSEVFVHQLIHTIEFVLGAVSNTA  721

Query  608   SYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAF  429
             SYLRLWALSLAHSELS+VFYEKVLLLAWG+NNIIILVVG I+FI AT+GVLLVMETLSAF
Sbjct  722   SYLRLWALSLAHSELSSVFYEKVLLLAWGFNNIIILVVGIIVFICATVGVLLVMETLSAF  781

Query  428   LHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             LHALRLHWVEFQNKFYEGDGYKF+PFSF L+ +E+D
Sbjct  782   LHALRLHWVEFQNKFYEGDGYKFNPFSFALLSDEDD  817



>gb|KDP41742.1| hypothetical protein JCGZ_26760 [Jatropha curcas]
Length=819

 Score =  1241 bits (3212),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 651/816 (80%), Positives = 730/816 (89%), Gaps = 1/816 (0%)
 Frame = -2

Query  2765  GRGGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAA  2586
              RGGC PPMDLFRSE MQLVQLIIPIESA L+V+YLGDLGL+QFKDLNAEKSPFQRTYAA
Sbjct  4     ARGGCCPPMDLFRSEAMQLVQLIIPIESAHLTVSYLGDLGLLQFKDLNAEKSPFQRTYAA  63

Query  2585  QIKRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANND  2406
             QIK+ GEMARKLRFFK+QM KAG S S+ S TQ  I  D LE+KLG+LEAEL+E+NANND
Sbjct  64    QIKKCGEMARKLRFFKEQMEKAGFSPSSKSVTQTNIDMDGLELKLGELEAELVEMNANND  123

Query  2405  KLQRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSAD  2226
             KLQR++NEL+EYKLVLQK GEFF SA SSA AQQ+E  S Q GEESL+ PLL++ +MS D
Sbjct  124   KLQRTYNELIEYKLVLQKAGEFFSSALSSATAQQREMQSRQVGEESLDTPLLADKEMSTD  183

Query  2225  TSKQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFL  2046
             +SKQV+LGF++GLVPK KS+AFERI+FRATRGNV +RQ+ V+E V DP+SGEK EKNVF+
Sbjct  184   SSKQVKLGFLTGLVPKAKSLAFERIIFRATRGNVFIRQAAVEEPVTDPVSGEKTEKNVFV  243

Query  2045  VFYSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGN  1866
             VFYSGER K K+LKIC+AFGANRYPF E+LGK  Q+I EVSGK+SELKT  DAG+LHR N
Sbjct  244   VFYSGERIKAKLLKICEAFGANRYPFTEDLGKHNQMINEVSGKLSELKTTTDAGLLHRSN  303

Query  1865  LLQSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAG  1686
             LLQ+I++ F +WN LVR+EKSIYHTLNMLS+DVTKKCLVAEGWSP  A+ +IQ+ALQRA 
Sbjct  304   LLQTISDHFVQWNSLVRKEKSIYHTLNMLSLDVTKKCLVAEGWSPVFASKQIQEALQRAA  363

Query  1685  HDSNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPF  1506
              DSNS++G IF+VL T+ESPPTYF+TNKFTSAFQEIVDAYGVA+YQEANPGV+T+VTFPF
Sbjct  364   FDSNSQVGPIFQVLHTKESPPTYFRTNKFTSAFQEIVDAYGVARYQEANPGVYTVVTFPF  423

Query  1505  LFAVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGF  1326
             LFAVMFGDWGHGICLLLATL F+IREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTG 
Sbjct  424   LFAVMFGDWGHGICLLLATLVFIIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGL  483

Query  1325  IYNEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNS  1146
             IYNEFFSV FELFG SAY CRD SC DATT+GLIK   TY FGVDP WHGTRSELPFLNS
Sbjct  484   IYNEFFSVPFELFGHSAYACRDLSCRDATTVGLIKVGPTYPFGVDPVWHGTRSELPFLNS  543

Query  1145  LKMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKW  966
             LKMK+SILLGVAQMNLGIILS+FNA YFR+ VN W QFIPQ+IFLN+LFGYLS+LIIVKW
Sbjct  544   LKMKMSILLGVAQMNLGIILSFFNALYFRNNVNIWFQFIPQVIFLNSLFGYLSLLIIVKW  603

Query  965   CTGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKS  786
              TGSQADLYHVMIYMFL PT++LGENQLFPGQKT QL L+LLALVSVPWMLLPKPF+LK 
Sbjct  604   WTGSQADLYHVMIYMFLSPTDELGENQLFPGQKTAQLALLLLALVSVPWMLLPKPFVLKK  663

Query  785   QH-NRHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTA  609
             QH +RHQGQSY  +Q  +ESL VD +H S  HEEFEFSEVFVHQLIHTIEFVLGAVSNTA
Sbjct  664   QHQDRHQGQSYTLLQTTEESLQVDANHGSYGHEEFEFSEVFVHQLIHTIEFVLGAVSNTA  723

Query  608   SYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAF  429
             SYLRLWALSLAHSELS+VFYEKVLLLAWG+NN++IL+VG I+FIFATIGVLLVMETLSAF
Sbjct  724   SYLRLWALSLAHSELSSVFYEKVLLLAWGFNNVVILIVGIIVFIFATIGVLLVMETLSAF  783

Query  428   LHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             LHALRLHWVEFQNKFYEGDGYKF PFS  L+++E++
Sbjct  784   LHALRLHWVEFQNKFYEGDGYKFFPFSLALINDEDE  819



>ref|XP_002265086.1| PREDICTED: V-type proton ATPase subunit a3 [Vitis vinifera]
 ref|XP_010647686.1| PREDICTED: V-type proton ATPase subunit a3 [Vitis vinifera]
 emb|CBI38019.3| unnamed protein product [Vitis vinifera]
Length=822

 Score =  1241 bits (3210),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 648/812 (80%), Positives = 727/812 (90%), Gaps = 1/812 (0%)
 Frame = -2

Query  2753  CFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKR  2574
             C PPMDLFRSEPMQLVQLIIPIESA  +++YLGDLGLIQFKDLN EKSPFQRTYAAQIK+
Sbjct  11    CCPPMDLFRSEPMQLVQLIIPIESAHHTISYLGDLGLIQFKDLNVEKSPFQRTYAAQIKK  70

Query  2573  SGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQR  2394
               EMARKLRFFK+QMSKAG+S SA    +  I  DDLEVKLG+LEAEL+EINAN +KLQR
Sbjct  71    CAEMARKLRFFKEQMSKAGLSPSAKIMMRGDIDMDDLEVKLGELEAELVEINANGEKLQR  130

Query  2393  SFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTSKQ  2214
             +++EL EYKLVL K GEFF+S RSSA AQQ+E  +    EES++ PLL E +MS D SKQ
Sbjct  131   AYSELAEYKLVLHKAGEFFYSIRSSATAQQREIEAHSISEESVDTPLLLEQEMSTDLSKQ  190

Query  2213  VRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYS  2034
             V+LGF++GLVP+ KSMAFERILFRATRGNV LRQS V++ V DP+SGEK+EKNVF+VFYS
Sbjct  191   VKLGFLAGLVPRVKSMAFERILFRATRGNVFLRQSAVEDPVTDPVSGEKIEKNVFVVFYS  250

Query  2033  GERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQS  1854
             GE+ KNKILKIC+AFGANRY F E+LGKQAQ+ITEVSG++SELKT ID G+LHRGNLLQ+
Sbjct  251   GEKVKNKILKICEAFGANRYSFPEDLGKQAQMITEVSGRLSELKTTIDVGLLHRGNLLQT  310

Query  1853  IAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSN  1674
             I +QF++WN+LVR+EKSIYHTLNMLSIDVTKKCLVAEGWSPT AT +IQDALQRA  DSN
Sbjct  311   IGDQFEQWNLLVRKEKSIYHTLNMLSIDVTKKCLVAEGWSPTFATKQIQDALQRATFDSN  370

Query  1673  SEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAV  1494
             S++GAIF+VL T ESPPTYF+TNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAV
Sbjct  371   SQVGAIFQVLHTIESPPTYFRTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAV  430

Query  1493  MFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNE  1314
             MFGDWGHG+CLLLATL+F+IREKKLS+QKLGDITEMTFGGRYVILMMALFSIYTG IYNE
Sbjct  431   MFGDWGHGLCLLLATLFFIIREKKLSNQKLGDITEMTFGGRYVILMMALFSIYTGLIYNE  490

Query  1313  FFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMK  1134
             FFSV FELFG SAY CRD SC DA+T GLIK R TY FGVDP WHG+RSELPFLNSLKMK
Sbjct  491   FFSVPFELFGPSAYACRDLSCRDASTAGLIKVRRTYPFGVDPVWHGSRSELPFLNSLKMK  550

Query  1133  LSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGS  954
             +SIL+GVAQMNLGIILSYFNA +F++ +N W QF+PQ+IFLN+LFGYLSVLIIVKWCTGS
Sbjct  551   MSILIGVAQMNLGIILSYFNAKFFQNSLNIWFQFVPQMIFLNSLFGYLSVLIIVKWCTGS  610

Query  953   QADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQH-N  777
             QADLYH+MIYMFL PT+DLGENQLF GQKT Q+VL+LLALV+VPWMLLPKPF++K QH  
Sbjct  611   QADLYHIMIYMFLSPTDDLGENQLFIGQKTGQIVLLLLALVAVPWMLLPKPFLMKKQHEE  670

Query  776   RHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLR  597
             RHQ Q Y P+Q  ++S  +D SHDS DHEEFEF EVFVHQLIHTIEFVLGAVSNTASYLR
Sbjct  671   RHQSQLYVPLQSTEDSFQLDTSHDSHDHEEFEFGEVFVHQLIHTIEFVLGAVSNTASYLR  730

Query  596   LWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHAL  417
             LWALSLAHSELS+VFYEKVLLLAWG+NN+IIL+VG I+FI ATIGVLLVMETLSAFLHAL
Sbjct  731   LWALSLAHSELSSVFYEKVLLLAWGFNNVIILIVGIIVFICATIGVLLVMETLSAFLHAL  790

Query  416   RLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             RLHWVEFQNKFYEGDGYKF PFSF L+ EE+D
Sbjct  791   RLHWVEFQNKFYEGDGYKFCPFSFALLSEEDD  822



>ref|XP_010096180.1| Vacuolar proton translocating ATPase 100 kDa subunit [Morus notabilis]
 gb|EXB63575.1| Vacuolar proton translocating ATPase 100 kDa subunit [Morus notabilis]
Length=814

 Score =  1240 bits (3209),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 652/814 (80%), Positives = 731/814 (90%), Gaps = 2/814 (0%)
 Frame = -2

Query  2759  GGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQI  2580
             GGC PPMDLFRSEPMQLV+LIIPIES+ L+ +YLGDLGL+QFKDLNAEKSPFQRTYA QI
Sbjct  2     GGCCPPMDLFRSEPMQLVRLIIPIESSHLTASYLGDLGLLQFKDLNAEKSPFQRTYATQI  61

Query  2579  KRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKL  2400
             KR GE+ARKLRFFKDQM KAG S    S T+  I  DDLEVKLG+LEAELIE+NAN +KL
Sbjct  62    KRCGELARKLRFFKDQMLKAGFSPKL-STTRADISLDDLEVKLGELEAELIEMNANGEKL  120

Query  2399  QRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTS  2220
             QR++NEL EYKLVLQK GEFFHSA+SSA  Q +EYGS  +GEESL+ PLL + +MS D S
Sbjct  121   QRAYNELGEYKLVLQKAGEFFHSAQSSALEQHREYGSRLTGEESLDIPLLLDQEMSIDPS  180

Query  2219  KQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVF  2040
             KQV+LGF++GLVP+EKSMAFERILFRATRGN+ L+Q+ V++ V DP+S EKVEKNVFLVF
Sbjct  181   KQVKLGFLTGLVPREKSMAFERILFRATRGNIFLKQTVVEDPVTDPVSREKVEKNVFLVF  240

Query  2039  YSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLL  1860
             +SGERAKNKILKIC+AFGANRYPF+E+L KQAQ I EVS ++SELKT +DAG+LHRGNLL
Sbjct  241   FSGERAKNKILKICEAFGANRYPFSEDLNKQAQAINEVSARLSELKTTVDAGLLHRGNLL  300

Query  1859  QSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHD  1680
             Q+IAEQF+RWN+LVR+EK IYHTLNMLS+DVTKKCLVAEGWSP  AT +IQDALQRA  D
Sbjct  301   QTIAEQFERWNLLVRKEKYIYHTLNMLSLDVTKKCLVAEGWSPVFATKQIQDALQRAAID  360

Query  1679  SNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLF  1500
             SNS++GAIF+ L TRESPPTYF+TNKFTSAFQEIVDAYGVAKYQEANPGV+TIVTFPFLF
Sbjct  361   SNSQVGAIFQGLHTRESPPTYFRTNKFTSAFQEIVDAYGVAKYQEANPGVYTIVTFPFLF  420

Query  1499  AVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIY  1320
             AVMFGDWGHGICL LATLYF++REKKLS +KLGDITEMTFGGRYVILMM++FSIYTG IY
Sbjct  421   AVMFGDWGHGICLFLATLYFIVREKKLSVEKLGDITEMTFGGRYVILMMSIFSIYTGLIY  480

Query  1319  NEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLK  1140
             NEFFSV FELFGRSAY CRD SC DATT GL+K R TY FG+DP WHGTRSELPFLNSLK
Sbjct  481   NEFFSVPFELFGRSAYACRDISCRDATTEGLVKVRSTYPFGLDPVWHGTRSELPFLNSLK  540

Query  1139  MKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCT  960
             MK+SILLGVAQMNLGIILSYFNA YF + +N W QF+PQ+IFLN+LFGYLSVLI+VKWCT
Sbjct  541   MKMSILLGVAQMNLGIILSYFNAKYFGNNINIWFQFLPQLIFLNSLFGYLSVLILVKWCT  600

Query  959   GSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQ-  783
             GSQ DLYHVMIYMFLGPT+DLGENQLF GQKT QLVL+ LAL+SVPWMLLPKPF+LK Q 
Sbjct  601   GSQVDLYHVMIYMFLGPTDDLGENQLFAGQKTVQLVLLFLALISVPWMLLPKPFLLKKQC  660

Query  782   HNRHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASY  603
              N HQGQSY  I+  +ESL V+ +HDS +HEEF+FSEVFVHQLIHTIEFVLGAVSNTASY
Sbjct  661   ENMHQGQSYTLIEGTEESLQVESNHDSHNHEEFDFSEVFVHQLIHTIEFVLGAVSNTASY  720

Query  602   LRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLH  423
             LRLWALSLAHSELS+VFY+KVLLLAWGYNN+IILVVG I+FIFATIGVLLVMETLSAFLH
Sbjct  721   LRLWALSLAHSELSSVFYDKVLLLAWGYNNVIILVVGIIVFIFATIGVLLVMETLSAFLH  780

Query  422   ALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             ALRLHWVEFQNKFYEGDGYKF PFSF + D+++D
Sbjct  781   ALRLHWVEFQNKFYEGDGYKFHPFSFAVTDDDDD  814



>ref|XP_010934090.1| PREDICTED: V-type proton ATPase subunit a3-like [Elaeis guineensis]
Length=819

 Score =  1238 bits (3203),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 638/817 (78%), Positives = 731/817 (89%), Gaps = 1/817 (0%)
 Frame = -2

Query  2768  GGRGGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYA  2589
             GG  GC PPMDL RSEPMQLVQ+I+PIESA L+V+YLGDLGL+QFKDLNA+KSPFQRTYA
Sbjct  3     GGGHGCCPPMDLMRSEPMQLVQIIVPIESAHLTVSYLGDLGLLQFKDLNADKSPFQRTYA  62

Query  2588  AQIKRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANN  2409
              QIKR GEMARKLRFF++QM+KAG+S SA S TQ  I  DDLE+KLG+LEAELIE+N N+
Sbjct  63    NQIKRCGEMARKLRFFREQMTKAGISPSAMSLTQTHIDLDDLEIKLGELEAELIEVNTNS  122

Query  2408  DKLQRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSA  2229
             +KLQR++NEL+EYKLVLQK GEFF++A+SSA AQQ+E  + Q  + SL++PLL E +  A
Sbjct  123   EKLQRTYNELLEYKLVLQKAGEFFYAAQSSATAQQREIEAQQVFDGSLDSPLLLEQESLA  182

Query  2228  DTSKQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVF  2049
             D SKQV+LGF+SGLVPKEKSMAFERILFRATRGN+ L+Q  V++ V DP+SGEKV KNVF
Sbjct  183   DPSKQVKLGFVSGLVPKEKSMAFERILFRATRGNMYLKQVAVEDPVTDPVSGEKVAKNVF  242

Query  2048  LVFYSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRG  1869
             +VFYSGERAK KILKIC+AFGANRYPF E++GKQ Q+I EVSGKISELKT ID G++HR 
Sbjct  243   VVFYSGERAKTKILKICEAFGANRYPFTEDVGKQMQMIDEVSGKISELKTTIDVGLIHRD  302

Query  1868  NLLQSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRA  1689
             N+L++I  QF++WN LVRREKSIYHTLNMLS+DVTKKC+VAEGWSP  AT ++QDAL+RA
Sbjct  303   NILKNIGHQFEQWNHLVRREKSIYHTLNMLSLDVTKKCVVAEGWSPVFATSQVQDALKRA  362

Query  1688  GHDSNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFP  1509
              +DSNS++G+IF+VL T+ESPPTYF+TNKFTSAFQEIVDAYGVAKYQEANPGV+TI+TFP
Sbjct  363   TYDSNSQVGSIFQVLYTKESPPTYFQTNKFTSAFQEIVDAYGVAKYQEANPGVYTIITFP  422

Query  1508  FLFAVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTG  1329
             FLFAVMFGDWGHGICLLL T+YF+ REKKLSSQKLGDITEMTFGGRYVI+MM LFSIY G
Sbjct  423   FLFAVMFGDWGHGICLLLVTMYFIFREKKLSSQKLGDITEMTFGGRYVIMMMGLFSIYAG  482

Query  1328  FIYNEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLN  1149
              IYNEFFSV FELFG+SAY CRDPSCS+ATT+GLIK R TY FGVDP W+G+RSELPFLN
Sbjct  483   LIYNEFFSVPFELFGKSAYACRDPSCSNATTVGLIKVRSTYPFGVDPKWYGSRSELPFLN  542

Query  1148  SLKMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVK  969
             SLKMK+SILLGVAQMNLGI+LSYFNA +F++ +N W QF+PQ+IFLN+LFGYLS+LIIVK
Sbjct  543   SLKMKMSILLGVAQMNLGIVLSYFNAKFFKNNLNIWYQFVPQLIFLNSLFGYLSLLIIVK  602

Query  968   WCTGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILK  789
             WCTGS+ADLYHVMIYMFL PT+DLGENQLFPGQKT QLVL+ LAL+SVPWML PKP +LK
Sbjct  603   WCTGSKADLYHVMIYMFLSPTDDLGENQLFPGQKTLQLVLLFLALISVPWMLFPKPILLK  662

Query  788   SQHN-RHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNT  612
              QH  RHQGQSY  +Q  +ESL ++  H S  HEEFEFSEVFVHQLIHTIEFVLGAVSNT
Sbjct  663   KQHQERHQGQSYTLLQSTEESLELEQDHSSHGHEEFEFSEVFVHQLIHTIEFVLGAVSNT  722

Query  611   ASYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSA  432
             ASYLRLWALSLAHSELSTVFYEKVLLLAWG+NNIIIL+VGFI+F+FAT+GVLLVMETLSA
Sbjct  723   ASYLRLWALSLAHSELSTVFYEKVLLLAWGFNNIIILIVGFIVFVFATVGVLLVMETLSA  782

Query  431   FLHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             FLHALRLHWVEFQNKFYEGDGYKF PFSF L+ E ED
Sbjct  783   FLHALRLHWVEFQNKFYEGDGYKFSPFSFALLGEVED  819



>ref|XP_008783594.1| PREDICTED: vacuolar proton ATPase a3-like [Phoenix dactylifera]
Length=826

 Score =  1232 bits (3188),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 638/810 (79%), Positives = 729/810 (90%), Gaps = 1/810 (0%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             PPMDL RSEPMQLVQ+IIPIESA L+V+YLGDLGL+QFKDLNA+KSPFQRTYA QIKR G
Sbjct  17    PPMDLLRSEPMQLVQIIIPIESAHLTVSYLGDLGLLQFKDLNADKSPFQRTYANQIKRCG  76

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EMARKLRFF++QM+KAG+S SA S TQ  I  DDLE+KLG+LEAELIE+N N++KLQR++
Sbjct  77    EMARKLRFFREQMTKAGISPSAMSLTQTHIDLDDLEIKLGELEAELIEVNTNSEKLQRTY  136

Query  2387  NELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTSKQVR  2208
             NEL+EYKLVLQK GEFF+S +SSA AQQ+E  + Q  + SL++PLL E ++ AD SKQV+
Sbjct  137   NELLEYKLVLQKAGEFFYSVQSSAIAQQREIEAHQVFDGSLDSPLLLEQEILADPSKQVK  196

Query  2207  LGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSGE  2028
             LGF+SGLVPKEKSMAFERILFRATRGN+ L+Q  VD+ V DP+SGEKV KNVF+VFYSGE
Sbjct  197   LGFVSGLVPKEKSMAFERILFRATRGNMYLKQVAVDDPVTDPVSGEKVAKNVFVVFYSGE  256

Query  2027  RAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSIA  1848
             RAK KILKIC+AFGANRYP  E++GKQ Q+I EVSGKISELKT ID G++ R N+L++I 
Sbjct  257   RAKTKILKICEAFGANRYPLTEDVGKQMQMIDEVSGKISELKTTIDIGLIQRDNMLKNIG  316

Query  1847  EQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNSE  1668
              QF++WN +VRREKSIYHTLNMLS+DVTKKC+VAEGWSP  AT ++QDAL+RA +DSNS+
Sbjct  317   YQFEQWNQMVRREKSIYHTLNMLSLDVTKKCVVAEGWSPVFATNQVQDALKRATYDSNSQ  376

Query  1667  IGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMF  1488
             +G+IF++L T+ESPPTYF+TNKFT AFQEIVDAYGVAKYQEANPGV+TI+TFPFLFAVMF
Sbjct  377   VGSIFQILHTKESPPTYFQTNKFTLAFQEIVDAYGVAKYQEANPGVYTIITFPFLFAVMF  436

Query  1487  GDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEFF  1308
             GDWGHGICLLLATLYF+ REKKLSSQKLGDITEMTFGGRYV++MMA+FSIYTG IYNEFF
Sbjct  437   GDWGHGICLLLATLYFIFREKKLSSQKLGDITEMTFGGRYVLMMMAMFSIYTGLIYNEFF  496

Query  1307  SVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKLS  1128
             SV FELFG+SAY CRDPSC DAT+ GLIK R TY FGVDP WHG+RSELPFLNSLKMKLS
Sbjct  497   SVPFELFGKSAYACRDPSCRDATSEGLIKVRSTYPFGVDPKWHGSRSELPFLNSLKMKLS  556

Query  1127  ILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQA  948
             ILLGVAQMNLGI+LSYFNA +FR+ +N W QF+PQ+IFLN+LFGYLS+LIIVKWCTGS+A
Sbjct  557   ILLGVAQMNLGIVLSYFNAKFFRNNLNIWYQFVPQLIFLNSLFGYLSLLIIVKWCTGSKA  616

Query  947   DLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQHN-RH  771
             DLYHVMIYMFL PT+DLGENQLFPGQKT QLVL+LLAL+SVPWMLLPKP +LK QH  RH
Sbjct  617   DLYHVMIYMFLSPTDDLGENQLFPGQKTLQLVLLLLALISVPWMLLPKPILLKKQHQERH  676

Query  770   QGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLRLW  591
             QGQSYA +Q+ +ESL ++  H S  HEEFEFSEVFVHQLIHTIEFVLGAVSNTASYLRLW
Sbjct  677   QGQSYALLQNTEESLELEQDHSSHGHEEFEFSEVFVHQLIHTIEFVLGAVSNTASYLRLW  736

Query  590   ALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHALRL  411
             ALSLAHSELS+VFYEKVLLLAWG+NNIIIL+VG I+FIFATIGVLLVMETLSAFLHALRL
Sbjct  737   ALSLAHSELSSVFYEKVLLLAWGFNNIIILIVGIIVFIFATIGVLLVMETLSAFLHALRL  796

Query  410   HWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             HWVEFQNKFYEGDGYKF PFSF L+ E+ED
Sbjct  797   HWVEFQNKFYEGDGYKFSPFSFALLGEDED  826



>ref|XP_006487336.1| PREDICTED: vacuolar proton ATPase a3-like [Citrus sinensis]
Length=823

 Score =  1231 bits (3185),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 650/808 (80%), Positives = 732/808 (91%), Gaps = 1/808 (0%)
 Frame = -2

Query  2741  MDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSGEM  2562
             MDLFRSEPMQLVQ+IIPIESA L+V+YLG+LGL+QFKDLN+EKSPFQRTYAAQIK+  EM
Sbjct  16    MDLFRSEPMQLVQIIIPIESAHLTVSYLGELGLLQFKDLNSEKSPFQRTYAAQIKKCAEM  75

Query  2561  ARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSFNE  2382
             ARKLRFFK+QM KAG+ +S  S T+     DDLEVKLGDLEAEL+EINAN DKLQR+ +E
Sbjct  76    ARKLRFFKEQMLKAGILSSVKSTTRADNNTDDLEVKLGDLEAELVEINANGDKLQRAHSE  135

Query  2381  LVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTSKQVRLG  2202
             LVEYKLVLQK GEFF SA +SA AQQ+E  S Q+GE ++E PLL++ +MSAD SKQ++LG
Sbjct  136   LVEYKLVLQKAGEFFSSALTSAAAQQREMESQQTGEMTIETPLLTDKEMSADPSKQIKLG  195

Query  2201  FISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSGERA  2022
             FI+GLVP+EKSM+FER+LFRATRGNV LRQ+ VDE V+DP+SGEK+EKNVF+VFYSGERA
Sbjct  196   FIAGLVPREKSMSFERMLFRATRGNVFLRQAVVDEPVVDPVSGEKMEKNVFVVFYSGERA  255

Query  2021  KNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSIAEQ  1842
             KNKILKICDAFGANRYPF EE  KQAQ I+EVSG++SELKT IDAG+LHRGNLLQ+I +Q
Sbjct  256   KNKILKICDAFGANRYPFNEEFDKQAQAISEVSGRLSELKTTIDAGLLHRGNLLQTIGDQ  315

Query  1841  FDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNSEIG  1662
             F++WN+LV++EKSIYHTLNMLS+DVTKKCLV EGWSP  AT +IQDAL+RA  DSNS++G
Sbjct  316   FEQWNLLVKKEKSIYHTLNMLSLDVTKKCLVGEGWSPVFATKQIQDALERAAFDSNSQVG  375

Query  1661  AIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGD  1482
             AIF+VL T+ESPPTYF+TNKFTSAFQEIVDAYGVAKY+EANPGVFTIVTFPFLFAVMFGD
Sbjct  376   AIFQVLHTKESPPTYFRTNKFTSAFQEIVDAYGVAKYREANPGVFTIVTFPFLFAVMFGD  435

Query  1481  WGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEFFSV  1302
             WGHGICLLL TL  ++REKKL+SQKL DIT+MTFGGRYVILMMALFSIYTG IYNEFFSV
Sbjct  436   WGHGICLLLGTLVLIVREKKLASQKLDDITDMTFGGRYVILMMALFSIYTGLIYNEFFSV  495

Query  1301  QFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKLSIL  1122
              FE+F  SAY CRD SCS+ATT+GLIK RDTY FGVDP WHG+RSELPFLNSLKMK+SIL
Sbjct  496   PFEIFSHSAYACRDLSCSEATTVGLIKVRDTYPFGVDPVWHGSRSELPFLNSLKMKMSIL  555

Query  1121  LGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQADL  942
             LGVAQMNLGIILSYFNA +FR GVN WCQFIPQIIFLN+LFGYLS+LII+KW TGSQADL
Sbjct  556   LGVAQMNLGIILSYFNATFFRIGVNIWCQFIPQIIFLNSLFGYLSLLIILKWITGSQADL  615

Query  941   YHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQHN-RHQG  765
             YHVMIYMFL PT++LG+NQLFPGQKT QLVL+LLA VSVPWMLLPKPFILK QH  RHQG
Sbjct  616   YHVMIYMFLSPTDELGDNQLFPGQKTAQLVLLLLAFVSVPWMLLPKPFILKMQHQGRHQG  675

Query  764   QSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLRLWAL  585
             QSY P+Q  DESL  D +HDS  HEEFEFSEVFVHQ+IHTIEFVLGAVSNTASYLRLWAL
Sbjct  676   QSYEPLQSTDESLQPDTNHDSHGHEEFEFSEVFVHQMIHTIEFVLGAVSNTASYLRLWAL  735

Query  584   SLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHALRLHW  405
             SLAHSELS+VFYEKVLLLAWGYNNI+IL+VG I+FIFAT+GVLLVMETLSAFLHALRLHW
Sbjct  736   SLAHSELSSVFYEKVLLLAWGYNNILILIVGIIVFIFATVGVLLVMETLSAFLHALRLHW  795

Query  404   VEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             VEFQNKFYEGDGYKF PFSF L+D+E++
Sbjct  796   VEFQNKFYEGDGYKFSPFSFALLDDEDE  823



>ref|XP_010437006.1| PREDICTED: V-type proton ATPase subunit a3-like [Camelina sativa]
Length=821

 Score =  1229 bits (3181),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 631/817 (77%), Positives = 719/817 (88%), Gaps = 3/817 (0%)
 Frame = -2

Query  2762  RGGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQ  2583
              GGC PPMDL RSE MQLVQLI+P+ESA L+V+YLGDLGL+QFKDLN+EKSPFQRTYAAQ
Sbjct  5     HGGCCPPMDLMRSETMQLVQLIVPMESAHLTVSYLGDLGLVQFKDLNSEKSPFQRTYAAQ  64

Query  2582  IKRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDK  2403
             IKR GEMARK+RFFKDQMSKAGV    + + +  I  DD+EVKLG+LEAEL+EINANNDK
Sbjct  65    IKRCGEMARKIRFFKDQMSKAGVLPKESLEKESDIDLDDVEVKLGELEAELVEINANNDK  124

Query  2402  LQRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgee--sleapllsePDMSA  2229
             LQRS+NEL+EYKLVLQK GEFF SA  SA AQQ+E  S  S +    L    L + + S 
Sbjct  125   LQRSYNELMEYKLVLQKAGEFFSSAHRSATAQQREIESEDSQQAGDDLLESPLLQEEKSI  184

Query  2228  DTSKQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVF  2049
             D+SKQV+LGF++GLVP+EKSM FERILFRATRGN+ +RQ+ ++E VIDP SGEK EKNVF
Sbjct  185   DSSKQVKLGFLTGLVPREKSMVFERILFRATRGNIFIRQTVIEEPVIDPSSGEKAEKNVF  244

Query  2048  LVFYSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRG  1869
             +VFYSGERAK+KILKIC+AFGANRYPF+E+LGKQAQ+ITEVSG+ISELKT IDAG+ HR 
Sbjct  245   VVFYSGERAKSKILKICEAFGANRYPFSEDLGKQAQMITEVSGRISELKTTIDAGLGHRD  304

Query  1868  NLLQSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRA  1689
              LLQ+I ++F+ WN  VR+EK+IYHTLNMLS+DVTKKCLVAEGWSP  A+ EIQDALQRA
Sbjct  305   ILLQTIGDKFELWNHKVRKEKAIYHTLNMLSLDVTKKCLVAEGWSPVFASNEIQDALQRA  364

Query  1688  GHDSNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFP  1509
               DSNS++G+IF+VL T+ESPPTYF+TNKFTSA QEIVDAYGVAKYQEANPGVFTIVTFP
Sbjct  365   AVDSNSQVGSIFQVLRTKESPPTYFRTNKFTSAIQEIVDAYGVAKYQEANPGVFTIVTFP  424

Query  1508  FLFAVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTG  1329
             FLFAVMFGDWGHGIC+LLAT+Y ++REKKLSSQKLGDI EM FGGRYVILMM+LFSIYTG
Sbjct  425   FLFAVMFGDWGHGICILLATMYLILREKKLSSQKLGDIMEMAFGGRYVILMMSLFSIYTG  484

Query  1328  FIYNEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLN  1149
              IYNEFFS+ + LF  SAY CRD SCS+ATTIGLIK RDTY FG+DP WHGTRSELPFLN
Sbjct  485   LIYNEFFSIPYPLFAPSAYDCRDASCSEATTIGLIKVRDTYPFGLDPVWHGTRSELPFLN  544

Query  1148  SLKMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVK  969
             SLKMK+SILLGV+QMNLGII+SYFNA +F+S VN W QFIPQ+IFLN+LFGYLSVLII+K
Sbjct  545   SLKMKMSILLGVSQMNLGIIMSYFNARFFKSSVNIWFQFIPQMIFLNSLFGYLSVLIIIK  604

Query  968   WCTGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILK  789
             WCTGSQADLYHVMIYMFL PT++LGENQLFP QKT QLVL+ LALVSVP MLLPKPFILK
Sbjct  605   WCTGSQADLYHVMIYMFLSPTDELGENQLFPHQKTVQLVLLFLALVSVPCMLLPKPFILK  664

Query  788   SQHN-RHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNT  612
              QH  RHQGQSYAP+ + DESL V+ +  S  HEEFEFSE+FVHQLIHTIEFVLGAVSNT
Sbjct  665   KQHEARHQGQSYAPLDETDESLHVETTGGSHGHEEFEFSEIFVHQLIHTIEFVLGAVSNT  724

Query  611   ASYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSA  432
             ASYLRLWALSLAHSELS+VFYEKVLLLAWGYNN++IL++G ++FIFAT+GVLLVMETLSA
Sbjct  725   ASYLRLWALSLAHSELSSVFYEKVLLLAWGYNNVLILILGIMVFIFATVGVLLVMETLSA  784

Query  431   FLHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             FLHALRLHWVEFQNKFYEGDGYKF PF+F+    E++
Sbjct  785   FLHALRLHWVEFQNKFYEGDGYKFAPFTFIFTANEDE  821



>ref|XP_006423404.1| hypothetical protein CICLE_v10027828mg [Citrus clementina]
 gb|ESR36644.1| hypothetical protein CICLE_v10027828mg [Citrus clementina]
Length=823

 Score =  1229 bits (3180),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 649/808 (80%), Positives = 732/808 (91%), Gaps = 1/808 (0%)
 Frame = -2

Query  2741  MDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSGEM  2562
             MDLFRSEPMQLVQ+IIPIESA L+V+YLG+LGL+QFKDLN+EKSPFQRTYAAQIK+  EM
Sbjct  16    MDLFRSEPMQLVQIIIPIESAHLTVSYLGELGLLQFKDLNSEKSPFQRTYAAQIKKCAEM  75

Query  2561  ARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSFNE  2382
             ARKLRFFK+QM KAG+ +S  S T+     DDLEVKLGDLEAEL+EINAN DKLQR+ +E
Sbjct  76    ARKLRFFKEQMLKAGILSSVKSTTRADNNTDDLEVKLGDLEAELVEINANGDKLQRAHSE  135

Query  2381  LVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTSKQVRLG  2202
             LVEYKLVLQK GEFF SA +SA AQQ+E  S Q+GE ++E PLL++ +MSAD SKQ++LG
Sbjct  136   LVEYKLVLQKAGEFFSSALTSAAAQQREMESQQTGEMTIETPLLTDKEMSADPSKQIKLG  195

Query  2201  FISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSGERA  2022
             FI+GLVP+EKSM+FER+LFRATRGNV LRQ+ VDE V+DP+SGEK+EKNVF+VFYSGERA
Sbjct  196   FIAGLVPREKSMSFERMLFRATRGNVFLRQAVVDEPVVDPVSGEKMEKNVFVVFYSGERA  255

Query  2021  KNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSIAEQ  1842
             KNKILKICDAFGANRYPF EE  KQAQ I+EVSG++SELKT +DAG+LHRGNLLQ+I +Q
Sbjct  256   KNKILKICDAFGANRYPFNEEFDKQAQAISEVSGRLSELKTTLDAGLLHRGNLLQTIGDQ  315

Query  1841  FDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNSEIG  1662
             F++WN+LV+REKSIYHTLNMLS+DVTKKCLV EGWSP  AT +IQDAL+RA  DSNS++G
Sbjct  316   FEQWNLLVKREKSIYHTLNMLSLDVTKKCLVGEGWSPVFATKQIQDALERAAFDSNSQVG  375

Query  1661  AIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGD  1482
             AIF+VL T+ESPPTYF+TNKFTSAFQEIVDAYGVAKY+EANPGVFTIVTFPFLFAVMFGD
Sbjct  376   AIFQVLHTKESPPTYFRTNKFTSAFQEIVDAYGVAKYREANPGVFTIVTFPFLFAVMFGD  435

Query  1481  WGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEFFSV  1302
             WGHGICLLL TL  ++REKKL+SQKL DIT+MTFGGRYVILMMALFSIYTG IYNEFFSV
Sbjct  436   WGHGICLLLGTLVLIVREKKLASQKLDDITDMTFGGRYVILMMALFSIYTGLIYNEFFSV  495

Query  1301  QFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKLSIL  1122
              FE+F  SAY CRD SCS+ATT+GLIK RDTY FGVDP WHG+RSELPFLNSLKMK+SIL
Sbjct  496   PFEIFSHSAYACRDLSCSEATTVGLIKVRDTYPFGVDPVWHGSRSELPFLNSLKMKMSIL  555

Query  1121  LGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQADL  942
             LGVAQMNLGIILSYFNA +FR GVN WCQFIPQIIFLN+LFGYLS+LII+KW TGSQADL
Sbjct  556   LGVAQMNLGIILSYFNATFFRIGVNIWCQFIPQIIFLNSLFGYLSLLIILKWITGSQADL  615

Query  941   YHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQH-NRHQG  765
             YHVMIYMFL PT++LG+NQLFPGQKT QLVL+LLA VSVPWMLLPKPFILK QH +RHQG
Sbjct  616   YHVMIYMFLSPTDELGDNQLFPGQKTAQLVLLLLAFVSVPWMLLPKPFILKMQHQDRHQG  675

Query  764   QSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLRLWAL  585
             QSY  +Q  DESL  D +HDS  HEEFEFSEVFVHQ+IHTIEFVLGAVSNTASYLRLWAL
Sbjct  676   QSYEALQSTDESLQPDTNHDSHGHEEFEFSEVFVHQMIHTIEFVLGAVSNTASYLRLWAL  735

Query  584   SLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHALRLHW  405
             SLAHSELS+VFYEKVLLLAWGYNNI+IL+VG I+FIFAT+GVLLVMETLSAFLHALRLHW
Sbjct  736   SLAHSELSSVFYEKVLLLAWGYNNILILIVGIIVFIFATVGVLLVMETLSAFLHALRLHW  795

Query  404   VEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             VEFQNKFYEGDGYKF PFSF L+D+E++
Sbjct  796   VEFQNKFYEGDGYKFSPFSFALLDDEDE  823



>ref|XP_010431861.1| PREDICTED: V-type proton ATPase subunit a3-like [Camelina sativa]
Length=822

 Score =  1228 bits (3178),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 633/824 (77%), Positives = 722/824 (88%), Gaps = 5/824 (1%)
 Frame = -2

Query  2783  MAERLGGRGGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPF  2604
             M E  GG  GC PPMDL RSE MQLVQLI+P+ESA L+V+YLGDLGL+QFKDLN+EKSPF
Sbjct  1     MGESRGG--GCCPPMDLMRSETMQLVQLIVPMESAHLTVSYLGDLGLVQFKDLNSEKSPF  58

Query  2603  QRTYAAQIKRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIE  2424
             QRTYAAQIKR GEMARK+RFFKDQMSKAGV      + +  I  DD+EVKLG+LEAEL+E
Sbjct  59    QRTYAAQIKRCGEMARKIRFFKDQMSKAGVIPKELLEKESDIDLDDVEVKLGELEAELVE  118

Query  2423  INANNDKLQRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgee--sleapll  2250
             INANNDKLQRS+NEL+EYKLVLQK GEFF SA  SA AQQ+E  S  S +    L    L
Sbjct  119   INANNDKLQRSYNELMEYKLVLQKAGEFFSSAHRSATAQQREIESEDSQQAGDDLLESPL  178

Query  2249  sePDMSADTSKQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGE  2070
              + + S D+SKQV+LGF++GLVP+EKSM FERILFRATRGN+ +RQ+ ++E VIDP SGE
Sbjct  179   LQEEKSIDSSKQVKLGFLTGLVPREKSMVFERILFRATRGNIFIRQTVIEEPVIDPSSGE  238

Query  2069  KVEKNVFLVFYSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAID  1890
             K EKNVF+VFYSGERAK+KILKIC+AFGANRYPF+E+LGKQAQ+ITEVSG++SELKT ID
Sbjct  239   KAEKNVFVVFYSGERAKSKILKICEAFGANRYPFSEDLGKQAQMITEVSGRLSELKTTID  298

Query  1889  AGILHRGNLLQSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEI  1710
             AG+ HR  LLQ+I ++F+ WN+ VR+EK+IYHTLNMLS+DVTKKCLVAEGWSP  A+ EI
Sbjct  299   AGLGHRDILLQTIGDKFELWNLKVRKEKAIYHTLNMLSLDVTKKCLVAEGWSPVFASNEI  358

Query  1709  QDALQRAGHDSNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGV  1530
             QDALQRA  DSNS++G+IF+VL T+ESPPTYF+TNKFTSA QEIVDAYGVAKYQEANPGV
Sbjct  359   QDALQRAAFDSNSQVGSIFQVLRTKESPPTYFRTNKFTSAIQEIVDAYGVAKYQEANPGV  418

Query  1529  FTIVTFPFLFAVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMA  1350
             FTIVTFPFLFAVMFGDWGHGIC+LLAT+Y ++REKKLSSQKLGDI EM FGGRYVILMM+
Sbjct  419   FTIVTFPFLFAVMFGDWGHGICILLATMYLILREKKLSSQKLGDIMEMAFGGRYVILMMS  478

Query  1349  LFSIYTGFIYNEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTR  1170
             LFSIYTG IYNEFFS+ + LF  SAY CRD SCS+ATTIGLIK RDTY FG+DP WHGTR
Sbjct  479   LFSIYTGLIYNEFFSIPYPLFAPSAYDCRDASCSEATTIGLIKVRDTYPFGLDPVWHGTR  538

Query  1169  SELPFLNSLKMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYL  990
             SELPFLNSLKMK+SILLGV+QMNLGII+SYFNA +F+S VN W QFIPQ+IFLN+LFGYL
Sbjct  539   SELPFLNSLKMKMSILLGVSQMNLGIIMSYFNARFFKSSVNIWFQFIPQMIFLNSLFGYL  598

Query  989   SVLIIVKWCTGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLL  810
             SVLII+KWCTGSQADLYHVMIYMFL PT++LGENQLFP QKT QLVL+ LALVSVP MLL
Sbjct  599   SVLIIIKWCTGSQADLYHVMIYMFLSPTDELGENQLFPHQKTVQLVLLFLALVSVPCMLL  658

Query  809   PKPFILKSQHN-RHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFV  633
             PKPFILK QH  RHQGQSYAP+ + DESL V+ +  S  HEEFEFSE+FVHQLIHTIEFV
Sbjct  659   PKPFILKKQHEARHQGQSYAPLDETDESLHVETTGGSHGHEEFEFSEIFVHQLIHTIEFV  718

Query  632   LGAVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLL  453
             LGAVSNTASYLRLWALSLAHSELS+VFYEKVLLLAWGYNN++IL++G ++FIFAT+GVLL
Sbjct  719   LGAVSNTASYLRLWALSLAHSELSSVFYEKVLLLAWGYNNVLILILGIMVFIFATVGVLL  778

Query  452   VMETLSAFLHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             VMETLSAFLHALRLHWVEFQNKFYEGDGYKF PF+F+    E++
Sbjct  779   VMETLSAFLHALRLHWVEFQNKFYEGDGYKFAPFTFIFTANEDE  822



>gb|KDO49485.1| hypothetical protein CISIN_1g003392mg [Citrus sinensis]
Length=823

 Score =  1227 bits (3175),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 648/808 (80%), Positives = 732/808 (91%), Gaps = 1/808 (0%)
 Frame = -2

Query  2741  MDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSGEM  2562
             MDLFRSEPMQLVQ+IIPIESA L+V+YLG+LGL+QFKDLN+EKSPFQRTYAAQIK+  EM
Sbjct  16    MDLFRSEPMQLVQIIIPIESAHLTVSYLGELGLLQFKDLNSEKSPFQRTYAAQIKKCAEM  75

Query  2561  ARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSFNE  2382
             ARKLRFFK+QM KAG+ +S  S T+     DDLEVKLGDLEAEL+EINAN DKLQR+ +E
Sbjct  76    ARKLRFFKEQMLKAGILSSVKSTTRADNNTDDLEVKLGDLEAELVEINANGDKLQRAHSE  135

Query  2381  LVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTSKQVRLG  2202
             LVEYKLVLQK GEFF SA +SA AQQ+E  S Q+GE ++E PLL++ +MSAD SKQ++LG
Sbjct  136   LVEYKLVLQKAGEFFSSALTSAAAQQREMESQQTGEMTIETPLLTDKEMSADPSKQIKLG  195

Query  2201  FISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSGERA  2022
             FI+GLVP+EKSM+FER+LFRATRGNV LRQ+ VDE V+DP+SGEK+EKNVF+VFYSGERA
Sbjct  196   FIAGLVPREKSMSFERMLFRATRGNVFLRQAVVDEPVVDPVSGEKMEKNVFVVFYSGERA  255

Query  2021  KNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSIAEQ  1842
             KNKILKICDAFGANRYPF EE  KQAQ I+EVSG++SELKT +DAG+LHRGNLLQ+I +Q
Sbjct  256   KNKILKICDAFGANRYPFNEEFDKQAQAISEVSGRLSELKTTLDAGLLHRGNLLQTIGDQ  315

Query  1841  FDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNSEIG  1662
             F++WN+LV++EKSIYHTLNMLS+DVTKKCLV EGWSP  AT +IQDAL+RA  DSNS++G
Sbjct  316   FEQWNLLVKKEKSIYHTLNMLSLDVTKKCLVGEGWSPVFATKQIQDALERAAFDSNSQVG  375

Query  1661  AIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGD  1482
             AIF+VL T+ESPPTYF+TNKFTSAFQEIVDAYGVAKY+EANPGVFTIVTFPFLFAVMFGD
Sbjct  376   AIFQVLHTKESPPTYFRTNKFTSAFQEIVDAYGVAKYREANPGVFTIVTFPFLFAVMFGD  435

Query  1481  WGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEFFSV  1302
             WGHGICLLL TL  ++REKKL+SQKL DIT+MTFGGRYVILMMALFSIYTG IYNEFFSV
Sbjct  436   WGHGICLLLGTLVLIVREKKLASQKLDDITDMTFGGRYVILMMALFSIYTGLIYNEFFSV  495

Query  1301  QFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKLSIL  1122
              FE+F  SAY CRD SCS+ATT+GLIK RDTY FGVDP WHG+RSELPFLNSLKMK+SIL
Sbjct  496   PFEIFSHSAYACRDLSCSEATTVGLIKVRDTYPFGVDPVWHGSRSELPFLNSLKMKMSIL  555

Query  1121  LGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQADL  942
             LGVAQMNLGIILSYFNA +FR GVN WCQFIPQIIFLN+LFGYLS+LII+KW TGSQADL
Sbjct  556   LGVAQMNLGIILSYFNATFFRIGVNIWCQFIPQIIFLNSLFGYLSLLIILKWITGSQADL  615

Query  941   YHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQH-NRHQG  765
             YHVMIYMFL PT++LG+NQLFPGQKT QLVL+LLA VSVPWMLLPKPFILK QH +RHQG
Sbjct  616   YHVMIYMFLSPTDELGDNQLFPGQKTAQLVLLLLAFVSVPWMLLPKPFILKMQHQDRHQG  675

Query  764   QSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLRLWAL  585
             QSY  +Q  DESL  D +HDS  HEEFEFSEVFVHQ+IHTIEFVLGAVSNTASYLRLWAL
Sbjct  676   QSYEALQSTDESLQPDTNHDSHGHEEFEFSEVFVHQMIHTIEFVLGAVSNTASYLRLWAL  735

Query  584   SLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHALRLHW  405
             SLAHSELS+VFYEKVLLLAWGYNNI+IL+VG I+FIFAT+GVLLVMETLSAFLHALRLHW
Sbjct  736   SLAHSELSSVFYEKVLLLAWGYNNILILIVGIIVFIFATVGVLLVMETLSAFLHALRLHW  795

Query  404   VEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             VEFQNKFYEGDGYKF PFSF L+D+E++
Sbjct  796   VEFQNKFYEGDGYKFSPFSFALLDDEDE  823



>ref|XP_006411705.1| hypothetical protein EUTSA_v10024425mg [Eutrema salsugineum]
 gb|ESQ53158.1| hypothetical protein EUTSA_v10024425mg [Eutrema salsugineum]
Length=819

 Score =  1227 bits (3174),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 635/816 (78%), Positives = 726/816 (89%), Gaps = 2/816 (0%)
 Frame = -2

Query  2765  GRGGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAA  2586
             G GGC PPMDL RSEPMQLVQLI+P+ESA L+V+YLGDLGL+QFKDLN++KSPFQRTYAA
Sbjct  5     GGGGCCPPMDLMRSEPMQLVQLIVPMESAHLTVSYLGDLGLVQFKDLNSDKSPFQRTYAA  64

Query  2585  QIKRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANND  2406
             QIKR GEMARK+RFFKDQMSKAGV A    + ++ I  DD+EVKLG+LEAEL+EINANND
Sbjct  65    QIKRCGEMARKIRFFKDQMSKAGVLAKEMLEKENDIDLDDVEVKLGELEAELVEINANND  124

Query  2405  KLQRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSAD  2226
             KLQRS+NEL+EYKLVLQK GEFF SA  SA AQQ+E  S   GE+ LE+PLL E + S D
Sbjct  125   KLQRSYNELMEYKLVLQKAGEFFSSAHRSATAQQRETESQHGGEDLLESPLLQE-EKSID  183

Query  2225  TSKQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFL  2046
             ++KQV+LGF++GLVP+EKSM FERILFRATRGN+ +RQ+ +++ VIDP SGEK EKNVF+
Sbjct  184   STKQVKLGFLTGLVPREKSMVFERILFRATRGNIFIRQTVIEDPVIDPNSGEKAEKNVFV  243

Query  2045  VFYSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGN  1866
             VFYSGERAK+KILKIC+AFGANRYPF+E+LGKQAQ+ITEVSG+++ELKT IDAG+  R  
Sbjct  244   VFYSGERAKSKILKICEAFGANRYPFSEDLGKQAQMITEVSGRLAELKTTIDAGLGQRNI  303

Query  1865  LLQSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAG  1686
             LLQ+I ++F+ WN+ VR+EK+IYHTLNMLS+DVTKKCLVAEGWSP  A+ EIQDALQRA 
Sbjct  304   LLQTIGDKFELWNLKVRKEKAIYHTLNMLSLDVTKKCLVAEGWSPVFASKEIQDALQRAA  363

Query  1685  HDSNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPF  1506
              DSNS++G+IF+VL T+E PPTYF+TNKFTSA QEIVDAYGVAKYQEANPGVFTIVTFPF
Sbjct  364   VDSNSQVGSIFQVLRTKELPPTYFRTNKFTSAIQEIVDAYGVAKYQEANPGVFTIVTFPF  423

Query  1505  LFAVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGF  1326
             LFAVMFGDWGHGICLLLAT+Y ++REKKLSSQKLGDI EM FGGRYVI+MM+LFSIYTG 
Sbjct  424   LFAVMFGDWGHGICLLLATMYLILREKKLSSQKLGDIMEMAFGGRYVIMMMSLFSIYTGL  483

Query  1325  IYNEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNS  1146
             IYNEFFS+ + LF  SAY CRD SCS+ATTIGLIK RDTY FG+DP WHGTRSELPFLNS
Sbjct  484   IYNEFFSIPYPLFATSAYDCRDASCSEATTIGLIKVRDTYPFGLDPVWHGTRSELPFLNS  543

Query  1145  LKMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKW  966
             LKMK+SILLGV+QMNLGII+SYFNA +F+S VN W QFIPQ+IFLN+LFGYLSVLII+KW
Sbjct  544   LKMKMSILLGVSQMNLGIIMSYFNARFFKSSVNIWFQFIPQMIFLNSLFGYLSVLIIIKW  603

Query  965   CTGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKS  786
             CTGSQADLYHVMIYMFL PT++LGENQLFP QKT QL L+ LALVSVP MLLPKPFILK 
Sbjct  604   CTGSQADLYHVMIYMFLSPTDELGENQLFPHQKTVQLALLFLALVSVPCMLLPKPFILKK  663

Query  785   QHN-RHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTA  609
             QH  RHQGQSYAP+ + DESL V+ S  S  HEEFEFSE+FVHQLIHTIEFVLGAVSNTA
Sbjct  664   QHEARHQGQSYAPLDETDESLHVETSGGSHGHEEFEFSEIFVHQLIHTIEFVLGAVSNTA  723

Query  608   SYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAF  429
             SYLRLWALSLAHSELS+VFYEKVLLLAWGYNN++IL+VG I+FIFAT+GVLLVMETLSAF
Sbjct  724   SYLRLWALSLAHSELSSVFYEKVLLLAWGYNNVLILIVGIIVFIFATVGVLLVMETLSAF  783

Query  428   LHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             LHALRLHWVEFQNKFYEGDGYKF PF+F+L   E++
Sbjct  784   LHALRLHWVEFQNKFYEGDGYKFAPFTFILAANEDE  819



>ref|XP_009401931.1| PREDICTED: vacuolar proton ATPase a3-like [Musa acuminata subsp. 
malaccensis]
Length=827

 Score =  1226 bits (3171),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 632/815 (78%), Positives = 730/815 (90%), Gaps = 1/815 (0%)
 Frame = -2

Query  2762  RGGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQ  2583
             RGGC PPMDL RSE MQLV++I+P+ESA L+++YLGDLGL QFKDLNA+KSPFQRTYA Q
Sbjct  13    RGGCCPPMDLMRSEAMQLVRIIVPVESAHLTLSYLGDLGLFQFKDLNADKSPFQRTYANQ  72

Query  2582  IKRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDK  2403
             IKR GEMARKLR FK+QM+KAG+S S  + TQ  I FD++E+KLG+LEAELIE+N+NN+K
Sbjct  73    IKRCGEMARKLRLFKEQMAKAGISHSEMAMTQTRIDFDEMEIKLGELEAELIEVNSNNEK  132

Query  2402  LQRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADT  2223
             LQRS+NEL+EY LVL+K GEFF+SA+SSA AQQ+E  + Q+G+ SL++PLL E +M  D 
Sbjct  133   LQRSYNELLEYMLVLKKAGEFFYSAQSSATAQQREIEARQTGDGSLDSPLLLEQEMLTDP  192

Query  2222  SKQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLV  2043
             +KQV+LGF+SGLVPKEK+MAFERILFRATRGN+ LRQ+ VD+ VIDPISGEK+ KNVF+V
Sbjct  193   AKQVKLGFVSGLVPKEKAMAFERILFRATRGNMYLRQAAVDDPVIDPISGEKIAKNVFVV  252

Query  2042  FYSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNL  1863
             FYSGERAK KILKIC+AFGANRYPF +++GKQ Q+I+EVSGKI+ELKT ID G+LHR N+
Sbjct  253   FYSGERAKTKILKICEAFGANRYPFTDDIGKQMQMISEVSGKITELKTTIDLGMLHRDNI  312

Query  1862  LQSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGH  1683
             L++I+ QF++WN LVR EK+IYHTLNMLS+DVTKKCLVAEGWSP  AT +IQDALQRA +
Sbjct  313   LKNISYQFEQWNNLVRTEKAIYHTLNMLSLDVTKKCLVAEGWSPVFATSQIQDALQRATY  372

Query  1682  DSNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFL  1503
             DSNS++G+IF+VL T+ESPPTYF+TNKFTSAFQEIVDAYG+AKYQEANPGV+TIVTFPFL
Sbjct  373   DSNSQVGSIFQVLHTKESPPTYFQTNKFTSAFQEIVDAYGIAKYQEANPGVYTIVTFPFL  432

Query  1502  FAVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFI  1323
             FAVMFGDWGHG+CLLLATL  + REKKLSSQKLGDI EM FGGRYVILMMALFSIYTG I
Sbjct  433   FAVMFGDWGHGMCLLLATLMLIFREKKLSSQKLGDIMEMMFGGRYVILMMALFSIYTGLI  492

Query  1322  YNEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSL  1143
             YNEFFSV FE+FGRSAY CRD SC DATT GL+K R+ Y FGVDP WHG+RSELPFLNSL
Sbjct  493   YNEFFSVPFEMFGRSAYACRDLSCRDATTEGLVKVREAYPFGVDPKWHGSRSELPFLNSL  552

Query  1142  KMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWC  963
             KMK+SILLGVAQMNLGIILSYFNA +F + +N W QFIPQ+IFLN+LFGYLS+LIIVKWC
Sbjct  553   KMKMSILLGVAQMNLGIILSYFNAKFFSNSINTWYQFIPQLIFLNSLFGYLSLLIIVKWC  612

Query  962   TGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQ  783
             TGSQADLYHVMIYMFL PT+DLGENQLFPGQKT QLVL+LLAL+SVPWML PKP +L+ Q
Sbjct  613   TGSQADLYHVMIYMFLSPTDDLGENQLFPGQKTLQLVLLLLALISVPWMLFPKPILLRKQ  672

Query  782   HN-RHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTAS  606
             HN RHQGQSY  + + +ESL ++  HDS DHEEFEFSEVFVHQLIHTIEFVLGAVSNTAS
Sbjct  673   HNERHQGQSYTMLHNTEESLEIEEDHDSHDHEEFEFSEVFVHQLIHTIEFVLGAVSNTAS  732

Query  605   YLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFL  426
             YLRLWALSLAHSELS+VFYEKVLLLAWG+NNI IL++G ++F+ ATIGVLLVMETLSAFL
Sbjct  733   YLRLWALSLAHSELSSVFYEKVLLLAWGFNNIAILIIGIVVFVCATIGVLLVMETLSAFL  792

Query  425   HALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             HALRLHWVEFQNKFYEGDGYKF PFSF L+ +EED
Sbjct  793   HALRLHWVEFQNKFYEGDGYKFAPFSFALLTDEED  827



>ref|XP_010446444.1| PREDICTED: V-type proton ATPase subunit a3 [Camelina sativa]
Length=822

 Score =  1225 bits (3169),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 631/824 (77%), Positives = 720/824 (87%), Gaps = 5/824 (1%)
 Frame = -2

Query  2783  MAERLGGRGGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPF  2604
             M E  GG  GC PPMDL RSE MQLVQLI+P+ESA L+V+YLGDLGL+QFKDLN+EKSPF
Sbjct  1     MGESRGG--GCCPPMDLMRSETMQLVQLIVPMESAHLTVSYLGDLGLVQFKDLNSEKSPF  58

Query  2603  QRTYAAQIKRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIE  2424
             QRTYAAQIKR GEMARK+RFFKDQMSKA V      + +  I  DD+EVKLG+LEAEL+E
Sbjct  59    QRTYAAQIKRCGEMARKIRFFKDQMSKAEVLPKELLEKESDIDLDDVEVKLGELEAELVE  118

Query  2423  INANNDKLQRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgee--sleapll  2250
             INANNDKLQRS+NEL+EYKLVLQK GEFF SA  SA AQQ+E  S  S +    L    L
Sbjct  119   INANNDKLQRSYNELMEYKLVLQKAGEFFSSAHRSATAQQREIESEDSQQAGDDLLESPL  178

Query  2249  sePDMSADTSKQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGE  2070
              + + S D+SKQV+LGF++GLVP+EKSM FERILFRATRGN+ +RQ+ ++E VIDP SGE
Sbjct  179   LQEEKSVDSSKQVKLGFLTGLVPREKSMVFERILFRATRGNIFIRQTVIEEPVIDPSSGE  238

Query  2069  KVEKNVFLVFYSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAID  1890
             K EKNVF+VFYSGERAK+KILKIC+AFGANRYPF+E+LGKQAQ+ITEVSG++SELKT ID
Sbjct  239   KAEKNVFIVFYSGERAKSKILKICEAFGANRYPFSEDLGKQAQMITEVSGRLSELKTTID  298

Query  1889  AGILHRGNLLQSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEI  1710
             AG+ HR  LLQ+I ++F+ WN+ VR+EK+IYHTLNMLS+DVTKKCLVAEGWSP  A+ EI
Sbjct  299   AGLGHRNVLLQTIGDKFELWNLKVRKEKAIYHTLNMLSLDVTKKCLVAEGWSPVFASNEI  358

Query  1709  QDALQRAGHDSNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGV  1530
             QDALQRA  DSNS++G+IF+VL T+ESPPTYF+TNKFTSA QEIVDAYGVAKYQEANPGV
Sbjct  359   QDALQRAAVDSNSQVGSIFQVLRTKESPPTYFRTNKFTSAIQEIVDAYGVAKYQEANPGV  418

Query  1529  FTIVTFPFLFAVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMA  1350
             FTIVTFPFLFAVMFGDWGHGIC+LLAT+Y ++REKKL+SQKLGDI EM FGGRYVILMM+
Sbjct  419   FTIVTFPFLFAVMFGDWGHGICILLATMYLILREKKLASQKLGDIMEMAFGGRYVILMMS  478

Query  1349  LFSIYTGFIYNEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTR  1170
             LFSIYTG IYNEFFS+ + LF  SAY CRD SCS+ATTIGLIK RDTY FG+DP WHGTR
Sbjct  479   LFSIYTGLIYNEFFSIPYPLFAPSAYDCRDASCSEATTIGLIKVRDTYPFGLDPVWHGTR  538

Query  1169  SELPFLNSLKMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYL  990
             SELPFLNSLKMK+SILLGV+QMNLGII+SYFNA +F+S VN W QFIPQ+IFLN+LFGYL
Sbjct  539   SELPFLNSLKMKMSILLGVSQMNLGIIMSYFNARFFKSSVNIWFQFIPQMIFLNSLFGYL  598

Query  989   SVLIIVKWCTGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLL  810
             SVLII+KWCTGSQADLYHVMIYMFL PT++LGENQLFP QKT QLVL+ LALVSVP MLL
Sbjct  599   SVLIIIKWCTGSQADLYHVMIYMFLSPTDELGENQLFPHQKTVQLVLLFLALVSVPCMLL  658

Query  809   PKPFILKSQHN-RHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFV  633
             PKPFILK QH  RHQGQSYAP+ + DESL V+ +  S  HEEFEFSE+FVHQLIHTIEFV
Sbjct  659   PKPFILKKQHEARHQGQSYAPLDETDESLHVETTGGSHGHEEFEFSEIFVHQLIHTIEFV  718

Query  632   LGAVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLL  453
             LGAVSNTASYLRLWALSLAHSELS+VFYEKVLLLAWGYNN+ IL++G ++FIFAT+GVLL
Sbjct  719   LGAVSNTASYLRLWALSLAHSELSSVFYEKVLLLAWGYNNVFILIIGILVFIFATVGVLL  778

Query  452   VMETLSAFLHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             VMETLSAFLHALRLHWVEFQNKFYEGDGYKF PF+F+    E++
Sbjct  779   VMETLSAFLHALRLHWVEFQNKFYEGDGYKFAPFTFIFTANEDE  822



>emb|CDY41958.1| BnaA01g05300D [Brassica napus]
Length=817

 Score =  1225 bits (3169),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 638/818 (78%), Positives = 728/818 (89%), Gaps = 2/818 (0%)
 Frame = -2

Query  2771  LGGRGGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTY  2592
             +G  GGC PPMDL RSEPMQLVQLI+P+ESA L+V+YLGDLGL+QFKDLN+EKSPFQRTY
Sbjct  1     MGESGGCCPPMDLMRSEPMQLVQLIVPMESAHLTVSYLGDLGLVQFKDLNSEKSPFQRTY  60

Query  2591  AAQIKRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINAN  2412
             AAQIKR GEMARK+RFFKDQMSKAGV    + +    I  DD+EVKLG+LEAEL+EINAN
Sbjct  61    AAQIKRCGEMARKIRFFKDQMSKAGVLPKDSLENGTDIDLDDVEVKLGELEAELVEINAN  120

Query  2411  NDKLQRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMS  2232
             NDKLQRS+NEL+EYKLVL+K GEFF SA +SA AQQ+E  S Q GE+ LEAPLL E D S
Sbjct  121   NDKLQRSYNELIEYKLVLEKAGEFFSSAHTSATAQQREIDSQQVGEDLLEAPLLQE-DKS  179

Query  2231  ADTSKQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNV  2052
              D+SKQV+LGF++GLVP+EKSM FERILFRATRGNV +RQ+ ++E VIDP SG+K EKNV
Sbjct  180   IDSSKQVKLGFLTGLVPREKSMVFERILFRATRGNVFIRQTVIEEPVIDPNSGDKAEKNV  239

Query  2051  FLVFYSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHR  1872
             F+VFYSGERAK+KILKIC+AFGANRYPF+E+LGKQAQ+ITEVSG+++ELKT IDAG+ HR
Sbjct  240   FVVFYSGERAKSKILKICEAFGANRYPFSEDLGKQAQMITEVSGRLTELKTTIDAGLGHR  299

Query  1871  GNLLQSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQR  1692
               LL +I ++F+ WN+ VR+EK+IYHTLNMLS+DVTKKCLVAEGWSP  A+ EIQ+AL+R
Sbjct  300   NILLHAIGDKFELWNLKVRKEKAIYHTLNMLSLDVTKKCLVAEGWSPVFASNEIQNALKR  359

Query  1691  AGHDSNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTF  1512
             A  DSNS++G+IF+VL T+E PPTYF+TNKFTSA QEIVDAYGVAKYQEANPGVFTIVTF
Sbjct  360   AAVDSNSQVGSIFQVLRTKELPPTYFRTNKFTSAIQEIVDAYGVAKYQEANPGVFTIVTF  419

Query  1511  PFLFAVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYT  1332
             PFLFAVMFGDWGHGICLLLAT+Y ++REKKLSSQKLGDI EM FGGRYVI+MM+LFSIYT
Sbjct  420   PFLFAVMFGDWGHGICLLLATMYLIVREKKLSSQKLGDIMEMAFGGRYVIMMMSLFSIYT  479

Query  1331  GFIYNEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFL  1152
             G IYNEFFS+ + LF  SAY CRD SCS+ATTIGLIK RDTY FG+DP WHGTRSELPFL
Sbjct  480   GLIYNEFFSIPYPLFAPSAYDCRDASCSEATTIGLIKVRDTYPFGLDPVWHGTRSELPFL  539

Query  1151  NSLKMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIV  972
             NSLKMK+SILLGV+QMNLGII+SYFNA +F+S VN W QFIPQ+IFLN+LFGYLSVLII+
Sbjct  540   NSLKMKMSILLGVSQMNLGIIMSYFNARFFKSSVNIWFQFIPQMIFLNSLFGYLSVLIII  599

Query  971   KWCTGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFIL  792
             KWCTGSQADLYHVMIYMFL PT++LGENQLFP QKT QLVL+ LALVSVP MLLPKPFIL
Sbjct  600   KWCTGSQADLYHVMIYMFLSPTDELGENQLFPHQKTVQLVLLFLALVSVPCMLLPKPFIL  659

Query  791   KSQHN-RHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSN  615
             K QH  RHQGQSYAP+++ DESL V+ S  S  HEEFEFSE+FVHQLIHTIEFVLGAVSN
Sbjct  660   KKQHEARHQGQSYAPLEETDESLHVEASGGSHGHEEFEFSEIFVHQLIHTIEFVLGAVSN  719

Query  614   TASYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLS  435
             TASYLRLWALSLAHSELS+VFYEKVLLLAWGYNN +IL+VG I+F+FAT+GVLLVMETLS
Sbjct  720   TASYLRLWALSLAHSELSSVFYEKVLLLAWGYNNWLILIVGIIVFVFATVGVLLVMETLS  779

Query  434   AFLHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             AFLHALRLHWVEFQNKFYEGDGYKF PFSF+L   E++
Sbjct  780   AFLHALRLHWVEFQNKFYEGDGYKFAPFSFILTASEDE  817



>ref|XP_009109504.1| PREDICTED: vacuolar proton ATPase a3 [Brassica rapa]
 emb|CDX90307.1| BnaA08g16770D [Brassica napus]
Length=819

 Score =  1222 bits (3161),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 635/822 (77%), Positives = 728/822 (89%), Gaps = 4/822 (0%)
 Frame = -2

Query  2783  MAERLGGRGGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPF  2604
             MAE   G GGC PPMDL RSEPMQLVQLI+P+ESA L+V+YLGDLGL+QFKDLN+EKSPF
Sbjct  1     MAE--NGGGGCCPPMDLMRSEPMQLVQLIVPMESAHLTVSYLGDLGLVQFKDLNSEKSPF  58

Query  2603  QRTYAAQIKRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIE  2424
             QRTYAAQIKR GEMARK+RFFKDQMSKAGV        ++ I  DD+EVKLG+LEAEL+E
Sbjct  59    QRTYAAQIKRCGEMARKIRFFKDQMSKAGVLPKEMLGKENDIDLDDVEVKLGELEAELVE  118

Query  2423  INANNDKLQRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllse  2244
             INANNDKLQRS+NEL+EYKLVL+K GEFF SA  SA AQQ+E  S ++ E+ LE+PLL E
Sbjct  119   INANNDKLQRSYNELMEYKLVLEKAGEFFSSAHRSATAQQRETESPRASEDLLESPLLQE  178

Query  2243  PDMSADTSKQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKV  2064
              + S D SKQV+LGF++GLVP+EKSM FERILFRATRGNV +RQ+ V+E+VIDP SGEK 
Sbjct  179   -EKSIDASKQVKLGFLTGLVPREKSMVFERILFRATRGNVYIRQTVVEETVIDPNSGEKA  237

Query  2063  EKNVFLVFYSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAG  1884
             EKNVF+VFYSGERAK+KILKIC+AFGANRYPF+E+L KQAQ+ITEVSG+++ELKT IDAG
Sbjct  238   EKNVFVVFYSGERAKSKILKICEAFGANRYPFSEDLRKQAQMITEVSGRLTELKTTIDAG  297

Query  1883  ILHRGNLLQSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQD  1704
             + HR  LLQ+I ++F+ W++ VR+EK+IYHTLNMLS+DVTKKCLVAEGWSP  A+ EIQ+
Sbjct  298   LGHRNILLQTIGDKFELWSLKVRKEKAIYHTLNMLSLDVTKKCLVAEGWSPVFASKEIQE  357

Query  1703  ALQRAGHDSNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFT  1524
             AL+RA  DSNS++G+IF++L T+E PPTYF+TNKFTSA QEIVDAYGVAKYQEANPGVFT
Sbjct  358   ALERAAVDSNSQVGSIFQILRTKELPPTYFRTNKFTSAIQEIVDAYGVAKYQEANPGVFT  417

Query  1523  IVTFPFLFAVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALF  1344
             IVTFPFLFAVMFGDWGHGICLLLAT+Y ++REKKL+SQKLGDI EM FGGRYVI+MM+LF
Sbjct  418   IVTFPFLFAVMFGDWGHGICLLLATMYLIVREKKLASQKLGDIMEMAFGGRYVIMMMSLF  477

Query  1343  SIYTGFIYNEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSE  1164
             SIYTG IYNEFFS+ + LF  SAY CRD SCS+ATTIGLIK RDTY FG+DP WHGTRSE
Sbjct  478   SIYTGLIYNEFFSIPYPLFAPSAYDCRDASCSEATTIGLIKVRDTYPFGLDPVWHGTRSE  537

Query  1163  LPFLNSLKMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSV  984
             LPFLNSLKMK+SILLGV+QMNLGII+SYFNA +F+S VN W QFIPQ+IFLN+LFGYLSV
Sbjct  538   LPFLNSLKMKMSILLGVSQMNLGIIMSYFNARFFKSSVNIWFQFIPQMIFLNSLFGYLSV  597

Query  983   LIIVKWCTGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPK  804
             LII+KWCTGSQADLYHVMIYMFL PT++LGENQLFP QKT QLVL+ LALVSVP MLLPK
Sbjct  598   LIIIKWCTGSQADLYHVMIYMFLSPTDELGENQLFPHQKTVQLVLLFLALVSVPCMLLPK  657

Query  803   PFILKSQHN-RHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLG  627
             PFILK QH  RHQGQSYAP+++ DESL V+ S     HEEFEFSE+FVHQLIHTIEFVLG
Sbjct  658   PFILKKQHEARHQGQSYAPLEETDESLHVETSGGGHGHEEFEFSEIFVHQLIHTIEFVLG  717

Query  626   AVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVM  447
             AVSNTASYLRLWALSLAHSELS+VFYEKVLLLAWGYNN +IL+VG I+F+FAT+GVLLVM
Sbjct  718   AVSNTASYLRLWALSLAHSELSSVFYEKVLLLAWGYNNWLILIVGIIVFVFATVGVLLVM  777

Query  446   ETLSAFLHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             ETLSAFLHALRLHWVEFQNKFYEGDGYKF PFSF+L   E++
Sbjct  778   ETLSAFLHALRLHWVEFQNKFYEGDGYKFAPFSFILTASEDE  819



>emb|CDY42603.1| BnaC01g00150D [Brassica napus]
Length=818

 Score =  1221 bits (3160),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 637/819 (78%), Positives = 725/819 (89%), Gaps = 3/819 (0%)
 Frame = -2

Query  2771  LGGRGGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTY  2592
             +G  GGC PPMDL RSEPMQLVQLI+P+ESA L+V+YLGDLGL+QFKDLN EKSPFQRTY
Sbjct  1     MGESGGCCPPMDLMRSEPMQLVQLIVPMESAHLTVSYLGDLGLVQFKDLNPEKSPFQRTY  60

Query  2591  AAQIKRSGEMARKLRFFKDQMSKAGV-SASANSDTQDAIKFDDLEVKLGDLEAELIEINA  2415
             AAQIKR GEMARK+RFFKDQMSKAGV    +  +    I  DD+EVKLG+LEAEL+EINA
Sbjct  61    AAQIKRCGEMARKIRFFKDQMSKAGVLPKDSLENGTHIIDLDDVEVKLGELEAELVEINA  120

Query  2414  NNDKLQRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDM  2235
             NNDKLQRS+NEL+EYKLVL K GEFF SA +SA AQQ E  S Q G++ LEAPLL + D 
Sbjct  121   NNDKLQRSYNELIEYKLVLDKAGEFFSSAHTSATAQQIEIESQQVGQDLLEAPLLQQ-DK  179

Query  2234  SADTSKQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKN  2055
             S D+SKQV+LGF++GLVP+EKSM FERILFRATRGNV +RQ+ ++E VIDP SGEK EKN
Sbjct  180   SIDSSKQVKLGFLTGLVPREKSMVFERILFRATRGNVFIRQTVIEEPVIDPNSGEKAEKN  239

Query  2054  VFLVFYSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILH  1875
             VF+VFYSGERAK+KILKIC+AFGANRYPF+E+LGKQAQ+ITEVSG+++ELKT IDAG+ H
Sbjct  240   VFVVFYSGERAKSKILKICEAFGANRYPFSEDLGKQAQMITEVSGRLTELKTTIDAGLGH  299

Query  1874  RGNLLQSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQ  1695
             R  LL +I ++F+ WN+ VR+EK+IYHTLNMLS+DVTKKCLVAEGWSP  A+ EIQ+AL+
Sbjct  300   RNILLHAIGDKFELWNLKVRKEKAIYHTLNMLSLDVTKKCLVAEGWSPVFASNEIQNALK  359

Query  1694  RAGHDSNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVT  1515
             RA  DSNS++G+IF+VL T+E PPTYF+TNKFTSA QEIVDAYGVAKYQEANPGVFTIVT
Sbjct  360   RAAVDSNSQVGSIFQVLRTKELPPTYFRTNKFTSAIQEIVDAYGVAKYQEANPGVFTIVT  419

Query  1514  FPFLFAVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIY  1335
             FPFLFAVMFGDWGHGICLLLAT+Y ++REKKLSSQKLGDI EM FGGRYVI+MM+LFSIY
Sbjct  420   FPFLFAVMFGDWGHGICLLLATMYLIVREKKLSSQKLGDIMEMAFGGRYVIMMMSLFSIY  479

Query  1334  TGFIYNEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPF  1155
             TG IYNEFFS+ + LF  SAY CRD SCS+ATTIGLIK RDTY FG+DP WHGTRSELPF
Sbjct  480   TGLIYNEFFSIPYPLFAPSAYDCRDASCSEATTIGLIKVRDTYPFGLDPVWHGTRSELPF  539

Query  1154  LNSLKMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLII  975
             LNSLKMK+SILLGV+QMNLGII+SYFNA +F+S VN W QFIPQ+IFLN+LFGYLSVLII
Sbjct  540   LNSLKMKMSILLGVSQMNLGIIMSYFNARFFKSSVNIWFQFIPQMIFLNSLFGYLSVLII  599

Query  974   VKWCTGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFI  795
             +KWCTGSQADLYHVMIYMFL PT++LGENQLFP QKT QLVL+ LALVSVP MLLPKPFI
Sbjct  600   IKWCTGSQADLYHVMIYMFLSPTDELGENQLFPHQKTVQLVLLFLALVSVPCMLLPKPFI  659

Query  794   LKSQHN-RHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVS  618
             LK QH  RHQGQSYAP+++ DESL V+ +  S  HEEFEFSE+FVHQLIHTIEFVLGAVS
Sbjct  660   LKKQHEARHQGQSYAPLEETDESLHVEANGGSHGHEEFEFSEIFVHQLIHTIEFVLGAVS  719

Query  617   NTASYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETL  438
             NTASYLRLWALSLAHSELS+VFYEKVLLLAWGYNN +IL+VG I+FIFAT+GVLLVMETL
Sbjct  720   NTASYLRLWALSLAHSELSSVFYEKVLLLAWGYNNWLILIVGIIVFIFATVGVLLVMETL  779

Query  437   SAFLHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             SAFLHALRLHWVEFQNKFYEGDGYKF PFSF+L   E++
Sbjct  780   SAFLHALRLHWVEFQNKFYEGDGYKFAPFSFILTANEDE  818



>ref|XP_006404587.1| hypothetical protein EUTSA_v10000048mg [Eutrema salsugineum]
 gb|ESQ46040.1| hypothetical protein EUTSA_v10000048mg [Eutrema salsugineum]
Length=819

 Score =  1221 bits (3158),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 631/822 (77%), Positives = 723/822 (88%), Gaps = 4/822 (0%)
 Frame = -2

Query  2783  MAERLGGRGGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPF  2604
             MAE  GG  GCFPPMDL RSEPMQLVQ+I+P+ESA L+V+YLGDLGL+QFKDLN+EKSPF
Sbjct  1     MAESRGG--GCFPPMDLMRSEPMQLVQVIVPMESAHLTVSYLGDLGLVQFKDLNSEKSPF  58

Query  2603  QRTYAAQIKRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIE  2424
             QRTYAAQIKR GEMARK+RFFKDQMSKAGVS     D +  I  DD+EVKLG+LEAEL+E
Sbjct  59    QRTYAAQIKRCGEMARKIRFFKDQMSKAGVSPKEILDKEIDIDLDDVEVKLGELEAELVE  118

Query  2423  INANNDKLQRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllse  2244
             INAN+DKLQRS+NELVEYKLVL+K GEFF SA  SA  QQ E  S Q+GE++LEAPLL E
Sbjct  119   INANSDKLQRSYNELVEYKLVLEKAGEFFASAHRSATTQQSEIESQQAGEDALEAPLLQE  178

Query  2243  PDMSADTSKQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKV  2064
              + S D +KQV+LGF++GLVP+EKSM FERILFRATRGN+ +RQS ++ESV+DP SGEK 
Sbjct  179   -EKSIDPTKQVKLGFLTGLVPREKSMVFERILFRATRGNIFIRQSVIEESVVDPNSGEKA  237

Query  2063  EKNVFLVFYSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAG  1884
             EKNVF+VFYSGERAK+KILKIC+AFGANRYPF+EELG+QAQ++TEV+G+++ELKT I AG
Sbjct  238   EKNVFVVFYSGERAKSKILKICEAFGANRYPFSEELGRQAQMMTEVTGRLAELKTTIGAG  297

Query  1883  ILHRGNLLQSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQD  1704
             +  R  LL++I ++F++WN+ VR+EK+IYHTLNMLS+DVTKKCLV EGWSP  A  EIQD
Sbjct  298   LDQRKILLETIGDRFEQWNLKVRKEKAIYHTLNMLSLDVTKKCLVGEGWSPVFAATEIQD  357

Query  1703  ALQRAGHDSNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFT  1524
             ALQRA  DSNS++G+IF+VL T+E PPT+F+TNKFT+AFQEIVDAYGVAKYQEANP VFT
Sbjct  358   ALQRAAVDSNSQVGSIFQVLRTKEMPPTFFRTNKFTTAFQEIVDAYGVAKYQEANPSVFT  417

Query  1523  IVTFPFLFAVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALF  1344
             IVTFPFLFAVMFGDWGHGICLLLAT+Y ++REKKLSSQKLGDI EM FGGRYVI MM+LF
Sbjct  418   IVTFPFLFAVMFGDWGHGICLLLATMYLILREKKLSSQKLGDIMEMAFGGRYVIFMMSLF  477

Query  1343  SIYTGFIYNEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSE  1164
             SIYTG IYNEFFS+ + LF  SAY CRD SCS+ATTIGLIK RDTY FGVDP WHGTRSE
Sbjct  478   SIYTGLIYNEFFSIPYPLFASSAYECRDASCSEATTIGLIKTRDTYPFGVDPVWHGTRSE  537

Query  1163  LPFLNSLKMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSV  984
             LPFLNSLKMK+SILLGVAQMNLGII+S+FNA +F+S VN W QF+PQ+IFLN LFGYLSV
Sbjct  538   LPFLNSLKMKMSILLGVAQMNLGIIMSFFNAKFFKSAVNVWFQFVPQMIFLNCLFGYLSV  597

Query  983   LIIVKWCTGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPK  804
             LII+KWCTGSQADLYHVMIYMFL P +DLGENQLFP QK  QL  + LALVSVPWMLLPK
Sbjct  598   LIIIKWCTGSQADLYHVMIYMFLSPMDDLGENQLFPNQKIVQLTFLFLALVSVPWMLLPK  657

Query  803   PFILKSQHN-RHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLG  627
             PFILK QH  RHQGQSYA + + DESL V+ +  S  HEEFEFSE+FVHQLIHTIEFVLG
Sbjct  658   PFILKKQHEARHQGQSYAQLDETDESLQVETNGGSHGHEEFEFSEIFVHQLIHTIEFVLG  717

Query  626   AVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVM  447
             AVSNTASYLRLWALSLAHSELS+VFYEKVLL+AWG+NNI IL+VG ++FIFAT+GVLLVM
Sbjct  718   AVSNTASYLRLWALSLAHSELSSVFYEKVLLMAWGFNNIFILIVGILVFIFATVGVLLVM  777

Query  446   ETLSAFLHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             ETLSAFLHALRLHWVE+QNKFYEGDGYKF PF+FVLV  E++
Sbjct  778   ETLSAFLHALRLHWVEYQNKFYEGDGYKFAPFTFVLVGNEDE  819



>gb|KDO49484.1| hypothetical protein CISIN_1g003392mg [Citrus sinensis]
Length=821

 Score =  1220 bits (3157),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 647/808 (80%), Positives = 730/808 (90%), Gaps = 3/808 (0%)
 Frame = -2

Query  2741  MDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSGEM  2562
             MDLFRSEPMQLVQ+IIPIESA L+V+YLG+LGL+QFKDLN+EKSPFQRTYAAQIK+  EM
Sbjct  16    MDLFRSEPMQLVQIIIPIESAHLTVSYLGELGLLQFKDLNSEKSPFQRTYAAQIKKCAEM  75

Query  2561  ARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSFNE  2382
             ARKLRFFK+QM KAG+ +S  S T+     DDLEVKLGDLEAEL+EINAN DKLQR+ +E
Sbjct  76    ARKLRFFKEQMLKAGILSSVKSTTRADNNTDDLEVKLGDLEAELVEINANGDKLQRAHSE  135

Query  2381  LVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTSKQVRLG  2202
             LVEYKLVLQK GEFF SA +SA AQQ+E  S Q+GE ++E PLL++ +MSAD SKQ++LG
Sbjct  136   LVEYKLVLQKAGEFFSSALTSAAAQQREMESQQTGEMTIETPLLTDKEMSADPSKQIKLG  195

Query  2201  FISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSGERA  2022
             FI+GLVP+EKSM+FER+LFRATRGNV LRQ+ VDE V+DP+SGEK+EKNVF+VFYSGERA
Sbjct  196   FIAGLVPREKSMSFERMLFRATRGNVFLRQAVVDEPVVDPVSGEKMEKNVFVVFYSGERA  255

Query  2021  KNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSIAEQ  1842
             KNKILKICDAFGANRYPF EE  KQAQ I+EVSG++SELKT +DAG+LHRGNLLQ+I +Q
Sbjct  256   KNKILKICDAFGANRYPFNEEFDKQAQAISEVSGRLSELKTTLDAGLLHRGNLLQTIGDQ  315

Query  1841  FDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNSEIG  1662
             F++WN+LV++EKSIYHTLNMLS+DVTKKCLV EGWSP  AT   QDAL+RA  DSNS++G
Sbjct  316   FEQWNLLVKKEKSIYHTLNMLSLDVTKKCLVGEGWSPVFATK--QDALERAAFDSNSQVG  373

Query  1661  AIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGD  1482
             AIF+VL T+ESPPTYF+TNKFTSAFQEIVDAYGVAKY+EANPGVFTIVTFPFLFAVMFGD
Sbjct  374   AIFQVLHTKESPPTYFRTNKFTSAFQEIVDAYGVAKYREANPGVFTIVTFPFLFAVMFGD  433

Query  1481  WGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEFFSV  1302
             WGHGICLLL TL  ++REKKL+SQKL DIT+MTFGGRYVILMMALFSIYTG IYNEFFSV
Sbjct  434   WGHGICLLLGTLVLIVREKKLASQKLDDITDMTFGGRYVILMMALFSIYTGLIYNEFFSV  493

Query  1301  QFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKLSIL  1122
              FE+F  SAY CRD SCS+ATT+GLIK RDTY FGVDP WHG+RSELPFLNSLKMK+SIL
Sbjct  494   PFEIFSHSAYACRDLSCSEATTVGLIKVRDTYPFGVDPVWHGSRSELPFLNSLKMKMSIL  553

Query  1121  LGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQADL  942
             LGVAQMNLGIILSYFNA +FR GVN WCQFIPQIIFLN+LFGYLS+LII+KW TGSQADL
Sbjct  554   LGVAQMNLGIILSYFNATFFRIGVNIWCQFIPQIIFLNSLFGYLSLLIILKWITGSQADL  613

Query  941   YHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQH-NRHQG  765
             YHVMIYMFL PT++LG+NQLFPGQKT QLVL+LLA VSVPWMLLPKPFILK QH +RHQG
Sbjct  614   YHVMIYMFLSPTDELGDNQLFPGQKTAQLVLLLLAFVSVPWMLLPKPFILKMQHQDRHQG  673

Query  764   QSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLRLWAL  585
             QSY  +Q  DESL  D +HDS  HEEFEFSEVFVHQ+IHTIEFVLGAVSNTASYLRLWAL
Sbjct  674   QSYEALQSTDESLQPDTNHDSHGHEEFEFSEVFVHQMIHTIEFVLGAVSNTASYLRLWAL  733

Query  584   SLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHALRLHW  405
             SLAHSELS+VFYEKVLLLAWGYNNI+IL+VG I+FIFAT+GVLLVMETLSAFLHALRLHW
Sbjct  734   SLAHSELSSVFYEKVLLLAWGYNNILILIVGIIVFIFATVGVLLVMETLSAFLHALRLHW  793

Query  404   VEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             VEFQNKFYEGDGYKF PFSF L+D+E++
Sbjct  794   VEFQNKFYEGDGYKFSPFSFALLDDEDE  821



>ref|XP_002512965.1| vacuolar proton atpase, putative [Ricinus communis]
 gb|EEF49468.1| vacuolar proton atpase, putative [Ricinus communis]
Length=814

 Score =  1220 bits (3157),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 648/813 (80%), Positives = 734/813 (90%), Gaps = 1/813 (0%)
 Frame = -2

Query  2756  GCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIK  2577
             GC PPMDLFRSE MQLVQLIIPIESA L+V+YLGDLGL+QFKDLN+EKSPFQRTYAAQ+K
Sbjct  2     GCCPPMDLFRSEAMQLVQLIIPIESAHLTVSYLGDLGLLQFKDLNSEKSPFQRTYAAQLK  61

Query  2576  RSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQ  2397
             + GEMARKLRFFKDQM KAGV  S+ S T++ I  D L++KLG+LEAEL+E+NANNDKLQ
Sbjct  62    KCGEMARKLRFFKDQMEKAGVFPSSKSTTRNDINMDGLDIKLGELEAELVEMNANNDKLQ  121

Query  2396  RSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTSK  2217
             R++NEL+EYKLVL K GEFF SA SSA +QQ+E  S Q GEESLE PLL + ++S D+SK
Sbjct  122   RTYNELIEYKLVLHKAGEFFSSALSSATSQQRELESGQVGEESLETPLLGDQEISTDSSK  181

Query  2216  QVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFY  2037
             QV+LGF++GLVPK+KS+AFERI+FRATRGNV LRQ+ V+E VIDP+SGEK+EKNVF+VF+
Sbjct  182   QVKLGFLTGLVPKDKSIAFERIIFRATRGNVFLRQAAVEEPVIDPVSGEKIEKNVFVVFF  241

Query  2036  SGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQ  1857
             SGE+AK KILKIC+AFGANRYPF E+LGKQ Q+ITEVSG++SELKT IDAG+LHR NLL+
Sbjct  242   SGEKAKTKILKICEAFGANRYPFTEDLGKQNQMITEVSGRLSELKTTIDAGLLHRSNLLR  301

Query  1856  SIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDS  1677
             +IA+QF +WN +VR+EKS+YHTLNMLS+DVTKKCLVAE WSP  A+ +IQ+AL RA  DS
Sbjct  302   TIADQFVQWNSMVRKEKSVYHTLNMLSLDVTKKCLVAEAWSPVFASKQIQEALHRAAFDS  361

Query  1676  NSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFA  1497
             NS++GAIF+VL  +ESPPTYF+TNKFTSAFQEIVD+YGVAKYQEANPGVFTIVTFPFLFA
Sbjct  362   NSQVGAIFQVLHAKESPPTYFRTNKFTSAFQEIVDSYGVAKYQEANPGVFTIVTFPFLFA  421

Query  1496  VMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYN  1317
             VMFGDWGHGICLLLATL F+IREKKLSSQKLGDITEMTFGGRYVIL+MALFSIYTG IYN
Sbjct  422   VMFGDWGHGICLLLATLVFIIREKKLSSQKLGDITEMTFGGRYVILLMALFSIYTGLIYN  481

Query  1316  EFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKM  1137
             EFFSV FELFGRSAY CRD SC DATT GLIK   TY FGVDP WHGTRSELPFLNSLKM
Sbjct  482   EFFSVPFELFGRSAYACRDLSCRDATTDGLIKVGPTYPFGVDPVWHGTRSELPFLNSLKM  541

Query  1136  KLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTG  957
             K+SIL+GVAQMNLGIILSYFNA YFR+ +N W QFIPQ+IFLN+LFGYLS+LII+KW TG
Sbjct  542   KMSILIGVAQMNLGIILSYFNALYFRNSLNTWFQFIPQMIFLNSLFGYLSLLIILKWSTG  601

Query  956   SQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQH-  780
             SQADLYHVMIYMFL PT++L ENQLFPGQKT QLVL+LLALVSVPWMLLPKP +LK QH 
Sbjct  602   SQADLYHVMIYMFLSPTDELEENQLFPGQKTAQLVLLLLALVSVPWMLLPKPLLLKKQHQ  661

Query  779   NRHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYL  600
             +RHQGQ Y P+Q  +ESL V+ +HDS  HEEFEFSEVFVHQLIHTIEFVLGAVSNTASYL
Sbjct  662   DRHQGQLYTPLQSTEESLQVEVNHDSHGHEEFEFSEVFVHQLIHTIEFVLGAVSNTASYL  721

Query  599   RLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHA  420
             RLWALSLAHSELS+VFYEKVLLLAWG+NN+IIL+VG I+FIFAT+GVLLVMETLSAFLHA
Sbjct  722   RLWALSLAHSELSSVFYEKVLLLAWGFNNVIILIVGIIVFIFATVGVLLVMETLSAFLHA  781

Query  419   LRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             LRLHWVEFQNKFYEGDGYKF PFSF LVD+EE+
Sbjct  782   LRLHWVEFQNKFYEGDGYKFHPFSFALVDDEEE  814



>ref|XP_003537855.1| PREDICTED: vacuolar proton ATPase a3-like [Glycine max]
Length=818

 Score =  1220 bits (3156),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 634/815 (78%), Positives = 724/815 (89%), Gaps = 2/815 (0%)
 Frame = -2

Query  2765  GRGGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAA  2586
              RGGC PPMDLFRSEPMQLVQLIIPIESA  +V+YLGDLGL+QFKDLNA+KSPFQRTYAA
Sbjct  5     ARGGCCPPMDLFRSEPMQLVQLIIPIESAHRTVSYLGDLGLLQFKDLNADKSPFQRTYAA  64

Query  2585  QIKRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANND  2406
             QI+RSGEMAR+LRFFK+QM KAGVS   ++   D +  DDLEVKL ++E+EL E+NAN +
Sbjct  65    QIRRSGEMARRLRFFKEQMLKAGVSPKYSTTPVD-VNIDDLEVKLTEIESELTEMNANGE  123

Query  2405  KLQRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSAD  2226
             KLQRS+NELVEYKLVLQK GEFFHSA+S A  QQ+E  S     ES+E PLL + ++S D
Sbjct  124   KLQRSYNELVEYKLVLQKAGEFFHSAQSRALEQQREQESCHLSGESIETPLLQDQELSVD  183

Query  2225  TSKQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFL  2046
             +SKQV+LGF++GLVP+EKSM FERILFRATRGNV LRQ+ V++ V DP+SGEK EKNVF+
Sbjct  184   SSKQVKLGFLAGLVPREKSMVFERILFRATRGNVFLRQATVEDPVTDPVSGEKTEKNVFV  243

Query  2045  VFYSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGN  1866
             VFY+GE+AK KILKIC+AFGANRYPFAEELGKQAQ+ITEVSG++ ELKT +DAG+LHR N
Sbjct  244   VFYAGEKAKAKILKICEAFGANRYPFAEELGKQAQMITEVSGRLLELKTTLDAGLLHRNN  303

Query  1865  LLQSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAG  1686
             LL +I  QF++W+VLVR+EKSI+HTLNMLS+DVTKKCLVAEGWSP  AT +IQ+ALQRA 
Sbjct  304   LLNTIGAQFEQWDVLVRKEKSIHHTLNMLSLDVTKKCLVAEGWSPVFATKQIQEALQRAA  363

Query  1685  HDSNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPF  1506
              DSNS++ AIF+VL TRE PPTYF+TNKFTS+FQ I+D+YGVAKYQEANP V+T+VTFPF
Sbjct  364   LDSNSQVNAIFQVLQTRELPPTYFRTNKFTSSFQGIIDSYGVAKYQEANPTVYTVVTFPF  423

Query  1505  LFAVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGF  1326
             LFAVMFGDWGHGICLLLA LYF+IREKKLSSQKL DITEMTFGGRYVIL+MA+FSIYTGF
Sbjct  424   LFAVMFGDWGHGICLLLAALYFIIREKKLSSQKLDDITEMTFGGRYVILLMAIFSIYTGF  483

Query  1325  IYNEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNS  1146
             IYNEFFSV F +F  SAY CRD SC DATT+GLIK RDTY FGVDP WHGTRSELPFLNS
Sbjct  484   IYNEFFSVPFAIFAPSAYDCRDLSCRDATTVGLIKVRDTYPFGVDPVWHGTRSELPFLNS  543

Query  1145  LKMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKW  966
             LKMK+SILLGVAQMNLGI++SYFNA +FR+ VN W QFIPQ+IFLN+LFGYLS+LIIVKW
Sbjct  544   LKMKMSILLGVAQMNLGIVMSYFNAIFFRNSVNVWFQFIPQMIFLNSLFGYLSLLIIVKW  603

Query  965   CTGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKS  786
              TGSQADLYH++IYMFL PT+DLGENQLF GQK  QLVL+LLA++SVPWMLLPKPFILK 
Sbjct  604   ATGSQADLYHILIYMFLSPTDDLGENQLFAGQKNLQLVLLLLAVISVPWMLLPKPFILKK  663

Query  785   QHN-RHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTA  609
             QH  RH  +SYAP+Q  DESL V+ +HDS  HEEFEFSEVFVHQLIHTIEFVLGAVSNTA
Sbjct  664   QHEARHGVESYAPLQSTDESLQVESNHDSHGHEEFEFSEVFVHQLIHTIEFVLGAVSNTA  723

Query  608   SYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAF  429
             SYLRLWALSLAHSELS+VFYEKVL++AWGYNN+IIL+VG I+FIFAT+GVLLVMETLSAF
Sbjct  724   SYLRLWALSLAHSELSSVFYEKVLMMAWGYNNVIILIVGLIVFIFATVGVLLVMETLSAF  783

Query  428   LHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEE  324
             LHALRLHWVEFQNKFYEGDGYKF PFSF  +D+EE
Sbjct  784   LHALRLHWVEFQNKFYEGDGYKFHPFSFSWLDDEE  818



>ref|XP_010555275.1| PREDICTED: V-type proton ATPase subunit a3-like [Tarenaya hassleriana]
Length=821

 Score =  1219 bits (3155),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 622/815 (76%), Positives = 709/815 (87%), Gaps = 3/815 (0%)
 Frame = -2

Query  2759  GGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQI  2580
             GGC PPMDL RSEPMQLVQLIIP+ESA L+V+YLGDLGL+QFKDLN++ SPFQRTYAAQ+
Sbjct  7     GGCCPPMDLMRSEPMQLVQLIIPMESAHLTVSYLGDLGLVQFKDLNSDTSPFQRTYAAQL  66

Query  2579  KRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKL  2400
             KR GEMARK+RFFK+QMSK GVS     +  D + FDDLEVKLGDLE EL+EINANNDKL
Sbjct  67    KRCGEMARKIRFFKEQMSKGGVSPKVILEKGDDLDFDDLEVKLGDLEGELVEINANNDKL  126

Query  2399  QRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTS  2220
             QRS+NELVEYKLVLQK GEFF SA     A   +   S    E      L + + S D+S
Sbjct  127   QRSYNELVEYKLVLQKAGEFFSSA-LQIAAAHHQEMGSHQAGEDPLEAPLLQEEKSIDSS  185

Query  2219  KQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVF  2040
             KQV+LGF++GLVP+EKSMAFERILFRATRGN+ +RQS  +E V+DP+SGEK EKNVF+VF
Sbjct  186   KQVKLGFLTGLVPREKSMAFERILFRATRGNIFMRQSVAEEPVVDPVSGEKTEKNVFVVF  245

Query  2039  YSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLL  1860
             +SGERAK+KILKIC+AFGANRYPF+E+LGKQAQ++T+VS ++ ELKT ID G+ HR NLL
Sbjct  246   FSGERAKSKILKICEAFGANRYPFSEDLGKQAQMMTQVSSRLVELKTTIDVGLGHRNNLL  305

Query  1859  QSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHD  1680
             ++I ++F++W++ VR+EK+IYHTLNMLS+DVTKKCLVAEGWSP  A  EIQDALQ A  D
Sbjct  306   ETIGDKFEKWSLKVRKEKAIYHTLNMLSLDVTKKCLVAEGWSPVFAAKEIQDALQHAAID  365

Query  1679  SNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLF  1500
             SNS++G+IF+VLGT+ESPPTYF+TNKFTSAFQEIVDAYG+AKYQEANPGV+TIVTFPFLF
Sbjct  366   SNSQVGSIFQVLGTKESPPTYFRTNKFTSAFQEIVDAYGIAKYQEANPGVYTIVTFPFLF  425

Query  1499  AVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIY  1320
             AVMFGDWGHGICLLLAT+YF++REKKLSSQKLGDI EM FGGRYVI MM+LFSI+TG IY
Sbjct  426   AVMFGDWGHGICLLLATMYFIMREKKLSSQKLGDIAEMAFGGRYVIFMMSLFSIFTGLIY  485

Query  1319  NEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLK  1140
             NEFFSV F LF  SAY CRD SCS+ATTIGLIK RDTY FGVDP WHGTRSELPFLNSLK
Sbjct  486   NEFFSVPFPLFAPSAYDCRDASCSEATTIGLIKVRDTYPFGVDPVWHGTRSELPFLNSLK  545

Query  1139  MKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCT  960
             MK+SILLGVAQMNLGII+S+FNA +F SGVN W QFIPQ+IFLN+LFGYLSVL+I+KWCT
Sbjct  546   MKMSILLGVAQMNLGIIMSFFNAKFFGSGVNIWFQFIPQMIFLNSLFGYLSVLVIIKWCT  605

Query  959   GSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQH  780
             GSQADLYHVMIYMFL PT++LGENQLFP QKT QLVL+LLALVSVPWMLLPKPFILK QH
Sbjct  606   GSQADLYHVMIYMFLSPTDELGENQLFPYQKTVQLVLLLLALVSVPWMLLPKPFILKKQH  665

Query  779   N-RHQGQSYAPIQDLDESLLvdgshdssdheef-efsevfvHQLIHTIEFVLGAVSNTAS  606
               RHQGQ+Y  IQ+ D+SLL     + S+  E  EFSE+FVHQLIHTIEFVLGAVSNTAS
Sbjct  666   EARHQGQAYRAIQEADDSLLQVEESEDSNGHEEFEFSEIFVHQLIHTIEFVLGAVSNTAS  725

Query  605   YLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFL  426
             YLRLWALSLAHSELS+VFYEKVLLLAWG+NN++ILVVG I+FIFAT+GVLLVMETLSAFL
Sbjct  726   YLRLWALSLAHSELSSVFYEKVLLLAWGFNNVVILVVGIIVFIFATVGVLLVMETLSAFL  785

Query  425   HALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             HALRLHWVEFQNKFYEGDGYKF PFSF L    +D
Sbjct  786   HALRLHWVEFQNKFYEGDGYKFSPFSFSLSASADD  820



>ref|XP_002313024.2| vacuolar proton ATPase family protein [Populus trichocarpa]
 gb|EEE86979.2| vacuolar proton ATPase family protein [Populus trichocarpa]
Length=821

 Score =  1218 bits (3151),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 643/822 (78%), Positives = 726/822 (88%), Gaps = 2/822 (0%)
 Frame = -2

Query  2783  MAERLGGRGGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPF  2604
             MAE   G GGC PPMDLFRSE MQLVQLIIPIESA  +V+YLGDLGL+QFKDLNA+KSPF
Sbjct  1     MAEARAG-GGCCPPMDLFRSEAMQLVQLIIPIESAHHTVSYLGDLGLLQFKDLNADKSPF  59

Query  2603  QRTYAAQIKRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIE  2424
             QRTYAAQIK+ GEMARKLRFFK+QM KAG+        Q  I  DDLEVKLG+LEAEL+E
Sbjct  60    QRTYAAQIKKFGEMARKLRFFKEQMVKAGIIPLTKPGAQTEIDVDDLEVKLGELEAELVE  119

Query  2423  INANNDKLQRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllse  2244
             +NANN+KLQRS+NELVEYKLVL K GEFF SA  +A A Q+E  S Q+GEESL+APLL +
Sbjct  120   MNANNEKLQRSYNELVEYKLVLNKAGEFFSSALRNATALQKELESQQTGEESLDAPLLQD  179

Query  2243  PDMSADTSKQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKV  2064
              ++  ++SKQV+LGFI+GLVPKEKSM FERI+FRATRGNV +RQ+ V+E V+DP+SGEKV
Sbjct  180   KEILNESSKQVKLGFITGLVPKEKSMPFERIIFRATRGNVYIRQAAVEEPVVDPVSGEKV  239

Query  2063  EKNVFLVFYSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAG  1884
             EKNV++VFYSGE+AK KILKIC+AFGANRYPF E+ GKQ Q+I+EVSG+ISE+K AIDAG
Sbjct  240   EKNVYVVFYSGEKAKTKILKICEAFGANRYPFTEDFGKQIQMISEVSGRISEMKAAIDAG  299

Query  1883  ILHRGNLLQSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQD  1704
             + HR +LLQ+I +QF +WN LVR+EKSIYHTLNMLS+DVTKKCLVAEGWSP   T +IQD
Sbjct  300   LFHRSHLLQTIGDQFVQWNTLVRKEKSIYHTLNMLSLDVTKKCLVAEGWSPVFGTKQIQD  359

Query  1703  ALQRAGHDSNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFT  1524
             ALQRA  DSNS++G IF+VL T E PPTYF+TNKFTSAFQ+IVDAYGVAKYQEANPGV+T
Sbjct  360   ALQRAAFDSNSQVGTIFQVLHTTELPPTYFRTNKFTSAFQDIVDAYGVAKYQEANPGVYT  419

Query  1523  IVTFPFLFAVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALF  1344
             IVTFPFLFAVMFGDWGHGIC+LLATL F+IREKKLS QKLGDITEMTFGGRYVILMMALF
Sbjct  420   IVTFPFLFAVMFGDWGHGICMLLATLVFIIREKKLSGQKLGDITEMTFGGRYVILMMALF  479

Query  1343  SIYTGFIYNEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSE  1164
             SIYTG IYNEFFSV FELF  SAY CRD SC DATT GLIK R TY FGVDP WHG+RSE
Sbjct  480   SIYTGLIYNEFFSVPFELFAPSAYACRDLSCRDATTDGLIKVRPTYPFGVDPVWHGSRSE  539

Query  1163  LPFLNSLKMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSV  984
             LPFLNSLKMK+SILLGVAQMNLGIILSYFNA YF++ +N W QFIPQ+IFLN+LFGYLS+
Sbjct  540   LPFLNSLKMKMSILLGVAQMNLGIILSYFNATYFKNSLNIWFQFIPQMIFLNSLFGYLSL  599

Query  983   LIIVKWCTGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPK  804
             LIIVKW TGSQADLYHVMIYMFL PT++LGEN+LFP QKT QLVL+LLALVSVPWMLLPK
Sbjct  600   LIIVKWSTGSQADLYHVMIYMFLSPTDELGENELFPRQKTVQLVLLLLALVSVPWMLLPK  659

Query  803   PFILKSQHN-RHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLG  627
             PF+LK QH  RHQG+SY P+Q  +ESL ++ +HDS  HEEFEFSEVFVHQ+IHTIEFVLG
Sbjct  660   PFLLKKQHEARHQGESYTPLQSTEESLQLETNHDSHGHEEFEFSEVFVHQMIHTIEFVLG  719

Query  626   AVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVM  447
             AVSNTASYLRLWALSLAHSELS+VFYEKVLLLAWGY+NI ILV+G I+FIFAT+GVLLVM
Sbjct  720   AVSNTASYLRLWALSLAHSELSSVFYEKVLLLAWGYHNIFILVIGAIVFIFATVGVLLVM  779

Query  446   ETLSAFLHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             ETLSAFLHALRLHWVEFQNKFYEGDGYKF PFSF LV++E++
Sbjct  780   ETLSAFLHALRLHWVEFQNKFYEGDGYKFYPFSFALVNDEDE  821



>gb|KHN39818.1| V-type proton ATPase 116 kDa subunit a isoform 1 [Glycine soja]
Length=818

 Score =  1217 bits (3150),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 633/815 (78%), Positives = 723/815 (89%), Gaps = 2/815 (0%)
 Frame = -2

Query  2765  GRGGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAA  2586
              RGGC PPMDLFRSEPMQLVQLIIPIESA  +V+YLGDLGL+QFKDLNA+KSPFQRTYAA
Sbjct  5     ARGGCCPPMDLFRSEPMQLVQLIIPIESAHRTVSYLGDLGLLQFKDLNADKSPFQRTYAA  64

Query  2585  QIKRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANND  2406
             QI+RSGEMAR+LRFFK+QM KAGVS   ++   D +  DDLEVKL ++E+EL E+NAN +
Sbjct  65    QIRRSGEMARRLRFFKEQMLKAGVSPKYSTTPVD-VNIDDLEVKLTEIESELTEMNANGE  123

Query  2405  KLQRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSAD  2226
             KLQRS+NELVEYKLVLQK GEFFHSA+S A  QQ+E  S     ES+E PLL + ++S D
Sbjct  124   KLQRSYNELVEYKLVLQKAGEFFHSAQSRALEQQREQESCHLSGESIETPLLQDQELSVD  183

Query  2225  TSKQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFL  2046
             +SKQV+LGF++GLVP+EKSM FERILFRATRGNV LRQ+ V++ V DP+SGEK EKNVF+
Sbjct  184   SSKQVKLGFLAGLVPREKSMVFERILFRATRGNVFLRQATVEDPVTDPVSGEKTEKNVFV  243

Query  2045  VFYSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGN  1866
             VFY+GE+AK KILKIC+AFGANRYPFAEELGKQAQ+ITEVSG++ ELKT +DAG+LHR N
Sbjct  244   VFYAGEKAKAKILKICEAFGANRYPFAEELGKQAQMITEVSGRLLELKTTLDAGLLHRNN  303

Query  1865  LLQSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAG  1686
             LL +I  QF++W+VLVR+EKSI+HTLNMLS+DVTKKCLVAEGWSP  AT +IQ+ALQRA 
Sbjct  304   LLNTIGAQFEQWDVLVRKEKSIHHTLNMLSLDVTKKCLVAEGWSPVFATKQIQEALQRAA  363

Query  1685  HDSNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPF  1506
              DSNS++ AIF+VL TRE PPTYF+TNKFTS+FQ I+D+YGVAKYQEANP V+T+VTFPF
Sbjct  364   LDSNSQVNAIFQVLQTRELPPTYFRTNKFTSSFQGIIDSYGVAKYQEANPTVYTVVTFPF  423

Query  1505  LFAVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGF  1326
             LFAVMFGDWGHGICLLLA LYF+IREKKLSSQKL DITEMTFGGRYVIL+MA+FSIYTGF
Sbjct  424   LFAVMFGDWGHGICLLLAALYFIIREKKLSSQKLDDITEMTFGGRYVILLMAIFSIYTGF  483

Query  1325  IYNEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNS  1146
             IYNEFFSV F +F  SAY CRD SC DATT+GLIK RDTY FGVDP WHGTRSELPFLNS
Sbjct  484   IYNEFFSVPFAIFAPSAYDCRDLSCRDATTVGLIKVRDTYPFGVDPVWHGTRSELPFLNS  543

Query  1145  LKMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKW  966
             LKMK+SI LGVAQMNLGI++SYFNA +FR+ VN W QFIPQ+IFLN+LFGYLS+LIIVKW
Sbjct  544   LKMKMSIPLGVAQMNLGIVMSYFNAIFFRNSVNVWFQFIPQMIFLNSLFGYLSLLIIVKW  603

Query  965   CTGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKS  786
              TGSQADLYH++IYMFL PT+DLGENQLF GQK  QLVL+LLA++SVPWMLLPKPFILK 
Sbjct  604   ATGSQADLYHILIYMFLSPTDDLGENQLFAGQKNLQLVLLLLAVISVPWMLLPKPFILKK  663

Query  785   QHN-RHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTA  609
             QH  RH  +SYAP+Q  DESL V+ +HDS  HEEFEFSEVFVHQLIHTIEFVLGAVSNTA
Sbjct  664   QHEARHGVESYAPLQSTDESLQVESNHDSHGHEEFEFSEVFVHQLIHTIEFVLGAVSNTA  723

Query  608   SYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAF  429
             SYLRLWALSLAHSELS+VFYEKVL++AWGYNN+IIL+VG I+FIFAT+GVLLVMETLSAF
Sbjct  724   SYLRLWALSLAHSELSSVFYEKVLMMAWGYNNVIILIVGLIVFIFATVGVLLVMETLSAF  783

Query  428   LHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEE  324
             LHALRLHWVEFQNKFYEGDGYKF PFSF  +D+EE
Sbjct  784   LHALRLHWVEFQNKFYEGDGYKFHPFSFSWLDDEE  818



>ref|XP_008448072.1| PREDICTED: vacuolar proton ATPase a3 [Cucumis melo]
Length=818

 Score =  1217 bits (3150),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 638/815 (78%), Positives = 728/815 (89%), Gaps = 2/815 (0%)
 Frame = -2

Query  2762  RGGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQ  2583
             RGGC PPMDLFRSEPMQLVQLIIPIESA  +++YLGDLGL+QFKDLNA+KSPFQRTYAAQ
Sbjct  5     RGGCCPPMDLFRSEPMQLVQLIIPIESAHRTISYLGDLGLLQFKDLNADKSPFQRTYAAQ  64

Query  2582  IKRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDK  2403
             IKR GEMARKL FFK+Q+ KAG+S S +S +Q  I  DDLEVKLG+LEAEL+EINAN++K
Sbjct  65    IKRCGEMARKLNFFKEQILKAGLS-SKSSVSQVDINIDDLEVKLGELEAELVEINANSEK  123

Query  2402  LQRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADT  2223
             LQRS+NEL+EYKLVLQK GEFF +A+SSA  QQ+E+ S ++G +S+E PLL E +   D 
Sbjct  124   LQRSYNELLEYKLVLQKAGEFFTAAQSSAVEQQREFESRRTGGDSIEVPLLLEQESLVDQ  183

Query  2222  SKQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLV  2043
             SK V LGF+SGLVP+EKSMAFERILFRATRGNV L+Q+EV++ V DP+SGEKVEKNVF+V
Sbjct  184   SKPVNLGFLSGLVPREKSMAFERILFRATRGNVFLKQTEVEDPVADPVSGEKVEKNVFIV  243

Query  2042  FYSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNL  1863
             FYSGERAK+KILKIC+AFGANRYPF E++GKQAQ+I EVSGK+SELKT ID G+LHRGNL
Sbjct  244   FYSGERAKSKILKICEAFGANRYPFTEDVGKQAQMIAEVSGKLSELKTTIDIGLLHRGNL  303

Query  1862  LQSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGH  1683
             LQ+I E F+ WN+L R+EKSIYH LNMLS+DVTKKCLVAEGW P  AT +IQDALQRA  
Sbjct  304   LQTIGEHFENWNLLARKEKSIYHILNMLSLDVTKKCLVAEGWGPVFATKQIQDALQRAAS  363

Query  1682  DSNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFL  1503
             DSNS++G IF+VL T E+PPTYF+TNKF+SAFQEIVDAYGVA+YQEANPGV+TIVTFPFL
Sbjct  364   DSNSQVGPIFQVLLTTEAPPTYFRTNKFSSAFQEIVDAYGVARYQEANPGVYTIVTFPFL  423

Query  1502  FAVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFI  1323
             FAVMFGDWGHGICL LATLYF++REKKLSSQKLGDITEM FGGRYVILMM+LFSIYTG I
Sbjct  424   FAVMFGDWGHGICLFLATLYFILREKKLSSQKLGDITEMAFGGRYVILMMSLFSIYTGLI  483

Query  1322  YNEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSL  1143
             YNEFFSV F LFGRSAY CR P CSD+TT+GLIK   TY FG+DP WHGTRSELPFLNSL
Sbjct  484   YNEFFSVPFGLFGRSAYECRSPDCSDSTTMGLIKVGSTYPFGLDPVWHGTRSELPFLNSL  543

Query  1142  KMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWC  963
             KMK+SILLGVAQMNLGII+SYFNA +FR+ +N W QF+PQ+IFLN+LFGYLS+LII+KWC
Sbjct  544   KMKMSILLGVAQMNLGIIISYFNATFFRNSINIWFQFLPQMIFLNSLFGYLSLLIIIKWC  603

Query  962   TGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQ  783
             TGS ADLYHVMIYMFLGPT+DL ENQLFPGQK  Q+VL+LLALV+VPWMLLPKPF+LK Q
Sbjct  604   TGSNADLYHVMIYMFLGPTDDLAENQLFPGQKNVQIVLLLLALVAVPWMLLPKPFLLKRQ  663

Query  782   H-NRHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTAS  606
             H  R QGQSYAP+   D+SL +D  HDS  HEEFEFSEVFVHQLIHTIEFVLGAVSNTAS
Sbjct  664   HEQRFQGQSYAPLPSGDDSLELDSHHDSHGHEEFEFSEVFVHQLIHTIEFVLGAVSNTAS  723

Query  605   YLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFL  426
             YLRLWALSLAHSELS+VFY+KVL+L+ G+NNIIIL+VG I+FIFAT+GVLL+METLSAFL
Sbjct  724   YLRLWALSLAHSELSSVFYDKVLVLSAGFNNIIILIVGIIVFIFATVGVLLLMETLSAFL  783

Query  425   HALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             HALRLHWVEFQNKFYEGDGYKF PFSF L+DE++D
Sbjct  784   HALRLHWVEFQNKFYEGDGYKFHPFSFALLDEDDD  818



>ref|XP_010531458.1| PREDICTED: V-type proton ATPase subunit a2 [Tarenaya hassleriana]
Length=821

 Score =  1217 bits (3149),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 651/823 (79%), Positives = 735/823 (89%), Gaps = 5/823 (1%)
 Frame = -2

Query  2783  MAERLGGRGGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPF  2604
             M E  GG  GC PPMDL RSEPMQLVQLIIP+ESA L+V+YLGDLGL+QFKDLN++KSPF
Sbjct  1     MGESRGG--GCCPPMDLMRSEPMQLVQLIIPVESAHLTVSYLGDLGLVQFKDLNSDKSPF  58

Query  2603  QRTYAAQIKRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIE  2424
             QRTYAAQIKR GEMARK+RFFK+QMSKAGVS     +  D + FDDLEVKLGDLEAEL+E
Sbjct  59    QRTYAAQIKRCGEMARKVRFFKEQMSKAGVSPKIILEKGDDLDFDDLEVKLGDLEAELVE  118

Query  2423  INANNDKLQRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllse  2244
             INANNDKLQRS+NELVEYK+VLQK GEFF  A  SA A  QE  S Q+GE++LE PLL E
Sbjct  119   INANNDKLQRSYNELVEYKMVLQKAGEFFSYAHQSATAHHQEMESRQAGEDALEVPLLQE  178

Query  2243  PDMSADTSKQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKV  2064
              + S D+SKQV+LGF++GLVP+EKSM FERILFRATRGN+ +RQS V+E V+DP+SGEK 
Sbjct  179   -EKSVDSSKQVKLGFLTGLVPREKSMLFERILFRATRGNIFIRQSVVEEPVVDPVSGEKT  237

Query  2063  EKNVFLVFYSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAG  1884
             EKNVF+VFYSGERAK+KILKIC+AFGANRYPF+E+LGKQAQ++TEVSGK++E+ T IDAG
Sbjct  238   EKNVFVVFYSGERAKSKILKICEAFGANRYPFSEDLGKQAQMMTEVSGKLAEINTTIDAG  297

Query  1883  ILHRGNLLQSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQD  1704
             + HR NLL+ IA++F++WNV VR+EK+IYHTLNMLS+DVTKKCLVAEGWSP  A  +IQD
Sbjct  298   LGHRNNLLEIIADKFEQWNVKVRKEKAIYHTLNMLSLDVTKKCLVAEGWSPVFAANDIQD  357

Query  1703  ALQRAGHDSNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFT  1524
             ALQR   DSNS++G+IF+VL T+ESPPTYF+TNKFTSAFQEIVDAYG+AKYQEANPGV+T
Sbjct  358   ALQRGAVDSNSQVGSIFQVLRTKESPPTYFRTNKFTSAFQEIVDAYGIAKYQEANPGVYT  417

Query  1523  IVTFPFLFAVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALF  1344
             IVTFPFLFAVMFGDWGHGICLLLATLYF++REKKLSSQKLGDITEMTFGGRYVI MM+LF
Sbjct  418   IVTFPFLFAVMFGDWGHGICLLLATLYFIVREKKLSSQKLGDITEMTFGGRYVIFMMSLF  477

Query  1343  SIYTGFIYNEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSE  1164
             SI+TG IYNEFFSV F LF  SAY CRD SCS+ATTIGLIK RDTY FGVDP WHGTRSE
Sbjct  478   SIFTGLIYNEFFSVPFPLFAPSAYDCRDTSCSEATTIGLIKVRDTYPFGVDPVWHGTRSE  537

Query  1163  LPFLNSLKMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSV  984
             LPFLNSLKMK+SILLGVAQMNLGII+SYFNA +F  GVN W QFIPQ+IFLN+LFGYLSV
Sbjct  538   LPFLNSLKMKMSILLGVAQMNLGIIMSYFNAKFFGIGVNIWFQFIPQMIFLNSLFGYLSV  597

Query  983   LIIVKWCTGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPK  804
             LII+KWCTGSQADLYHVMIYMFL PT++LGENQ+FP QKT QLVL+LLALVSVPWMLLPK
Sbjct  598   LIIIKWCTGSQADLYHVMIYMFLSPTDELGENQVFPYQKTVQLVLLLLALVSVPWMLLPK  657

Query  803   PFILKSQH-NRHQGQSYAPIQDLDE-SLLvdgshdssdheefefsevfvHQLIHTIEFVL  630
             PFILK QH  RHQG SYA +++ D+ SL V+ S +S +HEEFEFSE+FVHQLIHTIEFVL
Sbjct  658   PFILKKQHETRHQGHSYAQLEETDDNSLQVETSEESHEHEEFEFSEIFVHQLIHTIEFVL  717

Query  629   GAVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLV  450
             GAVSNTASYLRLWALSLAHSELS+VFYEKVLLLAWG+NN+IILVVG I+FIFAT+GVLLV
Sbjct  718   GAVSNTASYLRLWALSLAHSELSSVFYEKVLLLAWGFNNVIILVVGIIVFIFATVGVLLV  777

Query  449   METLSAFLHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             METLSAFLHALRLHWVEFQNKFYEGDGYKF PFSF LV  E+D
Sbjct  778   METLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFALVSSEDD  820



>ref|XP_006286207.1| hypothetical protein CARUB_v10007773mg [Capsella rubella]
 gb|EOA19105.1| hypothetical protein CARUB_v10007773mg [Capsella rubella]
Length=819

 Score =  1217 bits (3149),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 636/822 (77%), Positives = 727/822 (88%), Gaps = 4/822 (0%)
 Frame = -2

Query  2783  MAERLGGRGGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPF  2604
             M E  GG  GC P MDL RSE MQLVQLI+P+ESA L+V+YLGDLGL+QFKDLN+EKSPF
Sbjct  1     MGESRGG--GCCPSMDLMRSETMQLVQLIVPMESAHLTVSYLGDLGLVQFKDLNSEKSPF  58

Query  2603  QRTYAAQIKRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIE  2424
             QRTYAAQIKR GEMARK+RFFKDQMSKAGV      + +  I  DD+EVKLG+LEAEL+E
Sbjct  59    QRTYAAQIKRCGEMARKIRFFKDQMSKAGVLPKEMLEKEIDIDLDDVEVKLGELEAELVE  118

Query  2423  INANNDKLQRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllse  2244
             INANNDKLQRS+NEL+EYKLVLQK GEFF SA  SA AQQ+E  S Q+GE+ LE+PLL E
Sbjct  119   INANNDKLQRSYNELMEYKLVLQKAGEFFSSAHRSATAQQREIESQQTGEDLLESPLLQE  178

Query  2243  PDMSADTSKQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKV  2064
              + + D++KQV+LGF++GLVP+EKSM FERILFRATRGN+ +RQ+ ++E VIDP SGEK 
Sbjct  179   -EKAIDSTKQVKLGFLTGLVPREKSMVFERILFRATRGNIFIRQTVIEEPVIDPNSGEKA  237

Query  2063  EKNVFLVFYSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAG  1884
             EKNVF+VFYSGERAK+KILKIC+AFGANRYPF+E+LG+QAQ+ITEVSG++SELKT IDAG
Sbjct  238   EKNVFVVFYSGERAKSKILKICEAFGANRYPFSEDLGRQAQMITEVSGRLSELKTTIDAG  297

Query  1883  ILHRGNLLQSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQD  1704
             + HR  LLQSI ++F+ WN+ VR+EK+IYHTLNMLS+DVTKKCLVAEGWSP  A+ EIQD
Sbjct  298   LGHRNILLQSIGDKFELWNLKVRKEKAIYHTLNMLSLDVTKKCLVAEGWSPVFASKEIQD  357

Query  1703  ALQRAGHDSNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFT  1524
             ALQRA  DSNS++G+IF+VL T+ESPPTYF+TNKFTSA QEIVDAYGVAKYQEANPGVFT
Sbjct  358   ALQRAAVDSNSQVGSIFQVLRTKESPPTYFRTNKFTSAIQEIVDAYGVAKYQEANPGVFT  417

Query  1523  IVTFPFLFAVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALF  1344
             IVTFPFLFAVMFGDWGHGIC+LLAT+Y ++REKKLSSQKLGDI EM FGGRYVILMM++F
Sbjct  418   IVTFPFLFAVMFGDWGHGICILLATMYLILREKKLSSQKLGDIMEMAFGGRYVILMMSIF  477

Query  1343  SIYTGFIYNEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSE  1164
             SIYTG IYNEFFS+ + LF  SAY CRD SCS+ATTIGLIK RDTY FG+DP WHGTRSE
Sbjct  478   SIYTGLIYNEFFSIPYPLFAPSAYDCRDASCSEATTIGLIKVRDTYPFGLDPVWHGTRSE  537

Query  1163  LPFLNSLKMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSV  984
             LPFLNSLKMK+SILLGV+QMNLGII+SYFNA +F+S VN W QFIPQ+IFLN+LFGYLSV
Sbjct  538   LPFLNSLKMKMSILLGVSQMNLGIIMSYFNARFFKSSVNIWFQFIPQMIFLNSLFGYLSV  597

Query  983   LIIVKWCTGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPK  804
             LII+KWCTGSQADLYHVMIYMFL PT++LGENQLFP QK  QLVL+ LALVSVP MLLPK
Sbjct  598   LIIIKWCTGSQADLYHVMIYMFLSPTDELGENQLFPHQKIVQLVLLFLALVSVPCMLLPK  657

Query  803   PFILKSQHN-RHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLG  627
             PFILK QH  RHQGQSYAP+ + DESL V+ +  S  HEEFEFSE+FVHQLIHTIEFVLG
Sbjct  658   PFILKKQHEARHQGQSYAPLDETDESLHVETNGGSHGHEEFEFSEIFVHQLIHTIEFVLG  717

Query  626   AVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVM  447
             AVSNTASYLRLWALSLAHSELS+VFYEKVLLLAWGYNN++IL+VG I+FIFAT+GVLLVM
Sbjct  718   AVSNTASYLRLWALSLAHSELSSVFYEKVLLLAWGYNNVLILIVGIIVFIFATVGVLLVM  777

Query  446   ETLSAFLHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             ETLSAFLHALRLHWVEFQNKFYEGDGYKF PF+F+    E++
Sbjct  778   ETLSAFLHALRLHWVEFQNKFYEGDGYKFAPFTFIFTANEDE  819



>ref|XP_004148529.1| PREDICTED: vacuolar proton ATPase a3-like [Cucumis sativus]
 gb|KGN43160.1| hypothetical protein Csa_7G004130 [Cucumis sativus]
Length=818

 Score =  1217 bits (3148),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 638/815 (78%), Positives = 727/815 (89%), Gaps = 2/815 (0%)
 Frame = -2

Query  2762  RGGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQ  2583
             RGGC P MDLFRSEPMQLVQLIIPIESA  +++YLGDLGL+QFKDLNA+KSPFQRTYAAQ
Sbjct  5     RGGCCPSMDLFRSEPMQLVQLIIPIESAHRTISYLGDLGLLQFKDLNADKSPFQRTYAAQ  64

Query  2582  IKRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDK  2403
             IKR GEMARKL FFK+Q+ +AG+S S +S +Q  I  DDLEVKLG+LEAEL+EINAN++K
Sbjct  65    IKRCGEMARKLNFFKEQILRAGLS-SKSSVSQVDINIDDLEVKLGELEAELVEINANSEK  123

Query  2402  LQRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADT  2223
             LQRS+NEL+EYKLVLQK GEFF +A+SSA  QQ+E+ S Q+G +S+E PLL E +   D 
Sbjct  124   LQRSYNELLEYKLVLQKAGEFFIAAQSSAVEQQREFESRQTGGDSIEVPLLLEQESLVDQ  183

Query  2222  SKQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLV  2043
             SK V LGF+SGLVP+EKSMAFERILFRATRGNV L+Q+ V++ V DPISGEKVEKNVF+V
Sbjct  184   SKPVNLGFLSGLVPREKSMAFERILFRATRGNVFLKQTAVEDPVADPISGEKVEKNVFIV  243

Query  2042  FYSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNL  1863
             FYSGERAKNKILKIC+AFGANRYPF E++GKQAQ+I EVSGK+SELKT ID G+LHRGNL
Sbjct  244   FYSGERAKNKILKICEAFGANRYPFTEDVGKQAQMIAEVSGKLSELKTTIDIGLLHRGNL  303

Query  1862  LQSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGH  1683
             LQ+I E F+ WN+L R+EKSIYH LNMLS+DVTKKCLVAEGW P  AT +IQDALQRA  
Sbjct  304   LQTIGEHFENWNLLARKEKSIYHILNMLSLDVTKKCLVAEGWGPVFATKQIQDALQRAAS  363

Query  1682  DSNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFL  1503
             DSNS++G IF+VL T E+PPTYF+TNKF+SAFQEIVDAYGVA+YQEANPGV+TIVTFPFL
Sbjct  364   DSNSQVGPIFQVLLTTEAPPTYFRTNKFSSAFQEIVDAYGVARYQEANPGVYTIVTFPFL  423

Query  1502  FAVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFI  1323
             FAVMFGDWGHGICLLLATLYF++REKKLSSQKLGDITEM FGGRYVILMM+LFSIYTG I
Sbjct  424   FAVMFGDWGHGICLLLATLYFILREKKLSSQKLGDITEMAFGGRYVILMMSLFSIYTGLI  483

Query  1322  YNEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSL  1143
             YNEFFSV F LFGRSAY CR P CSD+TT+GL+K   TY FG+DP WHGTRSELPFLNSL
Sbjct  484   YNEFFSVPFGLFGRSAYACRSPDCSDSTTVGLLKVGSTYPFGLDPVWHGTRSELPFLNSL  543

Query  1142  KMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWC  963
             KMK+SILLGVAQMNLGII+SYFNA +FR+ +N W QF+PQ+IFLN+LFGYLS+LII+KWC
Sbjct  544   KMKMSILLGVAQMNLGIIISYFNATFFRNSINIWFQFLPQMIFLNSLFGYLSLLIIIKWC  603

Query  962   TGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQ  783
             TGS ADLYHVMIYMFLGPTEDL ENQLFPGQK  Q+VL+LLALV+VPWMLLPKPF+LK Q
Sbjct  604   TGSNADLYHVMIYMFLGPTEDLAENQLFPGQKNVQIVLLLLALVAVPWMLLPKPFLLKRQ  663

Query  782   H-NRHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTAS  606
             H  R QGQSYAP+   D+SL +D  HDS  HEEFEFSE+FVHQLIHTIEFVLGAVSNTAS
Sbjct  664   HEQRFQGQSYAPLPSGDDSLELDSHHDSHGHEEFEFSEIFVHQLIHTIEFVLGAVSNTAS  723

Query  605   YLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFL  426
             YLRLWALSLAHSELS+VFY+KVL+L+ G+NNIIIL+VG I+FIFAT+GVLL+METLSAFL
Sbjct  724   YLRLWALSLAHSELSSVFYDKVLVLSAGFNNIIILIVGIIVFIFATVGVLLLMETLSAFL  783

Query  425   HALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             HALRLHWVEFQNKFYEGDGYKF PFSF L+DE++D
Sbjct  784   HALRLHWVEFQNKFYEGDGYKFHPFSFALLDEDDD  818



>ref|XP_003540986.1| PREDICTED: vacuolar proton ATPase a3-like [Glycine max]
Length=818

 Score =  1216 bits (3147),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 635/815 (78%), Positives = 720/815 (88%), Gaps = 2/815 (0%)
 Frame = -2

Query  2765  GRGGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAA  2586
              RGGC PPMDLFRSEPMQLVQLIIPIESA  +V+YLGDLGL+QFKDLNA+KSPFQRTYAA
Sbjct  5     ARGGCCPPMDLFRSEPMQLVQLIIPIESAHRTVSYLGDLGLLQFKDLNADKSPFQRTYAA  64

Query  2585  QIKRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANND  2406
             QIKR GEMAR LRFFKDQM KAGVS   ++   D +  DDLEVKL ++E+EL E+NAN +
Sbjct  65    QIKRCGEMARGLRFFKDQMLKAGVSPKYSTTPVD-LNIDDLEVKLTEIESELTEMNANGE  123

Query  2405  KLQRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSAD  2226
             KLQRS+NELVEYKLVLQK GEFFHSA+S A  QQ+E  S     ES+E PLL + ++S D
Sbjct  124   KLQRSYNELVEYKLVLQKAGEFFHSAQSRALEQQREQESCHLSGESMETPLLQDQELSID  183

Query  2225  TSKQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFL  2046
             +SKQV+LGF++GLVP+EKSM FERILFRATRGNV LRQ+ V++ V DP+SGEK EKNVF+
Sbjct  184   SSKQVKLGFLAGLVPREKSMVFERILFRATRGNVFLRQATVEDPVTDPVSGEKTEKNVFV  243

Query  2045  VFYSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGN  1866
             VFY+GE+AK KILKIC+AFGANRYPFAEELGKQAQ+ITEVSG++ ELKT IDAG+LHR N
Sbjct  244   VFYAGEKAKAKILKICEAFGANRYPFAEELGKQAQMITEVSGRLLELKTTIDAGLLHRDN  303

Query  1865  LLQSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAG  1686
             LL +I  QF++W+ LVR+EKSI+HTLNMLS+DVTKKCLVAEGWSP  AT +IQDALQRA 
Sbjct  304   LLNTIGAQFEQWDALVRKEKSIHHTLNMLSLDVTKKCLVAEGWSPVFATKQIQDALQRAA  363

Query  1685  HDSNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPF  1506
              DSNS++ AIF+VL TRE PPTYF+TNKFTS+FQ I+D+YGVAKYQEANP V+T+VTFPF
Sbjct  364   LDSNSQVNAIFQVLQTRELPPTYFRTNKFTSSFQGIIDSYGVAKYQEANPTVYTVVTFPF  423

Query  1505  LFAVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGF  1326
             LFAVMFGDWGHGICLLLA LYF+IREKKLSSQKL DITEMTFGGRYVIL+MA+FSIYTGF
Sbjct  424   LFAVMFGDWGHGICLLLAALYFIIREKKLSSQKLDDITEMTFGGRYVILLMAIFSIYTGF  483

Query  1325  IYNEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNS  1146
             IYNEFFSV F +F  SAY CRD SC DATT+GLIK RDTY FGVDP WHGTRSELPFLNS
Sbjct  484   IYNEFFSVPFAIFAPSAYECRDLSCRDATTVGLIKVRDTYPFGVDPVWHGTRSELPFLNS  543

Query  1145  LKMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKW  966
             LKMK+SILLGVAQMNLGI++SYFNA +FR+ VN W QFIPQ+IFLN+LFGYLS+LIIVKW
Sbjct  544   LKMKMSILLGVAQMNLGIVMSYFNAIFFRNSVNVWFQFIPQMIFLNSLFGYLSLLIIVKW  603

Query  965   CTGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKS  786
              TGSQADLYH++IYMFL PT+DLGENQLF GQK  QLVL+LLA++SVPWMLLPKPFILK 
Sbjct  604   ATGSQADLYHILIYMFLSPTDDLGENQLFAGQKNLQLVLLLLAVISVPWMLLPKPFILKK  663

Query  785   QHN-RHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTA  609
             QH  RH  +SY P+Q  DESL V+ +HDS  HEEFEFSEVFVHQLIHTIEFVLGAVSNTA
Sbjct  664   QHEARHGVESYEPLQSTDESLQVESNHDSHGHEEFEFSEVFVHQLIHTIEFVLGAVSNTA  723

Query  608   SYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAF  429
             SYLRLWALSLAHSELS+VFYEKVL++AWGYNN+IIL+VG I+FIFAT+GVLLVMETLSAF
Sbjct  724   SYLRLWALSLAHSELSSVFYEKVLMMAWGYNNVIILIVGLIVFIFATVGVLLVMETLSAF  783

Query  428   LHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEE  324
             LHALRLHWVEFQNKFYEGDGYKF PFSF  +D+EE
Sbjct  784   LHALRLHWVEFQNKFYEGDGYKFHPFSFSWLDDEE  818



>ref|XP_011047706.1| PREDICTED: V-type proton ATPase subunit a3 [Populus euphratica]
Length=821

 Score =  1216 bits (3146),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 639/814 (79%), Positives = 719/814 (88%), Gaps = 1/814 (0%)
 Frame = -2

Query  2759  GGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQI  2580
             GGC PPMDLFRSE MQLVQLIIPIESA  +V+YLGDLGLIQFKDLNA+KSPFQRTYAAQI
Sbjct  8     GGCCPPMDLFRSEAMQLVQLIIPIESAHHTVSYLGDLGLIQFKDLNADKSPFQRTYAAQI  67

Query  2579  KRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKL  2400
             K+ GEMARKLRFFK+QM KAG++       Q  I  DDLEVKLG+LEAEL+E+NANN+KL
Sbjct  68    KKFGEMARKLRFFKEQMVKAGITPLTKPGAQTEIDVDDLEVKLGELEAELVEMNANNEKL  127

Query  2399  QRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTS  2220
             QRS+NELVEYKLVL K G FF SA  +A A Q+E  S Q+GEESL+ PLL + +M  ++S
Sbjct  128   QRSYNELVEYKLVLNKAGAFFSSALRNATALQKELESQQAGEESLDTPLLQDKEMLNESS  187

Query  2219  KQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVF  2040
             KQV+LGFI+GLVPKEKSM FERI+FRATRGNV  RQ+ V+E V+DP+SGEKVEKNVF+VF
Sbjct  188   KQVKLGFITGLVPKEKSMPFERIIFRATRGNVYTRQAAVEEPVVDPVSGEKVEKNVFVVF  247

Query  2039  YSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLL  1860
             YSG++AK KILKIC+AFGANRYPF E+ GKQ Q+I+EVSG+ISE+K AIDAG+ HR NLL
Sbjct  248   YSGDKAKTKILKICEAFGANRYPFTEDFGKQIQMISEVSGRISEMKAAIDAGLFHRSNLL  307

Query  1859  QSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHD  1680
             Q+I +QF +WN LVR+EKSIYHTLNMLS+DVTKKCLVAEGWSP   T +IQDALQRA  D
Sbjct  308   QTIGDQFVQWNTLVRKEKSIYHTLNMLSLDVTKKCLVAEGWSPVFGTKQIQDALQRAAFD  367

Query  1679  SNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLF  1500
             SNS++G IF+VL T E PPTYF+TNKFTSAFQ+IVDAYGVA+YQEANPGV+TIVTFPFLF
Sbjct  368   SNSQVGTIFQVLHTTELPPTYFRTNKFTSAFQDIVDAYGVARYQEANPGVYTIVTFPFLF  427

Query  1499  AVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIY  1320
             AVMFGDWGHGIC+LLATL F+IREKKLS QKLGDITEMTFGGRYVILMMALFSIYTG IY
Sbjct  428   AVMFGDWGHGICMLLATLVFIIREKKLSGQKLGDITEMTFGGRYVILMMALFSIYTGLIY  487

Query  1319  NEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLK  1140
             NEFFSV FELF  SAY CRD SC DATT GLIK R TY FGVDP WHG+RSELPFLNSLK
Sbjct  488   NEFFSVPFELFAPSAYACRDLSCRDATTEGLIKVRPTYPFGVDPVWHGSRSELPFLNSLK  547

Query  1139  MKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCT  960
             MK+SILLGVAQMNLGIILSYFNA YF++ +N W QFIPQ+IFLN+LFGYLS+LIIVKW T
Sbjct  548   MKMSILLGVAQMNLGIILSYFNATYFKNSLNIWFQFIPQMIFLNSLFGYLSLLIIVKWST  607

Query  959   GSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQH  780
             GSQADLYHVMIYMFL PT++LGENQLFP QK  QLVL+LLALVSVPWMLLPKPF+LK QH
Sbjct  608   GSQADLYHVMIYMFLSPTDELGENQLFPRQKNVQLVLLLLALVSVPWMLLPKPFLLKKQH  667

Query  779   N-RHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASY  603
               RHQG+SY P+Q  +ESL ++ +HDS  HEEFEFSEVFVHQ+IHTIEFVLGAVSNTASY
Sbjct  668   EARHQGESYTPLQSTEESLQLETNHDSHGHEEFEFSEVFVHQMIHTIEFVLGAVSNTASY  727

Query  602   LRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLH  423
             LRLWALSLAHSELS+VFYEKVLLLAWGY+NI ILV+G I+FIFAT+GVLLVMETLSAFLH
Sbjct  728   LRLWALSLAHSELSSVFYEKVLLLAWGYHNIFILVIGAIVFIFATVGVLLVMETLSAFLH  787

Query  422   ALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             ALRLHWVEFQNKFYEGDGYKF PFSF LV++E++
Sbjct  788   ALRLHWVEFQNKFYEGDGYKFYPFSFALVNDEDE  821



>ref|XP_007199708.1| hypothetical protein PRUPE_ppa001492mg [Prunus persica]
 gb|EMJ00907.1| hypothetical protein PRUPE_ppa001492mg [Prunus persica]
Length=814

 Score =  1213 bits (3139),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 633/814 (78%), Positives = 725/814 (89%), Gaps = 2/814 (0%)
 Frame = -2

Query  2759  GGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQI  2580
             G C PPMDLFRSEPMQLVQ+IIPIESA L+V+YLGDLGL+QFKDLNAEKSPFQRTYAAQI
Sbjct  2     GECCPPMDLFRSEPMQLVQIIIPIESAHLTVSYLGDLGLLQFKDLNAEKSPFQRTYAAQI  61

Query  2579  KRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKL  2400
             KRS EMARKLRFFKDQM KA +  S+ S  Q  +  D+LEVKLG+ EAELIEIN+N++KL
Sbjct  62    KRSAEMARKLRFFKDQMLKANL-PSSKSKRQVDVNVDNLEVKLGEFEAELIEINSNSEKL  120

Query  2399  QRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTS  2220
             QRS+NEL+EYKLVL+K GEFFHSA+SSA  QQ+E  S   G+ESL+ PLL E + S D S
Sbjct  121   QRSYNELIEYKLVLEKAGEFFHSAQSSAALQQRENESRHIGDESLDTPLLLEQEASTDPS  180

Query  2219  KQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVF  2040
             KQV+LGF++GLVP+ KS+AFERILFRATRGNV LRQ+ V+  V DP+SGEKVEKNVF+VF
Sbjct  181   KQVKLGFLTGLVPRGKSLAFERILFRATRGNVFLRQAVVENPVTDPVSGEKVEKNVFVVF  240

Query  2039  YSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLL  1860
             YSGERAKNKILKIC+AFGANRY F E+LG+QAQ+ITEVSG+ISELKT ID G+LH+G+LL
Sbjct  241   YSGERAKNKILKICEAFGANRYSFPEDLGRQAQMITEVSGRISELKTTIDIGLLHQGSLL  300

Query  1859  QSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHD  1680
             Q+I E F+ WN+LVR+EKSIYH LNMLS+DVTKKCLVAEGWSP  A+ +IQDALQRA  D
Sbjct  301   QNIGEHFEHWNLLVRKEKSIYHHLNMLSLDVTKKCLVAEGWSPIFASKQIQDALQRAAFD  360

Query  1679  SNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLF  1500
             SNS++GAIF+VL T+E+PPTYF+TNKFTS+FQEIV+AYGVAKYQEANP V+TIVTFPFLF
Sbjct  361   SNSQVGAIFQVLHTQEAPPTYFRTNKFTSSFQEIVEAYGVAKYQEANPAVYTIVTFPFLF  420

Query  1499  AVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIY  1320
             AVMFGDWGHGICLLLATLY + RE+KLSSQKLGDI EM FGGRYVIL+MA+FSIYTG IY
Sbjct  421   AVMFGDWGHGICLLLATLYLIGRERKLSSQKLGDIMEMAFGGRYVILLMAIFSIYTGLIY  480

Query  1319  NEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLK  1140
             NEFFSV FELFG SAY CRD SC DATT GLIK R TY FG+DP WHG+RSELPFLNSLK
Sbjct  481   NEFFSVPFELFGSSAYACRDLSCRDATTAGLIKVRPTYPFGLDPVWHGSRSELPFLNSLK  540

Query  1139  MKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCT  960
             MK+SILLGV QMNLGIILS+FNA +FRSGVN W QF+PQIIFLN+LFGYLSVLI++KW T
Sbjct  541   MKMSILLGVVQMNLGIILSFFNARFFRSGVNVWFQFVPQIIFLNSLFGYLSVLIVMKWWT  600

Query  959   GSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQH  780
             GS+ADLYHVMIYMFL PT++LGENQLF GQ+T QLVL+LLA VSVPWML PKPFILK QH
Sbjct  601   GSKADLYHVMIYMFLSPTDELGENQLFSGQRTVQLVLLLLAFVSVPWMLFPKPFILKKQH  660

Query  779   -NRHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASY  603
              +RHQGQSYA +++ +ESL V+ +HD+  H EFEFSEVFVHQ+IHTIEFVLGAVSNTASY
Sbjct  661   QDRHQGQSYALLENTEESLQVNSNHDAHGHGEFEFSEVFVHQMIHTIEFVLGAVSNTASY  720

Query  602   LRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLH  423
             LRLWALSLAHSELS+VFY+KVLLLAWG+NN+IIL+VG I+FI AT+GVLL+METLSAFLH
Sbjct  721   LRLWALSLAHSELSSVFYDKVLLLAWGFNNVIILIVGIIVFICATVGVLLLMETLSAFLH  780

Query  422   ALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             ALRLHWVEFQNKFYEGDGYKF PFSF L+D+E++
Sbjct  781   ALRLHWVEFQNKFYEGDGYKFYPFSFALLDDEDE  814



>ref|XP_008236967.1| PREDICTED: vacuolar proton ATPase a3 [Prunus mume]
Length=814

 Score =  1213 bits (3138),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 633/814 (78%), Positives = 725/814 (89%), Gaps = 2/814 (0%)
 Frame = -2

Query  2759  GGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQI  2580
             G C PPMDLFRSEPMQLVQ+IIPIESA L+V+YLGDLGL+QFKDLNAEKSPFQRTYAAQI
Sbjct  2     GECCPPMDLFRSEPMQLVQIIIPIESAHLTVSYLGDLGLLQFKDLNAEKSPFQRTYAAQI  61

Query  2579  KRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKL  2400
             KR  EMARKLRFFKDQM KA +  S+ S  Q  +  DDLEVKLG+ EAELIEIN+N+DKL
Sbjct  62    KRCAEMARKLRFFKDQMLKANL-PSSKSKRQVDVNVDDLEVKLGEFEAELIEINSNSDKL  120

Query  2399  QRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTS  2220
             QRS+NEL+EYKLV++K GEFFHSA+SSA  QQ+E  S   G+ESL+ PLL E + S D S
Sbjct  121   QRSYNELIEYKLVMEKAGEFFHSAQSSAALQQRENESRHIGDESLDMPLLLEQEASTDPS  180

Query  2219  KQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVF  2040
             KQV+LGF++GLVP+ KS+AFERILFRATRGNV LRQ+ V+  V DP+SGEKVEKNVF+VF
Sbjct  181   KQVKLGFLTGLVPRGKSLAFERILFRATRGNVFLRQAVVENPVTDPVSGEKVEKNVFVVF  240

Query  2039  YSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLL  1860
             YSGERAKNKILKIC+AFGANRY F E+LG+QAQ+ITEVSG+ISELKT ID G+LH+G+LL
Sbjct  241   YSGERAKNKILKICEAFGANRYSFPEDLGRQAQMITEVSGRISELKTTIDIGLLHQGSLL  300

Query  1859  QSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHD  1680
             Q+I E+F+ WN+LVR+EKSIYH LNMLS+DVTKKCLVAEGWSP  A+ +IQDALQRA  D
Sbjct  301   QTIGERFEHWNLLVRKEKSIYHHLNMLSLDVTKKCLVAEGWSPIFASKQIQDALQRAAFD  360

Query  1679  SNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLF  1500
             SNS++GAIF+VL T+E+PPTYF+TNKFTS+FQEIV+AYGVAKYQEANP V+TIVTFPFLF
Sbjct  361   SNSQVGAIFQVLHTQEAPPTYFRTNKFTSSFQEIVEAYGVAKYQEANPAVYTIVTFPFLF  420

Query  1499  AVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIY  1320
             AVMFGDWGHGICLLLATLY + RE+KLSSQKLGDI EM FGGRYVIL+MA+FSIYTG IY
Sbjct  421   AVMFGDWGHGICLLLATLYLIGRERKLSSQKLGDIMEMAFGGRYVILLMAIFSIYTGLIY  480

Query  1319  NEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLK  1140
             NEFFSV FELFG SAY CRD SC DATT GLIK R TY FG+DP WHG+RSELPFLNSLK
Sbjct  481   NEFFSVPFELFGSSAYACRDLSCRDATTAGLIKVRPTYPFGLDPVWHGSRSELPFLNSLK  540

Query  1139  MKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCT  960
             MK+SILLGV QMNLGII+S+FNA +FRSGVN W QFIPQIIFLN+LFGYLSVLI++KW T
Sbjct  541   MKMSILLGVVQMNLGIIISFFNARFFRSGVNVWFQFIPQIIFLNSLFGYLSVLIVMKWWT  600

Query  959   GSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQH  780
             GS+ADLYHVMIYMFL PT++LGENQLF GQ+T QLVL+LLA VSVPWML PKPFILK QH
Sbjct  601   GSKADLYHVMIYMFLSPTDELGENQLFSGQRTVQLVLLLLAFVSVPWMLFPKPFILKKQH  660

Query  779   -NRHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASY  603
              +RHQGQSYA +++ +ESL V+ +HD+  H EFEFSEVFVHQ+IHTIEFVLGAVSNTASY
Sbjct  661   QDRHQGQSYALLENTEESLQVNSNHDAHGHGEFEFSEVFVHQMIHTIEFVLGAVSNTASY  720

Query  602   LRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLH  423
             LRLWALSLAHSELS+VFY+KVLLLAWG+NN+IIL+VG I+FI AT+GVLL+METLSAFLH
Sbjct  721   LRLWALSLAHSELSSVFYDKVLLLAWGFNNVIILIVGIIVFICATVGVLLLMETLSAFLH  780

Query  422   ALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             ALRLHWVEFQNKFYEGDGYKF PFSF L+D+E++
Sbjct  781   ALRLHWVEFQNKFYEGDGYKFYPFSFALLDDEDE  814



>ref|XP_002306128.1| vacuolar proton ATPase family protein [Populus trichocarpa]
 gb|EEE86639.1| vacuolar proton ATPase family protein [Populus trichocarpa]
Length=821

 Score =  1211 bits (3134),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 641/819 (78%), Positives = 719/819 (88%), Gaps = 0/819 (0%)
 Frame = -2

Query  2783  MAERLGGRGGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPF  2604
             MAE     GGC PPMDLFRSE MQLVQLIIPIESA  +V+Y+GDLGLIQFKDLNA+KSPF
Sbjct  1     MAEARVAGGGCCPPMDLFRSEAMQLVQLIIPIESAHHTVSYIGDLGLIQFKDLNADKSPF  60

Query  2603  QRTYAAQIKRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIE  2424
             QRTYAAQIK+ GEMARKLRFFK+QM KAGV+ S    TQ  I  DDLEVKLG+ EAEL+E
Sbjct  61    QRTYAAQIKKFGEMARKLRFFKEQMEKAGVTPSTKPMTQTEIDVDDLEVKLGEFEAELVE  120

Query  2423  INANNDKLQRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllse  2244
             +N N++KLQRS+NELVEYKLVL K G FF SA SSA AQQ+E  S Q+GEESL+ PLL +
Sbjct  121   MNTNDEKLQRSYNELVEYKLVLNKAGGFFSSAFSSATAQQKEIESQQTGEESLDTPLLQD  180

Query  2243  PDMSADTSKQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKV  2064
              ++S ++SKQV+LGFI+GLV KEKSM FERI+FRATRGNV  RQ+ V+E VIDP+SGEKV
Sbjct  181   REISIESSKQVKLGFITGLVSKEKSMLFERIIFRATRGNVYTRQAAVEEPVIDPVSGEKV  240

Query  2063  EKNVFLVFYSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAG  1884
             EKNVF+VFYSGE+AK KIL+IC+AFGANRY F E+ GKQ Q+I+EVSG+++EL+TAIDAG
Sbjct  241   EKNVFVVFYSGEKAKTKILRICEAFGANRYSFTEDFGKQVQMISEVSGRLAELRTAIDAG  300

Query  1883  ILHRGNLLQSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQD  1704
             +L +  LLQ+I +QF +WN L R+EKSIYHT+NMLS+DVTKKCLVAEGWSP  AT  IQD
Sbjct  301   LLQKSKLLQTIGDQFVQWNTLARKEKSIYHTMNMLSLDVTKKCLVAEGWSPVFATNLIQD  360

Query  1703  ALQRAGHDSNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFT  1524
             ALQ+A  DSNS++GAIF+VL T ESPPTYF TNKFTSAFQ+IVDAYGVAKYQEANPGV+T
Sbjct  361   ALQKAAFDSNSQVGAIFQVLHTSESPPTYFHTNKFTSAFQDIVDAYGVAKYQEANPGVYT  420

Query  1523  IVTFPFLFAVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALF  1344
             IVTFPFLFAVMFGDWGHGICLLLA L F+IREKKLS QKLGDITEMTFGGRYVILMMALF
Sbjct  421   IVTFPFLFAVMFGDWGHGICLLLAALVFIIREKKLSGQKLGDITEMTFGGRYVILMMALF  480

Query  1343  SIYTGFIYNEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSE  1164
             SIYTG IYNEFFSV FELF  SAY CRD SC DATT+GLIKAR TY FGVDP WHG+RSE
Sbjct  481   SIYTGIIYNEFFSVPFELFAPSAYACRDLSCRDATTVGLIKARPTYPFGVDPVWHGSRSE  540

Query  1163  LPFLNSLKMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSV  984
             LPFLNSLKMK+SIL+GV QMNLGIILSYFNA YFR+ +N W QFIPQIIFLN+LFGYLS+
Sbjct  541   LPFLNSLKMKMSILIGVTQMNLGIILSYFNAAYFRNSLNVWFQFIPQIIFLNSLFGYLSL  600

Query  983   LIIVKWCTGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPK  804
             LII+KWCTGSQADLYHVMIYMFL PT++LGENQLFP QKT QLVL+LLALVSVPWMLLPK
Sbjct  601   LIILKWCTGSQADLYHVMIYMFLSPTDELGENQLFPQQKTVQLVLLLLALVSVPWMLLPK  660

Query  803   PFILKSQHNRHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGA  624
             PF+LK QH   QG+SY P+Q  +ESL ++ +HDS  HEEFEFSEVFVHQ+IHTIEFVLGA
Sbjct  661   PFLLKMQHQARQGESYMPLQSTEESLQLEANHDSHGHEEFEFSEVFVHQMIHTIEFVLGA  720

Query  623   VSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVME  444
             VSNTASYLRLWALSLAHSELS+VFYEKVLLLAWGYNNIIIL VG I+FIF T+GVLLVME
Sbjct  721   VSNTASYLRLWALSLAHSELSSVFYEKVLLLAWGYNNIIILAVGAILFIFVTVGVLLVME  780

Query  443   TLSAFLHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEE  327
             TLSAFLHALRLHWVEFQNKFYEGDGYKF PFSF  V++E
Sbjct  781   TLSAFLHALRLHWVEFQNKFYEGDGYKFYPFSFASVNDE  819



>ref|XP_010028630.1| PREDICTED: V-type proton ATPase subunit a2 [Eucalyptus grandis]
 gb|KCW55394.1| hypothetical protein EUGRSUZ_I01306 [Eucalyptus grandis]
Length=824

 Score =  1211 bits (3132),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 632/809 (78%), Positives = 721/809 (89%), Gaps = 2/809 (0%)
 Frame = -2

Query  2741  MDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSGEM  2562
             MDL RSEPMQLVQ+IIP+ESA L+V+YLGDLGL+QFKDLNA+KSPFQRTYAAQIK+ GEM
Sbjct  15    MDLLRSEPMQLVQVIIPMESAHLTVSYLGDLGLLQFKDLNADKSPFQRTYAAQIKKCGEM  74

Query  2561  ARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSFNE  2382
             ARKLRFFK+QMSKAG++ S  S T+D I  DDLE KLG+LEAEL+EINAN +KLQRS++E
Sbjct  75    ARKLRFFKEQMSKAGLAPSFKSITRDDIDVDDLETKLGELEAELVEINANGEKLQRSYSE  134

Query  2381  LVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTSKQVRLG  2202
             +VEYKLVLQKVGEFFH A+SSA AQ +E  S  +GEES++ PLL + +M+ D SKQ++LG
Sbjct  135   MVEYKLVLQKVGEFFHLAQSSATAQHREIESQHAGEESIDTPLLRDQEMATDASKQMKLG  194

Query  2201  FISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSGERA  2022
             F+ GLVP+EKSMAFERILFRATRGNV L+Q+ V+E VIDP SGEKVEKNVFLVFYSGERA
Sbjct  195   FLCGLVPREKSMAFERILFRATRGNVFLKQALVEEPVIDPASGEKVEKNVFLVFYSGERA  254

Query  2021  KNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSIAEQ  1842
             KNKILKIC+AFGANRYPF E+LGKQA++I+EV G++SELKT IDAG+ HRGNLL++I +Q
Sbjct  255   KNKILKICEAFGANRYPFNEDLGKQAKMISEVMGRLSELKTTIDAGLAHRGNLLETIGDQ  314

Query  1841  FDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNSEIG  1662
             +++W+ LVR+EK+IYHTLNMLS+DVTKKCLVAEGW P  A+ +IQDALQRA  DSN+++G
Sbjct  315   YEQWSRLVRKEKAIYHTLNMLSLDVTKKCLVAEGWCPVFASKQIQDALQRAASDSNAQVG  374

Query  1661  AIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGD  1482
             AIF+V+ T+E PPTYF+TNKFTSAFQEIVDAYGVA+YQE NPGVFTIVTFPFLFAVMFGD
Sbjct  375   AIFQVVHTKELPPTYFRTNKFTSAFQEIVDAYGVARYQEVNPGVFTIVTFPFLFAVMFGD  434

Query  1481  WGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEFFSV  1302
             WGHGICLLLATL ++ +EKKLS QKLGDITEMTFGGRYVILMMALFSIYTG IYNEFFSV
Sbjct  435   WGHGICLLLATLVYIFKEKKLSGQKLGDITEMTFGGRYVILMMALFSIYTGLIYNEFFSV  494

Query  1301  QFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKLSIL  1122
              FELFG SAY CRD SC DATT+GLIK R+TY FGVDP WHGTRSELPFLNSLKMK+SIL
Sbjct  495   PFELFGLSAYACRDLSCRDATTVGLIKVRETYPFGVDPVWHGTRSELPFLNSLKMKMSIL  554

Query  1121  LGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQADL  942
             LGVAQMNLGIILS+FNA +F + VN W QFIPQ+IFLN+LFGYLS+LIIVKWCTGS+ADL
Sbjct  555   LGVAQMNLGIILSFFNAKFFGNCVNIWFQFIPQLIFLNSLFGYLSLLIIVKWCTGSKADL  614

Query  941   YHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQH-NRHQG  765
             YH+MIYMFL PT++LGEN LFPGQK  Q+VL+LLALVSVPWMLLPKPF+LK QH  RH+G
Sbjct  615   YHIMIYMFLSPTDELGENALFPGQKMVQIVLLLLALVSVPWMLLPKPFLLKKQHEERHRG  674

Query  764   QSYAPIQDLDESL-LvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLRLWA  588
              SY P++  D S  L        DHEEFEFSEVFVHQLIHTIEFVLGAVSNTASYLRLWA
Sbjct  675   NSYMPLETTDNSFQLDTNHDAHGDHEEFEFSEVFVHQLIHTIEFVLGAVSNTASYLRLWA  734

Query  587   LSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHALRLH  408
             LSLAHSELS+VFYEKVLLLAWG+NN+IIL+VG IIFIFAT+GVLLVMETLSAFLHALRLH
Sbjct  735   LSLAHSELSSVFYEKVLLLAWGFNNVIILIVGIIIFIFATVGVLLVMETLSAFLHALRLH  794

Query  407   WVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             WVEFQNKFYEGDGYKF PFSF L  +E+D
Sbjct  795   WVEFQNKFYEGDGYKFYPFSFALAGDEDD  823



>ref|XP_003607000.1| V-type proton ATPase 116 kDa subunit a isoform [Medicago truncatula]
 gb|AES89197.1| vacuolar proton ATPase a3-like protein [Medicago truncatula]
Length=822

 Score =  1211 bits (3132),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 629/814 (77%), Positives = 723/814 (89%), Gaps = 2/814 (0%)
 Frame = -2

Query  2759  GGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQI  2580
             GGC PPMDLFRSEPMQL+QLIIP+ESA  +V+YLGDLGL+QFKDLN+EKSPFQRTYAAQI
Sbjct  8     GGCCPPMDLFRSEPMQLIQLIIPMESAHCTVSYLGDLGLLQFKDLNSEKSPFQRTYAAQI  67

Query  2579  KRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKL  2400
             KR GEMARKLRFFK+QM KAGVS    S TQ  +  DD+E+KL ++E+EL E+NAN +KL
Sbjct  68    KRCGEMARKLRFFKEQMFKAGVSPKG-STTQSDVNIDDIEIKLTEIESELTEMNANGEKL  126

Query  2399  QRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTS  2220
             QR++NELVEYKLVLQK G+FFHSA+S A  QQ+EY S Q   ES+EAPLL + ++S D+S
Sbjct  127   QRTYNELVEYKLVLQKAGDFFHSAQSRAIEQQREYESRQLSGESMEAPLLQDQELSGDSS  186

Query  2219  KQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVF  2040
             K V+LGF++GLVP+EKSMAFERILFRATRGNV LRQ+ V++ V DP+SGEK EKNVF+VF
Sbjct  187   KPVKLGFLAGLVPREKSMAFERILFRATRGNVFLRQTAVEDPVTDPVSGEKTEKNVFVVF  246

Query  2039  YSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLL  1860
             Y+GE+ K KILKICDAFGANRYPFAEELGKQAQ+I+EVSGK++ELKT IDAG+ HR NLL
Sbjct  247   YAGEKVKAKILKICDAFGANRYPFAEELGKQAQMISEVSGKLAELKTTIDAGLSHRVNLL  306

Query  1859  QSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHD  1680
             ++I  QF++WN+LVR+EKSI+HTLNMLS+DVTKKCLVAEGWSP  AT ++QDAL+RA  D
Sbjct  307   ENIGTQFEQWNLLVRKEKSIHHTLNMLSLDVTKKCLVAEGWSPVFATHQVQDALKRAAKD  366

Query  1679  SNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLF  1500
             SNS++ AI +VL TRESPPTYF+TNKFTS++Q I+D+YGVAKYQEANP VFT+VTFPFLF
Sbjct  367   SNSQVSAILQVLHTRESPPTYFRTNKFTSSYQGIIDSYGVAKYQEANPTVFTVVTFPFLF  426

Query  1499  AVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIY  1320
             AVMFGDWGHGICLLLA LYF+IREKKLSSQKL DIT MTFGGRYVI +M+LFSIYTG IY
Sbjct  427   AVMFGDWGHGICLLLAALYFIIREKKLSSQKLDDITAMTFGGRYVIFLMSLFSIYTGLIY  486

Query  1319  NEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLK  1140
             NEFFSV FELFG SAYVCRD SC D+TTIGLIKA  TY FGVDP WHGTRSELPFLNSLK
Sbjct  487   NEFFSVPFELFGPSAYVCRDDSCRDSTTIGLIKAGPTYPFGVDPVWHGTRSELPFLNSLK  546

Query  1139  MKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCT  960
             MK+SILLGVAQMNLGII+SY NA +F++ VN W QFIPQ+IFLN+LFGYLS+LIIVKWCT
Sbjct  547   MKMSILLGVAQMNLGIIMSYCNAKFFKNNVNVWFQFIPQVIFLNSLFGYLSLLIIVKWCT  606

Query  959   GSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQH  780
             GSQADLYHVMIYMFL PT+DLGENQLF GQK  QLVL+LLA V+VPWMLLPKPFILK QH
Sbjct  607   GSQADLYHVMIYMFLSPTDDLGENQLFAGQKNVQLVLLLLAGVAVPWMLLPKPFILKKQH  666

Query  779   N-RHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASY  603
               RH  +SYAP+ + +ESL V+ +HDS  H EFEFSE+FVHQLIHTIEFVLGAVSNTASY
Sbjct  667   EARHGDESYAPLPNTEESLQVESNHDSHGHGEFEFSEIFVHQLIHTIEFVLGAVSNTASY  726

Query  602   LRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLH  423
             LRLWALSLAHSELS+VFYEKVLL+AWGYNN++IL+VG I+FIFAT+GVLLVMETLSAFLH
Sbjct  727   LRLWALSLAHSELSSVFYEKVLLMAWGYNNVVILIVGLIVFIFATVGVLLVMETLSAFLH  786

Query  422   ALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             ALRLHWVE+QNKFYEGDGY F PFSF L+DEE++
Sbjct  787   ALRLHWVEYQNKFYEGDGYLFLPFSFSLLDEEDE  820



>ref|XP_011037174.1| PREDICTED: V-type proton ATPase subunit a3-like [Populus euphratica]
Length=821

 Score =  1207 bits (3124),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 642/819 (78%), Positives = 715/819 (87%), Gaps = 0/819 (0%)
 Frame = -2

Query  2783  MAERLGGRGGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPF  2604
             MAE     GGC PPMDLFRSE MQLVQLIIPIESA  +V+Y+GDLGL+QFKDLNA+KSPF
Sbjct  1     MAEARVAGGGCCPPMDLFRSEAMQLVQLIIPIESAHHTVSYIGDLGLLQFKDLNADKSPF  60

Query  2603  QRTYAAQIKRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIE  2424
             QRTYAAQIK+ GEMARKLRFF +QM KAGV+ S    TQ  I  DDLEVKLG+ EAEL+E
Sbjct  61    QRTYAAQIKKFGEMARKLRFFMEQMEKAGVTPSTKPMTQTEIDVDDLEVKLGEFEAELVE  120

Query  2423  INANNDKLQRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllse  2244
             +N NN+KL RS+NELVEYKLVL K G FF SA SSA AQQ E  S Q+GEESL+ PLL +
Sbjct  121   MNTNNEKLLRSYNELVEYKLVLNKAGGFFSSAFSSATAQQNEIESQQTGEESLDTPLLED  180

Query  2243  PDMSADTSKQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKV  2064
              ++S ++SKQV+LGFI+GLV KEKSM FERI+FRATRGNV  RQ+ V+E VIDP+SGEKV
Sbjct  181   REISIESSKQVKLGFITGLVSKEKSMLFERIIFRATRGNVYTRQAAVEEPVIDPVSGEKV  240

Query  2063  EKNVFLVFYSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAG  1884
             EKNVF VFYSGERAK KILKIC+AFGANRY F E+ GKQ Q+I+EVSG+++EL+TAIDAG
Sbjct  241   EKNVFAVFYSGERAKTKILKICEAFGANRYSFTEDFGKQVQMISEVSGRLAELRTAIDAG  300

Query  1883  ILHRGNLLQSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQD  1704
             +L +  LL++I +QF +WN L R+EKSIYHT+NMLS+DVTKKCLVAEGWSP  AT  IQD
Sbjct  301   LLQKSKLLKTIGDQFVQWNTLTRKEKSIYHTMNMLSLDVTKKCLVAEGWSPVFATNLIQD  360

Query  1703  ALQRAGHDSNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFT  1524
             ALQRA  DSNS++G IF+VL T ESPPTYF TNKFTSAFQ+IVDAYGVAKYQEANPGV+T
Sbjct  361   ALQRAAFDSNSQVGTIFQVLHTSESPPTYFHTNKFTSAFQDIVDAYGVAKYQEANPGVYT  420

Query  1523  IVTFPFLFAVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALF  1344
             IVTFPFLFAVMFGDWGHGICLLLA L F+IREKKLS QKLGDITEMTFGGRYVILMMALF
Sbjct  421   IVTFPFLFAVMFGDWGHGICLLLAALVFIIREKKLSGQKLGDITEMTFGGRYVILMMALF  480

Query  1343  SIYTGFIYNEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSE  1164
             SIYTG IYNEFFSV FELF  SAY CRD SC DATT+GLIKAR TY FGVDP WHG+RSE
Sbjct  481   SIYTGIIYNEFFSVPFELFAPSAYACRDLSCRDATTVGLIKARPTYPFGVDPVWHGSRSE  540

Query  1163  LPFLNSLKMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSV  984
             LPFLNSLKMK+SILLGVAQMNLGIILSYFNA YFR+ +N W QFIPQIIFLN+LFGYLS+
Sbjct  541   LPFLNSLKMKMSILLGVAQMNLGIILSYFNAAYFRNSLNVWFQFIPQIIFLNSLFGYLSL  600

Query  983   LIIVKWCTGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPK  804
             LII+KWCTGSQADLYHVMIYMFL PT++LGENQLFP QKT QLVL+LLALVSVPWMLLPK
Sbjct  601   LIILKWCTGSQADLYHVMIYMFLSPTDELGENQLFPRQKTVQLVLLLLALVSVPWMLLPK  660

Query  803   PFILKSQHNRHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGA  624
             PF+LK QH   QG+SY P+Q  +ESL ++ +HDS  HEEFEFSEVFVHQ+IHTIEFVLGA
Sbjct  661   PFLLKMQHQAMQGESYMPLQSTEESLQLEANHDSHGHEEFEFSEVFVHQMIHTIEFVLGA  720

Query  623   VSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVME  444
             VSNTASYLRLWALSLAHSELS+VFYEKVLLLAWGYNNIIIL VG I+FIF T+GVLLVME
Sbjct  721   VSNTASYLRLWALSLAHSELSSVFYEKVLLLAWGYNNIIILAVGAIVFIFVTVGVLLVME  780

Query  443   TLSAFLHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEE  327
             TLSAFLHALRLHWVEFQNKFYEGDGYKF PFSF  V++E
Sbjct  781   TLSAFLHALRLHWVEFQNKFYEGDGYKFYPFSFASVNDE  819



>emb|CDY12118.1| BnaC03g60340D [Brassica napus]
Length=820

 Score =  1207 bits (3122),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 627/808 (78%), Positives = 719/808 (89%), Gaps = 2/808 (0%)
 Frame = -2

Query  2741  MDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSGEM  2562
             MDL RSEPMQLVQLI+P+ESA L+V+YLGDLGL+QFKDLN+EKSPFQRTYAAQIKR GEM
Sbjct  14    MDLMRSEPMQLVQLIVPMESAHLTVSYLGDLGLVQFKDLNSEKSPFQRTYAAQIKRCGEM  73

Query  2561  ARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSFNE  2382
             ARK+RFFKDQMSKAGV        ++ I  DD+EVKLG+LEAEL+EINANNDKLQRS+NE
Sbjct  74    ARKIRFFKDQMSKAGVLPKEMLGKENDIDLDDVEVKLGELEAELVEINANNDKLQRSYNE  133

Query  2381  LVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTSKQVRLG  2202
             L+EYKLVL+K GEFF SA  SA AQQ+E  S ++ E+ LE+PLL E + S D SKQV+LG
Sbjct  134   LMEYKLVLEKAGEFFSSAHRSATAQQRETESPRASEDLLESPLLQE-EKSIDASKQVKLG  192

Query  2201  FISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSGERA  2022
             F++GLVP+EKSM FERILFRATRGNV +RQ+ V+E+VIDP SGEK EKNVF+VFYSGERA
Sbjct  193   FLTGLVPREKSMVFERILFRATRGNVYVRQTVVEETVIDPNSGEKAEKNVFVVFYSGERA  252

Query  2021  KNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSIAEQ  1842
             K+KILKIC+AFGANRYPF+E+L KQAQ+ITEVSG+++ELKT IDAG+ HR  LLQ+I ++
Sbjct  253   KSKILKICEAFGANRYPFSEDLRKQAQMITEVSGRLTELKTTIDAGLGHRNILLQTIGDK  312

Query  1841  FDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNSEIG  1662
             F+ W++ VR+EK+IYHTLNMLS+DVTKKCLVAEGWSP  A+ EIQ AL+RA  DSNS++G
Sbjct  313   FELWSLKVRKEKAIYHTLNMLSLDVTKKCLVAEGWSPVFASKEIQKALERAAVDSNSQVG  372

Query  1661  AIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGD  1482
             +IF++L T+E PPTYF+TNKFTSA QEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGD
Sbjct  373   SIFQILRTKELPPTYFRTNKFTSAIQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGD  432

Query  1481  WGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEFFSV  1302
             WGHGICLLLAT+Y ++REKKL+SQKLGDI EM FGGRYVI+MM+LFSIYTG IYNEFFS+
Sbjct  433   WGHGICLLLATMYLIVREKKLASQKLGDIMEMAFGGRYVIMMMSLFSIYTGLIYNEFFSI  492

Query  1301  QFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKLSIL  1122
              + LF  SAY CRD SCS+ATTIGLIK RDTY FG+DP WHGTRSELPFLNSLKMK+SIL
Sbjct  493   PYPLFAPSAYDCRDASCSEATTIGLIKVRDTYPFGLDPVWHGTRSELPFLNSLKMKMSIL  552

Query  1121  LGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQADL  942
             LGV+QMNLGII+SYFNA +F+S VN W QFIPQ+IFLN+LFGYLSVLII+KWCTGSQADL
Sbjct  553   LGVSQMNLGIIMSYFNARFFKSSVNVWFQFIPQMIFLNSLFGYLSVLIIIKWCTGSQADL  612

Query  941   YHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQHN-RHQG  765
             YHVMIYMFL PT++LGENQLFP QKT QLVL+ LALVSVP MLLPKPFILK QH  RHQG
Sbjct  613   YHVMIYMFLSPTDELGENQLFPHQKTVQLVLLFLALVSVPCMLLPKPFILKKQHEARHQG  672

Query  764   QSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLRLWAL  585
             QSYAP+++ DESL V+ S  S  HEEFEFSE+FVHQLIHTIEFVLGAVSNTASYLRLWAL
Sbjct  673   QSYAPLEETDESLHVETSGGSHGHEEFEFSEIFVHQLIHTIEFVLGAVSNTASYLRLWAL  732

Query  584   SLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHALRLHW  405
             SLAHSELS+VFYEKVLLLAWGYNN +IL+VG I+F+FAT+GVLLVMETLSAFLHALRLHW
Sbjct  733   SLAHSELSSVFYEKVLLLAWGYNNWLILIVGIIVFVFATVGVLLVMETLSAFLHALRLHW  792

Query  404   VEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             VEFQNKFYEGDGYKF PFSF+L   E++
Sbjct  793   VEFQNKFYEGDGYKFAPFSFILTASEDE  820



>ref|XP_004507485.1| PREDICTED: vacuolar proton ATPase a2-like [Cicer arietinum]
Length=821

 Score =  1207 bits (3122),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 629/816 (77%), Positives = 718/816 (88%), Gaps = 2/816 (0%)
 Frame = -2

Query  2765  GRGGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAA  2586
              RGGC PPMDLFRSEPMQL+QLIIPIESA L+V+YLGDLGL+QFKDLN+EKSPFQRTYAA
Sbjct  5     ARGGCCPPMDLFRSEPMQLIQLIIPIESAHLTVSYLGDLGLLQFKDLNSEKSPFQRTYAA  64

Query  2585  QIKRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANND  2406
             QIKR GEMARKLRFFK+QM KAGVS   ++   DA   DDLE+KL ++E+EL E+NAN +
Sbjct  65    QIKRCGEMARKLRFFKEQMFKAGVSPKCSTTQFDA-NTDDLEIKLTEIESELTEMNANGE  123

Query  2405  KLQRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSAD  2226
             KLQRS+NEL+EYKLVLQK G+FFHSA+S A  QQ+EY S Q   ES+E PLL + ++  D
Sbjct  124   KLQRSYNELLEYKLVLQKAGDFFHSAQSRAIEQQREYESRQLSGESMETPLLQDQELPGD  183

Query  2225  TSKQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFL  2046
             +SK V+LGF++GLVP+EKSMAFERILFRATRGNV LRQ+ V++ V DP+SGEK EKNVF+
Sbjct  184   SSKPVKLGFLAGLVPREKSMAFERILFRATRGNVFLRQTSVEDPVTDPVSGEKTEKNVFV  243

Query  2045  VFYSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGN  1866
             VFY+GE+ K KILKICDAFGANRYPFAEEL KQAQ+I+EVSGK+SELK  IDAG+ HR N
Sbjct  244   VFYAGEKVKAKILKICDAFGANRYPFAEELVKQAQMISEVSGKLSELKATIDAGLSHRVN  303

Query  1865  LLQSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAG  1686
             LL++I  QF++WN+L R+EKSIYHTLNMLS+DVTKKCLVAEGWSP  A  ++QDAL RA 
Sbjct  304   LLENIGTQFEQWNLLARKEKSIYHTLNMLSLDVTKKCLVAEGWSPVFAIKQVQDALHRAA  363

Query  1685  HDSNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPF  1506
              DSNS++ AI +VL TRE PPTYF+TNK TS+FQ I+D+YGVAKYQEANP VFT+VTFPF
Sbjct  364   IDSNSQVSAILQVLHTRELPPTYFRTNKVTSSFQGIIDSYGVAKYQEANPTVFTVVTFPF  423

Query  1505  LFAVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGF  1326
             LFAVMFGDWGHGICLLLA LYF+IREKKLSSQKL DITEMTFGGRYVI +M+LFSIYTG 
Sbjct  424   LFAVMFGDWGHGICLLLAALYFIIREKKLSSQKLDDITEMTFGGRYVIFLMSLFSIYTGL  483

Query  1325  IYNEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNS  1146
             IYNEFFS+ FELFG SAY CRD SCS+ATTIGLIK R TY FGVDP WHG+RSELPFLNS
Sbjct  484   IYNEFFSLPFELFGPSAYECRDLSCSEATTIGLIKVRRTYPFGVDPVWHGSRSELPFLNS  543

Query  1145  LKMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKW  966
             LKMK+SILLGVAQMNLGI++SY NA +FR+ VN W QFIPQ+IFLN+LFGYL++LIIVKW
Sbjct  544   LKMKMSILLGVAQMNLGIVMSYCNAKFFRNNVNVWFQFIPQVIFLNSLFGYLALLIIVKW  603

Query  965   CTGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKS  786
             CTGSQADLYHVMIYMFL PT+DLGENQLF GQK  QL L+LLA+V+VPWMLLPKPFILK 
Sbjct  604   CTGSQADLYHVMIYMFLSPTDDLGENQLFAGQKNLQLTLLLLAVVAVPWMLLPKPFILKK  663

Query  785   QHN-RHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTA  609
             QH  RH  +SYAP+ + +ESL V+ +HDS  HEEFEFSE+FVHQLIHTIEFVLGAVSNTA
Sbjct  664   QHEARHGDESYAPLPNTEESLQVESNHDSHGHEEFEFSEIFVHQLIHTIEFVLGAVSNTA  723

Query  608   SYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAF  429
             SYLRLWALSLAHSELSTVFYEKVLL+AWGYNN IIL+VG I+FIFAT+GVLLVMETLSAF
Sbjct  724   SYLRLWALSLAHSELSTVFYEKVLLMAWGYNNWIILIVGLIVFIFATVGVLLVMETLSAF  783

Query  428   LHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             LHALRLHWVE+QNKFYEGDGYKF PFSF L+DEEE+
Sbjct  784   LHALRLHWVEYQNKFYEGDGYKFHPFSFTLLDEEEE  819



>gb|KFK30491.1| hypothetical protein AALP_AA7G268500 [Arabis alpina]
Length=817

 Score =  1206 bits (3121),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 626/814 (77%), Positives = 721/814 (89%), Gaps = 3/814 (0%)
 Frame = -2

Query  2759  GGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQI  2580
             GGC PPMDL RSEPMQLVQLI+P+ESA L+V+YLGDLGL+QFKDLN+EKSPFQRTYAAQI
Sbjct  6     GGCCPPMDLMRSEPMQLVQLIVPMESAHLTVSYLGDLGLVQFKDLNSEKSPFQRTYAAQI  65

Query  2579  KRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKL  2400
             KR GEMARK+RFFKDQMSKAGV      + +D I  DD+EV+LG+LEAEL+EINANNDKL
Sbjct  66    KRCGEMARKIRFFKDQMSKAGVVPKEVVE-KDDIDLDDVEVRLGELEAELVEINANNDKL  124

Query  2399  QRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTS  2220
             QRS+NEL+EYKLVL+K GEFF SA   A AQQ E  SS  GE+ L++PLL E + + D+S
Sbjct  125   QRSYNELMEYKLVLEKAGEFFSSAHRGATAQQSETESSHEGEDQLDSPLLRE-EKAIDSS  183

Query  2219  KQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVF  2040
             KQV+LGF++GLVP+EKSM FERILFRATRGN+  RQS ++E+VIDP SGEK EKNVF+VF
Sbjct  184   KQVKLGFLTGLVPREKSMVFERILFRATRGNIFTRQSVIEEAVIDPNSGEKAEKNVFVVF  243

Query  2039  YSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLL  1860
             YSGERAK+KILKIC+AFGANRYPF+E+LGKQAQ+ITEVSG+++ELKT IDAG+ HR  LL
Sbjct  244   YSGERAKSKILKICEAFGANRYPFSEDLGKQAQMITEVSGRLAELKTTIDAGLGHRDMLL  303

Query  1859  QSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHD  1680
              +I ++F+ WN+ VR+EK+IYHTLNMLS+DVTKKCLVAEGWSP  A+ EIQDALQRA  D
Sbjct  304   HTIGDKFELWNLKVRKEKAIYHTLNMLSLDVTKKCLVAEGWSPVFASNEIQDALQRAAVD  363

Query  1679  SNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLF  1500
             SNS++G+IF+VL T+E PPTYF+TNKFTSA QEIVDAYGVAKYQEANPGVFTIVTFPFLF
Sbjct  364   SNSQVGSIFQVLRTKELPPTYFRTNKFTSAIQEIVDAYGVAKYQEANPGVFTIVTFPFLF  423

Query  1499  AVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIY  1320
             AVMFGDWGHGIC+LLA+LY ++REKK +SQKLGDI +M FGGRYVI MM+LFSIYTG IY
Sbjct  424   AVMFGDWGHGICILLASLYLIVREKKFASQKLGDIMDMAFGGRYVIFMMSLFSIYTGLIY  483

Query  1319  NEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLK  1140
             NEFFS+ + LF  SAY CRD +CS+ATTIGLIK RDTY FG+DP WHGTRSELPFLNSLK
Sbjct  484   NEFFSIPYPLFAPSAYDCRDVACSEATTIGLIKVRDTYPFGLDPVWHGTRSELPFLNSLK  543

Query  1139  MKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCT  960
             MK+SILLGV+QMNLGII+S+FNA +F+S VN W QF+PQ+IFLN+LFGYLSVLII+KWCT
Sbjct  544   MKMSILLGVSQMNLGIIMSFFNAIFFKSKVNIWFQFVPQMIFLNSLFGYLSVLIIIKWCT  603

Query  959   GSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQH  780
             GSQADLYHVMIYMFL PT++LGEN+LFP QK  QLVL+ LALVSVP MLLPKPFILK QH
Sbjct  604   GSQADLYHVMIYMFLSPTDELGENELFPHQKIVQLVLLFLALVSVPCMLLPKPFILKKQH  663

Query  779   N-RHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASY  603
               RHQGQSYAP+ + DESL V+ +  S  HEEFEFSE+FVHQLIHTIEFVLGAVSNTASY
Sbjct  664   EARHQGQSYAPLDETDESLHVETNGGSHGHEEFEFSEIFVHQLIHTIEFVLGAVSNTASY  723

Query  602   LRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLH  423
             LRLWALSLAHSELS+VFYEKVLLLAWGYNNI+IL+VG I+F+FAT+GVLLVMETLSAFLH
Sbjct  724   LRLWALSLAHSELSSVFYEKVLLLAWGYNNILILIVGIIVFVFATVGVLLVMETLSAFLH  783

Query  422   ALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             ALRLHWVEFQNKFYEGDGYKF PF+FVL   E++
Sbjct  784   ALRLHWVEFQNKFYEGDGYKFAPFTFVLTGTEDE  817



>ref|XP_009149095.1| PREDICTED: LOW QUALITY PROTEIN: vacuolar proton ATPase a3-like 
[Brassica rapa]
Length=817

 Score =  1206 bits (3119),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 632/818 (77%), Positives = 723/818 (88%), Gaps = 2/818 (0%)
 Frame = -2

Query  2771  LGGRGGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTY  2592
             +G  GGC PPMDL RSEPMQLVQLI+P+ESA L+V+YLGDLGL+QFKDLN+EKSPFQRTY
Sbjct  1     MGESGGCCPPMDLMRSEPMQLVQLIVPMESAHLTVSYLGDLGLVQFKDLNSEKSPFQRTY  60

Query  2591  AAQIKRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINAN  2412
             AAQIKR GEMARK+RFFKDQMSKAGV    + +    I  DD++VKLG+LEAEL+EINAN
Sbjct  61    AAQIKRCGEMARKIRFFKDQMSKAGVLRKDSLENGTDIDLDDVDVKLGELEAELVEINAN  120

Query  2411  NDKLQRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMS  2232
             NDKLQRS+NEL+EYKLVL+K GEFF SA +SA AQQ+E  S Q GE+ LEAPLL E D S
Sbjct  121   NDKLQRSYNELMEYKLVLEKAGEFFSSAHTSATAQQREIDSQQVGEDLLEAPLLQE-DKS  179

Query  2231  ADTSKQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNV  2052
              D+SKQV+LGF++GLVP+EKSM FERILFRATRGNV +RQ+ ++E VIDP SG+K EKNV
Sbjct  180   IDSSKQVKLGFLTGLVPREKSMVFERILFRATRGNVFIRQTVIEEPVIDPNSGDKAEKNV  239

Query  2051  FLVFYSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHR  1872
             F+VFYSGERAK+KILKIC+AFGANRYPF+E+LGKQAQ+ITEVSG+++ELKT IDAG+ HR
Sbjct  240   FVVFYSGERAKSKILKICEAFGANRYPFSEDLGKQAQMITEVSGRLTELKTTIDAGLGHR  299

Query  1871  GNLLQSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQR  1692
               LL +I ++F+ WN+ VR+EK+IYHTLNMLS+DVTKKCLVAEGWSP  A+ EIQ+AL+R
Sbjct  300   NILLHAIGDKFELWNLKVRKEKAIYHTLNMLSLDVTKKCLVAEGWSPVFASNEIQNALKR  359

Query  1691  AGHDSNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTF  1512
             A  DSNS++G+IF+VL T+E  PTYF+TNKFTSA QEIVDAYGVAKYQEANPGVFTIVTF
Sbjct  360   AAVDSNSQVGSIFQVLRTKELSPTYFRTNKFTSAIQEIVDAYGVAKYQEANPGVFTIVTF  419

Query  1511  PFLFAVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYT  1332
             PFLFAVMFGDWGHGICLLLAT+Y ++REKKLSSQKLGDI EM FGGRYVI+MM+LFSIYT
Sbjct  420   PFLFAVMFGDWGHGICLLLATMYLIVREKKLSSQKLGDIMEMAFGGRYVIMMMSLFSIYT  479

Query  1331  GFIYNEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFL  1152
             G IYNEFFS+ + LF  SAY CRD SCS+ATTIGLIK RDTY FG+DP WH  RSEL FL
Sbjct  480   GLIYNEFFSIPYPLFAPSAYDCRDASCSEATTIGLIKVRDTYPFGLDPVWHVPRSELQFL  539

Query  1151  NSLKMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIV  972
             NSL MK+SILLGV+QM+LGII+SYFNA +F+S VN W QFIPQ+IFLN+LFGYLSVLII+
Sbjct  540   NSLXMKMSILLGVSQMSLGIIMSYFNARFFKSSVNIWFQFIPQMIFLNSLFGYLSVLIII  599

Query  971   KWCTGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFIL  792
             KWCTGSQADLYHVMIYMFL PT++LGENQLFP QKT QLVL+ LALVSVP MLLPKPFIL
Sbjct  600   KWCTGSQADLYHVMIYMFLSPTDELGENQLFPHQKTVQLVLLFLALVSVPCMLLPKPFIL  659

Query  791   KSQHN-RHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSN  615
             K QH  RHQGQSYAP+++ DESL V+ S  S  HEEFEFSE+FVHQLIHTIEFVLGAVSN
Sbjct  660   KKQHEARHQGQSYAPLEETDESLHVEASGGSHGHEEFEFSEIFVHQLIHTIEFVLGAVSN  719

Query  614   TASYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLS  435
             TASYLRLWALSLAHSELS+VFYEKVLLLAWGYNN +IL+VG I+FIFAT+GVLLVMETLS
Sbjct  720   TASYLRLWALSLAHSELSSVFYEKVLLLAWGYNNWLILIVGIIVFIFATVGVLLVMETLS  779

Query  434   AFLHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             AFLHALRLHWVEFQNKFYEGDGYKF PFSF+L   E++
Sbjct  780   AFLHALRLHWVEFQNKFYEGDGYKFAPFSFILTANEDE  817



>gb|KHG13283.1| Vacuolar proton translocating ATPase subunit [Gossypium arboreum]
Length=820

 Score =  1205 bits (3117),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 632/815 (78%), Positives = 719/815 (88%), Gaps = 2/815 (0%)
 Frame = -2

Query  2762  RGGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQ  2583
             RGGC PPMDLFRSE MQLVQLIIP+ESARL+V YLG LGL+QFKDLN++KSPF+RTYA Q
Sbjct  5     RGGCCPPMDLFRSETMQLVQLIIPMESARLTVYYLGKLGLLQFKDLNSDKSPFRRTYAGQ  64

Query  2582  IKRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDK  2403
             IK+ GEMAR LRFFK+QM KAGVS SA S  +  I  DDLEVKL +LEAEL E+NAN +K
Sbjct  65    IKKCGEMARTLRFFKEQMLKAGVSPSAKSVEETEIDLDDLEVKLAELEAELTEMNANGEK  124

Query  2402  LQRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADT  2223
             LQRS+NELVEYK+VL+K G+FF SA+ SA A+Q+E   +Q  EES+E PLL E   S D 
Sbjct  125   LQRSYNELVEYKIVLRKAGDFFPSAQHSATARQREMELNQMVEESIETPLLQEQATSTDL  184

Query  2222  SKQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLV  2043
             SKQV+LGF++GLV + KSMAFERILFRATRGNV L Q  ++  + DP+SGEK+EKNVF+V
Sbjct  185   SKQVKLGFVTGLVSRGKSMAFERILFRATRGNVFLEQVPIEAPITDPVSGEKMEKNVFMV  244

Query  2042  FYSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNL  1863
             FYSGERAKNKILKICDAFGANRYPFAE+ GKQA +I+EVSGKISELK+ IDAG+LHR +L
Sbjct  245   FYSGERAKNKILKICDAFGANRYPFAEDCGKQALMISEVSGKISELKSTIDAGLLHRDHL  304

Query  1862  LQSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGH  1683
             L++I++QF++WN+ V++EKSI+HTLNMLS+DVTKKCLVAE WSP  AT +IQD LQRA  
Sbjct  305   LRTISDQFEQWNLKVKKEKSIHHTLNMLSLDVTKKCLVAEAWSPVFATKQIQDVLQRASV  364

Query  1682  DSNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFL  1503
             DSNS++GAIF+VL TRESPPTYF+TNKFTSAFQEIVDAYGVAKYQEANPGV+TIVTFPFL
Sbjct  365   DSNSQVGAIFQVLHTRESPPTYFRTNKFTSAFQEIVDAYGVAKYQEANPGVYTIVTFPFL  424

Query  1502  FAVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFI  1323
             FAVMFGDWGHGICLLLATL+F+IREKKLSSQKLGDITEMTFGGRYVI+MM+LFSIYTGFI
Sbjct  425   FAVMFGDWGHGICLLLATLFFIIREKKLSSQKLGDITEMTFGGRYVIMMMSLFSIYTGFI  484

Query  1322  YNEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSL  1143
             YNE FSV F+LF  SAY CRD SC DA +IGLIK RDTY FGVDPAWHGTRSELPFLNSL
Sbjct  485   YNECFSVAFDLFAPSAYACRDLSCRDAYSIGLIKVRDTYPFGVDPAWHGTRSELPFLNSL  544

Query  1142  KMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWC  963
             KMK+SILLGVAQMNLGI+LSY NA +F + +N W QFIPQ+IFLN+LFGYLS+LIIVKWC
Sbjct  545   KMKMSILLGVAQMNLGILLSYSNATFFGNSLNIWFQFIPQMIFLNSLFGYLSLLIIVKWC  604

Query  962   TGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQ  783
             TGSQADLYH+MIYMFL PT++LG+NQLFP QKT QLVL+LLALVSVPWMLLPKPF+LK +
Sbjct  605   TGSQADLYHIMIYMFLSPTDELGDNQLFPYQKTVQLVLLLLALVSVPWMLLPKPFLLKKR  664

Query  782   H-NRHQGQSYAPIQDLDESLLvdgshds-sdheefefsevfvHQLIHTIEFVLGAVSNTA  609
             H NRHQGQSY  +Q  D++L           HEEFEFSEVFVHQLIHTIEFVLGAVSNTA
Sbjct  665   HENRHQGQSYTQVQGTDDALSEANHDSHGHGHEEFEFSEVFVHQLIHTIEFVLGAVSNTA  724

Query  608   SYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAF  429
             SYLRLWALSLAHS+LS VFYEKVLLLAWGYNN++ILVVG IIFIFAT+GVLL+METLSAF
Sbjct  725   SYLRLWALSLAHSQLSIVFYEKVLLLAWGYNNMVILVVGIIIFIFATVGVLLIMETLSAF  784

Query  428   LHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEE  324
             LHALRLHWVEFQNKFYEGDGYKF PFSF+L+D+E+
Sbjct  785   LHALRLHWVEFQNKFYEGDGYKFYPFSFILIDDED  819



>ref|XP_010918984.1| PREDICTED: V-type proton ATPase subunit a3 isoform X2 [Elaeis 
guineensis]
Length=828

 Score =  1204 bits (3114),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 634/814 (78%), Positives = 718/814 (88%), Gaps = 3/814 (0%)
 Frame = -2

Query  2753  CFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKR  2574
             C P MDL RSEPMQLVQ+IIPIESA L+V+YLGDLGL+QFKDLNA+KSPFQRTYA QIKR
Sbjct  15    CCPTMDLMRSEPMQLVQIIIPIESAHLTVSYLGDLGLLQFKDLNADKSPFQRTYANQIKR  74

Query  2573  SGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQR  2394
              GEMARKLRFF +QM+KA +S SA   T+  I  DDLEVKLG+LEAELIE+N+N +KLQR
Sbjct  75    CGEMARKLRFFGEQMTKADISPSAMPVTRTHIDLDDLEVKLGELEAELIEVNSNGEKLQR  134

Query  2393  SFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTSKQ  2214
             +FNEL+EYKLVLQK GEFF+SA+  A AQQ+E  + Q G+ SL++PLL E +M AD SKQ
Sbjct  135   TFNELLEYKLVLQKAGEFFYSAQGHATAQQREIEAHQVGDGSLDSPLLLEQEMLADPSKQ  194

Query  2213  VRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYS  2034
             V+LGF+SGLVPKEK+MAFERILFRATRGN+ L+Q  +D+ V DP+SGEKV KNVF+VFYS
Sbjct  195   VKLGFVSGLVPKEKAMAFERILFRATRGNMFLKQVAIDDPVTDPVSGEKVGKNVFVVFYS  254

Query  2033  GERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQS  1854
             GERAK KILKIC+AFGANRYPF E++GKQ Q+I EVS KISELKT ID G++HR ++L++
Sbjct  255   GERAKTKILKICEAFGANRYPFTEDVGKQMQMIDEVSWKISELKTTIDVGLIHRDSILKN  314

Query  1853  IAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSN  1674
             I  QF++WN LVRREKSIYHTLNMLS+DVTKKCLVAEGWSP  AT ++QDALQRA +DSN
Sbjct  315   IGYQFEQWNHLVRREKSIYHTLNMLSLDVTKKCLVAEGWSPVFATSQVQDALQRATYDSN  374

Query  1673  SEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAV  1494
             S++G+IF+VL T ESPPTYF+TNKFTSAFQEIVDAYGVAKYQEANPGV+TI+TFPFLFAV
Sbjct  375   SQVGSIFQVLHTNESPPTYFQTNKFTSAFQEIVDAYGVAKYQEANPGVYTIITFPFLFAV  434

Query  1493  MFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNE  1314
             MFGDWGHGICLLL TLYF+IREKKLSSQKLGDI EMTFGGRYVI+MMA+FSIYTG IYNE
Sbjct  435   MFGDWGHGICLLLTTLYFIIREKKLSSQKLGDIMEMTFGGRYVIMMMAIFSIYTGLIYNE  494

Query  1313  FFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMK  1134
             FFSV FELFG+SAY CRD SC DATT GLIK R  Y FGVDP WHGTRSELPFLNSLKMK
Sbjct  495   FFSVPFELFGKSAYACRDSSCRDATTEGLIKVRPAYPFGVDPKWHGTRSELPFLNSLKMK  554

Query  1133  LSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGS  954
             +SILLGVAQMNLGI+LSYFNA +FR+ +N W QF+PQ+IFLN+LFGYLS+LIIVKWCTGS
Sbjct  555   MSILLGVAQMNLGIVLSYFNAKFFRNNLNIWYQFVPQLIFLNSLFGYLSLLIIVKWCTGS  614

Query  953   QADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQHN-  777
             +ADLYHVMIYMFL PT+DLGENQLFPGQKT QLVL+LLAL+SVPWML PKP +LK QH  
Sbjct  615   KADLYHVMIYMFLSPTDDLGENQLFPGQKTLQLVLLLLALISVPWMLFPKPILLKKQHQE  674

Query  776   RHQGQSYAPIQDLDE--SLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASY  603
             RHQGQSY  +Q  +E   L    S     +EEFEFSEVFVHQLIHTIEFVLGAVSNTASY
Sbjct  675   RHQGQSYTMLQSTEEMLELDHGHSSHGHGNEEFEFSEVFVHQLIHTIEFVLGAVSNTASY  734

Query  602   LRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLH  423
             LRLWALSLAHSELS+VFYEKVLLLAWG+NNIIIL++GFI+FIFAT+GVLLVMETLSAFLH
Sbjct  735   LRLWALSLAHSELSSVFYEKVLLLAWGFNNIIILIIGFIVFIFATVGVLLVMETLSAFLH  794

Query  422   ALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             ALRLHWVEFQNKFYEGDGYKF PFSF L+ E+ED
Sbjct  795   ALRLHWVEFQNKFYEGDGYKFSPFSFALLAEDED  828



>emb|CDY15895.1| BnaA04g12160D [Brassica napus]
Length=819

 Score =  1204 bits (3114),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 612/814 (75%), Positives = 704/814 (86%), Gaps = 1/814 (0%)
 Frame = -2

Query  2759  GGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQI  2580
             GGC PPMDL RSEPMQLVQ+I+P+ESA L+V+YLGDLGL+QFKDLN++KSPFQRTYAAQI
Sbjct  6     GGCCPPMDLMRSEPMQLVQVIVPMESAHLTVSYLGDLGLVQFKDLNSDKSPFQRTYAAQI  65

Query  2579  KRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKL  2400
             KR GEMARKLRFFKDQMSKAGVS          I  DD+EVKLG+LEAEL EINANNDKL
Sbjct  66    KRCGEMARKLRFFKDQMSKAGVSPKEFLGKDVDIDLDDVEVKLGELEAELSEINANNDKL  125

Query  2399  QRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTS  2220
             QRS+NEL+EYKLVL+K GEFF SA  SA  QQ E  S Q   E      L + + S D +
Sbjct  126   QRSYNELMEYKLVLEKAGEFFASAHRSATTQQSEIESQQQVGEDALEAPLLQEEKSVDPT  185

Query  2219  KQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVF  2040
             KQV+LGF++GLVP+EKSM FERILFRATRGN+ +RQS ++ESV+DP SGEK EKNVF+VF
Sbjct  186   KQVKLGFLTGLVPREKSMVFERILFRATRGNIFIRQSVIEESVVDPSSGEKAEKNVFVVF  245

Query  2039  YSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLL  1860
             YSGERAK+KILKIC+AFGANRYPF+EEL KQAQ++TEV+G+++ELKT I AG+ HR  LL
Sbjct  246   YSGERAKSKILKICEAFGANRYPFSEELSKQAQMMTEVTGRLAELKTTISAGLDHRKILL  305

Query  1859  QSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHD  1680
             ++I ++F++WN+ VR+EK+IYHTLNMLS+DVTKKCLV EGWSP  AT EIQ AL+RA  D
Sbjct  306   ETIGDKFEQWNLKVRKEKAIYHTLNMLSLDVTKKCLVGEGWSPVFATPEIQKALERAAVD  365

Query  1679  SNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLF  1500
             SNS++G+IF+VL T+E PPT+F+TNKFT+AFQEIVDAYGVA YQEANP VFTIVTFPFLF
Sbjct  366   SNSQVGSIFQVLRTKEMPPTFFRTNKFTTAFQEIVDAYGVAIYQEANPTVFTIVTFPFLF  425

Query  1499  AVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIY  1320
             AVMFGDWGHGICLL+AT+Y +++EKKLSSQKLGDI EM FGGRYVILMM+LFSIYTG IY
Sbjct  426   AVMFGDWGHGICLLIATMYLVLKEKKLSSQKLGDIMEMAFGGRYVILMMSLFSIYTGLIY  485

Query  1319  NEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLK  1140
             NEFFS+ F LF  SAY CRD SCS+ATTIGLIK RDTY FGVDP WHGTRSELPFLNSLK
Sbjct  486   NEFFSIPFPLFAPSAYECRDASCSEATTIGLIKTRDTYPFGVDPVWHGTRSELPFLNSLK  545

Query  1139  MKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCT  960
             MK+SILLGVAQMNLGII+S+ NA +F+S VN W QF+PQ+IFLN LFGYLS LII+KWCT
Sbjct  546   MKMSILLGVAQMNLGIIMSFCNAKFFKSAVNIWFQFVPQMIFLNCLFGYLSALIIIKWCT  605

Query  959   GSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQH  780
             GSQADLYHVMIYMFL P EDLGENQLFP QKT QL  + LAL+SVPWMLLPKPFILK QH
Sbjct  606   GSQADLYHVMIYMFLSPMEDLGENQLFPHQKTVQLTFLFLALISVPWMLLPKPFILKKQH  665

Query  779   N-RHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASY  603
               RHQGQSYA +++ DESL V+ +     HEEFEFSE+FVHQLIHTIEFVLGAVSNTASY
Sbjct  666   EARHQGQSYAQLEETDESLQVETNGGPHGHEEFEFSEIFVHQLIHTIEFVLGAVSNTASY  725

Query  602   LRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLH  423
             LRLWALSLAHSELS+VFYEKVLL+AWG+NN +IL+VG ++FIFAT+GVLLVMETLSAFLH
Sbjct  726   LRLWALSLAHSELSSVFYEKVLLMAWGFNNFLILIVGILVFIFATVGVLLVMETLSAFLH  785

Query  422   ALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             ALRLHWVE+QNKFYEGDGYKF PF+F L+  E++
Sbjct  786   ALRLHWVEYQNKFYEGDGYKFAPFTFTLLGNEDE  819



>gb|KHN25411.1| Vacuolar proton translocating ATPase 100 kDa subunit [Glycine 
soja]
Length=806

 Score =  1202 bits (3111),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 629/807 (78%), Positives = 714/807 (88%), Gaps = 2/807 (0%)
 Frame = -2

Query  2741  MDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSGEM  2562
             MDLFRSEPMQLVQLIIPIESA  +V+YLGDLGL+QFKDLNA+KSPFQRTYAAQIKR GEM
Sbjct  1     MDLFRSEPMQLVQLIIPIESAHRTVSYLGDLGLLQFKDLNADKSPFQRTYAAQIKRCGEM  60

Query  2561  ARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSFNE  2382
             AR LRFFKDQM KAGVS   ++   D +  DDLEVKL ++E+EL E+NAN +KLQRS+NE
Sbjct  61    ARGLRFFKDQMLKAGVSPKYSTTPVD-LNIDDLEVKLTEIESELTEMNANGEKLQRSYNE  119

Query  2381  LVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTSKQVRLG  2202
             LVEYKLVLQK GEFFHSA+S A  QQ+E  S     ES+E PLL + ++S D+SKQV+LG
Sbjct  120   LVEYKLVLQKAGEFFHSAQSRALEQQREQESCHLSGESMETPLLQDQELSIDSSKQVKLG  179

Query  2201  FISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSGERA  2022
             F++GLVP+EKSM FERILFRATRGNV LRQ+ V++ V DP+SGEK EKNVF+VFY+GE+A
Sbjct  180   FLAGLVPREKSMVFERILFRATRGNVFLRQATVEDPVTDPVSGEKTEKNVFVVFYAGEKA  239

Query  2021  KNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSIAEQ  1842
             K KILKIC+AFGANRYPFAEELGKQAQ+ITEVSG++ ELKT IDAG+LHR NLL +I  Q
Sbjct  240   KAKILKICEAFGANRYPFAEELGKQAQMITEVSGRLLELKTTIDAGLLHRDNLLNTIGAQ  299

Query  1841  FDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNSEIG  1662
             F++W+ LVR+EKSI+HTLNMLS+DVTKKCLVAEGWSP  AT +IQDALQRA  DSNS++ 
Sbjct  300   FEQWDALVRKEKSIHHTLNMLSLDVTKKCLVAEGWSPVFATKQIQDALQRAALDSNSQVN  359

Query  1661  AIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGD  1482
             AIF+VL TRE PPTYF+TNKFTS+FQ I+D+YGVAKYQEANP V+T+VTFPFLFAVMFGD
Sbjct  360   AIFQVLQTRELPPTYFRTNKFTSSFQGIIDSYGVAKYQEANPTVYTVVTFPFLFAVMFGD  419

Query  1481  WGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEFFSV  1302
             WGHGICLLLA LYF+IREKKLSSQKL DITEMTFGGRYVIL+MA+FSIYTGFIYNEFFSV
Sbjct  420   WGHGICLLLAALYFIIREKKLSSQKLDDITEMTFGGRYVILLMAIFSIYTGFIYNEFFSV  479

Query  1301  QFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKLSIL  1122
              F +F  SAY CRD SC DATT+GLIK RDTY FGVDP WHGTRSELPFLNSLKMK+SIL
Sbjct  480   PFAIFAPSAYECRDLSCRDATTVGLIKVRDTYPFGVDPVWHGTRSELPFLNSLKMKMSIL  539

Query  1121  LGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQADL  942
             LGVAQMNLGI++SYFNA +FR+ VN W QFIPQ+IFLN+LFGYLS+LIIVKW TGSQADL
Sbjct  540   LGVAQMNLGIVMSYFNAIFFRNSVNVWFQFIPQMIFLNSLFGYLSLLIIVKWATGSQADL  599

Query  941   YHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQHN-RHQG  765
             YH++IYMFL PT+DLGENQLF GQK  QLVL+LLA++SVPWMLLPKPFILK QH  RH  
Sbjct  600   YHILIYMFLSPTDDLGENQLFAGQKNLQLVLLLLAVISVPWMLLPKPFILKKQHEARHGV  659

Query  764   QSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLRLWAL  585
             +SY P+Q  DESL V+ +HDS  HEEFEFSEVFVHQLIHTIEFVLGAVSNTASYLRLWAL
Sbjct  660   ESYEPLQSTDESLQVESNHDSHGHEEFEFSEVFVHQLIHTIEFVLGAVSNTASYLRLWAL  719

Query  584   SLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHALRLHW  405
             SLAHSELS+VFYEKVL++AWGYNN+IIL+VG I+FIFAT+GVLLVMETLSAFLHALRLHW
Sbjct  720   SLAHSELSSVFYEKVLMMAWGYNNVIILIVGLIVFIFATVGVLLVMETLSAFLHALRLHW  779

Query  404   VEFQNKFYEGDGYKFDPFSFVLVDEEE  324
             VEFQNKFYEGDGYKF PFSF  +D+EE
Sbjct  780   VEFQNKFYEGDGYKFHPFSFSWLDDEE  806



>emb|CDX99594.1| BnaC04g33510D [Brassica napus]
Length=823

 Score =  1201 bits (3106),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 613/812 (75%), Positives = 704/812 (87%), Gaps = 1/812 (0%)
 Frame = -2

Query  2753  CFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKR  2574
             C PPMDL RSEPMQLVQ+I+P+ESA L+V+YLGDLGL+QFKDLN++KSPFQRTYAAQIKR
Sbjct  12    CCPPMDLMRSEPMQLVQVIVPMESAHLTVSYLGDLGLVQFKDLNSDKSPFQRTYAAQIKR  71

Query  2573  SGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQR  2394
              GEMARKLRFFKDQMSKAGVS          I  DD+EVKLG+LEAEL EINANNDKLQR
Sbjct  72    CGEMARKLRFFKDQMSKAGVSPKEFLGNDVDIDLDDVEVKLGELEAELSEINANNDKLQR  131

Query  2393  SFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTSKQ  2214
             S+NEL+EYKLVL+K GEFF SA  SA AQQ E  S Q   E      L + + S D +KQ
Sbjct  132   SYNELMEYKLVLEKAGEFFASAHRSATAQQSEIESQQQVGEDALEAPLLQEEKSVDPTKQ  191

Query  2213  VRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYS  2034
             V+LGF++GLVP+EKSM FERILFRATRGN+ +RQS ++ESV+DP SGEK EKNVF+VFYS
Sbjct  192   VKLGFLTGLVPREKSMVFERILFRATRGNIFIRQSVIEESVVDPNSGEKAEKNVFVVFYS  251

Query  2033  GERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQS  1854
             GERAK+KILKIC+AFGANRYPF+E+L KQAQ++TEV+G+++ELKT I AG+ HR  LL++
Sbjct  252   GERAKSKILKICEAFGANRYPFSEDLSKQAQMMTEVTGRLAELKTTISAGLDHRKILLET  311

Query  1853  IAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSN  1674
             I ++F++WN+ VR+EK+IYHTLNMLS+DVTKKCLV EGWSP  AT EIQ ALQRA  DSN
Sbjct  312   IGDKFEQWNLKVRKEKAIYHTLNMLSLDVTKKCLVGEGWSPVFATPEIQKALQRAAVDSN  371

Query  1673  SEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAV  1494
             S++G+IF+VL T+E PPT+F+TNKFT+AFQEIVDAYGVAKYQEANP VFTIVTFPFLFAV
Sbjct  372   SQVGSIFQVLRTKEMPPTFFRTNKFTTAFQEIVDAYGVAKYQEANPTVFTIVTFPFLFAV  431

Query  1493  MFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNE  1314
             MFGDWGHGICLL+AT+Y ++REKKLSSQKLGDI EM FGGRYVILMM+LFSIYTG IYNE
Sbjct  432   MFGDWGHGICLLIATMYLVLREKKLSSQKLGDIMEMAFGGRYVILMMSLFSIYTGLIYNE  491

Query  1313  FFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMK  1134
             FFS+ F LF  SAY CRD SCS+ATTIGLIK RDTY FGVDP WHGTRSELPFLNSLKMK
Sbjct  492   FFSIPFPLFAPSAYECRDASCSEATTIGLIKTRDTYPFGVDPVWHGTRSELPFLNSLKMK  551

Query  1133  LSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGS  954
             +SILLGVAQMNLGII+S+ NA +F+S VN W QF+PQ+IFLN LFGYLS LII+KWCTGS
Sbjct  552   MSILLGVAQMNLGIIMSFCNAKFFKSAVNIWFQFVPQMIFLNCLFGYLSALIIIKWCTGS  611

Query  953   QADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQHN-  777
             QADLYHVMIYMFL P EDLGENQLFP QKT QL  + LAL+SVPWMLLPKPFILK QH  
Sbjct  612   QADLYHVMIYMFLSPMEDLGENQLFPYQKTVQLTFLFLALISVPWMLLPKPFILKKQHEA  671

Query  776   RHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLR  597
             RHQGQSYA + + DESL V+ +  +  HEEFEFSE+FVHQLIHTIEFVLGAVSNTASYLR
Sbjct  672   RHQGQSYAQLGETDESLQVETNGGAHGHEEFEFSEIFVHQLIHTIEFVLGAVSNTASYLR  731

Query  596   LWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHAL  417
             LWALSLAHSELS+VFYEKVLL+AWG+NN +IL+VG ++FIFAT+GVLLVMETLSAFLHAL
Sbjct  732   LWALSLAHSELSSVFYEKVLLMAWGFNNFLILIVGILVFIFATVGVLLVMETLSAFLHAL  791

Query  416   RLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             RLHWVE+QNKFYEGDGYKF PF+F L+  E++
Sbjct  792   RLHWVEYQNKFYEGDGYKFAPFTFTLLGNEDE  823



>ref|XP_009140276.1| PREDICTED: vacuolar proton ATPase a2-like [Brassica rapa]
Length=818

 Score =  1200 bits (3104),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 619/814 (76%), Positives = 714/814 (88%), Gaps = 2/814 (0%)
 Frame = -2

Query  2759  GGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQI  2580
             GGC PPMDL RSEPMQLVQ+I+P+ESA L+V+YLGDLGL+QFKDLN++KSPFQRTYAAQI
Sbjct  6     GGCCPPMDLMRSEPMQLVQVIVPMESAHLTVSYLGDLGLVQFKDLNSDKSPFQRTYAAQI  65

Query  2579  KRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKL  2400
             KR GEMARKLRFFKDQMSKAGVS          I FDD+EVKLG+LEAEL EINANNDKL
Sbjct  66    KRCGEMARKLRFFKDQMSKAGVSPKEFLGKDVDIDFDDVEVKLGELEAELSEINANNDKL  125

Query  2399  QRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTS  2220
             QRS+NEL+EYKLVL+K GEFF SA  SA AQQ E  S Q GE++LEAPLL E + S D +
Sbjct  126   QRSYNELMEYKLVLEKAGEFFASAHRSATAQQSEIESQQVGEDALEAPLLQE-EKSVDPT  184

Query  2219  KQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVF  2040
             KQV+LGF++GLVP+EKSM FERILFRATRGN+ +RQS ++ESV+DP SGEK EKNVF+VF
Sbjct  185   KQVKLGFLTGLVPREKSMVFERILFRATRGNIFIRQSVIEESVVDPSSGEKAEKNVFVVF  244

Query  2039  YSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLL  1860
             YSGERAK+KILKIC+AFGANRYPF+E+L KQAQ++TEV+G+++ELKT I AG+ HR  LL
Sbjct  245   YSGERAKSKILKICEAFGANRYPFSEDLSKQAQMMTEVTGRLAELKTTISAGLDHRKILL  304

Query  1859  QSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHD  1680
             ++I ++F++WN+ VR+EK+IYHTLNMLS+DVTKKCLV EGWSP  AT EIQ ALQRA  D
Sbjct  305   ETIGDKFEQWNLKVRKEKAIYHTLNMLSLDVTKKCLVGEGWSPVFATPEIQKALQRAAVD  364

Query  1679  SNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLF  1500
             SNS++G+IF+VL T+E PPT+F+TNKFT+AFQEIVDAYGVAKYQEANP VFTIVTFPFLF
Sbjct  365   SNSQVGSIFQVLRTKEMPPTFFRTNKFTTAFQEIVDAYGVAKYQEANPTVFTIVTFPFLF  424

Query  1499  AVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIY  1320
             AVMFGDWGHGICLL+AT+Y ++REKKLSSQKLGDI EM FGGRYVILMM+LFSIYTG IY
Sbjct  425   AVMFGDWGHGICLLIATMYLVLREKKLSSQKLGDIMEMAFGGRYVILMMSLFSIYTGLIY  484

Query  1319  NEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLK  1140
             NEFFS+ F LF  SAY CRD SCS+ATTIGLIK RDTY FGVDP WHGTRSELPFLNSLK
Sbjct  485   NEFFSIPFPLFAPSAYECRDASCSEATTIGLIKTRDTYPFGVDPVWHGTRSELPFLNSLK  544

Query  1139  MKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCT  960
             MK+SILLGVAQMNLGII+S+ NA +F+S VN W QF+PQ+IFLN LFGYLS LI++KWCT
Sbjct  545   MKMSILLGVAQMNLGIIMSFCNAKFFKSAVNIWFQFVPQMIFLNCLFGYLSALIVIKWCT  604

Query  959   GSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQH  780
             GSQADLYHVMIYMFL P EDLGENQLFP QKT QL  + LAL+SVPWMLLPKPFILK QH
Sbjct  605   GSQADLYHVMIYMFLSPMEDLGENQLFPHQKTVQLTFLFLALISVPWMLLPKPFILKKQH  664

Query  779   N-RHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASY  603
               RHQGQSYA +++ DESL V+ +  +  HEEFEFSE+FVHQLIHTIEFVLGAVSNTASY
Sbjct  665   EARHQGQSYAQLEETDESLQVETNGGAHGHEEFEFSEIFVHQLIHTIEFVLGAVSNTASY  724

Query  602   LRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLH  423
             LRLWALSLAHSELS+VFYEKVLL+AWG+NN +IL+VG ++FIFAT+GVLLVMETLSA L 
Sbjct  725   LRLWALSLAHSELSSVFYEKVLLMAWGFNNFLILIVGILVFIFATVGVLLVMETLSALLQ  784

Query  422   ALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             ALRLHWVE+Q+KFYEGDGYKF PF+F L+  E++
Sbjct  785   ALRLHWVEYQHKFYEGDGYKFAPFTFTLLGNEDE  818



>ref|XP_002866830.1| VHA-A3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43089.1| VHA-A3 [Arabidopsis lyrata subsp. lyrata]
Length=820

 Score =  1199 bits (3101),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 625/808 (77%), Positives = 716/808 (89%), Gaps = 2/808 (0%)
 Frame = -2

Query  2741  MDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSGEM  2562
             MDL RSE MQLVQLI+P+ESA L+V+YLGDLGL+QFKDLN+EKSPFQRTYAAQIKR GEM
Sbjct  14    MDLMRSETMQLVQLIVPMESAHLTVSYLGDLGLVQFKDLNSEKSPFQRTYAAQIKRCGEM  73

Query  2561  ARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSFNE  2382
             ARK+RFFKDQMSKAGV A      ++ I  DD+EVKLG+LEAEL+EINANNDKLQRS+NE
Sbjct  74    ARKIRFFKDQMSKAGVPAKEMLVKENDIDLDDVEVKLGELEAELVEINANNDKLQRSYNE  133

Query  2381  LVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTSKQVRLG  2202
             L+EYKLVLQK GEFF SA  SA  QQ E  S Q+GE+ LE+PLL E + S D++KQV+LG
Sbjct  134   LMEYKLVLQKAGEFFSSAHRSATDQQSEIESQQAGEDLLESPLLQE-EKSIDSTKQVKLG  192

Query  2201  FISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSGERA  2022
             F++GLVP+EKSM FERILFRATRGN+ +RQ+ ++E VIDP +GEK EKNVF+VFYSGERA
Sbjct  193   FLTGLVPREKSMVFERILFRATRGNIFIRQTVIEEPVIDPNTGEKAEKNVFVVFYSGERA  252

Query  2021  KNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSIAEQ  1842
             K+KILKIC+AFGANRYPF+E+LG+QAQ+ITEVSG++SELKT IDAG+  R  LLQ+I ++
Sbjct  253   KSKILKICEAFGANRYPFSEDLGRQAQMITEVSGRLSELKTTIDAGLGQRNILLQTIGDK  312

Query  1841  FDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNSEIG  1662
             F+ WN+ VR+EK+IYHTLNMLS+DVTKKCLVAEGWSP  A+ EIQDALQRA  DSNS++G
Sbjct  313   FELWNLKVRKEKAIYHTLNMLSLDVTKKCLVAEGWSPVFASKEIQDALQRAAVDSNSQVG  372

Query  1661  AIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGD  1482
             +IF+VL T+ESPPTYF+TNKFTSA QEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGD
Sbjct  373   SIFQVLRTKESPPTYFRTNKFTSAIQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGD  432

Query  1481  WGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEFFSV  1302
             WGHGIC+LLAT+Y ++REKKLSSQKLGDI EM FGGRYVILMM+LFSIYTG IYNEFFS+
Sbjct  433   WGHGICILLATMYLILREKKLSSQKLGDIMEMAFGGRYVILMMSLFSIYTGLIYNEFFSI  492

Query  1301  QFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKLSIL  1122
              + LF  SAY CRD SCS+ATTIGLIK RDTY FG+DP WHG+RSELPFLNSLKMK+SIL
Sbjct  493   PYPLFAPSAYDCRDTSCSEATTIGLIKVRDTYPFGLDPVWHGSRSELPFLNSLKMKMSIL  552

Query  1121  LGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQADL  942
             LGV+QMNLGII+SYFNA +F+S VN W QFIPQ+IFLN+LFGYLSVLII+KWCTGSQADL
Sbjct  553   LGVSQMNLGIIMSYFNARFFKSSVNIWFQFIPQMIFLNSLFGYLSVLIIIKWCTGSQADL  612

Query  941   YHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQHN-RHQG  765
             YHVMIYMFL P ++LGENQLFP QKT QL+L+ LALVSVP MLLPKPFILK QH  RHQG
Sbjct  613   YHVMIYMFLSPMDELGENQLFPHQKTVQLLLLFLALVSVPCMLLPKPFILKKQHEARHQG  672

Query  764   QSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLRLWAL  585
             Q YAP+ + DESL V+ S  S  HEEFEFSE+FVHQLIHTIEFVLGAVSNTASYLRLWAL
Sbjct  673   QLYAPLDETDESLHVETSGGSHGHEEFEFSEIFVHQLIHTIEFVLGAVSNTASYLRLWAL  732

Query  584   SLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHALRLHW  405
             SLAHSELS+VFYEKVLLLA+GYNN++I +VG I+FIFAT+GVLLVMETLSAFLHALRLHW
Sbjct  733   SLAHSELSSVFYEKVLLLAFGYNNVLIWIVGIIVFIFATVGVLLVMETLSAFLHALRLHW  792

Query  404   VEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             VEFQNKFYEGDGYKF PF+FV    E++
Sbjct  793   VEFQNKFYEGDGYKFAPFTFVFTANEDE  820



>emb|CDX82029.1| BnaC08g35720D [Brassica napus]
Length=821

 Score =  1197 bits (3098),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 627/822 (76%), Positives = 716/822 (87%), Gaps = 2/822 (0%)
 Frame = -2

Query  2783  MAERLGGRGGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPF  2604
             MA+  GG GG  PPMDL RSEPMQLVQ+I+P+ESA L+V+YLGDLGL+QFKDLNA KSPF
Sbjct  1     MADIRGGGGGFCPPMDLMRSEPMQLVQVIVPMESAHLTVSYLGDLGLVQFKDLNAGKSPF  60

Query  2603  QRTYAAQIKRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIE  2424
             QRTYA QIKR GEMARK+RFFKDQ SKAGVS     D    I  DD+EVKLG+LEAEL+E
Sbjct  61    QRTYATQIKRCGEMARKIRFFKDQTSKAGVSPRVILDKDIDIDLDDVEVKLGELEAELVE  120

Query  2423  INANNDKLQRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllse  2244
             INANNDKLQRS+NELVEYKLVL+K GEFF SA  SA AQQ E  S Q GE+ LE PLL E
Sbjct  121   INANNDKLQRSYNELVEYKLVLEKAGEFFASAHRSATAQQSEIESQQVGEDVLETPLLQE  180

Query  2243  PDMSADTSKQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKV  2064
              + S D +KQV+LGF++GLVP+EKSM FERILFRATRGN+ +RQS ++ESV+DP SGEK 
Sbjct  181   -EKSVDPTKQVKLGFLTGLVPREKSMVFERILFRATRGNIFIRQSVIEESVVDPNSGEKA  239

Query  2063  EKNVFLVFYSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAG  1884
             EKNVF+VFYSGERAK+KILKIC+AFGANRYPF+EELG+QAQ+++EVSG+++ELKT I AG
Sbjct  240   EKNVFVVFYSGERAKSKILKICEAFGANRYPFSEELGRQAQMMSEVSGRLAELKTTISAG  299

Query  1883  ILHRGNLLQSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQD  1704
             + HR  LL++I ++F++WN+ VR+EK+IYHTLNMLS+DVTKKCLV EGWSP  A  EIQ+
Sbjct  300   LDHRKILLETIGDKFEQWNLKVRKEKAIYHTLNMLSLDVTKKCLVGEGWSPLFAAPEIQE  359

Query  1703  ALQRAGHDSNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFT  1524
             ALQRA  DSNS++G+IF+VL T+E PPT+F+TNKFT+AFQEIVDAYGVAKYQEANP VFT
Sbjct  360   ALQRAAVDSNSQVGSIFQVLRTKEMPPTFFRTNKFTTAFQEIVDAYGVAKYQEANPTVFT  419

Query  1523  IVTFPFLFAVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALF  1344
             IVTFPFLFAVMFGDWGHGICLLLAT+Y ++REKKLSSQKLGDI EM FGGRYVI MM+LF
Sbjct  420   IVTFPFLFAVMFGDWGHGICLLLATMYLILREKKLSSQKLGDIMEMAFGGRYVIFMMSLF  479

Query  1343  SIYTGFIYNEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSE  1164
             SIYTG IYNEFFS+ + LF  SAY CRD SCS+ATTIGLIK RDTY FGVDP WHGTRSE
Sbjct  480   SIYTGLIYNEFFSIPYPLFSPSAYECRDASCSEATTIGLIKTRDTYPFGVDPVWHGTRSE  539

Query  1163  LPFLNSLKMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSV  984
             LPFLNSLKMK+SILLGVAQMNLGII+S+ NA +F+S VN W QF+PQ+IFLN LFGYLSV
Sbjct  540   LPFLNSLKMKMSILLGVAQMNLGIIMSFCNAKFFKSAVNVWFQFVPQMIFLNCLFGYLSV  599

Query  983   LIIVKWCTGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPK  804
             LII+KWCTGSQADLYHVMIYMFL P +DLGENQLFP QKT QL  + LALVSVPWMLLPK
Sbjct  600   LIIIKWCTGSQADLYHVMIYMFLSPMDDLGENQLFPNQKTVQLTFLFLALVSVPWMLLPK  659

Query  803   PFILKSQHN-RHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLG  627
             PFILK QH  RHQGQSYA + + DESL V+ +  S  HEEFEFSE+FVHQLIHTIEFVLG
Sbjct  660   PFILKKQHEARHQGQSYAQLDETDESLQVETNGGSHGHEEFEFSEIFVHQLIHTIEFVLG  719

Query  626   AVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVM  447
             AVSNTASYLRLWALSLAHSELS+VFYEKVLL+AWG+NNI IL+VG ++FIFAT+GVLLVM
Sbjct  720   AVSNTASYLRLWALSLAHSELSSVFYEKVLLMAWGFNNIFILIVGILVFIFATVGVLLVM  779

Query  446   ETLSAFLHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             ETLSAFLHALRLHWVE+QNKFYEGDGYKF PF+F LV  E++
Sbjct  780   ETLSAFLHALRLHWVEYQNKFYEGDGYKFAPFTFTLVGNEDE  821



>gb|EEE50667.1| hypothetical protein OsJ_30905 [Oryza sativa Japonica Group]
Length=820

 Score =  1196 bits (3095),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 621/818 (76%), Positives = 717/818 (88%), Gaps = 4/818 (0%)
 Frame = -2

Query  2765  GRGGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAA  2586
             G GGC P MDL RSE MQLVQ+IIP ESA L+V+YLGDLGL+QFKDLNA+KSPFQRTYA+
Sbjct  4     GGGGCCPSMDLMRSEAMQLVQVIIPAESAHLAVSYLGDLGLLQFKDLNADKSPFQRTYAS  63

Query  2585  QIKRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANND  2406
             QIKR GEMARKLRFF++QMSKA + A++   +  +++ DDLEVKLG+LE EL E+NANND
Sbjct  64    QIKRCGEMARKLRFFREQMSKAAI-ATSTQFSGTSLEIDDLEVKLGELEVELTEVNANND  122

Query  2405  KLQRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSAD  2226
             KLQR++NELVEY +VLQK GEFF+SA+ SA  QQ+E  + QSG+ SLE+PLL + +M  D
Sbjct  123   KLQRTYNELVEYNIVLQKAGEFFYSAQRSATEQQREMSADQSGDSSLESPLLQQAEMVTD  182

Query  2225  TSKQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFL  2046
              SKQV+LG +SGLVPKEK+MAFERILFRATRGN+ LRQ  VDE+V DP+SGEKV KN F+
Sbjct  183   PSKQVKLGSLSGLVPKEKAMAFERILFRATRGNMFLRQEPVDETVTDPLSGEKVIKNAFV  242

Query  2045  VFYSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGN  1866
             +FYSGERAK+KI+KICDAFGANRYPF E+LGKQ Q I EVSGKISELK  I+ G+ HR +
Sbjct  243   IFYSGERAKSKIVKICDAFGANRYPFPEDLGKQLQTIQEVSGKISELKATIEIGLAHRDS  302

Query  1865  LLQSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAG  1686
             +L++I+ +F++WN LV++EK+IYHTLNMLS+DVTKKCLVAEGWSP  AT +IQDALQRA 
Sbjct  303   ILKNISSEFEQWNTLVKKEKAIYHTLNMLSLDVTKKCLVAEGWSPVFATSQIQDALQRAT  362

Query  1685  HDSNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPF  1506
              DS S++G+IF+VL T+ESPPT+F+TNKFTSAFQEIVDAYG+AKYQEANPGVFTIVTFPF
Sbjct  363   VDSKSQVGSIFQVLNTQESPPTFFQTNKFTSAFQEIVDAYGIAKYQEANPGVFTIVTFPF  422

Query  1505  LFAVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGF  1326
             LFA+MFGDWGHGICLLLATLY +IREKKL+SQKL DI +M FGGRYVILMM+LFSIYTG 
Sbjct  423   LFAIMFGDWGHGICLLLATLYLIIREKKLASQKLDDIMDMMFGGRYVILMMSLFSIYTGL  482

Query  1325  IYNEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNS  1146
             IYNEFFSV FELFG+SAY CRDPSC DATT GLIK R  Y+FGVDP WHG+RSELPFLNS
Sbjct  483   IYNEFFSVPFELFGKSAYACRDPSCGDATTEGLIKVRPAYSFGVDPVWHGSRSELPFLNS  542

Query  1145  LKMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKW  966
             LKMKLSIL+GVAQMNLGI++SYFNA +FR+ +N W QFIPQ+IFLN+LFGYLS+LII+KW
Sbjct  543   LKMKLSILIGVAQMNLGIMMSYFNAKFFRNAINVWYQFIPQLIFLNSLFGYLSLLIIIKW  602

Query  965   CTGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKS  786
             CTGS+ADLYHVMIYMFL PT+DLGEN+LFPGQK  QLVL+LLALVSVPWML+PKPF LK 
Sbjct  603   CTGSKADLYHVMIYMFLSPTDDLGENELFPGQKLVQLVLLLLALVSVPWMLIPKPFFLKK  662

Query  785   QH-NRHQGQSYAPIQDLDESL--LvdgshdssdheefefsevfvHQLIHTIEFVLGAVSN  615
             QH  RHQGQ Y  +Q  DES+  L +   D   HEEFEFSEVFVHQLIHTIEFVLGAVSN
Sbjct  663   QHEQRHQGQQYTMLQATDESVTELEEHQDDPHHHEEFEFSEVFVHQLIHTIEFVLGAVSN  722

Query  614   TASYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLS  435
             TASYLRLWALSLAHSELSTVFYEKVL+L+WGYNNI IL++G +IF+FATIGVLLVMETLS
Sbjct  723   TASYLRLWALSLAHSELSTVFYEKVLVLSWGYNNIFILIIGAVIFLFATIGVLLVMETLS  782

Query  434   AFLHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             AFLHALRLHWVEFQNKFYEGDGYKF PF+F  + EEED
Sbjct  783   AFLHALRLHWVEFQNKFYEGDGYKFVPFAFASIIEEED  820



>ref|XP_007131786.1| hypothetical protein PHAVU_011G041500g [Phaseolus vulgaris]
 gb|ESW03780.1| hypothetical protein PHAVU_011G041500g [Phaseolus vulgaris]
Length=818

 Score =  1196 bits (3094),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 628/815 (77%), Positives = 719/815 (88%), Gaps = 2/815 (0%)
 Frame = -2

Query  2765  GRGGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAA  2586
              R GC PPMDLFRSEPMQLVQLIIPIESA  +V+YLGDLGL+QFKDLNA+KSPFQRTYA 
Sbjct  5     ARSGCCPPMDLFRSEPMQLVQLIIPIESAHRTVSYLGDLGLLQFKDLNADKSPFQRTYAN  64

Query  2585  QIKRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANND  2406
             QIKR GEMAR+LR+FK+QM KAGVS   ++   D +  DDLEVKL ++E+EL E+NAN +
Sbjct  65    QIKRCGEMARRLRYFKEQMLKAGVSPKYSTTPVD-VNIDDLEVKLTEIESELTEMNANGE  123

Query  2405  KLQRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSAD  2226
             KLQRS+NELVEYKLVLQK GEFF SA+S A  QQ+EY S Q G ES+E PLL + ++  D
Sbjct  124   KLQRSYNELVEYKLVLQKAGEFFRSAQSRAIEQQREYESRQLGGESMETPLLQDQELLGD  183

Query  2225  TSKQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFL  2046
             +SKQ++LGF++GLVP+EKSM FERILFRATRGNV LRQ+ V++ V DP+SG+K EKNVF+
Sbjct  184   SSKQIKLGFLAGLVPREKSMVFERILFRATRGNVFLRQATVEDPVTDPVSGDKTEKNVFV  243

Query  2045  VFYSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGN  1866
             +FY+GE+AK KILKIC+AFGANRYPFAEELGKQAQ+ITEVSG++ ELKT IDAG+LHR N
Sbjct  244   IFYAGEKAKAKILKICEAFGANRYPFAEELGKQAQMITEVSGRLLELKTTIDAGLLHRNN  303

Query  1865  LLQSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAG  1686
             LL +I  QF++W+VLVR+EKSI+H LNMLS+DVTKKCLVAEGWSP  A  +IQDALQRA 
Sbjct  304   LLNTIGAQFEQWDVLVRKEKSIHHILNMLSLDVTKKCLVAEGWSPIFANKQIQDALQRAA  363

Query  1685  HDSNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPF  1506
              DSNS++ AIF+VL TRE PPTYF+TNKFTS+FQ I+D+YGVAKYQEANP V+T+VTFPF
Sbjct  364   LDSNSQVNAIFQVLHTRELPPTYFRTNKFTSSFQGIIDSYGVAKYQEANPTVYTVVTFPF  423

Query  1505  LFAVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGF  1326
             LFAVMFGDWGHGICLLLA LYF+IREKKLSSQKL DITEMTFGGRYVILMMALFSIYTGF
Sbjct  424   LFAVMFGDWGHGICLLLAALYFIIREKKLSSQKLDDITEMTFGGRYVILMMALFSIYTGF  483

Query  1325  IYNEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNS  1146
             IYNEFFSV F LF  SAY CRD SC D+TT+GLIK RDTY FGVDP WHGTRSELPFLNS
Sbjct  484   IYNEFFSVPFALFAPSAYDCRDLSCRDSTTVGLIKVRDTYPFGVDPVWHGTRSELPFLNS  543

Query  1145  LKMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKW  966
             LKMK+SILLGVAQMNLGI++SY NA +FR+ VN W QFIPQ+IFLN+LFGYL++LIIVKW
Sbjct  544   LKMKMSILLGVAQMNLGIVMSYCNAIFFRNRVNVWFQFIPQMIFLNSLFGYLALLIIVKW  603

Query  965   CTGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKS  786
              TGSQADLYH++IYMFL PT+DLGENQLF GQ+  QLVL+LLA+VSVPWML+PKPFILK 
Sbjct  604   STGSQADLYHILIYMFLSPTDDLGENQLFVGQRNLQLVLLLLAVVSVPWMLVPKPFILKK  663

Query  785   QHN-RHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTA  609
             QH  RH  +SY P++  DESL V+ +HDS  HEEFEFSEVFVHQLIHTIEFVLGAVSNTA
Sbjct  664   QHEARHGVESYTPLESTDESLQVESNHDSHGHEEFEFSEVFVHQLIHTIEFVLGAVSNTA  723

Query  608   SYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAF  429
             SYLRLWALSLAHSELS+VFYEKVLL+AWGYNN+IIL+VG I+FIFAT+GVLLVMETLSAF
Sbjct  724   SYLRLWALSLAHSELSSVFYEKVLLMAWGYNNVIILIVGLIVFIFATVGVLLVMETLSAF  783

Query  428   LHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEE  324
             LHALRLHWVEFQNKFYEGDGYKF PFSF L+D+EE
Sbjct  784   LHALRLHWVEFQNKFYEGDGYKFHPFSFSLLDDEE  818



>ref|XP_009769606.1| PREDICTED: V-type proton ATPase subunit a2-like [Nicotiana sylvestris]
Length=819

 Score =  1196 bits (3093),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 624/816 (76%), Positives = 705/816 (86%), Gaps = 1/816 (0%)
 Frame = -2

Query  2765  GRGGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAA  2586
             G  GC P MDL RSEPMQLVQLIIP+ESA  +++YLGDLGL QFKDLN EKSPFQRTYA 
Sbjct  4     GGEGCCPTMDLLRSEPMQLVQLIIPMESAHRTISYLGDLGLFQFKDLNVEKSPFQRTYAT  63

Query  2585  QIKRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANND  2406
             QIKR GEMARKLRF K+QM+KAG + S  +     I  D+LEVKLG+LEAEL E+N N +
Sbjct  64    QIKRCGEMARKLRFLKEQMTKAGFTPSTRTTMGSNINLDELEVKLGELEAELAEMNTNTE  123

Query  2405  KLQRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSAD  2226
             KLQRS+NEL+EYKLVLQK GEFFHSA++SA AQ +E      GE S+++PLL E +  AD
Sbjct  124   KLQRSYNELLEYKLVLQKAGEFFHSAQNSATAQHKELEEHAHGERSIDSPLLLEQEAFAD  183

Query  2225  TSKQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFL  2046
              SKQV+LGF+SGLV +EKSMAFER LFRATRGNV L+Q  V+  VIDP+SG +VEKNVF+
Sbjct  184   PSKQVKLGFVSGLVAREKSMAFERFLFRATRGNVFLKQVVVENPVIDPVSGTEVEKNVFV  243

Query  2045  VFYSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGN  1866
             +FYSGERAKNKILKICDAFGANRYPF +++GKQ ++ITEVSGK+SELKT +D G LHR N
Sbjct  244   IFYSGERAKNKILKICDAFGANRYPFTDDIGKQYEMITEVSGKLSELKTTVDVGQLHRAN  303

Query  1865  LLQSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAG  1686
             LLQ+I  +FD+WN+LV++EK IYHTLNMLSIDVTKKCLV EGW P  A+ +IQ+ L RA 
Sbjct  304   LLQTIGYEFDQWNLLVKKEKFIYHTLNMLSIDVTKKCLVGEGWCPVYASSQIQNQLHRAT  363

Query  1685  HDSNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPF  1506
              DSNS++GAIF+VL T E PPTYF+TNKFTSAFQEIVDAYGVAKYQE NPGVFTIVTFPF
Sbjct  364   LDSNSQVGAIFQVLHTTELPPTYFRTNKFTSAFQEIVDAYGVAKYQEVNPGVFTIVTFPF  423

Query  1505  LFAVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGF  1326
             LFAVMFGDWGHGICLLLATLYF++REKKLSSQKLGDI EMTFGGRYVI+MMALFSIYTGF
Sbjct  424   LFAVMFGDWGHGICLLLATLYFILREKKLSSQKLGDIMEMTFGGRYVIMMMALFSIYTGF  483

Query  1325  IYNEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNS  1146
             IYNEFFSV FE+FGRSAY CRD SC DATTIGLIK RD Y FGVDP WHGTRSELPFLNS
Sbjct  484   IYNEFFSVPFEIFGRSAYGCRDLSCRDATTIGLIKVRDAYPFGVDPKWHGTRSELPFLNS  543

Query  1145  LKMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKW  966
             LKMK+SILLGVAQMNLGIILSYFN  +F++ VN W QF+PQ+IFLN+LFGYLS+LIIVKW
Sbjct  544   LKMKMSILLGVAQMNLGIILSYFNGKFFKNDVNVWHQFVPQMIFLNSLFGYLSLLIIVKW  603

Query  965   CTGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKS  786
             CTGSQADLYHVMIYMFL PT+DLGENQLF GQK  QL+LV LALV+VPWML PKPF+LK 
Sbjct  604   CTGSQADLYHVMIYMFLSPTDDLGENQLFIGQKYLQLLLVSLALVAVPWMLFPKPFLLKK  663

Query  785   QH-NRHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTA  609
             QH  RH+GQ YA +   D+S  ++  + S  HEEFEFSEVFVHQLIHTIEFVLGAVSNTA
Sbjct  664   QHEERHRGQLYAMLDSTDDSFELETHNHSHGHEEFEFSEVFVHQLIHTIEFVLGAVSNTA  723

Query  608   SYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAF  429
             SYLRLWALSLAHSELS+VFY+KVLLLA G+NNIIILV+G ++FIFAT+GVLLVMETLSAF
Sbjct  724   SYLRLWALSLAHSELSSVFYDKVLLLAMGFNNIIILVIGIVVFIFATVGVLLVMETLSAF  783

Query  428   LHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             LHALRLHWVEFQNKFYEGDGYKF PFSF L+ E+ED
Sbjct  784   LHALRLHWVEFQNKFYEGDGYKFSPFSFGLISEDED  819



>ref|NP_568051.1| vacuolar proton ATPase A3 [Arabidopsis thaliana]
 sp|Q8W4S4.1|VHAA3_ARATH RecName: Full=V-type proton ATPase subunit a3; Short=V-ATPase 
subunit a3; AltName: Full=V-type proton ATPase 95 kDa subunit 
a isoform 3; Short=V-ATPase 95 kDa isoform a3; AltName: Full=Vacuolar 
H(+)-ATPase subunit a isoform 3; AltName: Full=Vacuolar 
proton pump subunit a3; AltName: Full=Vacuolar proton 
translocating ATPase 95 kDa subunit a isoform 3 [Arabidopsis 
thaliana]
 gb|AAL31187.1| AT4g39080/F19H22_180 [Arabidopsis thaliana]
 gb|AAO11531.1| At4g39080/F19H22_180 [Arabidopsis thaliana]
 dbj|BAE99335.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE87015.1| vacuolar proton ATPase A3 [Arabidopsis thaliana]
Length=821

 Score =  1196 bits (3093),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 623/809 (77%), Positives = 716/809 (89%), Gaps = 3/809 (0%)
 Frame = -2

Query  2741  MDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSGEM  2562
             MDL RSE MQLVQLI+P+ESA L+V+YLGDLGL+QFKDLN+EKSPFQRTYAAQIKR GEM
Sbjct  14    MDLMRSETMQLVQLIVPMESAHLTVSYLGDLGLVQFKDLNSEKSPFQRTYAAQIKRCGEM  73

Query  2561  ARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSFNE  2382
             ARK+RFF+DQMSKAGV A      ++ I  DD+EVKLG+LEAEL+EINANNDKLQRS+NE
Sbjct  74    ARKIRFFRDQMSKAGVPAKEMQGKENDIDLDDVEVKLGELEAELVEINANNDKLQRSYNE  133

Query  2381  LVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTSKQVRLG  2202
             L+EYKLVLQK GEFF SA  SA  QQ+E  S Q+GE+ LE+PLL E + S D++KQV+LG
Sbjct  134   LMEYKLVLQKAGEFFSSAHRSAADQQRETESQQAGEDLLESPLLQE-EKSIDSTKQVKLG  192

Query  2201  FISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSGERA  2022
             F++GLVP+EKSM FERILFRATRGN+ +RQ+ ++E VIDP SGEK EKNVF+VFYSGERA
Sbjct  193   FLTGLVPREKSMVFERILFRATRGNIFIRQTVIEEPVIDPNSGEKAEKNVFVVFYSGERA  252

Query  2021  KNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSIAEQ  1842
             K+KILKIC+AFGANRYPF+E+LG+QAQ+ITEVSG++SELKT IDAG+  R  LLQ+I ++
Sbjct  253   KSKILKICEAFGANRYPFSEDLGRQAQMITEVSGRLSELKTTIDAGLGQRNILLQTIGDK  312

Query  1841  FDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNSEIG  1662
             F+ WN+ VR+EK+IYHTLNMLS+DVTKKCLVAEGWSP  A+ EIQDALQRA  DSNS++G
Sbjct  313   FELWNLKVRKEKAIYHTLNMLSLDVTKKCLVAEGWSPVFASREIQDALQRAAVDSNSQVG  372

Query  1661  AIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGD  1482
             +IF+VL T+ESPPTYF+TNKFTSA QEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGD
Sbjct  373   SIFQVLRTKESPPTYFRTNKFTSAIQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGD  432

Query  1481  WGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEFFSV  1302
             WGHGIC+LLAT+Y +++EKKL+SQKLGDI EM FGGRYVILMM+LFSIYTG IYNEFFS+
Sbjct  433   WGHGICILLATMYLILKEKKLASQKLGDIMEMAFGGRYVILMMSLFSIYTGLIYNEFFSI  492

Query  1301  QFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKLSIL  1122
              F LF  SAY CRD SCS+ATTIGLIK RDTY FG+DP WHG+RSELPFLNSLKMK+SIL
Sbjct  493   PFPLFAPSAYDCRDVSCSEATTIGLIKVRDTYPFGLDPVWHGSRSELPFLNSLKMKMSIL  552

Query  1121  LGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQADL  942
             LGV+QMNLGII+SYFNA +F+S VN W QFIPQ+IFLN+LFGYLSVLII+KWCTGSQADL
Sbjct  553   LGVSQMNLGIIMSYFNARFFKSSVNIWFQFIPQMIFLNSLFGYLSVLIIIKWCTGSQADL  612

Query  941   YHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQHN-RHQG  765
             YHVMIYMFL P ++LGENQLFP QKT QLVL+ LALVSVP MLLPKPFILK QH  RHQG
Sbjct  613   YHVMIYMFLSPMDELGENQLFPHQKTLQLVLLFLALVSVPCMLLPKPFILKKQHEARHQG  672

Query  764   QSYAPIQDLDESL-LvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLRLWA  588
             Q+YAP+ + DESL +      S  HEEFEFSE+FVHQLIHTIEFVLGAVSNTASYLRLWA
Sbjct  673   QAYAPLDETDESLHVETNGGGSHGHEEFEFSEIFVHQLIHTIEFVLGAVSNTASYLRLWA  732

Query  587   LSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHALRLH  408
             LSLAHSELS+VFYEKVLLLAWGYNN +IL+VG ++FIFAT+GVLLVMETLSAFLHALRLH
Sbjct  733   LSLAHSELSSVFYEKVLLLAWGYNNPLILIVGVLVFIFATVGVLLVMETLSAFLHALRLH  792

Query  407   WVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             WVEFQNKFYEGDGYKF PF+F+    E++
Sbjct  793   WVEFQNKFYEGDGYKFAPFTFIFTANEDE  821



>ref|XP_009373024.1| PREDICTED: vacuolar proton ATPase a3-like [Pyrus x bretschneideri]
Length=814

 Score =  1194 bits (3090),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 621/814 (76%), Positives = 719/814 (88%), Gaps = 2/814 (0%)
 Frame = -2

Query  2759  GGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQI  2580
             G C PPMDLFRSEPMQLVQ+IIPIESA  +V+YLGDLGLIQFKDLN+EKSPFQRTYAAQI
Sbjct  2     GECCPPMDLFRSEPMQLVQIIIPIESAHPTVSYLGDLGLIQFKDLNSEKSPFQRTYAAQI  61

Query  2579  KRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKL  2400
             KRS EMARKLRFFK+QMSKA +  S ++   D +  DDLEVKLG+LEAELIEIN N++KL
Sbjct  62    KRSAEMARKLRFFKEQMSKADLPPSKSARQVD-VNVDDLEVKLGELEAELIEINLNDEKL  120

Query  2399  QRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTS  2220
             QRS+NEL+EYKLVL+K GEFFH+ARSSA   Q+E  S    +ESL+ PLL E + S + S
Sbjct  121   QRSYNELLEYKLVLEKAGEFFHAARSSAVLHQRENESRDISDESLDMPLLLEQETSTNPS  180

Query  2219  KQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVF  2040
             KQV+LGF++GLVP+EKS+AFERILFRATRGNV LRQ+ V+  V DP+SGEKVEKNVF+VF
Sbjct  181   KQVKLGFLTGLVPREKSLAFERILFRATRGNVFLRQTVVENPVTDPVSGEKVEKNVFVVF  240

Query  2039  YSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLL  1860
             YSGERAK+KILKICDAFGANRY F E+LG+Q Q+ITEVSG++SELKT ID G+L RG+LL
Sbjct  241   YSGERAKSKILKICDAFGANRYSFTEDLGRQYQMITEVSGRLSELKTTIDVGVLLRGSLL  300

Query  1859  QSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHD  1680
             Q+I E F++WN+LVR+EKSIYH LNMLS+DVTKKCLVAEGWSP  A+ +IQDALQRA  D
Sbjct  301   QTIGEHFEQWNLLVRKEKSIYHHLNMLSLDVTKKCLVAEGWSPVFASKQIQDALQRAAFD  360

Query  1679  SNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLF  1500
             SNS++GAIF+VL  +E+PPTYF+TNKFTS+FQEIVDAYGVAKYQEANP V+TIVTFPFLF
Sbjct  361   SNSQVGAIFQVLHAKEAPPTYFRTNKFTSSFQEIVDAYGVAKYQEANPAVYTIVTFPFLF  420

Query  1499  AVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIY  1320
             AVMFGDWGHGICLLLA LY + REKKLSSQKLGDI EM FGGRYVIL+MA+FSIYTGFIY
Sbjct  421   AVMFGDWGHGICLLLAALYLIGREKKLSSQKLGDIMEMAFGGRYVILLMAIFSIYTGFIY  480

Query  1319  NEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLK  1140
             NEFFSV FELFG SAY CRD SC DATT GLIK R TY FG+DP WHG+RSELPFLNSLK
Sbjct  481   NEFFSVPFELFGPSAYACRDLSCRDATTAGLIKVRPTYPFGLDPVWHGSRSELPFLNSLK  540

Query  1139  MKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCT  960
             MK+SI++GV QMNLGI++SYFNA +FRS +N W QFIPQ+IFLN LFGYLSVLI++KW T
Sbjct  541   MKMSIIIGVVQMNLGIMISYFNARFFRSNLNVWFQFIPQMIFLNGLFGYLSVLIVMKWWT  600

Query  959   GSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQH  780
             GS+ADLYHVMIYMFL PT++LGENQLF GQKT QLVL+LLA V+VPWML PKPF+LK QH
Sbjct  601   GSKADLYHVMIYMFLSPTDELGENQLFNGQKTVQLVLLLLAFVAVPWMLFPKPFLLKKQH  660

Query  779   -NRHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASY  603
              +RHQGQSYA +++ +ESL V+ +HD+  HEEFEFSEVFVHQ+IHTIEFVLGAVSNTASY
Sbjct  661   QDRHQGQSYALLENTEESLQVNSNHDAHGHEEFEFSEVFVHQMIHTIEFVLGAVSNTASY  720

Query  602   LRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLH  423
             LRLWALSLAHSELS+VFY+KVLL AWG+NN IIL+VG I+F+ AT+GVLL+METLSAFLH
Sbjct  721   LRLWALSLAHSELSSVFYDKVLLTAWGFNNWIILIVGLIVFVCATVGVLLLMETLSAFLH  780

Query  422   ALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             ALRLHWVEFQNKFYEGDGYKF P+SF L+D++++
Sbjct  781   ALRLHWVEFQNKFYEGDGYKFYPYSFALLDDDDE  814



>ref|XP_009373002.1| PREDICTED: vacuolar proton ATPase a3 [Pyrus x bretschneideri]
 ref|XP_009351217.1| PREDICTED: vacuolar proton ATPase a3-like [Pyrus x bretschneideri]
Length=814

 Score =  1194 bits (3090),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 621/814 (76%), Positives = 719/814 (88%), Gaps = 2/814 (0%)
 Frame = -2

Query  2759  GGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQI  2580
             G C PPMDLFRSEPMQLVQ+IIPIESA  +V+YLGDLGLIQFKDLN+EKSPFQRTYAAQI
Sbjct  2     GECCPPMDLFRSEPMQLVQIIIPIESAHPTVSYLGDLGLIQFKDLNSEKSPFQRTYAAQI  61

Query  2579  KRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKL  2400
             KRS EMARKLRFFK+QMSKA +  S ++   D +  DDLEVKLG+LEAELIEIN N++KL
Sbjct  62    KRSAEMARKLRFFKEQMSKADLPPSKSARQVD-VNVDDLEVKLGELEAELIEINLNDEKL  120

Query  2399  QRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTS  2220
             QRS+NEL+EYKLVL+K GEFFH+ARSSA   Q+E  S    +ESL+ PLL E + S D S
Sbjct  121   QRSYNELLEYKLVLEKAGEFFHAARSSAVLHQRENESRDISDESLDMPLLLEQETSTDPS  180

Query  2219  KQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVF  2040
             KQV+LGF++GLVP+EKS+AFERILFRATRGNV LRQ+ V+  V DP+SGEKVEKNVF+VF
Sbjct  181   KQVKLGFLTGLVPREKSLAFERILFRATRGNVFLRQTVVENPVTDPVSGEKVEKNVFVVF  240

Query  2039  YSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLL  1860
             YSGERAK+KILKICDAFGANRY F E+LG+Q Q+ITEVSG++SELKT ID G+L RG+LL
Sbjct  241   YSGERAKSKILKICDAFGANRYSFTEDLGRQYQMITEVSGRLSELKTTIDVGVLLRGSLL  300

Query  1859  QSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHD  1680
             ++I E F++WN+LVR+EKSIYH LNMLS+DVTKKCLVAEGWSP  A+ +IQDALQRA  D
Sbjct  301   RTIGEHFEQWNLLVRKEKSIYHHLNMLSLDVTKKCLVAEGWSPVFASKQIQDALQRAAFD  360

Query  1679  SNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLF  1500
             SNS++GAIF+VL  +E+PPTYF+TNKFTS+FQEIVDAYGVAKYQEANP V+TIVTFPFLF
Sbjct  361   SNSQVGAIFQVLHAKEAPPTYFRTNKFTSSFQEIVDAYGVAKYQEANPAVYTIVTFPFLF  420

Query  1499  AVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIY  1320
             AVMFGDWGHGICLLLA LY + REKKLSSQKLGDI EM FGGRYVIL+MA+FSIYTGFIY
Sbjct  421   AVMFGDWGHGICLLLAALYLIGREKKLSSQKLGDIMEMAFGGRYVILLMAIFSIYTGFIY  480

Query  1319  NEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLK  1140
             NEFFSV FELFG SAY CRD SC DATT GLIK R TY FG+DP WHG+RSELPFLNSLK
Sbjct  481   NEFFSVPFELFGPSAYACRDLSCRDATTAGLIKVRPTYPFGLDPVWHGSRSELPFLNSLK  540

Query  1139  MKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCT  960
             MK+SI++GV QMNLGI++SYFNA +FRS +N W QFIPQ+IFLN LFGYLSVLI++KW T
Sbjct  541   MKMSIIIGVVQMNLGIMISYFNARFFRSNLNVWFQFIPQMIFLNGLFGYLSVLIVMKWWT  600

Query  959   GSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQH  780
             GS+ADLYHVMIYMFL PT++LGENQLF GQKT QLVL+LLA V+VPWML PKPF+LK QH
Sbjct  601   GSKADLYHVMIYMFLSPTDELGENQLFNGQKTVQLVLLLLAFVAVPWMLFPKPFLLKKQH  660

Query  779   -NRHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASY  603
              +RHQGQSYA +++ +ESL V+ +HD+  HEEFEFSEVFVHQ+IHTIEFVLGAVSNTASY
Sbjct  661   QDRHQGQSYALLENTEESLQVNSNHDAHGHEEFEFSEVFVHQMIHTIEFVLGAVSNTASY  720

Query  602   LRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLH  423
             LRLWALSLAHSELS+VFY+KVLL AWG+NN IIL+VG I+F+ AT+GVLL+METLSAFLH
Sbjct  721   LRLWALSLAHSELSSVFYDKVLLTAWGFNNWIILIVGLIVFVCATVGVLLLMETLSAFLH  780

Query  422   ALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             ALRLHWVEFQNKFYEGDGYKF P+SF L+D++++
Sbjct  781   ALRLHWVEFQNKFYEGDGYKFYPYSFALLDDDDE  814



>ref|XP_010690814.1| PREDICTED: V-type proton ATPase subunit a3 [Beta vulgaris subsp. 
vulgaris]
Length=814

 Score =  1192 bits (3085),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 611/813 (75%), Positives = 711/813 (87%), Gaps = 2/813 (0%)
 Frame = -2

Query  2756  GCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIK  2577
             GC PPMDL RSE MQLVQLIIPIES+ L+V+YLGDLGL+QFKDLNA+KSPFQRTYA Q+K
Sbjct  3     GCCPPMDLMRSEEMQLVQLIIPIESSHLTVSYLGDLGLVQFKDLNADKSPFQRTYANQVK  62

Query  2576  RSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQ  2397
             + GEMAR+LR+FK+QMS AG++    S T + IK DDLEVKLG+LE+EL E+N+NNDKLQ
Sbjct  63    KCGEMARRLRYFKEQMSNAGITIPPTSFTGNDIKVDDLEVKLGELESELTEMNSNNDKLQ  122

Query  2396  RSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTSK  2217
             R++NELVEYKLVLQK  EFF+SA+ SA +QQ+E  + Q+ E      LL + + S D SK
Sbjct  123   RTYNELVEYKLVLQKAEEFFYSAQRSAASQQRELEAQQTEESLDTPLLLDQ-EKSGDPSK  181

Query  2216  QVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFY  2037
              V+LGF +GLV +EKSMAFERILFRATRGNV L+Q+ V+  V DP SGEKVEKNVF++FY
Sbjct  182   PVQLGFFTGLVSREKSMAFERILFRATRGNVFLKQTTVENPVTDPASGEKVEKNVFVIFY  241

Query  2036  SGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQ  1857
             SGERAKNKILKIC+AFGANRYPF+E++GKQAQ++ EVSGK+SEL+T IDAG+LHRGNLLQ
Sbjct  242   SGERAKNKILKICEAFGANRYPFSEDIGKQAQMLKEVSGKLSELRTTIDAGLLHRGNLLQ  301

Query  1856  SIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDS  1677
             +I +QF++WN+LVR+EKS+YH LNMLSIDVTKKCLVAEGW P  AT +IQD L RA  DS
Sbjct  302   TIGDQFEQWNLLVRKEKSVYHILNMLSIDVTKKCLVAEGWCPVFATKQIQDVLHRATLDS  361

Query  1676  NSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFA  1497
             NS++ AIF+VL T+ESPPTYF+TNKFT  FQEIVD+YGVA+YQEANP VFT+VTFPFLFA
Sbjct  362   NSQVEAIFQVLYTKESPPTYFRTNKFTLPFQEIVDSYGVARYQEANPTVFTVVTFPFLFA  421

Query  1496  VMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYN  1317
             VMFGDWGHGICLLLAT Y ++REKKL+SQKLGDI EM FGGRYVILMMA+FSIYTGFIYN
Sbjct  422   VMFGDWGHGICLLLATAYLVLREKKLASQKLGDIMEMMFGGRYVILMMAIFSIYTGFIYN  481

Query  1316  EFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKM  1137
             EFFSV FELFG+SAY CRDPSC DATT GLIK R  Y FG+DP WHG+RSELPFLNSLKM
Sbjct  482   EFFSVPFELFGKSAYECRDPSCKDATTDGLIKVRSAYPFGLDPVWHGSRSELPFLNSLKM  541

Query  1136  KLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTG  957
             K+SILLGVAQMNLGII+S+FNA +FRS V+ W QFIPQ+IFLN+LFGYLSVLII+KWCTG
Sbjct  542   KMSILLGVAQMNLGIIMSFFNAKFFRSCVDIWFQFIPQVIFLNSLFGYLSVLIIMKWCTG  601

Query  956   SQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQH-  780
             S+ADLYH+MIYMFL PT++LGEN+LF GQKTTQ+VL+LLAL+SVP MLLPKPFILKSQH 
Sbjct  602   SKADLYHIMIYMFLSPTDELGENELFAGQKTTQMVLLLLALISVPCMLLPKPFILKSQHQ  661

Query  779   NRHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYL  600
             +RHQG+SY P+Q  +   +        DHEEFEFSEV VHQLIHTIEFVLGAVSNTASYL
Sbjct  662   SRHQGESYVPLQAEESLQVEATHGSHGDHEEFEFSEVLVHQLIHTIEFVLGAVSNTASYL  721

Query  599   RLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHA  420
             RLWALSLAHSELSTVFY+KVL+LAWGYNN++IL+VG I+FIFAT+GVLLVMETLSAFLHA
Sbjct  722   RLWALSLAHSELSTVFYDKVLMLAWGYNNVLILIVGIIVFIFATVGVLLVMETLSAFLHA  781

Query  419   LRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             LRLHWVE+QNKFY GDGYKF P+SF L+ EE++
Sbjct  782   LRLHWVEYQNKFYFGDGYKFYPYSFSLIVEEDE  814



>gb|ABB46970.1| V-type ATPase 116kDa subunit family protein, expressed [Oryza 
sativa Japonica Group]
Length=819

 Score =  1192 bits (3085),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 621/818 (76%), Positives = 717/818 (88%), Gaps = 5/818 (1%)
 Frame = -2

Query  2765  GRGGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAA  2586
             G GGC P MDL RSE MQLVQ+IIP ESA L+V+YLGDLGL+QFKDLNA+KSPFQRTYA+
Sbjct  4     GGGGCCPSMDLMRSEAMQLVQVIIPAESAHLAVSYLGDLGLLQFKDLNADKSPFQRTYAS  63

Query  2585  QIKRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANND  2406
             QIKR GEMARKLRFF++QMSKA + A++   +  +++ DDLEVKLG+LE EL E+NANND
Sbjct  64    QIKRCGEMARKLRFFREQMSKAAI-ATSTQFSGTSLEIDDLEVKLGELEVELTEVNANND  122

Query  2405  KLQRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSAD  2226
             KLQR++NELVEY +VLQK GEFF+SA+ SA  QQ+E  + QSG+ SLE+PLL + +M  D
Sbjct  123   KLQRTYNELVEYNIVLQKAGEFFYSAQRSATEQQREMSADQSGDSSLESPLLQQ-EMVTD  181

Query  2225  TSKQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFL  2046
              SKQV+LG +SGLVPKEK+MAFERILFRATRGN+ LRQ  VDE+V DP+SGEKV KN F+
Sbjct  182   PSKQVKLGSLSGLVPKEKAMAFERILFRATRGNMFLRQEPVDETVTDPLSGEKVIKNAFV  241

Query  2045  VFYSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGN  1866
             +FYSGERAK+KI+KICDAFGANRYPF E+LGKQ Q I EVSGKISELK  I+ G+ HR +
Sbjct  242   IFYSGERAKSKIVKICDAFGANRYPFPEDLGKQLQTIQEVSGKISELKATIEIGLAHRDS  301

Query  1865  LLQSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAG  1686
             +L++I+ +F++WN LV++EK+IYHTLNMLS+DVTKKCLVAEGWSP  AT +IQDALQRA 
Sbjct  302   ILKNISSEFEQWNTLVKKEKAIYHTLNMLSLDVTKKCLVAEGWSPVFATSQIQDALQRAT  361

Query  1685  HDSNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPF  1506
              DS S++G+IF+VL T+ESPPT+F+TNKFTSAFQEIVDAYG+AKYQEANPGVFTIVTFPF
Sbjct  362   VDSKSQVGSIFQVLNTQESPPTFFQTNKFTSAFQEIVDAYGIAKYQEANPGVFTIVTFPF  421

Query  1505  LFAVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGF  1326
             LFA+MFGDWGHGICLLLATLY +IREKKL+SQKL DI +M FGGRYVILMM+LFSIYTG 
Sbjct  422   LFAIMFGDWGHGICLLLATLYLIIREKKLASQKLDDIMDMMFGGRYVILMMSLFSIYTGL  481

Query  1325  IYNEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNS  1146
             IYNEFFSV FELFG+SAY CRDPSC DATT GLIK R  Y+FGVDP WHG+RSELPFLNS
Sbjct  482   IYNEFFSVPFELFGKSAYACRDPSCGDATTEGLIKVRPAYSFGVDPVWHGSRSELPFLNS  541

Query  1145  LKMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKW  966
             LKMKLSIL+GVAQMNLGI++SYFNA +FR+ +N W QFIPQ+IFLN+LFGYLS+LII+KW
Sbjct  542   LKMKLSILIGVAQMNLGIMMSYFNAKFFRNAINVWYQFIPQLIFLNSLFGYLSLLIIIKW  601

Query  965   CTGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKS  786
             CTGS+ADLYHVMIYMFL PT+DLGEN+LFPGQK  QLVL+LLALVSVPWML+PKPF LK 
Sbjct  602   CTGSKADLYHVMIYMFLSPTDDLGENELFPGQKLVQLVLLLLALVSVPWMLIPKPFFLKK  661

Query  785   QH-NRHQGQSYAPIQDLDESL--LvdgshdssdheefefsevfvHQLIHTIEFVLGAVSN  615
             QH  RHQGQ Y  +Q  DES+  L +   D   HEEFEFSEVFVHQLIHTIEFVLGAVSN
Sbjct  662   QHEQRHQGQQYTMLQATDESVTELEEHQDDPHHHEEFEFSEVFVHQLIHTIEFVLGAVSN  721

Query  614   TASYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLS  435
             TASYLRLWALSLAHSELSTVFYEKVL+L+WGYNNI IL++G +IF+FATIGVLLVMETLS
Sbjct  722   TASYLRLWALSLAHSELSTVFYEKVLVLSWGYNNIFILIIGAVIFLFATIGVLLVMETLS  781

Query  434   AFLHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             AFLHALRLHWVEFQNKFYEGDGYKF PF+F  + EEED
Sbjct  782   AFLHALRLHWVEFQNKFYEGDGYKFVPFAFASIIEEED  819



>emb|CAD27718.1| putative vacuolar ATPase subunit 100 kDa subunit [Mesembryanthemum 
crystallinum]
Length=816

 Score =  1192 bits (3084),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 615/822 (75%), Positives = 709/822 (86%), Gaps = 7/822 (1%)
 Frame = -2

Query  2783  MAERLGGRGGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPF  2604
             MA+R     GC PPMDL RSEPMQLVQLI+P+ES+ L+V+YLGDLGL+QFKDLNA+KSPF
Sbjct  1     MADR-----GCCPPMDLMRSEPMQLVQLIVPLESSHLTVSYLGDLGLVQFKDLNADKSPF  55

Query  2603  QRTYAAQIKRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIE  2424
             QRTYA QIK+SGEMAR+LR+F++QM  AG+S  A +  ++ IK DDLEVKL +LE+EL E
Sbjct  56    QRTYANQIKKSGEMARRLRYFREQMLNAGISIPAMTSNKNDIKVDDLEVKLAELESELSE  115

Query  2423  INANNDKLQRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllse  2244
             +NANN+KLQR++NELVEYKLVLQK GEFF+SA+ SA AQQ+E     + E      L+ E
Sbjct  116   MNANNEKLQRAYNELVEYKLVLQKSGEFFYSAQRSAAAQQRETEPEHTEESLNTPLLMDE  175

Query  2243  PDMSADTSKQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKV  2064
              D SAD SK ++LGF +GLVP++KSMAFERILFRATRGNV +RQ+ V+  V DP SGEKV
Sbjct  176   -DKSADPSKSIQLGFFTGLVPRDKSMAFERILFRATRGNVFVRQATVENPVTDPASGEKV  234

Query  2063  EKNVFLVFYSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAG  1884
             EKNVF++FYSG+RAKNKILKIC+AFGANRY F EE GKQAQ++ EVSG++SEL+T IDAG
Sbjct  235   EKNVFVIFYSGDRAKNKILKICEAFGANRYSFYEEAGKQAQMLKEVSGRLSELRTTIDAG  294

Query  1883  ILHRGNLLQSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQD  1704
             +LHRGNLLQ+I +QF++WN+LVR+EKSIYHTLNMLS+DVT KCLVAEGW P  AT EIQD
Sbjct  295   LLHRGNLLQTIGDQFEQWNLLVRKEKSIYHTLNMLSMDVTTKCLVAEGWCPVFATKEIQD  354

Query  1703  ALQRAGHDSNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFT  1524
              L RA  DSNSE+ AIF+VL TRES PTYF+TNKFTS+FQEIVDAYG+A+YQEANP V+T
Sbjct  355   TLHRATVDSNSEVEAIFQVLHTRESLPTYFRTNKFTSSFQEIVDAYGIARYQEANPSVYT  414

Query  1523  IVTFPFLFAVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALF  1344
             IVTFPFLFAVMFGDWGHGIC+LLAT   ++REKKLSSQKLGDI EM FGGRYVI MMALF
Sbjct  415   IVTFPFLFAVMFGDWGHGICILLATSILILREKKLSSQKLGDIMEMMFGGRYVIFMMALF  474

Query  1343  SIYTGFIYNEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSE  1164
             SIYTG IYNEFFSV FELFG+SAY CRDPSC DAT  GLIK RD Y FG+DP WHG+RSE
Sbjct  475   SIYTGLIYNEFFSVPFELFGKSAYECRDPSCKDATVDGLIKVRDAYPFGLDPVWHGSRSE  534

Query  1163  LPFLNSLKMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSV  984
             LPFLNSLKMK+SILLGV+QMNLGII+S+FNA +FRS V+ W QFIPQIIFLN+LFGYLSV
Sbjct  535   LPFLNSLKMKMSILLGVSQMNLGIIMSFFNAKFFRSCVDIWFQFIPQIIFLNSLFGYLSV  594

Query  983   LIIVKWCTGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPK  804
             LIIVKWCTGS+ADLYHVMIYMFL PT++LGEN+LFPGQKT Q VL+LLALV+VPWMLLPK
Sbjct  595   LIIVKWCTGSKADLYHVMIYMFLSPTDELGENELFPGQKTAQQVLLLLALVAVPWMLLPK  654

Query  803   PFILKSQH-NRHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLG  627
             PFI+K QH NRHQG+SY P+Q  +   +         HEEFEFSEV VHQLIHTIEFVLG
Sbjct  655   PFIMKWQHQNRHQGESYEPLQGEESLQVETTHDSHGGHEEFEFSEVLVHQLIHTIEFVLG  714

Query  626   AVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVM  447
             AVSNTASYLRLWALSLAHSELS+VFY+KVLLLAWG+NN++IL+VG I+FIFAT+GVLLVM
Sbjct  715   AVSNTASYLRLWALSLAHSELSSVFYDKVLLLAWGFNNVLILIVGIIVFIFATVGVLLVM  774

Query  446   ETLSAFLHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             ETLSAFLHALRLHWVEFQNKFY GDGYKF PFSF  + EEE+
Sbjct  775   ETLSAFLHALRLHWVEFQNKFYLGDGYKFYPFSFSTIGEEEE  816



>ref|XP_003558337.1| PREDICTED: V-type proton ATPase subunit a3-like [Brachypodium 
distachyon]
Length=821

 Score =  1191 bits (3081),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 616/819 (75%), Positives = 710/819 (87%), Gaps = 5/819 (1%)
 Frame = -2

Query  2765  GRGGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAA  2586
             G GGC P MDL RSEPMQL+Q+IIP ESA L+V+YLGDLGLIQFKDLNA+KSPFQRTYAA
Sbjct  4     GGGGCLPAMDLMRSEPMQLLQVIIPTESAHLAVSYLGDLGLIQFKDLNADKSPFQRTYAA  63

Query  2585  QIKRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANND  2406
             QIKR GEMARKLRFFK+QMSKAG+  S    T+  + FDD+E+KLG+LEAEL E+NAN++
Sbjct  64    QIKRCGEMARKLRFFKEQMSKAGIQISPVQLTETPLDFDDMEIKLGELEAELTEVNANDE  123

Query  2405  KLQRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSAD  2226
             KLQR++NEL+EY  VLQK GEFF+SA+ SA AQQ+E  +SQSG+ SLE+PLL + DM  D
Sbjct  124   KLQRTYNELLEYSTVLQKAGEFFYSAQRSAAAQQREMETSQSGDISLESPLLEQ-DMFTD  182

Query  2225  TSKQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFL  2046
              SKQV+LG +SGLVPKEK+MAFERILFRATRGN+LLRQ  VDE V DP SGEKV KN F+
Sbjct  183   ASKQVKLGSLSGLVPKEKAMAFERILFRATRGNILLRQESVDEPVTDPQSGEKVSKNTFV  242

Query  2045  VFYSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGN  1866
             +FYSGERAK KILKICDAF ANRYPF E+LGKQ   + EVSGKISELK  ID G+ HR +
Sbjct  243   IFYSGERAKAKILKICDAFRANRYPFPEDLGKQMHTVQEVSGKISELKATIDMGLAHRDS  302

Query  1865  LLQSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAG  1686
             +L++IA +++ WN L ++EKSIYHTLNMLS+DVTKKCLV EGWSP  AT ++QDALQRA 
Sbjct  303   ILKTIALEYEHWNHLAKKEKSIYHTLNMLSVDVTKKCLVGEGWSPVFATSQVQDALQRAT  362

Query  1685  HDSNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPF  1506
              +S S++G+IF+VL T+ESPPTYF+TNKFTSAFQEIVDAYGVAKYQEANPGVFT++TFPF
Sbjct  363   LESKSQVGSIFQVLNTKESPPTYFQTNKFTSAFQEIVDAYGVAKYQEANPGVFTVITFPF  422

Query  1505  LFAVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGF  1326
             LFAVMFGDWGHGIC+LLATLY +IREKK +SQKLGDI EM FGGRY+I+MMALFSIYTG 
Sbjct  423   LFAVMFGDWGHGICILLATLYLIIREKKFASQKLGDIMEMMFGGRYIIMMMALFSIYTGL  482

Query  1325  IYNEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNS  1146
             IYNEFFSV FELF +SAY CRDPSC DATT GL+K R TY FGVDP WHG+RSELPFLNS
Sbjct  483   IYNEFFSVPFELFAKSAYACRDPSCGDATTEGLVKIRPTYPFGVDPVWHGSRSELPFLNS  542

Query  1145  LKMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKW  966
             LKMK+SILLGVAQMNLGI++SYFNA +FR+ VN W QF+PQ+IFLN+LFGYLS+LII+KW
Sbjct  543   LKMKMSILLGVAQMNLGIMMSYFNAKFFRNSVNVWYQFVPQLIFLNSLFGYLSMLIIIKW  602

Query  965   CTGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKS  786
             CTGS+ADLYHVMIYMFL PT++LGEN+LFPGQKT QLVL+LLALVSVPWML+PKPF LK 
Sbjct  603   CTGSKADLYHVMIYMFLSPTDELGENELFPGQKTVQLVLLLLALVSVPWMLIPKPFFLKM  662

Query  785   QHN-RHQGQSYAPIQDLDESL---LvdgshdssdheefefsevfvHQLIHTIEFVLGAVS  618
             +H  RHQG  YA ++  DES+   L +   +S+ HEEFEFSE+FVHQLIHTIEFVLGAVS
Sbjct  663   EHERRHQGHQYAMLEGADESVVAELGEHHEESNHHEEFEFSEIFVHQLIHTIEFVLGAVS  722

Query  617   NTASYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETL  438
             NTASYLRLWALSLAHSELSTVFY+KVLLL  GYNN+ IL +G  +FI AT+GVLLVMETL
Sbjct  723   NTASYLRLWALSLAHSELSTVFYDKVLLLTLGYNNLFILAIGVFVFICATVGVLLVMETL  782

Query  437   SAFLHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             SAFLHALRLHWVEFQNKFYEGDGYKF PFSF L+ EEE+
Sbjct  783   SAFLHALRLHWVEFQNKFYEGDGYKFAPFSFALITEEEE  821



>ref|XP_010918981.1| PREDICTED: V-type proton ATPase subunit a3 isoform X1 [Elaeis 
guineensis]
 ref|XP_010918983.1| PREDICTED: V-type proton ATPase subunit a3 isoform X1 [Elaeis 
guineensis]
Length=837

 Score =  1189 bits (3077),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 631/823 (77%), Positives = 716/823 (87%), Gaps = 12/823 (1%)
 Frame = -2

Query  2753  CFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKD---------LNAEKSPFQ  2601
             C P MDL RSEPMQLVQ+IIPIESA L+V+YLGDLGL+QFKD          + +KSPFQ
Sbjct  15    CCPTMDLMRSEPMQLVQIIIPIESAHLTVSYLGDLGLLQFKDNMDNINRNATHQDKSPFQ  74

Query  2600  RTYAAQIKRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEI  2421
             RTYA QIKR GEMARKLRFF +QM+KA +S SA   T+  I  DDLEVKLG+LEAELIE+
Sbjct  75    RTYANQIKRCGEMARKLRFFGEQMTKADISPSAMPVTRTHIDLDDLEVKLGELEAELIEV  134

Query  2420  NANNDKLQRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllseP  2241
             N+N +KLQR+FNEL+EYKLVLQK GEFF+SA+  A AQQ+E  + Q G+ SL++PLL E 
Sbjct  135   NSNGEKLQRTFNELLEYKLVLQKAGEFFYSAQGHATAQQREIEAHQVGDGSLDSPLLLEQ  194

Query  2240  DMSADTSKQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVE  2061
             +M AD SKQV+LGF+SGLVPKEK+MAFERILFRATRGN+ L+Q  +D+ V DP+SGEKV 
Sbjct  195   EMLADPSKQVKLGFVSGLVPKEKAMAFERILFRATRGNMFLKQVAIDDPVTDPVSGEKVG  254

Query  2060  KNVFLVFYSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGI  1881
             KNVF+VFYSGERAK KILKIC+AFGANRYPF E++GKQ Q+I EVS KISELKT ID G+
Sbjct  255   KNVFVVFYSGERAKTKILKICEAFGANRYPFTEDVGKQMQMIDEVSWKISELKTTIDVGL  314

Query  1880  LHRGNLLQSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDA  1701
             +HR ++L++I  QF++WN LVRREKSIYHTLNMLS+DVTKKCLVAEGWSP  AT ++QDA
Sbjct  315   IHRDSILKNIGYQFEQWNHLVRREKSIYHTLNMLSLDVTKKCLVAEGWSPVFATSQVQDA  374

Query  1700  LQRAGHDSNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTI  1521
             LQRA +DSNS++G+IF+VL T ESPPTYF+TNKFTSAFQEIVDAYGVAKYQEANPGV+TI
Sbjct  375   LQRATYDSNSQVGSIFQVLHTNESPPTYFQTNKFTSAFQEIVDAYGVAKYQEANPGVYTI  434

Query  1520  VTFPFLFAVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFS  1341
             +TFPFLFAVMFGDWGHGICLLL TLYF+IREKKLSSQKLGDI EMTFGGRYVI+MMA+FS
Sbjct  435   ITFPFLFAVMFGDWGHGICLLLTTLYFIIREKKLSSQKLGDIMEMTFGGRYVIMMMAIFS  494

Query  1340  IYTGFIYNEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSEL  1161
             IYTG IYNEFFSV FELFG+SAY CRD SC DATT GLIK R  Y FGVDP WHGTRSEL
Sbjct  495   IYTGLIYNEFFSVPFELFGKSAYACRDSSCRDATTEGLIKVRPAYPFGVDPKWHGTRSEL  554

Query  1160  PFLNSLKMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVL  981
             PFLNSLKMK+SILLGVAQMNLGI+LSYFNA +FR+ +N W QF+PQ+IFLN+LFGYLS+L
Sbjct  555   PFLNSLKMKMSILLGVAQMNLGIVLSYFNAKFFRNNLNIWYQFVPQLIFLNSLFGYLSLL  614

Query  980   IIVKWCTGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKP  801
             IIVKWCTGS+ADLYHVMIYMFL PT+DLGENQLFPGQKT QLVL+LLAL+SVPWML PKP
Sbjct  615   IIVKWCTGSKADLYHVMIYMFLSPTDDLGENQLFPGQKTLQLVLLLLALISVPWMLFPKP  674

Query  800   FILKSQHN-RHQGQSYAPIQDLDE--SLLvdgshdssdheefefsevfvHQLIHTIEFVL  630
              +LK QH  RHQGQSY  +Q  +E   L    S     +EEFEFSEVFVHQLIHTIEFVL
Sbjct  675   ILLKKQHQERHQGQSYTMLQSTEEMLELDHGHSSHGHGNEEFEFSEVFVHQLIHTIEFVL  734

Query  629   GAVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLV  450
             GAVSNTASYLRLWALSLAHSELS+VFYEKVLLLAWG+NNIIIL++GFI+FIFAT+GVLLV
Sbjct  735   GAVSNTASYLRLWALSLAHSELSSVFYEKVLLLAWGFNNIIILIIGFIVFIFATVGVLLV  794

Query  449   METLSAFLHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             METLSAFLHALRLHWVEFQNKFYEGDGYKF PFSF L+ E+ED
Sbjct  795   METLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFALLAEDED  837



>ref|XP_006649752.1| PREDICTED: vacuolar proton ATPase a3-like [Oryza brachyantha]
Length=819

 Score =  1186 bits (3067),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 619/819 (76%), Positives = 710/819 (87%), Gaps = 6/819 (1%)
 Frame = -2

Query  2768  GGRGGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYA  2589
             GG GGC PPMDL R+E M+LVQ+IIP ESA L+V+YLG+LGL+Q KDLNAEKSPFQRTYA
Sbjct  4     GGGGGC-PPMDLMRAEAMELVQVIIPTESAHLTVSYLGELGLLQLKDLNAEKSPFQRTYA  62

Query  2588  AQIKRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANN  2409
             AQIKR GEMARKLRFFK+QMSKAG+S S    T+ ++ FDDLE+KLG+LEAEL E+NANN
Sbjct  63    AQIKRCGEMARKLRFFKEQMSKAGISTSTQL-TEISLDFDDLEIKLGELEAELAEVNANN  121

Query  2408  DKLQRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSA  2229
             +KLQR++NEL+EY  VLQK GEFF+SA+ SA AQQ+E  ++QSG+ SLE+PLL + DM  
Sbjct  122   EKLQRTYNELLEYSTVLQKAGEFFYSAQRSAAAQQREMEANQSGDTSLESPLLEQ-DMLT  180

Query  2228  DTSKQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVF  2049
             D SKQV+LG +SGLVPKEK+MAFERILFRATRGN+ LRQ  +DE V DP+SGEKV KN F
Sbjct  181   DASKQVKLGSLSGLVPKEKAMAFERILFRATRGNIFLRQESIDEPVTDPVSGEKVAKNAF  240

Query  2048  LVFYSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRG  1869
             +VFYSG+RAK KILKICDAF ANRYPF +++ KQ   + EVS KISEL+  ID G+ HR 
Sbjct  241   VVFYSGDRAKAKILKICDAFNANRYPFPDDVAKQLHTVREVSAKISELRVTIDMGLAHRD  300

Query  1868  NLLQSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRA  1689
             N+L+SIA +F+ WN L  +EKSIYHTLNMLS+DVTKKCLV EGWSP  AT +IQDALQ+A
Sbjct  301   NILRSIASEFENWNRLANKEKSIYHTLNMLSVDVTKKCLVGEGWSPVFATTQIQDALQQA  360

Query  1688  GHDSNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFP  1509
               DS S++G+IF+VL T ESPPTYF+TNKFTSAFQEIVDAYG+AKYQEANPGVFT+VTFP
Sbjct  361   TLDSKSQVGSIFQVLNTTESPPTYFRTNKFTSAFQEIVDAYGIAKYQEANPGVFTVVTFP  420

Query  1508  FLFAVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTG  1329
             FLFAVMFGDWGHGICLL+ATLY +IREKKL+SQKLGDI EM FGGRYVI+MMALFSIYTG
Sbjct  421   FLFAVMFGDWGHGICLLVATLYLIIREKKLASQKLGDIMEMMFGGRYVIMMMALFSIYTG  480

Query  1328  FIYNEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLN  1149
              IYNEFFSV FELFG+SAY CRDPSC DA T GL+K R  Y FGVDP WHG+RSELPFLN
Sbjct  481   LIYNEFFSVPFELFGKSAYACRDPSCGDAATEGLLKVRRAYPFGVDPVWHGSRSELPFLN  540

Query  1148  SLKMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVK  969
             SLKMK+SILLGVAQMNLGI++SYFNA +FR+ VN W QFIPQ+IFLN+LFGYLS+LII+K
Sbjct  541   SLKMKMSILLGVAQMNLGIVISYFNAKFFRNSVNVWYQFIPQLIFLNSLFGYLSMLIIIK  600

Query  968   WCTGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILK  789
             WCTG++ADLYH MIYMFL PT++LGENQLFPGQK  QLVL++LALVSVPWML+PKPF LK
Sbjct  601   WCTGAKADLYHTMIYMFLSPTDELGENQLFPGQKLVQLVLLVLALVSVPWMLIPKPFFLK  660

Query  788   SQHN-RHQGQSYAPIQDLDESLLvdg--shdssdheefefsevfvHQLIHTIEFVLGAVS  618
              +H  RHQGQ YA +Q  D+S++ D     DS+ HEEFEFSEVFVHQLIHTIEFVLGAVS
Sbjct  661   REHERRHQGQQYAMLQTADDSVVADLGDHGDSNHHEEFEFSEVFVHQLIHTIEFVLGAVS  720

Query  617   NTASYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETL  438
             NTASYLRLWALSLAHSELS+VFY+KVLLLAWGYNNI+I +VG  IFI AT+GVLLVMETL
Sbjct  721   NTASYLRLWALSLAHSELSSVFYDKVLLLAWGYNNILIRIVGIAIFIAATVGVLLVMETL  780

Query  437   SAFLHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             SAFLHALRLHWVEFQNKFYEGDGYKF PFSF L+ EEED
Sbjct  781   SAFLHALRLHWVEFQNKFYEGDGYKFAPFSFDLISEEED  819



>ref|XP_009598988.1| PREDICTED: V-type proton ATPase subunit a2-like [Nicotiana tomentosiformis]
Length=819

 Score =  1185 bits (3066),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 621/816 (76%), Positives = 700/816 (86%), Gaps = 1/816 (0%)
 Frame = -2

Query  2765  GRGGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAA  2586
             G  GC P MDL RSEPMQLVQLIIP+ESA  +++YLGDLGL QFKDLN EKSPFQRTYA 
Sbjct  4     GGEGCCPTMDLLRSEPMQLVQLIIPMESAHRTISYLGDLGLFQFKDLNVEKSPFQRTYAT  63

Query  2585  QIKRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANND  2406
             Q KR GEMARKLRF K+QM+KAG + S  +     I  D+LEVKLG+LEAEL E+N N +
Sbjct  64    QTKRCGEMARKLRFLKEQMTKAGFTPSTRTTMGSNINLDELEVKLGELEAELAEMNTNTE  123

Query  2405  KLQRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSAD  2226
             KLQ S+NEL+EYKLVLQK GEFFHSA++SA  QQ+E      GE S+++PLL E +  AD
Sbjct  124   KLQHSYNELLEYKLVLQKAGEFFHSAQNSATDQQKEVEEHAHGERSIDSPLLLEQEPFAD  183

Query  2225  TSKQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFL  2046
              SKQV+LGF+SGLV +EKSMAFER LFRATRGNV L+Q  V+ +V DP+SG +VEKNVF+
Sbjct  184   PSKQVKLGFVSGLVAREKSMAFERFLFRATRGNVFLKQVVVENTVTDPVSGTEVEKNVFV  243

Query  2045  VFYSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGN  1866
             +FYSGERAKNKILKICDAFGANRYPF +++GKQ ++ITEVSGK+SELKT +D G LH  N
Sbjct  244   IFYSGERAKNKILKICDAFGANRYPFTDDIGKQYEMITEVSGKLSELKTTVDVGQLHWAN  303

Query  1865  LLQSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAG  1686
             LLQ+I  +FD+WN+LV++EK IYHTLNMLSIDVTKKCLV EGW P  AT +IQ+ L RA 
Sbjct  304   LLQTIGYEFDQWNLLVKKEKFIYHTLNMLSIDVTKKCLVGEGWCPVYATSQIQNQLHRAT  363

Query  1685  HDSNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPF  1506
              DSNS++GAIF+VL T E PPTYF+TNKFTSAFQEIVDAYGVAKYQE NPGVFTIVTFPF
Sbjct  364   LDSNSQVGAIFQVLHTTELPPTYFRTNKFTSAFQEIVDAYGVAKYQEVNPGVFTIVTFPF  423

Query  1505  LFAVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGF  1326
             LFAVMFGDWGHGICLLLATLYF+  EKKLSSQKLGDI EMTFGGRYVI+MMALFSIYTGF
Sbjct  424   LFAVMFGDWGHGICLLLATLYFIFWEKKLSSQKLGDIMEMTFGGRYVIIMMALFSIYTGF  483

Query  1325  IYNEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNS  1146
             IYNEFFSV FE+FGRSAY CRDPSC DATTIGLIK RD Y FGVDP WHGTRSELPFLNS
Sbjct  484   IYNEFFSVPFEIFGRSAYGCRDPSCRDATTIGLIKVRDAYPFGVDPKWHGTRSELPFLNS  543

Query  1145  LKMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKW  966
             LKMK+SILLGVAQMNLGIILSYFN  +F++ VN W QF+PQ+IFLN+LFGYLS+LIIVKW
Sbjct  544   LKMKMSILLGVAQMNLGIILSYFNGKFFKNDVNVWHQFVPQMIFLNSLFGYLSLLIIVKW  603

Query  965   CTGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKS  786
             CTGSQADLYHVMIYMFL PT+DLGENQLF GQK  QL+LV LALV+VPWML PKPF LK 
Sbjct  604   CTGSQADLYHVMIYMFLSPTDDLGENQLFIGQKYLQLLLVSLALVAVPWMLFPKPFFLKK  663

Query  785   QH-NRHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTA  609
             QH  RH+GQ YA + + D+S  ++    S  HEEFEFSEVFVHQLIHTIEFVLGAVSNTA
Sbjct  664   QHEERHRGQLYAMLDNTDDSFELETHDHSHGHEEFEFSEVFVHQLIHTIEFVLGAVSNTA  723

Query  608   SYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAF  429
             SYLRLWALSLAHSELS+VFY+KVLLLA G+NNIIILV+G ++FIFAT+GVLLVMETLSAF
Sbjct  724   SYLRLWALSLAHSELSSVFYDKVLLLAMGFNNIIILVIGIVVFIFATVGVLLVMETLSAF  783

Query  428   LHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             LHALRLHWVEFQNKFYEGDGYKF PFSF L+ E+ED
Sbjct  784   LHALRLHWVEFQNKFYEGDGYKFSPFSFGLISEDED  819



>ref|XP_006356756.1| PREDICTED: vacuolar proton ATPase a2-like [Solanum tuberosum]
Length=818

 Score =  1185 bits (3066),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 607/814 (75%), Positives = 698/814 (86%), Gaps = 1/814 (0%)
 Frame = -2

Query  2759  GGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQI  2580
             GGC P MDL RSEPMQLVQLIIP+ESA  +V+YLGDLGL QFKDLN EKSPFQRTYA QI
Sbjct  5     GGCCPTMDLLRSEPMQLVQLIIPLESAHRTVSYLGDLGLFQFKDLNVEKSPFQRTYATQI  64

Query  2579  KRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKL  2400
             KR GEMARKLRF K+QM+KAG++ S  +     I  D+LEVKLG+LEA+L E+N N +KL
Sbjct  65    KRCGEMARKLRFLKEQMTKAGITPSTRTTMCQNINLDELEVKLGELEADLAEMNTNTEKL  124

Query  2399  QRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTS  2220
             QRS+NEL+EYKLVLQK GEFFHSA++SA AQQ+E       E S+++PLL E +  AD S
Sbjct  125   QRSYNELLEYKLVLQKAGEFFHSAQNSATAQQKELEEHMHSERSIDSPLLLEQEAFADPS  184

Query  2219  KQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVF  2040
             KQV+LGF+SGLV +EKSMAFER LFRATRGNV L+Q  V   V DP+SG +VEKNVF++F
Sbjct  185   KQVKLGFVSGLVAREKSMAFERFLFRATRGNVFLKQVVVKNPVTDPLSGSEVEKNVFVIF  244

Query  2039  YSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLL  1860
             YSGER KNKILKICDAFGANRYPF +++G+Q ++ITEVSGK+SELKT +D G LHR NLL
Sbjct  245   YSGERTKNKILKICDAFGANRYPFTDDIGRQFEMITEVSGKLSELKTTVDIGQLHRANLL  304

Query  1859  QSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHD  1680
             Q+I  +FD+WN+LV++EK I+HTLNMLS DVTKKCLV EGW P  AT +IQ+AL RA  D
Sbjct  305   QTIGYEFDQWNLLVKQEKFIFHTLNMLSFDVTKKCLVGEGWCPVYATSQIQNALHRATLD  364

Query  1679  SNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLF  1500
              NS++GAIF+VL T E PPTYF+TNKFTSAFQEIVDAYG+AKYQE NP VFT+VTFPFLF
Sbjct  365   GNSQVGAIFQVLHTTELPPTYFRTNKFTSAFQEIVDAYGIAKYQEVNPAVFTVVTFPFLF  424

Query  1499  AVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIY  1320
             AVMFGDWGHGICL LATLYF+++E+KLS QKLGDI EMTFGGRY+I+MMALFSIYTGFIY
Sbjct  425   AVMFGDWGHGICLFLATLYFILQERKLSGQKLGDIMEMTFGGRYIIMMMALFSIYTGFIY  484

Query  1319  NEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLK  1140
             NEFFSV FE+FG+SAY C DPSC DAT  GLIK RD Y FGVDP WHG+RSELPFLNSLK
Sbjct  485   NEFFSVPFEIFGQSAYGCHDPSCRDATITGLIKVRDAYPFGVDPKWHGSRSELPFLNSLK  544

Query  1139  MKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCT  960
             MK+SILLGVAQMNLGIILSYFNA +F++ VN W QF+PQIIFLN+LFGYLS+LIIVKWCT
Sbjct  545   MKMSILLGVAQMNLGIILSYFNAKFFQNNVNVWHQFVPQIIFLNSLFGYLSLLIIVKWCT  604

Query  959   GSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQH  780
             GSQADLYHVMIYMFL PT+DLGENQLFPGQK  QL+ V LALV+VPWML PKPF+LK QH
Sbjct  605   GSQADLYHVMIYMFLSPTDDLGENQLFPGQKYLQLLFVSLALVAVPWMLFPKPFLLKKQH  664

Query  779   -NRHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASY  603
               RH+GQ YA ++  D+S  ++    S  HEEF+FSEVFVHQLIHTIEFVLGAVSNTASY
Sbjct  665   EERHRGQLYAMLESTDDSFELETHDHSHGHEEFDFSEVFVHQLIHTIEFVLGAVSNTASY  724

Query  602   LRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLH  423
             LRLWALSLAHSELS+VFY+KVLLLA GYNN+IIL++G ++FIFAT+GVLLVMETLSAFLH
Sbjct  725   LRLWALSLAHSELSSVFYDKVLLLAMGYNNLIILIIGIVVFIFATVGVLLVMETLSAFLH  784

Query  422   ALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             ALRLHWVEFQNKFYEGDGYKF PFSF L+ E++D
Sbjct  785   ALRLHWVEFQNKFYEGDGYKFSPFSFCLISEDDD  818



>ref|XP_009117405.1| PREDICTED: vacuolar proton ATPase a2 [Brassica rapa]
Length=821

 Score =  1184 bits (3064),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 619/808 (77%), Positives = 710/808 (88%), Gaps = 2/808 (0%)
 Frame = -2

Query  2741  MDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSGEM  2562
             MDL RSEPMQLVQ+I+P+ESA L+V+YLGDLGL+QFKDLN+EKSPFQRTYAAQIKR GEM
Sbjct  15    MDLMRSEPMQLVQVIVPMESAHLTVSYLGDLGLVQFKDLNSEKSPFQRTYAAQIKRCGEM  74

Query  2561  ARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSFNE  2382
             ARK+RFFKDQMSKAGVS     D    I  DD+EVKLG+LEAEL+EINANNDKLQRS+NE
Sbjct  75    ARKIRFFKDQMSKAGVSPKVILDKDIDIDLDDVEVKLGELEAELVEINANNDKLQRSYNE  134

Query  2381  LVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTSKQVRLG  2202
             LVEYKLVL+K G+FF SA  SA AQQ E  S Q GE+ LE PLL E + S D +KQV+LG
Sbjct  135   LVEYKLVLEKAGDFFASAHRSATAQQSEIESQQVGEDVLETPLLQE-EKSVDPTKQVKLG  193

Query  2201  FISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSGERA  2022
             F++GLVP+EKSM FERILFRATRGN+ +RQS ++ESV+DP SGEK EKNVF+VFYSGERA
Sbjct  194   FLTGLVPREKSMVFERILFRATRGNIFIRQSVIEESVVDPNSGEKAEKNVFVVFYSGERA  253

Query  2021  KNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSIAEQ  1842
             K+KILKIC+AFGANRYPF+E+LG+QAQ++TEVSG+++ELKT I+AG+ HR  LL++I ++
Sbjct  254   KSKILKICEAFGANRYPFSEDLGRQAQMMTEVSGRLAELKTTINAGLDHRKILLETIGDK  313

Query  1841  FDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNSEIG  1662
             F++WN+ VR+EK+IYHTLNMLS+DVTKKCLV EGWSP  A  EIQ+ALQRAG DSNS++G
Sbjct  314   FEQWNLKVRKEKAIYHTLNMLSLDVTKKCLVGEGWSPLFAAPEIQEALQRAGVDSNSQVG  373

Query  1661  AIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGD  1482
             +IF+VL T+E PPT+F+TNKFT+AFQEIVDAYGVAKYQEANP VFTIVTFPFLFAVMFGD
Sbjct  374   SIFQVLRTKEMPPTFFRTNKFTTAFQEIVDAYGVAKYQEANPTVFTIVTFPFLFAVMFGD  433

Query  1481  WGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEFFSV  1302
             WGHGICLLLAT+Y ++REKKLSSQKLGDI EM FGGRYVI MM+LFSIYTG IYNEFFS+
Sbjct  434   WGHGICLLLATMYLILREKKLSSQKLGDIMEMAFGGRYVIFMMSLFSIYTGLIYNEFFSI  493

Query  1301  QFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKLSIL  1122
              + LF  SAY CRD SCS+ATTIGLIK RDTY FGVDP WHGTRSELPFLNSLKMK+SIL
Sbjct  494   PYPLFAPSAYECRDASCSEATTIGLIKTRDTYPFGVDPVWHGTRSELPFLNSLKMKMSIL  553

Query  1121  LGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQADL  942
             LGVAQMNLGII+S+ NA +F+S VN W QF+PQ+IFLN LFGYLSVLII+KWCTGSQADL
Sbjct  554   LGVAQMNLGIIMSFCNAKFFKSAVNVWFQFVPQMIFLNCLFGYLSVLIIIKWCTGSQADL  613

Query  941   YHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQHN-RHQG  765
             YHVMIYMFL P +DLGENQLFP QKT QL  + LALVSVPWMLLPKPFILK QH  RHQG
Sbjct  614   YHVMIYMFLSPMDDLGENQLFPNQKTVQLTFLFLALVSVPWMLLPKPFILKKQHEARHQG  673

Query  764   QSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLRLWAL  585
             QSYA + + DESL V+ +  S  HEEFEFSE+FVHQLIHTIEFVLGAVSNTASYLRLWAL
Sbjct  674   QSYAQLDETDESLQVETTGGSHGHEEFEFSEIFVHQLIHTIEFVLGAVSNTASYLRLWAL  733

Query  584   SLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHALRLHW  405
             SLAHSELS+VFYEKVLL+AWG+NNI IL+VG ++FIFAT+GVLLVMETLSAFLHALRL  
Sbjct  734   SLAHSELSSVFYEKVLLMAWGFNNIFILIVGILVFIFATVGVLLVMETLSAFLHALRLRC  793

Query  404   VEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             VE+QNKFYEGDGYKF PF+F LV  E++
Sbjct  794   VEYQNKFYEGDGYKFAPFTFTLVGNEDE  821



>gb|EEC66656.1| hypothetical protein OsI_32928 [Oryza sativa Indica Group]
Length=814

 Score =  1183 bits (3061),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 610/828 (74%), Positives = 705/828 (85%), Gaps = 30/828 (4%)
 Frame = -2

Query  2765  GRGGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAA  2586
             G GGC P MDL RSE MQLVQ+IIP ESA L+V+YLGDLGL+QFKDLNA+KSPFQRTYA+
Sbjct  4     GGGGCCPSMDLMRSEAMQLVQVIIPAESAHLAVSYLGDLGLLQFKDLNADKSPFQRTYAS  63

Query  2585  QIKRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANND  2406
             QIKR GEMARKLRFF++QMSKA + A++   +  +++ DDLEVKLG+LE EL E+NANND
Sbjct  64    QIKRCGEMARKLRFFREQMSKAAI-ATSTQFSGTSLEIDDLEVKLGELEVELTEVNANND  122

Query  2405  KLQRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSAD  2226
             KLQR++NELVEY +VLQK GEFF+SA+ SA  QQ+E  +                D S D
Sbjct  123   KLQRTYNELVEYNIVLQKAGEFFYSAQRSATEQQREMSA----------------DQSGD  166

Query  2225  TS----------KQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPIS  2076
             +S           +++LG +SGLVPKEK+MAFERILFRATRGN+ LRQ  VDE+V DP+S
Sbjct  167   SSLERNGDRSIKNKLKLGSLSGLVPKEKAMAFERILFRATRGNMFLRQEPVDETVTDPLS  226

Query  2075  GEKVEKNVFLVFYSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTA  1896
             GEKV KN F++FYSGERAK+KI+KICDAFGANRYPF E+LGKQ Q I EVSGKISELK  
Sbjct  227   GEKVIKNAFVIFYSGERAKSKIVKICDAFGANRYPFPEDLGKQLQTIQEVSGKISELKAT  286

Query  1895  IDAGILHRGNLLQSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATI  1716
             I+ G+ HR ++L++I+ +F++WN LV++EK+IYHTLNMLS+DVTKKCLVAEGWSP  AT 
Sbjct  287   IEIGLAHRDSILKNISSEFEQWNTLVKKEKAIYHTLNMLSLDVTKKCLVAEGWSPVFATS  346

Query  1715  EIQDALQRAGHDSNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANP  1536
             +IQDALQRA  DS S++G+IF+VL T+ESPPT+F+TNKFTSAFQEIVDAYG+AKYQEANP
Sbjct  347   QIQDALQRATVDSKSQVGSIFQVLNTQESPPTFFQTNKFTSAFQEIVDAYGIAKYQEANP  406

Query  1535  GVFTIVTFPFLFAVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILM  1356
             GVFTIVTFPFLFA+MFGDWGHGICLLLATLY +IREKKL+SQKL DI +M FGGRYVILM
Sbjct  407   GVFTIVTFPFLFAIMFGDWGHGICLLLATLYLIIREKKLASQKLDDIMDMMFGGRYVILM  466

Query  1355  MALFSIYTGFIYNEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHG  1176
             M+LFSIYTG IYNEFFSV FELFG+SAY CRDPSC DATT GLIK R  Y+FGVDP WHG
Sbjct  467   MSLFSIYTGLIYNEFFSVPFELFGKSAYACRDPSCGDATTEGLIKVRPAYSFGVDPVWHG  526

Query  1175  TRSELPFLNSLKMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFG  996
             +RSELPFLNSLKMKLSIL+GVAQMNLGI++SYFNA +FR+ +N W QFIPQ+IFLN+LFG
Sbjct  527   SRSELPFLNSLKMKLSILIGVAQMNLGIMMSYFNAKFFRNAINVWYQFIPQLIFLNSLFG  586

Query  995   YLSVLIIVKWCTGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWM  816
             YLS+LII+KWCTGS+ADLYHVMIYMFL PT+DLGEN+LFPGQK  QLVL+LLALVSVPWM
Sbjct  587   YLSLLIIIKWCTGSKADLYHVMIYMFLSPTDDLGENELFPGQKLVQLVLLLLALVSVPWM  646

Query  815   LLPKPFILKSQH-NRHQGQSYAPIQDLDESL--LvdgshdssdheefefsevfvHQLIHT  645
             L+PKPF LK QH  RHQGQ Y  +Q  DES+  L +   D   HEEFEFSEVFVHQLIHT
Sbjct  647   LIPKPFFLKKQHEQRHQGQQYTMLQATDESVTELEEHQDDPHHHEEFEFSEVFVHQLIHT  706

Query  644   IEFVLGAVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATI  465
             IEFVLGAVSNTASYLRLWALSLAHSELSTVFYEKVL+L+WGYNNI IL++G +IF+FATI
Sbjct  707   IEFVLGAVSNTASYLRLWALSLAHSELSTVFYEKVLVLSWGYNNIFILIIGAVIFLFATI  766

Query  464   GVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             GVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKF PF+F  + EEED
Sbjct  767   GVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFVPFAFASIIEEED  814



>ref|XP_007017673.1| Vacuolar proton ATPase A3 isoform 1 [Theobroma cacao]
 gb|EOY14898.1| Vacuolar proton ATPase A3 isoform 1 [Theobroma cacao]
Length=818

 Score =  1181 bits (3056),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 620/817 (76%), Positives = 709/817 (87%), Gaps = 2/817 (0%)
 Frame = -2

Query  2765  GRGGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAA  2586
             G G   P MDL RSEPMQLVQLIIPIESA  S++YLGDLGL QFKDLN+EKSPFQRTYA 
Sbjct  2     GEGRQRPTMDLLRSEPMQLVQLIIPIESAHRSISYLGDLGLFQFKDLNSEKSPFQRTYAT  61

Query  2585  QIKRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANND  2406
             QIKRSGEMARKLRFFK+QM+KAG+S S  S   D +  D+LEVKLG+LEAELIE+NAN++
Sbjct  62    QIKRSGEMARKLRFFKEQMTKAGLSPSTRSARNDDVDLDNLEVKLGELEAELIEMNANHE  121

Query  2405  KLQRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSAD  2226
             KLQ+S+NEL EYKLV+QK GEFF SA+SSA A+Q+E  + Q GE S+++PLL E +M  D
Sbjct  122   KLQQSYNELKEYKLVMQKAGEFFQSAQSSAAAKQREAEAEQRGEGSIDSPLLLEQEMVTD  181

Query  2225  TSKQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFL  2046
              SKQV+LGF+SGLV +E+S+AFERILFRATRGNV L+QS V++ V DP SGEKVEKNVF+
Sbjct  182   PSKQVKLGFVSGLVSRERSLAFERILFRATRGNVFLKQSVVEDPVTDPASGEKVEKNVFI  241

Query  2045  VFYSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGN  1866
             VFYSGERA+NKI+KIC+ FGANRYPF E+LGKQ Q+ITEVSG++ ELKT ID G++H+ N
Sbjct  242   VFYSGERARNKIMKICEVFGANRYPFTEDLGKQFQIITEVSGRLEELKTTIDVGLVHQSN  301

Query  1865  LLQSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAG  1686
             LLQ+IA  F+ W++LV++EKSIYHTLNMLSIDV++KCLVAEGW P  AT +IQ+ LQ+A 
Sbjct  302   LLQTIAYHFENWSLLVKKEKSIYHTLNMLSIDVSRKCLVAEGWCPVFATNQIQNVLQKAT  361

Query  1685  HDSNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPF  1506
              DS+S++G IF VL T+ESPPTYF TNKFTSAFQEIVDAYG+AKYQEANP VFTI+TFPF
Sbjct  362   IDSSSQVGTIFHVLQTKESPPTYFHTNKFTSAFQEIVDAYGIAKYQEANPAVFTIITFPF  421

Query  1505  LFAVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGF  1326
             LFAVMFGDWGHGICL LAT YF+IREKK SSQKLGDITEM FGGRYVI+MMALFSIYTG 
Sbjct  422   LFAVMFGDWGHGICLCLATSYFIIREKKFSSQKLGDITEMIFGGRYVIMMMALFSIYTGL  481

Query  1325  IYNEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNS  1146
             IYNEFFSV FELFG SAY C DPSCSDA+T GL+K R TY FGVDP WHGTRSELPFLNS
Sbjct  482   IYNEFFSVPFELFGPSAYGCHDPSCSDASTAGLVKVRATYPFGVDPKWHGTRSELPFLNS  541

Query  1145  LKMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKW  966
             LKMK+SIL+GVAQMNLGIILSYFNA +F++ +N W QF+PQ+IFLN+LFGYLS+LI+VKW
Sbjct  542   LKMKMSILIGVAQMNLGIILSYFNAKFFKNEINIWYQFVPQLIFLNSLFGYLSLLIVVKW  601

Query  965   CTGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKS  786
             CTGSQADLYHVMIYMFL PT+DLGENQLF GQK  Q+VL+L ALVSVPWML PKPF+LK 
Sbjct  602   CTGSQADLYHVMIYMFLSPTDDLGENQLFFGQKFLQIVLLLAALVSVPWMLFPKPFLLKK  661

Query  785   QH-NRHQGQSYAPIQDLDESLLvdgshd-ssdheefefsevfvHQLIHTIEFVLGAVSNT  612
             QH  RH+GQSYA +   D+  L    H  S  HEEFEFSEVFVHQLIHTIEFVLGAVSNT
Sbjct  662   QHEERHRGQSYALLDSSDDDPLEMELHHGSGSHEEFEFSEVFVHQLIHTIEFVLGAVSNT  721

Query  611   ASYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSA  432
             ASYLRLWALSLAHSELS+VFY+KVLLLAWG+NNIIIL++G  +FI AT+GVLLVMETLSA
Sbjct  722   ASYLRLWALSLAHSELSSVFYDKVLLLAWGFNNIIILIIGIFVFICATVGVLLVMETLSA  781

Query  431   FLHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             FLHALRLHWVEFQNKFYEGDGYKF PFSF LV EE+D
Sbjct  782   FLHALRLHWVEFQNKFYEGDGYKFQPFSFALVSEEDD  818



>ref|XP_004984994.1| PREDICTED: vacuolar proton ATPase a3-like [Setaria italica]
Length=822

 Score =  1181 bits (3054),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 614/811 (76%), Positives = 707/811 (87%), Gaps = 5/811 (1%)
 Frame = -2

Query  2741  MDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSGEM  2562
             MDL RSE MQLVQ+IIP ESA L+V+YLGDLGLIQFKDLNAEKSPFQRTYAAQIKR  EM
Sbjct  13    MDLMRSEAMQLVQVIIPAESAHLTVSYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRCSEM  72

Query  2561  ARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSFNE  2382
             ARKLRFFK+QMSKA +S S     +  ++FDDLE+KLG+LEAEL E+NANN+KLQR++NE
Sbjct  73    ARKLRFFKEQMSKANISPSPTQLNEAHLEFDDLEIKLGELEAELTEVNANNEKLQRTYNE  132

Query  2381  LVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTSKQVRLG  2202
             L+EY  VLQK GEFF+SA+ SA AQQ+E  ++QS + SLE+PLL + +MS D SKQV+LG
Sbjct  133   LLEYNTVLQKAGEFFYSAQRSAAAQQREMEANQSSQTSLESPLLEQ-EMSTDPSKQVKLG  191

Query  2201  FISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSGERA  2022
              +SGLVPKEK+MAFERILFRATRGN+ LRQ  +DE V DP+SGEKV KN F++FYSGER+
Sbjct  192   SLSGLVPKEKAMAFERILFRATRGNIFLRQEPIDEPVTDPVSGEKVAKNAFVIFYSGERS  251

Query  2021  KNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSIAEQ  1842
             K KILKICDAF ANRYPF E++ KQ   + EVSG+ISELK  ID G+ HR ++L+SIA  
Sbjct  252   KAKILKICDAFNANRYPFPEDVTKQLHAVQEVSGRISELKATIDMGLAHRDSILKSIASD  311

Query  1841  FDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNSEIG  1662
             F++WN L +REK+IYHTLNMLS+DVTKKCLVAEGWSP  A+++IQDALQRA  DS S++G
Sbjct  312   FEQWNHLAKREKAIYHTLNMLSVDVTKKCLVAEGWSPVFASVQIQDALQRATVDSKSQVG  371

Query  1661  AIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGD  1482
             +IF++L T+ESPPTYF+TNKFT+AFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGD
Sbjct  372   SIFQILNTKESPPTYFQTNKFTTAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGD  431

Query  1481  WGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEFFSV  1302
             WGHGICLLL TL+ +IREKKL+SQKLGDITEM FGGRYVI+MM++FSIYTG IYNEFFSV
Sbjct  432   WGHGICLLLGTLFLIIREKKLASQKLGDITEMMFGGRYVIMMMSIFSIYTGLIYNEFFSV  491

Query  1301  QFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKLSIL  1122
              FELFG+SAY CRDPSC D+TT GLIK R TY FGVDP WHG+RSELPFLNSLKMK+SIL
Sbjct  492   PFELFGKSAYACRDPSCRDSTTEGLIKVRGTYPFGVDPVWHGSRSELPFLNSLKMKMSIL  551

Query  1121  LGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQADL  942
             LGVAQMNLGI++SYFNA +FR+ +N W QFIPQ+IFLN+LFGYLS+LII+KWCTGS+ADL
Sbjct  552   LGVAQMNLGIVMSYFNAKFFRNSINVWYQFIPQLIFLNSLFGYLSLLIIIKWCTGSKADL  611

Query  941   YHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQHN-RHQG  765
             YHVMIYMFL PT++LGENQLF GQKT QLVL+LLALVSVPWML+PKP +LK QH  RHQG
Sbjct  612   YHVMIYMFLSPTDELGENQLFSGQKTVQLVLLLLALVSVPWMLIPKPVLLKKQHERRHQG  671

Query  764   QSYAPIQDLDESL---LvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLRL  594
               YA +Q  DES+   L +   +S DHEEFEFSEVFVHQLIHTIEFVLGAVSNTASYLRL
Sbjct  672   HQYAMLQGTDESVGAELGEHHDESHDHEEFEFSEVFVHQLIHTIEFVLGAVSNTASYLRL  731

Query  593   WALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHALR  414
             WALSLAHSELSTVFY+KVL+L W  NN++ L++G IIFIFATIGVLLVMETLSAFLHALR
Sbjct  732   WALSLAHSELSTVFYDKVLMLTWRMNNVVALILGVIIFIFATIGVLLVMETLSAFLHALR  791

Query  413   LHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             LHWVEFQNKFYEGDGYKF PFSF L+ EEED
Sbjct  792   LHWVEFQNKFYEGDGYKFAPFSFALIREEED  822



>gb|AEH95770.1| vacuolar ATPase subunit A [Triticum aestivum]
Length=821

 Score =  1180 bits (3052),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 610/817 (75%), Positives = 705/817 (86%), Gaps = 5/817 (1%)
 Frame = -2

Query  2759  GGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQI  2580
             GGC P MDL RSE MQL+Q+IIP ESA L+V++LGDLGLIQFKDLNA+KSPFQRTYAAQI
Sbjct  6     GGCCPSMDLMRSEAMQLLQVIIPTESAHLAVSHLGDLGLIQFKDLNADKSPFQRTYAAQI  65

Query  2579  KRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKL  2400
             KR  EMARKLRFFK+QMSKAG+  S    T+  + FDD+EVKLG+LEAEL E+NAN++KL
Sbjct  66    KRCAEMARKLRFFKEQMSKAGILVSPMQSTETPLDFDDMEVKLGELEAELTEVNANDEKL  125

Query  2399  QRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTS  2220
             QR+ NEL+EY  VLQK GEFF+SA+ SA AQ ++  ++QSGE SLE+PLL + DM  D S
Sbjct  126   QRAHNELLEYSTVLQKAGEFFYSAQRSAAAQHRQMEANQSGETSLESPLLEQ-DMLTDAS  184

Query  2219  KQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVF  2040
             KQV+LG +SGLVPKEK+MAFERILFRATRGN+LLRQ  VDE V DP SGEKV KN F+VF
Sbjct  185   KQVKLGSLSGLVPKEKAMAFERILFRATRGNILLRQESVDEPVTDPQSGEKVYKNTFVVF  244

Query  2039  YSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLL  1860
             YSGERAK KILKICDAF ANRYPF E+L KQ   + EVSGKISELK  ID G+ HR ++L
Sbjct  245   YSGERAKAKILKICDAFRANRYPFPEDLAKQTHTVQEVSGKISELKATIDMGLAHRDSIL  304

Query  1859  QSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHD  1680
             ++IA +F+ WN L ++EKSIYHTLNMLS+DVTKKCLV EGWSP  AT +IQDALQRA  +
Sbjct  305   KTIASEFEHWNHLAKKEKSIYHTLNMLSVDVTKKCLVGEGWSPVFATNQIQDALQRATLE  364

Query  1679  SNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLF  1500
             S S++G+IF+VL T+ESPPTYF+TNKFTSAFQEIVDAYGVAKYQEANPGV+TI+TFPFLF
Sbjct  365   SKSQVGSIFQVLNTKESPPTYFQTNKFTSAFQEIVDAYGVAKYQEANPGVYTIITFPFLF  424

Query  1499  AVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIY  1320
             AVMFGDWGHGIC+LLATLY +IREKK +SQKLGDI EM FGGRY+I+MM++FSIYTG IY
Sbjct  425   AVMFGDWGHGICILLATLYLIIREKKFASQKLGDIMEMMFGGRYIIMMMSIFSIYTGLIY  484

Query  1319  NEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLK  1140
             NEFFSV FELF +SAY CRD SCSD+TT GLIK RDTY FGVDP WHG+RSELPFLNSLK
Sbjct  485   NEFFSVPFELFAKSAYACRDSSCSDSTTEGLIKVRDTYPFGVDPVWHGSRSELPFLNSLK  544

Query  1139  MKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCT  960
             MK+SILLGV+QMNLGI +SYFNA +FR+ VN W QF+PQ+IFLN+LFGYLS+LII+KWCT
Sbjct  545   MKMSILLGVSQMNLGIFMSYFNAKFFRNSVNVWYQFVPQLIFLNSLFGYLSMLIIIKWCT  604

Query  959   GSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQH  780
             GS+ADLYHVMIYMFL PT+D+GENQLFPGQKT Q VL+LLALVSVPWML+PKPF LK +H
Sbjct  605   GSKADLYHVMIYMFLSPTDDMGENQLFPGQKTLQQVLLLLALVSVPWMLIPKPFFLKWEH  664

Query  779   N-RHQGQSYAPIQDLDESL---LvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNT  612
               RHQG  YA ++  DES+   L + + +S+ HEEFEF+E+FVHQLIHTIEFVLGAVSNT
Sbjct  665   ERRHQGHQYAMLEGADESVVAELGEHNEESNHHEEFEFNEIFVHQLIHTIEFVLGAVSNT  724

Query  611   ASYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSA  432
             ASYLRLWALSLAHSELSTVFY+KVLLL  GYNNI IL +G ++FI AT+GVLLVMETLSA
Sbjct  725   ASYLRLWALSLAHSELSTVFYDKVLLLTLGYNNIFILAIGVVVFICATVGVLLVMETLSA  784

Query  431   FLHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             FLHALRLHWVEFQNKFYEGDGYKF PFSF L+ E+E+
Sbjct  785   FLHALRLHWVEFQNKFYEGDGYKFAPFSFALISEDEE  821



>emb|CAE45587.1| vacuolar proton-ATPase subunit-like protein [Lotus japonicus]
Length=815

 Score =  1179 bits (3050),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 626/815 (77%), Positives = 716/815 (88%), Gaps = 11/815 (1%)
 Frame = -2

Query  2759  GGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQI  2580
             GGC PPMDLFRSEPMQLVQLIIPIESA  +V+YLGDLGL+QFKD++  K PF+      I
Sbjct  8     GGCCPPMDLFRSEPMQLVQLIIPIESAHRTVSYLGDLGLLQFKDVSNSK-PFK------I  60

Query  2579  KRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKL  2400
             KR GEMARKLRFFK+QM KAGVS    S TQ  +  D+LEVKL ++E+EL E+NAN +KL
Sbjct  61    KRCGEMARKLRFFKEQMLKAGVSPKL-STTQVDVNIDNLEVKLSEIESELTEMNANGEKL  119

Query  2399  QRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTS  2220
             QRS+NELVEYKLVLQK GEFFHSA+S A  QQ+EY S     ES+E PLL + ++S D+S
Sbjct  120   QRSYNELVEYKLVLQKAGEFFHSAQSGAIEQQREYESRLLSGESMETPLLQD-ELSGDSS  178

Query  2219  KQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVF  2040
             KQ++LGF++GLVP+EKSM FERILFRATRGNV LRQ+ V++ V DP+SGEK EKNVF+VF
Sbjct  179   KQIKLGFLAGLVPREKSMTFERILFRATRGNVFLRQTAVEDPVTDPVSGEKTEKNVFVVF  238

Query  2039  YSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLL  1860
             Y+GE+ K KILKICDAF ANRYPFAEELGKQAQ+ITEVSGKISELKT ID G+ HR NLL
Sbjct  239   YAGEKVKAKILKICDAFSANRYPFAEELGKQAQMITEVSGKISELKTTIDTGLQHRVNLL  298

Query  1859  QSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHD  1680
              +I  QF++WN+LVR+EKSI+HTLNMLS+DVTKKCLVAEGWSP  AT +IQDALQRA  D
Sbjct  299   DTIGVQFEQWNLLVRKEKSIHHTLNMLSLDVTKKCLVAEGWSPVFATKQIQDALQRAAVD  358

Query  1679  SNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLF  1500
             SNS++ AIF+VL T+E PPTYF+TNKFTS++Q I+D+YGVAKYQEANP V+T+VTFPFLF
Sbjct  359   SNSQVSAIFQVLHTKEMPPTYFRTNKFTSSYQGIIDSYGVAKYQEANPTVYTVVTFPFLF  418

Query  1499  AVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIY  1320
             AVMFGDWGHGICLLLA LYF+IRE+KLSSQKL DITEMTFGGRYVIL+M+LFSIYTG IY
Sbjct  419   AVMFGDWGHGICLLLAALYFIIRERKLSSQKLDDITEMTFGGRYVILLMSLFSIYTGLIY  478

Query  1319  NEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLK  1140
             NEFFSV FELFG SAY CRD +CS+ATTIGLIKAR TY FGVDP WHGTRSELPFLNSLK
Sbjct  479   NEFFSVPFELFGPSAYECRDLACSEATTIGLIKARRTYPFGVDPVWHGTRSELPFLNSLK  538

Query  1139  MKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCT  960
             MK+SILLGVAQMNLGII+S+FNA +FR+ VN W QFIPQ+IFLN+LFGYLS+LIIVKWCT
Sbjct  539   MKMSILLGVAQMNLGIIMSFFNAIFFRNSVNIWFQFIPQMIFLNSLFGYLSLLIIVKWCT  598

Query  959   GSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQH  780
             GSQADLYHVMIYMFL PT+DLGEN+LF GQK+ QLVL+LLA+V+VPWMLLPKPFILK QH
Sbjct  599   GSQADLYHVMIYMFLSPTDDLGENELFAGQKSYQLVLLLLAVVAVPWMLLPKPFILKKQH  658

Query  779   N-RHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASY  603
               RH  +SYAP+   +ESL V+ +HDS  HEEFEFSE+FVHQLIHTIEFVLGAVSNTASY
Sbjct  659   EARHGAESYAPLPSTEESLQVESNHDSHGHEEFEFSEIFVHQLIHTIEFVLGAVSNTASY  718

Query  602   LRLWALSLAHSELSTVFYEKVLLLAWG-YNNiiilvvgfiifiFATIGVLLVMETLSAFL  426
             LRLWALSLAHSELS+VFYEKVLLLAWG YNN+IIL+VG ++FIFAT+GVLLVMETLSAFL
Sbjct  719   LRLWALSLAHSELSSVFYEKVLLLAWGYYNNVIILIVGILVFIFATVGVLLVMETLSAFL  778

Query  425   HALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             HALRLHWVEFQNKFYEGDGYKF PFSF L+DEE++
Sbjct  779   HALRLHWVEFQNKFYEGDGYKFFPFSFSLLDEEDE  813



>dbj|BAF98583.1| CM0216.490.nc [Lotus japonicus]
Length=815

 Score =  1177 bits (3046),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 625/815 (77%), Positives = 714/815 (88%), Gaps = 11/815 (1%)
 Frame = -2

Query  2759  GGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQI  2580
             GGC PPMDLFRSEPMQLVQLIIPIESA  +V+YLGDLGL+QFKD++  K PF+      I
Sbjct  8     GGCCPPMDLFRSEPMQLVQLIIPIESAHRTVSYLGDLGLLQFKDVSNSK-PFK------I  60

Query  2579  KRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKL  2400
             KR GEMARKLRFFK+QM KAGVS    S TQ  +  D+LEVKL ++E+EL E+NAN +KL
Sbjct  61    KRCGEMARKLRFFKEQMLKAGVSPKL-STTQVDVNIDNLEVKLSEIESELTEMNANGEKL  119

Query  2399  QRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTS  2220
             QRS+NELVEYKLVLQK GEFFHSA+S A  QQ+EY S     ES+E PLL +  +S D+S
Sbjct  120   QRSYNELVEYKLVLQKAGEFFHSAQSGAIEQQREYESRLLSGESMETPLLQD-QLSGDSS  178

Query  2219  KQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVF  2040
             KQ++LGF++GLVP+EKSM FERILFRATRGNV LRQ+ V++ V DP+SGEK EKNVF+VF
Sbjct  179   KQIKLGFLAGLVPREKSMTFERILFRATRGNVFLRQTAVEDPVTDPVSGEKTEKNVFVVF  238

Query  2039  YSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLL  1860
             Y+GE+ K KILKICDAF ANRYPFAEELGKQAQ+ITE SGKISELKT ID G+ HR NLL
Sbjct  239   YAGEKVKAKILKICDAFSANRYPFAEELGKQAQMITEASGKISELKTTIDTGLQHRVNLL  298

Query  1859  QSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHD  1680
              +I  QF++WN+LVR+EKSI+HTLNMLS+DVTKKCLVAEGWSP  AT +IQDALQRA  D
Sbjct  299   DTIGVQFEQWNLLVRKEKSIHHTLNMLSLDVTKKCLVAEGWSPVFATKQIQDALQRAAVD  358

Query  1679  SNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLF  1500
             SNS++ AIF+VL T+E PPTYF+TNKFTS++Q I+D+YGVAKYQEANP V+T+VTFPFLF
Sbjct  359   SNSQVSAIFQVLHTKEMPPTYFRTNKFTSSYQGIIDSYGVAKYQEANPTVYTVVTFPFLF  418

Query  1499  AVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIY  1320
             AVMFGDWGHGICLLLA LYF+IRE+KLSSQKL DITEMTFGGRYVIL+M+LFSIYTG IY
Sbjct  419   AVMFGDWGHGICLLLAALYFIIRERKLSSQKLDDITEMTFGGRYVILLMSLFSIYTGLIY  478

Query  1319  NEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLK  1140
             NEFFSV FELFG SAY CRD +CS+ATTIGLIKAR TY FGVDP WHGTRSELPFLNSLK
Sbjct  479   NEFFSVPFELFGPSAYECRDLACSEATTIGLIKARRTYPFGVDPVWHGTRSELPFLNSLK  538

Query  1139  MKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCT  960
             MK+SILLGVAQMNLGII+S+FNA +FR+ VN W QFIPQ+IFLN+LFGYLS+LIIVKWCT
Sbjct  539   MKMSILLGVAQMNLGIIMSFFNAIFFRNSVNIWFQFIPQMIFLNSLFGYLSLLIIVKWCT  598

Query  959   GSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQH  780
             GSQADLYHVMIYMFL PT+DLGEN+LF GQK+ QLVL+LLA+V+VPWMLLPKPFILK QH
Sbjct  599   GSQADLYHVMIYMFLSPTDDLGENELFAGQKSYQLVLLLLAVVAVPWMLLPKPFILKKQH  658

Query  779   N-RHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASY  603
               RH  +SYAP+   +ESL V+ +HDS  HEEFEFSE+FVHQLIHTIEFVLGAVSNTASY
Sbjct  659   EARHGAESYAPLPSTEESLQVESNHDSHGHEEFEFSEIFVHQLIHTIEFVLGAVSNTASY  718

Query  602   LRLWALSLAHSELSTVFYEKVLLLAWG-YNNiiilvvgfiifiFATIGVLLVMETLSAFL  426
             LRLWALSLAHSELS+VFYEKVLLLAWG YNN+IIL+VG ++FIFAT+GVLLVMETLSAFL
Sbjct  719   LRLWALSLAHSELSSVFYEKVLLLAWGYYNNVIILIVGILVFIFATVGVLLVMETLSAFL  778

Query  425   HALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             HALRLHWVEFQNKFYEGDGYKF PFSF L+DEE++
Sbjct  779   HALRLHWVEFQNKFYEGDGYKFFPFSFSLLDEEDE  813



>ref|XP_006661663.1| PREDICTED: vacuolar proton ATPase a3-like [Oryza brachyantha]
Length=808

 Score =  1177 bits (3045),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 616/810 (76%), Positives = 708/810 (87%), Gaps = 5/810 (1%)
 Frame = -2

Query  2741  MDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSGEM  2562
             MDL RSE MQLVQ+IIP ESA L+V+YLGDLGL+QFKDLN++KSPFQRTYA+QIKR GEM
Sbjct  1     MDLMRSEAMQLVQVIIPAESAHLAVSYLGDLGLLQFKDLNSDKSPFQRTYASQIKRCGEM  60

Query  2561  ARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSFNE  2382
             ARKLRFF++QMSKA +S S+ +     ++ DDLEVKLG+LE EL E+NANN+KLQR++NE
Sbjct  61    ARKLRFFREQMSKAAISTSS-TQFSGTLEIDDLEVKLGELEVELTEVNANNEKLQRTYNE  119

Query  2381  LVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTSKQVRLG  2202
             L+EY +VLQK GEFF SA+ SA  QQ+E  + QSG+ SLE+PLL + +M  D SKQV+LG
Sbjct  120   LMEYNVVLQKAGEFFSSAQRSATEQQREMSADQSGDSSLESPLLQQ-EMVTDPSKQVKLG  178

Query  2201  FISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSGERA  2022
              +SGLVPKEK+MAFERILFRATRGN+ LRQ  VDE+V DP+SGEKV KN F++FYSGERA
Sbjct  179   SLSGLVPKEKAMAFERILFRATRGNMFLRQEPVDETVTDPLSGEKVIKNAFVIFYSGERA  238

Query  2021  KNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSIAEQ  1842
             K+KI+KICDAFGANRYPF E+LGKQ Q I EVSGKISELK  I+ G+ HR ++L+SI+ +
Sbjct  239   KSKIVKICDAFGANRYPFPEDLGKQLQTIQEVSGKISELKATIELGLAHRDSILKSISSE  298

Query  1841  FDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNSEIG  1662
             F+ WN LV++EK+IYHTLNMLS+DVTKKCLVAEGWSP  AT +IQDALQRA  DS S++G
Sbjct  299   FEHWNTLVKKEKAIYHTLNMLSLDVTKKCLVAEGWSPVFATSQIQDALQRATVDSKSQVG  358

Query  1661  AIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGD  1482
             +IF+VL T+ESPPT+F+TNKFTSAFQEIVDAYG+AKYQEANPGVFTIVTFPFLFAVMFGD
Sbjct  359   SIFQVLNTQESPPTFFQTNKFTSAFQEIVDAYGIAKYQEANPGVFTIVTFPFLFAVMFGD  418

Query  1481  WGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEFFSV  1302
             WGHGICLLLATLY +IREKKL+SQKL DI +M FGGRYVILMM+LFSIYTG IYNEFFSV
Sbjct  419   WGHGICLLLATLYLIIREKKLASQKLDDIMDMMFGGRYVILMMSLFSIYTGLIYNEFFSV  478

Query  1301  QFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKLSIL  1122
              FELFG+SAY CRDPSC DATT GLIK R  Y FGVDP WHG+RSELPFLNSLKMKLSIL
Sbjct  479   PFELFGKSAYACRDPSCGDATTEGLIKVRPAYPFGVDPVWHGSRSELPFLNSLKMKLSIL  538

Query  1121  LGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQADL  942
             LGVAQMNLGI++SYFNA +FR+ +N W QFIPQ+IFLN+LFGYLS+LII+KWCTGS+ADL
Sbjct  539   LGVAQMNLGILMSYFNAKFFRNALNVWYQFIPQLIFLNSLFGYLSLLIIIKWCTGSKADL  598

Query  941   YHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQH-NRHQG  765
             YHVMIYMFL PT+DLGEN+LFPGQK  QLVL+LLALVSVPWML+PKP  LK QH  RHQG
Sbjct  599   YHVMIYMFLSPTDDLGENELFPGQKLVQLVLLLLALVSVPWMLIPKPLFLKRQHEQRHQG  658

Query  764   QSYAPIQDLDESL--LvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLRLW  591
             Q Y  +Q  DES+  L +   DS  HEEFEFSEVFVHQLIHTIEFVLGAVSNTASYLRLW
Sbjct  659   QQYTMLQATDESVTELEENHEDSHHHEEFEFSEVFVHQLIHTIEFVLGAVSNTASYLRLW  718

Query  590   ALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHALRL  411
             ALSLAHSELS+VFYEKVL+L+WGYNNI IL++G +IF+FATIGVLLVMETLSAFLHALRL
Sbjct  719   ALSLAHSELSSVFYEKVLVLSWGYNNIFILIIGAVIFLFATIGVLLVMETLSAFLHALRL  778

Query  410   HWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             HWVEFQNKFYEGDGYKF PF+F  + EEED
Sbjct  779   HWVEFQNKFYEGDGYKFAPFAFASIIEEED  808



>dbj|BAJ53179.1| JHL18I08.13 [Jatropha curcas]
 gb|KDP38579.1| hypothetical protein JCGZ_04504 [Jatropha curcas]
Length=817

 Score =  1176 bits (3042),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 603/812 (74%), Positives = 706/812 (87%), Gaps = 1/812 (0%)
 Frame = -2

Query  2753  CFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKR  2574
             C+P MDL RSE MQLVQLIIP+ESA  +++YLGDLGL QFKDLNAEKSPFQRTYA QIKR
Sbjct  6     CWPTMDLLRSETMQLVQLIIPMESAHRTISYLGDLGLFQFKDLNAEKSPFQRTYAVQIKR  65

Query  2573  SGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQR  2394
               EMARKLRFFK+QM+K G+  S  S   + I  D+LEVKLG+LEAELIEIN+NN++L+R
Sbjct  66    CAEMARKLRFFKEQMTKIGLLPSTRSARSNDIDLDNLEVKLGELEAELIEINSNNERLKR  125

Query  2393  SFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTSKQ  2214
             ++NEL+EY+LVLQK GE FHSA+ SA  Q ++     + E S+++PLL E +M  D SKQ
Sbjct  126   TYNELLEYELVLQKAGELFHSAQQSAAVQPRKLEVDNNNEGSIDSPLLLEQEMITDPSKQ  185

Query  2213  VRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYS  2034
             V+LGF+SGLVP+EK MAFERI+FRATRGNV L+QS V+  V+DP+SGEKVEKNVF++FYS
Sbjct  186   VKLGFVSGLVPREKLMAFERIVFRATRGNVFLKQSVVESPVVDPVSGEKVEKNVFVIFYS  245

Query  2033  GERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQS  1854
             GERAK+KILKIC+AFGANRYPF E+L KQ Q++TEVSG+++ELKT ID G+ H  NLLQ+
Sbjct  246   GERAKSKILKICEAFGANRYPFTEDLSKQYQMMTEVSGRLAELKTTIDVGLAHASNLLQT  305

Query  1853  IAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSN  1674
             I  QF++WN LV++EKS+YHTLNMLSIDVTKKCLVAEGW P  A  +IQ+ LQ+A  DSN
Sbjct  306   IGVQFEQWNFLVKKEKSVYHTLNMLSIDVTKKCLVAEGWCPVFAIDQIQNVLQQATVDSN  365

Query  1673  SEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAV  1494
             S+IGAIF+VL T+ESPPT+F+TNKFTSAFQEIVDAYGVAKYQEANPGV+TI+TFPFLFAV
Sbjct  366   SQIGAIFQVLQTKESPPTFFRTNKFTSAFQEIVDAYGVAKYQEANPGVYTIITFPFLFAV  425

Query  1493  MFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNE  1314
             MFGDWGHGICLLLATLYF++REKKLSSQKLGDI EMTFGGRYVI+MMA+FSIYTG IYNE
Sbjct  426   MFGDWGHGICLLLATLYFIVREKKLSSQKLGDIMEMTFGGRYVIMMMAIFSIYTGLIYNE  485

Query  1313  FFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMK  1134
             FFSV FELFG SAY CRD SC DA+T GL+K R TY FGVDP WHGTRSELPFLNSLKMK
Sbjct  486   FFSVPFELFGPSAYSCRDLSCRDASTSGLLKVRATYTFGVDPKWHGTRSELPFLNSLKMK  545

Query  1133  LSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGS  954
             +SILLGVAQMNLGI++SYFNA +F   +N W QF+PQIIFLN+LFGYLS+LIIVKW TGS
Sbjct  546   MSILLGVAQMNLGIVMSYFNAKFFGDNLNVWYQFVPQIIFLNSLFGYLSLLIIVKWFTGS  605

Query  953   QADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQHN-  777
             QADLYHVMIYMFL PT+DLG+NQLF GQK  Q++L+LLALV+VPWML PKPF+LK Q+  
Sbjct  606   QADLYHVMIYMFLSPTDDLGDNQLFVGQKFLQILLLLLALVAVPWMLFPKPFLLKKQYQE  665

Query  776   RHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLR  597
             RHQGQSYA +   ++ L ++  +DS  HEEFEFSEVFVHQLIHTIEFVLGAVSNTASYLR
Sbjct  666   RHQGQSYAILDSTEDPLEMEPQYDSQKHEEFEFSEVFVHQLIHTIEFVLGAVSNTASYLR  725

Query  596   LWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHAL  417
             LWALSLAHSELS+VFY+KVLLLAWG+NNI+IL++G I+F+ AT+GVLLVMETLSAFLHAL
Sbjct  726   LWALSLAHSELSSVFYDKVLLLAWGFNNIVILMIGIIVFVCATVGVLLVMETLSAFLHAL  785

Query  416   RLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             RLHWVEFQNKFYEG+GYKF PFSF L+  E++
Sbjct  786   RLHWVEFQNKFYEGNGYKFHPFSFALLTVEDE  817



>ref|XP_004243162.1| PREDICTED: V-type proton ATPase subunit a2-like [Solanum lycopersicum]
Length=818

 Score =  1176 bits (3041),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 605/814 (74%), Positives = 697/814 (86%), Gaps = 1/814 (0%)
 Frame = -2

Query  2759  GGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQI  2580
             GGC P MDL RSEPMQLVQLIIP+ESA  +V+YLGDLGL QFKDLN EKSPFQRTYA QI
Sbjct  5     GGCCPTMDLLRSEPMQLVQLIIPLESAHRTVSYLGDLGLFQFKDLNVEKSPFQRTYATQI  64

Query  2579  KRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKL  2400
             KR GEMARKLRF K+QM+KAG++ S  +     I  D+LEVKLG+LEA+L E+N+N +KL
Sbjct  65    KRCGEMARKLRFLKEQMTKAGITPSTRTTMCPNINLDELEVKLGELEADLAEMNSNTEKL  124

Query  2399  QRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTS  2220
             QRS+NEL+EYKLVLQK GEFFHSA++SA AQQ+E      GE S+++PLL E +   D+S
Sbjct  125   QRSYNELLEYKLVLQKAGEFFHSAQNSATAQQKELEEHMHGERSIDSPLLLEQEAFTDSS  184

Query  2219  KQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVF  2040
             KQV+LGF+SGLV +EKSMAFER LFRATRGNV L+Q  V   V DP+SG +VEKNVF++F
Sbjct  185   KQVKLGFVSGLVAREKSMAFERFLFRATRGNVFLKQVVVKNPVKDPLSGSEVEKNVFVIF  244

Query  2039  YSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLL  1860
             YSGERAKNKILKICDAFGANRYPF +++G+Q ++ITEVSGK+SELKT ID G LHR NLL
Sbjct  245   YSGERAKNKILKICDAFGANRYPFTDDIGRQFEMITEVSGKLSELKTTIDIGQLHRANLL  304

Query  1859  QSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHD  1680
             Q+I  +FD+WN+LV++EK I+HTLNMLS DVTKKCLV EGW P  AT +IQ+AL RA  D
Sbjct  305   QTIGYEFDQWNLLVKQEKFIFHTLNMLSFDVTKKCLVGEGWCPVYATSQIQNALHRATLD  364

Query  1679  SNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLF  1500
              NS++GAIF+VL T E PPTYF+TNKFTS FQEIVDAYG+AKYQE NP VFT+VTFPFLF
Sbjct  365   GNSQVGAIFQVLHTTELPPTYFRTNKFTSGFQEIVDAYGIAKYQEVNPAVFTVVTFPFLF  424

Query  1499  AVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIY  1320
             AVMFGDWGHGICL   TLYF++RE+KLS QKLGDI EMTFGGRY+I+MMALFSIYTGFIY
Sbjct  425   AVMFGDWGHGICLFFTTLYFILRERKLSGQKLGDIMEMTFGGRYIIMMMALFSIYTGFIY  484

Query  1319  NEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLK  1140
             NEFFSV FE+FG+SAY CRDPSC DAT  GL+K RD Y FGVDP WHG+RSELPFLNSLK
Sbjct  485   NEFFSVPFEIFGQSAYGCRDPSCRDATITGLVKVRDAYPFGVDPKWHGSRSELPFLNSLK  544

Query  1139  MKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCT  960
             MK+SILLGVAQMNLGIILSYFNA +F++ VN W QF+PQIIFLN+LFGYLS+LIIVKWCT
Sbjct  545   MKMSILLGVAQMNLGIILSYFNAKFFQNNVNVWHQFVPQIIFLNSLFGYLSLLIIVKWCT  604

Query  959   GSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQH  780
             GSQADLYHVMIYMFL PT+DLGENQLFPGQK  QL+ V LALV+VPWML PKPF+LK QH
Sbjct  605   GSQADLYHVMIYMFLSPTDDLGENQLFPGQKYLQLLFVSLALVAVPWMLFPKPFLLKKQH  664

Query  779   -NRHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASY  603
               RH+GQ YA +   D+S  ++    S  HEEF+FSE+FVHQLIHTIEFVLGAVSNTASY
Sbjct  665   EERHRGQLYAMLDSTDDSFELETHDHSHGHEEFDFSEIFVHQLIHTIEFVLGAVSNTASY  724

Query  602   LRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLH  423
             LRLWALSLAHSELS+VFY+KVLLLA GYNN+IIL++G ++F FAT+GVLLVMETLSAFLH
Sbjct  725   LRLWALSLAHSELSSVFYDKVLLLAVGYNNLIILIIGIVVFTFATVGVLLVMETLSAFLH  784

Query  422   ALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             ALRLHWVEFQNKFYEGDGYKF PFSF L+ E++D
Sbjct  785   ALRLHWVEFQNKFYEGDGYKFSPFSFCLISEDDD  818



>emb|CAB38828.1| putative proton pump [Arabidopsis thaliana]
 emb|CAB80571.1| putative proton pump [Arabidopsis thaliana]
Length=843

 Score =  1174 bits (3038),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 621/831 (75%), Positives = 716/831 (86%), Gaps = 25/831 (3%)
 Frame = -2

Query  2741  MDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSGEM  2562
             MDL RSE MQLVQLI+P+ESA L+V+YLGDLGL+QFKDLN+EKSPFQRTYAAQIKR GEM
Sbjct  14    MDLMRSETMQLVQLIVPMESAHLTVSYLGDLGLVQFKDLNSEKSPFQRTYAAQIKRCGEM  73

Query  2561  ARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSFNE  2382
             ARK+RFF+DQMSKAGV A      ++ I  DD+EVKLG+LEAEL+EINANNDKLQRS+NE
Sbjct  74    ARKIRFFRDQMSKAGVPAKEMQGKENDIDLDDVEVKLGELEAELVEINANNDKLQRSYNE  133

Query  2381  LVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTSKQVRLG  2202
             L+EYKLVLQK GEFF SA  SA  QQ+E  S Q+GE+ LE+PLL E + S D++KQV+LG
Sbjct  134   LMEYKLVLQKAGEFFSSAHRSAADQQRETESQQAGEDLLESPLLQE-EKSIDSTKQVKLG  192

Query  2201  FISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSGERA  2022
             F++GLVP+EKSM FERILFRATRGN+ +RQ+ ++E VIDP SGEK EKNVF+VFYSGERA
Sbjct  193   FLTGLVPREKSMVFERILFRATRGNIFIRQTVIEEPVIDPNSGEKAEKNVFVVFYSGERA  252

Query  2021  KNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSIAEQ  1842
             K+KILKIC+AFGANRYPF+E+LG+QAQ+ITEVSG++SELKT IDAG+  R  LLQ+I ++
Sbjct  253   KSKILKICEAFGANRYPFSEDLGRQAQMITEVSGRLSELKTTIDAGLGQRNILLQTIGDK  312

Query  1841  FDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNSEIG  1662
             F+ WN+ VR+EK+IYHTLNMLS+DVTKKCLVAEGWSP  A+ EIQDALQRA  DSNS++G
Sbjct  313   FELWNLKVRKEKAIYHTLNMLSLDVTKKCLVAEGWSPVFASREIQDALQRAAVDSNSQVG  372

Query  1661  AIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGD  1482
             +IF+VL T+ESPPTYF+TNKFTSA QEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGD
Sbjct  373   SIFQVLRTKESPPTYFRTNKFTSAIQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGD  432

Query  1481  WGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEFFSV  1302
             WGHGIC+LLAT+Y +++EKKL+SQKLGDI EM FGGRYVILMM+LFSIYTG IYNEFFS+
Sbjct  433   WGHGICILLATMYLILKEKKLASQKLGDIMEMAFGGRYVILMMSLFSIYTGLIYNEFFSI  492

Query  1301  QFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKLSIL  1122
              F LF  SAY CRD SCS+ATTIGLIK RDTY FG+DP WHG+RSELPFLNSLKMK+SIL
Sbjct  493   PFPLFAPSAYDCRDVSCSEATTIGLIKVRDTYPFGLDPVWHGSRSELPFLNSLKMKMSIL  552

Query  1121  LGVAQMNLGIILSYFNAHYFRSG--------------------VNKWC--QFIPQIIFLN  1008
             LGV+QMNLGII+SYFNA +F+S                     + + C  QFIPQ+IFLN
Sbjct  553   LGVSQMNLGIIMSYFNARFFKSSRALSLSSSLNSKNQSSSQHLILRACRFQFIPQMIFLN  612

Query  1007  ALFGYLSVLIIVKWCTGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvs  828
             +LFGYLSVLII+KWCTGSQADLYHVMIYMFL P ++LGENQLFP QKT QLVL+ LALVS
Sbjct  613   SLFGYLSVLIIIKWCTGSQADLYHVMIYMFLSPMDELGENQLFPHQKTLQLVLLFLALVS  672

Query  827   VPWMLLPKPFILKSQHN-RHQGQSYAPIQDLDESL-LvdgshdssdheefefsevfvHQL  654
             VP MLLPKPFILK QH  RHQGQ+YAP+ + DESL +      S  HEEFEFSE+FVHQL
Sbjct  673   VPCMLLPKPFILKKQHEARHQGQAYAPLDETDESLHVETNGGGSHGHEEFEFSEIFVHQL  732

Query  653   IHTIEFVLGAVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiF  474
             IHTIEFVLGAVSNTASYLRLWALSLAHSELS+VFYEKVLLLAWGYNN +IL+VG ++FIF
Sbjct  733   IHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYEKVLLLAWGYNNPLILIVGVLVFIF  792

Query  473   ATIGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             AT+GVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKF PF+F+    E++
Sbjct  793   ATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFAPFTFIFTANEDE  843



>gb|AAL78104.1|AC093568_14 Putative proton pump [Oryza sativa]
Length=783

 Score =  1174 bits (3037),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 601/818 (73%), Positives = 690/818 (84%), Gaps = 41/818 (5%)
 Frame = -2

Query  2765  GRGGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAA  2586
             G GGC P MDL RSE MQLVQ+IIP ESA L+V+YLGDLGL+QFKDLNA+KSPFQRTYA+
Sbjct  4     GGGGCCPSMDLMRSEAMQLVQVIIPAESAHLAVSYLGDLGLLQFKDLNADKSPFQRTYAS  63

Query  2585  QIKRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANND  2406
             QIKR GEMARKLRFF++QMSKA + A++   +  +++ DDLEVKLG+LE EL E+NANND
Sbjct  64    QIKRCGEMARKLRFFREQMSKAAI-ATSTQFSGTSLEIDDLEVKLGELEVELTEVNANND  122

Query  2405  KLQRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSAD  2226
             KLQR++NELVEY +VLQK                                     +M  D
Sbjct  123   KLQRTYNELVEYNIVLQK-------------------------------------EMVTD  145

Query  2225  TSKQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFL  2046
              SKQV+LG +SGLVPKEK+MAFERILFRATRGN+ LRQ  VDE+V DP+SGEKV KN F+
Sbjct  146   PSKQVKLGSLSGLVPKEKAMAFERILFRATRGNMFLRQEPVDETVTDPLSGEKVIKNAFV  205

Query  2045  VFYSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGN  1866
             +FYSGERAK+KI+KICDAFGANRYPF E+LGKQ Q I EVSGKISELK  I+ G+ HR +
Sbjct  206   IFYSGERAKSKIVKICDAFGANRYPFPEDLGKQLQTIQEVSGKISELKATIEIGLAHRDS  265

Query  1865  LLQSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAG  1686
             +L++I+ +F++WN LV++EK+IYHTLNMLS+DVTKKCLVAEGWSP  AT +IQDALQRA 
Sbjct  266   ILKNISSEFEQWNTLVKKEKAIYHTLNMLSLDVTKKCLVAEGWSPVFATSQIQDALQRAT  325

Query  1685  HDSNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPF  1506
              DS S++G+IF+VL T+ESPPT+F+TNKFTSAFQEIVDAYG+AKYQEANPGVFTIVTFPF
Sbjct  326   VDSKSQVGSIFQVLNTQESPPTFFQTNKFTSAFQEIVDAYGIAKYQEANPGVFTIVTFPF  385

Query  1505  LFAVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGF  1326
             LFA+MFGDWGHGICLLLATLY +IREKKL+SQKL DI +M FGGRYVILMM+LFSIYTG 
Sbjct  386   LFAIMFGDWGHGICLLLATLYLIIREKKLASQKLDDIMDMMFGGRYVILMMSLFSIYTGL  445

Query  1325  IYNEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNS  1146
             IYNEFFSV FELFG+SAY CRDPSC DATT GLIK R  Y+FGVDP WHG+RSELPFLNS
Sbjct  446   IYNEFFSVPFELFGKSAYACRDPSCGDATTEGLIKVRPAYSFGVDPVWHGSRSELPFLNS  505

Query  1145  LKMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKW  966
             LKMKLSIL+GVAQMNLGI++SYFNA +FR+ +N W QFIPQ+IFLN+LFGYLS+LII+KW
Sbjct  506   LKMKLSILIGVAQMNLGIMMSYFNAKFFRNAINVWYQFIPQLIFLNSLFGYLSLLIIIKW  565

Query  965   CTGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKS  786
             CTGS+ADLYHVMIYMFL PT+DLGEN+LFPGQK  QLVL+LLALVSVPWML+PKPF LK 
Sbjct  566   CTGSKADLYHVMIYMFLSPTDDLGENELFPGQKLVQLVLLLLALVSVPWMLIPKPFFLKK  625

Query  785   QH-NRHQGQSYAPIQDLDESL--LvdgshdssdheefefsevfvHQLIHTIEFVLGAVSN  615
             QH  RHQGQ Y  +Q  DES+  L +   D   HEEFEFSEVFVHQLIHTIEFVLGAVSN
Sbjct  626   QHEQRHQGQQYTMLQATDESVTELEEHQDDPHHHEEFEFSEVFVHQLIHTIEFVLGAVSN  685

Query  614   TASYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLS  435
             TASYLRLWALSLAHSELSTVFYEKVL+L+WGYNNI IL++G +IF+FATIGVLLVMETLS
Sbjct  686   TASYLRLWALSLAHSELSTVFYEKVLVLSWGYNNIFILIIGAVIFLFATIGVLLVMETLS  745

Query  434   AFLHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             AFLHALRLHWVEFQNKFYEGDGYKF PF+F  + EEED
Sbjct  746   AFLHALRLHWVEFQNKFYEGDGYKFVPFAFASIIEEED  783



>ref|XP_002468170.1| hypothetical protein SORBIDRAFT_01g040970 [Sorghum bicolor]
 gb|EER95168.1| hypothetical protein SORBIDRAFT_01g040970 [Sorghum bicolor]
Length=822

 Score =  1174 bits (3036),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 620/820 (76%), Positives = 711/820 (87%), Gaps = 5/820 (1%)
 Frame = -2

Query  2768  GGRGGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYA  2589
             GG GGC P MDL RSE MQLVQ+IIP ESA L+V+YLGDLGL+QFKDLNAEKSPFQRTYA
Sbjct  4     GGGGGCCPQMDLMRSEAMQLVQVIIPAESAHLTVSYLGDLGLLQFKDLNAEKSPFQRTYA  63

Query  2588  AQIKRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANN  2409
             AQIKR  EMARKLRFFK+QMSKA ++ S     +  + FDDLE+KLG+LEAEL E+NANN
Sbjct  64    AQIKRCSEMARKLRFFKEQMSKADITTSPTQLNETHLDFDDLEIKLGELEAELTEVNANN  123

Query  2408  DKLQRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSA  2229
             +KLQR++NEL+EY  VLQK G+FF+SA+ +A AQQ+E  ++QSG+ SLE+PLL + +MS 
Sbjct  124   EKLQRTYNELLEYHTVLQKAGDFFYSAQRTAAAQQREMEANQSGQTSLESPLLEQ-EMSN  182

Query  2228  DTSKQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVF  2049
             D SKQV+LG +SGLVPKEK+MAFERILFRATRGN+ LRQ  VDE V DP+SGEKV KN F
Sbjct  183   DPSKQVKLGSLSGLVPKEKAMAFERILFRATRGNIFLRQEPVDEPVTDPVSGEKVTKNAF  242

Query  2048  LVFYSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRG  1869
             ++FYSGERAK KILKICDAF ANRYPF E++ KQ   + EVSGKISELK  ID G+ HR 
Sbjct  243   VIFYSGERAKTKILKICDAFNANRYPFPEDVSKQLHAVQEVSGKISELKATIDMGLAHRD  302

Query  1868  NLLQSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRA  1689
             ++L++IA  F++WN L ++EK+IYHTLNMLS+DVTKKCLVAEGWSP  A+++IQDALQRA
Sbjct  303   SILKNIASDFEQWNHLAKKEKAIYHTLNMLSVDVTKKCLVAEGWSPVFASVQIQDALQRA  362

Query  1688  GHDSNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFP  1509
               DS S++G+IF+VL T+ESPPTYF+TNKFT+AFQEIVDAYGVAKYQEANPGVFTIVTFP
Sbjct  363   TVDSKSQVGSIFQVLNTKESPPTYFQTNKFTTAFQEIVDAYGVAKYQEANPGVFTIVTFP  422

Query  1508  FLFAVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTG  1329
             FLFAVMFGDWGHGICLLLATLY +IREKKL+SQKLGDI EM FGGRYVI+MMA+FSIYTG
Sbjct  423   FLFAVMFGDWGHGICLLLATLYLIIREKKLASQKLGDIMEMMFGGRYVIMMMAVFSIYTG  482

Query  1328  FIYNEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLN  1149
              IYNEFFSV FELFG+SAY CRDPSCSDATT GLIK RD Y FGVDP WHG+RSELPFLN
Sbjct  483   LIYNEFFSVPFELFGKSAYECRDPSCSDATTDGLIKVRDAYPFGVDPVWHGSRSELPFLN  542

Query  1148  SLKMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVK  969
             SLKMK+SILLGVAQMNLGI++SYFNA +FR+ +N W QFIPQ+IFLN+LFGYLS+LII+K
Sbjct  543   SLKMKMSILLGVAQMNLGIVISYFNAKFFRNSLNVWYQFIPQLIFLNSLFGYLSLLIIIK  602

Query  968   WCTGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILK  789
             WCTGS+ADLYHVMIYMFL PT++LGENQLF GQKT QLVL+LLALVSVPWML+PKP +LK
Sbjct  603   WCTGSKADLYHVMIYMFLSPTDELGENQLFSGQKTVQLVLLLLALVSVPWMLIPKPLLLK  662

Query  788   S-QHNRHQGQSYAPIQDLDESL---LvdgshdssdheefefsevfvHQLIHTIEFVLGAV  621
                  RHQG  YA +Q  DES+   L +   D+ DHEEFEFSEVFVHQLIHTIEFVLGAV
Sbjct  663   KQHQQRHQGHQYAMLQGTDESVGAELGEHHEDAHDHEEFEFSEVFVHQLIHTIEFVLGAV  722

Query  620   SNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMET  441
             SNTASYLRLWALSLAHSELSTVFY+KVLL A G NNI  L++G I+F+FAT+GVLLVMET
Sbjct  723   SNTASYLRLWALSLAHSELSTVFYDKVLLTALGLNNIFALIIGGIVFVFATVGVLLVMET  782

Query  440   LSAFLHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             LSAFLHALRLHWVEFQNKFYEGDGYKF PFSF L+ EEED
Sbjct  783   LSAFLHALRLHWVEFQNKFYEGDGYKFAPFSFALIREEED  822



>dbj|BAJ89139.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=821

 Score =  1172 bits (3033),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 604/817 (74%), Positives = 704/817 (86%), Gaps = 5/817 (1%)
 Frame = -2

Query  2759  GGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQI  2580
             GGC P MDL RSE MQL+Q+IIP ESA L+V++LGDLGLIQFKDLNA+KSPFQRTYAAQI
Sbjct  6     GGCCPSMDLMRSEAMQLLQVIIPTESAHLAVSHLGDLGLIQFKDLNADKSPFQRTYAAQI  65

Query  2579  KRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKL  2400
             KR  EM+RKLRFFK+QMSKAG+       T+  + FDD+EVKLG+LEAEL E+NAN++KL
Sbjct  66    KRCAEMSRKLRFFKEQMSKAGIQVPPMQSTETPLDFDDMEVKLGELEAELTEVNANDEKL  125

Query  2399  QRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTS  2220
             QR+ NEL+EY  VLQK GEFF+SA+ SA AQ ++  ++QSGE SLE+PLL + DM  D S
Sbjct  126   QRAHNELLEYSTVLQKAGEFFYSAQRSAAAQHRQMEANQSGETSLESPLLEQ-DMLTDAS  184

Query  2219  KQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVF  2040
             KQV+LG +SGLVPKEK+MAFERILFR+TRGN+LLRQ  VDE V DP SGEKV KN F+VF
Sbjct  185   KQVKLGSLSGLVPKEKAMAFERILFRSTRGNILLRQESVDEPVTDPQSGEKVSKNTFVVF  244

Query  2039  YSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLL  1860
             YSGERAK KILKICDAF ANRYPF E+L KQ   + EV+GKISELK  ID G+ HR ++L
Sbjct  245   YSGERAKAKILKICDAFRANRYPFPEDLAKQTHTVQEVAGKISELKATIDMGLAHRDSIL  304

Query  1859  QSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHD  1680
             ++IA +F+ WN L ++EKSIYHTLNMLS+DVTKKCLV EGWSP  AT ++QDALQRA  +
Sbjct  305   KTIASEFEHWNHLAKKEKSIYHTLNMLSVDVTKKCLVGEGWSPVFATNQVQDALQRATLE  364

Query  1679  SNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLF  1500
             S S++G+IF+VL T+ESPPTYF+TNKFTSAFQEIVDAYGVAKYQEANPGV+TI+TFPFLF
Sbjct  365   SKSQVGSIFQVLNTKESPPTYFQTNKFTSAFQEIVDAYGVAKYQEANPGVYTIITFPFLF  424

Query  1499  AVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIY  1320
             AVMFGDWGHGIC+LLATLY +IREKK +SQKLGDI EM FGGRY+I+MM++FSIYTG IY
Sbjct  425   AVMFGDWGHGICILLATLYLIIREKKFASQKLGDIMEMMFGGRYIIMMMSIFSIYTGLIY  484

Query  1319  NEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLK  1140
             NEFFSV FELF +SAY CRD SCSD+TT GLIK RDTY FGVDP WHG+RSELPFLNSLK
Sbjct  485   NEFFSVPFELFAKSAYACRDSSCSDSTTEGLIKVRDTYPFGVDPVWHGSRSELPFLNSLK  544

Query  1139  MKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCT  960
             MK+SILLGV+QMNLGI +SYFNA +FR+ VN W QF+PQ+IFLN+LFGYLS+LII+KWCT
Sbjct  545   MKMSILLGVSQMNLGIFMSYFNAKFFRNSVNVWYQFVPQLIFLNSLFGYLSMLIIIKWCT  604

Query  959   GSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQH  780
             GS+ADLYHVMIYMFL PT+++GENQLFPGQKT Q VL+LLALVSVPWML+PKPF LK +H
Sbjct  605   GSKADLYHVMIYMFLSPTDEMGENQLFPGQKTVQQVLLLLALVSVPWMLIPKPFFLKWEH  664

Query  779   N-RHQGQSYAPIQDLDESL---LvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNT  612
               RHQG  YA ++  DES+   L D + + + HEEFEFSE+FVHQLIHTIEFVLGAVSNT
Sbjct  665   ERRHQGHQYAMLEGADESVIAELGDHNEEPNHHEEFEFSEIFVHQLIHTIEFVLGAVSNT  724

Query  611   ASYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSA  432
             ASYLRLWALSLAHSELSTVFY+KVL+L  GYNNI+IL +G ++FI AT+GVLLVMETLSA
Sbjct  725   ASYLRLWALSLAHSELSTVFYDKVLILTLGYNNILILAIGVVVFICATVGVLLVMETLSA  784

Query  431   FLHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             FLHALRLHWVEFQNKFYEGDGYKF PFSF L+ E+E+
Sbjct  785   FLHALRLHWVEFQNKFYEGDGYKFAPFSFALISEDEE  821



>ref|XP_004291813.1| PREDICTED: vacuolar proton ATPase a3-like [Fragaria vesca subsp. 
vesca]
Length=812

 Score =  1172 bits (3031),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 611/816 (75%), Positives = 707/816 (87%), Gaps = 14/816 (2%)
 Frame = -2

Query  2741  MDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSGEM  2562
             MDLFRSEPMQLV LIIPI+S+R +++YLG+LGL QFKDLNAEKSPFQRTYAAQIKR GEM
Sbjct  1     MDLFRSEPMQLVHLIIPIDSSRRAISYLGELGLFQFKDLNAEKSPFQRTYAAQIKRCGEM  60

Query  2561  ARKLRFFKDQMSKAGV-SASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSFN  2385
             AR+LRFF+DQM KAG+ S S  S   +    D LEVKLG+LE +L+E+NANN++LQR++N
Sbjct  61    ARRLRFFRDQMRKAGLLSQSTMSTMSNETDLDSLEVKLGELEGDLLEMNANNEQLQRTYN  120

Query  2384  ELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTSKQVRL  2205
             EL+EYKLVLQK GEFF SA+S A AQQ+E      GE S+++PLL E +M+ D SK V+L
Sbjct  121   ELLEYKLVLQKAGEFFSSAQSIAAAQQREIEVQPMGERSMDSPLLLEQEMTTDPSKHVKL  180

Query  2204  GFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSGER  2025
             G +SGLVP+EKSMAFERILFRATRGNV L+QS V+ +V+DP+SGEKVEKNVF++FYSGER
Sbjct  181   GSVSGLVPREKSMAFERILFRATRGNVFLKQSVVNGAVVDPVSGEKVEKNVFIIFYSGER  240

Query  2024  AKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSIAE  1845
             AK+KILKIC+AFGANRYPF ++LGKQ Q+ITEVSGKISELK+ IDAG+LHR +LLQ+I  
Sbjct  241   AKSKILKICEAFGANRYPFTDDLGKQFQMITEVSGKISELKSTIDAGLLHRNSLLQTIGH  300

Query  1844  QFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNSEI  1665
             Q+++WN+LV++EKSIYHTLNMLSIDVTK CLVAEGW P SA+++IQ+ALQ+A +DSNS++
Sbjct  301   QYEQWNLLVKKEKSIYHTLNMLSIDVTKMCLVAEGWCPVSASLQIQNALQQATYDSNSQV  360

Query  1664  GAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMFG  1485
             GAIF+VL T+ESPPTYF+TNKFT+AFQEIVDAYGVAKYQEANPGV+TIVTFPFLFAVMFG
Sbjct  361   GAIFQVLHTKESPPTYFRTNKFTTAFQEIVDAYGVAKYQEANPGVYTIVTFPFLFAVMFG  420

Query  1484  DWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEFFS  1305
             DWGHGICLLLATLYF+I E+K S+QKLGDI EMTFGGRYVI MMALFSIYTG IYNEFFS
Sbjct  421   DWGHGICLLLATLYFIISERKFSNQKLGDIIEMTFGGRYVIFMMALFSIYTGLIYNEFFS  480

Query  1304  VQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKLSI  1125
             V FELFG SAY CRDPSC DATT+GL K RDTY FG+DP WHG+RSELPFLNSLKMK+SI
Sbjct  481   VPFELFGPSAYACRDPSCRDATTVGLTKVRDTYPFGLDPKWHGSRSELPFLNSLKMKMSI  540

Query  1124  LLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQAD  945
             LLGVAQMNLGI+LSY NA +F   +N W QF+PQ+IFLN+LFGYLS+LIIVKWCTGS+AD
Sbjct  541   LLGVAQMNLGIVLSYVNAKFFADKLNVWYQFVPQMIFLNSLFGYLSLLIIVKWCTGSKAD  600

Query  944   LYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQH-NRHQ  768
             LYHVMIYMFL P +DLGENQLF GQ   Q++L+L ALV+VPWML PKP+ LK QH  RHQ
Sbjct  601   LYHVMIYMFLSPFDDLGENQLFWGQGFLQVLLLLSALVAVPWMLFPKPYFLKKQHEERHQ  660

Query  767   GQSYA-------PIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTA  609
             GQSYA       P+ D  E       H S DHEEFEFSE+FVHQLIHTIEFVLGAVSNTA
Sbjct  661   GQSYALLLSGEDPLDDDQED-----HHKSKDHEEFEFSEIFVHQLIHTIEFVLGAVSNTA  715

Query  608   SYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAF  429
             SYLRLWALSLAHSELS+VFY+KVLLLAWGY+N+IIL++G I+FI AT GVLLVMETLSAF
Sbjct  716   SYLRLWALSLAHSELSSVFYDKVLLLAWGYDNVIILIIGIIVFISATGGVLLVMETLSAF  775

Query  428   LHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             LHALRLHWVEF NKFYEG GYKF PFSF L+  E+D
Sbjct  776   LHALRLHWVEFMNKFYEGSGYKFYPFSFALLSSEDD  811



>ref|XP_010061010.1| PREDICTED: V-type proton ATPase subunit a3-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW67909.1| hypothetical protein EUGRSUZ_F01613 [Eucalyptus grandis]
Length=819

 Score =  1170 bits (3026),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 603/814 (74%), Positives = 704/814 (86%), Gaps = 1/814 (0%)
 Frame = -2

Query  2759  GGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQI  2580
             G  +P MDL RSEPMQL QLIIPIESA  +V+YLGDLGL QFKDLNA+KSPFQRTYAAQ+
Sbjct  6     GDRWPTMDLLRSEPMQLAQLIIPIESAHRTVSYLGDLGLFQFKDLNADKSPFQRTYAAQM  65

Query  2579  KRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKL  2400
             KRSGEMARKLRF ++QM KAG+S S        +  ++LEVKLG+LEA++IE+NANN++L
Sbjct  66    KRSGEMARKLRFLREQMIKAGLSTSTRPLAGTDVDLENLEVKLGELEADIIEMNANNEQL  125

Query  2399  QRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTS  2220
             QR++ EL+EYKLVLQK GE FHS +S A  QQ+E  +   GE S+++PLL E +M  D S
Sbjct  126   QRTYAELLEYKLVLQKAGEIFHSTKSIAAVQQRELEAQSPGEGSIDSPLLLEQEMVTDPS  185

Query  2219  KQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVF  2040
             KQV+LGF+SGL+ ++KS AFERILFRATRGNV L+Q+ V+E + DP SGEKVEKNVF++F
Sbjct  186   KQVKLGFVSGLMRRDKSAAFERILFRATRGNVFLKQAIVEEPIRDPASGEKVEKNVFVIF  245

Query  2039  YSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLL  1860
             YSGERAKNKI+KIC+AF ANRYPFA+++GKQ Q+ITEVSG++SELKT ID G+LH+ +LL
Sbjct  246   YSGERAKNKIVKICEAFAANRYPFADDVGKQFQMITEVSGRLSELKTTIDVGLLHQASLL  305

Query  1859  QSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHD  1680
             Q+IA QF+ W++LV++EKSIYHTLNMLSIDVTKKCLVAEGW P SAT +IQ+ALQ+A  D
Sbjct  306   QNIAYQFEHWSLLVKKEKSIYHTLNMLSIDVTKKCLVAEGWCPVSATTQIQNALQKATLD  365

Query  1679  SNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLF  1500
              NS++GAIF VL T ESPPTYF TNKFT+AFQEI+DAYG+AKYQEANPGV+TI+TFPFLF
Sbjct  366   CNSQVGAIFHVLHTEESPPTYFCTNKFTTAFQEIIDAYGIAKYQEANPGVYTIITFPFLF  425

Query  1499  AVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIY  1320
             AVMFGDWGHGICLL+ATLYF+ REKKLS+QKLGDIT M FGGRYVI+MMALFSIYTG IY
Sbjct  426   AVMFGDWGHGICLLMATLYFIFREKKLSNQKLGDITGMIFGGRYVIMMMALFSIYTGLIY  485

Query  1319  NEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLK  1140
             NEFFSV FE+FG SAY CRD SC DA+T GLIK R TY FGVDP WHGTRSELPFLNSLK
Sbjct  486   NEFFSVPFEIFGPSAYACRDLSCRDASTQGLIKVRATYPFGVDPVWHGTRSELPFLNSLK  545

Query  1139  MKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCT  960
             MK+SILLGVAQMNLGI+LSYFNA +F + +N   QF+PQIIFLN+LFGYLS+LIIVKWCT
Sbjct  546   MKMSILLGVAQMNLGIVLSYFNARFFANDLNIRYQFVPQIIFLNSLFGYLSLLIIVKWCT  605

Query  959   GSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQH  780
             GSQADLYHVMIYMFL P EDLGENQLF GQK  Q++L+LLAL +VPWML PKPFILK QH
Sbjct  606   GSQADLYHVMIYMFLSPMEDLGENQLFFGQKFLQVILLLLALAAVPWMLFPKPFILKKQH  665

Query  779   -NRHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASY  603
               RH+GQ YA +  +D+ L +D   DS  HEEFEFSEVFVHQLIHTIEFVLGAVSNTASY
Sbjct  666   EERHKGQQYAILHSIDDPLEMDLDPDSHRHEEFEFSEVFVHQLIHTIEFVLGAVSNTASY  725

Query  602   LRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLH  423
             LRLWALSLAHSELS+VFY+KVLLLAWG+NN ++L++G ++FI AT+GVLLVMETLSAFLH
Sbjct  726   LRLWALSLAHSELSSVFYDKVLLLAWGFNNTLVLIIGIVVFISATVGVLLVMETLSAFLH  785

Query  422   ALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             ALRLHWVEFQNKFYEGDGYKF PFSF L+ EE++
Sbjct  786   ALRLHWVEFQNKFYEGDGYKFQPFSFALLSEEDE  819



>gb|KHG00114.1| Vacuolar proton translocating ATPase subunit [Gossypium arboreum]
Length=818

 Score =  1169 bits (3024),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 611/817 (75%), Positives = 707/817 (87%), Gaps = 2/817 (0%)
 Frame = -2

Query  2765  GRGGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAA  2586
             G G   P MDL RSEPMQLVQLIIPIESA  S++YLGDLG  QFKDLN+EKSPFQRTYA 
Sbjct  2     GGGTHRPTMDLLRSEPMQLVQLIIPIESAHRSISYLGDLGFFQFKDLNSEKSPFQRTYAT  61

Query  2585  QIKRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANND  2406
             QIKR GEMARKLRFFK+QM+KAG+S    S   D +  D+LEVK G+LEAEL+E+NAN++
Sbjct  62    QIKRCGEMARKLRFFKEQMTKAGLSPWTRSAMSDDVDLDNLEVKHGELEAELLEMNANHE  121

Query  2405  KLQRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSAD  2226
             KLQ S+NEL+EYKLV+QK GEFFHSA+S A A+Q+E  + Q GE S+++PLL E +M  D
Sbjct  122   KLQHSYNELIEYKLVVQKAGEFFHSAQSIAAAKQREVEAQQRGEGSIDSPLLLEQEMVTD  181

Query  2225  TSKQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFL  2046
              SKQV+LGF++GLVP+EKS+AFERILFRATRGNV L+QS ++ SV DP SGEK EKNVF+
Sbjct  182   PSKQVKLGFVTGLVPREKSLAFERILFRATRGNVFLKQSVLEGSVTDPASGEKAEKNVFV  241

Query  2045  VFYSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGN  1866
             VFYSGERA+NKI+KIC+AFGANRYPF E+L KQ Q+ITEVSG++ ELKT ID G++H+ N
Sbjct  242   VFYSGERARNKIVKICEAFGANRYPFIEDLSKQFQIITEVSGRLEELKTTIDVGLVHQTN  301

Query  1865  LLQSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAG  1686
             LLQ+IA  F++W+ LV++EKSIYHTL+MLSIDVTKKCLVAEGW P  AT +IQ+ LQRA 
Sbjct  302   LLQTIAYHFEQWSHLVKKEKSIYHTLSMLSIDVTKKCLVAEGWCPVFATNKIQNVLQRAT  361

Query  1685  HDSNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPF  1506
              DSNS+IG IF +L T+ESPPTYF+TNKF+SAFQEIVDAYG+AKYQEANPGVFTI+TFPF
Sbjct  362   VDSNSQIGTIFHILQTKESPPTYFQTNKFSSAFQEIVDAYGIAKYQEANPGVFTIITFPF  421

Query  1505  LFAVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGF  1326
             LFAVMFGDWGHGICL LAT YF+I+EKK SSQKLGDITEM FGGRYVI+MMALFSIYTG 
Sbjct  422   LFAVMFGDWGHGICLFLATSYFIIKEKKFSSQKLGDITEMIFGGRYVIMMMALFSIYTGL  481

Query  1325  IYNEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNS  1146
             IYNEFFSV FELFG SAY CRDP+C DA+T GL+K R TY FGVDP WHGTRSELPFLNS
Sbjct  482   IYNEFFSVPFELFGPSAYGCRDPACRDASTAGLVKVRATYPFGVDPKWHGTRSELPFLNS  541

Query  1145  LKMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKW  966
             LKMK+SILLGVAQMNLGIILSYFNA +  + +N   QF+PQ+IFLN+LFGYLS+LI+VKW
Sbjct  542   LKMKMSILLGVAQMNLGIILSYFNAKFSGNELNIRYQFLPQMIFLNSLFGYLSLLIVVKW  601

Query  965   CTGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKS  786
             C GSQADLYHVMIYMFL PT+DLGENQLF GQK  Q+VL+L ALV+VPWML PKPF+LK 
Sbjct  602   CIGSQADLYHVMIYMFLSPTDDLGENQLFFGQKFLQIVLLLAALVAVPWMLFPKPFLLKK  661

Query  785   QH-NRHQGQSYAPIQD-LDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNT  612
             QH  RH+GQSYA +++ LDES  ++  H SS HEEFEFSE+FVHQLIHTIEFVLGAVSNT
Sbjct  662   QHEERHRGQSYALLENSLDESDEMEVRHGSSSHEEFEFSEIFVHQLIHTIEFVLGAVSNT  721

Query  611   ASYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSA  432
             ASYLRLWALSLAHSELS+VFY+KVLLLAWG+NNI IL++G  +FI AT+GVLLVMETLSA
Sbjct  722   ASYLRLWALSLAHSELSSVFYDKVLLLAWGFNNIFILIIGIFVFICATVGVLLVMETLSA  781

Query  431   FLHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             FLHALRLHWVEFQNKFYEGDGYKF PFSF  +D E++
Sbjct  782   FLHALRLHWVEFQNKFYEGDGYKFQPFSFASLDAEDE  818



>ref|XP_002510470.1| vacuolar proton atpase, putative [Ricinus communis]
 gb|EEF52657.1| vacuolar proton atpase, putative [Ricinus communis]
Length=810

 Score =  1169 bits (3023),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 603/808 (75%), Positives = 701/808 (87%), Gaps = 1/808 (0%)
 Frame = -2

Query  2741  MDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSGEM  2562
             MDL RSEPMQLVQLIIPIESA  S++YLGDLGL QFKDLNAEKSPFQRTYA QIKR  EM
Sbjct  3     MDLLRSEPMQLVQLIIPIESAHRSISYLGDLGLFQFKDLNAEKSPFQRTYATQIKRCAEM  62

Query  2561  ARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSFNE  2382
             ARKLRFF++ M+K  +  S  S     I  D+LEVKL +LEAELIEIN+NN+KL+R++NE
Sbjct  63    ARKLRFFRENMTKTSLLPSTRSARGIDINLDNLEVKLAELEAELIEINSNNEKLERTYNE  122

Query  2381  LVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTSKQVRLG  2202
             L+EYKLVLQK GE FHSA+ S   QQ+E     +GE S+++PLL E +M  D SKQV+LG
Sbjct  123   LLEYKLVLQKAGELFHSAQKSGAVQQRELDVHNNGEGSIDSPLLLEQEMVTDPSKQVKLG  182

Query  2201  FISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSGERA  2022
             +ISGLVP+EKS+AFERILFRATRGNV L+QS V+ SV+DP+SGEKVEKNVF+VFYSGERA
Sbjct  183   YISGLVPREKSIAFERILFRATRGNVFLKQSVVENSVVDPVSGEKVEKNVFVVFYSGERA  242

Query  2021  KNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSIAEQ  1842
             KNKILKIC+AFGANRYPF E+L KQ Q++TEVSG+++ELKT IDAG  HR NLLQ+I  +
Sbjct  243   KNKILKICEAFGANRYPFNEDLSKQYQMMTEVSGRLTELKTTIDAGSAHRSNLLQTIGFE  302

Query  1841  FDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNSEIG  1662
              ++WN+LV++EKSIYHTLNMLS+DVTKKC+VAEGW P  A+ +I++ L++A  DSNS+IG
Sbjct  303   LEQWNLLVKKEKSIYHTLNMLSMDVTKKCVVAEGWCPVFASDQIRNTLRQATVDSNSQIG  362

Query  1661  AIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGD  1482
             AIF+VL T+ESPPTYF TNKFTSAFQEIVDAYG+AKYQEANPGV+TI+TFPFLFAVMFGD
Sbjct  363   AIFQVLQTKESPPTYFLTNKFTSAFQEIVDAYGIAKYQEANPGVYTIITFPFLFAVMFGD  422

Query  1481  WGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEFFSV  1302
             WGHGICLLLATLYF+ REKKLSSQKLGDI EMTFGGRYVI+MMA+FSIYTG IYNEFFSV
Sbjct  423   WGHGICLLLATLYFITREKKLSSQKLGDIMEMTFGGRYVIMMMAIFSIYTGLIYNEFFSV  482

Query  1301  QFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKLSIL  1122
              FELFG SAY CRD SC DA T GLIK R TY FGVDP WHGTRSELPFLNSLKMK+SIL
Sbjct  483   PFELFGPSAYACRDQSCRDAYTAGLIKVRATYPFGVDPKWHGTRSELPFLNSLKMKMSIL  542

Query  1121  LGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQADL  942
             LGVAQMNLGI++SYFNA +F   +N   QF+PQ+IFLN+LFGYLS+LIIVKWCTGSQADL
Sbjct  543   LGVAQMNLGIVMSYFNAKFFGDNLNVRYQFVPQMIFLNSLFGYLSLLIIVKWCTGSQADL  602

Query  941   YHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQH-NRHQG  765
             YHVMIYMFL P +DLG+NQLF GQK  Q++L++LALV+ PWML PKP +LK QH  RHQG
Sbjct  603   YHVMIYMFLSPIDDLGDNQLFVGQKFLQILLLILALVAAPWMLFPKPLLLKKQHEERHQG  662

Query  764   QSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLRLWAL  585
             QSYA ++  ++ L ++   DS  HEEFEFSEVFVHQLIHTIEFVLGAVSNTASYLRLWAL
Sbjct  663   QSYALLESTEDPLEMEPHSDSHKHEEFEFSEVFVHQLIHTIEFVLGAVSNTASYLRLWAL  722

Query  584   SLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHALRLHW  405
             SLAHSELS+VFY+KVLLLAWG+NNI+IL++G ++F+ AT+GVLLVMETLSAFLHALRLHW
Sbjct  723   SLAHSELSSVFYDKVLLLAWGFNNIVILIIGIVVFVCATVGVLLVMETLSAFLHALRLHW  782

Query  404   VEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             VEFQNKFYEGDGYKF PFSFVL+ +E++
Sbjct  783   VEFQNKFYEGDGYKFHPFSFVLLGDEDE  810



>ref|XP_002878553.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54812.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=819

 Score =  1168 bits (3022),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 621/822 (76%), Positives = 713/822 (87%), Gaps = 4/822 (0%)
 Frame = -2

Query  2783  MAERLGGRGGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPF  2604
             MAE  GG  GC PPMDL RSEPM LVQ+I+P+ESA L+V+YLGDLGL+QFKDLN++KSPF
Sbjct  1     MAESHGG--GCCPPMDLMRSEPMHLVQVIVPMESAHLTVSYLGDLGLVQFKDLNSDKSPF  58

Query  2603  QRTYAAQIKRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIE  2424
             QRTYAAQIKR GEMARK+RFFKDQMSKAGV+     D    I  DD+EVKL +LEAEL+E
Sbjct  59    QRTYAAQIKRCGEMARKIRFFKDQMSKAGVTPKETLDKDIDIDLDDVEVKLEELEAELVE  118

Query  2423  INANNDKLQRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllse  2244
             INANNDKLQRS+NELVEYKLVL+K GEFF SA  SA AQ+ E  + Q  E+ LEAPLL E
Sbjct  119   INANNDKLQRSYNELVEYKLVLEKAGEFFASAHRSANAQRSEIETEQVNEDLLEAPLLQE  178

Query  2243  PDMSADTSKQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKV  2064
              + S D +KQV+LGF++GLVP+EKSM FERILFRATRGN+ +RQS ++ESV+DP SGEK 
Sbjct  179   -EKSVDPTKQVKLGFLTGLVPREKSMVFERILFRATRGNIFIRQSVIEESVVDPNSGEKA  237

Query  2063  EKNVFLVFYSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAG  1884
             EKNVF+VFYSGERAK+KILKIC+AFGANRYPF+E+LGKQAQ++TEVSG++SELKT I AG
Sbjct  238   EKNVFVVFYSGERAKSKILKICEAFGANRYPFSEDLGKQAQMMTEVSGRLSELKTTIGAG  297

Query  1883  ILHRGNLLQSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQD  1704
             + HR  LL++I ++F++WN+ V +EK+IYHTLNMLS+DVTKKCLV EGWSP  A  E+QD
Sbjct  298   LDHRNILLETIGDKFEQWNLKVHKEKAIYHTLNMLSLDVTKKCLVGEGWSPVFAATEVQD  357

Query  1703  ALQRAGHDSNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFT  1524
             ALQRA  DSNS++G+IF+VL T+E PPT+F+TNKFT+AFQEIVDAYGVAKYQEANP VFT
Sbjct  358   ALQRAAVDSNSQVGSIFQVLRTKEMPPTFFRTNKFTTAFQEIVDAYGVAKYQEANPSVFT  417

Query  1523  IVTFPFLFAVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALF  1344
             IVTFPFLFAVMFGDWGHGICLLLAT+Y ++REKKLSSQKLGDI EM FGGRYVI MM+LF
Sbjct  418   IVTFPFLFAVMFGDWGHGICLLLATMYLILREKKLSSQKLGDIMEMAFGGRYVIFMMSLF  477

Query  1343  SIYTGFIYNEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSE  1164
             SIYTG IYNEFFS+ + LF  SAY CRD SCS+ATTIGLIK RDTY FGVDP WHGTRSE
Sbjct  478   SIYTGLIYNEFFSIPYPLFASSAYECRDVSCSEATTIGLIKTRDTYPFGVDPVWHGTRSE  537

Query  1163  LPFLNSLKMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSV  984
             LPFLNSLKMK+SIL+GVAQMNLGII+S+FNA +F+S VN W QF+PQ+IFLN LFGYLSV
Sbjct  538   LPFLNSLKMKMSILIGVAQMNLGIIMSFFNAKFFKSAVNVWFQFVPQMIFLNCLFGYLSV  597

Query  983   LIIVKWCTGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPK  804
             LII+KWCTGSQADLYHVMIYMFL P +DLGENQLFP QK  QL  + LALVSVPWMLLPK
Sbjct  598   LIIIKWCTGSQADLYHVMIYMFLSPMDDLGENQLFPNQKKIQLTFLFLALVSVPWMLLPK  657

Query  803   PFILKSQHN-RHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLG  627
             PFILK QH  RHQG SYA + + DESL VD +     HEEFEFSE+FVHQLIHTIEFVLG
Sbjct  658   PFILKKQHEARHQGLSYAHLDETDESLQVDTNGGGHGHEEFEFSEIFVHQLIHTIEFVLG  717

Query  626   AVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVM  447
             AVSNTASYLRLWALSLAHSELS+VFYEKVLL+AWG+NN+ IL+VG ++FIFAT+GVLLVM
Sbjct  718   AVSNTASYLRLWALSLAHSELSSVFYEKVLLMAWGFNNVFILIVGILVFIFATVGVLLVM  777

Query  446   ETLSAFLHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             ETLSAFLHALRLHWVE+QNKFYEGDGYKF PF+F L   E++
Sbjct  778   ETLSAFLHALRLHWVEYQNKFYEGDGYKFAPFTFTLDGNEDE  819



>ref|NP_179736.1| vacuolar proton ATPase A2 [Arabidopsis thaliana]
 sp|Q9SJT7.1|VHAA2_ARATH RecName: Full=V-type proton ATPase subunit a2; Short=V-ATPase 
subunit a2; AltName: Full=V-type proton ATPase 95 kDa subunit 
a isoform 2; Short=V-ATPase 95 kDa isoform a2; AltName: Full=Vacuolar 
H(+)-ATPase subunit a isoform 2; AltName: Full=Vacuolar 
proton pump subunit a2; AltName: Full=Vacuolar proton 
translocating ATPase 95 kDa subunit a isoform 2 [Arabidopsis 
thaliana]
 gb|AAL11550.1|AF424556_1 At2g21410/F3K23.17 [Arabidopsis thaliana]
 gb|AAD23686.1| putative vacuolar proton-ATPase subunit [Arabidopsis thaliana]
 gb|AAM20541.1| putative vacuolar proton-ATPase subunit [Arabidopsis thaliana]
 gb|AEC07175.1| vacuolar proton ATPase A2 [Arabidopsis thaliana]
Length=821

 Score =  1168 bits (3021),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 613/808 (76%), Positives = 707/808 (88%), Gaps = 2/808 (0%)
 Frame = -2

Query  2741  MDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSGEM  2562
             MDL RSEPMQLVQ+I+P+ESA L+V+YLGDLGL+QFKDLN+EKSPFQRTYAAQIKR GEM
Sbjct  15    MDLMRSEPMQLVQVIVPMESAHLTVSYLGDLGLVQFKDLNSEKSPFQRTYAAQIKRCGEM  74

Query  2561  ARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSFNE  2382
             ARK+RFFK+QMSKAGV+     D ++ I  DD+EVKL +LEAEL+EINANNDKLQRS+NE
Sbjct  75    ARKIRFFKEQMSKAGVTPKETLDRENDIDLDDVEVKLEELEAELVEINANNDKLQRSYNE  134

Query  2381  LVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTSKQVRLG  2202
             LVEYKLVL+K GEFF SA  SA AQQ E  + Q GE+ LEAPLL E + S D +KQV+LG
Sbjct  135   LVEYKLVLEKAGEFFASAHRSATAQQSEIETEQVGEDLLEAPLLQE-EKSVDPTKQVKLG  193

Query  2201  FISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSGERA  2022
             F++GLVP+EKSM FERILFRATRGN+ +RQS ++ESV+DP SGEK EKNVF+VFYSGERA
Sbjct  194   FLTGLVPREKSMVFERILFRATRGNIFIRQSVIEESVVDPNSGEKAEKNVFVVFYSGERA  253

Query  2021  KNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSIAEQ  1842
             K+KILKIC+AFGANRYPF+E+LGKQAQ++TEVSG++SELKT I AG+  R  LL++I ++
Sbjct  254   KSKILKICEAFGANRYPFSEDLGKQAQMMTEVSGRLSELKTTIGAGLDQRNILLETIGDK  313

Query  1841  FDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNSEIG  1662
             F++WN+ +R+EK+IYHTLNMLS+DVTKKCLV EGWSP  A  EIQDAL RA  DSNS++G
Sbjct  314   FEQWNLKIRKEKAIYHTLNMLSLDVTKKCLVGEGWSPVFAATEIQDALHRAAVDSNSQVG  373

Query  1661  AIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGD  1482
             +IF+VL T+E PPT+F+TNKFT+AFQEIVDAYGVAKYQEANP VFTIVTFPFLFAVMFGD
Sbjct  374   SIFQVLRTKEMPPTFFRTNKFTTAFQEIVDAYGVAKYQEANPSVFTIVTFPFLFAVMFGD  433

Query  1481  WGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEFFSV  1302
             WGHGICLLLAT+Y ++REKKLSSQKLGDI EM FGGRYVI MM+LFSIYTG IYNEFFS+
Sbjct  434   WGHGICLLLATMYLILREKKLSSQKLGDIMEMAFGGRYVIFMMSLFSIYTGLIYNEFFSI  493

Query  1301  QFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKLSIL  1122
              + LF  SAY CRD SCS+ATTIGLIK RDTY FGVDP WHGTRSELPFLNSLKMK+SIL
Sbjct  494   PYPLFASSAYDCRDVSCSEATTIGLIKTRDTYPFGVDPVWHGTRSELPFLNSLKMKMSIL  553

Query  1121  LGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQADL  942
             +GVAQMNLGII+S+FNA +F+S VN W QF+PQ+IFLN LFGYLSVLII+KWCTGSQADL
Sbjct  554   IGVAQMNLGIIMSFFNAKFFKSAVNIWFQFVPQMIFLNCLFGYLSVLIIIKWCTGSQADL  613

Query  941   YHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQHN-RHQG  765
             YHVMIYMFL P +DLGENQLFP QK  QL  + LALVSVPWMLLPKPFILK QH  RHQG
Sbjct  614   YHVMIYMFLSPMDDLGENQLFPNQKIVQLTFLFLALVSVPWMLLPKPFILKKQHEARHQG  673

Query  764   QSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLRLWAL  585
              SYA + + DESL V+ +     HEEFEFSE+FVHQLIHTIEFVLGAVSNTASYLRLWAL
Sbjct  674   LSYAQLDETDESLQVETNGGGHGHEEFEFSEIFVHQLIHTIEFVLGAVSNTASYLRLWAL  733

Query  584   SLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHALRLHW  405
             SLAHSELS+VFYEKVLL+AWG+NN+ I +VG ++FIFAT+GVLLVMETLSAFLHALRLHW
Sbjct  734   SLAHSELSSVFYEKVLLMAWGFNNVFIWIVGILVFIFATVGVLLVMETLSAFLHALRLHW  793

Query  404   VEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             VE+QNKFYEGDGYKF PF+F LV  E++
Sbjct  794   VEYQNKFYEGDGYKFAPFTFTLVGNEDE  821



>ref|XP_011083638.1| PREDICTED: V-type proton ATPase subunit a3-like [Sesamum indicum]
Length=817

 Score =  1167 bits (3019),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 597/813 (73%), Positives = 695/813 (85%), Gaps = 3/813 (0%)
 Frame = -2

Query  2753  CFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKR  2574
             C+P MD+ RSEPMQLVQLIIPIESA  +++YLGDLGL QFKDLNAEKSPFQRTYA QIKR
Sbjct  6     CWPSMDMLRSEPMQLVQLIIPIESAHRAISYLGDLGLFQFKDLNAEKSPFQRTYATQIKR  65

Query  2573  SGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQR  2394
              GEMARKLRF +DQM + G  +S+ S     +  D+LEVKLG+ EAEL+E+N N +KLQR
Sbjct  66    CGEMARKLRFLRDQMKRTGFLSSSWSPMGTNVNLDELEVKLGEYEAELLEMNTNTEKLQR  125

Query  2393  SFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTSKQ  2214
             S+NEL+EYKLVL+K  + F+SA  +A AQ +E   +          LL + +MS++ SKQ
Sbjct  126   SYNELLEYKLVLEKASQVFYSAEHNAIAQHREVEQALGEGSIDSPLLLEQ-EMSSEPSKQ  184

Query  2213  VRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYS  2034
             V+LGF+SGLV +EKSM FERILFR+TRGNV  RQ  V+E V DP+SG+KVEKNVF+VFYS
Sbjct  185   VKLGFVSGLVAREKSMTFERILFRSTRGNVYHRQVVVEEPVTDPVSGDKVEKNVFVVFYS  244

Query  2033  GERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQS  1854
             GERAKNKILKICDAFGANRYPF +++GKQ Q+ITEVSGK+SELKT ID G LHR  LLQS
Sbjct  245   GERAKNKILKICDAFGANRYPFPDDIGKQYQMITEVSGKLSELKTTIDIGQLHRATLLQS  304

Query  1853  IAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSN  1674
             I  +F++WN+LV++EKSIYHTLNMLS+DVTKKCLV EGW PT AT +IQ+ L RA  DSN
Sbjct  305   IGYEFEQWNLLVKKEKSIYHTLNMLSLDVTKKCLVGEGWCPTFATNQIQNVLNRATVDSN  364

Query  1673  SEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAV  1494
             S++GAIF+VL T++SPPTYF+TNKFTSAFQEIVDAYGVAKYQEANPGV+TIVTFPFLFAV
Sbjct  365   SQVGAIFQVLHTKDSPPTYFRTNKFTSAFQEIVDAYGVAKYQEANPGVYTIVTFPFLFAV  424

Query  1493  MFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNE  1314
             MFGDWGHGICL LATLYF++REKKLS+QKLGDI EM FGGRYVI+MMALFSIYTG IYNE
Sbjct  425   MFGDWGHGICLFLATLYFILREKKLSNQKLGDIMEMAFGGRYVIMMMALFSIYTGLIYNE  484

Query  1313  FFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMK  1134
             FFSV FELFGRSAY CRD +C +A+T+GLIK R TY FGVDP WHGTRSELPFLNSLKMK
Sbjct  485   FFSVPFELFGRSAYDCRDSTCREASTLGLIKVRHTYPFGVDPKWHGTRSELPFLNSLKMK  544

Query  1133  LSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGS  954
             +SILLGV QMNLGIILSY+NA +FR+ +N W QF+PQ+IFLN+LFGYLS+LIIVKWCTGS
Sbjct  545   MSILLGVVQMNLGIILSYYNAKFFRNDLNVWYQFVPQMIFLNSLFGYLSLLIIVKWCTGS  604

Query  953   QADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQH-N  777
             QADLYHVMIYMFL PT+DLGENQLF GQK  Q+ L+L ALV+VPWML PKPF+LK QH  
Sbjct  605   QADLYHVMIYMFLSPTDDLGENQLFMGQKFLQIALLLAALVAVPWMLFPKPFLLKKQHEE  664

Query  776   RHQGQSYAPIQDL-DESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYL  600
             RH+GQ+YA +    D+S  ++    S  HEEFEFSEVFVHQ+IHTIEFVLGAVSNTASYL
Sbjct  665   RHRGQAYALLDSTEDDSFELEEHKGSRGHEEFEFSEVFVHQVIHTIEFVLGAVSNTASYL  724

Query  599   RLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHA  420
             RLWALSLAHSELS+VFYEKVLLLAWG+NNI IL++G ++FI AT+GVLL+METLSAFLHA
Sbjct  725   RLWALSLAHSELSSVFYEKVLLLAWGFNNIFILIIGIVVFICATVGVLLLMETLSAFLHA  784

Query  419   LRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             LRLHWVEFQ+KFYEGDGYKF PFSFV + ++E+
Sbjct  785   LRLHWVEFQSKFYEGDGYKFSPFSFVSIGDDEE  817



>ref|NP_001049572.1| Os03g0251500 [Oryza sativa Japonica Group]
 gb|ABF94992.1| V-type ATPase 116kDa subunit family protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF11486.1| Os03g0251500 [Oryza sativa Japonica Group]
 gb|EAY89276.1| hypothetical protein OsI_10776 [Oryza sativa Indica Group]
 gb|EAZ26290.1| hypothetical protein OsJ_10160 [Oryza sativa Japonica Group]
 dbj|BAG94928.1| unnamed protein product [Oryza sativa Japonica Group]
Length=820

 Score =  1166 bits (3017),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 609/810 (75%), Positives = 701/810 (87%), Gaps = 5/810 (1%)
 Frame = -2

Query  2741  MDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSGEM  2562
             MDL RSE MQLVQ+IIP ESA L+V+YLG+LGL+Q KDLNA+KSPFQRTYAAQIKR GEM
Sbjct  13    MDLMRSEAMQLVQVIIPTESAHLTVSYLGELGLLQLKDLNADKSPFQRTYAAQIKRCGEM  72

Query  2561  ARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSFNE  2382
             ARKLRFFK+QMSKAG+S SA   T+ ++ FDDLE+KLG+LEAEL E+NANN+KL+R++NE
Sbjct  73    ARKLRFFKEQMSKAGISTSAQL-TEISLDFDDLEIKLGELEAELAEVNANNEKLKRTYNE  131

Query  2381  LVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTSKQVRLG  2202
             L+EY  VLQK GEFF+SA+ SA AQQ+E  ++QSGE SLE+PLL + D   D SKQV+LG
Sbjct  132   LLEYSTVLQKAGEFFYSAQRSAAAQQREMEANQSGESSLESPLLEQ-DTLTDASKQVKLG  190

Query  2201  FISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSGERA  2022
              +SGLVPKEK+MAFERILFRATRGN+ LRQ  VDE V DP+SGEKV KN F++FYSG+RA
Sbjct  191   SLSGLVPKEKAMAFERILFRATRGNIFLRQESVDEPVTDPVSGEKVAKNAFVIFYSGDRA  250

Query  2021  KNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSIAEQ  1842
             K KILKICDAF ANRYPF E++ +Q   + EVS KISELK  ID G+ HR N+L++IA +
Sbjct  251   KAKILKICDAFNANRYPFPEDVARQLHAVQEVSAKISELKATIDMGLAHRDNILKNIASE  310

Query  1841  FDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNSEIG  1662
             F+ WN L  +EK IYHTLNMLS+DVTKKCLV EGWSP  AT +IQDALQRA  DS S++G
Sbjct  311   FENWNRLANKEKIIYHTLNMLSVDVTKKCLVGEGWSPVFATTQIQDALQRATLDSKSQVG  370

Query  1661  AIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGD  1482
             +IF+VL T ESPPTYF+TNKFTSAFQEIVDAYG+AKYQEANPGVFTIVTFPFLFAVMFGD
Sbjct  371   SIFQVLNTTESPPTYFQTNKFTSAFQEIVDAYGIAKYQEANPGVFTIVTFPFLFAVMFGD  430

Query  1481  WGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEFFSV  1302
             WGHGIC+L++TLY +IREKK +SQKLGDI EM FGGRYVI+MMALFSIYTG IYNEFFSV
Sbjct  431   WGHGICILVSTLYLIIREKKFASQKLGDIMEMMFGGRYVIIMMALFSIYTGLIYNEFFSV  490

Query  1301  QFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKLSIL  1122
              FELFG+SAY CRDPSC DA T GL+K R TY FGVDP WHG+RSELPFLNSLKMK+SIL
Sbjct  491   PFELFGKSAYACRDPSCGDAATEGLLKVRRTYPFGVDPVWHGSRSELPFLNSLKMKMSIL  550

Query  1121  LGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQADL  942
             LGVAQMNLGI++SYFNA +FR+ VN W QFIPQ+IFLN+LFGYLS+LII+KW TG++ADL
Sbjct  551   LGVAQMNLGIVISYFNAKFFRNSVNVWYQFIPQLIFLNSLFGYLSMLIIIKWSTGAKADL  610

Query  941   YHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQHN-RHQG  765
             YH MIYMFL PT++LGENQLFPGQKT QLVL+LLALVSVPWML+PKPF LK +H  RHQG
Sbjct  611   YHTMIYMFLSPTDELGENQLFPGQKTVQLVLLLLALVSVPWMLIPKPFFLKMEHERRHQG  670

Query  764   QSYAPIQDLDESLLvdg--shdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLRLW  591
             Q YA +Q  D+S++ +    + S+ HEEFEFSEVFVHQLIHTIEFVLGAVSNTASYLRLW
Sbjct  671   QQYAMLQSTDDSVVAEMGHHNGSNHHEEFEFSEVFVHQLIHTIEFVLGAVSNTASYLRLW  730

Query  590   ALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHALRL  411
             ALSLAHSELS+VFY+KVLLLA+GYNNI+I + G  IFI AT+GVLLVMETLSAFLHALRL
Sbjct  731   ALSLAHSELSSVFYDKVLLLAFGYNNILIRIAGITIFICATVGVLLVMETLSAFLHALRL  790

Query  410   HWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             HWVEFQNKFYEGDGYKF PFSF L+ EEED
Sbjct  791   HWVEFQNKFYEGDGYKFAPFSFALISEEED  820



>ref|XP_004290287.1| PREDICTED: vacuolar proton ATPase a3-like [Fragaria vesca subsp. 
vesca]
Length=812

 Score =  1166 bits (3016),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 608/814 (75%), Positives = 709/814 (87%), Gaps = 4/814 (0%)
 Frame = -2

Query  2759  GGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQI  2580
             GGC PPMDLFRSEPMQLVQ+IIPIESA L+V+YLGDLGL+QFKDLN EKSPFQRTYA QI
Sbjct  2     GGCCPPMDLFRSEPMQLVQIIIPIESAHLTVSYLGDLGLLQFKDLNTEKSPFQRTYATQI  61

Query  2579  KRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKL  2400
             KRSGEMARKLRFFKDQM K+G+     +   D +  DDLEVKLG+LEAELIEINAN++KL
Sbjct  62    KRSGEMARKLRFFKDQMLKSGLPPPKATRQAD-LNLDDLEVKLGELEAELIEINANSEKL  120

Query  2399  QRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTS  2220
             QRS+NELVEYKLVLQK GEFFHSA SSA  QQ+E       +      L    + S D S
Sbjct  121   QRSYNELVEYKLVLQKAGEFFHSAESSARLQQREESRHIGDDALDTPLLDQ--ESSTDPS  178

Query  2219  KQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVF  2040
             KQV+LGF++GLVP+ K +AFERILFRATRGNV LRQ+ V+  V DP++GEK+EKNVF+VF
Sbjct  179   KQVKLGFLTGLVPRGKCLAFERILFRATRGNVFLRQAVVENPVTDPVTGEKIEKNVFVVF  238

Query  2039  YSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLL  1860
             YSGERAKNKILKICDAFGANRYPF E+L KQAQ I EV GK+SELKT ID G+LHRG+LL
Sbjct  239   YSGERAKNKILKICDAFGANRYPFTEDLSKQAQTINEVMGKLSELKTTIDIGVLHRGSLL  298

Query  1859  QSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHD  1680
             Q+I E +++WN LV++EK+I+HTLNMLS+DVTKKCLV EGWSP  A+ +IQ+ALQRA  D
Sbjct  299   QTIGEHYEQWNHLVKKEKAIHHTLNMLSLDVTKKCLVGEGWSPIFASKQIQEALQRAAFD  358

Query  1679  SNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLF  1500
             SNS++GAIF+VL T E+PPTYF+TNKFTS+FQEIVDAYGVAKYQEANP V+TI+TFPFLF
Sbjct  359   SNSQVGAIFQVLHTTEAPPTYFRTNKFTSSFQEIVDAYGVAKYQEANPAVYTIITFPFLF  418

Query  1499  AVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIY  1320
             AVMFGDWGHG+CLLLATLY ++RE+K S++KLGDI EM FGGRYVIL+M++FSIYTGFIY
Sbjct  419   AVMFGDWGHGLCLLLATLYLIVRERKFSNEKLGDIMEMAFGGRYVILLMSIFSIYTGFIY  478

Query  1319  NEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLK  1140
             NEFFSV FELFGRSAY CRD SC DATT GLIK   TY FG+DP WHG+RSELPFLNSLK
Sbjct  479   NEFFSVPFELFGRSAYACRDLSCRDATTAGLIKVGPTYPFGLDPVWHGSRSELPFLNSLK  538

Query  1139  MKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCT  960
             MK+SILLGV QMNLGI++SYFNA +F++G+N W QFIPQ+IFLN+LFGYLSVLI++KW T
Sbjct  539   MKMSILLGVVQMNLGIVISYFNAKFFQNGLNVWFQFIPQLIFLNSLFGYLSVLIVMKWWT  598

Query  959   GSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQH  780
             GS+ DLYHVMIYMFL PT++LGENQLF GQKT QLVL+ LALV+VPWML+PKPF++K QH
Sbjct  599   GSKVDLYHVMIYMFLSPTDELGENQLFSGQKTVQLVLLGLALVAVPWMLIPKPFLMKKQH  658

Query  779   N-RHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASY  603
               RHQGQSYA +++ +ESL V+ +HD   HEEFEFSEVFVHQLIHTIEFVLGAVSNTASY
Sbjct  659   EARHQGQSYALLENTEESLQVNSNHDGHGHEEFEFSEVFVHQLIHTIEFVLGAVSNTASY  718

Query  602   LRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLH  423
             LRLWALSLAHSELS+VFY+KVLL+A+G+NN +I +VG ++F+FAT+GVLL+METLSAFLH
Sbjct  719   LRLWALSLAHSELSSVFYDKVLLMAFGFNNWLIRIVGILVFVFATVGVLLLMETLSAFLH  778

Query  422   ALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             ALRLHWVEFQNKFYEGDGYKF PFSFVL D+E++
Sbjct  779   ALRLHWVEFQNKFYEGDGYKFYPFSFVLHDDEDE  812



>ref|XP_010664756.1| PREDICTED: V-type proton ATPase subunit a2-like isoform X1 [Vitis 
vinifera]
 emb|CBI19786.3| unnamed protein product [Vitis vinifera]
Length=808

 Score =  1165 bits (3014),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 605/807 (75%), Positives = 702/807 (87%), Gaps = 1/807 (0%)
 Frame = -2

Query  2741  MDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSGEM  2562
             MDL RSEPMQLVQLIIP+E+A  +++YLGDLGL QFKDLNAEKSPFQRTYA QIKR GEM
Sbjct  1     MDLLRSEPMQLVQLIIPVEAAYRTISYLGDLGLFQFKDLNAEKSPFQRTYATQIKRCGEM  60

Query  2561  ARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSFNE  2382
             ARKLRFFK+QM+KAG+S S  S  +     DDLEV+L + EAEL EI ANN+KLQR+++E
Sbjct  61    ARKLRFFKEQMTKAGLSPSTRSVARADFNLDDLEVQLAEFEAELTEIKANNEKLQRAYSE  120

Query  2381  LVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTSKQVRLG  2202
             LVEYKLVLQK GEFF+SA+++A A Q+E  +   GE S+++PLL E ++  D SKQV+LG
Sbjct  121   LVEYKLVLQKAGEFFYSAQNTAVAWQREVEAHHIGEGSIDSPLLLEQEILTDPSKQVKLG  180

Query  2201  FISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSGERA  2022
             F+SGLVP+EKSMAFERILFRATRGNV L+Q+ V++ VIDP+ GEK+EKNVF++F+SGER 
Sbjct  181   FVSGLVPREKSMAFERILFRATRGNVFLKQALVEDCVIDPVLGEKIEKNVFVIFFSGERV  240

Query  2021  KNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSIAEQ  1842
             KNKILKICDAFGANRYPF ++LGKQ Q+ITEVS ++ ELKT +DAG+LH  NLLQ+I  Q
Sbjct  241   KNKILKICDAFGANRYPFMDDLGKQYQMITEVSRRLLELKTTVDAGLLHWSNLLQTIGHQ  300

Query  1841  FDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNSEIG  1662
             F++WN LV++EKSIYHTLNMLSIDVTKKCLVAEGW P  AT +IQ+AL++A  DSNS++G
Sbjct  301   FEQWNHLVKKEKSIYHTLNMLSIDVTKKCLVAEGWCPVFATNQIQNALKQATFDSNSQLG  360

Query  1661  AIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGD  1482
             AIF+VL T+ESPPTYF+TNKFT  FQEIVDAYGVAKYQE NPGV+ I+TFPFLFAVMFGD
Sbjct  361   AIFQVLHTKESPPTYFRTNKFTLPFQEIVDAYGVAKYQEVNPGVYVIITFPFLFAVMFGD  420

Query  1481  WGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEFFSV  1302
             WGHGICLLLATLYF+++EKK SSQKLGDI EMTFGGRYVI+MMALFSIYTG IYNEFFSV
Sbjct  421   WGHGICLLLATLYFIVKEKKFSSQKLGDIMEMTFGGRYVIMMMALFSIYTGLIYNEFFSV  480

Query  1301  QFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKLSIL  1122
              FELFG SAY C DPSC  A+ +GLI+ R TY FGVDP WHG+RSELPFLNSLKMK+SIL
Sbjct  481   PFELFGPSAYECPDPSCRGASIVGLIRVRPTYPFGVDPKWHGSRSELPFLNSLKMKMSIL  540

Query  1121  LGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQADL  942
             LGVAQMNLGIIL YFNA +F + +N W QF+PQ+IFLN+LFGYLS+LIIVKWC GSQADL
Sbjct  541   LGVAQMNLGIILGYFNATFFGNNLNIWYQFVPQMIFLNSLFGYLSLLIIVKWCMGSQADL  600

Query  941   YHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQHN-RHQG  765
             YHVMIYMFL PT+DLGENQLF GQK  QLVL+LLALVS+PWML PKPF+LK QH  RHQG
Sbjct  601   YHVMIYMFLSPTDDLGENQLFVGQKMLQLVLLLLALVSIPWMLFPKPFLLKKQHQERHQG  660

Query  764   QSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLRLWAL  585
             +SY  +  +D+S  ++  HDS  H EFEFSEVFVHQLIHTIEFVLGAVSNTASYLRLWAL
Sbjct  661   RSYTLLHSIDDSPELERHHDSLGHVEFEFSEVFVHQLIHTIEFVLGAVSNTASYLRLWAL  720

Query  584   SLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHALRLHW  405
             SLAHSELS+VFYEKVLLLAWG+NN++IL +G I+FIFAT+GVLLVMETLSAFLHALRLHW
Sbjct  721   SLAHSELSSVFYEKVLLLAWGFNNVVILTIGIIVFIFATVGVLLVMETLSAFLHALRLHW  780

Query  404   VEFQNKFYEGDGYKFDPFSFVLVDEEE  324
             VEFQNKFYEGDGYKF PFSF L+ +E+
Sbjct  781   VEFQNKFYEGDGYKFYPFSFALLTDED  807



>ref|XP_010271519.1| PREDICTED: V-type proton ATPase subunit a2-like isoform X2 [Nelumbo 
nucifera]
Length=782

 Score =  1165 bits (3013),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 606/770 (79%), Positives = 695/770 (90%), Gaps = 1/770 (0%)
 Frame = -2

Query  2627  LNAEKSPFQRTYAAQIKRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLG  2448
             LNAEKSPFQRTYA QIKR GEMARKLRFFK+QM+KAG++ S    T+  I  D+LE KLG
Sbjct  13    LNAEKSPFQRTYATQIKRCGEMARKLRFFKEQMTKAGLTPSTRPLTRVDIDLDNLETKLG  72

Query  2447  DLEAELIEINANNDKLQRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgees  2268
             +LE ELIEINAN+DKLQR+++EL+EYKLVL+K GEFF+SA+SSA AQ++E  + Q GE S
Sbjct  73    ELETELIEINANSDKLQRTYSELLEYKLVLRKAGEFFYSAQSSATAQKREIDARQMGEVS  132

Query  2267  leapllsePDMSADTSKQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVI  2088
             +++PLL E +MS D SKQV+LG++SGLVP+E SMAFERILFRATRGNV LRQ+ ++E V+
Sbjct  133   IDSPLLLEQEMSIDPSKQVKLGYVSGLVPRENSMAFERILFRATRGNVFLRQAVIEEPVM  192

Query  2087  DPISGEKVEKNVFLVFYSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISE  1908
             DP+SGEKVEKNVF+VFYSGERAK KILKIC+AFGANRYPF E++GKQ Q++TEVSGKISE
Sbjct  193   DPMSGEKVEKNVFVVFYSGERAKAKILKICEAFGANRYPFTEDVGKQGQMLTEVSGKISE  252

Query  1907  LKTAIDAGILHRGNLLQSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPT  1728
             LKT ID G++HR NLL++I+ QF++W++L R+EKSIYHTLNMLS DVTKKCLVAEGWSP 
Sbjct  253   LKTTIDVGLMHRDNLLKAISYQFEQWSLLARKEKSIYHTLNMLSFDVTKKCLVAEGWSPV  312

Query  1727  SATIEIQDALQRAGHDSNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQ  1548
              A  +IQDAL+RA  DSNS++G+IF+VL T+ESPPTYF+TNKFTSAFQEIVDAYGVAKY 
Sbjct  313   FAINQIQDALKRATFDSNSQVGSIFQVLHTKESPPTYFRTNKFTSAFQEIVDAYGVAKYL  372

Query  1547  EANPGVFTIVTFPFLFAVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRY  1368
             EANPGV+TI+TFPFLFAVMFGDWGHGICLLLATL+F+IREKKLS+QKLGDITEMTFGGRY
Sbjct  373   EANPGVYTIITFPFLFAVMFGDWGHGICLLLATLFFIIREKKLSTQKLGDITEMTFGGRY  432

Query  1367  VILMMALFSIYTGFIYNEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDP  1188
             VI+MMALFSIYTG IYNEFFSV FELFGRSAY CRDPSCSD+TT+GLIK R TY FGVDP
Sbjct  433   VIMMMALFSIYTGLIYNEFFSVPFELFGRSAYACRDPSCSDSTTVGLIKVRGTYPFGVDP  492

Query  1187  AWHGTRSELPFLNSLKMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLN  1008
             AW+GTRSELPFLNSLKMK+SIL+GVAQMNLGI+LSYFNA ++ S +N W QF+PQIIFLN
Sbjct  493   AWYGTRSELPFLNSLKMKMSILIGVAQMNLGIVLSYFNAKFYGSNLNIWYQFVPQIIFLN  552

Query  1007  ALFGYLSVLIIVKWCTGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvs  828
             +LFGYLS+LIIVKWCTGSQADLYHVMIYMFL PT+DLGENQLF GQKT Q+VL+LLALV+
Sbjct  553   SLFGYLSLLIIVKWCTGSQADLYHVMIYMFLSPTDDLGENQLFAGQKTLQMVLLLLALVA  612

Query  827   VPWMLLPKPFILKSQHN-RHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLI  651
             VPWMLLPKPF+LK QH  RHQGQSYA +Q  D+S  V+  HDS  HEEFEFSEVFVHQLI
Sbjct  613   VPWMLLPKPFLLKKQHQERHQGQSYALLQSTDDSFEVEAHHDSHGHEEFEFSEVFVHQLI  672

Query  650   HTIEFVLGAVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFA  471
             HTIEFVLGAVSNTASYLRLWALSLAHSELS+VFYEKVLLLAWG+NNIIILVVG I+FI A
Sbjct  673   HTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYEKVLLLAWGFNNIIILVVGIIVFICA  732

Query  470   TIGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             T+GVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKF+PFSF L+ +E+D
Sbjct  733   TVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFNPFSFALLSDEDD  782



>gb|AAK96647.1| At2g21410/F3K23.17 [Arabidopsis thaliana]
 gb|AAM70564.1| At2g21410/F3K23.17 [Arabidopsis thaliana]
Length=821

 Score =  1164 bits (3011),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 612/808 (76%), Positives = 706/808 (87%), Gaps = 2/808 (0%)
 Frame = -2

Query  2741  MDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSGEM  2562
             MDL RSEPMQLVQ+I+P+ESA L+V+YLGDLGL+QFKDLN+EKSPFQRTYAAQIKR GEM
Sbjct  15    MDLMRSEPMQLVQVIVPMESAHLTVSYLGDLGLVQFKDLNSEKSPFQRTYAAQIKRCGEM  74

Query  2561  ARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSFNE  2382
             ARK+RFFK+QMSKAGV+     D ++ I  DD+EVKL +LEAEL+EINANNDKLQRS+NE
Sbjct  75    ARKIRFFKEQMSKAGVTPKETLDRENDIDLDDVEVKLEELEAELVEINANNDKLQRSYNE  134

Query  2381  LVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTSKQVRLG  2202
             LVEYKLVL+K GEFF SA  SA AQQ E  + Q GE+ LEAPLL E + S D +KQV+LG
Sbjct  135   LVEYKLVLEKAGEFFASAHRSATAQQSEIETEQVGEDLLEAPLLQEEE-SVDPTKQVKLG  193

Query  2201  FISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSGERA  2022
             F++GLVP+EKSM FERILFRATRGN+ +RQS ++ESV+DP SGEK EKNVF+VFYSGERA
Sbjct  194   FLTGLVPREKSMVFERILFRATRGNIFIRQSVIEESVVDPNSGEKAEKNVFVVFYSGERA  253

Query  2021  KNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSIAEQ  1842
             K+KILKIC+AFGANRYPF+E+LGKQAQ++TEVSG++SELKT I AG+  R  LL++I ++
Sbjct  254   KSKILKICEAFGANRYPFSEDLGKQAQMMTEVSGRLSELKTTIGAGLDQRNILLETIGDK  313

Query  1841  FDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNSEIG  1662
             F++WN+ +R+EK+IYHTLNMLS+DVTKKCLV EGWSP  A  EIQDAL RA  DSNS++G
Sbjct  314   FEQWNLKIRKEKAIYHTLNMLSLDVTKKCLVGEGWSPVFAATEIQDALHRAAVDSNSQVG  373

Query  1661  AIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGD  1482
             +IF+VL T+E PPT+F+TNKFT+AFQEIVDAYGVAKYQEANP VFTIVTF FLFAVMFGD
Sbjct  374   SIFQVLRTKEMPPTFFRTNKFTTAFQEIVDAYGVAKYQEANPSVFTIVTFLFLFAVMFGD  433

Query  1481  WGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEFFSV  1302
             WGHGICLLLAT+Y ++REKKLSSQKLGDI EM FGGRYVI MM+LFSIYTG IYNEFFS+
Sbjct  434   WGHGICLLLATMYLILREKKLSSQKLGDIMEMAFGGRYVIFMMSLFSIYTGLIYNEFFSI  493

Query  1301  QFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKLSIL  1122
              + LF  SAY CRD SCS+ATTIGLIK RDTY FGVDP WHGTRSELPFLNSLKMK+SIL
Sbjct  494   PYPLFASSAYDCRDVSCSEATTIGLIKTRDTYPFGVDPVWHGTRSELPFLNSLKMKMSIL  553

Query  1121  LGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQADL  942
             +GVAQMNLGII+S+FNA +F+S VN W QF+PQ+IFLN LFGYLSVLII+KWCTGSQADL
Sbjct  554   IGVAQMNLGIIMSFFNAKFFKSAVNIWFQFVPQMIFLNCLFGYLSVLIIIKWCTGSQADL  613

Query  941   YHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQHN-RHQG  765
             YHVMIYMFL P +DLGENQLFP QK  QL  + LALVSVPWMLLPKPFILK QH  RHQG
Sbjct  614   YHVMIYMFLSPMDDLGENQLFPNQKIVQLTFLFLALVSVPWMLLPKPFILKKQHEARHQG  673

Query  764   QSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLRLWAL  585
              SYA + + DESL V+ +     HEEFEFSE+FVHQLIHTIEFVLGAVSNTASYLRLWAL
Sbjct  674   LSYAQLDETDESLQVETNGGGHGHEEFEFSEIFVHQLIHTIEFVLGAVSNTASYLRLWAL  733

Query  584   SLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHALRLHW  405
             SLAHSELS+VFYEKVLL+AWG+NN+ I +VG ++FIFAT+GVLLVMETLSAFLHALRLHW
Sbjct  734   SLAHSELSSVFYEKVLLMAWGFNNVFIWIVGILVFIFATVGVLLVMETLSAFLHALRLHW  793

Query  404   VEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             VE+QNKFYEGDGYKF PF+F LV  E++
Sbjct  794   VEYQNKFYEGDGYKFAPFTFTLVGNEDE  821



>ref|XP_006828785.1| hypothetical protein AMTR_s00001p00110790 [Amborella trichopoda]
 gb|ERM96201.1| hypothetical protein AMTR_s00001p00110790 [Amborella trichopoda]
Length=819

 Score =  1161 bits (3004),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 623/815 (76%), Positives = 708/815 (87%), Gaps = 3/815 (0%)
 Frame = -2

Query  2756  GCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIK  2577
             GC PPMDLFRSEPMQLVQLIIP+ESA  +V+YLG+ GL QFKDLNAEKSPFQRTYA QIK
Sbjct  5     GCCPPMDLFRSEPMQLVQLIIPMESAHQTVSYLGETGLFQFKDLNAEKSPFQRTYANQIK  64

Query  2576  RSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQ  2397
             R GEMARKLRFFK+QMSKAG+S S  S +   I  DDLE+KLG+LEAELIE+N+NN+KLQ
Sbjct  65    RCGEMARKLRFFKEQMSKAGISPSTRSASSPDIDLDDLEIKLGELEAELIEVNSNNEKLQ  124

Query  2396  RSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgee-sleapllsePDMSADTS  2220
             R++NEL+EYKLVL+K GEFF+SAR  A AQQ+E   S    E S+++PLL E +M  D S
Sbjct  125   RTYNELMEYKLVLEKAGEFFYSARRDATAQQREIEESLQVGEGSIDSPLLLEQEMLTDPS  184

Query  2219  KQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVF  2040
             KQV+LGF+SGLVPK KSMAFERILFRATRGN+ L+QS V+  V DP+SGEKVEKNVF+VF
Sbjct  185   KQVKLGFVSGLVPKAKSMAFERILFRATRGNMYLKQSVVEGPVTDPVSGEKVEKNVFVVF  244

Query  2039  YSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLL  1860
             YSGERAK KILKIC+AFGANRYPF E+ GKQ Q+I EVSGK  +LKT ID G+ HR N+L
Sbjct  245   YSGERAKMKILKICEAFGANRYPFPEDFGKQRQMIGEVSGKTMDLKTTIDIGLRHRNNVL  304

Query  1859  QSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHD  1680
             + I+ QF++WN+LVR+EK+++HTLNMLS+DVTKKCLVAEGWSP  A  +IQ  LQRA  D
Sbjct  305   EIISYQFEQWNILVRKEKAVFHTLNMLSMDVTKKCLVAEGWSPVFAKSQIQGTLQRATRD  364

Query  1679  SNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLF  1500
             SNS++GAIF+VL T+ESPPTYF+ NKFTSAFQEIVDAYGVA+YQEANPGV+TIVTFPFLF
Sbjct  365   SNSQVGAIFQVLRTKESPPTYFRANKFTSAFQEIVDAYGVARYQEANPGVYTIVTFPFLF  424

Query  1499  AVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIY  1320
             AVMFGDWGHGICLLLA L  + +EKKLSSQKLGDI EMTFGGRYVILMM+LFSIYTG IY
Sbjct  425   AVMFGDWGHGICLLLAALILVFKEKKLSSQKLGDILEMTFGGRYVILMMSLFSIYTGLIY  484

Query  1319  NEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLK  1140
             NEFFSV F LFGRSAY CR+PSCSDA T GLIK RD Y FGVDP WHG+R+ELPFLNSLK
Sbjct  485   NEFFSVPFSLFGRSAYECREPSCSDAYTGGLIKVRDAYPFGVDPTWHGSRTELPFLNSLK  544

Query  1139  MKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCT  960
             MK+SILLGVAQMNLGI+LSYFNA +F + VN W QF+PQ+IFLN+LFGYLSVL+IVKWCT
Sbjct  545   MKMSILLGVAQMNLGIVLSYFNARFFGNYVNVWYQFVPQMIFLNSLFGYLSVLVIVKWCT  604

Query  959   GSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQH  780
             GS ADLYH+MIYMFL PT+DLGENQLF GQKT QLVL+LLALVSVPWML PKPFILK Q+
Sbjct  605   GSTADLYHIMIYMFLSPTDDLGENQLFFGQKTLQLVLLLLALVSVPWMLFPKPFILKKQY  664

Query  779   -NRHQGQSYAPIQDLD-ESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTAS  606
              +RH+G SY  I   D +S  ++  HDS  HEEFEFSEVFVHQLIHTIEFVLGAVSNTAS
Sbjct  665   DDRHRGHSYDVIPTTDPDSFEMEAGHDSHGHEEFEFSEVFVHQLIHTIEFVLGAVSNTAS  724

Query  605   YLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFL  426
             YLRLWALSLAHSELS+VFYEKVL+LAWGYNNI IL++GFI+F FATIGVLL+METLSAFL
Sbjct  725   YLRLWALSLAHSELSSVFYEKVLILAWGYNNIFILIIGFIVFAFATIGVLLIMETLSAFL  784

Query  425   HALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             HALRLHWVEFQNKFYEGDGYKF PF+F L+ EE+D
Sbjct  785   HALRLHWVEFQNKFYEGDGYKFLPFAFSLLGEEDD  819



>ref|XP_006293690.1| hypothetical protein CARUB_v10022648mg [Capsella rubella]
 gb|EOA26588.1| hypothetical protein CARUB_v10022648mg [Capsella rubella]
Length=821

 Score =  1160 bits (3001),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 615/808 (76%), Positives = 709/808 (88%), Gaps = 2/808 (0%)
 Frame = -2

Query  2741  MDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSGEM  2562
             MDL RSEPMQLVQLI+P+ESA L+V+YLGDLGL+QFKDLN++KSPFQRTYAAQIKR GEM
Sbjct  15    MDLMRSEPMQLVQLIVPMESAHLTVSYLGDLGLVQFKDLNSDKSPFQRTYAAQIKRCGEM  74

Query  2561  ARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSFNE  2382
             ARK+RFFKDQMSKAGV      D +D I  DD+EVKL +LEAEL+EINANNDKLQRS+NE
Sbjct  75    ARKIRFFKDQMSKAGVIPKDVLDKEDDIDLDDVEVKLEELEAELVEINANNDKLQRSYNE  134

Query  2381  LVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTSKQVRLG  2202
             LVEYKLVL+K GEFF SA  SA AQQ E  + Q+ ++ LEAPLL E + S D +KQV+LG
Sbjct  135   LVEYKLVLEKAGEFFASAHRSAAAQQSEIETQQADDDLLEAPLLQE-EKSVDPTKQVKLG  193

Query  2201  FISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSGERA  2022
             F++GLVP+EKSM FERILFRATRGN+ +RQS ++ESV+DP SGEK EKNVF+VFYSGERA
Sbjct  194   FLTGLVPREKSMVFERILFRATRGNIFIRQSVIEESVVDPNSGEKAEKNVFVVFYSGERA  253

Query  2021  KNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSIAEQ  1842
             K+KILKIC+AFGANRYPF+E+LG+QAQ++TEVSG++SELKT I AG+  R  LL++I ++
Sbjct  254   KSKILKICEAFGANRYPFSEDLGRQAQMMTEVSGRLSELKTTIGAGLDQRNILLETIGDK  313

Query  1841  FDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNSEIG  1662
             F++WN+ VR+EK+IYHTLNMLS+DVTKKCLV EGWSP  A  E+QDALQRA  DSNS++G
Sbjct  314   FEQWNLKVRKEKAIYHTLNMLSLDVTKKCLVGEGWSPVFAATELQDALQRAAIDSNSQVG  373

Query  1661  AIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGD  1482
             +IF++L T+E PPTYF+TNKFT+AFQEIVDAYGVAKYQEANP VFTIVTFPFLFAVMFGD
Sbjct  374   SIFQILRTKEMPPTYFRTNKFTTAFQEIVDAYGVAKYQEANPSVFTIVTFPFLFAVMFGD  433

Query  1481  WGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEFFSV  1302
             WGHGICLLLAT+Y ++REKKLSSQKLGDI EM FGGRYVI MM+LFSIYTG IYNEFFS+
Sbjct  434   WGHGICLLLATMYLILREKKLSSQKLGDIMEMAFGGRYVIFMMSLFSIYTGLIYNEFFSI  493

Query  1301  QFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKLSIL  1122
              + LF  SAY CRD SCS+ATTIGLIK RDTY FGVDP WHGTRSELPFLNSLKMK+SIL
Sbjct  494   PYPLFASSAYECRDVSCSEATTIGLIKTRDTYPFGVDPVWHGTRSELPFLNSLKMKMSIL  553

Query  1121  LGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQADL  942
             LGVAQMNLGII+S+FNA +F+S VN W QF+PQ+IFLN LFGYLSVLII+KWCTGSQADL
Sbjct  554   LGVAQMNLGIIMSFFNAKFFKSAVNVWFQFVPQMIFLNCLFGYLSVLIIIKWCTGSQADL  613

Query  941   YHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQHN-RHQG  765
             YHVMIYMFL P +DLGENQLFP QK  QL  + LALVSVPWMLLPKPFILK QH  RHQG
Sbjct  614   YHVMIYMFLSPMDDLGENQLFPNQKIVQLTFLFLALVSVPWMLLPKPFILKKQHEARHQG  673

Query  764   QSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLRLWAL  585
              SYA + + DESL V+ +     HEEFEFSE+FVHQLIHTIEFVLGAVSNTASYLRLWAL
Sbjct  674   LSYAQLDETDESLQVETNGGGHGHEEFEFSEIFVHQLIHTIEFVLGAVSNTASYLRLWAL  733

Query  584   SLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHALRLHW  405
             SLAHSELS+VFYEKVLL+AWG+NNI +L++G ++FIFAT+GVLLVMETLSAFLHALRLHW
Sbjct  734   SLAHSELSSVFYEKVLLMAWGFNNIALLILGILVFIFATVGVLLVMETLSAFLHALRLHW  793

Query  404   VEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             VE+QNKFYEGDGYKFDPF+F L+  EE+
Sbjct  794   VEYQNKFYEGDGYKFDPFNFTLIGNEEE  821



>ref|XP_008653566.1| PREDICTED: vacuolar proton ATPase a3 [Zea mays]
 tpg|DAA44411.1| TPA: hypothetical protein ZEAMMB73_955022 [Zea mays]
Length=822

 Score =  1159 bits (2998),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 614/811 (76%), Positives = 705/811 (87%), Gaps = 5/811 (1%)
 Frame = -2

Query  2741  MDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSGEM  2562
             MDL RSE MQLVQ+IIP ESA L+V+YLGDLGL+QFKDLN +KSPFQRTYAAQIKR  EM
Sbjct  13    MDLMRSEAMQLVQVIIPAESAHLTVSYLGDLGLLQFKDLNIDKSPFQRTYAAQIKRCSEM  72

Query  2561  ARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSFNE  2382
             ARKLRFFK+QMSKA ++AS        + FD+LE+KLG+LEAEL E+NANN+KLQR++NE
Sbjct  73    ARKLRFFKEQMSKADITASPTQLNGTHMDFDELEIKLGELEAELTEVNANNEKLQRTYNE  132

Query  2381  LVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTSKQVRLG  2202
             L+EY  VLQK GEFF+SA+ +A AQQ E  ++QSG+ SLE+PLL + +M+ D SKQV+LG
Sbjct  133   LLEYHTVLQKAGEFFYSAQRTAAAQQMEMEANQSGQTSLESPLLEQ-EMTTDPSKQVKLG  191

Query  2201  FISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSGERA  2022
              +SGLVPKEK+MAFERILFRATRGN+ LRQ  VDE V DP+S EKV KN F++FYSGERA
Sbjct  192   SLSGLVPKEKAMAFERILFRATRGNIFLRQEPVDEPVTDPVSREKVTKNAFVIFYSGERA  251

Query  2021  KNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSIAEQ  1842
             K KILKICDAF ANRYPF E++GKQ   + EVSGKISELKT ID G+ HR ++L++IA  
Sbjct  252   KTKILKICDAFNANRYPFPEDVGKQLHAVQEVSGKISELKTTIDMGLAHRDSILKNIASD  311

Query  1841  FDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNSEIG  1662
             F++WN LV++EK+IYHTLNMLS+DVTKKCLVAEGWSP  A+I+IQDALQRA  DS S++G
Sbjct  312   FEQWNHLVKKEKAIYHTLNMLSVDVTKKCLVAEGWSPIFASIQIQDALQRATLDSKSQVG  371

Query  1661  AIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGD  1482
             +IF+VL T+ESPPTYF+TNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGD
Sbjct  372   SIFQVLNTKESPPTYFQTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGD  431

Query  1481  WGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEFFSV  1302
             WGHGICLLLATLY +IREKKL+SQKLGDI EM FGGRYVI+MMA+FSIYTG IYNEFFSV
Sbjct  432   WGHGICLLLATLYLIIREKKLASQKLGDIMEMMFGGRYVIMMMAVFSIYTGLIYNEFFSV  491

Query  1301  QFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKLSIL  1122
              F LFG+SAY CRD SCSDATT GL+K RD Y FGVDP WHG+RSELPFLNSLKMK+SIL
Sbjct  492   PFGLFGKSAYACRDSSCSDATTEGLLKVRDAYPFGVDPVWHGSRSELPFLNSLKMKMSIL  551

Query  1121  LGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQADL  942
             LGVAQMNLGI++SYFNA +FR+ +N W QFIPQ+IFLN+LFGYLS+LII+KWCTGS+ADL
Sbjct  552   LGVAQMNLGIVISYFNAKFFRNSINVWYQFIPQLIFLNSLFGYLSLLIIIKWCTGSKADL  611

Query  941   YHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKS-QHNRHQG  765
             YHVMIYMFL PT+DL ENQLF GQKT QLVL+LLALVSVPWML+PKP +LK     RHQG
Sbjct  612   YHVMIYMFLSPTDDLSENQLFSGQKTVQLVLLLLALVSVPWMLIPKPLLLKKQHQQRHQG  671

Query  764   QSYAPIQDLDESL---LvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLRL  594
               YA +Q +DES+   L +   D+ DHEEFEF EVFVHQLIHTIEFVLGAVSNTASYLRL
Sbjct  672   HQYAMLQGIDESVGAELGEHHEDAHDHEEFEFGEVFVHQLIHTIEFVLGAVSNTASYLRL  731

Query  593   WALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHALR  414
             WALSLAHSELSTVFYEKVL+ A+G+NN+ IL++G +IFIFATIGVLLVMETLSAFLHALR
Sbjct  732   WALSLAHSELSTVFYEKVLMTAYGFNNVFILIIGVVIFIFATIGVLLVMETLSAFLHALR  791

Query  413   LHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             LHWVEFQNKFYEGDGYKF PFSF L+ EEED
Sbjct  792   LHWVEFQNKFYEGDGYKFAPFSFALIREEED  822



>ref|XP_008221327.1| PREDICTED: vacuolar proton ATPase a3-like [Prunus mume]
Length=816

 Score =  1159 bits (2997),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 620/814 (76%), Positives = 713/814 (88%), Gaps = 1/814 (0%)
 Frame = -2

Query  2759  GGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQI  2580
             G C P MDL RSEPMQL QLIIPIES+R +++YLGDLGL QFKDLNAEKSPFQRTYA QI
Sbjct  3     GECCPTMDLLRSEPMQLAQLIIPIESSRHAISYLGDLGLFQFKDLNAEKSPFQRTYATQI  62

Query  2579  KRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKL  2400
             KR GEMAR+LRFFK+QM KAG+S SA S T + I  D+LEVKLG+LEAEL+EINANN+ L
Sbjct  63    KRCGEMARRLRFFKEQMKKAGLSPSARSTTGNDIDLDNLEVKLGELEAELLEINANNEHL  122

Query  2399  QRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTS  2220
             QR+++EL+EYKLVLQK GEFF+SA+SSA AQQ+++    S E+S+++PLL E +M+ D S
Sbjct  123   QRTYSELLEYKLVLQKAGEFFNSAQSSAAAQQRQFERQHSIEKSIDSPLLLEQEMTTDPS  182

Query  2219  KQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVF  2040
             K V+LGF+SGLVP+EKSM FERILFRATRGNV L+Q+ V++ V+DP+SG+KVEKNVF++F
Sbjct  183   KHVKLGFVSGLVPREKSMTFERILFRATRGNVFLKQAVVNDPVVDPVSGDKVEKNVFIIF  242

Query  2039  YSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLL  1860
             YSGERAKNKILKIC+AFGANRYPF ++LGKQ Q+I EVSGK+SELK  IDAG+LHR +LL
Sbjct  243   YSGERAKNKILKICEAFGANRYPFTDDLGKQFQMIAEVSGKLSELKITIDAGLLHRSSLL  302

Query  1859  QSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHD  1680
             Q+I  Q + WN+LV++EKSIYHTLNMLSIDVTK CLVAEGW P  A+ +IQ+ALQRA  D
Sbjct  303   QTIGHQHELWNLLVKKEKSIYHTLNMLSIDVTKMCLVAEGWCPVDASNQIQNALQRASFD  362

Query  1679  SNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLF  1500
             S+S++G IF+VL T+ESPPTYF+TNKFTSAFQEIVDAYGVAKYQEANPGV+TIVTFPFLF
Sbjct  363   SSSQVGTIFQVLQTKESPPTYFRTNKFTSAFQEIVDAYGVAKYQEANPGVYTIVTFPFLF  422

Query  1499  AVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIY  1320
             AVMFGDWGHGICLLLATLYF+IRE+K SSQKLGDI EMTFGGRYVI+MMALFSIYTG IY
Sbjct  423   AVMFGDWGHGICLLLATLYFIIRERKFSSQKLGDIVEMTFGGRYVIMMMALFSIYTGLIY  482

Query  1319  NEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLK  1140
             NEFFSV FELFG SAY CRD SCSDATT+GL K R TY FGVDP WHG+RSELPFLNSLK
Sbjct  483   NEFFSVPFELFGPSAYGCRDQSCSDATTVGLSKVRGTYPFGVDPKWHGSRSELPFLNSLK  542

Query  1139  MKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCT  960
             MK+SILLGVAQMNLGIILSYFNA +F   +N W QF+PQIIFLN+LFGYLS+LIIVKWCT
Sbjct  543   MKMSILLGVAQMNLGIILSYFNAKFFGDNLNIWYQFVPQIIFLNSLFGYLSLLIIVKWCT  602

Query  959   GSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQH  780
             GSQADLYHVMIYMFL PTEDLGENQLF GQK  Q++L+L ALV+VPWML PKP++LK QH
Sbjct  603   GSQADLYHVMIYMFLSPTEDLGENQLFFGQKFLQILLLLSALVAVPWMLFPKPYLLKKQH  662

Query  779   -NRHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASY  603
               RHQGQSYA +   D+ L  D       HEEFEF+EVFVHQLIHTIEFVLGAVSNTASY
Sbjct  663   EERHQGQSYALLHGGDDPLEEDHHQSLHGHEEFEFTEVFVHQLIHTIEFVLGAVSNTASY  722

Query  602   LRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLH  423
             LRLWALSLAHSELS+VFY+K+LLLAWG+NN+IIL++G I+FI AT+GVLLVMETLSAFLH
Sbjct  723   LRLWALSLAHSELSSVFYDKILLLAWGFNNVIILIIGIIVFICATVGVLLVMETLSAFLH  782

Query  422   ALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             ALRLHWVEFQNKFYEG GYKF PFSF L+  E++
Sbjct  783   ALRLHWVEFQNKFYEGAGYKFYPFSFALLSGEDE  816



>ref|XP_008660336.1| PREDICTED: vacuolar proton ATPase a3-like [Zea mays]
Length=822

 Score =  1150 bits (2976),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 612/813 (75%), Positives = 708/813 (87%), Gaps = 9/813 (1%)
 Frame = -2

Query  2741  MDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFK--DLNAEKSPFQRTYAAQIKRSG  2568
             MDL RSE MQLVQ+IIP ESA L+V+YLGDLGL+QFK   LNAEKSPFQRTYAAQIKR  
Sbjct  13    MDLMRSEAMQLVQVIIPAESAHLTVSYLGDLGLLQFKRRKLNAEKSPFQRTYAAQIKRCS  72

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EMARKLRFFK+QMSKA +  +  ++T   + FDDLE+KLG+LEAEL E+NANN+KL R++
Sbjct  73    EMARKLRFFKEQMSKADIGPTQLNETH--LDFDDLEIKLGELEAELTEVNANNEKLLRTY  130

Query  2387  NELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTSKQVR  2208
             NEL+EY  VLQK G+FF+SA+ +A +QQ+E  ++QSG+ SLE+PLL + +MS D SKQV+
Sbjct  131   NELLEYHTVLQKAGDFFYSAQRTAASQQRELEANQSGQTSLESPLLEQ-EMSTDPSKQVK  189

Query  2207  LGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSGE  2028
             LG +SGLVPKEK+MAFERILFRATRGN+ LRQ  VDE V DP+SGEKV KN F++FYSGE
Sbjct  190   LGSLSGLVPKEKAMAFERILFRATRGNIFLRQEPVDEPVTDPVSGEKVTKNAFVIFYSGE  249

Query  2027  RAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSIA  1848
             RAK KILKICDAF ANRYPF E++ KQ   + EVSGKISELK  ID G+ HR ++L++IA
Sbjct  250   RAKTKILKICDAFNANRYPFPEDVSKQLHAVQEVSGKISELKATIDMGLAHRDSILKNIA  309

Query  1847  EQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNSE  1668
               F++WN LV++EK+IYHTLNMLS+DVTKKCLVAEGWSP  A+I+IQDALQRA  +S S+
Sbjct  310   SDFEQWNHLVKKEKAIYHTLNMLSVDVTKKCLVAEGWSPVFASIQIQDALQRATVNSKSQ  369

Query  1667  IGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMF  1488
             +G+IF VL T+ESPPTYF+TNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMF
Sbjct  370   VGSIFEVLNTKESPPTYFQTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMF  429

Query  1487  GDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEFF  1308
             GDWGHGICLLLATLY +IREKKL+SQKLGDI EM FGGRYVI+MMA+FSIYTG IYNEFF
Sbjct  430   GDWGHGICLLLATLYLIIREKKLASQKLGDIMEMMFGGRYVIMMMAVFSIYTGLIYNEFF  489

Query  1307  SVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKLS  1128
             SV F LFG+SAY CRD SCSDATT GLIK RD Y FGVDP WHG+RSELPFLNSLKMK+S
Sbjct  490   SVPFGLFGKSAYACRDSSCSDATTEGLIKVRDAYPFGVDPVWHGSRSELPFLNSLKMKMS  549

Query  1127  ILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQA  948
             ILLGVAQMNLGI++SYFNA +FR+ +N W QFIPQ+IFLN+LFGYLS+LII+KWCTGS+A
Sbjct  550   ILLGVAQMNLGIVISYFNAKFFRNSLNVWYQFIPQLIFLNSLFGYLSLLIIIKWCTGSKA  609

Query  947   DLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKS-QHNRH  771
             DLYHVMIYMFL PT+++GENQLF GQKT QLVL+LLALVSVPWML+PKP +LK     RH
Sbjct  610   DLYHVMIYMFLSPTDEIGENQLFSGQKTVQLVLLLLALVSVPWMLIPKPLLLKKQHQQRH  669

Query  770   QGQSYAPIQDLDESL---LvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYL  600
             QG  YA +Q +DES+   L +   ++ DHEEFEFSEVFVHQLIHTIEFVLGAVSNTASYL
Sbjct  670   QGHQYAMLQGVDESVGAELGEHHEEAHDHEEFEFSEVFVHQLIHTIEFVLGAVSNTASYL  729

Query  599   RLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHA  420
             RLWALSLAHSELSTVFY+KVLL+AWG+NN+IIL++G I+FIFAT+GVLLVMETLSAFLHA
Sbjct  730   RLWALSLAHSELSTVFYDKVLLMAWGFNNVIILIIGIIVFIFATVGVLLVMETLSAFLHA  789

Query  419   LRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             LRLHWVEFQNKFYEGDGYKF PFSF L+ EEED
Sbjct  790   LRLHWVEFQNKFYEGDGYKFAPFSFALIREEED  822



>ref|XP_003573831.1| PREDICTED: V-type proton ATPase subunit a3-like [Brachypodium 
distachyon]
Length=823

 Score =  1147 bits (2968),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 596/814 (73%), Positives = 697/814 (86%), Gaps = 4/814 (0%)
 Frame = -2

Query  2753  CFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKR  2574
             C PPMDL RSE MQLVQ+IIP ESARL V+ LGDLGL+QFKDLN +KSPFQR YAAQIKR
Sbjct  11    CCPPMDLMRSEAMQLVQVIIPAESARLVVSNLGDLGLVQFKDLNGDKSPFQRAYAAQIKR  70

Query  2573  SGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQR  2394
              GEMARKLRFFK+QM KA +   A   +   ++ DDLE+KL + EA+LIE+N NN KLQR
Sbjct  71    CGEMARKLRFFKEQMLKAAILTGATQFSGSPLEIDDLEIKLEEFEADLIEVNRNNGKLQR  130

Query  2393  SFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTSKQ  2214
             ++NELVEY ++L+ +G+FF+SA+ SA  QQ+E  + QSG+ SLE+PLL + +M  D SKQ
Sbjct  131   TYNELVEYNVLLKTIGDFFYSAQRSATRQQREMVADQSGDSSLESPLLEQ-EMVIDPSKQ  189

Query  2213  VRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYS  2034
             V+LG +SGLVPK+KSMAFERILFRATRGN+LLRQ  VDE V  P SGEKV KN F++FYS
Sbjct  190   VKLGSLSGLVPKQKSMAFERILFRATRGNMLLRQESVDEPVTHPQSGEKVVKNSFVIFYS  249

Query  2033  GERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQS  1854
             GERAK+KI+KICD+FGANRYPF E+L KQ Q I EVSGKISELK  I+ G+ HR ++L++
Sbjct  250   GERAKSKIVKICDSFGANRYPFPEDLAKQTQTIQEVSGKISELKATIEIGLAHRDSILKN  309

Query  1853  IAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSN  1674
             IA +F++W+ L+++EK+IYHTLNM S+DVTKKC VAEGWSP  AT ++QDAL RA  DSN
Sbjct  310   IAYEFEQWSNLLKKEKAIYHTLNMFSLDVTKKCFVAEGWSPVFATDQVQDALHRATTDSN  369

Query  1673  SEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAV  1494
             S++G+IF+VL T+ESPPTYF+TNKFTS+FQ+IVDAYG+AKYQEANPG+FTIVTFPFLFAV
Sbjct  370   SQVGSIFQVLNTQESPPTYFQTNKFTSSFQDIVDAYGIAKYQEANPGLFTIVTFPFLFAV  429

Query  1493  MFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNE  1314
             MFGDWGHGICLLL+ LY +IREKKL+SQKL DI E+ FGGRYVILMM+LFSIYTG IYNE
Sbjct  430   MFGDWGHGICLLLSALYLVIREKKLASQKLDDIVEIMFGGRYVILMMSLFSIYTGLIYNE  489

Query  1313  FFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMK  1134
             FFSV FELFG+SAY CRDPSC DAT+ GLIK R TY FGVDP WHG+RSELPFLNSLKMK
Sbjct  490   FFSVPFELFGKSAYACRDPSCVDATSEGLIKVRQTYPFGVDPVWHGSRSELPFLNSLKMK  549

Query  1133  LSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGS  954
             +SIL+GV+QMNLGI++S+FNA YF++ VN W QF+PQ+IFLN+LFGYLS+LII+KWCTGS
Sbjct  550   MSILIGVSQMNLGIVMSFFNAKYFKNSVNVWYQFVPQLIFLNSLFGYLSLLIIIKWCTGS  609

Query  953   QADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQH-N  777
             +ADLYHVMIYMFLGPT+D+GENQLFPGQK  Q+VL+LLALVSVPWML+PKP  LK QH  
Sbjct  610   KADLYHVMIYMFLGPTDDIGENQLFPGQKIVQIVLLLLALVSVPWMLIPKPLFLKKQHEQ  669

Query  776   RHQGQSYAPIQDLDESL--LvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASY  603
             RHQGQ Y  IQ   ES+  L     +   H+EFEFSEVFVHQLIHTIEFVLGAVSNTASY
Sbjct  670   RHQGQQYTMIQATTESVTGLQRHHENPHHHDEFEFSEVFVHQLIHTIEFVLGAVSNTASY  729

Query  602   LRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLH  423
             LRLWALSLAHSELS+VFY+KVLLLAWGYNNI ILVVG I+F+FATIGVLL METLSAFLH
Sbjct  730   LRLWALSLAHSELSSVFYDKVLLLAWGYNNITILVVGVIVFLFATIGVLLSMETLSAFLH  789

Query  422   ALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             ALRLHWVEFQNKFYEGDGYKF PF+F  + EEED
Sbjct  790   ALRLHWVEFQNKFYEGDGYKFAPFAFASIIEEED  823



>ref|XP_004152666.1| PREDICTED: vacuolar proton ATPase a3-like [Cucumis sativus]
 ref|XP_004169002.1| PREDICTED: vacuolar proton ATPase a3-like [Cucumis sativus]
 gb|KGN62648.1| hypothetical protein Csa_2G364570 [Cucumis sativus]
Length=808

 Score =  1145 bits (2963),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 603/808 (75%), Positives = 698/808 (86%), Gaps = 1/808 (0%)
 Frame = -2

Query  2741  MDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSGEM  2562
             MDL RSEPMQLVQLIIP ESAR +++YLGDLGL QF DLNA KSPFQRTYAAQIKR GEM
Sbjct  1     MDLLRSEPMQLVQLIIPNESARRTISYLGDLGLFQFNDLNASKSPFQRTYAAQIKRCGEM  60

Query  2561  ARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSFNE  2382
             ARKLRFF++QM++AG+S S+ S        D+LEVKLG+LE EL+EI  NN+KLQR+++E
Sbjct  61    ARKLRFFREQMTRAGLSPSSYSLGTHDFDLDNLEVKLGELEVELLEIKDNNEKLQRNYSE  120

Query  2381  LVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTSKQVRLG  2202
             L+EYKLVLQKVGEFFH A+ +A A Q+E    Q+GE S++ PLL E +M+ D +KQV+LG
Sbjct  121   LLEYKLVLQKVGEFFHLAQRTAAAHQRELEVQQNGEGSIDTPLLLEQEMTTDPTKQVKLG  180

Query  2201  FISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSGERA  2022
             +ISGLVP+EKSMAFERILFR+TRGNV LRQ+ +D SV DP+SG+KVEKNVF++FYSGERA
Sbjct  181   YISGLVPREKSMAFERILFRSTRGNVYLRQAVIDGSVTDPVSGDKVEKNVFVIFYSGERA  240

Query  2021  KNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSIAEQ  1842
             K KI KIC+AFGANRYPF ++LGKQ Q+ITEVS K+SELK  ID G LHR  LLQ+I  Q
Sbjct  241   KEKIRKICEAFGANRYPFTDDLGKQFQMITEVSRKLSELKITIDMGQLHRSQLLQTIGHQ  300

Query  1841  FDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNSEIG  1662
             ++ WN+LV++EKS+YHTLNMLS+DVTKKCLV EGW P  ATI+IQ  +Q+A HDS S+I 
Sbjct  301   YELWNLLVKKEKSVYHTLNMLSVDVTKKCLVGEGWCPVFATIQIQSVMQKATHDSKSQIE  360

Query  1661  AIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGD  1482
             AIF VL T+E+PPTYF TNKFTS+FQEIVDAYGVAKYQEANPGV+TIVTFPFLFAVMFGD
Sbjct  361   AIFHVLDTKEAPPTYFCTNKFTSSFQEIVDAYGVAKYQEANPGVYTIVTFPFLFAVMFGD  420

Query  1481  WGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEFFSV  1302
             WGHGICLLLATLYF+IREKK S QKLGDI EMTFGGRYVI+MMALFSIYTG IYNEFFSV
Sbjct  421   WGHGICLLLATLYFIIREKKFSGQKLGDIVEMTFGGRYVIMMMALFSIYTGLIYNEFFSV  480

Query  1301  QFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKLSIL  1122
              FELFG SAY CRD SC DAT+IGLIK RDTY FGVDP WHGTRSELPFLNSLKMK+SIL
Sbjct  481   PFELFGPSAYGCRDTSCRDATSIGLIKVRDTYPFGVDPKWHGTRSELPFLNSLKMKMSIL  540

Query  1121  LGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQADL  942
             LGVAQMNLGIILSYFNA +F   +N W QF+PQ+IFLN+LFGYLS+LIIVKW +GSQADL
Sbjct  541   LGVAQMNLGIILSYFNAKFFGESINIWYQFVPQMIFLNSLFGYLSLLIIVKWYSGSQADL  600

Query  941   YHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQH-NRHQG  765
             YHVMIYMFL PT+DLGENQLFPGQK  QL+L+L AL +VPWML PKPF+LK Q+  RHQG
Sbjct  601   YHVMIYMFLSPTDDLGENQLFPGQKFLQLLLLLSALTAVPWMLFPKPFLLKKQNEERHQG  660

Query  764   QSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLRLWAL  585
             QSY+ +   D++  ++  H S  HEEF+FSEVFVHQLIHTIEFVLGAVSNTASYLRLWAL
Sbjct  661   QSYSVLHCTDDNHEIERHHGSHGHEEFDFSEVFVHQLIHTIEFVLGAVSNTASYLRLWAL  720

Query  584   SLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHALRLHW  405
             SLAHSELS+VFY+KVLLLAWG++++II +VG  +FIFAT+GVLL+METLSAFLHALRLHW
Sbjct  721   SLAHSELSSVFYDKVLLLAWGFDSLIIRIVGMAVFIFATVGVLLIMETLSAFLHALRLHW  780

Query  404   VEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             VEFQNKFY GDG+KF PFSF L+ EE++
Sbjct  781   VEFQNKFYAGDGFKFSPFSFSLLREEDE  808



>ref|XP_002300733.1| hypothetical protein POPTR_0002s03010g [Populus trichocarpa]
 gb|EEE80006.1| hypothetical protein POPTR_0002s03010g [Populus trichocarpa]
Length=807

 Score =  1144 bits (2959),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 591/808 (73%), Positives = 691/808 (86%), Gaps = 2/808 (0%)
 Frame = -2

Query  2741  MDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSGEM  2562
             MDL RSEPMQLVQLIIPIESA  +++YLGDLGL QF DLNAEKSPFQRTYAAQIKR  EM
Sbjct  1     MDLMRSEPMQLVQLIIPIESAYRTISYLGDLGLFQFNDLNAEKSPFQRTYAAQIKRCAEM  60

Query  2561  ARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSFNE  2382
             ARKLRFFK+QM KAG+S + +  + D +  D LEV LG+LE+ELIEIN+NN+ LQ ++NE
Sbjct  61    ARKLRFFKEQMKKAGLSPTKSLRSSD-VDLDRLEVALGELESELIEINSNNEMLQHTYNE  119

Query  2381  LVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTSKQVRLG  2202
             L EYKLVLQK GE FHSA+SS  AQQ E  +  + E S+++ LL E +M+ D SKQV+LG
Sbjct  120   LSEYKLVLQKAGELFHSAQSSVAAQQSELEAYNTAEASIDSALLLEQEMTMDPSKQVKLG  179

Query  2201  FISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSGERA  2022
             +ISGLV +EK+MAFERILFRATRGNV L+QS ++ +V+DP+SG+KVEKNVF+VFYSGERA
Sbjct  180   YISGLVAREKAMAFERILFRATRGNVFLKQSVLENAVVDPVSGDKVEKNVFIVFYSGERA  239

Query  2021  KNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSIAEQ  1842
             KNKILK+C+ FGANRYPF E+L KQ Q+I++VSG+++ELKT IDAG+ H  NLLQ+I  +
Sbjct  240   KNKILKLCEGFGANRYPFMEDLNKQFQIISQVSGRLAELKTTIDAGLAHWSNLLQTIGFE  299

Query  1841  FDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNSEIG  1662
             F++WN LV++EKSIYHTLNML++DVTKKCLVAEGW P  AT +IQ+ L+RA  DS+S+IG
Sbjct  300   FEQWNFLVKKEKSIYHTLNMLNMDVTKKCLVAEGWCPVFATDQIQNGLRRATLDSSSQIG  359

Query  1661  AIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGD  1482
             AIF VL T++SPPTYF+TNKFTSAFQEIVDAYGVAKYQEANP V+TIVTFPFLFAVMFGD
Sbjct  360   AIFHVLQTKDSPPTYFRTNKFTSAFQEIVDAYGVAKYQEANPSVYTIVTFPFLFAVMFGD  419

Query  1481  WGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEFFSV  1302
             WGHGICLLLATLYF+ REKKLSSQKLGDI EM F GRYVI+MMA+FSIYTG IYNEFFSV
Sbjct  420   WGHGICLLLATLYFIFREKKLSSQKLGDIMEMAFSGRYVIMMMAIFSIYTGLIYNEFFSV  479

Query  1301  QFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKLSIL  1122
              FELFG SAY CRD SC DA+T GL+K R TY FG+DP WHGTRSELPFLNS+KMK+SIL
Sbjct  480   PFELFGLSAYGCRDQSCGDASTAGLVKVRATYPFGLDPKWHGTRSELPFLNSMKMKMSIL  539

Query  1121  LGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQADL  942
              GVAQMNLGII+SYFNA +F   +N W QF+PQ+IFLN+LFGYLS+LIIVKWCTGSQADL
Sbjct  540   FGVAQMNLGIIISYFNAKFFGDNINIWYQFVPQMIFLNSLFGYLSLLIIVKWCTGSQADL  599

Query  941   YHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQH-NRHQG  765
             YHVMIYMFL PT+DL +NQLF GQK  Q++L+L AL +VPWML PKPF+LK QH  R QG
Sbjct  600   YHVMIYMFLSPTDDLDDNQLFFGQKFFQILLLLSALAAVPWMLFPKPFLLKKQHEERFQG  659

Query  764   QSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLRLWAL  585
             QSYA +   D S  V+    S +HEEFEFSEVFVHQLIHTIEFVLGAVSNTASYLRLWAL
Sbjct  660   QSYARLDSSDYSPEVEQHSVSHNHEEFEFSEVFVHQLIHTIEFVLGAVSNTASYLRLWAL  719

Query  584   SLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHALRLHW  405
             SLAHSEL++VFY+KVLLL+WGYN+I+   +G I+FIFAT+GVLLVMETLSAFLHALRLHW
Sbjct  720   SLAHSELASVFYDKVLLLSWGYNSILARSIGLIVFIFATVGVLLVMETLSAFLHALRLHW  779

Query  404   VEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             VEFQNKFY GDGYKF PFSF  + E+++
Sbjct  780   VEFQNKFYVGDGYKFYPFSFASLGEDDE  807



>ref|XP_011028942.1| PREDICTED: V-type proton ATPase subunit a2-like isoform X2 [Populus 
euphratica]
Length=816

 Score =  1139 bits (2946),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 588/816 (72%), Positives = 693/816 (85%), Gaps = 2/816 (0%)
 Frame = -2

Query  2765  GRGGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAA  2586
             G G   P MDL RSEPMQLVQLIIPIESA  +++YLGDLGL QF DLNAEKSPFQRTYAA
Sbjct  2     GDGIFGPTMDLMRSEPMQLVQLIIPIESAYRTISYLGDLGLFQFNDLNAEKSPFQRTYAA  61

Query  2585  QIKRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANND  2406
             QIKR  EMARKLRFFK+QM+KAG+S + +  + D +  D LE+ LG+LE+ELIEIN+NN+
Sbjct  62    QIKRCAEMARKLRFFKEQMTKAGLSPTKSLRSSD-VDLDRLEMALGELESELIEINSNNE  120

Query  2405  KLQRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSAD  2226
              L+ ++NEL EYKLVLQK GE FHSA+ S  AQQ E  +  + E S+++ LL E +M+ D
Sbjct  121   MLKHTYNELSEYKLVLQKAGELFHSAQISVAAQQSELEAYNTAEASIDSALLLEQEMTTD  180

Query  2225  TSKQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFL  2046
              SKQV+LG+ISGLV +EK+MAFERILFRATRGNV L+QS ++ +V+DP+SG+KVEKNVF+
Sbjct  181   PSKQVKLGYISGLVAREKAMAFERILFRATRGNVFLKQSVLENAVVDPVSGDKVEKNVFI  240

Query  2045  VFYSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGN  1866
             VFYSGERAKNKILK+C+ FGANRYPF E+L +Q Q+I++VSG+++ELKT ID G++H  N
Sbjct  241   VFYSGERAKNKILKLCEGFGANRYPFMEDLNRQFQIISQVSGRLAELKTTIDVGLVHWSN  300

Query  1865  LLQSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAG  1686
             LLQ+I   F++WN LV++EKSIYHTLNML++DVTKKCLVAEGW P  AT +IQ+ L+RA 
Sbjct  301   LLQTIGFDFEQWNFLVKKEKSIYHTLNMLNMDVTKKCLVAEGWCPVFATDQIQNGLRRAT  360

Query  1685  HDSNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPF  1506
              DS+S+IGAIF VL T++SPPTYF+TNKFTSAFQEIVDAYGVAKYQEANP V+TIVTFPF
Sbjct  361   LDSSSQIGAIFHVLQTKDSPPTYFQTNKFTSAFQEIVDAYGVAKYQEANPSVYTIVTFPF  420

Query  1505  LFAVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGF  1326
             LFAVMFGDWGHGICLLLATLYF+ REKKLSSQKLGDI EM F GRYVI+MMA+FSIYTG 
Sbjct  421   LFAVMFGDWGHGICLLLATLYFIFREKKLSSQKLGDIMEMAFSGRYVIMMMAIFSIYTGL  480

Query  1325  IYNEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNS  1146
             IYNEFFSV FELFG SAY CRD SC DA+T GL+K R TY FG+DP WHGTRSELPFLNS
Sbjct  481   IYNEFFSVPFELFGPSAYGCRDQSCGDASTAGLVKVRATYPFGLDPKWHGTRSELPFLNS  540

Query  1145  LKMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKW  966
             +KMK+SIL GVAQMNLGII+SYFNA +F   +N W QF+PQ+IFLN+LFGYLS+LIIVKW
Sbjct  541   MKMKMSILFGVAQMNLGIIISYFNAKFFGDNINIWYQFVPQMIFLNSLFGYLSLLIIVKW  600

Query  965   CTGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKS  786
             CTGSQADLYHVMIYMFL PT+DL +NQLF GQK  Q++L+L AL +VPWML PKPF+LK 
Sbjct  601   CTGSQADLYHVMIYMFLSPTDDLDDNQLFFGQKFFQILLLLSALAAVPWMLFPKPFLLKK  660

Query  785   QH-NRHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTA  609
             QH  R QGQSYA +   D S  ++    S +HEEFEFSEVFVHQLIHTIEFVLGAVSNTA
Sbjct  661   QHEERFQGQSYARLDSSDFSPEIEPHSVSHNHEEFEFSEVFVHQLIHTIEFVLGAVSNTA  720

Query  608   SYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAF  429
             SYLRLWALSLAHSEL++VFY+KVLLL+WGYN+I+   +G I+FIFAT+GVLLVMETLSAF
Sbjct  721   SYLRLWALSLAHSELASVFYDKVLLLSWGYNSILARSIGLIVFIFATVGVLLVMETLSAF  780

Query  428   LHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             LHALRLHWVEFQNKFY GDGYKF PFSF  + E+++
Sbjct  781   LHALRLHWVEFQNKFYVGDGYKFYPFSFASLGEDDE  816



>ref|XP_002307693.1| hypothetical protein POPTR_0005s25550g [Populus trichocarpa]
 gb|EEE94689.1| hypothetical protein POPTR_0005s25550g [Populus trichocarpa]
Length=817

 Score =  1137 bits (2942),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 589/816 (72%), Positives = 684/816 (84%), Gaps = 1/816 (0%)
 Frame = -2

Query  2765  GRGGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAA  2586
             G G   P MDL RSEPMQLVQLIIPIESA  +++YLGDLGL QF DLNAEKSPFQRTYAA
Sbjct  2     GDGSSGPTMDLMRSEPMQLVQLIIPIESAYRTISYLGDLGLFQFNDLNAEKSPFQRTYAA  61

Query  2585  QIKRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANND  2406
             QIKR  EMARKLRFFK+QM KAG+S S  S     I  D LEV LG+LE+ELIEIN+NN+
Sbjct  62    QIKRCAEMARKLRFFKEQMRKAGLSPSTKSLRSGDIDLDHLEVTLGELESELIEINSNNE  121

Query  2405  KLQRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSAD  2226
              LQ ++NEL EYKLVLQK GE FHSA+S   AQQ E     + E+S+E  LL E +M+ D
Sbjct  122   MLQHTYNELSEYKLVLQKAGELFHSAQSIVAAQQGELELYNTTEQSVERSLLLEQEMTMD  181

Query  2225  TSKQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFL  2046
              SKQV+LG+ISGLV +EKSMAFERILFRATRGNV L+Q+ ++ +V+DP+SG++VEKNVF+
Sbjct  182   PSKQVKLGYISGLVAREKSMAFERILFRATRGNVFLKQTVLENAVVDPVSGDEVEKNVFV  241

Query  2045  VFYSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGN  1866
             VFYSGERAKNKILK+C+ FGANRYPF E+L KQ Q+I++VSG+++ELKT IDAG+ HR N
Sbjct  242   VFYSGERAKNKILKLCEGFGANRYPFTEDLNKQFQIISQVSGRLAELKTTIDAGLAHRSN  301

Query  1865  LLQSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAG  1686
             LLQ+I  +F++WN LV++EKSIYH LNML++DVTKKCLVAEGW P  A  +IQ+ L+RA 
Sbjct  302   LLQTIGFEFEQWNFLVKKEKSIYHILNMLNMDVTKKCLVAEGWCPVFAKDQIQNGLRRAT  361

Query  1685  HDSNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPF  1506
              DSNS+IGAIF VL T+ESPPT+F+TNKFTSAFQEIVDAYGVAKYQEANP V+TIVTFPF
Sbjct  362   LDSNSQIGAIFHVLQTKESPPTFFQTNKFTSAFQEIVDAYGVAKYQEANPSVYTIVTFPF  421

Query  1505  LFAVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGF  1326
             LFAVMFGDWGHGICLLLATLY +IREKKLSSQKLGDI EM F GRYVI+MM +FSIYTG 
Sbjct  422   LFAVMFGDWGHGICLLLATLYLIIREKKLSSQKLGDIMEMAFSGRYVIMMMGIFSIYTGL  481

Query  1325  IYNEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNS  1146
             IYNEFFSV FELFG SAY CRD SC DA T GL+K   TY FG+DP WHG+RSELPFLNS
Sbjct  482   IYNEFFSVPFELFGPSAYGCRDQSCRDAYTAGLVKVHATYPFGLDPKWHGSRSELPFLNS  541

Query  1145  LKMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKW  966
             +KMK+SIL GVAQMNLGII+SYFNA +F   +N W QF+PQ+IFLN+LFGYLS+LIIVKW
Sbjct  542   MKMKMSILFGVAQMNLGIIMSYFNAKFFGDNINIWYQFVPQMIFLNSLFGYLSLLIIVKW  601

Query  965   CTGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKS  786
             CTGSQADLYHVMIYMFL PT+DL +NQLF GQK  Q++L+L AL +VPWM+ PKPF+LK 
Sbjct  602   CTGSQADLYHVMIYMFLSPTDDLDDNQLFIGQKFFQILLLLSALAAVPWMMFPKPFLLKK  661

Query  785   QH-NRHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTA  609
             +H  R QGQSYA +   D    ++    S +HEEFEFSEVFVHQLIHTIEFVLGAVSNTA
Sbjct  662   RHEERFQGQSYARLDSNDYPPEIEPHSVSHNHEEFEFSEVFVHQLIHTIEFVLGAVSNTA  721

Query  608   SYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAF  429
             SYLRLWALSLAHSELS+VFY+KVLLLAWGYN+II   +G  +FIFAT+GVLLVMETLSAF
Sbjct  722   SYLRLWALSLAHSELSSVFYDKVLLLAWGYNSIIARGIGLCVFIFATVGVLLVMETLSAF  781

Query  428   LHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             LHALRLHWVEFQNKFY GDGYKF PFSF  + ++++
Sbjct  782   LHALRLHWVEFQNKFYVGDGYKFYPFSFASLGQDDE  817



>ref|XP_011045160.1| PREDICTED: V-type proton ATPase subunit a2-like [Populus euphratica]
Length=817

 Score =  1137 bits (2941),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 590/816 (72%), Positives = 683/816 (84%), Gaps = 1/816 (0%)
 Frame = -2

Query  2765  GRGGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAA  2586
             G G   P MDL RSEPMQLVQLIIPIESA  +++YLGDLGL QF DLNAEKSPFQRTYAA
Sbjct  2     GDGSSGPTMDLMRSEPMQLVQLIIPIESAYRTISYLGDLGLFQFNDLNAEKSPFQRTYAA  61

Query  2585  QIKRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANND  2406
             QIKR  EMARKLRFFK+QM KAG+S S  S     I  D LEV LG+LE+ELIEIN+NN+
Sbjct  62    QIKRCAEMARKLRFFKEQMRKAGLSPSVKSLRSGNIDLDHLEVTLGELESELIEINSNNE  121

Query  2405  KLQRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSAD  2226
              LQ ++NEL EYKLVLQK GE FHSA+S   AQQ E     + E+S+E  LL E +M+ D
Sbjct  122   TLQHTYNELSEYKLVLQKAGELFHSAQSIVAAQQGELELYNTTEQSIERSLLLEQEMTMD  181

Query  2225  TSKQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFL  2046
              SKQV+LG+ISGLV +EKSMAFERILFRATRGNV L+Q+ ++ +V+DP+SG++VEKNVF+
Sbjct  182   PSKQVKLGYISGLVAREKSMAFERILFRATRGNVFLKQTVLENAVVDPVSGDEVEKNVFV  241

Query  2045  VFYSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGN  1866
             VFYSGERAKNKILK+C+ FGANRYPF E+L KQ Q+I++VSG+++ELKT IDAG+ HR N
Sbjct  242   VFYSGERAKNKILKLCEGFGANRYPFTEDLNKQFQIISQVSGRLAELKTTIDAGLAHRSN  301

Query  1865  LLQSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAG  1686
             LLQ+I  +F+ WN LV++EKSIYH LNML++DVTKKCLVAEGW P  A  +IQ+ L+RA 
Sbjct  302   LLQTIGFEFEEWNFLVKKEKSIYHILNMLNMDVTKKCLVAEGWCPVFAKDQIQNGLRRAT  361

Query  1685  HDSNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPF  1506
              DSNS+IGAIF VL T+ESPPT+F+TNKFT AFQEIVDAYGVAKYQEANP V+TIVTFPF
Sbjct  362   LDSNSQIGAIFHVLQTKESPPTFFQTNKFTLAFQEIVDAYGVAKYQEANPSVYTIVTFPF  421

Query  1505  LFAVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGF  1326
             LFAVMFGDWGHGICLLLATLY +IREKKLSSQKLGDI EM FGGRYVI+MM +FSIYTG 
Sbjct  422   LFAVMFGDWGHGICLLLATLYLIIREKKLSSQKLGDIMEMAFGGRYVIMMMGIFSIYTGL  481

Query  1325  IYNEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNS  1146
             IYNEFFSV FELFG SAY CRD SC DA T GL+K   TY FG+DP WHGTRSELPFLNS
Sbjct  482   IYNEFFSVPFELFGPSAYGCRDQSCRDAYTAGLVKVHATYPFGLDPKWHGTRSELPFLNS  541

Query  1145  LKMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKW  966
             +KMK+SIL GVAQMNLGII+SYFNA +F   +N W QF+PQ+IFLN+LFGYLS+LIIVKW
Sbjct  542   MKMKMSILFGVAQMNLGIIMSYFNAKFFGDNINIWYQFVPQMIFLNSLFGYLSLLIIVKW  601

Query  965   CTGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKS  786
             CTGSQADLYHVMIYMFL PT+DL +NQLF GQK  Q++L+L AL +VPWM+ PKPF+LK 
Sbjct  602   CTGSQADLYHVMIYMFLSPTDDLDDNQLFIGQKFFQILLLLSALAAVPWMMFPKPFLLKK  661

Query  785   QH-NRHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTA  609
             +H  R QGQSYA +   D    ++    S +HEEFEFSEVFVHQLIHTIEFVLGAVSNTA
Sbjct  662   RHEERFQGQSYARLDSNDYPPEIEPHSVSHNHEEFEFSEVFVHQLIHTIEFVLGAVSNTA  721

Query  608   SYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAF  429
             SYLRLWALSLAHSELS+VFY+KVLLLAWGYN+II   +G  +FIFAT+GVLLVMETLSAF
Sbjct  722   SYLRLWALSLAHSELSSVFYDKVLLLAWGYNSIIARGIGLCVFIFATVGVLLVMETLSAF  781

Query  428   LHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             LHALRLHWVEFQNKFY GDGYKF PFSF  + ++++
Sbjct  782   LHALRLHWVEFQNKFYVGDGYKFYPFSFASLGQDDE  817



>emb|CDP07451.1| unnamed protein product [Coffea canephora]
Length=808

 Score =  1135 bits (2937),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 600/808 (74%), Positives = 696/808 (86%), Gaps = 1/808 (0%)
 Frame = -2

Query  2741  MDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSGEM  2562
             MDL RSEPMQL QLIIP+ESA  +++YLGDLGL QFKDLN EKSPFQRTYAAQIKR GEM
Sbjct  1     MDLLRSEPMQLAQLIIPMESAHRTISYLGDLGLFQFKDLNTEKSPFQRTYAAQIKRCGEM  60

Query  2561  ARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSFNE  2382
             ARKLRF KDQM+KAG S S+       +  D+LEVKLG+LE ELIE+NAN+DKLQRS NE
Sbjct  61    ARKLRFLKDQMTKAGFSPSSRCSFDTRVTLDELEVKLGELEEELIEVNANSDKLQRSHNE  120

Query  2381  LVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTSKQVRLG  2202
             L+EYKLVLQK GEFFHSA+S A AQ  E+ ++  GE S+++PLL E +MS D SKQV+LG
Sbjct  121   LLEYKLVLQKAGEFFHSAQSIAAAQNHEFEANVMGEVSIDSPLLLEQEMSVDPSKQVKLG  180

Query  2201  FISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSGERA  2022
             F+SGLV +EKSMAFERILFRATRGNV L+Q  V++ VIDP+SG+K+EKNVF++FYSGERA
Sbjct  181   FVSGLVAREKSMAFERILFRATRGNVFLKQVAVEDPVIDPLSGDKIEKNVFVIFYSGERA  240

Query  2021  KNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSIAEQ  1842
             + K+ KICDAFGANRYPF +++ KQ Q I+EVSGK+SELKT ID G L R NLLQ+I+ +
Sbjct  241   RMKVTKICDAFGANRYPFTDDIAKQYQTISEVSGKLSELKTTIDVGQLQRSNLLQTISFE  300

Query  1841  FDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNSEIG  1662
             F++WN+LV++EKSIYH LNMLS DVTKKCLV EGW P SAT +I++ LQ+A  DSNS +G
Sbjct  301   FEQWNLLVKKEKSIYHILNMLSFDVTKKCLVGEGWCPISATDQIKNTLQQASLDSNSLVG  360

Query  1661  AIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGD  1482
             AIF+VL T ESPPT+F+TNKFTSAFQEIVDAYGVAKYQEANPGVFTI TFPFLFAVMFGD
Sbjct  361   AIFQVLQTEESPPTHFRTNKFTSAFQEIVDAYGVAKYQEANPGVFTIATFPFLFAVMFGD  420

Query  1481  WGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEFFSV  1302
             WGHG+CL LATLYF++REKKLS QKLGDI EM FGGRYVI+MMALFSIYTG IYNEFFSV
Sbjct  421   WGHGLCLFLATLYFILREKKLSHQKLGDIMEMAFGGRYVIMMMALFSIYTGLIYNEFFSV  480

Query  1301  QFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKLSIL  1122
              FELFGRSAY CRD SC DA+T+GLIK R TY FGVDP WHGTRSELPFLNSLKMK+SIL
Sbjct  481   PFELFGRSAYDCRDSSCRDASTVGLIKVRGTYPFGVDPKWHGTRSELPFLNSLKMKMSIL  540

Query  1121  LGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQADL  942
             LG+AQMNLGI+LSYFNA +F + +N W QF+PQIIFLN+LFGYLS+LIIVKWC+GSQADL
Sbjct  541   LGIAQMNLGIVLSYFNAKFFGNDINIWYQFVPQIIFLNSLFGYLSLLIIVKWCSGSQADL  600

Query  941   YHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQHN-RHQG  765
             YHVMIYMFL PT DLG+NQLF GQK  Q++L+L ALV+VPWML PKP +LK QH  RH+G
Sbjct  601   YHVMIYMFLSPTADLGDNQLFFGQKYLQILLLLFALVAVPWMLFPKPLLLKKQHQERHRG  660

Query  764   QSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLRLWAL  585
             Q+Y P+   ++S  ++   D   HEEFEFSEVFVHQ IHTIEFVLGAVSNTASYLRLWAL
Sbjct  661   QAYRPLYSTEDSFELEIQSDLHGHEEFEFSEVFVHQFIHTIEFVLGAVSNTASYLRLWAL  720

Query  584   SLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHALRLHW  405
             SLAHSELS+VFY+KVLLLAWG+NN+IIL++G I+FI AT+GVLL+METLSAFLHALRLHW
Sbjct  721   SLAHSELSSVFYDKVLLLAWGFNNVIILIIGIIVFICATVGVLLLMETLSAFLHALRLHW  780

Query  404   VEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             VEFQ+KFYEGDGYKF PFSF  + E+E+
Sbjct  781   VEFQSKFYEGDGYKFYPFSFASLSEDEE  808



>ref|XP_004500962.1| PREDICTED: vacuolar proton ATPase a2-like [Cicer arietinum]
Length=819

 Score =  1134 bits (2933),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 588/817 (72%), Positives = 696/817 (85%), Gaps = 2/817 (0%)
 Frame = -2

Query  2771  LGGRGGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTY  2592
             +G    CFP MDL RSEPMQLVQLIIPIESA  S++Y+GDL L QFKDLN +KSPFQRTY
Sbjct  1     MGNERYCFPTMDLLRSEPMQLVQLIIPIESAHRSISYIGDLALFQFKDLNEDKSPFQRTY  60

Query  2591  AAQIKRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINAN  2412
             A+Q+KR GEMAR LR FK+QM KAG+S S  S   D +  + LEVKL +LEAEL+E+NAN
Sbjct  61    ASQVKRCGEMARTLRLFKEQMMKAGISPSTRSTRDDGLDLEYLEVKLAELEAELLEMNAN  120

Query  2411  NDKLQRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMS  2232
             N+KLQ ++NEL+EYKLVL+KVGEFF SA+++A A+Q+E       E S+++PLL E + +
Sbjct  121   NEKLQHTYNELIEYKLVLEKVGEFFPSAQNNAVARQRELQVQPIVEGSIDSPLLMEQETT  180

Query  2231  ADTSKQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNV  2052
             +   KQ++LG+ISGLV +EKS+ FER+LFRATRGNV L+Q+ V+  ++DP+SGEKV KNV
Sbjct  181   SYPVKQIKLGYISGLVSREKSIPFERVLFRATRGNVYLKQTVVEHPILDPLSGEKVHKNV  240

Query  2051  FLVFYSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHR  1872
             F++FYSGER K+KILKICDAFGANRYPF+++LGKQ Q++TEVSG++ ELK  IDAG+LHR
Sbjct  241   FVIFYSGERVKSKILKICDAFGANRYPFSDDLGKQFQMLTEVSGRLGELKATIDAGLLHR  300

Query  1871  GNLLQSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQR  1692
               LLQ+I  QF++WN+L+++EKSIYHTLNMLSI+VTKKCL+AEGW P  AT +IQ  L R
Sbjct  301   STLLQTIGYQFEQWNLLLKKEKSIYHTLNMLSINVTKKCLLAEGWCPVFATNQIQKVLLR  360

Query  1691  AGHDSNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTF  1512
             A  D NS++ +IF+VL T+E PPTYF TNKFTS+FQEIVDAYG+AKYQEANPGV+TI+TF
Sbjct  361   ATMDCNSQVESIFQVLQTKELPPTYFCTNKFTSSFQEIVDAYGIAKYQEANPGVYTIITF  420

Query  1511  PFLFAVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYT  1332
             PFLFAVMFGDWGHGICLLLATLYF+I EKK S QKLGDI EM FGGRY+I+MMALFSIYT
Sbjct  421   PFLFAVMFGDWGHGICLLLATLYFIINEKKFSCQKLGDILEMVFGGRYIIMMMALFSIYT  480

Query  1331  GFIYNEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFL  1152
             G IYNEFFS+ FELFG +AY CRDPSC DATTIGLIK RDTY FGVDP WHGTRSELPFL
Sbjct  481   GLIYNEFFSIPFELFGPTAYGCRDPSCRDATTIGLIKMRDTYPFGVDPKWHGTRSELPFL  540

Query  1151  NSLKMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIV  972
             NSLKMK+SILLGV+QMNLGI+LSY+NA YF + +N W QF+PQ+IFLN+LFGYLS+LIIV
Sbjct  541   NSLKMKMSILLGVSQMNLGIVLSYYNAKYFENSINTWYQFVPQMIFLNSLFGYLSLLIIV  600

Query  971   KWCTGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFIL  792
             KWC GSQADLYHVMIYMFL PT+DLGENQLF GQ+  Q+ L+LLAL++VPWML+PKPF+L
Sbjct  601   KWCCGSQADLYHVMIYMFLSPTDDLGENQLFVGQQFLQITLLLLALIAVPWMLIPKPFLL  660

Query  791   KSQH-NRHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSN  615
             K QH  RH+GQSY+ +   D+ L         +HEEFEFSEVFVHQLIHTIEFVLGAVSN
Sbjct  661   KKQHEERHRGQSYSLLYSGDDPLESKSHGIHHNHEEFEFSEVFVHQLIHTIEFVLGAVSN  720

Query  614   TASYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLS  435
             TASYLRLWALSLAHSELS+VFY+KVLLLAWGYNN I+L+VG I+FI AT+GVLLVME+LS
Sbjct  721   TASYLRLWALSLAHSELSSVFYDKVLLLAWGYNNTIVLIVGVIVFICATVGVLLVMESLS  780

Query  434   AFLHALRLHWVEFQNKFYEGDGYKFDPFSFV-LVDEE  327
             AFLHALRLHWVEFQNKFYEGDGYKF PFSF  L DE+
Sbjct  781   AFLHALRLHWVEFQNKFYEGDGYKFFPFSFTSLADED  817



>ref|XP_010918985.1| PREDICTED: V-type proton ATPase subunit a3 isoform X3 [Elaeis 
guineensis]
Length=777

 Score =  1134 bits (2932),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 600/772 (78%), Positives = 680/772 (88%), Gaps = 3/772 (0%)
 Frame = -2

Query  2627  LNAEKSPFQRTYAAQIKRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLG  2448
             LNA+KSPFQRTYA QIKR GEMARKLRFF +QM+KA +S SA   T+  I  DDLEVKLG
Sbjct  6     LNADKSPFQRTYANQIKRCGEMARKLRFFGEQMTKADISPSAMPVTRTHIDLDDLEVKLG  65

Query  2447  DLEAELIEINANNDKLQRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgees  2268
             +LEAELIE+N+N +KLQR+FNEL+EYKLVLQK GEFF+SA+  A AQQ+E  + Q G+ S
Sbjct  66    ELEAELIEVNSNGEKLQRTFNELLEYKLVLQKAGEFFYSAQGHATAQQREIEAHQVGDGS  125

Query  2267  leapllsePDMSADTSKQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVI  2088
             L++PLL E +M AD SKQV+LGF+SGLVPKEK+MAFERILFRATRGN+ L+Q  +D+ V 
Sbjct  126   LDSPLLLEQEMLADPSKQVKLGFVSGLVPKEKAMAFERILFRATRGNMFLKQVAIDDPVT  185

Query  2087  DPISGEKVEKNVFLVFYSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISE  1908
             DP+SGEKV KNVF+VFYSGERAK KILKIC+AFGANRYPF E++GKQ Q+I EVS KISE
Sbjct  186   DPVSGEKVGKNVFVVFYSGERAKTKILKICEAFGANRYPFTEDVGKQMQMIDEVSWKISE  245

Query  1907  LKTAIDAGILHRGNLLQSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPT  1728
             LKT ID G++HR ++L++I  QF++WN LVRREKSIYHTLNMLS+DVTKKCLVAEGWSP 
Sbjct  246   LKTTIDVGLIHRDSILKNIGYQFEQWNHLVRREKSIYHTLNMLSLDVTKKCLVAEGWSPV  305

Query  1727  SATIEIQDALQRAGHDSNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQ  1548
              AT ++QDALQRA +DSNS++G+IF+VL T ESPPTYF+TNKFTSAFQEIVDAYGVAKYQ
Sbjct  306   FATSQVQDALQRATYDSNSQVGSIFQVLHTNESPPTYFQTNKFTSAFQEIVDAYGVAKYQ  365

Query  1547  EANPGVFTIVTFPFLFAVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRY  1368
             EANPGV+TI+TFPFLFAVMFGDWGHGICLLL TLYF+IREKKLSSQKLGDI EMTFGGRY
Sbjct  366   EANPGVYTIITFPFLFAVMFGDWGHGICLLLTTLYFIIREKKLSSQKLGDIMEMTFGGRY  425

Query  1367  VILMMALFSIYTGFIYNEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDP  1188
             VI+MMA+FSIYTG IYNEFFSV FELFG+SAY CRD SC DATT GLIK R  Y FGVDP
Sbjct  426   VIMMMAIFSIYTGLIYNEFFSVPFELFGKSAYACRDSSCRDATTEGLIKVRPAYPFGVDP  485

Query  1187  AWHGTRSELPFLNSLKMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLN  1008
              WHGTRSELPFLNSLKMK+SILLGVAQMNLGI+LSYFNA +FR+ +N W QF+PQ+IFLN
Sbjct  486   KWHGTRSELPFLNSLKMKMSILLGVAQMNLGIVLSYFNAKFFRNNLNIWYQFVPQLIFLN  545

Query  1007  ALFGYLSVLIIVKWCTGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvs  828
             +LFGYLS+LIIVKWCTGS+ADLYHVMIYMFL PT+DLGENQLFPGQKT QLVL+LLAL+S
Sbjct  546   SLFGYLSLLIIVKWCTGSKADLYHVMIYMFLSPTDDLGENQLFPGQKTLQLVLLLLALIS  605

Query  827   VPWMLLPKPFILKSQHN-RHQGQSYAPIQDLDE--SLLvdgshdssdheefefsevfvHQ  657
             VPWML PKP +LK QH  RHQGQSY  +Q  +E   L    S     +EEFEFSEVFVHQ
Sbjct  606   VPWMLFPKPILLKKQHQERHQGQSYTMLQSTEEMLELDHGHSSHGHGNEEFEFSEVFVHQ  665

Query  656   LIHTIEFVLGAVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifi  477
             LIHTIEFVLGAVSNTASYLRLWALSLAHSELS+VFYEKVLLLAWG+NNIIIL++GFI+FI
Sbjct  666   LIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYEKVLLLAWGFNNIIILIIGFIVFI  725

Query  476   FATIGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             FAT+GVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKF PFSF L+ E+ED
Sbjct  726   FATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFSPFSFALLAEDED  777



>ref|XP_007158764.1| hypothetical protein PHAVU_002G179900g [Phaseolus vulgaris]
 gb|ESW30758.1| hypothetical protein PHAVU_002G179900g [Phaseolus vulgaris]
Length=817

 Score =  1132 bits (2928),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 589/816 (72%), Positives = 693/816 (85%), Gaps = 3/816 (0%)
 Frame = -2

Query  2765  GRGGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAA  2586
               G C P MDL RSEPMQL QLIIPIESA  +++YLGDLGL QFKDLN +KSPFQRTYA+
Sbjct  3     NEGNCLPKMDLLRSEPMQLAQLIIPIESAHRAISYLGDLGLFQFKDLNVDKSPFQRTYAS  62

Query  2585  QIKRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANND  2406
             QIKR GEMAR+LR FK+QM KAGVS S  S  +D +  + LEVKL +LEA+L+EINANN+
Sbjct  63    QIKRCGEMARRLRLFKEQMMKAGVSPSTTSAREDNVDLESLEVKLEELEADLLEINANNE  122

Query  2405  KLQRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSAD  2226
             KL+ ++NEL EYKLV +KVGEFF SA+++A A Q++     + E S+++PLL   +    
Sbjct  123   KLKHTYNELSEYKLVQEKVGEFFSSAKNNAVAHQKKLEVQITVERSIDSPLLW--EQEET  180

Query  2225  TSKQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFL  2046
             ++KQ++LGFISGLV +EKS+ FERILFRATRGNV L+Q+ VD SV+D  SGEKV KNVF+
Sbjct  181   STKQIKLGFISGLVSREKSVPFERILFRATRGNVFLKQAVVDHSVLDLTSGEKVHKNVFV  240

Query  2045  VFYSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGN  1866
             VFYSGE  K+KILKICDAFGANRYPF+++L KQ Q ITEVSG+++ELKT I+AG+LHR  
Sbjct  241   VFYSGESVKSKILKICDAFGANRYPFSDDLSKQLQTITEVSGRLAELKTTIEAGLLHRST  300

Query  1865  LLQSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAG  1686
             LLQ+I   +D+W++ +++EKSIYHTLNMLSI+VTKKCL+AEGW P  AT +I   L++A 
Sbjct  301   LLQTIGYHYDQWSLQLKKEKSIYHTLNMLSINVTKKCLLAEGWCPVFATTQIHKVLEQAT  360

Query  1685  HDSNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPF  1506
              D +S++G IF+VL T+ESPPTYF TNKFTS+FQEIVDAYGVAKYQEANPGV+TI+TFPF
Sbjct  361   VDCSSQVGVIFQVLHTKESPPTYFCTNKFTSSFQEIVDAYGVAKYQEANPGVYTIITFPF  420

Query  1505  LFAVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGF  1326
             LFAVMFGDWGHGICLLLA LY +I EKK S+QKLGDI EM FGGRY+I MMALFSIYTG 
Sbjct  421   LFAVMFGDWGHGICLLLAALYLVINEKKFSTQKLGDIMEMAFGGRYIITMMALFSIYTGM  480

Query  1325  IYNEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNS  1146
             IYNEFFSV FELFG SAY CRDPSC DA+TIGLIK RDTY FGVDP WHGTRSELP+LNS
Sbjct  481   IYNEFFSVPFELFGPSAYGCRDPSCGDASTIGLIKVRDTYPFGVDPKWHGTRSELPYLNS  540

Query  1145  LKMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKW  966
             LKMK+SILLGV+QMNLGII+SY+NA YF + +N W QF+PQ+IFLN+LFGYLS+LIIVKW
Sbjct  541   LKMKMSILLGVSQMNLGIIMSYYNAKYFENNINIWYQFVPQMIFLNSLFGYLSLLIIVKW  600

Query  965   CTGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKS  786
             CTGSQADLYHV+IYMFL PTEDLGENQLF GQK  QLVL+LLALV+VPWML+PKPF+LK 
Sbjct  601   CTGSQADLYHVVIYMFLSPTEDLGENQLFVGQKLLQLVLLLLALVAVPWMLVPKPFLLKK  660

Query  785   QHN-RHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTA  609
             QH  RHQGQSYA + + D+    +    S DH+EF+FSEVFVHQLIHTIEFVLGAVSNTA
Sbjct  661   QHKERHQGQSYALLYNADDPNESESQSVSCDHDEFDFSEVFVHQLIHTIEFVLGAVSNTA  720

Query  608   SYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAF  429
             SYLRLWALSLAHSELS+VFY+KVLLLAWGYNN IIL+VG  +FI AT+GVLL+METLSAF
Sbjct  721   SYLRLWALSLAHSELSSVFYDKVLLLAWGYNNTIILIVGIFVFICATVGVLLLMETLSAF  780

Query  428   LHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             LHALRLHWVEFQNKFYEGDGYKF PFSF L+ +E++
Sbjct  781   LHALRLHWVEFQNKFYEGDGYKFFPFSFTLLTDEDE  816



>ref|XP_011028941.1| PREDICTED: V-type proton ATPase subunit a2-like isoform X1 [Populus 
euphratica]
Length=826

 Score =  1132 bits (2927),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 589/826 (71%), Positives = 694/826 (84%), Gaps = 12/826 (1%)
 Frame = -2

Query  2765  GRGGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAA  2586
             G G   P MDL RSEPMQLVQLIIPIESA  +++YLGDLGL QF DLNAEKSPFQRTYAA
Sbjct  2     GDGIFGPTMDLMRSEPMQLVQLIIPIESAYRTISYLGDLGLFQFNDLNAEKSPFQRTYAA  61

Query  2585  QIKRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANND  2406
             QIKR  EMARKLRFFK+QM+KAG+S + +  + D +  D LE+ LG+LE+ELIEIN+NN+
Sbjct  62    QIKRCAEMARKLRFFKEQMTKAGLSPTKSLRSSD-VDLDRLEMALGELESELIEINSNNE  120

Query  2405  KLQRSFNELVEYKLVLQKV----------GEFFHSARssaeaqqqeygssqsgeesleap  2256
              L+ ++NEL EYKLVLQKV          GE FHSA+ S  AQQ E  +  + E S+++ 
Sbjct  121   MLKHTYNELSEYKLVLQKVWLLLHPKPLAGELFHSAQISVAAQQSELEAYNTAEASIDSA  180

Query  2255  llsePDMSADTSKQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPIS  2076
             LL E +M+ D SKQV+LG+ISGLV +EK+MAFERILFRATRGNV L+QS ++ +V+DP+S
Sbjct  181   LLLEQEMTTDPSKQVKLGYISGLVAREKAMAFERILFRATRGNVFLKQSVLENAVVDPVS  240

Query  2075  GEKVEKNVFLVFYSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTA  1896
             G+KVEKNVF+VFYSGERAKNKILK+C+ FGANRYPF E+L +Q Q+I++VSG+++ELKT 
Sbjct  241   GDKVEKNVFIVFYSGERAKNKILKLCEGFGANRYPFMEDLNRQFQIISQVSGRLAELKTT  300

Query  1895  IDAGILHRGNLLQSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATI  1716
             ID G++H  NLLQ+I   F++WN LV++EKSIYHTLNML++DVTKKCLVAEGW P  AT 
Sbjct  301   IDVGLVHWSNLLQTIGFDFEQWNFLVKKEKSIYHTLNMLNMDVTKKCLVAEGWCPVFATD  360

Query  1715  EIQDALQRAGHDSNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANP  1536
             +IQ+ L+RA  DS+S+IGAIF VL T++SPPTYF+TNKFTSAFQEIVDAYGVAKYQEANP
Sbjct  361   QIQNGLRRATLDSSSQIGAIFHVLQTKDSPPTYFQTNKFTSAFQEIVDAYGVAKYQEANP  420

Query  1535  GVFTIVTFPFLFAVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILM  1356
              V+TIVTFPFLFAVMFGDWGHGICLLLATLYF+ REKKLSSQKLGDI EM F GRYVI+M
Sbjct  421   SVYTIVTFPFLFAVMFGDWGHGICLLLATLYFIFREKKLSSQKLGDIMEMAFSGRYVIMM  480

Query  1355  MALFSIYTGFIYNEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHG  1176
             MA+FSIYTG IYNEFFSV FELFG SAY CRD SC DA+T GL+K R TY FG+DP WHG
Sbjct  481   MAIFSIYTGLIYNEFFSVPFELFGPSAYGCRDQSCGDASTAGLVKVRATYPFGLDPKWHG  540

Query  1175  TRSELPFLNSLKMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFG  996
             TRSELPFLNS+KMK+SIL GVAQMNLGII+SYFNA +F   +N W QF+PQ+IFLN+LFG
Sbjct  541   TRSELPFLNSMKMKMSILFGVAQMNLGIIISYFNAKFFGDNINIWYQFVPQMIFLNSLFG  600

Query  995   YLSVLIIVKWCTGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWM  816
             YLS+LIIVKWCTGSQADLYHVMIYMFL PT+DL +NQLF GQK  Q++L+L AL +VPWM
Sbjct  601   YLSLLIIVKWCTGSQADLYHVMIYMFLSPTDDLDDNQLFFGQKFFQILLLLSALAAVPWM  660

Query  815   LLPKPFILKSQH-NRHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIE  639
             L PKPF+LK QH  R QGQSYA +   D S  ++    S +HEEFEFSEVFVHQLIHTIE
Sbjct  661   LFPKPFLLKKQHEERFQGQSYARLDSSDFSPEIEPHSVSHNHEEFEFSEVFVHQLIHTIE  720

Query  638   FVLGAVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGV  459
             FVLGAVSNTASYLRLWALSLAHSEL++VFY+KVLLL+WGYN+I+   +G I+FIFAT+GV
Sbjct  721   FVLGAVSNTASYLRLWALSLAHSELASVFYDKVLLLSWGYNSILARSIGLIVFIFATVGV  780

Query  458   LLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             LLVMETLSAFLHALRLHWVEFQNKFY GDGYKF PFSF  + E+++
Sbjct  781   LLVMETLSAFLHALRLHWVEFQNKFYVGDGYKFYPFSFASLGEDDE  826



>ref|XP_007042076.1| Vacuolar proton ATPase A3 isoform 3 [Theobroma cacao]
 gb|EOX97907.1| Vacuolar proton ATPase A3 isoform 3 [Theobroma cacao]
Length=752

 Score =  1126 bits (2913),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 598/752 (80%), Positives = 678/752 (90%), Gaps = 4/752 (1%)
 Frame = -2

Query  2564  MARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSFN  2385
             MARK+RFFK+QM KAG S S  S+ +  I  DDLEVKLG+LEAELIE+NAN +KLQRS+N
Sbjct  1     MARKMRFFKEQMVKAGFSPSTKSEARGDIDVDDLEVKLGELEAELIEMNANGEKLQRSYN  60

Query  2384  ELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTSKQVRL  2205
             ELVEYKLVLQK GEFF SA+ SA AQQ+E  S Q GEES+E PLL + + + D SKQV+L
Sbjct  61    ELVEYKLVLQKAGEFFASAQHSAVAQQREMESRQMGEESIETPLLQDQETTIDLSKQVKL  120

Query  2204  GFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSGER  2025
             GFI+GLVP+EKSMAFERILFRATRGNVLL+Q  V++ V DP+SGEK+EKNVF+VFYSGER
Sbjct  121   GFITGLVPREKSMAFERILFRATRGNVLLKQVPVEDPVTDPVSGEKMEKNVFVVFYSGER  180

Query  2024  AKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSIAE  1845
             AKNKILKIC+AFGANRYPFAE+LGKQA +ITEVSG+I+ELKT IDAG  HR NLL++I +
Sbjct  181   AKNKILKICEAFGANRYPFAEDLGKQALMITEVSGRITELKTTIDAGSYHRDNLLRTIGD  240

Query  1844  QFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNSEI  1665
             QF++WN+ V++EKSIYHTLNMLS+DVTKKCLVAEGWSP  AT ++Q++LQRA  DSNS++
Sbjct  241   QFEQWNLKVKKEKSIYHTLNMLSLDVTKKCLVAEGWSPVFATKQVQESLQRAAFDSNSQV  300

Query  1664  GAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMFG  1485
             GAIF+VL TRESPPTYF+TNKFTSAFQEIVDAYGVAKYQEANPGV+TI+TFPFLFAVMFG
Sbjct  301   GAIFQVLSTRESPPTYFRTNKFTSAFQEIVDAYGVAKYQEANPGVYTIITFPFLFAVMFG  360

Query  1484  DWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEFFS  1305
             DWGHGICLLLATL+F++REKKLSSQKLGDITEMTFGGRYVI+MMALFSIYTG IYNEFFS
Sbjct  361   DWGHGICLLLATLFFIVREKKLSSQKLGDITEMTFGGRYVIMMMALFSIYTGLIYNEFFS  420

Query  1304  VQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKLSI  1125
             V FELFGRSAY CRD +C DA+T+GLIK R+TY FGVDPAWHGTRSELPFLNSLKMK+SI
Sbjct  421   VPFELFGRSAYACRDLTCRDASTVGLIKVRETYPFGVDPAWHGTRSELPFLNSLKMKMSI  480

Query  1124  LLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQAD  945
             LLGVAQMNLGIILSYFNA +F S +N W QFIPQ+IFLN+LFGYLS+LIIVKWCTGSQAD
Sbjct  481   LLGVAQMNLGIILSYFNATFFGSSLNVWFQFIPQMIFLNSLFGYLSLLIIVKWCTGSQAD  540

Query  944   LYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQH-NRHQ  768
             LYHVMIYMFL PT++LGENQLFPGQKT QLVL+LLALVSVPWMLLP+PF+LK QH N+HQ
Sbjct  541   LYHVMIYMFLSPTDELGENQLFPGQKTVQLVLLLLALVSVPWMLLPRPFLLKKQHENQHQ  600

Query  767   GQSYAPIQDLDESLLvdgshds--sdheefefsevfvHQLIHTIEFVLGAVSNTASYLRL  594
             GQSY P++  D++L  + ++DS    HEEFEFSEVFVHQLIHTIEFVLGAVSNTASYLRL
Sbjct  601   GQSYTPLESTDDTLHSEANNDSHGHGHEEFEFSEVFVHQLIHTIEFVLGAVSNTASYLRL  660

Query  593   WAL-SLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHAL  417
             WAL SLAHSELS VFYEKVLLLAWG+NNIIIL+VG IIFIFAT+GVLLVMETLSAFLHAL
Sbjct  661   WALSSLAHSELSVVFYEKVLLLAWGFNNIIILIVGIIIFIFATVGVLLVMETLSAFLHAL  720

Query  416   RLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             RLHWVEFQNKFYEGDGYKF PFSF L+ +E+D
Sbjct  721   RLHWVEFQNKFYEGDGYKFYPFSFALLGDEDD  752



>ref|XP_010431556.1| PREDICTED: V-type proton ATPase subunit a2-like [Camelina sativa]
Length=767

 Score =  1124 bits (2908),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 590/822 (72%), Positives = 678/822 (82%), Gaps = 56/822 (7%)
 Frame = -2

Query  2783  MAERLGGRGGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPF  2604
             MAE     GGC PPMDL RSEPMQLVQ+I+P+ESA L+V+YLGDLGL+QFKDLN++KSPF
Sbjct  1     MAET---HGGCCPPMDLMRSEPMQLVQVIVPMESAHLTVSYLGDLGLVQFKDLNSDKSPF  57

Query  2603  QRTYAAQIKRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIE  2424
             QRTYAAQ                                                   + 
Sbjct  58    QRTYAAQ---------------------------------------------------VS  66

Query  2423  INANNDKLQRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllse  2244
              NANNDKLQRS+NELVEYKLVLQK GEFF SA  SA AQQ E  + ++GE+ LEAPLL E
Sbjct  67    FNANNDKLQRSYNELVEYKLVLQKAGEFFASAHRSATAQQSEIETHEAGEDLLEAPLLQE  126

Query  2243  PDMSADTSKQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKV  2064
              + S D +KQV+LGF++GLVP+EKSM FERILFRATRGN+ +RQS ++ESV+DP SGEK 
Sbjct  127   -EKSVDPTKQVKLGFLTGLVPREKSMVFERILFRATRGNIFIRQSVIEESVVDPNSGEKA  185

Query  2063  EKNVFLVFYSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAG  1884
             EKNVF+VF+SGERAK+KILKIC+AFGANRYPF+E+LG+QAQ++TEVSG++SELKT I AG
Sbjct  186   EKNVFVVFFSGERAKSKILKICEAFGANRYPFSEDLGRQAQMMTEVSGRLSELKTTIGAG  245

Query  1883  ILHRGNLLQSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQD  1704
             + HR  LL++I E+F++WN+ VR+EK+IYHTLNMLS+DVTKKCLV EGWSP  A  E+QD
Sbjct  246   LDHRNILLETIGEKFEQWNLKVRKEKAIYHTLNMLSLDVTKKCLVGEGWSPVFAATELQD  305

Query  1703  ALQRAGHDSNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFT  1524
             ALQRA  DSNS++G+IF+VL T+E PPT+F+TNKFT+AFQEIVDAYGVAKYQEANP VFT
Sbjct  306   ALQRAAVDSNSQVGSIFQVLRTKEMPPTFFRTNKFTTAFQEIVDAYGVAKYQEANPSVFT  365

Query  1523  IVTFPFLFAVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALF  1344
             IVTFPFLFAVMFGDWGHGICLLLAT+Y ++REKKLSSQKLGDI EM FGGRYVI MM+LF
Sbjct  366   IVTFPFLFAVMFGDWGHGICLLLATMYLILREKKLSSQKLGDIMEMAFGGRYVIFMMSLF  425

Query  1343  SIYTGFIYNEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSE  1164
             SIYTG IYNEFFS+ + LF  SAY CRD SCS+ATTIGLIK RDTY FGVDP WHGTRSE
Sbjct  426   SIYTGLIYNEFFSIPYPLFASSAYECRDVSCSEATTIGLIKTRDTYPFGVDPVWHGTRSE  485

Query  1163  LPFLNSLKMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSV  984
             LPFLNSLKMK+SILLGVAQMNLGII+S+FNA +F+S VN W QF+PQ+IFLN LFGYLSV
Sbjct  486   LPFLNSLKMKMSILLGVAQMNLGIIMSFFNAKFFKSAVNVWFQFVPQMIFLNCLFGYLSV  545

Query  983   LIIVKWCTGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPK  804
             LII+KWCTGSQADLYHVMIYMFL P +DLGENQLFP QK  QL  + LALVSVPWMLLPK
Sbjct  546   LIIIKWCTGSQADLYHVMIYMFLSPMDDLGENQLFPNQKLVQLTFLFLALVSVPWMLLPK  605

Query  803   PFILKSQHN-RHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLG  627
             PFILK QH  RHQGQSYA + + DESL V+ +     HEEFEFSE+FVHQLIHTIEFVLG
Sbjct  606   PFILKKQHEARHQGQSYAQLDETDESLQVETNGGGHGHEEFEFSEIFVHQLIHTIEFVLG  665

Query  626   AVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVM  447
             AVSNTASYLRLWALSLAHSELS+VFYEKVLL+AWG+NNI IL++G ++FIFAT+GVLLVM
Sbjct  666   AVSNTASYLRLWALSLAHSELSSVFYEKVLLMAWGFNNIFILIIGILVFIFATVGVLLVM  725

Query  446   ETLSAFLHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             ETLSAFLHALRLHWVE+QNKFYEGDGYKF PF+F LV  EE+
Sbjct  726   ETLSAFLHALRLHWVEYQNKFYEGDGYKFAPFTFTLVANEEE  767



>ref|XP_010472132.1| PREDICTED: V-type proton ATPase subunit a2 isoform X2 [Camelina 
sativa]
Length=756

 Score =  1113 bits (2878),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 576/756 (76%), Positives = 664/756 (88%), Gaps = 2/756 (0%)
 Frame = -2

Query  2585  QIKRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANND  2406
             +IKR GEMARK+RFFKDQMSKAGV+     D ++ I  DD+EVKLG+LEAEL+EINANND
Sbjct  2     KIKRCGEMARKIRFFKDQMSKAGVTPKDFLDKENDIDLDDVEVKLGELEAELVEINANND  61

Query  2405  KLQRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSAD  2226
             KLQRS+NELVEYKLVL+K GEFF SA  SA AQQ E  + ++GE+ LEAPLL E + S D
Sbjct  62    KLQRSYNELVEYKLVLEKAGEFFASAHRSATAQQSEIETQEAGEDLLEAPLLQE-EKSVD  120

Query  2225  TSKQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFL  2046
              +KQV+LGF++GLVP+EKSM FERILFRATRGN+ +RQS ++ESV+DP SGEK EKNVF+
Sbjct  121   PTKQVKLGFLTGLVPREKSMVFERILFRATRGNIFIRQSVIEESVVDPNSGEKAEKNVFV  180

Query  2045  VFYSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGN  1866
             VFYSGERAK+KILKIC+AFGANRYPF+E+LG+QAQ++TEVSG++SELKT I AG+ HR  
Sbjct  181   VFYSGERAKSKILKICEAFGANRYPFSEDLGRQAQMMTEVSGRLSELKTTIGAGLDHRNI  240

Query  1865  LLQSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAG  1686
             LL++I E+F++WN+ VR+EK+IYHTLNMLS+DVTKKCLV EGWSP  A  E+QDALQRA 
Sbjct  241   LLETIGEKFEQWNLKVRKEKAIYHTLNMLSLDVTKKCLVGEGWSPVFAATELQDALQRAA  300

Query  1685  HDSNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPF  1506
              DSNS++G+IF+VL T+E PPT+F+TNKFT+AFQEIVDAYGVAKYQEANP VFTIVTFPF
Sbjct  301   VDSNSQVGSIFQVLRTKEMPPTFFRTNKFTTAFQEIVDAYGVAKYQEANPSVFTIVTFPF  360

Query  1505  LFAVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGF  1326
             LFAVMFGDWGHGICLLLAT+Y ++REKKLSSQKLGDI EM FGGRYVI MM+LFSIYTG 
Sbjct  361   LFAVMFGDWGHGICLLLATMYLILREKKLSSQKLGDIMEMAFGGRYVIFMMSLFSIYTGL  420

Query  1325  IYNEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNS  1146
             IYNEFFS+ + LF  SAY CRD SCS+ATTIGLIK RDTY FGVDP WHGTRSELPFLNS
Sbjct  421   IYNEFFSIPYPLFASSAYECRDVSCSEATTIGLIKTRDTYPFGVDPVWHGTRSELPFLNS  480

Query  1145  LKMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKW  966
             LKMK+SILLGVAQMNLGII+S+FNA +F+S VN W QF+PQ+IFLN LFGYLSVLII+KW
Sbjct  481   LKMKMSILLGVAQMNLGIIMSFFNAKFFKSAVNVWFQFVPQMIFLNCLFGYLSVLIIIKW  540

Query  965   CTGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKS  786
             CTGSQADLYHVMIYMFL P +DLGENQLFP QK  QL  + LALVSVPWMLLPKPFILK 
Sbjct  541   CTGSQADLYHVMIYMFLSPMDDLGENQLFPNQKIVQLTFLFLALVSVPWMLLPKPFILKK  600

Query  785   QHN-RHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTA  609
             QH  RHQGQSYA + + DESL V+ +     HEEFEFSE+FVHQLIHTIEFVLGAVSNTA
Sbjct  601   QHEARHQGQSYAQLDETDESLQVETNGGGHGHEEFEFSEIFVHQLIHTIEFVLGAVSNTA  660

Query  608   SYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAF  429
             SYLRLWALSLAHSELS+VFYEKVLL+AWG+NNI+IL++G ++FIFAT+GVLLVMETLSAF
Sbjct  661   SYLRLWALSLAHSELSSVFYEKVLLMAWGFNNILILIIGILVFIFATVGVLLVMETLSAF  720

Query  428   LHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             LHALRLHWVE+QNKFYEGDGYKF PF+F LV  EE+
Sbjct  721   LHALRLHWVEYQNKFYEGDGYKFAPFTFTLVGNEEE  756



>gb|EMT24018.1| Vacuolar proton translocating ATPase 100 kDa subunit [Aegilops 
tauschii]
Length=818

 Score =  1109 bits (2868),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 578/816 (71%), Positives = 682/816 (84%), Gaps = 5/816 (1%)
 Frame = -2

Query  2759  GGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQI  2580
             GGC PPMDL RSE MQLVQ+IIP ESARL+V+ LGDLGL+QFKDLNA+KSPFQR YAAQI
Sbjct  5     GGCCPPMDLLRSEAMQLVQVIIPAESARLAVSNLGDLGLLQFKDLNADKSPFQRAYAAQI  64

Query  2579  KRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKL  2400
             KR GEMARKLRFFK+QMSKA +  S    +   ++  DLE+KLG+ EAEL E+N NN KL
Sbjct  65    KRCGEMARKLRFFKEQMSKAAILTSPTQFSGAPLEIGDLEIKLGEFEAELTEVNTNNRKL  124

Query  2399  QRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTS  2220
             QR++NELVEY ++L+K GEFF+SA+ SA  QQ+E  + QSG+ SLE+PLL + +M  D S
Sbjct  125   QRTYNELVEYNVLLEKTGEFFYSAQRSAAEQQREMVADQSGDSSLESPLLHQ-EMVIDPS  183

Query  2219  KQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVF  2040
             K V+LG + GLVPK+K+MAFERIL+RATRGN+LLRQ  VDE + DP SGEK  KN F++F
Sbjct  184   KHVKLGSLIGLVPKQKAMAFERILYRATRGNMLLRQESVDEPITDPQSGEKAVKNSFVIF  243

Query  2039  YSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLL  1860
             YSGERAK+KILKICDAFGANRYPF E+L  Q   I EVSGK+SELK  ++ G+ HR  +L
Sbjct  244   YSGERAKSKILKICDAFGANRYPFPEDLATQLHTIQEVSGKVSELKATVEIGLAHRDGIL  303

Query  1859  QSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHD  1680
             +SIA ++++WN L+++EK+IYHTLNM S+DVTKKCLVAEGWSP  AT ++QDAL RA   
Sbjct  304   ESIACEYEQWNNLLKKEKAIYHTLNMFSLDVTKKCLVAEGWSPVFATSQVQDALHRATSG  363

Query  1679  SNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLF  1500
             SNSE+G IF++L T+ESPPTYF+TNKFTS+FQ+IVDAYG+A YQE NPG+FTIVTFPFLF
Sbjct  364   SNSEVGCIFQILNTQESPPTYFQTNKFTSSFQDIVDAYGIASYQEVNPGLFTIVTFPFLF  423

Query  1499  AVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIY  1320
             AVMFGDWGHGIC+ L  +Y +IREKKL+SQKL DI E+ F GRYVILMM+LFSIYTG IY
Sbjct  424   AVMFGDWGHGICIFLTAMYLIIREKKLASQKLDDIVEIMFAGRYVILMMSLFSIYTGLIY  483

Query  1319  NEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLK  1140
             NEFFSV FELFG+SAY C DPSC DATT GL++   TY FGVDP WHG+RSELPFLNSLK
Sbjct  484   NEFFSVPFELFGKSAYACHDPSCGDATTEGLVRVGQTYPFGVDPVWHGSRSELPFLNSLK  543

Query  1139  MKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCT  960
             MK+SILLG+AQMNLGI+LS+FNA YF++ VN W QF+PQ+IFLN+LFGYLS+LII+KWCT
Sbjct  544   MKMSILLGIAQMNLGIVLSFFNAKYFKNIVNVWYQFVPQLIFLNSLFGYLSLLIIIKWCT  603

Query  959   GSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQH  780
             GS+ADLYH+MIYMFL PT+D+GENQLFPGQ+  QLVL+LLALVSVPWML PKP  LK QH
Sbjct  604   GSKADLYHIMIYMFLSPTDDIGENQLFPGQRIVQLVLLLLALVSVPWMLFPKPLFLKKQH  663

Query  779   -NRHQGQSYAPIQDLDESL--LvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTA  609
               RHQGQ Y  +Q+ DES+  L     +  +HEEFEFSEV VHQLIHTIEFVLGAVSNTA
Sbjct  664   EQRHQGQHYTMLQETDESVAQLGGQHENPHNHEEFEFSEVLVHQLIHTIEFVLGAVSNTA  723

Query  608   SYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAF  429
             SYLRLWALSLAHSELS+VFY+KVLLL   YNN+IILV+G  +F+FATI VLL METLSAF
Sbjct  724   SYLRLWALSLAHSELSSVFYDKVLLLD-KYNNVIILVMGVTVFLFATIFVLLSMETLSAF  782

Query  428   LHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             LHALRLHWVEFQ KFY+G GYKF PF+F  + EEED
Sbjct  783   LHALRLHWVEFQGKFYDGSGYKFAPFAFASIIEEED  818



>dbj|BAJ94235.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=801

 Score =  1108 bits (2867),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 570/816 (70%), Positives = 672/816 (82%), Gaps = 22/816 (3%)
 Frame = -2

Query  2759  GGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQI  2580
             GGC PPMDL RSE MQLVQ+IIP+ESARL+V+ LGDLGL+QFKDLNA+KSPFQR YAAQI
Sbjct  5     GGCCPPMDLLRSEAMQLVQVIIPVESARLAVSNLGDLGLLQFKDLNADKSPFQRAYAAQI  64

Query  2579  KRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKL  2400
             KR GEMARKLRFFK+QMSKA +  S    +   ++  DLE+KLG+ EAEL E+N NN KL
Sbjct  65    KRCGEMARKLRFFKEQMSKAAILTSPTQFSGAPLEIGDLEIKLGEFEAELTEVNTNNRKL  124

Query  2399  QRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTS  2220
             QR++NELVEY ++L+K GEFF+SA+ SA  QQ+E  + QSG+ SLE+PLL + +M  D S
Sbjct  125   QRTYNELVEYNVLLEKTGEFFYSAQRSAAEQQREMVADQSGDSSLESPLLHQ-EMVIDPS  183

Query  2219  KQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVF  2040
             KQV+LG + GLVPK+K+MAFERIL+RATRGN+LLRQ  VDE +IDP SGEK  KN F++F
Sbjct  184   KQVKLGSLIGLVPKQKAMAFERILYRATRGNMLLRQESVDEPIIDPQSGEKAVKNYFVIF  243

Query  2039  YSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLL  1860
             YSGERAK+KILKICDAFGANRYPF E+L  Q   I EVSGK+SELK  ++ G+ HR  +L
Sbjct  244   YSGERAKSKILKICDAFGANRYPFPEDLATQLDTIQEVSGKVSELKATVEIGLAHRDGIL  303

Query  1859  QSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHD  1680
             ++IA ++++WN L+++EK+IYHTLNM S+DVTKKCLVAEGWSP  AT +IQDAL RA   
Sbjct  304   KNIASEYEQWNNLLKKEKAIYHTLNMFSLDVTKKCLVAEGWSPVFATSQIQDALHRATTY  363

Query  1679  SNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLF  1500
             SNSE+G IF+++ T+ESPPTYF+TNKFTS+FQ+IVDAYG+A YQE NPG+FTIVTFPFLF
Sbjct  364   SNSEVGCIFQIINTQESPPTYFQTNKFTSSFQDIVDAYGIASYQEINPGLFTIVTFPFLF  423

Query  1499  AVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIY  1320
             AVMFGDWGHGIC+ L+ LY +IREKKL+SQKL DI ++ F GRYVILMM+LFSIYTG IY
Sbjct  424   AVMFGDWGHGICIFLSALYLIIREKKLASQKLDDIVQIMFDGRYVILMMSLFSIYTGLIY  483

Query  1319  NEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLK  1140
             NEFFSV FELFG+SAY C DPSC DATT GL+K R  Y FGVDP WHG+RSELPFLNSLK
Sbjct  484   NEFFSVPFELFGKSAYACHDPSCGDATTEGLVKVRQAYPFGVDPVWHGSRSELPFLNSLK  543

Query  1139  MKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCT  960
             MK+SILLG+AQMNLGI+LS+FNA YF++ VN W QF+PQ+IFLN+LFGYLS LII+KWCT
Sbjct  544   MKMSILLGIAQMNLGIVLSFFNAKYFKNTVNIWHQFVPQLIFLNSLFGYLSFLIIIKWCT  603

Query  959   GSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQH  780
             GS+ADLYH+MIYMFL PT+D+GENQLFPGQ+  Q                  P  LK QH
Sbjct  604   GSKADLYHIMIYMFLSPTDDIGENQLFPGQRIVQ------------------PLFLKKQH  645

Query  779   -NRHQGQSYAPIQDLDESL--LvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTA  609
               RHQGQ Y  +Q+ DES+  L+    +   HEEFEFSEV VHQ+IHTIEFVLGAVSNTA
Sbjct  646   EQRHQGQHYTMLQETDESVAQLIGQHENPHQHEEFEFSEVLVHQMIHTIEFVLGAVSNTA  705

Query  608   SYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAF  429
             SYLRLWALSLAHSELS+VFY+KVLLLAWGYNN+IILVVG I+F+FATI VLL METLSAF
Sbjct  706   SYLRLWALSLAHSELSSVFYDKVLLLAWGYNNVIILVVGVIVFLFATIIVLLSMETLSAF  765

Query  428   LHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             LHALRLHWVEFQ KFYEG GYKF PFSF  + EEED
Sbjct  766   LHALRLHWVEFQGKFYEGGGYKFAPFSFASIIEEED  801



>ref|XP_007017675.1| Vacuolar proton ATPase A3 isoform 3 [Theobroma cacao]
 gb|EOY14900.1| Vacuolar proton ATPase A3 isoform 3 [Theobroma cacao]
Length=753

 Score =  1097 bits (2836),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 566/751 (75%), Positives = 649/751 (86%), Gaps = 2/751 (0%)
 Frame = -2

Query  2765  GRGGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAA  2586
             G G   P MDL RSEPMQLVQLIIPIESA  S++YLGDLGL QFKDLN+EKSPFQRTYA 
Sbjct  2     GEGRQRPTMDLLRSEPMQLVQLIIPIESAHRSISYLGDLGLFQFKDLNSEKSPFQRTYAT  61

Query  2585  QIKRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANND  2406
             QIKRSGEMARKLRFFK+QM+KAG+S S  S   D +  D+LEVKLG+LEAELIE+NAN++
Sbjct  62    QIKRSGEMARKLRFFKEQMTKAGLSPSTRSARNDDVDLDNLEVKLGELEAELIEMNANHE  121

Query  2405  KLQRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSAD  2226
             KLQ+S+NEL EYKLV+QK GEFF SA+SSA A+Q+E  + Q GE S+++PLL E +M  D
Sbjct  122   KLQQSYNELKEYKLVMQKAGEFFQSAQSSAAAKQREAEAEQRGEGSIDSPLLLEQEMVTD  181

Query  2225  TSKQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFL  2046
              SKQV+LGF+SGLV +E+S+AFERILFRATRGNV L+QS V++ V DP SGEKVEKNVF+
Sbjct  182   PSKQVKLGFVSGLVSRERSLAFERILFRATRGNVFLKQSVVEDPVTDPASGEKVEKNVFI  241

Query  2045  VFYSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGN  1866
             VFYSGERA+NKI+KIC+ FGANRYPF E+LGKQ Q+ITEVSG++ ELKT ID G++H+ N
Sbjct  242   VFYSGERARNKIMKICEVFGANRYPFTEDLGKQFQIITEVSGRLEELKTTIDVGLVHQSN  301

Query  1865  LLQSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAG  1686
             LLQ+IA  F+ W++LV++EKSIYHTLNMLSIDV++KCLVAEGW P  AT +IQ+ LQ+A 
Sbjct  302   LLQTIAYHFENWSLLVKKEKSIYHTLNMLSIDVSRKCLVAEGWCPVFATNQIQNVLQKAT  361

Query  1685  HDSNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPF  1506
              DS+S++G IF VL T+ESPPTYF TNKFTSAFQEIVDAYG+AKYQEANP VFTI+TFPF
Sbjct  362   IDSSSQVGTIFHVLQTKESPPTYFHTNKFTSAFQEIVDAYGIAKYQEANPAVFTIITFPF  421

Query  1505  LFAVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGF  1326
             LFAVMFGDWGHGICL LAT YF+IREKK SSQKLGDITEM FGGRYVI+MMALFSIYTG 
Sbjct  422   LFAVMFGDWGHGICLCLATSYFIIREKKFSSQKLGDITEMIFGGRYVIMMMALFSIYTGL  481

Query  1325  IYNEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNS  1146
             IYNEFFSV FELFG SAY C DPSCSDA+T GL+K R TY FGVDP WHGTRSELPFLNS
Sbjct  482   IYNEFFSVPFELFGPSAYGCHDPSCSDASTAGLVKVRATYPFGVDPKWHGTRSELPFLNS  541

Query  1145  LKMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKW  966
             LKMK+SIL+GVAQMNLGIILSYFNA +F++ +N W QF+PQ+IFLN+LFGYLS+LI+VKW
Sbjct  542   LKMKMSILIGVAQMNLGIILSYFNAKFFKNEINIWYQFVPQLIFLNSLFGYLSLLIVVKW  601

Query  965   CTGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKS  786
             CTGSQADLYHVMIYMFL PT+DLGENQLF GQK  Q+VL+L ALVSVPWML PKPF+LK 
Sbjct  602   CTGSQADLYHVMIYMFLSPTDDLGENQLFFGQKFLQIVLLLAALVSVPWMLFPKPFLLKK  661

Query  785   QH-NRHQGQSYAPIQDLDESLLvdgshd-ssdheefefsevfvHQLIHTIEFVLGAVSNT  612
             QH  RH+GQSYA +   D+  L    H  S  HEEFEFSEVFVHQLIHTIEFVLGAVSNT
Sbjct  662   QHEERHRGQSYALLDSSDDDPLEMELHHGSGSHEEFEFSEVFVHQLIHTIEFVLGAVSNT  721

Query  611   ASYLRLWALSLAHSELSTVFYEKVLLLAWGY  519
             ASYLRLWALSLAHSELS+VFY+KVLLLAWGY
Sbjct  722   ASYLRLWALSLAHSELSSVFYDKVLLLAWGY  752



>ref|XP_007017676.1| Vacuolar proton ATPase A3 isoform 4 [Theobroma cacao]
 gb|EOY14901.1| Vacuolar proton ATPase A3 isoform 4 [Theobroma cacao]
Length=751

 Score =  1094 bits (2830),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 565/750 (75%), Positives = 648/750 (86%), Gaps = 2/750 (0%)
 Frame = -2

Query  2765  GRGGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAA  2586
             G G   P MDL RSEPMQLVQLIIPIESA  S++YLGDLGL QFKDLN+EKSPFQRTYA 
Sbjct  2     GEGRQRPTMDLLRSEPMQLVQLIIPIESAHRSISYLGDLGLFQFKDLNSEKSPFQRTYAT  61

Query  2585  QIKRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANND  2406
             QIKRSGEMARKLRFFK+QM+KAG+S S  S   D +  D+LEVKLG+LEAELIE+NAN++
Sbjct  62    QIKRSGEMARKLRFFKEQMTKAGLSPSTRSARNDDVDLDNLEVKLGELEAELIEMNANHE  121

Query  2405  KLQRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSAD  2226
             KLQ+S+NEL EYKLV+QK GEFF SA+SSA A+Q+E  + Q GE S+++PLL E +M  D
Sbjct  122   KLQQSYNELKEYKLVMQKAGEFFQSAQSSAAAKQREAEAEQRGEGSIDSPLLLEQEMVTD  181

Query  2225  TSKQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFL  2046
              SKQV+LGF+SGLV +E+S+AFERILFRATRGNV L+QS V++ V DP SGEKVEKNVF+
Sbjct  182   PSKQVKLGFVSGLVSRERSLAFERILFRATRGNVFLKQSVVEDPVTDPASGEKVEKNVFI  241

Query  2045  VFYSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGN  1866
             VFYSGERA+NKI+KIC+ FGANRYPF E+LGKQ Q+ITEVSG++ ELKT ID G++H+ N
Sbjct  242   VFYSGERARNKIMKICEVFGANRYPFTEDLGKQFQIITEVSGRLEELKTTIDVGLVHQSN  301

Query  1865  LLQSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAG  1686
             LLQ+IA  F+ W++LV++EKSIYHTLNMLSIDV++KCLVAEGW P  AT +IQ+ LQ+A 
Sbjct  302   LLQTIAYHFENWSLLVKKEKSIYHTLNMLSIDVSRKCLVAEGWCPVFATNQIQNVLQKAT  361

Query  1685  HDSNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPF  1506
              DS+S++G IF VL T+ESPPTYF TNKFTSAFQEIVDAYG+AKYQEANP VFTI+TFPF
Sbjct  362   IDSSSQVGTIFHVLQTKESPPTYFHTNKFTSAFQEIVDAYGIAKYQEANPAVFTIITFPF  421

Query  1505  LFAVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGF  1326
             LFAVMFGDWGHGICL LAT YF+IREKK SSQKLGDITEM FGGRYVI+MMALFSIYTG 
Sbjct  422   LFAVMFGDWGHGICLCLATSYFIIREKKFSSQKLGDITEMIFGGRYVIMMMALFSIYTGL  481

Query  1325  IYNEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNS  1146
             IYNEFFSV FELFG SAY C DPSCSDA+T GL+K R TY FGVDP WHGTRSELPFLNS
Sbjct  482   IYNEFFSVPFELFGPSAYGCHDPSCSDASTAGLVKVRATYPFGVDPKWHGTRSELPFLNS  541

Query  1145  LKMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKW  966
             LKMK+SIL+GVAQMNLGIILSYFNA +F++ +N W QF+PQ+IFLN+LFGYLS+LI+VKW
Sbjct  542   LKMKMSILIGVAQMNLGIILSYFNAKFFKNEINIWYQFVPQLIFLNSLFGYLSLLIVVKW  601

Query  965   CTGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKS  786
             CTGSQADLYHVMIYMFL PT+DLGENQLF GQK  Q+VL+L ALVSVPWML PKPF+LK 
Sbjct  602   CTGSQADLYHVMIYMFLSPTDDLGENQLFFGQKFLQIVLLLAALVSVPWMLFPKPFLLKK  661

Query  785   QH-NRHQGQSYAPIQDLDESLLvdgshd-ssdheefefsevfvHQLIHTIEFVLGAVSNT  612
             QH  RH+GQSYA +   D+  L    H  S  HEEFEFSEVFVHQLIHTIEFVLGAVSNT
Sbjct  662   QHEERHRGQSYALLDSSDDDPLEMELHHGSGSHEEFEFSEVFVHQLIHTIEFVLGAVSNT  721

Query  611   ASYLRLWALSLAHSELSTVFYEKVLLLAWG  522
             ASYLRLWALSLAHSELS+VFY+KVLLLAWG
Sbjct  722   ASYLRLWALSLAHSELSSVFYDKVLLLAWG  751



>ref|XP_003527676.1| PREDICTED: vacuolar proton ATPase a3-like [Glycine max]
Length=815

 Score =  1087 bits (2812),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 579/816 (71%), Positives = 679/816 (83%), Gaps = 5/816 (1%)
 Frame = -2

Query  2765  GRGGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAA  2586
               G   P MDL RSEPMQLVQLIIPIESA  S++YLGDLGLIQFKDLNA+KSPFQRTYA+
Sbjct  3     NEGRFLPTMDLLRSEPMQLVQLIIPIESAHRSISYLGDLGLIQFKDLNADKSPFQRTYAS  62

Query  2585  QIKRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANND  2406
             QIKR GEMAR+LR FK+QM+KAGVS S  S   +    + LEVKL +LEAEL+EINANN+
Sbjct  63    QIKRCGEMARRLRLFKEQMTKAGVSPSTWSTRDNHFDLEHLEVKLEELEAELLEINANNE  122

Query  2405  KLQRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSAD  2226
             KLQ ++NEL+EYKLVL+KVGEFF SA+   +A  Q+                   +    
Sbjct  123   KLQHTYNELLEYKLVLEKVGEFFSSAK--NKAVAQQKELEFQTTVEGSIDSPLLLEQEET  180

Query  2225  TSKQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFL  2046
             T+KQ++L FISGLV +EKS+ FERI+FRATRGNV L+Q+ +   V+DP+SGEKV KNVF+
Sbjct  181   TTKQIKLRFISGLVHREKSIPFERIIFRATRGNVFLKQAVIQHPVLDPLSGEKVHKNVFV  240

Query  2045  VFYSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGN  1866
             VFYSGER K+KILKICDAFGANRYPF+++L KQ Q I EVSG++SELKT IDAG++HR  
Sbjct  241   VFYSGERVKSKILKICDAFGANRYPFSDDLSKQFQTIREVSGRLSELKTTIDAGLIHRST  300

Query  1865  LLQSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAG  1686
             LLQ+I   +++W++ +++EKSIYHTLNMLSI+VTKKCL+AEGW P  AT +I   L+RA 
Sbjct  301   LLQTIGYHYEQWSLQLKKEKSIYHTLNMLSINVTKKCLLAEGWCPVFATSQIHKVLERAT  360

Query  1685  HDSNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPF  1506
              D +S++GAIF+VL T+ESPPTYF TNKFTS+FQEIVDAYG+AKYQEANPGV+TIVTFPF
Sbjct  361   MDCSSQVGAIFQVLETKESPPTYFSTNKFTSSFQEIVDAYGIAKYQEANPGVYTIVTFPF  420

Query  1505  LFAVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGF  1326
             LFAVMFGDWGHGICLLLA LY +IREKK +SQKLGDI EM FGGRY+I++MALFSIYTG 
Sbjct  421   LFAVMFGDWGHGICLLLAALYLIIREKKFASQKLGDIMEMAFGGRYIIMLMALFSIYTGL  480

Query  1325  IYNEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNS  1146
             IYNEFFSV FELFG SAY CRD SC DA+T G IK R TY FGVDP WHGTRSELPFLNS
Sbjct  481   IYNEFFSVPFELFGPSAYGCRDSSCRDASTTGFIKVRSTYPFGVDPKWHGTRSELPFLNS  540

Query  1145  LKMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKW  966
             LKMK+SILLGV+QMNLGII+SYFNA YF + +N W QF+PQIIFLN+LFGYLS+LII+KW
Sbjct  541   LKMKMSILLGVSQMNLGIIMSYFNAKYFENNINIWYQFVPQIIFLNSLFGYLSLLIIIKW  600

Query  965   CTGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKS  786
              TGSQADLYHVMIYMFL PT+DLGENQLF GQK  QLVL+LLALV+VPWML+PKPF+LK 
Sbjct  601   STGSQADLYHVMIYMFLSPTDDLGENQLFVGQKLLQLVLLLLALVAVPWMLVPKPFLLKK  660

Query  785   QHN-RHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTA  609
             QH  RHQGQSY  +   D+ L  +    S  H+EF+FSEVFVHQLIHTIEFVLGAVSNTA
Sbjct  661   QHQERHQGQSYDLLYGTDDPL--ESESQSIPHDEFDFSEVFVHQLIHTIEFVLGAVSNTA  718

Query  608   SYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAF  429
             SYLRLWALSLAHSELS+VFY+KVLLLAWGYN+ I+L+VG  +FI AT+GVLL+ME+LSAF
Sbjct  719   SYLRLWALSLAHSELSSVFYDKVLLLAWGYNSTIVLIVGIFVFICATVGVLLLMESLSAF  778

Query  428   LHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             LHALRLHWVE+QNKFYEGDGYKF PFSF L+ +E++
Sbjct  779   LHALRLHWVEYQNKFYEGDGYKFFPFSFTLLTDEDE  814



>gb|EMT31646.1| Vacuolar proton translocating ATPase 100 kDa subunit [Aegilops 
tauschii]
Length=757

 Score =  1078 bits (2789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 557/774 (72%), Positives = 644/774 (83%), Gaps = 31/774 (4%)
 Frame = -2

Query  2633  KDLNAEKSPFQRTYAAQIKRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVK  2454
             + LNA+KSPFQRTYAAQIKR  EMARKLRFFK+QMSKAG+  S    T+  + FDD+EVK
Sbjct  12    ESLNADKSPFQRTYAAQIKRCAEMARKLRFFKEQMSKAGILVSPMQSTETPLDFDDMEVK  71

Query  2453  LGDLEAELIEINANNDKLQRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsge  2274
             LG+LEAEL E+NAN++KLQR+ NEL+EY  VLQK GEFF+SA+ SA AQ ++  ++QSGE
Sbjct  72    LGELEAELTEVNANDEKLQRAHNELLEYSTVLQKAGEFFYSAQRSAAAQHRQMEANQSGE  131

Query  2273  esleapllsePDMSADTSKQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDES  2094
              SLE+PLL + DM  D SKQV+LG +SGLVPKEK+MAFERILFRATRGN+LLRQ  VDE 
Sbjct  132   TSLESPLLEQ-DMLTDASKQVKLGSLSGLVPKEKAMAFERILFRATRGNILLRQESVDEP  190

Query  2093  VIDPISGEKVEKNVFLVFYSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKI  1914
             V DP SGEKV KN F+VFYSGERAK KILKICDAF ANRYPF E+L KQ   + EVSGKI
Sbjct  191   VTDPQSGEKVYKNTFVVFYSGERAKAKILKICDAFRANRYPFPEDLAKQTHTVQEVSGKI  250

Query  1913  SELKTAIDAGILHRGNLLQSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWS  1734
             SELK  ID G+ HR ++L++IA +F+ WN L ++EKSIYHTLNMLS+DVTKKCLV EGWS
Sbjct  251   SELKATIDMGLAHRDSILKTIASEFEHWNHLAKKEKSIYHTLNMLSVDVTKKCLVGEGWS  310

Query  1733  PTSATIEIQDALQRAGHDSNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAK  1554
             P  A  +IQDALQRA  +S S++G+IF+VL T+ESPPTYF+TNKFTSAFQEIVDAYGVAK
Sbjct  311   PVFAANQIQDALQRATLESKSQVGSIFQVLNTKESPPTYFQTNKFTSAFQEIVDAYGVAK  370

Query  1553  YQEANPGVFTIVTFPFLFAVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGG  1374
             YQEANPGV+TI+TFPFLFAVMFGDWGHGIC+LLATLY +IREKK +SQKLGDI EM FGG
Sbjct  371   YQEANPGVYTIITFPFLFAVMFGDWGHGICILLATLYLIIREKKFASQKLGDIMEMMFGG  430

Query  1373  RYVILMMALFSIYTGFIYNEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGV  1194
             RY+I+MM++FSIYTG IYNEFFSV FELF +SAY CRD SCSD+TT GLIK RDTY FGV
Sbjct  431   RYIIMMMSIFSIYTGLIYNEFFSVPFELFAKSAYACRDSSCSDSTTEGLIKVRDTYPFGV  490

Query  1193  DPAWHGTRSELPFLNSLKMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIF  1014
             DP WHG+RSELPFLNSLKMK+SILLGV+QMNLGI +SYFNA +FR+ VN W QF+PQ+IF
Sbjct  491   DPVWHGSRSELPFLNSLKMKMSILLGVSQMNLGIFMSYFNAKFFRNSVNIWYQFVPQLIF  550

Query  1013  LNALFGYLSVLIIVKWCTGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllal  834
             LN+LFGYLS+LII+KWCTGS+ADLYHVMIYMFL PT+D+GENQLFPGQKT Q        
Sbjct  551   LNSLFGYLSMLIIIKWCTGSKADLYHVMIYMFLSPTDDMGENQLFPGQKTLQ--------  602

Query  833   vsVPWMLLPKPFILKSQHNRHQGQSYAPIQDLDESL---Lvdgshdssdheefefsevfv  663
                                RHQG  YA ++  DES+   L + + +S+ HEEFEFSE+FV
Sbjct  603   -------------------RHQGHQYAMLEGADESVVAELGEHNEESNHHEEFEFSEIFV  643

Query  662   HQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfii  483
             HQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSTVFY+KVLLL  GYNNI IL +G ++
Sbjct  644   HQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSTVFYDKVLLLTLGYNNIFILAIGVVV  703

Query  482   fiFATIGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             FI AT+GVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKF PFSF L+ E+E+
Sbjct  704   FICATVGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFAPFSFALISEDEE  757



>ref|XP_010061011.1| PREDICTED: V-type proton ATPase subunit a3-like isoform X2 [Eucalyptus 
grandis]
Length=755

 Score =  1077 bits (2784),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 556/755 (74%), Positives = 653/755 (86%), Gaps = 1/755 (0%)
 Frame = -2

Query  2582  IKRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDK  2403
             +KRSGEMARKLRF ++QM KAG+S S        +  ++LEVKLG+LEA++IE+NANN++
Sbjct  1     MKRSGEMARKLRFLREQMIKAGLSTSTRPLAGTDVDLENLEVKLGELEADIIEMNANNEQ  60

Query  2402  LQRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADT  2223
             LQR++ EL+EYKLVLQK GE FHS +S A  QQ+E  +   GE S+++PLL E +M  D 
Sbjct  61    LQRTYAELLEYKLVLQKAGEIFHSTKSIAAVQQRELEAQSPGEGSIDSPLLLEQEMVTDP  120

Query  2222  SKQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLV  2043
             SKQV+LGF+SGL+ ++KS AFERILFRATRGNV L+Q+ V+E + DP SGEKVEKNVF++
Sbjct  121   SKQVKLGFVSGLMRRDKSAAFERILFRATRGNVFLKQAIVEEPIRDPASGEKVEKNVFVI  180

Query  2042  FYSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNL  1863
             FYSGERAKNKI+KIC+AF ANRYPFA+++GKQ Q+ITEVSG++SELKT ID G+LH+ +L
Sbjct  181   FYSGERAKNKIVKICEAFAANRYPFADDVGKQFQMITEVSGRLSELKTTIDVGLLHQASL  240

Query  1862  LQSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGH  1683
             LQ+IA QF+ W++LV++EKSIYHTLNMLSIDVTKKCLVAEGW P SAT +IQ+ALQ+A  
Sbjct  241   LQNIAYQFEHWSLLVKKEKSIYHTLNMLSIDVTKKCLVAEGWCPVSATTQIQNALQKATL  300

Query  1682  DSNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFL  1503
             D NS++GAIF VL T ESPPTYF TNKFT+AFQEI+DAYG+AKYQEANPGV+TI+TFPFL
Sbjct  301   DCNSQVGAIFHVLHTEESPPTYFCTNKFTTAFQEIIDAYGIAKYQEANPGVYTIITFPFL  360

Query  1502  FAVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFI  1323
             FAVMFGDWGHGICLL+ATLYF+ REKKLS+QKLGDIT M FGGRYVI+MMALFSIYTG I
Sbjct  361   FAVMFGDWGHGICLLMATLYFIFREKKLSNQKLGDITGMIFGGRYVIMMMALFSIYTGLI  420

Query  1322  YNEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSL  1143
             YNEFFSV FE+FG SAY CRD SC DA+T GLIK R TY FGVDP WHGTRSELPFLNSL
Sbjct  421   YNEFFSVPFEIFGPSAYACRDLSCRDASTQGLIKVRATYPFGVDPVWHGTRSELPFLNSL  480

Query  1142  KMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWC  963
             KMK+SILLGVAQMNLGI+LSYFNA +F + +N   QF+PQIIFLN+LFGYLS+LIIVKWC
Sbjct  481   KMKMSILLGVAQMNLGIVLSYFNARFFANDLNIRYQFVPQIIFLNSLFGYLSLLIIVKWC  540

Query  962   TGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQ  783
             TGSQADLYHVMIYMFL P EDLGENQLF GQK  Q++L+LLAL +VPWML PKPFILK Q
Sbjct  541   TGSQADLYHVMIYMFLSPMEDLGENQLFFGQKFLQVILLLLALAAVPWMLFPKPFILKKQ  600

Query  782   H-NRHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTAS  606
             H  RH+GQ YA +  +D+ L +D   DS  HEEFEFSEVFVHQLIHTIEFVLGAVSNTAS
Sbjct  601   HEERHKGQQYAILHSIDDPLEMDLDPDSHRHEEFEFSEVFVHQLIHTIEFVLGAVSNTAS  660

Query  605   YLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFL  426
             YLRLWALSLAHSELS+VFY+KVLLLAWG+NN ++L++G ++FI AT+GVLLVMETLSAFL
Sbjct  661   YLRLWALSLAHSELSSVFYDKVLLLAWGFNNTLVLIIGIVVFISATVGVLLVMETLSAFL  720

Query  425   HALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             HALRLHWVEFQNKFYEGDGYKF PFSF L+ EE++
Sbjct  721   HALRLHWVEFQNKFYEGDGYKFQPFSFALLSEEDE  755



>gb|EPS59200.1| hypothetical protein M569_15610, partial [Genlisea aurea]
Length=725

 Score =  1072 bits (2773),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 550/725 (76%), Positives = 634/725 (87%), Gaps = 4/725 (1%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             PPMDL RSE MQLVQLIIP+ESA L+++++G+LGLIQFKDLNA+KSPFQR YA QIKR G
Sbjct  1     PPMDLMRSEAMQLVQLIIPMESAHLAISHIGELGLIQFKDLNADKSPFQRAYAVQIKRCG  60

Query  2567  EMARKLRFFKDQMSKAGV-SASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRS  2391
             EM R+LRFF DQMSKAG+ S+   S       FDDLEVKLGDLEAELIEINAN DKLQRS
Sbjct  61    EMERELRFFHDQMSKAGLPSSEGGSSPTITASFDDLEVKLGDLEAELIEINANGDKLQRS  120

Query  2390  FNELVEYKLVLQKVGEFFHSA-RssaeaqqqeygssqsgeesleapllsePDMSADTSKQ  2214
             +NEL EY+L+LQ+  EFF+SA RS+   Q+    +  +  ESLEAPLL+E + S D++KQ
Sbjct  121   YNELAEYRLLLQRASEFFYSALRSAEAQQEDYEATQAARGESLEAPLLAEKEKSVDSTKQ  180

Query  2213  VRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYS  2034
             V LGFI+GLVP++K++AF+RILFRATRGNV L+Q+ VDE VIDP+SG K EKNVF+VF+S
Sbjct  181   VNLGFITGLVPRDKALAFDRILFRATRGNVFLKQAAVDEPVIDPVSGVKTEKNVFVVFFS  240

Query  2033  GERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQS  1854
             GERAKNKILKIC+AFGANRY F E++GKQ+Q+I EVS K+SELK  IDAG++ R NLL++
Sbjct  241   GERAKNKILKICEAFGANRYAFNEDIGKQSQMIKEVSEKLSELKITIDAGLVLRENLLRT  300

Query  1853  IAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSN  1674
             I EQFD+WN+LV++EK+IYHTLNMLSIDV+KKCLVAEGWSP  A+ +IQ AL RA +DSN
Sbjct  301   IGEQFDQWNLLVKKEKAIYHTLNMLSIDVSKKCLVAEGWSPVFASGKIQSALHRATNDSN  360

Query  1673  SEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAV  1494
             S++ AIF+VL TRE PPTYF+TNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAV
Sbjct  361   SQVDAIFQVLHTREMPPTYFQTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAV  420

Query  1493  MFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNE  1314
             MFGDWGHGIC+LLATL+ +IREKK  SQKLGDI EMTFGGRYVIL+MA+FSIYTG IYNE
Sbjct  421   MFGDWGHGICILLATLFLIIREKKYLSQKLGDIMEMTFGGRYVILLMAIFSIYTGLIYNE  480

Query  1313  FFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMK  1134
             FFSV FELF  SAYVCRDP+C D+TT+GLIK+RDTY FGVDPAWHGTRSELPFLNSLKMK
Sbjct  481   FFSVPFELFAPSAYVCRDPACRDSTTVGLIKSRDTYPFGVDPAWHGTRSELPFLNSLKMK  540

Query  1133  LSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGS  954
             +SILLGVAQMNLGIILSYFNA +F++ +N W QFIPQ+IFLN+LFGYLS+LII+KWCTGS
Sbjct  541   MSILLGVAQMNLGIILSYFNALFFKNSINVWFQFIPQMIFLNSLFGYLSLLIIIKWCTGS  600

Query  953   QADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQHNR  774
             QADLYHVMIYMFL PT++LGENQLFPGQKTTQLVL+LLALVSVPWMLLPKPF+LK QH+R
Sbjct  601   QADLYHVMIYMFLSPTDELGENQLFPGQKTTQLVLLLLALVSVPWMLLPKPFLLKRQHDR  660

Query  773   HQGQSYAPIQDLDESLLvdgshds--sdheefefsevfvHQLIHTIEFVLGAVSNTASYL  600
             H G+SYAP+QD DES L     +     HEEFEFSEVFVHQLIHTIEFVLGAVSNTASYL
Sbjct  661   HHGESYAPLQDTDESSLQHPEANHDPHGHEEFEFSEVFVHQLIHTIEFVLGAVSNTASYL  720

Query  599   RLWAL  585
             RLWAL
Sbjct  721   RLWAL  725



>ref|XP_010672374.1| PREDICTED: V-type proton ATPase subunit a3-like [Beta vulgaris 
subsp. vulgaris]
Length=816

 Score =  1071 bits (2769),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 567/822 (69%), Positives = 689/822 (84%), Gaps = 7/822 (1%)
 Frame = -2

Query  2783  MAERLGGRGGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPF  2604
             M+ER      C+P MDL RSE MQLVQLIIPIESA  +++ LGDL L QF+DLNAEKSPF
Sbjct  1     MSER-----RCWPTMDLMRSEEMQLVQLIIPIESAHRTISKLGDLSLFQFRDLNAEKSPF  55

Query  2603  QRTYAAQIKRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIE  2424
             QRTYAAQIKR  EMARK+RFFK+QM+KAG+  S    ++D +  D LEVKLG+LEAEL+E
Sbjct  56    QRTYAAQIKRCEEMARKIRFFKEQMTKAGLLPSTRILSRDDVHLDVLEVKLGELEAELLE  115

Query  2423  INANNDKLQRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllse  2244
             +NAN++KL+ S+NEL+EYKLVL K  EFF+SA  S  A   E  +   GE S+++PLL E
Sbjct  116   MNANSEKLEHSYNELIEYKLVLLKAAEFFNSA-FSTAALNAENEARHLGERSMDSPLLRE  174

Query  2243  PDMSADTSKQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKV  2064
              +M  D SKQVRLGFISGLVP+EK+MAFERILFRATRGNV L+Q+ ++  V+DP S +KV
Sbjct  175   QEMMVDPSKQVRLGFISGLVPREKAMAFERILFRATRGNVFLKQAVLEYPVVDPASSQKV  234

Query  2063  EKNVFLVFYSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAG  1884
             EKNVF++FYSG+RA+NKI+KIC+AFGAN Y F+++  KQ Q+  EV+ +++ELKT +D G
Sbjct  235   EKNVFVIFYSGDRARNKIVKICEAFGANCYSFSDDPEKQQQITEEVTARLAELKTTVDVG  294

Query  1883  ILHRGNLLQSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQD  1704
              +HR N+L +I    + W+ LV++EKSIYHTLNMLS+DVTKKCLVAEGW P  +T EIQ+
Sbjct  295   HVHRDNVLSTIGSHIEEWHHLVKKEKSIYHTLNMLSMDVTKKCLVAEGWCPVFSTKEIQN  354

Query  1703  ALQRAGHDSNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFT  1524
              LQRA  +SNS++G+IF +L T+ESPPTYF+TNKFTSAFQ+IV+AYGVAKYQEANPGV+T
Sbjct  355   TLQRATFESNSQVGSIFHILPTKESPPTYFRTNKFTSAFQDIVNAYGVAKYQEANPGVYT  414

Query  1523  IVTFPFLFAVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALF  1344
             I+TFPF FAVMFGDWGHGICL LATLY ++REKK S+QKLGDI +M F GRY+ILMMALF
Sbjct  415   IITFPFFFAVMFGDWGHGICLFLATLYLILREKKFSNQKLGDIMQMAFDGRYLILMMALF  474

Query  1343  SIYTGFIYNEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSE  1164
             SIYTG IYNEFFS+ FELFG SAY CR+ SC DA+T G+IK RDTY FGVDP WHG+RSE
Sbjct  475   SIYTGLIYNEFFSLPFELFGSSAYACRELSCRDASTAGVIKVRDTYPFGVDPVWHGSRSE  534

Query  1163  LPFLNSLKMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSV  984
             LPFLNSLKMK+SIL GVA MNLGIILSYFNA +F++ +N W QF+PQ+IFLN+LFGYLS+
Sbjct  535   LPFLNSLKMKMSILFGVAHMNLGIILSYFNAKFFKNDLNIWYQFVPQMIFLNSLFGYLSL  594

Query  983   LIIVKWCTGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPK  804
             LIIVKWC+GS+ADLYH++IYMFL PT+DLGENQLF GQK  Q++L+ LAL+SVPWML PK
Sbjct  595   LIIVKWCSGSKADLYHILIYMFLSPTDDLGENQLFFGQKLLQILLLFLALISVPWMLFPK  654

Query  803   PFILKSQH-NRHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLG  627
             PFILK Q+  RH+G++YA + D D+SL  +  HDS  H EFEFSEVF+HQLIH+IEFVLG
Sbjct  655   PFILKKQYEERHRGRTYALLDDADDSLDFEMEHDSHGHGEFEFSEVFIHQLIHSIEFVLG  714

Query  626   AVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVM  447
             AVSNTASYLRLWALSLAHSELS+VF++KVLLL W YNNI IL +G I+FI AT+GVLL+M
Sbjct  715   AVSNTASYLRLWALSLAHSELSSVFFDKVLLLTWRYNNIFILAIGVIVFISATVGVLLLM  774

Query  446   ETLSAFLHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             E+LSAFLHA+RLHWVEFQNKF+EGDGYKF P+SF  +DEE++
Sbjct  775   ESLSAFLHAMRLHWVEFQNKFFEGDGYKFQPYSFASLDEEDE  816



>gb|KCW55396.1| hypothetical protein EUGRSUZ_I01306 [Eucalyptus grandis]
Length=736

 Score =  1070 bits (2767),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 551/716 (77%), Positives = 633/716 (88%), Gaps = 2/716 (0%)
 Frame = -2

Query  2741  MDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSGEM  2562
             MDL RSEPMQLVQ+IIP+ESA L+V+YLGDLGL+QFKDLNA+KSPFQRTYAAQIK+ GEM
Sbjct  15    MDLLRSEPMQLVQVIIPMESAHLTVSYLGDLGLLQFKDLNADKSPFQRTYAAQIKKCGEM  74

Query  2561  ARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSFNE  2382
             ARKLRFFK+QMSKAG++ S  S T+D I  DDLE KLG+LEAEL+EINAN +KLQRS++E
Sbjct  75    ARKLRFFKEQMSKAGLAPSFKSITRDDIDVDDLETKLGELEAELVEINANGEKLQRSYSE  134

Query  2381  LVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTSKQVRLG  2202
             +VEYKLVLQKVGEFFH A+SSA AQ +E  S  +GEES++ PLL + +M+ D SKQ++LG
Sbjct  135   MVEYKLVLQKVGEFFHLAQSSATAQHREIESQHAGEESIDTPLLRDQEMATDASKQMKLG  194

Query  2201  FISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSGERA  2022
             F+ GLVP+EKSMAFERILFRATRGNV L+Q+ V+E VIDP SGEKVEKNVFLVFYSGERA
Sbjct  195   FLCGLVPREKSMAFERILFRATRGNVFLKQALVEEPVIDPASGEKVEKNVFLVFYSGERA  254

Query  2021  KNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSIAEQ  1842
             KNKILKIC+AFGANRYPF E+LGKQA++I+EV G++SELKT IDAG+ HRGNLL++I +Q
Sbjct  255   KNKILKICEAFGANRYPFNEDLGKQAKMISEVMGRLSELKTTIDAGLAHRGNLLETIGDQ  314

Query  1841  FDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNSEIG  1662
             +++W+ LVR+EK+IYHTLNMLS+DVTKKCLVAEGW P  A+ +IQDALQRA  DSN+++G
Sbjct  315   YEQWSRLVRKEKAIYHTLNMLSLDVTKKCLVAEGWCPVFASKQIQDALQRAASDSNAQVG  374

Query  1661  AIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGD  1482
             AIF+V+ T+E PPTYF+TNKFTSAFQEIVDAYGVA+YQE NPGVFTIVTFPFLFAVMFGD
Sbjct  375   AIFQVVHTKELPPTYFRTNKFTSAFQEIVDAYGVARYQEVNPGVFTIVTFPFLFAVMFGD  434

Query  1481  WGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEFFSV  1302
             WGHGICLLLATL ++ +EKKLS QKLGDITEMTFGGRYVILMMALFSIYTG IYNEFFSV
Sbjct  435   WGHGICLLLATLVYIFKEKKLSGQKLGDITEMTFGGRYVILMMALFSIYTGLIYNEFFSV  494

Query  1301  QFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKLSIL  1122
              FELFG SAY CRD SC DATT+GLIK R+TY FGVDP WHGTRSELPFLNSLKMK+SIL
Sbjct  495   PFELFGLSAYACRDLSCRDATTVGLIKVRETYPFGVDPVWHGTRSELPFLNSLKMKMSIL  554

Query  1121  LGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQADL  942
             LGVAQMNLGIILS+FNA +F + VN W QFIPQ+IFLN+LFGYLS+LIIVKWCTGS+ADL
Sbjct  555   LGVAQMNLGIILSFFNAKFFGNCVNIWFQFIPQLIFLNSLFGYLSLLIIVKWCTGSKADL  614

Query  941   YHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQH-NRHQG  765
             YH+MIYMFL PT++LGEN LFPGQK  Q+VL+LLALVSVPWMLLPKPF+LK QH  RH+G
Sbjct  615   YHIMIYMFLSPTDELGENALFPGQKMVQIVLLLLALVSVPWMLLPKPFLLKKQHEERHRG  674

Query  764   QSYAPIQDLDESL-LvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYL  600
              SY P++  D S  L        DHEEFEFSEVFVHQLIHTIEFVLGAVSNTASYL
Sbjct  675   NSYMPLETTDNSFQLDTNHDAHGDHEEFEFSEVFVHQLIHTIEFVLGAVSNTASYL  730



>ref|XP_006293691.1| hypothetical protein CARUB_v10022648mg [Capsella rubella]
 gb|EOA26589.1| hypothetical protein CARUB_v10022648mg [Capsella rubella]
Length=748

 Score =  1057 bits (2733),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 566/749 (76%), Positives = 653/749 (87%), Gaps = 2/749 (0%)
 Frame = -2

Query  2564  MARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSFN  2385
             MARK+RFFKDQMSKAGV      D +D I  DD+EVKL +LEAEL+EINANNDKLQRS+N
Sbjct  1     MARKIRFFKDQMSKAGVIPKDVLDKEDDIDLDDVEVKLEELEAELVEINANNDKLQRSYN  60

Query  2384  ELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTSKQVRL  2205
             ELVEYKLVL+K GEFF SA  SA AQQ E  + Q+ ++ LEAPLL E + S D +KQV+L
Sbjct  61    ELVEYKLVLEKAGEFFASAHRSAAAQQSEIETQQADDDLLEAPLLQE-EKSVDPTKQVKL  119

Query  2204  GFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSGER  2025
             GF++GLVP+EKSM FERILFRATRGN+ +RQS ++ESV+DP SGEK EKNVF+VFYSGER
Sbjct  120   GFLTGLVPREKSMVFERILFRATRGNIFIRQSVIEESVVDPNSGEKAEKNVFVVFYSGER  179

Query  2024  AKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSIAE  1845
             AK+KILKIC+AFGANRYPF+E+LG+QAQ++TEVSG++SELKT I AG+  R  LL++I +
Sbjct  180   AKSKILKICEAFGANRYPFSEDLGRQAQMMTEVSGRLSELKTTIGAGLDQRNILLETIGD  239

Query  1844  QFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNSEI  1665
             +F++WN+ VR+EK+IYHTLNMLS+DVTKKCLV EGWSP  A  E+QDALQRA  DSNS++
Sbjct  240   KFEQWNLKVRKEKAIYHTLNMLSLDVTKKCLVGEGWSPVFAATELQDALQRAAIDSNSQV  299

Query  1664  GAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMFG  1485
             G+IF++L T+E PPTYF+TNKFT+AFQEIVDAYGVAKYQEANP VFTIVTFPFLFAVMFG
Sbjct  300   GSIFQILRTKEMPPTYFRTNKFTTAFQEIVDAYGVAKYQEANPSVFTIVTFPFLFAVMFG  359

Query  1484  DWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEFFS  1305
             DWGHGICLLLAT+Y ++REKKLSSQKLGDI EM FGGRYVI MM+LFSIYTG IYNEFFS
Sbjct  360   DWGHGICLLLATMYLILREKKLSSQKLGDIMEMAFGGRYVIFMMSLFSIYTGLIYNEFFS  419

Query  1304  VQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKLSI  1125
             + + LF  SAY CRD SCS+ATTIGLIK RDTY FGVDP WHGTRSELPFLNSLKMK+SI
Sbjct  420   IPYPLFASSAYECRDVSCSEATTIGLIKTRDTYPFGVDPVWHGTRSELPFLNSLKMKMSI  479

Query  1124  LLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQAD  945
             LLGVAQMNLGII+S+FNA +F+S VN W QF+PQ+IFLN LFGYLSVLII+KWCTGSQAD
Sbjct  480   LLGVAQMNLGIIMSFFNAKFFKSAVNVWFQFVPQMIFLNCLFGYLSVLIIIKWCTGSQAD  539

Query  944   LYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQHN-RHQ  768
             LYHVMIYMFL P +DLGENQLFP QK  QL  + LALVSVPWMLLPKPFILK QH  RHQ
Sbjct  540   LYHVMIYMFLSPMDDLGENQLFPNQKIVQLTFLFLALVSVPWMLLPKPFILKKQHEARHQ  599

Query  767   GQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLRLWA  588
             G SYA + + DESL V+ +     HEEFEFSE+FVHQLIHTIEFVLGAVSNTASYLRLWA
Sbjct  600   GLSYAQLDETDESLQVETNGGGHGHEEFEFSEIFVHQLIHTIEFVLGAVSNTASYLRLWA  659

Query  587   LSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHALRLH  408
             LSLAHSELS+VFYEKVLL+AWG+NNI +L++G ++FIFAT+GVLLVMETLSAFLHALRLH
Sbjct  660   LSLAHSELSSVFYEKVLLMAWGFNNIALLILGILVFIFATVGVLLVMETLSAFLHALRLH  719

Query  407   WVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             WVE+QNKFYEGDGYKFDPF+F L+  EE+
Sbjct  720   WVEYQNKFYEGDGYKFDPFNFTLIGNEEE  748



>gb|KCW55395.1| hypothetical protein EUGRSUZ_I01306 [Eucalyptus grandis]
Length=789

 Score =  1026 bits (2653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 509/654 (78%), Positives = 588/654 (90%), Gaps = 0/654 (0%)
 Frame = -2

Query  2741  MDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSGEM  2562
             MDL RSEPMQLVQ+IIP+ESA L+V+YLGDLGL+QFKDLNA+KSPFQRTYAAQIK+ GEM
Sbjct  15    MDLLRSEPMQLVQVIIPMESAHLTVSYLGDLGLLQFKDLNADKSPFQRTYAAQIKKCGEM  74

Query  2561  ARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSFNE  2382
             ARKLRFFK+QMSKAG++ S  S T+D I  DDLE KLG+LEAEL+EINAN +KLQRS++E
Sbjct  75    ARKLRFFKEQMSKAGLAPSFKSITRDDIDVDDLETKLGELEAELVEINANGEKLQRSYSE  134

Query  2381  LVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTSKQVRLG  2202
             +VEYKLVLQKVGEFFH A+SSA AQ +E  S  +GEES++ PLL + +M+ D SKQ++LG
Sbjct  135   MVEYKLVLQKVGEFFHLAQSSATAQHREIESQHAGEESIDTPLLRDQEMATDASKQMKLG  194

Query  2201  FISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSGERA  2022
             F+ GLVP+EKSMAFERILFRATRGNV L+Q+ V+E VIDP SGEKVEKNVFLVFYSGERA
Sbjct  195   FLCGLVPREKSMAFERILFRATRGNVFLKQALVEEPVIDPASGEKVEKNVFLVFYSGERA  254

Query  2021  KNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSIAEQ  1842
             KNKILKIC+AFGANRYPF E+LGKQA++I+EV G++SELKT IDAG+ HRGNLL++I +Q
Sbjct  255   KNKILKICEAFGANRYPFNEDLGKQAKMISEVMGRLSELKTTIDAGLAHRGNLLETIGDQ  314

Query  1841  FDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNSEIG  1662
             +++W+ LVR+EK+IYHTLNMLS+DVTKKCLVAEGW P  A+ +IQDALQRA  DSN+++G
Sbjct  315   YEQWSRLVRKEKAIYHTLNMLSLDVTKKCLVAEGWCPVFASKQIQDALQRAASDSNAQVG  374

Query  1661  AIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGD  1482
             AIF+V+ T+E PPTYF+TNKFTSAFQEIVDAYGVA+YQE NPGVFTIVTFPFLFAVMFGD
Sbjct  375   AIFQVVHTKELPPTYFRTNKFTSAFQEIVDAYGVARYQEVNPGVFTIVTFPFLFAVMFGD  434

Query  1481  WGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEFFSV  1302
             WGHGICLLLATL ++ +EKKLS QKLGDITEMTFGGRYVILMMALFSIYTG IYNEFFSV
Sbjct  435   WGHGICLLLATLVYIFKEKKLSGQKLGDITEMTFGGRYVILMMALFSIYTGLIYNEFFSV  494

Query  1301  QFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKLSIL  1122
              FELFG SAY CRD SC DATT+GLIK R+TY FGVDP WHGTRSELPFLNSLKMK+SIL
Sbjct  495   PFELFGLSAYACRDLSCRDATTVGLIKVRETYPFGVDPVWHGTRSELPFLNSLKMKMSIL  554

Query  1121  LGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQADL  942
             LGVAQMNLGIILS+FNA +F + VN W QFIPQ+IFLN+LFGYLS+LIIVKWCTGS+ADL
Sbjct  555   LGVAQMNLGIILSFFNAKFFGNCVNIWFQFIPQLIFLNSLFGYLSLLIIVKWCTGSKADL  614

Query  941   YHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQH  780
             YH+MIYMFL PT++LGEN LFPGQK  Q+VL+LLALVSVPWMLLPKPF+LK QH
Sbjct  615   YHIMIYMFLSPTDELGENALFPGQKMVQIVLLLLALVSVPWMLLPKPFLLKKQH  668



>ref|XP_010472136.1| PREDICTED: V-type proton ATPase subunit a2 isoform X5 [Camelina 
sativa]
Length=717

 Score =  1023 bits (2645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 524/689 (76%), Positives = 602/689 (87%), Gaps = 2/689 (0%)
 Frame = -2

Query  2585  QIKRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANND  2406
             +IKR GEMARK+RFFKDQMSKAGV+     D ++ I  DD+EVKLG+LEAEL+EINANND
Sbjct  2     KIKRCGEMARKIRFFKDQMSKAGVTPKDFLDKENDIDLDDVEVKLGELEAELVEINANND  61

Query  2405  KLQRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSAD  2226
             KLQRS+NELVEYKLVL+K GEFF SA  SA AQQ E  + ++GE+ LEAPLL E + S D
Sbjct  62    KLQRSYNELVEYKLVLEKAGEFFASAHRSATAQQSEIETQEAGEDLLEAPLLQE-EKSVD  120

Query  2225  TSKQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFL  2046
              +KQV+LGF++GLVP+EKSM FERILFRATRGN+ +RQS ++ESV+DP SGEK EKNVF+
Sbjct  121   PTKQVKLGFLTGLVPREKSMVFERILFRATRGNIFIRQSVIEESVVDPNSGEKAEKNVFV  180

Query  2045  VFYSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGN  1866
             VFYSGERAK+KILKIC+AFGANRYPF+E+LG+QAQ++TEVSG++SELKT I AG+ HR  
Sbjct  181   VFYSGERAKSKILKICEAFGANRYPFSEDLGRQAQMMTEVSGRLSELKTTIGAGLDHRNI  240

Query  1865  LLQSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAG  1686
             LL++I E+F++WN+ VR+EK+IYHTLNMLS+DVTKKCLV EGWSP  A  E+QDALQRA 
Sbjct  241   LLETIGEKFEQWNLKVRKEKAIYHTLNMLSLDVTKKCLVGEGWSPVFAATELQDALQRAA  300

Query  1685  HDSNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPF  1506
              DSNS++G+IF+VL T+E PPT+F+TNKFT+AFQEIVDAYGVAKYQEANP VFTIVTFPF
Sbjct  301   VDSNSQVGSIFQVLRTKEMPPTFFRTNKFTTAFQEIVDAYGVAKYQEANPSVFTIVTFPF  360

Query  1505  LFAVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGF  1326
             LFAVMFGDWGHGICLLLAT+Y ++REKKLSSQKLGDI EM FGGRYVI MM+LFSIYTG 
Sbjct  361   LFAVMFGDWGHGICLLLATMYLILREKKLSSQKLGDIMEMAFGGRYVIFMMSLFSIYTGL  420

Query  1325  IYNEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNS  1146
             IYNEFFS+ + LF  SAY CRD SCS+ATTIGLIK RDTY FGVDP WHGTRSELPFLNS
Sbjct  421   IYNEFFSIPYPLFASSAYECRDVSCSEATTIGLIKTRDTYPFGVDPVWHGTRSELPFLNS  480

Query  1145  LKMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKW  966
             LKMK+SILLGVAQMNLGII+S+FNA +F+S VN W QF+PQ+IFLN LFGYLSVLII+KW
Sbjct  481   LKMKMSILLGVAQMNLGIIMSFFNAKFFKSAVNVWFQFVPQMIFLNCLFGYLSVLIIIKW  540

Query  965   CTGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKS  786
             CTGSQADLYHVMIYMFL P +DLGENQLFP QK  QL  + LALVSVPWMLLPKPFILK 
Sbjct  541   CTGSQADLYHVMIYMFLSPMDDLGENQLFPNQKIVQLTFLFLALVSVPWMLLPKPFILKK  600

Query  785   QHN-RHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTA  609
             QH  RHQGQSYA + + DESL V+ +     HEEFEFSE+FVHQLIHTIEFVLGAVSNTA
Sbjct  601   QHEARHQGQSYAQLDETDESLQVETNGGGHGHEEFEFSEIFVHQLIHTIEFVLGAVSNTA  660

Query  608   SYLRLWALSLAHSELSTVFYEKVLLLAWG  522
             SYLRLWALSLAHSELS+VFYEKVLL+AWG
Sbjct  661   SYLRLWALSLAHSELSSVFYEKVLLMAWG  689



>ref|XP_010472134.1| PREDICTED: V-type proton ATPase subunit a2 isoform X4 [Camelina 
sativa]
Length=719

 Score =  1023 bits (2645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 524/689 (76%), Positives = 602/689 (87%), Gaps = 2/689 (0%)
 Frame = -2

Query  2585  QIKRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANND  2406
             +IKR GEMARK+RFFKDQMSKAGV+     D ++ I  DD+EVKLG+LEAEL+EINANND
Sbjct  2     KIKRCGEMARKIRFFKDQMSKAGVTPKDFLDKENDIDLDDVEVKLGELEAELVEINANND  61

Query  2405  KLQRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSAD  2226
             KLQRS+NELVEYKLVL+K GEFF SA  SA AQQ E  + ++GE+ LEAPLL E + S D
Sbjct  62    KLQRSYNELVEYKLVLEKAGEFFASAHRSATAQQSEIETQEAGEDLLEAPLLQE-EKSVD  120

Query  2225  TSKQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFL  2046
              +KQV+LGF++GLVP+EKSM FERILFRATRGN+ +RQS ++ESV+DP SGEK EKNVF+
Sbjct  121   PTKQVKLGFLTGLVPREKSMVFERILFRATRGNIFIRQSVIEESVVDPNSGEKAEKNVFV  180

Query  2045  VFYSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGN  1866
             VFYSGERAK+KILKIC+AFGANRYPF+E+LG+QAQ++TEVSG++SELKT I AG+ HR  
Sbjct  181   VFYSGERAKSKILKICEAFGANRYPFSEDLGRQAQMMTEVSGRLSELKTTIGAGLDHRNI  240

Query  1865  LLQSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAG  1686
             LL++I E+F++WN+ VR+EK+IYHTLNMLS+DVTKKCLV EGWSP  A  E+QDALQRA 
Sbjct  241   LLETIGEKFEQWNLKVRKEKAIYHTLNMLSLDVTKKCLVGEGWSPVFAATELQDALQRAA  300

Query  1685  HDSNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPF  1506
              DSNS++G+IF+VL T+E PPT+F+TNKFT+AFQEIVDAYGVAKYQEANP VFTIVTFPF
Sbjct  301   VDSNSQVGSIFQVLRTKEMPPTFFRTNKFTTAFQEIVDAYGVAKYQEANPSVFTIVTFPF  360

Query  1505  LFAVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGF  1326
             LFAVMFGDWGHGICLLLAT+Y ++REKKLSSQKLGDI EM FGGRYVI MM+LFSIYTG 
Sbjct  361   LFAVMFGDWGHGICLLLATMYLILREKKLSSQKLGDIMEMAFGGRYVIFMMSLFSIYTGL  420

Query  1325  IYNEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNS  1146
             IYNEFFS+ + LF  SAY CRD SCS+ATTIGLIK RDTY FGVDP WHGTRSELPFLNS
Sbjct  421   IYNEFFSIPYPLFASSAYECRDVSCSEATTIGLIKTRDTYPFGVDPVWHGTRSELPFLNS  480

Query  1145  LKMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKW  966
             LKMK+SILLGVAQMNLGII+S+FNA +F+S VN W QF+PQ+IFLN LFGYLSVLII+KW
Sbjct  481   LKMKMSILLGVAQMNLGIIMSFFNAKFFKSAVNVWFQFVPQMIFLNCLFGYLSVLIIIKW  540

Query  965   CTGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKS  786
             CTGSQADLYHVMIYMFL P +DLGENQLFP QK  QL  + LALVSVPWMLLPKPFILK 
Sbjct  541   CTGSQADLYHVMIYMFLSPMDDLGENQLFPNQKIVQLTFLFLALVSVPWMLLPKPFILKK  600

Query  785   QHN-RHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTA  609
             QH  RHQGQSYA + + DESL V+ +     HEEFEFSE+FVHQLIHTIEFVLGAVSNTA
Sbjct  601   QHEARHQGQSYAQLDETDESLQVETNGGGHGHEEFEFSEIFVHQLIHTIEFVLGAVSNTA  660

Query  608   SYLRLWALSLAHSELSTVFYEKVLLLAWG  522
             SYLRLWALSLAHSELS+VFYEKVLL+AWG
Sbjct  661   SYLRLWALSLAHSELSSVFYEKVLLMAWG  689



>ref|XP_010472131.1| PREDICTED: V-type proton ATPase subunit a2 isoform X1 [Camelina 
sativa]
Length=757

 Score =  1023 bits (2645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 524/689 (76%), Positives = 602/689 (87%), Gaps = 2/689 (0%)
 Frame = -2

Query  2585  QIKRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANND  2406
             +IKR GEMARK+RFFKDQMSKAGV+     D ++ I  DD+EVKLG+LEAEL+EINANND
Sbjct  2     KIKRCGEMARKIRFFKDQMSKAGVTPKDFLDKENDIDLDDVEVKLGELEAELVEINANND  61

Query  2405  KLQRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSAD  2226
             KLQRS+NELVEYKLVL+K GEFF SA  SA AQQ E  + ++GE+ LEAPLL E + S D
Sbjct  62    KLQRSYNELVEYKLVLEKAGEFFASAHRSATAQQSEIETQEAGEDLLEAPLLQE-EKSVD  120

Query  2225  TSKQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFL  2046
              +KQV+LGF++GLVP+EKSM FERILFRATRGN+ +RQS ++ESV+DP SGEK EKNVF+
Sbjct  121   PTKQVKLGFLTGLVPREKSMVFERILFRATRGNIFIRQSVIEESVVDPNSGEKAEKNVFV  180

Query  2045  VFYSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGN  1866
             VFYSGERAK+KILKIC+AFGANRYPF+E+LG+QAQ++TEVSG++SELKT I AG+ HR  
Sbjct  181   VFYSGERAKSKILKICEAFGANRYPFSEDLGRQAQMMTEVSGRLSELKTTIGAGLDHRNI  240

Query  1865  LLQSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAG  1686
             LL++I E+F++WN+ VR+EK+IYHTLNMLS+DVTKKCLV EGWSP  A  E+QDALQRA 
Sbjct  241   LLETIGEKFEQWNLKVRKEKAIYHTLNMLSLDVTKKCLVGEGWSPVFAATELQDALQRAA  300

Query  1685  HDSNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPF  1506
              DSNS++G+IF+VL T+E PPT+F+TNKFT+AFQEIVDAYGVAKYQEANP VFTIVTFPF
Sbjct  301   VDSNSQVGSIFQVLRTKEMPPTFFRTNKFTTAFQEIVDAYGVAKYQEANPSVFTIVTFPF  360

Query  1505  LFAVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGF  1326
             LFAVMFGDWGHGICLLLAT+Y ++REKKLSSQKLGDI EM FGGRYVI MM+LFSIYTG 
Sbjct  361   LFAVMFGDWGHGICLLLATMYLILREKKLSSQKLGDIMEMAFGGRYVIFMMSLFSIYTGL  420

Query  1325  IYNEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNS  1146
             IYNEFFS+ + LF  SAY CRD SCS+ATTIGLIK RDTY FGVDP WHGTRSELPFLNS
Sbjct  421   IYNEFFSIPYPLFASSAYECRDVSCSEATTIGLIKTRDTYPFGVDPVWHGTRSELPFLNS  480

Query  1145  LKMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKW  966
             LKMK+SILLGVAQMNLGII+S+FNA +F+S VN W QF+PQ+IFLN LFGYLSVLII+KW
Sbjct  481   LKMKMSILLGVAQMNLGIIMSFFNAKFFKSAVNVWFQFVPQMIFLNCLFGYLSVLIIIKW  540

Query  965   CTGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKS  786
             CTGSQADLYHVMIYMFL P +DLGENQLFP QK  QL  + LALVSVPWMLLPKPFILK 
Sbjct  541   CTGSQADLYHVMIYMFLSPMDDLGENQLFPNQKIVQLTFLFLALVSVPWMLLPKPFILKK  600

Query  785   QHN-RHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTA  609
             QH  RHQGQSYA + + DESL V+ +     HEEFEFSE+FVHQLIHTIEFVLGAVSNTA
Sbjct  601   QHEARHQGQSYAQLDETDESLQVETNGGGHGHEEFEFSEIFVHQLIHTIEFVLGAVSNTA  660

Query  608   SYLRLWALSLAHSELSTVFYEKVLLLAWG  522
             SYLRLWALSLAHSELS+VFYEKVLL+AWG
Sbjct  661   SYLRLWALSLAHSELSSVFYEKVLLMAWG  689



>ref|XP_010472133.1| PREDICTED: V-type proton ATPase subunit a2 isoform X3 [Camelina 
sativa]
Length=721

 Score =  1023 bits (2644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 524/689 (76%), Positives = 602/689 (87%), Gaps = 2/689 (0%)
 Frame = -2

Query  2585  QIKRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANND  2406
             +IKR GEMARK+RFFKDQMSKAGV+     D ++ I  DD+EVKLG+LEAEL+EINANND
Sbjct  2     KIKRCGEMARKIRFFKDQMSKAGVTPKDFLDKENDIDLDDVEVKLGELEAELVEINANND  61

Query  2405  KLQRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSAD  2226
             KLQRS+NELVEYKLVL+K GEFF SA  SA AQQ E  + ++GE+ LEAPLL E + S D
Sbjct  62    KLQRSYNELVEYKLVLEKAGEFFASAHRSATAQQSEIETQEAGEDLLEAPLLQE-EKSVD  120

Query  2225  TSKQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFL  2046
              +KQV+LGF++GLVP+EKSM FERILFRATRGN+ +RQS ++ESV+DP SGEK EKNVF+
Sbjct  121   PTKQVKLGFLTGLVPREKSMVFERILFRATRGNIFIRQSVIEESVVDPNSGEKAEKNVFV  180

Query  2045  VFYSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGN  1866
             VFYSGERAK+KILKIC+AFGANRYPF+E+LG+QAQ++TEVSG++SELKT I AG+ HR  
Sbjct  181   VFYSGERAKSKILKICEAFGANRYPFSEDLGRQAQMMTEVSGRLSELKTTIGAGLDHRNI  240

Query  1865  LLQSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAG  1686
             LL++I E+F++WN+ VR+EK+IYHTLNMLS+DVTKKCLV EGWSP  A  E+QDALQRA 
Sbjct  241   LLETIGEKFEQWNLKVRKEKAIYHTLNMLSLDVTKKCLVGEGWSPVFAATELQDALQRAA  300

Query  1685  HDSNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPF  1506
              DSNS++G+IF+VL T+E PPT+F+TNKFT+AFQEIVDAYGVAKYQEANP VFTIVTFPF
Sbjct  301   VDSNSQVGSIFQVLRTKEMPPTFFRTNKFTTAFQEIVDAYGVAKYQEANPSVFTIVTFPF  360

Query  1505  LFAVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGF  1326
             LFAVMFGDWGHGICLLLAT+Y ++REKKLSSQKLGDI EM FGGRYVI MM+LFSIYTG 
Sbjct  361   LFAVMFGDWGHGICLLLATMYLILREKKLSSQKLGDIMEMAFGGRYVIFMMSLFSIYTGL  420

Query  1325  IYNEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNS  1146
             IYNEFFS+ + LF  SAY CRD SCS+ATTIGLIK RDTY FGVDP WHGTRSELPFLNS
Sbjct  421   IYNEFFSIPYPLFASSAYECRDVSCSEATTIGLIKTRDTYPFGVDPVWHGTRSELPFLNS  480

Query  1145  LKMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKW  966
             LKMK+SILLGVAQMNLGII+S+FNA +F+S VN W QF+PQ+IFLN LFGYLSVLII+KW
Sbjct  481   LKMKMSILLGVAQMNLGIIMSFFNAKFFKSAVNVWFQFVPQMIFLNCLFGYLSVLIIIKW  540

Query  965   CTGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKS  786
             CTGSQADLYHVMIYMFL P +DLGENQLFP QK  QL  + LALVSVPWMLLPKPFILK 
Sbjct  541   CTGSQADLYHVMIYMFLSPMDDLGENQLFPNQKIVQLTFLFLALVSVPWMLLPKPFILKK  600

Query  785   QHN-RHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTA  609
             QH  RHQGQSYA + + DESL V+ +     HEEFEFSE+FVHQLIHTIEFVLGAVSNTA
Sbjct  601   QHEARHQGQSYAQLDETDESLQVETNGGGHGHEEFEFSEIFVHQLIHTIEFVLGAVSNTA  660

Query  608   SYLRLWALSLAHSELSTVFYEKVLLLAWG  522
             SYLRLWALSLAHSELS+VFYEKVLL+AWG
Sbjct  661   SYLRLWALSLAHSELSSVFYEKVLLMAWG  689



>ref|XP_001768891.1| predicted protein [Physcomitrella patens]
 gb|EDQ66245.1| predicted protein [Physcomitrella patens]
Length=820

 Score =  1019 bits (2635),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 532/816 (65%), Positives = 645/816 (79%), Gaps = 9/816 (1%)
 Frame = -2

Query  2741  MDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSGEM  2562
             MDLFRSE M LVQLIIP ESA  +V YL +LGL+QFKDLN E+SPFQRTYA Q+KR GEM
Sbjct  4     MDLFRSEEMTLVQLIIPAESAHDTVTYLAELGLLQFKDLNPERSPFQRTYANQVKRCGEM  63

Query  2561  ARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSFNE  2382
             +RK+R+F+DQ++K+G +A+        I  D+LE KL DLEAEL+EINAN DKLQR+ +E
Sbjct  64    SRKIRYFQDQITKSGRTAAYRPLRDKDIGVDELEAKLTDLEAELLEINANTDKLQRTHSE  123

Query  2381  LVEYKLVLQKVGEFFHSARssaeaqqqeygssqsge--esleapllsePDMSADTSKQVR  2208
             L E++LVL K G FF S R++A   QQ           E+++ PLL E +M  + SKQ R
Sbjct  124   LTEFQLVLHKAGAFFSSVRNAANTVQQRADIENGSSIGEAIDRPLLQEQEMQTEPSKQAR  183

Query  2207  LGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSGE  2028
             LGFI+G++PK K+ +FERILFRATRGN+ L+Q+ ++++V+DP +GEK+EK VF++F+SGE
Sbjct  184   LGFITGVIPKIKAASFERILFRATRGNMFLKQASIEDAVVDPATGEKIEKTVFVIFFSGE  243

Query  2027  RAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSIA  1848
             RAK KI KICDAFGAN YPF EE  +Q  + TEV  ++ +L+  +DAGI HR N+L SI 
Sbjct  244   RAKTKISKICDAFGANCYPFPEESSRQGHMKTEVDNRLLDLQHTLDAGINHRDNVLNSIG  303

Query  1847  EQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNSE  1668
                D+W V+VRREK++YHTLNMLSIDVT+KCLVAEGW P SA  +IQDALQRA   SNS+
Sbjct  304   NNLDQWTVMVRREKAVYHTLNMLSIDVTRKCLVAEGWCPVSAKPKIQDALQRAAFVSNSQ  363

Query  1667  IGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMF  1488
             +  IF+VL T+ESPP+YF+TNKFT+AFQEIV+AYGV +YQEANPG FTI+TFPFLFAVMF
Sbjct  364   VNTIFQVLHTKESPPSYFETNKFTNAFQEIVEAYGVGRYQEANPGCFTIITFPFLFAVMF  423

Query  1487  GDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEFF  1308
             GDWGHGICLLL  LY ++ EKKL S+KLGDI EM +GGRYVIL+MA+FSIYTGFIYNEFF
Sbjct  424   GDWGHGICLLLGALYLVLNEKKLGSKKLGDIMEMAYGGRYVILLMAIFSIYTGFIYNEFF  483

Query  1307  SVQFELFGRSAYVCRDP-----SCSDATTIGLIK-ARDTYAFGVDPAWHGTRSELPFLNS  1146
             SV F  FG SAY C D      SC  ATT G+ K + + YAFGVDP WHG+RSELPF NS
Sbjct  484   SVPFGFFGGSAYRCPDSQYSIESCPMATTSGMEKWSYEPYAFGVDPIWHGSRSELPFTNS  543

Query  1145  LKMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKW  966
             LKMK+SILLG+AQMNLGI+LSYFNA YFRS ++ W QFIPQ++FLNALFGYLS LI++KW
Sbjct  544   LKMKMSILLGIAQMNLGILLSYFNARYFRSALDVWYQFIPQLLFLNALFGYLSFLIVLKW  603

Query  965   CTGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKS  786
             C GS+ DLYHVMIYMFL PTEDLGENQLF GQ   Q+VL+L+ALV+VPWML PKP IL+ 
Sbjct  604   CQGSKPDLYHVMIYMFLSPTEDLGENQLFMGQTFVQIVLLLVALVAVPWMLFPKPLILRK  663

Query  785   QH-NRHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTA  609
             +H  + QG++Y  +++ D            D EEFEF EV VHQ+IHTIEFVLGAVSNTA
Sbjct  664   RHVQKMQGRAYGMLRESDTESTDLEIDGEHDEEEFEFGEVLVHQMIHTIEFVLGAVSNTA  723

Query  608   SYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAF  429
             SYLRLWALSLAH++LS VFY++VL+ AWGY N II ++G I+F   T GVLL+METLSAF
Sbjct  724   SYLRLWALSLAHAQLSAVFYDRVLMFAWGYTNPIIRLIGLIVFASVTFGVLLLMETLSAF  783

Query  428   LHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             LHALRLHWVEFQNKFY GDGYKF PFSF  + EE+D
Sbjct  784   LHALRLHWVEFQNKFYLGDGYKFQPFSFRTLSEEDD  819



>emb|CDY13818.1| BnaA09g43200D [Brassica napus]
Length=799

 Score =  1017 bits (2630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 510/671 (76%), Positives = 587/671 (87%), Gaps = 2/671 (0%)
 Frame = -2

Query  2741  MDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSGEM  2562
             MDL RSEPMQLVQ+I+P+ESA L+V+YLGDLGL+QFKDLN+EKSPFQRTYAAQIKR GEM
Sbjct  15    MDLMRSEPMQLVQVIVPMESAHLTVSYLGDLGLVQFKDLNSEKSPFQRTYAAQIKRCGEM  74

Query  2561  ARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSFNE  2382
             ARK+RFFKDQMSKAGVS     D    I  DD+EVKLG+LEAEL+EINANNDKLQRS+NE
Sbjct  75    ARKIRFFKDQMSKAGVSPKVILDKDIDIDLDDVEVKLGELEAELVEINANNDKLQRSYNE  134

Query  2381  LVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTSKQVRLG  2202
             LVEYKLVL+K G+FF SA  SA AQQ E  S Q GE+ LE PLL E + S D +KQV+LG
Sbjct  135   LVEYKLVLEKAGDFFASAHRSATAQQSEIESQQVGEDVLETPLLQE-EKSVDPTKQVKLG  193

Query  2201  FISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSGERA  2022
             F++GLVP+EKSM FERILFRATRGN+ +RQS ++ESV+DP SGEK EKNVF+VFYSGERA
Sbjct  194   FLTGLVPREKSMVFERILFRATRGNIFIRQSVIEESVVDPNSGEKAEKNVFVVFYSGERA  253

Query  2021  KNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSIAEQ  1842
             K+KILKIC+AFGANRYPF+E+LG+QAQ++TEVSG+++ELKT I+AG+ HR  LL++I ++
Sbjct  254   KSKILKICEAFGANRYPFSEDLGRQAQMMTEVSGRLAELKTTINAGLDHRKILLETIGDK  313

Query  1841  FDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNSEIG  1662
             F++WN+ VR+EK+IYHTLNMLS+DVTKKCLV EGWSP  A  EIQ+ALQRAG DSNS++G
Sbjct  314   FEQWNLKVRKEKAIYHTLNMLSLDVTKKCLVGEGWSPLFAAPEIQEALQRAGVDSNSQVG  373

Query  1661  AIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGD  1482
             +IF+VL T+E PPT+F+TNKFT+AFQEIVDAYGVAKYQEANP VFTIVTFPFLFAVMFGD
Sbjct  374   SIFQVLRTKEMPPTFFRTNKFTTAFQEIVDAYGVAKYQEANPTVFTIVTFPFLFAVMFGD  433

Query  1481  WGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEFFSV  1302
             WGHGICLLLAT+Y ++REKKLSSQKLGDI EM FGGRYVI MM+LFSIYTG IYNEFFS+
Sbjct  434   WGHGICLLLATMYLILREKKLSSQKLGDIMEMAFGGRYVIFMMSLFSIYTGLIYNEFFSI  493

Query  1301  QFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKLSIL  1122
              + LF  SAY CRD SCS+ATTIGLIK RDTY FGVDP WHGTRSELPFLNSLKMK+SIL
Sbjct  494   PYPLFAPSAYECRDASCSEATTIGLIKTRDTYPFGVDPVWHGTRSELPFLNSLKMKMSIL  553

Query  1121  LGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQADL  942
             LGVAQMNLGII+S+ NA +F+S VN W QF+PQ+IFLN LFGYLSVLII+KWCTGSQADL
Sbjct  554   LGVAQMNLGIIMSFCNAKFFKSAVNVWFQFVPQMIFLNCLFGYLSVLIIIKWCTGSQADL  613

Query  941   YHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQHN-RHQG  765
             YHVMIYMFL P +DLGENQLFP QKT QL  + LALVSVPWMLLPKPFILK QH  RHQG
Sbjct  614   YHVMIYMFLSPMDDLGENQLFPNQKTVQLTFLFLALVSVPWMLLPKPFILKKQHEARHQG  673

Query  764   QSYAPIQDLDE  732
             QSYA + + DE
Sbjct  674   QSYAQLDETDE  684


 Score = 78.6 bits (192),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 50/101 (50%), Positives = 60/101 (59%), Gaps = 0/101 (0%)
 Frame = -1

Query  663  ASTDTYHRVCAWssl*ysflssSVGP*PCTL*AVHCLLREGSPPCLGVQQYYYPCRWFHH  484
            A  D    +CAWS   + FLSSS+GP  C L  V  LLREGSP  +G QQY +P RW   
Sbjct  677  AQLDETDEICAWSCFQHCFLSSSMGPQSCALVVVVSLLREGSPYGVGFQQYIHPYRWDPR  736

Query  483  FHFCYHRCAVSDGNTQCIPSCLEASLGGVSEQVL*G*WIQV  361
             H C    A  DG+ + +PS   +SLGGVSEQVL   W+QV
Sbjct  737  LHLCNGGSASGDGDVERVPSRPASSLGGVSEQVLRRRWLQV  777



>gb|KDP44125.1| hypothetical protein JCGZ_05592 [Jatropha curcas]
Length=824

 Score =  1014 bits (2621),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 517/811 (64%), Positives = 642/811 (79%), Gaps = 2/811 (0%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             PPMDL RSE M  VQLIIP+ESA  +++YLG+LGL+QF+DLNA+KSPFQRT+  Q+KR G
Sbjct  14    PPMDLMRSEKMTFVQLIIPVESAHRAISYLGELGLLQFRDLNADKSPFQRTFVNQVKRCG  73

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EM+RKLRFFKDQ++KAG+ +SA+   +  ++ ++LE++L + E ELIE+N+N++KLQ+SF
Sbjct  74    EMSRKLRFFKDQINKAGLLSSAHPVMEPDVELEELEIQLAEHEHELIEMNSNSEKLQQSF  133

Query  2387  NELVEYKLVLQK-VGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTSKQV  2211
             NEL+E+K+VLQK VG    S   +   +++   +  S     E+  L E ++++  S Q 
Sbjct  134   NELLEFKIVLQKAVGFLVSSNSHAVSEERELNENVYSNNNYGESASLLEQELTSAPSNQS  193

Query  2210  RLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSG  2031
              L FISG++P+ KS+ FER+LFRATRGN+L  Q+   E ++DP+S E VEK VF+VF+SG
Sbjct  194   GLRFISGIIPRSKSLRFERMLFRATRGNMLCNQASAGEEIMDPVSAEMVEKTVFVVFFSG  253

Query  2030  ERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSI  1851
             E+ + KILKICDAFGAN YP  E++ KQ Q+  EV  ++SEL+  +DAGI HR   L SI
Sbjct  254   EQTRTKILKICDAFGANCYPVPEDVTKQRQITREVLSRLSELEATLDAGIRHRNKALASI  313

Query  1850  AEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNS  1671
               Q  +W  +VRREK++Y TLNML+ DVTKKCLV EGW P  A  +IQ+ALQRA  DSNS
Sbjct  314   GYQLTKWMNMVRREKAVYDTLNMLNFDVTKKCLVGEGWCPMFAKAQIQEALQRATFDSNS  373

Query  1670  EIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVM  1491
             ++G IF V+   ESPPTYF+TN+FT+AFQEIVDAYGVA+Y+EANP V+T++TFPFLFAVM
Sbjct  374   QVGIIFHVMDATESPPTYFRTNRFTNAFQEIVDAYGVARYEEANPAVYTVITFPFLFAVM  433

Query  1490  FGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEF  1311
             FGDWGHGICLL+  L  ++RE KLSSQKLG   EM FGGRYV+L+MALFSIY G IYNEF
Sbjct  434   FGDWGHGICLLVGALVLIVRESKLSSQKLGSFMEMLFGGRYVLLLMALFSIYCGLIYNEF  493

Query  1310  FSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKL  1131
             FSV F +FG SAY CRD +CSDA T GLIK RD Y FGVDP+W G+RSELPFLNSLKMK+
Sbjct  494   FSVPFHIFGGSAYKCRDTTCSDAQTAGLIKFRDPYPFGVDPSWRGSRSELPFLNSLKMKM  553

Query  1130  SILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQ  951
             SIL GVAQMNLGIILSYFNA +F S ++   QF+PQ+IFLN LFGYLS+LII+KWC+GSQ
Sbjct  554   SILFGVAQMNLGIILSYFNARFFGSSLDIRYQFVPQMIFLNCLFGYLSLLIIIKWCSGSQ  613

Query  950   ADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQHN-R  774
             ADLYHVMIYMFL PTE LG+NQLF GQ+  Q++L+LLA+++VPWML PKPFILK  H  R
Sbjct  614   ADLYHVMIYMFLSPTEALGDNQLFWGQRPLQILLLLLAVIAVPWMLFPKPFILKKLHTER  673

Query  773   HQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLRL  594
              QG++Y  +   +  L ++       H++F FSEVFVHQ+IH+IEFVLGAVSNTASYLRL
Sbjct  674   FQGRTYGILGTSEIDLDMEPGSARPHHDDFNFSEVFVHQMIHSIEFVLGAVSNTASYLRL  733

Query  593   WALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHALR  414
             WALSLAHSELSTVFYEKVLLLAWGY+NIII +VG  +F FAT  +LL+ME+LSAFLHALR
Sbjct  734   WALSLAHSELSTVFYEKVLLLAWGYDNIIIRLVGLSVFAFATAFILLMMESLSAFLHALR  793

Query  413   LHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             LHWVEFQNKFY GDG KF PFSF L+ EE+D
Sbjct  794   LHWVEFQNKFYNGDGCKFRPFSFALITEEDD  824



>ref|XP_002282009.1| PREDICTED: V-type proton ATPase subunit a1 [Vitis vinifera]
 emb|CBI16252.3| unnamed protein product [Vitis vinifera]
Length=818

 Score =  1013 bits (2618),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 519/811 (64%), Positives = 646/811 (80%), Gaps = 2/811 (0%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             PPMDL RSE M  VQLIIP+ESA  +V+YLG+LGL+QF+DLNA+KSPFQRT+  Q+KR G
Sbjct  8     PPMDLMRSEKMTFVQLIIPVESAHRAVSYLGELGLLQFRDLNADKSPFQRTFVNQVKRCG  67

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EMARKLRFFKDQ+SKAG+ +SA  D Q  I+ ++LE++L + E EL+E+N+N++KL++++
Sbjct  68    EMARKLRFFKDQVSKAGLISSARPDLQPDIELEELEIQLSEHEHELLEMNSNSEKLRQTY  127

Query  2387  NELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsge-esleapllsePDMSADTSKQV  2211
             NEL+E+K+VLQK   F  S++S A  +++E   +   +   +E   L E +M    S Q 
Sbjct  128   NELLEFKMVLQKASGFLVSSKSHAVVEERELDETAYSKDRYVETASLLEQEMGPGPSNQS  187

Query  2210  RLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSG  2031
              L FISG++ K K++ FER+LFRATRGN+L  Q+  DE ++DP+S E +EK VF+VF+SG
Sbjct  188   GLRFISGIICKSKALRFERMLFRATRGNMLFNQATADEHIMDPVSTEMIEKTVFVVFFSG  247

Query  2030  ERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSI  1851
             E+AK KILKIC+AFGAN YP  E++ KQ Q+  EV  ++SEL+  +DAGI HR   L SI
Sbjct  248   EQAKTKILKICEAFGANCYPVPEDMTKQRQISREVLARLSELEATLDAGIRHRNKALSSI  307

Query  1850  AEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNS  1671
                  +W  +VRREK++Y TLNML+ DVTKKCLV EGW P  A  +IQ+ALQRA  DSNS
Sbjct  308   GFHLMKWMNMVRREKAVYDTLNMLNFDVTKKCLVGEGWCPIFAKAQIQEALQRATFDSNS  367

Query  1670  EIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVM  1491
             ++G IF V+   ESPPTYF+TN+FT+AFQEIVDAYGVA+YQEANP V+T++TFPFLFAVM
Sbjct  368   QVGIIFHVMDAVESPPTYFRTNRFTNAFQEIVDAYGVARYQEANPAVYTVITFPFLFAVM  427

Query  1490  FGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEF  1311
             FGDWGHGICLLL  L  + RE KLSSQKLG   EM FGGRYV+L+M++FSIY G IYNEF
Sbjct  428   FGDWGHGICLLLGALVLIARESKLSSQKLGSFMEMLFGGRYVLLLMSIFSIYCGLIYNEF  487

Query  1310  FSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKL  1131
             FSV + +FG SAY CRD +CS++ T+GLIK +DTY FGVDP+W G+RSELPFLNSLKMK+
Sbjct  488   FSVPYHIFGGSAYKCRDATCSNSNTVGLIKYQDTYPFGVDPSWRGSRSELPFLNSLKMKM  547

Query  1130  SILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQ  951
             SILLGV QMNLGI+LSYFNA +F S ++   QF+PQ+IFLN+LFGYLS+LII+KWCTGSQ
Sbjct  548   SILLGVTQMNLGIVLSYFNARFFGSSLDIRYQFVPQVIFLNSLFGYLSLLIIIKWCTGSQ  607

Query  950   ADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQHN-R  774
             ADLYHVMIYMFL PT++LGENQLF GQ+  Q++L+LLAL++VPWML PKPFILK  H+ R
Sbjct  608   ADLYHVMIYMFLSPTDNLGENQLFWGQRPLQIILLLLALIAVPWMLFPKPFILKKLHSER  667

Query  773   HQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLRL  594
              QG++Y  +   +  L V+       HEEF FSE+FVHQ+IH+IEFVLGAVSNTASYLRL
Sbjct  668   FQGRAYGILGTSEMDLEVEPDSARQHHEEFNFSEIFVHQMIHSIEFVLGAVSNTASYLRL  727

Query  593   WALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHALR  414
             WALSLAHSELSTVFYEKVLLLAWGYNN +I +VG  +F FAT  +LL+METLSAFLHALR
Sbjct  728   WALSLAHSELSTVFYEKVLLLAWGYNNFVIRMVGLAVFAFATAFILLMMETLSAFLHALR  787

Query  413   LHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             LHWVEFQNKFY GDGYKF PFSF  + ++ED
Sbjct  788   LHWVEFQNKFYHGDGYKFRPFSFASLIDDED  818



>ref|XP_007017674.1| Vacuolar proton ATPase A2 isoform 2 [Theobroma cacao]
 gb|EOY14899.1| Vacuolar proton ATPase A2 isoform 2 [Theobroma cacao]
Length=703

 Score =  1010 bits (2611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 534/703 (76%), Positives = 614/703 (87%), Gaps = 2/703 (0%)
 Frame = -2

Query  2423  INANNDKLQRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllse  2244
             +NAN++KLQ+S+NEL EYKLV+QK GEFF SA+SSA A+Q+E  + Q GE S+++PLL E
Sbjct  1     MNANHEKLQQSYNELKEYKLVMQKAGEFFQSAQSSAAAKQREAEAEQRGEGSIDSPLLLE  60

Query  2243  PDMSADTSKQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKV  2064
              +M  D SKQV+LGF+SGLV +E+S+AFERILFRATRGNV L+QS V++ V DP SGEKV
Sbjct  61    QEMVTDPSKQVKLGFVSGLVSRERSLAFERILFRATRGNVFLKQSVVEDPVTDPASGEKV  120

Query  2063  EKNVFLVFYSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAG  1884
             EKNVF+VFYSGERA+NKI+KIC+ FGANRYPF E+LGKQ Q+ITEVSG++ ELKT ID G
Sbjct  121   EKNVFIVFYSGERARNKIMKICEVFGANRYPFTEDLGKQFQIITEVSGRLEELKTTIDVG  180

Query  1883  ILHRGNLLQSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQD  1704
             ++H+ NLLQ+IA  F+ W++LV++EKSIYHTLNMLSIDV++KCLVAEGW P  AT +IQ+
Sbjct  181   LVHQSNLLQTIAYHFENWSLLVKKEKSIYHTLNMLSIDVSRKCLVAEGWCPVFATNQIQN  240

Query  1703  ALQRAGHDSNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFT  1524
              LQ+A  DS+S++G IF VL T+ESPPTYF TNKFTSAFQEIVDAYG+AKYQEANP VFT
Sbjct  241   VLQKATIDSSSQVGTIFHVLQTKESPPTYFHTNKFTSAFQEIVDAYGIAKYQEANPAVFT  300

Query  1523  IVTFPFLFAVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALF  1344
             I+TFPFLFAVMFGDWGHGICL LAT YF+IREKK SSQKLGDITEM FGGRYVI+MMALF
Sbjct  301   IITFPFLFAVMFGDWGHGICLCLATSYFIIREKKFSSQKLGDITEMIFGGRYVIMMMALF  360

Query  1343  SIYTGFIYNEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSE  1164
             SIYTG IYNEFFSV FELFG SAY C DPSCSDA+T GL+K R TY FGVDP WHGTRSE
Sbjct  361   SIYTGLIYNEFFSVPFELFGPSAYGCHDPSCSDASTAGLVKVRATYPFGVDPKWHGTRSE  420

Query  1163  LPFLNSLKMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSV  984
             LPFLNSLKMK+SIL+GVAQMNLGIILSYFNA +F++ +N W QF+PQ+IFLN+LFGYLS+
Sbjct  421   LPFLNSLKMKMSILIGVAQMNLGIILSYFNAKFFKNEINIWYQFVPQLIFLNSLFGYLSL  480

Query  983   LIIVKWCTGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPK  804
             LI+VKWCTGSQADLYHVMIYMFL PT+DLGENQLF GQK  Q+VL+L ALVSVPWML PK
Sbjct  481   LIVVKWCTGSQADLYHVMIYMFLSPTDDLGENQLFFGQKFLQIVLLLAALVSVPWMLFPK  540

Query  803   PFILKSQH-NRHQGQSYAPIQDLDESLLvdgshd-ssdheefefsevfvHQLIHTIEFVL  630
             PF+LK QH  RH+GQSYA +   D+  L    H  S  HEEFEFSEVFVHQLIHTIEFVL
Sbjct  541   PFLLKKQHEERHRGQSYALLDSSDDDPLEMELHHGSGSHEEFEFSEVFVHQLIHTIEFVL  600

Query  629   GAVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLV  450
             GAVSNTASYLRLWALSLAHSELS+VFY+KVLLLAWG+NNIIIL++G  +FI AT+GVLLV
Sbjct  601   GAVSNTASYLRLWALSLAHSELSSVFYDKVLLLAWGFNNIIILIIGIFVFICATVGVLLV  660

Query  449   METLSAFLHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             METLSAFLHALRLHWVEFQNKFYEGDGYKF PFSF LV EE+D
Sbjct  661   METLSAFLHALRLHWVEFQNKFYEGDGYKFQPFSFALVSEEDD  703



>ref|XP_008463888.1| PREDICTED: vacuolar proton ATPase a1 [Cucumis melo]
Length=819

 Score =  1007 bits (2603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 508/811 (63%), Positives = 639/811 (79%), Gaps = 2/811 (0%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             PPMDL RSE M  VQLIIP+ESA  +++YLG+LG++QF+DLN +KSPFQRT+  Q+KR  
Sbjct  9     PPMDLMRSEKMTFVQLIIPVESAHRAISYLGELGILQFRDLNVDKSPFQRTFVNQVKRCA  68

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EM+RKLRFFKDQ+SKAGV AS     Q+ I+ +DLE++L D E ELIE+N+N++KL++S+
Sbjct  69    EMSRKLRFFKDQISKAGVLASTRPILQEHIELEDLEIRLADHEHELIEMNSNSEKLRQSY  128

Query  2387  NELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleap-llsePDMSADTSKQV  2211
             NEL+E+K+VLQK   F  S+ S + ++++E   +    +S      L E ++    S Q 
Sbjct  129   NELLEFKMVLQKASVFLVSSNSHSVSEERELNENVFLNDSYVEDGSLLEQEIRPGPSNQS  188

Query  2210  RLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSG  2031
              L FI G++ K K + FER+LFRATRGN+L  Q++ D  ++DPIS E VEK VF+VF+SG
Sbjct  189   GLRFICGIICKSKVLRFERMLFRATRGNMLFNQAQADVQIVDPISMEMVEKTVFVVFFSG  248

Query  2030  ERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSI  1851
             E+A+NK+LKIC+AFGAN YP  E++ KQ Q+  EVS +++EL+  +DAGI HR   L SI
Sbjct  249   EQARNKVLKICEAFGANCYPVPEDVTKQRQITREVSSRLTELEATLDAGIRHRNEALASI  308

Query  1850  AEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNS  1671
                  +W  +VRREK++Y TLNML+ DVTKKCLV EGW P  A  +IQ+ALQRA  DS+S
Sbjct  309   GFHLIKWMNMVRREKAVYDTLNMLNFDVTKKCLVGEGWCPIFAKTQIQEALQRATFDSSS  368

Query  1670  EIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVM  1491
             ++G IF V+ T ESPPTYF+TN+ T+AFQEIVDAYGVA+YQEANP V+T++TFPFLFAVM
Sbjct  369   QVGIIFHVMDTVESPPTYFRTNRLTNAFQEIVDAYGVARYQEANPAVYTVITFPFLFAVM  428

Query  1490  FGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEF  1311
             FGDWGHGICLLL  L  + RE KL++QKLG   EM FGGRYV+L+M+LFSIY G IYNEF
Sbjct  429   FGDWGHGICLLLGALVLIARESKLNNQKLGSFMEMLFGGRYVLLLMSLFSIYCGLIYNEF  488

Query  1310  FSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKL  1131
             FSV + +FG SAY CRD SCSDA T+GL+K RD Y FGVDP+W G+RSELPFLNSLKMK+
Sbjct  489   FSVPYHIFGASAYKCRDNSCSDAHTVGLVKYRDPYPFGVDPSWRGSRSELPFLNSLKMKM  548

Query  1130  SILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQ  951
             SILLG+AQMNLGIILSYFNA +  S ++   QF+PQ+IFLN+LFGYLS+LI++KWCTGSQ
Sbjct  549   SILLGIAQMNLGIILSYFNARFTGSSIDIRYQFVPQVIFLNSLFGYLSLLIVIKWCTGSQ  608

Query  950   ADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQHN-R  774
             ADLYHVMIYMFL P EDLGEN+LF GQ+  Q++L++LA+V+VPWML PKPFILK  H  R
Sbjct  609   ADLYHVMIYMFLSPFEDLGENELFWGQRPLQIILLMLAIVAVPWMLFPKPFILKKMHTER  668

Query  773   HQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLRL  594
              QG++Y  +   +  L V+        E+F FSE+FVHQ+IH+IEFVLGAVSNTASYLRL
Sbjct  669   FQGRTYGMLGTSEIDLEVEPDSARQHQEDFNFSEIFVHQMIHSIEFVLGAVSNTASYLRL  728

Query  593   WALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHALR  414
             WALSLAHSELSTVFYEKVLLLAWGY++ ++ ++G  +F FAT  +LL+METLSAFLHALR
Sbjct  729   WALSLAHSELSTVFYEKVLLLAWGYDSFVVRLIGLAVFSFATAFILLMMETLSAFLHALR  788

Query  413   LHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             LHWVEFQNKFY GDG+KF PFSF  +DE+ED
Sbjct  789   LHWVEFQNKFYHGDGHKFKPFSFASIDEDED  819



>gb|KEH36223.1| vacuolar proton ATPase a3-like protein [Medicago truncatula]
Length=722

 Score =  1006 bits (2602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 512/721 (71%), Positives = 608/721 (84%), Gaps = 2/721 (0%)
 Frame = -2

Query  2741  MDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSGEM  2562
             MDL RSEPMQLVQLIIPIESA+ S++YLGDLGL QFKDLN +KSPFQ+TYA+Q+KR GEM
Sbjct  1     MDLLRSEPMQLVQLIIPIESAQRSISYLGDLGLFQFKDLNEDKSPFQQTYASQVKRCGEM  60

Query  2561  ARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSFNE  2382
             +RKLR FK+QM KA +S S  S    +I  + LEVKL +LEAELIEIN+NN+KLQ ++NE
Sbjct  61    SRKLRLFKEQMKKANISPSTWSTRDGSIDLEKLEVKLAELEAELIEINSNNEKLQHTYNE  120

Query  2381  LVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgee-sleapllsePDMSADTSKQVRL  2205
             L+EYKLVL+KVGEFF SA+ SA  +Q+E    Q   E S++ PLL E + +A   KQ++L
Sbjct  121   LIEYKLVLEKVGEFFSSAQISAATRQRELEVQQPSVEGSIDCPLLMEQETTAYPVKQIKL  180

Query  2204  GFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSGER  2025
             GFI+GLV +EKS+ FERILFRATRGNV L+Q+ V+  V+DP+SGEKV KNVF++FYSGER
Sbjct  181   GFITGLVTREKSIPFERILFRATRGNVFLKQAVVEHHVLDPLSGEKVHKNVFIIFYSGER  240

Query  2024  AKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSIAE  1845
              K+KI KICDAFGANRYPF+++L KQ +++TEVS ++ ELKT ID G+LHR NLLQ+I  
Sbjct  241   VKSKINKICDAFGANRYPFSDDLSKQFEMMTEVSERVVELKTTIDVGLLHRSNLLQTIGY  300

Query  1844  QFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNSEI  1665
             +F++WN+L+++EKSIYH LNML+I+VTKKCL+AEGW P  AT +IQ  L RA  D NS++
Sbjct  301   KFEQWNLLLQKEKSIYHILNMLNINVTKKCLLAEGWCPVFATSQIQKTLMRATMDCNSQV  360

Query  1664  GAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMFG  1485
              AI +VL T E PPTYF TN FTS+FQEI+DAYG+AKYQEANPGV+TI+TFPFLFAVMFG
Sbjct  361   EAIVQVLQTNELPPTYFCTNIFTSSFQEIIDAYGIAKYQEANPGVYTIITFPFLFAVMFG  420

Query  1484  DWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEFFS  1305
             DWGHGICLLLATLYF+I EKK   QKLGDI EM FGGRY+I+MMALFSIYTG IYNEFFS
Sbjct  421   DWGHGICLLLATLYFIINEKKFYCQKLGDILEMVFGGRYIIMMMALFSIYTGLIYNEFFS  480

Query  1304  VQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKLSI  1125
             + FELFG+SAY CRDP+C DATTIGL+K RDTY FGVDP WHGTRSELPFLNSLKMK+SI
Sbjct  481   IPFELFGQSAYGCRDPTCRDATTIGLVKVRDTYPFGVDPKWHGTRSELPFLNSLKMKMSI  540

Query  1124  LLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQAD  945
             LLGV+QMNLGIILSY+NA YF + +N W QF+PQIIFLN+LFGYLS+LIIVKWCTGSQAD
Sbjct  541   LLGVSQMNLGIILSYYNAKYFENNINIWHQFVPQIIFLNSLFGYLSLLIIVKWCTGSQAD  600

Query  944   LYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQHN-RHQ  768
             LYHVMIYMFL PT+DLGENQLF GQK  Q++L+LLALVSVPWMLLPKPF+LK QH  RH+
Sbjct  601   LYHVMIYMFLSPTDDLGENQLFVGQKLLQVILLLLALVSVPWMLLPKPFLLKKQHQERHK  660

Query  767   GQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLRLWA  588
              QSY+ I ++D+ L         +H+EF+FSEVFVHQLIHTIEFVLGAVSNTASYLRLWA
Sbjct  661   SQSYSLIYNVDDPLESKSHGIHKNHQEFDFSEVFVHQLIHTIEFVLGAVSNTASYLRLWA  720

Query  587   L  585
             L
Sbjct  721   L  721



>ref|XP_006424665.1| hypothetical protein CICLE_v10027830mg [Citrus clementina]
 ref|XP_006488191.1| PREDICTED: vacuolar proton ATPase a1-like [Citrus sinensis]
 gb|ESR37905.1| hypothetical protein CICLE_v10027830mg [Citrus clementina]
 gb|KDO73120.1| hypothetical protein CISIN_1g003454mg [Citrus sinensis]
Length=819

 Score =  1006 bits (2601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 507/811 (63%), Positives = 641/811 (79%), Gaps = 2/811 (0%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             PPMDL RSE M  VQLIIP+ESA+ +V+YLG+LGL+QF+DLN++KSPFQRT+  Q+KR G
Sbjct  9     PPMDLMRSEKMMFVQLIIPVESAQRAVSYLGELGLLQFRDLNSDKSPFQRTFVNQVKRCG  68

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EM+RKLRFFK+Q++KAG+ +S +  +   +  ++LE++L + E ELIE N+N++KL++++
Sbjct  69    EMSRKLRFFKEQINKAGLQSSVHPVSGPDLDLEELEIQLAEHEHELIETNSNSEKLRQTY  128

Query  2387  NELVEYKLVLQKVGEFFHSAR-ssaeaqqqeygssqsgeesleapllsePDMSADTSKQV  2211
             NEL+E+K+VLQK G F  S+   +   + +   +  S  +  +   L E D+ A  S Q 
Sbjct  129   NELLEFKMVLQKAGGFLVSSNGHAVAEETELSENVYSMNDYADTASLLEQDIRAGPSNQS  188

Query  2210  RLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSG  2031
              L FISG++ K K + FER+LFRATRGN+L  Q+  DE ++DP++ E VEK +F+VF+SG
Sbjct  189   GLRFISGIICKSKVLRFERMLFRATRGNMLFNQAPADEEIMDPVTAEMVEKTIFVVFFSG  248

Query  2030  ERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSI  1851
             E+A+ KILKIC+AFGAN YP +E+L KQ Q+I EV  ++SEL+  +DAGI HR   L SI
Sbjct  249   EQARTKILKICEAFGANCYPVSEDLTKQRQIIREVLSRLSELEATLDAGIRHRNKALTSI  308

Query  1850  AEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNS  1671
                  +W  +VRREK++Y TLNML+ DVTKKCLV EGW P  A  +IQ+ LQRA  DSNS
Sbjct  309   GFHLTKWMNMVRREKAVYDTLNMLNFDVTKKCLVGEGWCPIFAKAQIQEVLQRATFDSNS  368

Query  1670  EIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVM  1491
             ++G IF V+ + ESPPTYF+TN+FT+AFQEIVDAYGVA+YQEANP V+ ++TFPFLFAVM
Sbjct  369   QVGTIFHVMDSMESPPTYFRTNRFTNAFQEIVDAYGVARYQEANPAVYAVITFPFLFAVM  428

Query  1490  FGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEF  1311
             FGDWGHGICLLL  L  + RE+KL +QKLG   EM FGGRYV+L+M+LFSIY G IYNEF
Sbjct  429   FGDWGHGICLLLGALVLIARERKLGNQKLGSFMEMLFGGRYVLLLMSLFSIYCGLIYNEF  488

Query  1310  FSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKL  1131
             FSV + +FG SAY CRD +CSDA T GL+K R+ Y FGVDP+W G+RSELPFLNSLKMK+
Sbjct  489   FSVPYHIFGGSAYRCRDTTCSDAYTAGLVKYREPYPFGVDPSWRGSRSELPFLNSLKMKM  548

Query  1130  SILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQ  951
             SILLGV QMNLGIILSYF+A +F S ++   QF+PQ+IFLN+LFGYLS+LII+KWCTGSQ
Sbjct  549   SILLGVTQMNLGIILSYFDARFFGSSLDIRYQFVPQLIFLNSLFGYLSLLIIIKWCTGSQ  608

Query  950   ADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQHN-R  774
             ADLYHVMIYMFL PT+DLGEN+LF GQ+  Q++L+LLA V+VPWML PKPFIL+  H  R
Sbjct  609   ADLYHVMIYMFLSPTDDLGENELFWGQRPLQILLLLLATVAVPWMLFPKPFILRKLHTER  668

Query  773   HQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLRL  594
              QG++Y  +   +  L V+       HE+F FSE+FVHQ+IH+IEFVLGAVSNTASYLRL
Sbjct  669   FQGRTYGILGTSEMDLEVEPDSARQHHEDFNFSEIFVHQMIHSIEFVLGAVSNTASYLRL  728

Query  593   WALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHALR  414
             WALSLAHSELSTVFYEKVLLLAWGY+N++I +VG  +F FAT  +LL+METLSAFLHALR
Sbjct  729   WALSLAHSELSTVFYEKVLLLAWGYDNLVIRLVGLAVFAFATAFILLMMETLSAFLHALR  788

Query  413   LHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             LHWVEFQNKFY GDGYKF PFSF L+++EED
Sbjct  789   LHWVEFQNKFYHGDGYKFRPFSFALINDEED  819



>ref|XP_004149561.1| PREDICTED: vacuolar proton ATPase a1-like [Cucumis sativus]
 ref|XP_004168233.1| PREDICTED: vacuolar proton ATPase a1-like [Cucumis sativus]
 gb|KGN47288.1| hypothetical protein Csa_6G288220 [Cucumis sativus]
Length=819

 Score =  1005 bits (2599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 510/811 (63%), Positives = 638/811 (79%), Gaps = 2/811 (0%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             PPMDL RSE M  VQLIIP+ESA  +++YLG+LG++QF+DLN +KSPFQRT+  Q+KR  
Sbjct  9     PPMDLMRSEKMTFVQLIIPVESAHRAISYLGELGILQFRDLNVDKSPFQRTFVNQVKRCA  68

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EM+RKLRFFKDQ+SKAGV AS     Q+ I+ +DLE++L D E ELIE+N+N++KL++S+
Sbjct  69    EMSRKLRFFKDQISKAGVLASTRPILQEHIELEDLEIRLADHEHELIEMNSNSEKLRQSY  128

Query  2387  NELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleap-llsePDMSADTSKQV  2211
             NEL+E+K+VLQK   F  S+ S + ++++E   +    +S      L E +M    S Q 
Sbjct  129   NELLEFKMVLQKASVFLVSSNSHSVSEERELNENVFLNDSYVEDGSLLEREMRPGPSNQS  188

Query  2210  RLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSG  2031
              L FI G++ K K + FER+LFRATRGN+L  Q+  D  ++DPIS E VEK VF+VF+SG
Sbjct  189   GLRFICGIICKSKVLRFERMLFRATRGNMLFNQAPADVQIMDPISTEMVEKTVFVVFFSG  248

Query  2030  ERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSI  1851
             E+A+NK+LKIC+AFGAN YP  E++ KQ Q+  EVS +++EL+  +DAGI HR   L SI
Sbjct  249   EQARNKVLKICEAFGANCYPVPEDITKQRQITREVSSRLTELEATLDAGIRHRNEALASI  308

Query  1850  AEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNS  1671
                  +W  +VRREK++Y TLNML+ DVTKKCLV EGW P  A  +IQ+ALQRA  DS+S
Sbjct  309   GFHLIKWMNMVRREKAVYDTLNMLNFDVTKKCLVGEGWCPIFAKTQIQEALQRATFDSSS  368

Query  1670  EIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVM  1491
             ++G IF V+ T ESPPT+F+TN+ T+AFQEIVDAYGVA+YQEANP V+T++TFPFLFAVM
Sbjct  369   QVGIIFHVMDTVESPPTHFRTNRLTNAFQEIVDAYGVARYQEANPAVYTVITFPFLFAVM  428

Query  1490  FGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEF  1311
             FGDWGHGICLLL  L  + RE KL++QKLG   EM FGGRYV+L+M+LFSIY G IYNEF
Sbjct  429   FGDWGHGICLLLGALVLIARESKLNNQKLGSFMEMLFGGRYVLLLMSLFSIYCGLIYNEF  488

Query  1310  FSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKL  1131
             FSV + +FG SAY CRD SCSDA T+GL+K RD Y FGVDP+W G+RSELPFLNSLKMK+
Sbjct  489   FSVPYHIFGASAYKCRDNSCSDAHTVGLVKYRDPYPFGVDPSWRGSRSELPFLNSLKMKM  548

Query  1130  SILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQ  951
             SILLG+AQMNLGIILSYFNA +  S ++   QFIPQ+IFLN+LFGYLS+LI++KWCTGSQ
Sbjct  549   SILLGIAQMNLGIILSYFNARFTGSSIDIRYQFIPQVIFLNSLFGYLSLLIVIKWCTGSQ  608

Query  950   ADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQHN-R  774
             ADLYHVMIYMFL P EDLGEN+LF GQ+  Q++L++LA+V+VPWML PKPFILK  H  R
Sbjct  609   ADLYHVMIYMFLSPFEDLGENELFWGQRPLQIILLMLAIVAVPWMLFPKPFILKKMHTER  668

Query  773   HQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLRL  594
              QG++Y  +   +  L V+        E+F FSE+FVHQ+IH+IEFVLGAVSNTASYLRL
Sbjct  669   FQGRTYGMLGTSEIDLEVEPDSARQHQEDFNFSEIFVHQMIHSIEFVLGAVSNTASYLRL  728

Query  593   WALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHALR  414
             WALSLAHSELSTVFYEKVLLLAWGY++ +I ++G  +F FAT  +LL+METLSAFLHALR
Sbjct  729   WALSLAHSELSTVFYEKVLLLAWGYDSFVIRLIGLAVFSFATAFILLMMETLSAFLHALR  788

Query  413   LHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             LHWVEFQNKFY GDG+KF PFSF  +DE+ED
Sbjct  789   LHWVEFQNKFYHGDGHKFKPFSFASIDEDED  819



>ref|XP_007015509.1| Vacuolar proton ATPase A1 isoform 3 [Theobroma cacao]
 gb|EOY33128.1| Vacuolar proton ATPase A1 isoform 3 [Theobroma cacao]
Length=820

 Score =  1004 bits (2595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 511/810 (63%), Positives = 640/810 (79%), Gaps = 2/810 (0%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             PPMDL RSE M LVQLIIP+ESA  +++YLG+LGL+QF+DLNAEKSPFQRT+  Q+KR G
Sbjct  12    PPMDLMRSEKMTLVQLIIPVESAHRAISYLGELGLLQFRDLNAEKSPFQRTFVNQVKRCG  71

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EM+RKLRFFKDQ+SKAG+ +S +   +  ++ ++LE++L + E ELIE+N+N++KL++++
Sbjct  72    EMSRKLRFFKDQISKAGLLSSLHPVVEPDVELEELEIQLAEHEHELIEMNSNSEKLRQTY  131

Query  2387  NELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTSKQVR  2208
             NEL+E+K+VLQK G F  S+ + A  +++E   +    +          +     + Q  
Sbjct  132   NELLEFKIVLQKAGGFLVSSNNHAVDEERELSENVYSNDGYVETASLL-EQEMRPADQSG  190

Query  2207  LGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSGE  2028
             L FISG++ K K++ FER+LFRATRGN+L   +   E ++DP+S E VEK VF+VF+SGE
Sbjct  191   LRFISGIICKSKALRFERMLFRATRGNMLFNHAPAGEEIMDPVSAEMVEKTVFVVFFSGE  250

Query  2027  RAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSIA  1848
             +AK KILKIC+AFGAN YP  +++ KQ Q+  EV  ++SEL+T +DAGI HR   L S+ 
Sbjct  251   QAKTKILKICEAFGANCYPVPDDISKQRQITREVLSRLSELETTLDAGIRHRNKALTSVG  310

Query  1847  EQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNSE  1668
                  W  +VRREK++Y TLNML+ DVTKKCLV EGW P  A  +IQ+ALQRA  DSNS+
Sbjct  311   YHLTHWMSMVRREKAVYDTLNMLNFDVTKKCLVGEGWCPIFAKAQIQEALQRATFDSNSQ  370

Query  1667  IGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMF  1488
             +G IF V+   ESPPTYF+TN+FT+A+QEIVDAYGVA+YQE+NP V+T++TFPFLFAVMF
Sbjct  371   VGIIFHVMDAVESPPTYFRTNRFTNAYQEIVDAYGVARYQESNPAVYTVITFPFLFAVMF  430

Query  1487  GDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEFF  1308
             GDWGHGICLLL  L  + RE +LS+QKLG   EM FGGRYV+L+M+LFSIY G IYNEFF
Sbjct  431   GDWGHGICLLLGALVLIARESRLSTQKLGSFMEMLFGGRYVLLLMSLFSIYCGLIYNEFF  490

Query  1307  SVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKLS  1128
             SV F +FG SAY CRD +C DA + GLIK RD Y FGVDP+W G+RSELPFLNSLKMK+S
Sbjct  491   SVPFHIFGGSAYKCRDATCRDAQSAGLIKFRDPYPFGVDPSWRGSRSELPFLNSLKMKMS  550

Query  1127  ILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQA  948
             ILLGVAQMNLGIILSYFNA +FR+ ++   QF+PQ+IFLN+LFGYLS+LII+KWCTGSQA
Sbjct  551   ILLGVAQMNLGIILSYFNARFFRNSLDIRYQFVPQMIFLNSLFGYLSLLIIIKWCTGSQA  610

Query  947   DLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQHN-RH  771
             DLYHVMIYMFL PT+DLG+N+LF GQ+  Q+VL+LLALV+VPWML PKPFILK  H+ R 
Sbjct  611   DLYHVMIYMFLSPTDDLGDNELFWGQRPLQIVLLLLALVAVPWMLFPKPFILKKLHSERF  670

Query  770   QGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLRLW  591
             QG++Y  +   +  L V+       HEEF FSEVFVHQ+IH+IEFVLGAVSNTASYLRLW
Sbjct  671   QGRTYGMLGTSEFDLDVEPDSARQHHEEFNFSEVFVHQMIHSIEFVLGAVSNTASYLRLW  730

Query  590   ALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHALRL  411
             ALSLAHSELSTVFYEKVLLLAWGY+NI+I +VG  +F FAT  +LL+METLSAFLHALRL
Sbjct  731   ALSLAHSELSTVFYEKVLLLAWGYDNIVIRLVGLAVFAFATAFILLMMETLSAFLHALRL  790

Query  410   HWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             HWVEFQNKFY GDGYKF PF+F L+ E++D
Sbjct  791   HWVEFQNKFYHGDGYKFKPFAFALITEDDD  820



>ref|XP_001763380.1| predicted protein [Physcomitrella patens]
 gb|EDQ71910.1| predicted protein [Physcomitrella patens]
Length=818

 Score =  1003 bits (2592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 529/817 (65%), Positives = 648/817 (79%), Gaps = 10/817 (1%)
 Frame = -2

Query  2741  MDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSGEM  2562
             MDLFRSE M LVQLIIP ESA  +V YLG+LGL+QFKDLN +KSPFQRTYA Q+KR GEM
Sbjct  1     MDLFRSEEMSLVQLIIPAESAHDTVIYLGELGLLQFKDLNPDKSPFQRTYANQVKRCGEM  60

Query  2561  ARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSFNE  2382
             ARKLR+F DQ++KAG + +       ++  D+LE+KL +LEAEL+EINAN DKLQR+ +E
Sbjct  61    ARKLRYFHDQIAKAGQTPAQRPMVDKSVDLDELEIKLTELEAELLEINANTDKLQRAHSE  120

Query  2381  LVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleap---llsePDMSADTSKQV  2211
             LVE++LVL K G FF SAR++A   QQ+   +++     E+    LL E +M  + SK  
Sbjct  121   LVEFQLVLDKAGAFFSSARNTASTVQQQRADAENESSIEESIDRPLLQEQEMQTEPSKAA  180

Query  2210  RLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSG  2031
             RLGFISG+VPK K+ +FERILFRATRGN+ L+Q+ ++ + IDP +GE+ EK VF+VF+SG
Sbjct  181   RLGFISGVVPKAKAASFERILFRATRGNMFLKQAPIEGTTIDPATGEETEKTVFVVFFSG  240

Query  2030  ERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSI  1851
             ERAK+K++KIC+AFGANRYPF E+  KQ Q+ +EV  ++SEL+  +DAG  HR N+  +I
Sbjct  241   ERAKSKVVKICEAFGANRYPFPEDPNKQWQMKSEVETRLSELQNTLDAGNHHRHNIFNNI  300

Query  1850  AEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNS  1671
                 +RW + VRR+K+ YHTLNMLSIDVT+KCLVAEGW P SA  +IQDALQRA +DSNS
Sbjct  301   GFNLERWTITVRRDKAAYHTLNMLSIDVTRKCLVAEGWCPVSAKPKIQDALQRAAYDSNS  360

Query  1670  EIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVM  1491
             ++  IFRV   +ESPP+YF+TNKFT+AFQEIV+AYGV +YQEANPG FTI+TFPFLFAVM
Sbjct  361   QVNTIFRVFRMKESPPSYFETNKFTNAFQEIVEAYGVGRYQEANPGCFTIITFPFLFAVM  420

Query  1490  FGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEF  1311
             FGDWGHGICLLL  LY ++ EK L  QKLGDI EM +GGRYVIL+MA+FSIYTGFIYNEF
Sbjct  421   FGDWGHGICLLLGALYLVLNEKNLGKQKLGDIMEMAYGGRYVILLMAIFSIYTGFIYNEF  480

Query  1310  FSVQFELFGRSAYVCRDP-----SCSDATTIGLIK-ARDTYAFGVDPAWHGTRSELPFLN  1149
             FSV F  FG SAY C DP     +C  ATT G+ K + + YAFGVDP WHG+RSELPF N
Sbjct  481   FSVPFGFFGGSAYRCPDPQFSIENCPSATTSGVEKWSYEPYAFGVDPIWHGSRSELPFTN  540

Query  1148  SLKMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVK  969
             SLKMK+SILLG++QMNLGI+LSYFNA YF S ++ W QFIPQ++FLNALFGYLS LI++K
Sbjct  541   SLKMKMSILLGISQMNLGILLSYFNAKYFCSALDVWYQFIPQLLFLNALFGYLSFLIVLK  600

Query  968   WCTGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILK  789
             WC GS+ DLYHVMIYMFL PTEDLGENQLF GQ   Q++L+L+ALV+VPWML PKP IL+
Sbjct  601   WCQGSKPDLYHVMIYMFLSPTEDLGENQLFSGQTYVQIILLLIALVAVPWMLFPKPLILR  660

Query  788   SQH-NRHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNT  612
             +QH  + +G +Y  ++  D S          D EEFEFSEV VHQ+IHTIEFVLGAVSNT
Sbjct  661   NQHIQKMRGATYGALRRSDSSASEAEVDSDHDEEEFEFSEVLVHQMIHTIEFVLGAVSNT  720

Query  611   ASYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSA  432
             ASYLRLWALSLAH++LS VFYE+VL+ AWGY+N +I ++G I+F F T GVLL+METLSA
Sbjct  721   ASYLRLWALSLAHAQLSAVFYERVLMFAWGYSNPVIRLIGLIVFTFVTFGVLLLMETLSA  780

Query  431   FLHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             FLHALRLHWVEFQNKFY+GDGYKF PF+F  + EE+D
Sbjct  781   FLHALRLHWVEFQNKFYQGDGYKFKPFAFNSLSEEDD  817



>ref|XP_010922514.1| PREDICTED: V-type proton ATPase subunit a1 [Elaeis guineensis]
Length=819

 Score =  1002 bits (2590),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 512/811 (63%), Positives = 631/811 (78%), Gaps = 2/811 (0%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             PPMD  RSE M  VQLIIP+ESA  S+ YLG+LG++QFKDLN +KSPFQ T+  Q+KR G
Sbjct  9     PPMDHLRSEKMSFVQLIIPVESAHRSITYLGELGMLQFKDLNDDKSPFQLTFVNQVKRCG  68

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EMARKLRFF DQ+SKA + ++     Q  +  ++LEV+L + EAEL+E+N N++KLQ+++
Sbjct  69    EMARKLRFFSDQISKACIMSAGRPAMQPDVSLEELEVRLAEHEAELLEMNMNSEKLQQAY  128

Query  2387  NELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMS-ADTSKQV  2211
             NEL+E+KLVL K G F  S+++ A   ++E   S   +E  +  L      +  + S + 
Sbjct  129   NELLEFKLVLLKAGSFLVSSQNHAVPAERELDESIYSKEKDQESLSFLDQETLPEMSNKA  188

Query  2210  RLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSG  2031
              L FISG++ K K++ FER+LFRATRGN+   Q+   E V+DP+SGE VEK VF+VF+SG
Sbjct  189   GLRFISGIICKSKALRFERMLFRATRGNMFFNQAPAGEHVMDPVSGEMVEKIVFVVFFSG  248

Query  2030  ERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSI  1851
             E+AK KILKIC+AFGAN YP  E+  KQ Q+  EVS ++SEL+  +DAGI HR N L SI
Sbjct  249   EQAKTKILKICEAFGANCYPVPEDTSKQRQMTREVSSRLSELEATLDAGIRHRNNALASI  308

Query  1850  AEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNS  1671
               Q  +W ++VR+EK++Y TLNML+ DVTKKCLV EGW P SA  +IQDALQRA  DSNS
Sbjct  309   GSQLWKWTIMVRKEKAVYDTLNMLNFDVTKKCLVGEGWCPVSAKPQIQDALQRATIDSNS  368

Query  1670  EIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVM  1491
             ++G IF V+G  ESPPTYF+TN+FT AFQEI+DAYGVA+YQEANP V++++TFPFLFAVM
Sbjct  369   QVGIIFHVMGAIESPPTYFRTNRFTHAFQEIIDAYGVARYQEANPAVYSVITFPFLFAVM  428

Query  1490  FGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEF  1311
             FGDWGHGICLLL +   ++REKKL SQKLG   EM FGGRYV+L+MALFSIY G IYNEF
Sbjct  429   FGDWGHGICLLLGSFLLIVREKKLGSQKLGSFMEMAFGGRYVLLLMALFSIYCGLIYNEF  488

Query  1310  FSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKL  1131
             FSV F +FG SAY CRD SCSDA T GL+K RD Y FGVDP W G+RSELPFLNSLKMK+
Sbjct  489   FSVPFHIFGESAYKCRDTSCSDARTAGLVKYRDPYPFGVDPRWRGSRSELPFLNSLKMKM  548

Query  1130  SILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQ  951
             SILLGV+QMNLGIILSYF+A +  + ++   QFIPQ+IFLN+LFGYLS+L+++KWCTGSQ
Sbjct  549   SILLGVSQMNLGIILSYFDAKFHGNSLDVRYQFIPQMIFLNSLFGYLSLLVLIKWCTGSQ  608

Query  950   ADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKS-QHNR  774
             ADLYHVMIYMFL PT DLGENQLF GQK  Q++L+LLA+V+VPWML PKPFIL+     R
Sbjct  609   ADLYHVMIYMFLDPTGDLGENQLFWGQKPLQILLLLLAIVAVPWMLFPKPFILRKLDMER  668

Query  773   HQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLRL  594
              QG++Y  ++  +  L  +       H++F FSEVFVHQ+IH+IEFVLGAVSNTASYLRL
Sbjct  669   FQGRTYGILRTSEMDLDHEPDSARQRHDDFNFSEVFVHQMIHSIEFVLGAVSNTASYLRL  728

Query  593   WALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHALR  414
             WALSLAHSELSTVFYEK+LLLAWGY+N II + G  +F FAT  +LL+METLSAFLHALR
Sbjct  729   WALSLAHSELSTVFYEKILLLAWGYDNPIIRIAGLAVFAFATAFILLMMETLSAFLHALR  788

Query  413   LHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             LHWVEF NKFY GDGYKF PFSF  + +EED
Sbjct  789   LHWVEFMNKFYHGDGYKFRPFSFASLADEED  819



>ref|XP_007015511.1| Vacuolar proton ATPase A1 isoform 5 [Theobroma cacao]
 gb|EOY33130.1| Vacuolar proton ATPase A1 isoform 5 [Theobroma cacao]
Length=821

 Score =   999 bits (2583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 511/811 (63%), Positives = 640/811 (79%), Gaps = 3/811 (0%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             PPMDL RSE M LVQLIIP+ESA  +++YLG+LGL+QF+DLNAEKSPFQRT+  Q+KR G
Sbjct  12    PPMDLMRSEKMTLVQLIIPVESAHRAISYLGELGLLQFRDLNAEKSPFQRTFVNQVKRCG  71

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EM+RKLRFFKDQ+SKAG+ +S +   +  ++ ++LE++L + E ELIE+N+N++KL++++
Sbjct  72    EMSRKLRFFKDQISKAGLLSSLHPVVEPDVELEELEIQLAEHEHELIEMNSNSEKLRQTY  131

Query  2387  NELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTSKQVR  2208
             NEL+E+K+VLQK G F  S+ + A  +++E   +    +          +     + Q  
Sbjct  132   NELLEFKIVLQKAGGFLVSSNNHAVDEERELSENVYSNDGYVETASLL-EQEMRPADQSG  190

Query  2207  LGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSGE  2028
             L FISG++ K K++ FER+LFRATRGN+L   +   E ++DP+S E VEK VF+VF+SGE
Sbjct  191   LRFISGIICKSKALRFERMLFRATRGNMLFNHAPAGEEIMDPVSAEMVEKTVFVVFFSGE  250

Query  2027  RAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSIA  1848
             +AK KILKIC+AFGAN YP  +++ KQ Q+  EV  ++SEL+T +DAGI HR   L S+ 
Sbjct  251   QAKTKILKICEAFGANCYPVPDDISKQRQITREVLSRLSELETTLDAGIRHRNKALTSVG  310

Query  1847  EQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNSE  1668
                  W  +VRREK++Y TLNML+ DVTKKCLV EGW P  A  +IQ+ALQRA  DSNS+
Sbjct  311   YHLTHWMSMVRREKAVYDTLNMLNFDVTKKCLVGEGWCPIFAKAQIQEALQRATFDSNSQ  370

Query  1667  IGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMF  1488
             +G IF V+   ESPPTYF+TN+FT+A+QEIVDAYGVA+YQE+NP V+T++TFPFLFAVMF
Sbjct  371   VGIIFHVMDAVESPPTYFRTNRFTNAYQEIVDAYGVARYQESNPAVYTVITFPFLFAVMF  430

Query  1487  GDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEFF  1308
             GDWGHGICLLL  L  + RE +LS+QKLG   EM FGGRYV+L+M+LFSIY G IYNEFF
Sbjct  431   GDWGHGICLLLGALVLIARESRLSTQKLGSFMEMLFGGRYVLLLMSLFSIYCGLIYNEFF  490

Query  1307  SVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKLS  1128
             SV F +FG SAY CRD +C DA + GLIK RD Y FGVDP+W G+RSELPFLNSLKMK+S
Sbjct  491   SVPFHIFGGSAYKCRDATCRDAQSAGLIKFRDPYPFGVDPSWRGSRSELPFLNSLKMKMS  550

Query  1127  ILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQA  948
             ILLGVAQMNLGIILSYFNA +FR+ ++   QF+PQ+IFLN+LFGYLS+LII+KWCTGSQA
Sbjct  551   ILLGVAQMNLGIILSYFNARFFRNSLDIRYQFVPQMIFLNSLFGYLSLLIIIKWCTGSQA  610

Query  947   DLYHVMIYMFLGPTEDLGENQLFPGQKT-TQlvlvllalvsVPWMLLPKPFILKSQHN-R  774
             DLYHVMIYMFL PT+DLG+N+LF GQ+   Q+VL+LLALV+VPWML PKPFILK  H+ R
Sbjct  611   DLYHVMIYMFLSPTDDLGDNELFWGQRPLQQIVLLLLALVAVPWMLFPKPFILKKLHSER  670

Query  773   HQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLRL  594
              QG++Y  +   +  L V+       HEEF FSEVFVHQ+IH+IEFVLGAVSNTASYLRL
Sbjct  671   FQGRTYGMLGTSEFDLDVEPDSARQHHEEFNFSEVFVHQMIHSIEFVLGAVSNTASYLRL  730

Query  593   WALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHALR  414
             WALSLAHSELSTVFYEKVLLLAWGY+NI+I +VG  +F FAT  +LL+METLSAFLHALR
Sbjct  731   WALSLAHSELSTVFYEKVLLLAWGYDNIVIRLVGLAVFAFATAFILLMMETLSAFLHALR  790

Query  413   LHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             LHWVEFQNKFY GDGYKF PF+F L+ E++D
Sbjct  791   LHWVEFQNKFYHGDGYKFKPFAFALITEDDD  821



>ref|XP_010043691.1| PREDICTED: V-type proton ATPase subunit a1 isoform X1 [Eucalyptus 
grandis]
 gb|KCW85678.1| hypothetical protein EUGRSUZ_B02458 [Eucalyptus grandis]
Length=820

 Score =   998 bits (2581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 517/813 (64%), Positives = 642/813 (79%), Gaps = 4/813 (0%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             P MDL RSE M  VQLI+P ESA  ++ YLG+LGL+QF+DLNA++SPFQRT+  Q+KR G
Sbjct  8     PAMDLMRSERMTFVQLIMPFESAHRAITYLGELGLLQFRDLNADRSPFQRTFVNQVKRCG  67

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EM+RKLRFFKDQ+SKAG+ +S +S TQ  ++ ++LE++L + E EL E+NAN++KL++++
Sbjct  68    EMSRKLRFFKDQISKAGLISSLHSATQPDVELEELEIQLAEHEHELNEMNANSEKLRQAY  127

Query  2387  NELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsge-esleapllsePDMSADTSKQV  2211
             NEL+E+K+VLQK G F  S +S    + +E   +     + +E   L E +M  +T +Q 
Sbjct  128   NELLEFKMVLQKAGGFLVSGKSPVAVEDRELDENIHSNGDYVETASLLEKEMRPETMEQS  187

Query  2210  RLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSG  2031
             R+ FISG++ K K   FER+LFRATRGN+L  Q   DE ++DP++ E VEK VF+VF+SG
Sbjct  188   RVRFISGIICKSKVQIFERMLFRATRGNMLFNQGPADEDIVDPVTSETVEKIVFVVFFSG  247

Query  2030  ERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSI  1851
             E+A+ KILKIC+AF AN YP  E++ KQ Q+  EV  ++SE++T + AG  HR   L SI
Sbjct  248   EQARMKILKICEAFSANCYPVPEDITKQRQISQEVLSRLSEIETTLGAGYNHRNRALSSI  307

Query  1850  AEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNS  1671
                 ++W  +VRREK+IY TLNML+ DVTKKCLV EGW P  A  +IQ+ALQRA +DSNS
Sbjct  308   QFHLNKWMNMVRREKAIYDTLNMLNFDVTKKCLVGEGWCPIFAKAKIQEALQRATYDSNS  367

Query  1670  EIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVM  1491
             ++G IF  +   ESPPT+F+TN+FTSAFQEIVDAYGVA+YQEANP V+T+VTFPFLFAVM
Sbjct  368   QVGIIFHEMDAPESPPTFFRTNRFTSAFQEIVDAYGVARYQEANPAVYTVVTFPFLFAVM  427

Query  1490  FGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEF  1311
             FGDWGHGICLLL  L  + +E+KL+ QKLG   EM FGGRYV+L+M+LFSIY G IYNEF
Sbjct  428   FGDWGHGICLLLGALVLIAQERKLTGQKLGSFMEMLFGGRYVLLLMSLFSIYCGLIYNEF  487

Query  1310  FSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKL  1131
             FSV F +FG SAY CRD SCSDA ++GLIK +D Y FGVDP+W G+RSELPFLNSLKMK+
Sbjct  488   FSVPFNIFGESAYKCRDTSCSDARSVGLIKYQDPYPFGVDPSWRGSRSELPFLNSLKMKM  547

Query  1130  SILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQ  951
             SILLGV QMNLGIILSYFNA +F+S ++   QF+PQ+IFLN+LFGYLS+LII+KWCTGSQ
Sbjct  548   SILLGVVQMNLGIILSYFNARFFKSTLDIRFQFVPQVIFLNSLFGYLSLLIIIKWCTGSQ  607

Query  950   ADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQHN-R  774
             ADLYHVMIYMFL PT+DLGENQLF GQK  Q++L+LLAL++VPWML PKPFILK  H+ R
Sbjct  608   ADLYHVMIYMFLSPTDDLGENQLFWGQKPLQIILLLLALIAVPWMLFPKPFILKKLHSER  667

Query  773   HQGQSYAPI--QDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYL  600
              QG++Y  +   ++D     +       HEEF FSEVFVHQ+IH+IEFVLGAVSNTASYL
Sbjct  668   FQGRTYQMLGTSEMDIDGDTEPDSARQHHEEFNFSEVFVHQMIHSIEFVLGAVSNTASYL  727

Query  599   RLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHA  420
             RLWALSLAHSELSTVFYEKVLLLAWGY+N+II +VG  +F FAT  +LL+METLSAFLHA
Sbjct  728   RLWALSLAHSELSTVFYEKVLLLAWGYDNLIIRLVGLAVFAFATAFILLMMETLSAFLHA  787

Query  419   LRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             LRLHWVEFQNKFY GDGYKF PFSF L+ EEED
Sbjct  788   LRLHWVEFQNKFYHGDGYKFRPFSFSLLTEEED  820



>ref|XP_010032049.1| PREDICTED: V-type proton ATPase subunit a1-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW51435.1| hypothetical protein EUGRSUZ_J00960 [Eucalyptus grandis]
Length=820

 Score =   997 bits (2578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 506/812 (62%), Positives = 640/812 (79%), Gaps = 3/812 (0%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             P MDL RSE M  VQ IIP+ESA  +V+YLG+LGL+QF+DLNAEKSPFQRT+ +Q+KR G
Sbjct  9     PAMDLMRSERMSFVQFIIPVESAHRAVSYLGELGLVQFRDLNAEKSPFQRTFVSQVKRCG  68

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EM RKLRFF+DQ+ KAGV +  N   Q  +  + LE++L + E ELIE+N+N++ L++S+
Sbjct  69    EMLRKLRFFRDQVGKAGVKSPENPVVQPDVLLEQLEIQLAEHERELIEMNSNSEHLRQSY  128

Query  2387  NELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTSKQVR  2208
             NEL+E+K+VLQ+ G F  S ++   A+++E   +    + +E   L E +M   TS+Q  
Sbjct  129   NELLEFKMVLQEAGSFLFSGKNHPVAEERELDETAYSNDYVETASLLEKEMRPGTSEQSG  188

Query  2207  LGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSGE  2028
             L +I+G++ + K + FER+LFRATRGN+L  Q+  +E ++DP++ E VEK VF+V++SGE
Sbjct  189   LNYITGIICQTKVLIFERMLFRATRGNMLFNQAPANEGIMDPVTSEMVEKVVFMVYFSGE  248

Query  2027  RAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSIA  1848
             +A+ KI KIC+AFG N YP  +++ KQ Q+  EV  ++SEL+  +D GI HR + L SI+
Sbjct  249   QARKKIKKICEAFGVNCYPVPDDITKQRQMTREVVSRLSELEATLDVGIRHRNSALSSIS  308

Query  1847  EQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNSE  1668
                 +W  LVRREK++Y TLNML+ DVTKKCLV EGW PT A  +IQ+ LQRA +DSNS+
Sbjct  309   LHLPKWTDLVRREKAVYDTLNMLNFDVTKKCLVGEGWCPTFAKAKIQEVLQRATYDSNSQ  368

Query  1667  IGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMF  1488
             +G IF  +   +SPPT+F+TNKFT+A+QEIVDAYGV +YQEANP V+TIVTFPFLFAVMF
Sbjct  369   VGIIFHTMDAVDSPPTFFRTNKFTNAYQEIVDAYGVGRYQEANPAVYTIVTFPFLFAVMF  428

Query  1487  GDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEFF  1308
             GDWGHGICLLL  L  + RE KL ++KLG   EM FGGRY++L+M+LFSIY G IYNEFF
Sbjct  429   GDWGHGICLLLGALVLIARESKLGNKKLGSFMEMLFGGRYILLLMSLFSIYCGLIYNEFF  488

Query  1307  SVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKLS  1128
             SV F +FGRSAY CRD +CSDA ++GLIK RD Y FGVDP+W G+RSELPFLNSLKMK+S
Sbjct  489   SVPFHIFGRSAYKCRDTTCSDAYSVGLIKYRDPYPFGVDPSWRGSRSELPFLNSLKMKMS  548

Query  1127  ILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQA  948
             ILLGVAQMNLGIILSYFNA YF S ++   QF+PQIIFLN+LFGYLS+LII+KWCTGSQA
Sbjct  549   ILLGVAQMNLGIILSYFNARYFESSLDIRYQFVPQIIFLNSLFGYLSLLIIIKWCTGSQA  608

Query  947   DLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQH-NRH  771
             DLYHVMIYMFL PT++LGENQLF GQ+  Q++L+LLAL++VPWML PKPFILK  H  R 
Sbjct  609   DLYHVMIYMFLSPTDNLGENQLFWGQRPLQILLLLLALIAVPWMLFPKPFILKRLHIERF  668

Query  770   QGQSYA--PIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLR  597
             QG++Y    I ++D     D +     HE+F FS+VFVHQ+IH+IEFVLGAVSNTASYLR
Sbjct  669   QGRTYGVLGISEMDVEAEPDSARAQQHHEDFNFSKVFVHQMIHSIEFVLGAVSNTASYLR  728

Query  596   LWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHAL  417
             LWALSLAHSELSTVFYEKVLLLAWGY+N+II +VG  +F FAT  +LL+METLSAFLHAL
Sbjct  729   LWALSLAHSELSTVFYEKVLLLAWGYDNVIIRLVGLAVFAFATAFILLMMETLSAFLHAL  788

Query  416   RLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             RLHWVEFQNKFY GDGYKF PFSF L++++++
Sbjct  789   RLHWVEFQNKFYHGDGYKFKPFSFALLNDDDE  820



>ref|XP_008358210.1| PREDICTED: vacuolar proton ATPase a1 [Malus domestica]
Length=819

 Score =   996 bits (2575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 511/811 (63%), Positives = 636/811 (78%), Gaps = 2/811 (0%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             P MDL RSE M  VQLIIP+ESA  +++YLG+LGL+QF+DLNA+KSPFQRT+  Q+KR  
Sbjct  9     PAMDLMRSEKMTFVQLIIPVESAHRAISYLGELGLLQFRDLNADKSPFQRTFVNQVKRCA  68

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EM+RKLRFF+DQ+SKAG+ +S +   Q  I  ++LE++L + E ELIE+N+N+D++Q S+
Sbjct  69    EMSRKLRFFRDQISKAGLLSSVHPVLQPDIDLEELEIQLAEHEHELIELNSNSDRIQHSY  128

Query  2387  NELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesl-eapllsePDMSADTSKQV  2211
             NEL+EYK+VLQK   F  S+ S A ++++E   +    +   +   L E D+    S Q 
Sbjct  129   NELLEYKMVLQKASGFLVSSNSHAASEERELDENIYSNDHYGDEVSLLEQDIRPGPSDQS  188

Query  2210  RLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSG  2031
              L F+SG++ K K++ FER+LFRATRGN+L   +  DE ++DP+S E VEK VF+VF+SG
Sbjct  189   GLRFVSGIICKSKALRFERMLFRATRGNMLFNHAPADELMMDPLSTEMVEKTVFVVFFSG  248

Query  2030  ERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSI  1851
              +AK KILKIC+AFGAN YP  E+  +Q Q+  EVS +++EL+T +DAGI HR   L S+
Sbjct  249   MQAKTKILKICEAFGANCYPVPEDTTRQRQITREVSSRLAELETTLDAGIRHRNKALASV  308

Query  1850  AEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNS  1671
                  +W  +VRREK++Y TLNML+ DVTKKCLV EGW P  A  +IQ+ALQRA  DSNS
Sbjct  309   GFHLAKWMNMVRREKAVYDTLNMLNFDVTKKCLVGEGWCPIFAKPKIQEALQRATFDSNS  368

Query  1670  EIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVM  1491
             ++G IF  +   +SPPTYF+TN+FTSAFQEIVDAYGVA+YQEANP V+T++TFPFLFAVM
Sbjct  369   QVGVIFHXMDAIDSPPTYFRTNRFTSAFQEIVDAYGVARYQEANPAVYTVITFPFLFAVM  428

Query  1490  FGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEF  1311
             FGDWGHGICLLL  L  + RE KLS+QKLG   EM FGGRYV+L+M+LFSIY G IYNEF
Sbjct  429   FGDWGHGICLLLGALVLIARESKLSAQKLGSFMEMLFGGRYVLLLMSLFSIYCGLIYNEF  488

Query  1310  FSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKL  1131
             FSV F +FG SAY CRD +CS+  TIGLIK RD Y FGVDP+W G+RSELPFLNSLKMK+
Sbjct  489   FSVPFHIFGGSAYKCRDTACSEVHTIGLIKYRDPYPFGVDPSWRGSRSELPFLNSLKMKM  548

Query  1130  SILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQ  951
             SILLGV QMNLGI+LSYFNA +F S ++ W QF+PQ+IFLN+LFGYLS+L+++KWCTGSQ
Sbjct  549   SILLGVVQMNLGILLSYFNARFFSSSLDIWYQFVPQMIFLNSLFGYLSLLVVIKWCTGSQ  608

Query  950   ADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQHN-R  774
             ADLYHVMIYMFL PT+DLGENQLF GQ+  Q++L+LLAL++VPWML PKPFILK  H  R
Sbjct  609   ADLYHVMIYMFLSPTDDLGENQLFWGQRPLQIILLLLALIAVPWMLFPKPFILKKLHTER  668

Query  773   HQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLRL  594
              QG++Y  +   +  L V+       HEEF FSEVFVHQ+IH+IEFVLGAVSNTASYLRL
Sbjct  669   FQGRAYGMLGTSEMDLEVEPDSARQHHEEFNFSEVFVHQMIHSIEFVLGAVSNTASYLRL  728

Query  593   WALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHALR  414
             WALSLAHSELSTVFYEKVLLLAWGY++ II ++G  +F FAT  +LL+METLSAFLHALR
Sbjct  729   WALSLAHSELSTVFYEKVLLLAWGYDSFIIRLIGLSVFAFATAFILLMMETLSAFLHALR  788

Query  413   LHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             LHWVE+QNKFY GDGYKF PFSF  + E+ED
Sbjct  789   LHWVEYQNKFYHGDGYKFKPFSFASITEDED  819



>ref|XP_011028943.1| PREDICTED: V-type proton ATPase subunit a2-like isoform X3 [Populus 
euphratica]
Length=740

 Score =   995 bits (2573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 519/731 (71%), Positives = 616/731 (84%), Gaps = 11/731 (2%)
 Frame = -2

Query  2480  IKFDDLEVKLGDLEAELIEINANNDKLQRSFNELVEYKLVLQKV----------GEFFHS  2331
             + F   ++ LG+LE+ELIEIN+NN+ L+ ++NEL EYKLVLQKV          GE FHS
Sbjct  10    VSFWHEKMALGELESELIEINSNNEMLKHTYNELSEYKLVLQKVWLLLHPKPLAGELFHS  69

Query  2330  ARssaeaqqqeygssqsgeesleapllsePDMSADTSKQVRLGFISGLVPKEKSMAFERI  2151
             A+ S  AQQ E  +  + E S+++ LL E +M+ D SKQV+LG+ISGLV +EK+MAFERI
Sbjct  70    AQISVAAQQSELEAYNTAEASIDSALLLEQEMTTDPSKQVKLGYISGLVAREKAMAFERI  129

Query  2150  LFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSGERAKNKILKICDAFGANRYP  1971
             LFRATRGNV L+QS ++ +V+DP+SG+KVEKNVF+VFYSGERAKNKILK+C+ FGANRYP
Sbjct  130   LFRATRGNVFLKQSVLENAVVDPVSGDKVEKNVFIVFYSGERAKNKILKLCEGFGANRYP  189

Query  1970  FAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSIAEQFDRWNVLVRREKSIYHT  1791
             F E+L +Q Q+I++VSG+++ELKT ID G++H  NLLQ+I   F++WN LV++EKSIYHT
Sbjct  190   FMEDLNRQFQIISQVSGRLAELKTTIDVGLVHWSNLLQTIGFDFEQWNFLVKKEKSIYHT  249

Query  1790  LNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNSEIGAIFRVLGTRESPPTYFK  1611
             LNML++DVTKKCLVAEGW P  AT +IQ+ L+RA  DS+S+IGAIF VL T++SPPTYF+
Sbjct  250   LNMLNMDVTKKCLVAEGWCPVFATDQIQNGLRRATLDSSSQIGAIFHVLQTKDSPPTYFQ  309

Query  1610  TNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLLLATLYFLIR  1431
             TNKFTSAFQEIVDAYGVAKYQEANP V+TIVTFPFLFAVMFGDWGHGICLLLATLYF+ R
Sbjct  310   TNKFTSAFQEIVDAYGVAKYQEANPSVYTIVTFPFLFAVMFGDWGHGICLLLATLYFIFR  369

Query  1430  EKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEFFSVQFELFGRSAYVCRDPSC  1251
             EKKLSSQKLGDI EM F GRYVI+MMA+FSIYTG IYNEFFSV FELFG SAY CRD SC
Sbjct  370   EKKLSSQKLGDIMEMAFSGRYVIMMMAIFSIYTGLIYNEFFSVPFELFGPSAYGCRDQSC  429

Query  1250  SDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKLSILLGVAQMNLGIILSYFNA  1071
              DA+T GL+K R TY FG+DP WHGTRSELPFLNS+KMK+SIL GVAQMNLGII+SYFNA
Sbjct  430   GDASTAGLVKVRATYPFGLDPKWHGTRSELPFLNSMKMKMSILFGVAQMNLGIIISYFNA  489

Query  1070  HYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQADLYHVMIYMFLGPTEDLGE  891
              +F   +N W QF+PQ+IFLN+LFGYLS+LIIVKWCTGSQADLYHVMIYMFL PT+DL +
Sbjct  490   KFFGDNINIWYQFVPQMIFLNSLFGYLSLLIIVKWCTGSQADLYHVMIYMFLSPTDDLDD  549

Query  890   NQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQH-NRHQGQSYAPIQDLDESLLvdg  714
             NQLF GQK  Q++L+L AL +VPWML PKPF+LK QH  R QGQSYA +   D S  ++ 
Sbjct  550   NQLFFGQKFFQILLLLSALAAVPWMLFPKPFLLKKQHEERFQGQSYARLDSSDFSPEIEP  609

Query  713   shdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSTVFYEKVLL  534
                S +HEEFEFSEVFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSEL++VFY+KVLL
Sbjct  610   HSVSHNHEEFEFSEVFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELASVFYDKVLL  669

Query  533   LAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFDP  354
             L+WGYN+I+   +G I+FIFAT+GVLLVMETLSAFLHALRLHWVEFQNKFY GDGYKF P
Sbjct  670   LSWGYNSILARSIGLIVFIFATVGVLLVMETLSAFLHALRLHWVEFQNKFYVGDGYKFYP  729

Query  353   FSFVLVDEEED  321
             FSF  + E+++
Sbjct  730   FSFASLGEDDE  740



>ref|XP_006594994.1| PREDICTED: vacuolar proton ATPase a1-like isoform X1 [Glycine 
max]
 gb|KHN30237.1| V-type proton ATPase 116 kDa subunit a isoform 1 [Glycine soja]
Length=820

 Score =   994 bits (2570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 508/812 (63%), Positives = 632/812 (78%), Gaps = 3/812 (0%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             PPMDL RSE M  VQLIIP ESA  +++YLG+LGL+QF+DLNA+KSPFQRT+  Q+KR G
Sbjct  9     PPMDLMRSEKMTFVQLIIPAESAHRAISYLGELGLLQFRDLNADKSPFQRTFVNQVKRCG  68

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EM+RKLRFFKDQ+SKAG+ +S+ ++ Q  I  +DLE++L + E ELIE+N+N+DKL++S+
Sbjct  69    EMSRKLRFFKDQISKAGLMSSSRTELQPDIDLEDLEIQLAEHEHELIEMNSNSDKLRQSY  128

Query  2387  NELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsge-esleapllsePDMSADTSKQV  2211
             NEL+E+K+VLQK   F  S  S     ++E   +       +E   L E +M   +S   
Sbjct  129   NELLEFKIVLQKACGFLVSNHSRVVLDERELRENVYSNDAYVETVSLLEQEMRPQSSNSS  188

Query  2210  RLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSG  2031
              L FISG++ K K + FER+LFRATRGN+L   +  DE ++DP+S + +EK VF+VF+SG
Sbjct  189   GLRFISGIICKSKVLRFERMLFRATRGNMLFNLAPADEQIMDPVSADMIEKTVFVVFFSG  248

Query  2030  ERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSI  1851
             E+A+ KILKIC+AFGAN YP  E++ KQ Q+  EVS ++++L+  ++AGI HR   L S+
Sbjct  249   EQARTKILKICEAFGANCYPVPEDISKQRQITREVSSRLTDLEATLEAGIRHRNKALASV  308

Query  1850  AEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNS  1671
             A+   +W  +VRREK++Y TLNML+ DVTKKCLV EGW P  A  ++Q+ALQRA  DSNS
Sbjct  309   ADHLAKWMNMVRREKAVYDTLNMLNFDVTKKCLVGEGWCPLFAKTQMQEALQRATFDSNS  368

Query  1670  EIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVM  1491
             ++G I   +   ESPPTYF+TN FT+ +QEIVDAYGVA+YQEANP V+T V FPFLFA+M
Sbjct  369   QVGIILHPMDAVESPPTYFRTNTFTNPYQEIVDAYGVARYQEANPAVYTTVIFPFLFALM  428

Query  1490  FGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEF  1311
             FGDWGHGICLLL  L  + RE KLS+QKLG   EM FGGRYV+L+MALFSIY G IYNEF
Sbjct  429   FGDWGHGICLLLGALVLIARENKLSTQKLGSFMEMLFGGRYVLLLMALFSIYCGLIYNEF  488

Query  1310  FSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKL  1131
             FSV F +FG SAY CRD SC DA TIGLIK +D Y FGVDP+W G+RSELPFLNSLKMK+
Sbjct  489   FSVPFHIFGASAYKCRDSSCRDAHTIGLIKYQDPYPFGVDPSWRGSRSELPFLNSLKMKM  548

Query  1130  SILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQ  951
             SIL GVA MNLGI+LSYFNAH+FR+ ++   QF+PQ+IFLN+LFGYLS+LI++KWCTGSQ
Sbjct  549   SILFGVAHMNLGIVLSYFNAHFFRNSLDIRYQFVPQMIFLNSLFGYLSLLIVIKWCTGSQ  608

Query  950   ADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQHN-R  774
             ADLYHVMIYMFL PT++LGENQLF GQ+  Q+VL+LLA+++VPWML PKPFILK  H  R
Sbjct  609   ADLYHVMIYMFLSPTDNLGENQLFWGQRPLQIVLLLLAVIAVPWMLFPKPFILKKLHTER  668

Query  773   HQGQSYAPIQDLDESL-LvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLR  597
              QG+SY  +   +  L     S     HEEF FSEVFVHQ+IH IEFVLG+VSNTASYLR
Sbjct  669   FQGRSYGILNTSEVDLEAEPDSARQHHHEEFNFSEVFVHQMIHAIEFVLGSVSNTASYLR  728

Query  596   LWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHAL  417
             LWALSLAHSELSTVFYEKVLLLAWGY+N++I +VG  +F FAT  +LL+ME+LSAFLHAL
Sbjct  729   LWALSLAHSELSTVFYEKVLLLAWGYDNLVIRLVGLTVFAFATAFILLMMESLSAFLHAL  788

Query  416   RLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             RLHWVEFQNKFY GDGYKF PFSF  + E++D
Sbjct  789   RLHWVEFQNKFYHGDGYKFRPFSFASLTEDDD  820



>ref|XP_003547511.1| PREDICTED: vacuolar proton ATPase a1-like [Glycine max]
Length=822

 Score =   993 bits (2567),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 505/811 (62%), Positives = 632/811 (78%), Gaps = 2/811 (0%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             PPMDL RSE M  VQLIIP+ESA  +++YLG+LGL+QF+DLNA+KSPFQRT+  Q+KR  
Sbjct  12    PPMDLMRSEKMTFVQLIIPVESAHRAISYLGELGLLQFRDLNADKSPFQRTFVNQVKRCA  71

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EM+RKLRFFKDQ+SKAG+ +S+ +  Q  I  +DLE++L + E ELIE+N+N+DKLQ+S+
Sbjct  72    EMSRKLRFFKDQISKAGLMSSSRTVLQPDIDLEDLEIQLAEHEHELIEMNSNSDKLQQSY  131

Query  2387  NELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleap-llsePDMSADTSKQV  2211
             NEL E+K+VLQK   F  S  S A + ++E   +    ++      L E +M   +S   
Sbjct  132   NELQEFKIVLQKACGFLVSKHSLAVSDERELQENVYSNDAYVETGSLLEQEMRPQSSNSS  191

Query  2210  RLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSG  2031
              L FISG++ K K + FER+LFRATRGN+L  Q+  DE ++DP+S E +EK VF+VF+SG
Sbjct  192   GLRFISGIICKSKVLRFERMLFRATRGNMLFNQAPADELIMDPVSAEMIEKTVFVVFFSG  251

Query  2030  ERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSI  1851
             E+A+ KILKIC+AFGAN YP  E++ KQ ++  EVS ++++L+  ++AGI HR   L S+
Sbjct  252   EQARTKILKICEAFGANCYPVPEDISKQREITREVSSRLTDLEATLEAGIRHRNKALASV  311

Query  1850  AEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNS  1671
             A+   +W  +VRREK++Y TLNML+ DVTKKCLV EGW P  A  ++Q+ LQRA  DSNS
Sbjct  312   ADHLAKWINMVRREKAVYDTLNMLNFDVTKKCLVGEGWCPLFAKTQMQEVLQRATFDSNS  371

Query  1670  EIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVM  1491
             ++G IF  +   ESPPTYF+TN FT+ +QEIVDAYGVA+YQEANP V+T + FPFLFA+M
Sbjct  372   QVGIIFHPMDAVESPPTYFRTNTFTNPYQEIVDAYGVARYQEANPAVYTTIIFPFLFALM  431

Query  1490  FGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEF  1311
             FGDWGHGICLLL  L  + R+ KLS+QKLG   EM FGGRYV+L+MALFSIY G IYNEF
Sbjct  432   FGDWGHGICLLLGALVLIARQNKLSTQKLGSFMEMLFGGRYVLLLMALFSIYCGLIYNEF  491

Query  1310  FSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKL  1131
             FSV F +FG SAY CRD SC DA TIGLIK +D Y FGVDP+W G+RSEL FLNSLKMK+
Sbjct  492   FSVPFHIFGASAYKCRDSSCRDAHTIGLIKYQDPYPFGVDPSWRGSRSELSFLNSLKMKM  551

Query  1130  SILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQ  951
             SIL GVA MNLGIILSYFNAH+F++ ++   QF+PQ+IFLN+LFGYLSVLI++KWCTGSQ
Sbjct  552   SILFGVAHMNLGIILSYFNAHFFQNSLDIRYQFVPQMIFLNSLFGYLSVLIVIKWCTGSQ  611

Query  950   ADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQHN-R  774
             ADLYHVMIYMFL PT++LGENQLF GQ+  Q+VL+LLA+++VPWML PKPFILK  H  R
Sbjct  612   ADLYHVMIYMFLSPTDNLGENQLFWGQRPLQIVLLLLAVIAVPWMLFPKPFILKKLHTER  671

Query  773   HQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLRL  594
              QG+SY  +   +  L  +       HEEF FSEVFVHQ+IH IEFVLG+VSNTASYLRL
Sbjct  672   FQGRSYGILNTSEVDLEAEPDSARQHHEEFNFSEVFVHQMIHAIEFVLGSVSNTASYLRL  731

Query  593   WALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHALR  414
             WALSLAHSELSTVFYEKVLLLAWGY+N++I ++G  +F FAT  +LL+ME+LSAFLHALR
Sbjct  732   WALSLAHSELSTVFYEKVLLLAWGYDNLVIRLIGLTVFAFATAFILLMMESLSAFLHALR  791

Query  413   LHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             LHWVEFQNKFY GDGYKF PFSF  + E++D
Sbjct  792   LHWVEFQNKFYHGDGYKFRPFSFASLTEDDD  822



>gb|KHN22210.1| Vacuolar proton translocating ATPase 100 kDa subunit [Glycine 
soja]
Length=769

 Score =   993 bits (2566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 552/814 (68%), Positives = 651/814 (80%), Gaps = 51/814 (6%)
 Frame = -2

Query  2759  GGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQI  2580
             G   P MDL RSEPMQLVQLIIPIESA  S++YLGDLGLIQFKDLNA+KSPFQRTYA+QI
Sbjct  5     GRFLPTMDLLRSEPMQLVQLIIPIESAHRSISYLGDLGLIQFKDLNADKSPFQRTYASQI  64

Query  2579  KRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKL  2400
             KR GEMAR+LR FK+QM+KAGVS S  S   +    + LEVKL +LEAEL+EINANN+KL
Sbjct  65    KRCGEMARRLRLFKEQMTKAGVSPSTWSTRDNHFDLEHLEVKLEELEAELLEINANNEKL  124

Query  2399  QRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTS  2220
             Q ++NEL+EYKLVL+KVGEFF SA++ A AQQ+E     + E S+++PLL   +    T+
Sbjct  125   QHTYNELLEYKLVLEKVGEFFSSAKNKAVAQQKELEFQTTVEGSIDSPLLL--EQEETTT  182

Query  2219  KQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVF  2040
             KQ++L FISGLV +EKS+ FERI+FRATRGNV L+Q+ +   V+DP+SGEKV        
Sbjct  183   KQIKLRFISGLVHREKSIPFERIIFRATRGNVFLKQAVIQHPVLDPLSGEKV--------  234

Query  2039  YSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLL  1860
                                                   SG++SELKT IDAG++HR  LL
Sbjct  235   --------------------------------------SGRLSELKTTIDAGLIHRSTLL  256

Query  1859  QSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHD  1680
             Q+I   +++W++ +++EKSIYHTLNMLSI+VTKKCL+AEGW P  AT +I   L+RA  D
Sbjct  257   QTIGYHYEQWSLQLKKEKSIYHTLNMLSINVTKKCLLAEGWCPVFATSQIHKVLERATMD  316

Query  1679  SNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLF  1500
              +S++GAIF+VL T+ESPPTYF TNKFTS+FQEIVDAYG+AKYQEANPGV+TIVTFPFLF
Sbjct  317   CSSQVGAIFQVLETKESPPTYFSTNKFTSSFQEIVDAYGIAKYQEANPGVYTIVTFPFLF  376

Query  1499  AVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIY  1320
             AVMFGDWGHGICLLLA LY +IREKK +SQKLGDI EM FGGRY+I++MALFSIYTG IY
Sbjct  377   AVMFGDWGHGICLLLAALYLIIREKKFASQKLGDIMEMAFGGRYIIMLMALFSIYTGLIY  436

Query  1319  NEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLK  1140
             NEFFSV FELFG SAY CRD SC DA+T G IK R TY FGVDP WHGTRSELPFLNSLK
Sbjct  437   NEFFSVPFELFGPSAYGCRDSSCRDASTTGFIKVRSTYPFGVDPKWHGTRSELPFLNSLK  496

Query  1139  MKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCT  960
             MK+SILLGV+QMNLGII+SYFNA YF + +N W QF+PQIIFLN+LFGYLS+LII+KW T
Sbjct  497   MKMSILLGVSQMNLGIIMSYFNAKYFENNINIWYQFVPQIIFLNSLFGYLSLLIIIKWST  556

Query  959   GSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQH  780
             GSQADLYHVMIYMFL PT+DLGENQLF GQK  QLVL+LLALV+VPWML+PKPF+LK QH
Sbjct  557   GSQADLYHVMIYMFLSPTDDLGENQLFVGQKLLQLVLLLLALVAVPWMLVPKPFLLKKQH  616

Query  779   N-RHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASY  603
               RHQGQSY  +   D+ L  +    S  H+EF+FSEVFVHQLIHTIEFVLGAVSNTASY
Sbjct  617   QERHQGQSYDLLYGTDDPL--ESESQSIPHDEFDFSEVFVHQLIHTIEFVLGAVSNTASY  674

Query  602   LRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLH  423
             LRLWALSLAHSELS+VFY+KVLLLAWGYN+ I+L+VG  +FI AT+GVLL+ME+LSAFLH
Sbjct  675   LRLWALSLAHSELSSVFYDKVLLLAWGYNSTIVLIVGIFVFICATVGVLLLMESLSAFLH  734

Query  422   ALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             ALRLHWVE+QNKFYEGDGYKF PFSF L+ +E++
Sbjct  735   ALRLHWVEYQNKFYEGDGYKFFPFSFTLLTDEDE  768



>gb|KHN33443.1| V-type proton ATPase 116 kDa subunit a isoform 1 [Glycine soja]
Length=822

 Score =   992 bits (2565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 505/811 (62%), Positives = 632/811 (78%), Gaps = 2/811 (0%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             PPMDL RSE M  VQLIIP+ESA  +++YLG+LGL+QF+DLNA+KSPFQRT+  Q+KR  
Sbjct  12    PPMDLMRSEKMTFVQLIIPVESAHRAISYLGELGLLQFRDLNADKSPFQRTFVNQVKRCA  71

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EM+RKLRFFKDQ+SKAG+ +S+ +  Q  I  +DLE++L + E ELIE+N+N+DKLQ+S+
Sbjct  72    EMSRKLRFFKDQISKAGLMSSSRTVLQPDIDLEDLEIQLAEHEHELIEMNSNSDKLQQSY  131

Query  2387  NELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleap-llsePDMSADTSKQV  2211
             NEL E+K+VLQK   F  S  S A + ++E   +    ++      L E +M   +S   
Sbjct  132   NELQEFKIVLQKACGFLVSKHSLAVSDERELQENVYSNDAYVETGSLLEQEMRPQSSNSS  191

Query  2210  RLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSG  2031
              L FISG++ K K + FER+LFRATRGN+L  Q+  DE ++DP+S E +EK VF+VF+SG
Sbjct  192   GLRFISGIICKSKVLRFERMLFRATRGNMLFNQAPDDELIMDPVSAEMIEKTVFVVFFSG  251

Query  2030  ERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSI  1851
             E+A+ KILKIC+AFGAN YP  E++ KQ ++  EVS ++++L+  ++AGI HR   L S+
Sbjct  252   EQARTKILKICEAFGANCYPVPEDISKQREITREVSSRLTDLEATLEAGIRHRNKALASV  311

Query  1850  AEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNS  1671
             A+   +W  +VRREK++Y TLNML+ DVTKKCLV EGW P  A  ++Q+ LQRA  DSNS
Sbjct  312   ADHLAKWINMVRREKAVYDTLNMLNFDVTKKCLVGEGWCPLFAKTQMQEVLQRATFDSNS  371

Query  1670  EIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVM  1491
             ++G IF  +   ESPPTYF+TN FT+ +QEIVDAYGVA+YQEANP V+T + FPFLFA+M
Sbjct  372   QVGIIFHPMDAVESPPTYFRTNTFTNPYQEIVDAYGVARYQEANPAVYTTIIFPFLFALM  431

Query  1490  FGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEF  1311
             FGDWGHGICLLL  L  + R+ KLS+QKLG   EM FGGRYV+L+MALFSIY G IYNEF
Sbjct  432   FGDWGHGICLLLGALVLIARQNKLSTQKLGSFMEMLFGGRYVLLLMALFSIYCGLIYNEF  491

Query  1310  FSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKL  1131
             FSV F +FG SAY CRD SC DA TIGLIK +D Y FGVDP+W G+RSEL FLNSLKMK+
Sbjct  492   FSVPFHIFGASAYKCRDSSCRDAHTIGLIKYQDPYPFGVDPSWRGSRSELSFLNSLKMKM  551

Query  1130  SILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQ  951
             SIL GVA MNLGIILSYFNAH+F++ ++   QF+PQ+IFLN+LFGYLSVLI++KWCTGSQ
Sbjct  552   SILFGVAHMNLGIILSYFNAHFFQNSLDIRYQFVPQMIFLNSLFGYLSVLIVIKWCTGSQ  611

Query  950   ADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQHN-R  774
             ADLYHVMIYMFL PT++LGENQLF GQ+  Q+VL+LLA+++VPWML PKPFILK  H  R
Sbjct  612   ADLYHVMIYMFLSPTDNLGENQLFWGQRPLQIVLLLLAVIAVPWMLFPKPFILKKLHTER  671

Query  773   HQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLRL  594
              QG+SY  +   +  L  +       HEEF FSEVFVHQ+IH IEFVLG+VSNTASYLRL
Sbjct  672   FQGRSYGILNTSEVDLEAEPDSARQHHEEFNFSEVFVHQMIHAIEFVLGSVSNTASYLRL  731

Query  593   WALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHALR  414
             WALSLAHSELSTVFYEKVLLLAWGY+N++I ++G  +F FAT  +LL+ME+LSAFLHALR
Sbjct  732   WALSLAHSELSTVFYEKVLLLAWGYDNLVIRLIGLTVFAFATAFILLMMESLSAFLHALR  791

Query  413   LHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             LHWVEFQNKFY GDGYKF PFSF  + E++D
Sbjct  792   LHWVEFQNKFYHGDGYKFRPFSFASLTEDDD  822



>ref|XP_009352397.1| PREDICTED: vacuolar proton ATPase a1-like [Pyrus x bretschneideri]
 ref|XP_009352398.1| PREDICTED: vacuolar proton ATPase a1-like [Pyrus x bretschneideri]
 ref|XP_009352408.1| PREDICTED: vacuolar proton ATPase a1-like [Pyrus x bretschneideri]
 ref|XP_009352409.1| PREDICTED: vacuolar proton ATPase a1-like [Pyrus x bretschneideri]
 ref|XP_009352410.1| PREDICTED: vacuolar proton ATPase a1-like [Pyrus x bretschneideri]
Length=819

 Score =   992 bits (2564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 510/811 (63%), Positives = 639/811 (79%), Gaps = 2/811 (0%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             P MDL RSE M  VQLIIP+ESA  +++YLG+LGL+QF+DLNA+KSPFQRT+  Q+KR  
Sbjct  9     PAMDLMRSEKMTFVQLIIPVESAHRAISYLGELGLLQFRDLNADKSPFQRTFVNQVKRCA  68

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EM+RKLRFF+DQ+SKAG+ +S +   Q  I  ++LE++L + E ELIE+N+N+D+LQ S+
Sbjct  69    EMSRKLRFFRDQISKAGLLSSVHPVLQPDIDLEELEIQLAEHEHELIEMNSNSDRLQHSY  128

Query  2387  NELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesl-eapllsePDMSADTSKQV  2211
             NEL+E+K+VLQK   F  S+ S A ++++E   +    ++  +   L E D+    S Q 
Sbjct  129   NELLEFKMVLQKASGFLVSSNSHAVSEERELDENIYSNDNYGDEVSLLEQDIRPGPSDQS  188

Query  2210  RLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSG  2031
              L F+SG++ K K++ FER+LFRATRGN+L   +  DE ++DP+S E VEK VF+VF+SG
Sbjct  189   GLRFVSGIICKSKALRFERMLFRATRGNMLFNHAPADEQIMDPLSTEMVEKTVFVVFFSG  248

Query  2030  ERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSI  1851
              +AK KILKIC+AFGAN YP  E++ KQ Q+  EVS +++EL+T +DAGI HR   L S+
Sbjct  249   MQAKTKILKICEAFGANCYPVPEDITKQRQITREVSSRLAELETTLDAGIRHRNKALTSV  308

Query  1850  AEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNS  1671
                  +W  +VRREK++Y TLNML+ DVTKKCLV EGW P  A  +IQ+ALQRA  DS+S
Sbjct  309   GFHLAKWINMVRREKAVYDTLNMLNFDVTKKCLVGEGWCPIFAKPKIQEALQRATFDSSS  368

Query  1670  EIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVM  1491
             ++G IF V+ T +SPPTYF+TN+FTSAFQEIVDAYGVA+YQEANP V+T +TFPFLFAVM
Sbjct  369   QVGVIFHVMDTLDSPPTYFRTNRFTSAFQEIVDAYGVARYQEANPAVYTCITFPFLFAVM  428

Query  1490  FGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEF  1311
             FGDWGHGICLL+  L  + RE KLS+QKLG   EM FGGRYV+L+M+LFSIY G IYNEF
Sbjct  429   FGDWGHGICLLVGALVLIARESKLSAQKLGSFMEMLFGGRYVLLLMSLFSIYCGLIYNEF  488

Query  1310  FSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKL  1131
             FSV F +FG SAY CRD +CS+A TIGLIK RD Y FGVDP+W G+RSELPFLNSLKMK+
Sbjct  489   FSVPFHIFGGSAYKCRDAACSEAYTIGLIKYRDPYPFGVDPSWRGSRSELPFLNSLKMKM  548

Query  1130  SILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQ  951
             SILLGV QMNLGI+LSYFNA +F S ++   QF+PQ+IFLN+LFGYLS+L+++KWCTGSQ
Sbjct  549   SILLGVVQMNLGILLSYFNARFFSSSLDIRYQFVPQMIFLNSLFGYLSLLVVIKWCTGSQ  608

Query  950   ADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQHN-R  774
             ADLYHVMIYMFL PT+DLGENQLF GQ+  Q++L+LLAL++VPWML PKPFIL+  +  R
Sbjct  609   ADLYHVMIYMFLSPTDDLGENQLFWGQRPLQIILLLLALIAVPWMLFPKPFILRKLNTER  668

Query  773   HQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLRL  594
              QG++Y  +   +  L V+       HEEF FSEVFVHQ+IH+IEFVLGAVSNTASYLRL
Sbjct  669   FQGRAYGMLGTSEMDLEVEPDSARQHHEEFNFSEVFVHQMIHSIEFVLGAVSNTASYLRL  728

Query  593   WALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHALR  414
             WALSLAHSELSTVFYEKVLLLAWGY++ II ++G  +F FAT  +LL+METLSAFLHALR
Sbjct  729   WALSLAHSELSTVFYEKVLLLAWGYDSFIIRLIGLSVFAFATAFILLMMETLSAFLHALR  788

Query  413   LHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             LHWVE+QNKFY GDGYKF PFSF  + E+ED
Sbjct  789   LHWVEYQNKFYHGDGYKFKPFSFASITEDED  819



>ref|XP_008224871.1| PREDICTED: vacuolar proton ATPase a1-like [Prunus mume]
Length=819

 Score =   992 bits (2564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 514/811 (63%), Positives = 639/811 (79%), Gaps = 2/811 (0%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             P MDL RSE M  VQLIIP+ESA  +++YLG+LGL+QF+DLNA+KSPFQRT+  Q+KR  
Sbjct  9     PAMDLMRSEKMTFVQLIIPVESAHRAISYLGELGLLQFRDLNADKSPFQRTFVNQVKRCA  68

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EM+RKLRFF+DQ+SKAG+ +S +   Q  I+ ++LE++L + E ELIE+N+N+D+LQ S+
Sbjct  69    EMSRKLRFFRDQISKAGLLSSVHPVLQPDIELEELEIQLAEHEHELIEMNSNSDRLQHSY  128

Query  2387  NELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesl-eapllsePDMSADTSKQV  2211
             NEL+E+K+VLQK   F  S+ S A  +++E   +    +   ++  L E D+    S Q 
Sbjct  129   NELLEFKIVLQKASGFLVSSNSHAVPEERELDENVYSNDDYGDSVSLLEQDIRPGPSDQS  188

Query  2210  RLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSG  2031
              L F+SG++ K K++ FER+LFRATRGN+L  Q+  DE ++DP+S E VEK VF+VF+SG
Sbjct  189   GLSFVSGIICKSKALRFERMLFRATRGNMLFNQASADEQIMDPLSTEMVEKTVFVVFFSG  248

Query  2030  ERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSI  1851
              +AK KILKIC+AFGAN YP  E++ KQ Q+  EVS +++EL+  +DAGI HR   L S+
Sbjct  249   LQAKTKILKICEAFGANCYPVPEDITKQRQITREVSSRLAELEATLDAGIRHRNKALTSV  308

Query  1850  AEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNS  1671
                  +W  +VRREK++Y TLNML+ DVTKKCLV EGW P  A  +IQ+ALQRA  DSNS
Sbjct  309   GFHLAKWMNMVRREKAVYDTLNMLNFDVTKKCLVGEGWCPIFANTKIQEALQRATFDSNS  368

Query  1670  EIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVM  1491
             ++G IF ++   ESPPTYF+TN+FTSAFQEIVDAYGVA+YQEANP V+T +TFPFLFAVM
Sbjct  369   QVGIIFHLMDAIESPPTYFRTNRFTSAFQEIVDAYGVARYQEANPAVYTCITFPFLFAVM  428

Query  1490  FGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEF  1311
             FGDWGHGICLLL  L  + RE KLS+QKLG   EM FGGRYV+L+M+LFSIY G IYNEF
Sbjct  429   FGDWGHGICLLLGALILIARETKLSAQKLGSFMEMLFGGRYVLLLMSLFSIYCGLIYNEF  488

Query  1310  FSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKL  1131
             FSV F +FG SAY CRD +CS+A TIGLIK RD Y FGVDP+W G+RSELPFLNSLKMK+
Sbjct  489   FSVPFHIFGGSAYKCRDTACSEAYTIGLIKYRDPYPFGVDPSWRGSRSELPFLNSLKMKM  548

Query  1130  SILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQ  951
             SILLGVAQMNLGI+LSYFNA +F S ++   QF+PQ+IFLN+LFGYLS+LI++KWCTGSQ
Sbjct  549   SILLGVAQMNLGILLSYFNARFFSSSIDIRYQFVPQVIFLNSLFGYLSLLIVIKWCTGSQ  608

Query  950   ADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQHN-R  774
             ADLYHVMIYMFL PT+DLGEN+LF GQ+  Q++L+LLAL++VPWML PKPFILK  H  R
Sbjct  609   ADLYHVMIYMFLSPTDDLGENELFWGQRPLQIILLLLALIAVPWMLFPKPFILKKLHTER  668

Query  773   HQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLRL  594
              QG++Y  +   +  L V+       HEEF FSEVFVHQ+IH+IEFVLGAVSNTASYLRL
Sbjct  669   FQGRAYGMLGTSEMDLDVEPDSARQHHEEFNFSEVFVHQMIHSIEFVLGAVSNTASYLRL  728

Query  593   WALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHALR  414
             WALSLAHSELSTVFYEKVLLLAWGY+N +I ++G  +F FAT  +LL+METLSAFLHALR
Sbjct  729   WALSLAHSELSTVFYEKVLLLAWGYDNFVIRLIGLAVFAFATAFILLMMETLSAFLHALR  788

Query  413   LHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             LHWVE+QNKFY GDGYKF PFSF  + E+ED
Sbjct  789   LHWVEYQNKFYYGDGYKFKPFSFASITEDED  819



>ref|XP_010032050.1| PREDICTED: V-type proton ATPase subunit a1-like isoform X2 [Eucalyptus 
grandis]
Length=818

 Score =   991 bits (2561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 506/812 (62%), Positives = 638/812 (79%), Gaps = 5/812 (1%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             P MDL RSE M  VQ IIP+ESA  +V+YLG+LGL+QF+DLNAEKSPFQRT+ +Q+KR G
Sbjct  9     PAMDLMRSERMSFVQFIIPVESAHRAVSYLGELGLVQFRDLNAEKSPFQRTFVSQVKRCG  68

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EM RKLRFF+DQ+ KAGV +  N   Q  +  + LE  L + E ELIE+N+N++ L++S+
Sbjct  69    EMLRKLRFFRDQVGKAGVKSPENPVVQPDVLLEQLE--LAEHERELIEMNSNSEHLRQSY  126

Query  2387  NELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTSKQVR  2208
             NEL+E+K+VLQ+ G F  S ++   A+++E   +    + +E   L E +M   TS+Q  
Sbjct  127   NELLEFKMVLQEAGSFLFSGKNHPVAEERELDETAYSNDYVETASLLEKEMRPGTSEQSG  186

Query  2207  LGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSGE  2028
             L +I+G++ + K + FER+LFRATRGN+L  Q+  +E ++DP++ E VEK VF+V++SGE
Sbjct  187   LNYITGIICQTKVLIFERMLFRATRGNMLFNQAPANEGIMDPVTSEMVEKVVFMVYFSGE  246

Query  2027  RAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSIA  1848
             +A+ KI KIC+AFG N YP  +++ KQ Q+  EV  ++SEL+  +D GI HR + L SI+
Sbjct  247   QARKKIKKICEAFGVNCYPVPDDITKQRQMTREVVSRLSELEATLDVGIRHRNSALSSIS  306

Query  1847  EQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNSE  1668
                 +W  LVRREK++Y TLNML+ DVTKKCLV EGW PT A  +IQ+ LQRA +DSNS+
Sbjct  307   LHLPKWTDLVRREKAVYDTLNMLNFDVTKKCLVGEGWCPTFAKAKIQEVLQRATYDSNSQ  366

Query  1667  IGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMF  1488
             +G IF  +   +SPPT+F+TNKFT+A+QEIVDAYGV +YQEANP V+TIVTFPFLFAVMF
Sbjct  367   VGIIFHTMDAVDSPPTFFRTNKFTNAYQEIVDAYGVGRYQEANPAVYTIVTFPFLFAVMF  426

Query  1487  GDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEFF  1308
             GDWGHGICLLL  L  + RE KL ++KLG   EM FGGRY++L+M+LFSIY G IYNEFF
Sbjct  427   GDWGHGICLLLGALVLIARESKLGNKKLGSFMEMLFGGRYILLLMSLFSIYCGLIYNEFF  486

Query  1307  SVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKLS  1128
             SV F +FGRSAY CRD +CSDA ++GLIK RD Y FGVDP+W G+RSELPFLNSLKMK+S
Sbjct  487   SVPFHIFGRSAYKCRDTTCSDAYSVGLIKYRDPYPFGVDPSWRGSRSELPFLNSLKMKMS  546

Query  1127  ILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQA  948
             ILLGVAQMNLGIILSYFNA YF S ++   QF+PQIIFLN+LFGYLS+LII+KWCTGSQA
Sbjct  547   ILLGVAQMNLGIILSYFNARYFESSLDIRYQFVPQIIFLNSLFGYLSLLIIIKWCTGSQA  606

Query  947   DLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQH-NRH  771
             DLYHVMIYMFL PT++LGENQLF GQ+  Q++L+LLAL++VPWML PKPFILK  H  R 
Sbjct  607   DLYHVMIYMFLSPTDNLGENQLFWGQRPLQILLLLLALIAVPWMLFPKPFILKRLHIERF  666

Query  770   QGQSYA--PIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLR  597
             QG++Y    I ++D     D +     HE+F FS+VFVHQ+IH+IEFVLGAVSNTASYLR
Sbjct  667   QGRTYGVLGISEMDVEAEPDSARAQQHHEDFNFSKVFVHQMIHSIEFVLGAVSNTASYLR  726

Query  596   LWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHAL  417
             LWALSLAHSELSTVFYEKVLLLAWGY+N+II +VG  +F FAT  +LL+METLSAFLHAL
Sbjct  727   LWALSLAHSELSTVFYEKVLLLAWGYDNVIIRLVGLAVFAFATAFILLMMETLSAFLHAL  786

Query  416   RLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             RLHWVEFQNKFY GDGYKF PFSF L++++++
Sbjct  787   RLHWVEFQNKFYHGDGYKFKPFSFALLNDDDE  818



>ref|XP_009358259.1| PREDICTED: vacuolar proton ATPase a1-like [Pyrus x bretschneideri]
Length=819

 Score =   991 bits (2561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 507/811 (63%), Positives = 633/811 (78%), Gaps = 2/811 (0%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             P MDL RSE M  VQLIIP+ESA  +++YLG+LGL+QF+DLNA+KSPFQRT+  Q+KR  
Sbjct  9     PAMDLMRSEKMTFVQLIIPVESAHRAISYLGELGLLQFRDLNADKSPFQRTFVNQVKRCA  68

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EM+RKLRFF+DQ+SKAG+ +S +   Q  I  ++LE++L + E ELIE+N+N+D++Q S+
Sbjct  69    EMSRKLRFFRDQISKAGLLSSVHPVLQPDIDLEELEIQLAEHEHELIELNSNSDRIQHSY  128

Query  2387  NELVEYKLVLQK-VGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTSKQV  2211
             NEL+EYK+VLQK +G    S   +   +++   +    +   +   L E D+    S Q 
Sbjct  129   NELLEYKMVLQKAIGFLVSSNSHAVSEERELDENIYPNDHYGDEVSLLEQDIRPGPSDQS  188

Query  2210  RLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSG  2031
              L F+SG++ K K++ FER+LFRATRGN+L   +  DE ++DP+S E VEK VF+VF+SG
Sbjct  189   GLRFVSGIICKSKALRFERMLFRATRGNMLFNHAPADELMMDPLSTEMVEKTVFVVFFSG  248

Query  2030  ERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSI  1851
              +AK KILKIC+AFGAN YP  E++ KQ Q+  EVS +++EL+T +DAGI HR   L SI
Sbjct  249   MQAKTKILKICEAFGANCYPVPEDITKQRQITREVSSRLAELETTLDAGIRHRNKALASI  308

Query  1850  AEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNS  1671
                  +W  +VRREK++Y  LNML+ DVTKKCLV EGW P  A  +IQ+AL+RA  DSNS
Sbjct  309   GFHLAKWMNMVRREKAVYDILNMLNFDVTKKCLVGEGWCPIFAKPKIQEALERATFDSNS  368

Query  1670  EIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVM  1491
             ++G IF V+   +SPPTYF+TN+FTSAFQEIVDAYGVA+YQEANP V+T++TFPFLFAVM
Sbjct  369   QVGVIFHVMDAIDSPPTYFRTNRFTSAFQEIVDAYGVARYQEANPAVYTVITFPFLFAVM  428

Query  1490  FGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEF  1311
             FGDWGHGICLLL  L  + RE KLS+QKLG   EM FGGRYV+L+M+LFSIY G IYNEF
Sbjct  429   FGDWGHGICLLLGALVLIARESKLSAQKLGSFMEMLFGGRYVLLLMSLFSIYCGLIYNEF  488

Query  1310  FSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKL  1131
             FSV F +FG SAY CRD +CS+  TIGLIK RD Y FGVDP+W G+RSELPFLNSLKMK+
Sbjct  489   FSVPFHIFGGSAYKCRDTACSEVHTIGLIKYRDPYPFGVDPSWRGSRSELPFLNSLKMKM  548

Query  1130  SILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQ  951
             SILLGV QMNLGI+LSYFNA +F S ++   QF+PQ+IFLN+LFGYLS+L+++KWCTGSQ
Sbjct  549   SILLGVVQMNLGILLSYFNARFFSSSLDIRYQFVPQMIFLNSLFGYLSLLVVIKWCTGSQ  608

Query  950   ADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQHN-R  774
             ADLYH+MIYMFL PT+DLGENQLF GQ+  Q++L+LLAL++VPWML PKPFILK  H  R
Sbjct  609   ADLYHIMIYMFLSPTDDLGENQLFWGQRPLQIILLLLALIAVPWMLFPKPFILKKLHTER  668

Query  773   HQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLRL  594
              QG++Y  +   +  L V+       HEEF FSEVFVHQ+IH+IEFVLGAVSNTASYLRL
Sbjct  669   FQGRAYGMLGTSEMDLEVEPDSARQRHEEFNFSEVFVHQMIHSIEFVLGAVSNTASYLRL  728

Query  593   WALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHALR  414
             WALSLAHSELSTVFYEKVLLLAWGY++ II ++G  +F FAT  +LL+METLSAFLHALR
Sbjct  729   WALSLAHSELSTVFYEKVLLLAWGYDSFIIRLIGLSVFAFATAFILLMMETLSAFLHALR  788

Query  413   LHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             LHWVE+QNKFY GDGYKF PFSF  + E+ED
Sbjct  789   LHWVEYQNKFYHGDGYKFKPFSFASITEDED  819



>dbj|BAC41321.1| hypothetical protein [Lotus japonicus]
Length=702

 Score =   989 bits (2558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 540/749 (72%), Positives = 617/749 (82%), Gaps = 50/749 (7%)
 Frame = -2

Query  2564  MARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSFN  2385
             MARKLRFFK+QM KAGVS    S TQ  +  D+LEVKL ++E+EL E+NAN +KLQRS+N
Sbjct  1     MARKLRFFKEQMLKAGVSPKL-STTQVDVNIDNLEVKLSEIESELTEMNANGEKLQRSYN  59

Query  2384  ELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTSKQVRL  2205
             ELVEYKLVLQK GEFFHSA+S A  QQ+EY S     ES+E PLL + ++S D+SKQ++L
Sbjct  60    ELVEYKLVLQKAGEFFHSAQSGAIEQQREYESRLLSGESMETPLLQDQELSGDSSKQIKL  119

Query  2204  GFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSGER  2025
             GF++GLVP+EKSM FERILFRATRGNV LRQ+ V++ V DP+SGEK EKNVF+VFY+GE+
Sbjct  120   GFLAGLVPREKSMTFERILFRATRGNVFLRQTAVEDPVTDPVSGEKTEKNVFVVFYAGEK  179

Query  2024  AKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSIAE  1845
              K KILKICDAF ANRYPFAEELGKQAQ+ITE SGKISELKT ID G+ HR NLL +I  
Sbjct  180   VKAKILKICDAFSANRYPFAEELGKQAQMITEASGKISELKTTIDTGLQHRVNLLDTIGV  239

Query  1844  QFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNSEI  1665
             QF++WN+L                                    IQDALQRA  DSNS++
Sbjct  240   QFEQWNLL------------------------------------IQDALQRAAVDSNSQV  263

Query  1664  GAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMFG  1485
              AIF+VL T+E PPTYF+TNKFTS++Q I+D+YGVAKYQEANP V+T+VTFPFLFAVMFG
Sbjct  264   SAIFQVLHTKEMPPTYFRTNKFTSSYQGIIDSYGVAKYQEANPTVYTVVTFPFLFAVMFG  323

Query  1484  DWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEFFS  1305
             DWGHGICLLLA LYF+IRE+KLSSQKL DITEMTFGGRYVIL+M+LFSIYTG IYNEFFS
Sbjct  324   DWGHGICLLLAALYFIIRERKLSSQKLDDITEMTFGGRYVILLMSLFSIYTGLIYNEFFS  383

Query  1304  VQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKLSI  1125
             V FELFG SAY CRD +CS+ATTIGLIKAR TY FGVDP WHGTRSELPFLNSLKMK+SI
Sbjct  384   VPFELFGPSAYECRDLACSEATTIGLIKARRTYPFGVDPVWHGTRSELPFLNSLKMKMSI  443

Query  1124  LLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQAD  945
             LLGVAQMNLGII+S+FNA +FR+ VN              LFGYLS+LIIVKWCTGSQAD
Sbjct  444   LLGVAQMNLGIIMSFFNAIFFRNSVNI------------CLFGYLSLLIIVKWCTGSQAD  491

Query  944   LYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQHN-RHQ  768
             LYHVMIYMFL PT+DLGEN+LF GQK  QLVL+LLA+V+VPWMLLPKPFILK QH  RH 
Sbjct  492   LYHVMIYMFLSPTDDLGENELFAGQKNLQLVLLLLAVVAVPWMLLPKPFILKKQHEARHG  551

Query  767   GQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLRLWA  588
              +SYAP+   +ESL V+ +HDS  HEEFEFSE+FVHQLIHTIEFVLGAVSNTASYLRLWA
Sbjct  552   AESYAPLPSTEESLQVESNHDSHGHEEFEFSEIFVHQLIHTIEFVLGAVSNTASYLRLWA  611

Query  587   LSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHALRLH  408
             LSLAHSELS+VFYEKVLLLAWGYNN+IIL+VG ++FIFAT+GVLLVMETLSAFLHALRLH
Sbjct  612   LSLAHSELSSVFYEKVLLLAWGYNNVIILIVGILVFIFATVGVLLVMETLSAFLHALRLH  671

Query  407   WVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             WVEFQNKFYEGDGYKF PFSF L+DEE++
Sbjct  672   WVEFQNKFYEGDGYKFFPFSFSLLDEEDE  700



>ref|XP_007204941.1| hypothetical protein PRUPE_ppa001470mg [Prunus persica]
 gb|EMJ06140.1| hypothetical protein PRUPE_ppa001470mg [Prunus persica]
Length=819

 Score =   989 bits (2558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 514/811 (63%), Positives = 638/811 (79%), Gaps = 2/811 (0%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             P MDL RSE M  VQLIIP+ESA  +++YLG+LGL+QF+DLNA+KSPFQRT+  Q+KR  
Sbjct  9     PAMDLMRSEKMTFVQLIIPVESAHRAISYLGELGLLQFRDLNADKSPFQRTFVNQVKRCA  68

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EM+RKLRFF+DQ+SKAG+ +S +   Q  ++ ++LE++L + E ELIE+N+N+D+LQ S+
Sbjct  69    EMSRKLRFFRDQISKAGLLSSVHPVLQLDVELEELEIQLAEHEHELIEMNSNSDRLQHSY  128

Query  2387  NELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesl-eapllsePDMSADTSKQV  2211
             NEL+E+K+VLQK   F  S+ S A  +++E   +    +   ++  L E D+    S Q 
Sbjct  129   NELLEFKIVLQKASGFLVSSNSRAVPEERELDENVYSNDDYGDSVSLLEQDIRPGPSDQS  188

Query  2210  RLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSG  2031
              L F+SG++ K K++ FER+LFRATRGN+L  Q+  DE ++DP+S E VEK VF+VF+SG
Sbjct  189   GLSFVSGIICKSKALRFERMLFRATRGNMLFNQASADEQIMDPLSTEMVEKTVFVVFFSG  248

Query  2030  ERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSI  1851
              +AK KILKIC+AFGAN YP  E++ KQ Q+  EVS +++EL+  +DAGI HR   L S+
Sbjct  249   LQAKTKILKICEAFGANCYPVPEDITKQRQITREVSSRLAELEATLDAGIRHRNKALTSV  308

Query  1850  AEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNS  1671
                  +W  +VRREK++Y TLNML+ DVTKKCLV EGW P  A  +IQ+ALQRA  DSNS
Sbjct  309   GFHLGKWMNMVRREKAVYDTLNMLNFDVTKKCLVGEGWCPIFAKTKIQEALQRATFDSNS  368

Query  1670  EIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVM  1491
             ++G IF V    ESPPTYF+TN+FTSAFQEIVDAYGVA+YQEANP V+T +TFPFLFAVM
Sbjct  369   QVGIIFHVTDAIESPPTYFRTNRFTSAFQEIVDAYGVARYQEANPAVYTCITFPFLFAVM  428

Query  1490  FGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEF  1311
             FGDWGHGICLLL  L  + RE KLS+QKLG   EM FGGRYV+L+M+LFSIY G IYNEF
Sbjct  429   FGDWGHGICLLLGALILIARESKLSAQKLGSFMEMLFGGRYVLLLMSLFSIYCGLIYNEF  488

Query  1310  FSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKL  1131
             FSV F +FG SAY CRD +CS+A TIGLIK RD Y FGVDP+W G+RSELPFLNSLKMK+
Sbjct  489   FSVPFHIFGGSAYKCRDTACSEAYTIGLIKYRDPYPFGVDPSWRGSRSELPFLNSLKMKM  548

Query  1130  SILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQ  951
             SILLGVAQMNLGI+LSYFNA +F S ++   QF+PQ+IFLN+LFGYLS+LI++KWCTGSQ
Sbjct  549   SILLGVAQMNLGILLSYFNARFFSSSIDIRYQFVPQVIFLNSLFGYLSLLIVIKWCTGSQ  608

Query  950   ADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQHN-R  774
             ADLYHVMIYMFL PT+DLGEN+LF GQ+  Q++L+LLAL++VPWML PKPFILK  H  R
Sbjct  609   ADLYHVMIYMFLSPTDDLGENELFWGQRPLQIILLLLALIAVPWMLFPKPFILKKLHTER  668

Query  773   HQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLRL  594
              QG++Y  +   +  L V+       HEEF FSEVFVHQ+IH+IEFVLGAVSNTASYLRL
Sbjct  669   FQGRAYGMLGTSEMDLDVEPDSARQHHEEFNFSEVFVHQMIHSIEFVLGAVSNTASYLRL  728

Query  593   WALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHALR  414
             WALSLAHSELSTVFYEKVLLLAWGY+N +I ++G  +F FAT  +LL+METLSAFLHALR
Sbjct  729   WALSLAHSELSTVFYEKVLLLAWGYDNFVIRLIGLAVFAFATAFILLMMETLSAFLHALR  788

Query  413   LHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             LHWVE+QNKFY GDGYKF PFSF  + E+ED
Sbjct  789   LHWVEYQNKFYYGDGYKFKPFSFASITEDED  819



>ref|XP_004251275.1| PREDICTED: V-type proton ATPase subunit a1 [Solanum lycopersicum]
Length=819

 Score =   989 bits (2557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 512/812 (63%), Positives = 629/812 (77%), Gaps = 3/812 (0%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             PPMDL RSE M  VQLIIP+ESA  ++ YLG LGL+QF+DLNA+KSPFQRT+  Q+KR  
Sbjct  8     PPMDLMRSEKMTFVQLIIPVESAHPAITYLGQLGLLQFRDLNADKSPFQRTFVNQVKRCA  67

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EM+RKLRFFKDQ+ KAG+  S    +Q  I+ ++LE++L + E ELIE+N N+DKL++S+
Sbjct  68    EMSRKLRFFKDQIQKAGMLPSPRPASQPDIELEELEIQLAEHEHELIEMNGNSDKLRQSY  127

Query  2387  NELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesle-apllsePDMSADTSKQV  2211
             NEL+E+K+VLQK  +F  S+RS   AQ+ E   +    ++      L E +M  + S Q 
Sbjct  128   NELLEFKMVLQKASDFLVSSRSHTTAQETELSENVYSNDNYTDTASLLEQEMQPELSNQS  187

Query  2210  RLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSG  2031
              + FISG++ K K + FER+LFRATRGN+L  Q   DE ++DP S E VEK VF+VF+SG
Sbjct  188   GVRFISGIICKSKVLQFERMLFRATRGNMLFHQGVADEEILDPSSNEMVEKIVFVVFFSG  247

Query  2030  ERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSI  1851
             E+A++KILKIC+AFGAN YP  E++ K+ Q+  EV  ++SEL+T +D G+ HR   L SI
Sbjct  248   EQARSKILKICEAFGANCYPVPEDMTKRRQITREVVSRLSELETTLDVGLRHRDKALTSI  307

Query  1850  AEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNS  1671
                  +W  +VRREK++Y TLNML+ DVTKKCLV EGW P  A I+IQ+ALQRA  DSNS
Sbjct  308   GFHLTKWMNMVRREKAVYDTLNMLNFDVTKKCLVGEGWCPIFAKIKIQEALQRATMDSNS  367

Query  1670  EIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVM  1491
             ++G IF V+ T +SPPTYF+TN FT+A+QEIVDAYGVAKYQE NP V+TIVTFPFLFAVM
Sbjct  368   QVGIIFHVMDTVDSPPTYFRTNCFTNAYQEIVDAYGVAKYQEVNPAVYTIVTFPFLFAVM  427

Query  1490  FGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEF  1311
             FGDWGHGICLLL  L  + +E KLSSQKLG   EM FGGRYV+L+M++FSIY G IYNEF
Sbjct  428   FGDWGHGICLLLGALVLISKESKLSSQKLGSFMEMLFGGRYVLLLMSIFSIYCGLIYNEF  487

Query  1310  FSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKL  1131
             FSV F +FG SAY CRD SCSDA T+GLIK  D Y FGVDP+W G+RSELPFLNSLKMK+
Sbjct  488   FSVPFHIFGGSAYKCRDASCSDAQTVGLIKYSDPYPFGVDPSWRGSRSELPFLNSLKMKM  547

Query  1130  SILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQ  951
             SILLGV QMNLGIILSYFNA +F S ++   QF+PQ+IFLN+LFGYLS+L++VKWCTGSQ
Sbjct  548   SILLGVVQMNLGIILSYFNARFFNSSLDIKYQFVPQVIFLNSLFGYLSLLVVVKWCTGSQ  607

Query  950   ADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQHN-R  774
             ADLYHVMIYMFL P E LGENQLF GQ   Q++L+LLALV+VPWML PKPFILK  H  R
Sbjct  608   ADLYHVMIYMFLSPFEALGENQLFWGQSVLQVILLLLALVAVPWMLFPKPFILKRLHTER  667

Query  773   HQGQSYAPIQDLDESLLvdgshdssdheef-efsevfvHQLIHTIEFVLGAVSNTASYLR  597
              QG +Y  +   +  +  +       H E   FSEVFVHQ+IH+IEFVLGAVSNTASYLR
Sbjct  668   FQGGTYGLLGTSELDIYEEPDSARQHHHEEFNFSEVFVHQMIHSIEFVLGAVSNTASYLR  727

Query  596   LWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHAL  417
             LWALSLAHSELSTVFYEKVLLLAWGY++++I ++G  +F FAT  +LL+METLSAFLHAL
Sbjct  728   LWALSLAHSELSTVFYEKVLLLAWGYDSLVIRLIGLSVFAFATTFILLMMETLSAFLHAL  787

Query  416   RLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             RLHWVEFQNKFY GDGYKF+PFSF  + +++D
Sbjct  788   RLHWVEFQNKFYHGDGYKFNPFSFASLADDDD  819



>ref|XP_009795362.1| PREDICTED: V-type proton ATPase subunit a1-like [Nicotiana sylvestris]
Length=819

 Score =   989 bits (2556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 516/812 (64%), Positives = 632/812 (78%), Gaps = 3/812 (0%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             PPMD+ RSE M  VQLIIP+ESA  ++ YLG LGL+QF+DLN +KSPFQRT+  Q+KR  
Sbjct  8     PPMDMMRSENMTFVQLIIPVESAHPAITYLGQLGLLQFRDLNDDKSPFQRTFVNQVKRCA  67

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EM+RKLRFFKDQ+ KAG+  S    +Q  I+ ++LE++L + E ELIE+NAN++KL++S+
Sbjct  68    EMSRKLRFFKDQIQKAGLLPSPRPASQPDIELEELEIQLAEHEHELIEMNANSEKLRQSY  127

Query  2387  NELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesle-apllsePDMSADTSKQV  2211
             NEL+E+KLVLQK  +F  S+RS   AQ+ E   +     +      L E +M  + S Q 
Sbjct  128   NELLEFKLVLQKASDFLVSSRSHTTAQETELDENVYSNHNYSDTASLLEQEMQPELSNQS  187

Query  2210  RLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSG  2031
              + FISG++ K K + FER+LFRATRGN+L  Q+  DE ++DP S E VEK +F+VF+SG
Sbjct  188   GVRFISGIICKSKVLQFERMLFRATRGNMLFHQAVADEEILDPTSNEMVEKIIFVVFFSG  247

Query  2030  ERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSI  1851
             E+A+ KILKIC+AFGAN YP  E++ K+ Q+  EV  ++SEL+T +D G+ HR   L SI
Sbjct  248   EQARTKILKICEAFGANCYPVPEDMTKRRQITREVLSRLSELETTLDVGLRHRDKALTSI  307

Query  1850  AEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNS  1671
                  +W  +VRREK++Y TLNML+ DVTKKCLV EGW P  A  +IQ+ALQRA  DSNS
Sbjct  308   GFHLTKWMNMVRREKAVYDTLNMLNFDVTKKCLVGEGWCPIFAKTKIQEALQRATIDSNS  367

Query  1670  EIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVM  1491
             ++G +F V+G  +SPPTYF+TN+FT+A+QEIVDAYGVAKYQEANP V+TIVTFPFLFAVM
Sbjct  368   QVGIVFHVMGAVDSPPTYFRTNRFTNAYQEIVDAYGVAKYQEANPAVYTIVTFPFLFAVM  427

Query  1490  FGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEF  1311
             FGDWGHGICLLL  L  + +E KLSSQKLG   EM FGGRYV+L+M++FSIY G IYNEF
Sbjct  428   FGDWGHGICLLLGALVLISKESKLSSQKLGSFMEMLFGGRYVLLLMSIFSIYCGLIYNEF  487

Query  1310  FSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKL  1131
             FSV F +FG SAY CRD SCSDA T+GLIK  D Y FGVDP+W G+RSELPFLNSLKMK+
Sbjct  488   FSVPFHIFGGSAYKCRDASCSDAYTVGLIKYSDPYPFGVDPSWRGSRSELPFLNSLKMKM  547

Query  1130  SILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQ  951
             SILLGVAQMNLGIILSYFNA +F + ++   QF+PQ+IFLN+LFGYLS+LI+VKWCTGSQ
Sbjct  548   SILLGVAQMNLGIILSYFNARFFNNTLDIKYQFVPQVIFLNSLFGYLSLLIVVKWCTGSQ  607

Query  950   ADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQHN-R  774
             ADLYHVMIYMFL P E LGENQLF GQ   Q+VL+LLALV+VPWML PKPFILK  +  R
Sbjct  608   ADLYHVMIYMFLSPFEPLGENQLFWGQSVLQVVLLLLALVAVPWMLFPKPFILKRLYTER  667

Query  773   HQGQSYAPIQDLD-ESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLR  597
              QG +Y  +   + ++     S     HEEF FSEVFVHQ+IH+IEFVLGAVSNTASYLR
Sbjct  668   FQGGTYGLLGTSEVDTYEEPDSARQHHHEEFNFSEVFVHQMIHSIEFVLGAVSNTASYLR  727

Query  596   LWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHAL  417
             LWALSLAHSELSTVFYEKVLLLAWGY+N+II ++G  +F FAT  +LL+METLSAFLHAL
Sbjct  728   LWALSLAHSELSTVFYEKVLLLAWGYDNLIIRLIGLAVFAFATTFILLMMETLSAFLHAL  787

Query  416   RLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             RLHWVEFQNKFY GDGYKF PFSF  + ++ED
Sbjct  788   RLHWVEFQNKFYHGDGYKFKPFSFAALADDED  819



>ref|XP_009346583.1| PREDICTED: vacuolar proton ATPase a1-like [Pyrus x bretschneideri]
Length=819

 Score =   988 bits (2554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 509/811 (63%), Positives = 638/811 (79%), Gaps = 2/811 (0%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             P MDL RSE M  VQLIIP+ESA  +++YLG+LGL+QF+DLNA+KSPFQRT+  Q+KR  
Sbjct  9     PAMDLMRSEKMTFVQLIIPVESAHRAISYLGELGLLQFRDLNADKSPFQRTFVNQVKRCA  68

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EM+RKLRFF+DQ+SKAG+ +S +   Q  I  ++LE++L + E ELIE+N+N+D+LQ S+
Sbjct  69    EMSRKLRFFRDQISKAGLLSSVHPVLQPDIDLEELEIQLAEHEHELIEMNSNSDRLQHSY  128

Query  2387  NELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesl-eapllsePDMSADTSKQV  2211
             NEL+E+K+VLQK   F  S+ S A ++++E   +    ++  +   L E D+    S Q 
Sbjct  129   NELLEFKMVLQKASGFLVSSNSHAVSEERELDENIYSNDNYGDEVSLLEQDIRPGPSDQS  188

Query  2210  RLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSG  2031
              L F+SG++ K K++ FER+LFRATRGN+L   +  DE ++DP+S E VEK VF+VF+SG
Sbjct  189   GLRFVSGIICKSKALRFERMLFRATRGNMLFNHAPADEQIMDPLSTEMVEKTVFVVFFSG  248

Query  2030  ERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSI  1851
              +AK KILKIC+AFGAN YP  E++ KQ Q+  EVS +++EL+T +DAGI HR   L S+
Sbjct  249   MQAKTKILKICEAFGANCYPVPEDITKQRQITREVSSRLAELETTLDAGIRHRNKALTSV  308

Query  1850  AEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNS  1671
                  +W  +VRREK++Y TLNML+ DVTKKCLV EGW P  A  +IQ+ALQRA  DS+S
Sbjct  309   GFHLAKWINMVRREKAVYDTLNMLNFDVTKKCLVGEGWCPIFAKPKIQEALQRATFDSSS  368

Query  1670  EIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVM  1491
             ++G IF V+ T +SPPTYF+TN+FTSAFQEIVDAYGVA+YQEANP V+T +TFPFLFAVM
Sbjct  369   QVGVIFHVMDTLDSPPTYFRTNRFTSAFQEIVDAYGVARYQEANPAVYTCITFPFLFAVM  428

Query  1490  FGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEF  1311
             FGDWGHGICLL+  L  + RE KLS+QKLG   EM FGGRYV+L+M+LFSIY G IYNEF
Sbjct  429   FGDWGHGICLLVGALVLIARESKLSAQKLGSFMEMLFGGRYVLLLMSLFSIYCGLIYNEF  488

Query  1310  FSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKL  1131
             FSV F +FG SAY CRD +CS+A TIGLIK RD Y FGVDP+W G+RSELPFLNSLKMK+
Sbjct  489   FSVPFHIFGGSAYKCRDAACSEAYTIGLIKYRDPYPFGVDPSWRGSRSELPFLNSLKMKM  548

Query  1130  SILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQ  951
             SILLGV QMNLGI+LSYFNA +F S ++   QF+PQ+IFLN+LFGYLS+L+++KWCTGSQ
Sbjct  549   SILLGVVQMNLGILLSYFNARFFSSSLDIRYQFVPQMIFLNSLFGYLSLLVVIKWCTGSQ  608

Query  950   ADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQHN-R  774
             ADLYHVMIYMFL PT+DLGENQLF GQ+  Q++L+LLAL++VPWML PKPFIL+  +  R
Sbjct  609   ADLYHVMIYMFLSPTDDLGENQLFWGQRPLQIILLLLALIAVPWMLFPKPFILRKLNTER  668

Query  773   HQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLRL  594
              QG++Y  +   +  L V+       HEEF FSEVFVHQ+IH+IEFVLGAVSNTASYLRL
Sbjct  669   FQGRAYGMLGTSEMDLEVEPDSARQHHEEFNFSEVFVHQMIHSIEFVLGAVSNTASYLRL  728

Query  593   WALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHALR  414
             WALSLAHSELSTVF EKVLLLAWGY++ II ++G  +F FAT  +LL+METLSAFLHALR
Sbjct  729   WALSLAHSELSTVFCEKVLLLAWGYDSFIIRLIGLSVFAFATAFILLMMETLSAFLHALR  788

Query  413   LHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             LHWVE+QNKFY GDGYKF PFSF  + E+ED
Sbjct  789   LHWVEYQNKFYHGDGYKFKPFSFASITEDED  819



>ref|XP_008783707.1| PREDICTED: vacuolar proton ATPase a1-like isoform X1 [Phoenix 
dactylifera]
Length=819

 Score =   988 bits (2554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 507/810 (63%), Positives = 626/810 (77%), Gaps = 3/810 (0%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             PPMD  RSE M  VQLIIP+ESA  S+ YLG+LG++QFKDLN +KSPFQRT+  Q+KR G
Sbjct  9     PPMDHLRSEKMSFVQLIIPVESAHRSITYLGELGMLQFKDLNDDKSPFQRTFVNQVKRCG  68

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EMARKLRFF DQ+SKA ++++     Q  I  ++LEV+L + EAEL+E+N NN+KL+++ 
Sbjct  69    EMARKLRFFSDQISKACITSAGRPAMQPDISLEELEVRLAEHEAELLEMNMNNEKLRQAS  128

Query  2387  NELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllse-PDMSADTSKQV  2211
             NEL+E+KLVL K G F  S+++ A   ++E   +   +E     L     +   +   + 
Sbjct  129   NELLEFKLVLLKAGSFLVSSQNHAVPAERELDENIYSKERDRESLSLLDQETPPEMLNKA  188

Query  2210  RLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSG  2031
              L FISG++ K K++ FER+LFR TRGN+   Q+   E V+DP+SGE VEK +F+VF+SG
Sbjct  189   GLRFISGIICKSKALRFERMLFRTTRGNMFFNQAPAGEHVMDPVSGEMVEKIIFVVFFSG  248

Query  2030  ERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSI  1851
             E+AK KILKIC+AFGAN YP  E+  KQ Q+  EVS ++SEL+  +DAGI HR N L SI
Sbjct  249   EQAKTKILKICEAFGANCYPVPEDTSKQRQMTREVSSRLSELEATLDAGIRHRNNALASI  308

Query  1850  AEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNS  1671
               Q  +W ++VR+EK++Y TLN L+ DVTKKCLV EGW P  A  +IQDALQRA  DSNS
Sbjct  309   GSQLWKWTIMVRKEKAVYDTLNRLNFDVTKKCLVGEGWCPVFAKPQIQDALQRATIDSNS  368

Query  1670  EIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVM  1491
             ++G IF V+   ESPPTYF+TN+FT AFQEI+DAYGVA+YQEANP V++++TFPFLFAVM
Sbjct  369   QVGIIFHVMNAIESPPTYFRTNRFTHAFQEIIDAYGVARYQEANPAVYSVITFPFLFAVM  428

Query  1490  FGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEF  1311
             FGDWGHGICLLL + + ++REKK  SQKLG   EM FGGRYV+L+MALFSIY G IYNEF
Sbjct  429   FGDWGHGICLLLGSFFLIVREKKFGSQKLGSFMEMAFGGRYVLLLMALFSIYCGLIYNEF  488

Query  1310  FSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKL  1131
             FSV F +FG SAY CRD +CSDA T GL+K RD YAFGVDP W G+RSELPFLNSLKMK+
Sbjct  489   FSVPFRIFGESAYKCRDTTCSDARTAGLVKYRDPYAFGVDPRWRGSRSELPFLNSLKMKM  548

Query  1130  SILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQ  951
             SILLGV+QMNLGIILSYF+A +  S ++   QFIPQ+IFLN+LFGYLS+LI++KWCTGSQ
Sbjct  549   SILLGVSQMNLGIILSYFDAKFHGSSLDIRYQFIPQMIFLNSLFGYLSLLILIKWCTGSQ  608

Query  950   ADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQHN-R  774
             ADLYHVMIYMFL PT DLGEN+LF GQK  Q++L+LLA+V+VPWML PKPFIL+  +  R
Sbjct  609   ADLYHVMIYMFLDPTGDLGENRLFWGQKPLQILLLLLAIVAVPWMLFPKPFILRKLNTER  668

Query  773   HQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLRL  594
              QG++Y  +   +  L  +       H++F FSEVFVHQ+IH+IEFVLGAVSNTASYLRL
Sbjct  669   FQGRTYGILGTSEMDLDHEPDSARQRHDDFNFSEVFVHQMIHSIEFVLGAVSNTASYLRL  728

Query  593   WALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHALR  414
             WALSLAHSELSTVFYEK+LLLAWGY+N II + G  +F FAT  +LL+METLSAFLHALR
Sbjct  729   WALSLAHSELSTVFYEKILLLAWGYDNPIIRIAGLTVFAFATAFILLMMETLSAFLHALR  788

Query  413   LHWVEFQNKFYEGDGYKFDPFSFV-LVDEE  327
             LHWVEF +KFY GDGYKF PFSF  L DEE
Sbjct  789   LHWVEFMSKFYHGDGYKFRPFSFASLADEE  818



>emb|CDP08938.1| unnamed protein product [Coffea canephora]
Length=825

 Score =   988 bits (2554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 507/818 (62%), Positives = 626/818 (77%), Gaps = 9/818 (1%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             PPMDL RSE M  VQLIIP+ESA  +++YLG LGL+QF+DLN EKSPFQRT+  Q+KR  
Sbjct  8     PPMDLMRSEKMTFVQLIIPVESAHRAISYLGQLGLLQFRDLNDEKSPFQRTFVNQVKRCA  67

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EM+RKLRFFKDQ+ KAG+  S +  +Q  I+ ++LE++L + E ELIE+N+N +KLQ+++
Sbjct  68    EMSRKLRFFKDQIHKAGLLPSPHPASQPDIELEELEMQLAEHEHELIEMNSNTEKLQQTY  127

Query  2387  NELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesle-apllsePDMSADTSKQV  2211
             NEL+E+K+VL+K  +F  S+RS++  Q++E   +    +       L E +M    S Q 
Sbjct  128   NELLEFKMVLKKASDFLVSSRSNSTVQEREMVENVYSNDHYADTASLLEQEMQPGPSVQS  187

Query  2210  RLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSG  2031
              + F+SG++ K K + FER+LFRATRGN+   Q+  D+ ++DP S E VEK VF+VF+SG
Sbjct  188   GVRFVSGIICKSKVLTFERMLFRATRGNMFFNQAAADDQILDPSSNEMVEKTVFVVFFSG  247

Query  2030  ERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSI  1851
             E+A+ KILKIC+AFGAN YP  E++ K+ Q+  EVS ++SEL+T +DAG  HR   L SI
Sbjct  248   EQARTKILKICEAFGANCYPVPEDVTKRMQITREVSSRLSELETTLDAGTRHRDKALTSI  307

Query  1850  AEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNS  1671
               Q  +W  +V REK++Y TLNML+ DVTKKCLV EGW P  A  +IQ+ALQRA  DSNS
Sbjct  308   GFQLAKWMNMVGREKAVYDTLNMLNFDVTKKCLVGEGWCPIFAKAKIQEALQRATFDSNS  367

Query  1670  EIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVM  1491
             ++G IF V+   E PPTYF+TN+FTSAFQEIVDAYGVA YQEANP V+T+VTFPFLFAVM
Sbjct  368   QVGIIFHVMDAVEPPPTYFRTNRFTSAFQEIVDAYGVANYQEANPAVYTVVTFPFLFAVM  427

Query  1490  FGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEF  1311
             FGDWGHGICLLL  L  + RE+KL SQKLG   EM FGGRYV+L+M++FSIY G IYNEF
Sbjct  428   FGDWGHGICLLLGALVLIARERKLGSQKLGSFMEMLFGGRYVLLLMSIFSIYCGLIYNEF  487

Query  1310  FSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKL  1131
             FSV F +FG SAY CRD SCSDA +IGLIK+RD Y FGVDP+W G+R+ELPFLNSLKMKL
Sbjct  488   FSVPFHIFGESAYKCRDSSCSDARSIGLIKSRDPYPFGVDPSWRGSRTELPFLNSLKMKL  547

Query  1130  SILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQ  951
             SILLGV QMNLGIILSYFNA +F + ++   QF+PQ+IFLN LFGYLS+LI++KWC+GSQ
Sbjct  548   SILLGVVQMNLGIILSYFNARFFGNSLDIKYQFVPQMIFLNCLFGYLSLLIVIKWCSGSQ  607

Query  950   ADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvl-------vllalvsVPWMLLPKPFIL  792
             ADLYHVMIYMFL P EDLGEN+LF GQ   Q          +L A+V+VPWML PKPFIL
Sbjct  608   ADLYHVMIYMFLSPFEDLGENKLFWGQGVLQAQSLIFSVILLLCAVVAVPWMLFPKPFIL  667

Query  791   KSQHN-RHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSN  615
             K  H  R QG++Y  +   D ++  +        E+F FSE FVHQ+IH+IEFVLGAVSN
Sbjct  668   KRLHTERFQGRTYGLLGTSDMNIDDEPDSARQHQEDFNFSEEFVHQMIHSIEFVLGAVSN  727

Query  614   TASYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLS  435
             TASYLRLWALSLAHSELSTVFYEKVLLLAWGY NIII +VG  +F FAT  +LL+METLS
Sbjct  728   TASYLRLWALSLAHSELSTVFYEKVLLLAWGYENIIIRLVGLAVFAFATAFILLMMETLS  787

Query  434   AFLHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             AFLHALRLHWVEFQNKFY GDGYKF PFSF  + +++D
Sbjct  788   AFLHALRLHWVEFQNKFYHGDGYKFRPFSFASLTDDDD  825



>ref|XP_001752776.1| predicted protein [Physcomitrella patens]
 gb|EDQ82280.1| predicted protein [Physcomitrella patens]
Length=788

 Score =   988 bits (2553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 520/814 (64%), Positives = 632/814 (78%), Gaps = 37/814 (5%)
 Frame = -2

Query  2741  MDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSGEM  2562
             MDLFRSE M LVQLIIP ESA  +V YL +LGLIQFKDLN +KSPFQRTYA Q+KR GEM
Sbjct  4     MDLFRSEEMSLVQLIIPAESAHDTVTYLAELGLIQFKDLNPDKSPFQRTYANQVKRCGEM  63

Query  2561  ARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSFNE  2382
             ARKLR+F DQ++KAG +A+  + +  +I  D+LE KL +LEAEL+EINAN+DKLQRS +E
Sbjct  64    ARKLRYFHDQITKAGRTATFTATSDRSIDLDELETKLTELEAELLEINANSDKLQRSHSE  123

Query  2381  LVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTSKQVRLG  2202
             LVE +LVL K  + F                                ++  +TSK VRLG
Sbjct  124   LVELQLVLHKGSDRF------------------------------LRNLQTETSKSVRLG  153

Query  2201  FISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSGERA  2022
             FISG+VPK K+ +FERILFRATRGN+ L+Q+ + ++V DP +GEKV+K VF+VF++GERA
Sbjct  154   FISGVVPKAKAASFERILFRATRGNMFLKQALIQDAVTDPATGEKVKKTVFVVFFAGERA  213

Query  2021  KNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSIAEQ  1842
             K K++KIC+AFGANRYPF E+  +Q Q+ +EV  ++SEL+  +DAG   + N++ +I   
Sbjct  214   KTKVIKICEAFGANRYPFPEDPNRQWQMKSEVETRLSELQNTLDAGTHLKDNVINNIGSN  273

Query  1841  FDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNSEIG  1662
              D W V+VRREK++YHTLNMLSIDVT+KCLVAEGW P  A  +IQDALQRA HDSNS++ 
Sbjct  274   LDHWTVMVRREKAVYHTLNMLSIDVTRKCLVAEGWCPVFAKPKIQDALQRAAHDSNSQVN  333

Query  1661  AIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGD  1482
              IF+VL T+ESPP+YF+TNKFT+AFQEIV+AYGV +YQEANPG FTIVTFPFLFAVMFGD
Sbjct  334   TIFQVLHTKESPPSYFETNKFTNAFQEIVEAYGVGRYQEANPGCFTIVTFPFLFAVMFGD  393

Query  1481  WGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEFFSV  1302
             WGHGICLLL  LY ++ EKKL  QKLGDI EM +GGRYVIL+MA+FSIYTGFIYNEFFSV
Sbjct  394   WGHGICLLLGALYLVLNEKKLGKQKLGDIMEMAYGGRYVILLMAIFSIYTGFIYNEFFSV  453

Query  1301  QFELFGRSAYVCRDP-----SCSDATTIGLIK-ARDTYAFGVDPAWHGTRSELPFLNSLK  1140
              F +FG +AY C DP     +C  A+T GL K + + YAFGVDP WHG+RSELPF NSLK
Sbjct  454   PFGIFGGTAYRCPDPQYSVENCPVASTSGLEKWSYEPYAFGVDPVWHGSRSELPFTNSLK  513

Query  1139  MKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCT  960
             MK+SILLG++QMNLGI+LSYFNA YFRS ++ W QFIPQ++FLNALFGYLS LI++KWC 
Sbjct  514   MKMSILLGISQMNLGILLSYFNARYFRSALDVWYQFIPQLLFLNALFGYLSFLIVLKWCQ  573

Query  959   GSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQH  780
             GS+ DLYHVMIYMFL PT DL +NQLF GQ   Q+VL+++ALV+VPWML PKP +L+ QH
Sbjct  574   GSKPDLYHVMIYMFLSPTGDLEDNQLFSGQSYVQIVLLIIALVAVPWMLFPKPLLLRRQH  633

Query  779   -NRHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASY  603
               + QG+ Y  +   D S   D      D EEFEF EV VHQ+IHTIEFVLGAVSNTASY
Sbjct  634   MQKLQGRHYTALSRSDYSSSDDEGTGEHDEEEFEFGEVLVHQMIHTIEFVLGAVSNTASY  693

Query  602   LRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLH  423
             LRLWALSLAH++LS VFYE+VL+ AW Y+N +I ++G I+F F T GVLL+METLSAFLH
Sbjct  694   LRLWALSLAHAQLSAVFYERVLMFAWAYSNPVIRLIGLIVFAFVTFGVLLLMETLSAFLH  753

Query  422   ALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             ALRLHWVEFQNKFY+GDGYKF PFSF    EE+D
Sbjct  754   ALRLHWVEFQNKFYQGDGYKFKPFSFNTCSEEDD  787



>gb|KHG00921.1| Vacuolar proton translocating ATPase subunit [Gossypium arboreum]
Length=824

 Score =   987 bits (2551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 504/816 (62%), Positives = 634/816 (78%), Gaps = 9/816 (1%)
 Frame = -2

Query  2744  PMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSGE  2565
             PMDL RSE M LVQLIIP+ESA  +V+YLG+LGL+QF+DLNAEKSPFQRT+  Q+KR GE
Sbjct  10    PMDLMRSEKMSLVQLIIPVESAHRAVSYLGELGLLQFRDLNAEKSPFQRTFVNQVKRCGE  69

Query  2564  MARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSFN  2385
             M+RKLRFFKDQ+ KAG+ +S +   +  ++ ++LE++L + E ELIE+N+N++KL++++N
Sbjct  70    MSRKLRFFKDQIIKAGLLSSIHPVVEPDVELEELEMQLAEHEHELIEMNSNSEKLRQTYN  129

Query  2384  ELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTSKQVRL  2205
             EL+E+K+VL K G F  S  ++    ++   S             S  +    T+ Q  L
Sbjct  130   ELLEFKMVLLKAGSFLVS-NNNQAVAKERELSENVYSSDRYVEASSLLEQQMRTADQSGL  188

Query  2204  GFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSGER  2025
              FISG++ + K++ FER+LFRATRGN+L  Q+  DE ++DP+S E V+K VF+VF+SGE+
Sbjct  189   RFISGIIFQSKALRFERMLFRATRGNMLFNQAPADEEIMDPLSAEMVKKTVFVVFFSGEQ  248

Query  2024  AKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSIAE  1845
             A+ KILKIC+AFGAN YP  E+  KQ Q+  E+  ++SEL+T +DAGI H+   L SI  
Sbjct  249   ARTKILKICEAFGANCYPVPEDFSKQRQITREILSRLSELETTLDAGIRHQNKALTSIGY  308

Query  1844  QFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNSEI  1665
                +W  ++RREK++Y TLNML+ DVTKKCLV EGW P  A  ++Q+ALQRA  DSNS++
Sbjct  309   HLTQWMSMIRREKAVYDTLNMLNFDVTKKCLVGEGWCPVFAKAKVQEALQRATFDSNSQV  368

Query  1664  GAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMFG  1485
             G+IF V+   ESPPTYF+TN FT+A+QEIVDAYG+A+YQEANP V+T+VTFPFLFAVMFG
Sbjct  369   GSIFHVMDAVESPPTYFRTNHFTNAYQEIVDAYGIARYQEANPAVYTVVTFPFLFAVMFG  428

Query  1484  DWGHGICLLLATLYFLIREKKLSSQ-------KLGDITEMTFGGRYVILMMALFSIYTGF  1326
             DWGHGICLLL  +  + RE +LS+Q       KLG    M F GRYV+L+M+LFSIY G 
Sbjct  429   DWGHGICLLLGAVVLIARESRLSTQACVRAYHKLGSFMAMLFEGRYVLLLMSLFSIYCGL  488

Query  1325  IYNEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNS  1146
             IYNEFFSV F +FG SAY CRD +CSDA + GLIK RD Y FGVDP+W G+RSELPFLNS
Sbjct  489   IYNEFFSVPFHIFGGSAYKCRDATCSDAHSAGLIKFRDPYPFGVDPSWRGSRSELPFLNS  548

Query  1145  LKMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKW  966
             LKMK+SILLGVAQMNLGIILSYFNA +F S ++   QF+PQ+IFLN+LFGYLS+LII+KW
Sbjct  549   LKMKMSILLGVAQMNLGIILSYFNARFFHSSLDTRYQFVPQLIFLNSLFGYLSLLIIIKW  608

Query  965   CTGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKS  786
             CTGSQADLYHVMIYMFL PT+DLGEN+LF GQ+  Q+VL+LLALV+VPWML PKPFILK 
Sbjct  609   CTGSQADLYHVMIYMFLSPTDDLGENELFWGQRPLQIVLLLLALVAVPWMLFPKPFILKK  668

Query  785   QHN-RHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTA  609
              H+ R QG++Y  +   +    V+       HEEF FSEVFVHQ+IH+IEFVLGAVSNTA
Sbjct  669   LHSERFQGRNYGMLVSSEFDPDVEPDSARQHHEEFNFSEVFVHQMIHSIEFVLGAVSNTA  728

Query  608   SYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAF  429
             SYLRLWALSLAHSELSTVFYEK+LLLAWGY+N++I ++G  +F FAT  +LL+METLSAF
Sbjct  729   SYLRLWALSLAHSELSTVFYEKILLLAWGYDNVVIRLIGLAVFAFATAFILLMMETLSAF  788

Query  428   LHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             LHALRLHWVEFQNKFY GDGYKF PFSF L+ E++D
Sbjct  789   LHALRLHWVEFQNKFYHGDGYKFKPFSFALIAEDDD  824



>ref|XP_004294683.1| PREDICTED: vacuolar proton ATPase a1-like [Fragaria vesca subsp. 
vesca]
Length=820

 Score =   987 bits (2551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 508/812 (63%), Positives = 634/812 (78%), Gaps = 3/812 (0%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             P MDL RSE M  VQLIIP+ESA  +V+YLG+LGL+QF+DLNA+KSPFQ T+  Q+KR  
Sbjct  9     PSMDLMRSEKMTFVQLIIPVESAHRTVSYLGELGLLQFRDLNADKSPFQLTFVNQVKRCA  68

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EM+RKLRFFKDQ+SKAG+  S    +Q  I+ ++LE +LG+ E ELIE+N+N+++L++S+
Sbjct  69    EMSRKLRFFKDQISKAGLLGSIRPVSQPDIELEELEFQLGEHEHELIEMNSNSERLRQSY  128

Query  2387  NELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesl-eapllsePDMSADTSKQV  2211
             NEL+E+K+VLQK   F  S+ S A  ++ E   +        ++  L E D+    S Q 
Sbjct  129   NELLEFKMVLQKASGFLVSSNSHAVTEETELEENVYSMNDYGDSVSLLEQDIRPGPSDQS  188

Query  2210  RLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSG  2031
              L F+SG++ K K+  FER+LFRATRGN+L  Q+  DE ++DP+S E VE+ VF+VF+SG
Sbjct  189   GLNFVSGIICKSKAPRFERMLFRATRGNMLFNQAPADEQIMDPLSTEMVEQTVFVVFFSG  248

Query  2030  ERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSI  1851
              +AK KILKIC+AFGAN YP  E++ KQ Q+  EVS ++++L+  +DAGI HR   L S+
Sbjct  249   LQAKAKILKICEAFGANCYPVPEDITKQRQITREVSSRLADLEATLDAGIRHRNKALTSV  308

Query  1850  AEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNS  1671
                  +W  +VRREK++Y TLNML+ DVTKKCLV EGW P  A  +IQ+ALQRA  DSNS
Sbjct  309   GFHLAKWMNMVRREKAVYDTLNMLNFDVTKKCLVGEGWCPIFAKTKIQEALQRATFDSNS  368

Query  1670  EIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVM  1491
             ++G IF V+   ESPPTYF+TN FTSAFQEIVDAYGVA+YQEANP V+T++TFPFLFAVM
Sbjct  369   QVGVIFHVMDAIESPPTYFRTNNFTSAFQEIVDAYGVARYQEANPAVYTVITFPFLFAVM  428

Query  1490  FGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEF  1311
             FGDWGHGICLL+  L  + RE+KL++QKLG   EM FGGRYV+L+M+LFSIY G IYNEF
Sbjct  429   FGDWGHGICLLMGALVLIARERKLAAQKLGSFMEMLFGGRYVLLLMSLFSIYCGLIYNEF  488

Query  1310  FSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKL  1131
             FSV F +FG SAY CRD +CSDA T+GLIK RD Y FGVDP+W G+RSELPFLNSLKMKL
Sbjct  489   FSVPFHIFGGSAYKCRDATCSDAHTVGLIKYRDPYPFGVDPSWRGSRSELPFLNSLKMKL  548

Query  1130  SILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQ  951
             SILLGV QMN+GI+LSYFNA +F S ++   QF+PQ+IFLN+LFGYLS+L+++KWCTGS+
Sbjct  549   SILLGVVQMNVGIMLSYFNARFFNSSIDIRYQFVPQMIFLNSLFGYLSLLVVIKWCTGSK  608

Query  950   ADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQHN-R  774
             ADLYHVMIYMFL PT+DLG NQLF GQ+  Q++L++LAL++VPWML PKPFIL+  H  R
Sbjct  609   ADLYHVMIYMFLSPTDDLGVNQLFWGQRPLQIILLVLALIAVPWMLFPKPFILRKLHTER  668

Query  773   HQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLRL  594
              QG++Y  +   +  L V+       HEEF FSEVFVHQ+IH+IEFVLGAVSNTASYLRL
Sbjct  669   FQGRTYGMLGTSEMDLDVETDPVRQHHEEFNFSEVFVHQMIHSIEFVLGAVSNTASYLRL  728

Query  593   WALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHALR  414
             WALSLAHSELSTVFYEKVLLLAWGY++ II ++G  +F FAT  +LL+METLSAFLHALR
Sbjct  729   WALSLAHSELSTVFYEKVLLLAWGYDSFIIRLIGLAVFAFATAFILLMMETLSAFLHALR  788

Query  413   LHWVEFQNKFYEGDGYKFDPFSFV-LVDEEED  321
             LHWVEFQNKFY GDGYKF PFSF  L  E+ED
Sbjct  789   LHWVEFQNKFYLGDGYKFKPFSFASLATEDED  820



>ref|XP_009617904.1| PREDICTED: V-type proton ATPase subunit a1-like [Nicotiana tomentosiformis]
Length=819

 Score =   986 bits (2550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 517/812 (64%), Positives = 631/812 (78%), Gaps = 3/812 (0%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             PPMDL RSE M  VQLIIP+ESA  ++ YLG LGL+QF+DLN +KSPFQRT+  Q+KR  
Sbjct  8     PPMDLMRSENMTFVQLIIPVESAHPAITYLGQLGLLQFRDLNDDKSPFQRTFVNQVKRCA  67

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EM+RKLRFFKDQ+ KAG+  S    +Q  I+ ++LE++L + E ELIE+NAN++KL++S+
Sbjct  68    EMSRKLRFFKDQIQKAGLLPSPRPASQPDIELEELEIQLAEHEHELIEMNANSEKLRQSY  127

Query  2387  NELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesle-apllsePDMSADTSKQV  2211
             NEL+E+KLVLQK  +F  S+RS   AQ+ E   +     +      L E +M  + S Q 
Sbjct  128   NELLEFKLVLQKASDFLVSSRSHTTAQETELDENVYSNHNYSDTASLLEQEMQPELSNQS  187

Query  2210  RLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSG  2031
              + FISG++ K K + FER+LFRATRGN+L  Q+  DE ++DP S E VEK VF+VF+SG
Sbjct  188   GVRFISGIICKSKVLQFERMLFRATRGNMLFHQAVADEEILDPTSNEMVEKIVFVVFFSG  247

Query  2030  ERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSI  1851
             E+A+ KILKIC+AFGAN YP  E++ K+ Q+  EV   +SEL+T +D G+ HR   L SI
Sbjct  248   EQARTKILKICEAFGANCYPVPEDMTKRRQITREVLSHLSELETTLDVGLRHRDKALTSI  307

Query  1850  AEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNS  1671
                  +W  +VRREK++Y TLNML+ DVTKKCLV EGW P  A  +IQ+ALQRA  DSNS
Sbjct  308   GFHLTKWMNMVRREKAVYDTLNMLNFDVTKKCLVGEGWCPIFAKTKIQEALQRATIDSNS  367

Query  1670  EIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVM  1491
             ++G +F V+G  +SPPTYF+TN+FT+A+QEIVDAYGVAKYQEANP V+TIVTFPFLFAVM
Sbjct  368   QVGIVFHVMGAVDSPPTYFRTNRFTNAYQEIVDAYGVAKYQEANPAVYTIVTFPFLFAVM  427

Query  1490  FGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEF  1311
             FGDWGHGICLLL  L  + +E KLSSQKLG   EM FGGRYV+L+M++FSIY G IYNEF
Sbjct  428   FGDWGHGICLLLGALVLISKESKLSSQKLGSFMEMLFGGRYVLLLMSIFSIYCGLIYNEF  487

Query  1310  FSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKL  1131
             FSV F +FG SAY CRD SCSDA T+GLIK  D Y FGVDP+W G+RSELPFLNSLKMK+
Sbjct  488   FSVPFRIFGGSAYKCRDASCSDAYTVGLIKYSDPYPFGVDPSWRGSRSELPFLNSLKMKM  547

Query  1130  SILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQ  951
             SILLGVAQMNLGIILSYFNA +F + ++   QF+PQ+IFLN+LFGYLS+LI+VKWCTGSQ
Sbjct  548   SILLGVAQMNLGIILSYFNARFFNNTLDIKYQFVPQVIFLNSLFGYLSLLIVVKWCTGSQ  607

Query  950   ADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQHN-R  774
             ADLYHVMIYMFL P E LGENQLF GQ   Q+VL+LLALV+VPWML PKPFILK  +  R
Sbjct  608   ADLYHVMIYMFLSPFEALGENQLFWGQSVLQVVLLLLALVAVPWMLFPKPFILKRLYTER  667

Query  773   HQGQSYAPIQDLD-ESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLR  597
              QG +Y  +   + ++     S     HEEF FSEVFVHQ+IH+IEFVLGAVSNTASYLR
Sbjct  668   FQGGTYGLLGTSEVDTYEEPDSARQHHHEEFNFSEVFVHQMIHSIEFVLGAVSNTASYLR  727

Query  596   LWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHAL  417
             LWALSLAHSELSTVFYEKVLLLAWGY+++II ++G  +F FAT  +LL+METLSAFLHAL
Sbjct  728   LWALSLAHSELSTVFYEKVLLLAWGYDSLIIRLIGLAVFAFATTFILLMMETLSAFLHAL  787

Query  416   RLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             RLHWVEFQNKFY GDGYKF PFSF  + ++ED
Sbjct  788   RLHWVEFQNKFYHGDGYKFKPFSFAALADDED  819



>ref|XP_010244988.1| PREDICTED: V-type proton ATPase subunit a1-like [Nelumbo nucifera]
 ref|XP_010244989.1| PREDICTED: V-type proton ATPase subunit a1-like [Nelumbo nucifera]
 ref|XP_010244991.1| PREDICTED: V-type proton ATPase subunit a1-like [Nelumbo nucifera]
Length=818

 Score =   985 bits (2546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 508/818 (62%), Positives = 634/818 (78%), Gaps = 16/818 (2%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             PPMD  RSE M LVQLIIP+ESA  +V+YLG+LGL+QF DLNA+KSPFQRT+  Q+KR G
Sbjct  8     PPMDFLRSEEMTLVQLIIPVESAHRAVSYLGELGLLQFTDLNADKSPFQRTFVNQVKRCG  67

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             E++RKLRFFKDQ+SKAG+ +  +S  Q  +  ++LE++L + E ELIE+NAN++KL++++
Sbjct  68    EISRKLRFFKDQISKAGMVSPIHSSPQPDVDLEELEIQLSEHEHELIEMNANSEKLRQTY  127

Query  2387  NELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTSKQVR  2208
             NEL+E+K+VLQK G F  S +    AQ++E   +    ++         D+ +   ++ R
Sbjct  128   NELLEFKMVLQKAGGFLVSGQHHTVAQERELDENLYSRDNYA-------DIPSFLEQETR  180

Query  2207  LG--------FISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNV  2052
             LG        FISG++ K K++ FER++FRATRGN+L  Q+  ++   DP+S E VEK V
Sbjct  181   LGPSNEAGLRFISGIICKSKALRFERMIFRATRGNMLFNQAPTEKYATDPMSVEMVEKIV  240

Query  2051  FLVFYSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHR  1872
             F+VF+SGE+AK KILKIC+AFGAN YP  E++ +Q Q+  EV  ++SEL+  +DAG+ HR
Sbjct  241   FVVFFSGEQAKIKILKICEAFGANCYPVPEDITRQRQVTQEVLSRLSELEDTLDAGVRHR  300

Query  1871  GNLLQSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQR  1692
                L SIA    +W ++VR+EK++Y TLNML+ DVTKKCLV EGW P  A  +IQD LQ+
Sbjct  301   NKALTSIALHLRKWTIMVRKEKAVYDTLNMLNFDVTKKCLVGEGWCPIFAKPKIQDMLQQ  360

Query  1691  AGHDSNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTF  1512
             A  DSNS++G IF+V+   ESPPTYF+TN FT+AFQEIVDAYGVA YQEANP V+T++TF
Sbjct  361   ATIDSNSQVGIIFQVMDAVESPPTYFRTNCFTNAFQEIVDAYGVAGYQEANPAVYTVITF  420

Query  1511  PFLFAVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYT  1332
             PFLFAVMFGDWGHGICLLL  +  +  E +L S+KLG   EM FGGRYVIL+MALFSIY 
Sbjct  421   PFLFAVMFGDWGHGICLLLGAIILIACESRLGSRKLGSFMEMAFGGRYVILLMALFSIYC  480

Query  1331  GFIYNEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFL  1152
             G IYNEFFSV + +FG SAY CRD +C DA T GLIK RD Y FGVDP+W G+RSELPFL
Sbjct  481   GLIYNEFFSVPYHIFGGSAYKCRDATCRDAHTAGLIKYRDPYPFGVDPSWRGSRSELPFL  540

Query  1151  NSLKMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIV  972
             NSLKMK+SILLGVAQMNLGIILSYFNA +F S ++ W QF+PQ+IFLN+LFGYLS+LI++
Sbjct  541   NSLKMKMSILLGVAQMNLGIILSYFNARFFGSSLDIWYQFVPQMIFLNSLFGYLSLLIVI  600

Query  971   KWCTGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFIL  792
             KWCTGSQADLYHVMIYMFL PTEDLGENQLF GQK  Q++L+LLA+V+VPWML PKPFIL
Sbjct  601   KWCTGSQADLYHVMIYMFLSPTEDLGENQLFWGQKPLQMLLLLLAVVAVPWMLFPKPFIL  660

Query  791   KSQH-NRHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSN  615
             +  H  R QG++Y  +   D  L V+        +EF FSEVFVHQ+IH+IEFVL AVSN
Sbjct  661   RKLHLERFQGRTYGILDTSDMDLDVEPDSARHHVDEFNFSEVFVHQMIHSIEFVLEAVSN  720

Query  614   TASYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLS  435
             TASYLRLWALSLAHSELSTVFYEKVLLLAWG+++I+I +VG  +F FAT  +LL+METLS
Sbjct  721   TASYLRLWALSLAHSELSTVFYEKVLLLAWGFDSILIRLVGLAVFAFATAFILLMMETLS  780

Query  434   AFLHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             AFLHALRLHWVEFQNKFY GDGYKF P SF  + ++ED
Sbjct  781   AFLHALRLHWVEFQNKFYHGDGYKFRPLSFASLPDDED  818



>ref|XP_006366398.1| PREDICTED: vacuolar proton ATPase a1-like [Solanum tuberosum]
Length=819

 Score =   984 bits (2543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 510/812 (63%), Positives = 628/812 (77%), Gaps = 3/812 (0%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             PPMDL RSE M  VQLIIP+ESA  ++ YLG LGL+QF+DLNA+KSPFQRT+  Q+KR  
Sbjct  8     PPMDLMRSEKMTFVQLIIPVESAHPAITYLGQLGLLQFRDLNADKSPFQRTFVNQVKRCA  67

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EM+RKLRFFKDQ+ KAG+  S    +Q  I+ ++LE++L + E ELIE+N N++KL++S+
Sbjct  68    EMSRKLRFFKDQIQKAGMLPSPRPASQPDIELEELEIQLAEHEHELIEMNGNSEKLRQSY  127

Query  2387  NELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesle-apllsePDMSADTSKQV  2211
             NEL+E+K+VLQK  +F  S+RS   AQ+ E   +    ++      L E +M  + S Q 
Sbjct  128   NELLEFKMVLQKASDFLISSRSHTTAQETELSENVYSNDNYTDTASLLEQEMQPELSNQS  187

Query  2210  RLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSG  2031
              + FISG++ K K + FER+LFRATRGN+L  Q   DE ++DP S E VEK VF+VF+SG
Sbjct  188   GVRFISGIICKCKVLQFERMLFRATRGNMLFHQGVADEEILDPSSNEMVEKIVFVVFFSG  247

Query  2030  ERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSI  1851
             E+A++KILKIC+AFGAN YP  E++ K+ Q+  EV  ++SEL+T +D G+ HR   L SI
Sbjct  248   EQARSKILKICEAFGANCYPVPEDMTKRRQITREVLSRLSELETTLDVGLRHRDKALTSI  307

Query  1850  AEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNS  1671
                  +W  +VRREK++Y TLNML+ DVTKKCLV EGW P  A I+IQ+ALQRA  DSNS
Sbjct  308   GFHLTKWMNMVRREKAVYDTLNMLNFDVTKKCLVGEGWCPIFAKIKIQEALQRATMDSNS  367

Query  1670  EIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVM  1491
             ++G IF V+   +SPPTYF+TN FT+A+QEIVDAYGVAKYQE NP V+TIVTFPFLFAVM
Sbjct  368   QVGIIFHVMDAVDSPPTYFRTNCFTNAYQEIVDAYGVAKYQEVNPAVYTIVTFPFLFAVM  427

Query  1490  FGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEF  1311
             FGDWGHGICLLL  L  + +E KLSSQKLG   EM FGGRYV+L+M++FSIY G IYNEF
Sbjct  428   FGDWGHGICLLLGALVLISKESKLSSQKLGSFMEMLFGGRYVLLLMSIFSIYCGLIYNEF  487

Query  1310  FSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKL  1131
             FSV F +FG SAY CRD SCSDA T+GLIK  D Y FGVDP+W G+RSELPFLNSLKMK+
Sbjct  488   FSVPFHIFGGSAYKCRDASCSDAQTVGLIKYSDPYPFGVDPSWRGSRSELPFLNSLKMKM  547

Query  1130  SILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQ  951
             SILLGV QMNLGIILSYFNA +F S ++   QF+PQ+IFLN+LFGYLS+L++VKWCTGSQ
Sbjct  548   SILLGVVQMNLGIILSYFNARFFNSSLDIKYQFVPQVIFLNSLFGYLSLLVVVKWCTGSQ  607

Query  950   ADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQHN-R  774
             ADLYHVMIYMFL P E LGENQLF GQ   Q++L+LLALV+VPWML PKPFILK  H  R
Sbjct  608   ADLYHVMIYMFLSPFEPLGENQLFWGQSVLQVILLLLALVAVPWMLFPKPFILKRLHTER  667

Query  773   HQGQSYAPIQDLDESLLvdgshdssdheef-efsevfvHQLIHTIEFVLGAVSNTASYLR  597
              QG +Y  +   +  +  +       H E   FSEVFVHQ+IH+IEFVLGAVSNTASYLR
Sbjct  668   FQGGTYGLLGTSEVDIYEEPDSARQHHHEEFNFSEVFVHQMIHSIEFVLGAVSNTASYLR  727

Query  596   LWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHAL  417
             LWALSLAHSELSTVFYEKVLLLAWGY++++I ++G  +F FAT  +LL+METLSAFLHAL
Sbjct  728   LWALSLAHSELSTVFYEKVLLLAWGYDSLVIRLIGLSVFAFATTFILLMMETLSAFLHAL  787

Query  416   RLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             RLHWVEFQNKFY GDGYKF+PFSF  + +++D
Sbjct  788   RLHWVEFQNKFYHGDGYKFNPFSFASLADDDD  819



>ref|XP_004487144.1| PREDICTED: vacuolar proton ATPase a1-like [Cicer arietinum]
Length=825

 Score =   983 bits (2542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 511/812 (63%), Positives = 629/812 (77%), Gaps = 3/812 (0%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             PPMDL RSE M  VQLIIP ESA  +++YLG+LGL+QF+DLNAEKSPFQRT+  Q+KR  
Sbjct  14    PPMDLMRSEKMTFVQLIIPAESAHRAISYLGELGLLQFRDLNAEKSPFQRTFVNQVKRCA  73

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EM+RKLRFFKDQ++KAG+ +S+ +  Q  I  +DLEV L + E ELIE+N+N+DKL++S+
Sbjct  74    EMSRKLRFFKDQINKAGLMSSSRTVLQPDIDLEDLEVHLAEHEHELIEMNSNSDKLRQSY  133

Query  2387  NELVEYKLVLQKVGEFFHSAR-ssaeaqqqeygssqsgeesleapllsePDMSADTSKQV  2211
             NEL+E+K+VLQK   F  S+       +++   +  S ++ +E   L E +M    S   
Sbjct  134   NELLEFKIVLQKACSFLISSHGRPVSDERELQENVYSNDDYIETASLLEQEMRPQPSNMS  193

Query  2210  RLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSG  2031
              L FISG++ K K + FER+LFRATRGN+L  Q+   E ++DPIS E +EK VF+VF+SG
Sbjct  194   GLRFISGIICKFKVLRFERMLFRATRGNMLFNQAPAGEQIMDPISSEMIEKTVFVVFFSG  253

Query  2030  ERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSI  1851
             E+A+ KILKIC+AFGAN YP  E++ KQ Q+  EV+ ++++L+  +DAGI HR   L SI
Sbjct  254   EQARTKILKICEAFGANCYPVPEDISKQGQITREVTSRLTDLEATLDAGIRHRNKALASI  313

Query  1850  AEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNS  1671
             A+   +W  LVRREK++Y TLNML+ DVTKKCLV EGW P  A  ++Q+ALQRA  DSNS
Sbjct  314   ADHLTKWMNLVRREKAVYDTLNMLNFDVTKKCLVGEGWCPMIAKTQMQEALQRATFDSNS  373

Query  1670  EIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVM  1491
             ++G IF  +   ESPPTYF+TN FT+ +QEIVDAYGVA+YQEANP V+T + FPFLFA+M
Sbjct  374   QVGIIFHQMDAVESPPTYFRTNTFTNPYQEIVDAYGVARYQEANPAVYTTIIFPFLFALM  433

Query  1490  FGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEF  1311
             FGDWGHGICLLL  L  + RE KLS+QKLG   EM FGGRYVIL+M+LFSIY G IYNEF
Sbjct  434   FGDWGHGICLLLGALVLIARENKLSTQKLGSFMEMLFGGRYVILLMSLFSIYCGLIYNEF  493

Query  1310  FSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKL  1131
             FSV F +FG SAY CRD SC DA TIGLIK R+ Y FGVDP+W G+RSEL FLNS+KMK+
Sbjct  494   FSVPFHIFGASAYQCRDSSCRDAYTIGLIKYREPYPFGVDPSWRGSRSELSFLNSMKMKM  553

Query  1130  SILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQ  951
             SIL GVA MNLGIILSYFNA +F S ++   QF+PQ+IFLN+LFGYLS+LIIVKWCTGSQ
Sbjct  554   SILFGVAHMNLGIILSYFNARFFGSSLDIRYQFVPQMIFLNSLFGYLSLLIIVKWCTGSQ  613

Query  950   ADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQHN-R  774
             ADLYHVMIYMFL PT+ LGENQLF GQ+  Q+VL+LLA+V+VPWML PKPFILK  H  R
Sbjct  614   ADLYHVMIYMFLSPTDSLGENQLFWGQRPLQIVLLLLAVVAVPWMLFPKPFILKKLHTER  673

Query  773   HQGQSYAPIQDLDESL-LvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLR  597
              QG++Y  +   +  L     S     HEEF FSEVFVHQ+IH+IEFVLG+VSNTASYLR
Sbjct  674   FQGRNYGILNTSEMDLEAEPDSARQHHHEEFNFSEVFVHQMIHSIEFVLGSVSNTASYLR  733

Query  596   LWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHAL  417
             LWALSLAHSELSTVFYEKVLLLAWGY+N++I +VG  +F FAT  +LL+ME+LSAFLHAL
Sbjct  734   LWALSLAHSELSTVFYEKVLLLAWGYDNLVIRLVGLTVFAFATAFILLMMESLSAFLHAL  793

Query  416   RLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             RLHWVEFQNKFY GDGYKF PFSF  + E++D
Sbjct  794   RLHWVEFQNKFYFGDGYKFKPFSFASLTEDDD  825



>ref|XP_010521779.1| PREDICTED: V-type proton ATPase subunit a1 [Tarenaya hassleriana]
Length=822

 Score =   982 bits (2539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 509/815 (62%), Positives = 631/815 (77%), Gaps = 9/815 (1%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             P MDL RSE M LVQLIIP+E+A  SV+YLG+LGL+QF+DLNA+KSPFQRT+A Q+KR G
Sbjct  9     PSMDLMRSEKMTLVQLIIPVEAAHRSVSYLGELGLLQFRDLNADKSPFQRTFANQVKRCG  68

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EM+RKLRFFKDQ+ KAG+      + +  I+  DLE +L D E EL+E+N+N++KL ++ 
Sbjct  69    EMSRKLRFFKDQIDKAGLRCLPGHELEPDIELKDLERRLADHEHELLEMNSNSEKLWQTH  128

Query  2387  NELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgee-sleapllsePDMSADTSKQV  2211
             NEL+E+K+VLQK G F  S+ +    ++ E           ++   L + +M +  S Q 
Sbjct  129   NELLEFKIVLQKAGSFLVSSNARVVGEETELHEHTFSNNGYVDNASLLDQEMRSRPSNQS  188

Query  2210  RLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSG  2031
              L FISG++ KEK + FER+LFRATRGN+L  Q+  DE ++DP + + VEK VF+VF+SG
Sbjct  189   GLSFISGIISKEKVLRFERMLFRATRGNMLFNQAPADEEIMDPATTQMVEKIVFVVFFSG  248

Query  2030  ERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSI  1851
             E+A+ KILKIC+AFGAN YP  E+  KQ QL  EV  ++S+L+  +DAG  HR N L S+
Sbjct  249   EQARTKILKICEAFGANCYPVPEDTTKQRQLTREVLSRLSDLEATLDAGTRHRNNALTSV  308

Query  1850  AEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNS  1671
                  +W  +VRREK++Y TLNML+ DVTKKCLV EGW PT A  +IQ+ LQRA  D NS
Sbjct  309   GYHLTKWMSMVRREKAVYDTLNMLNFDVTKKCLVGEGWCPTFAKTQIQEVLQRATFDINS  368

Query  1670  EIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVM  1491
             ++G IF V+   ESPPTYF+TNKFT+AFQEI+DAYGVA+YQEANP V++++T+PFLFAVM
Sbjct  369   QVGVIFHVMQAAESPPTYFRTNKFTNAFQEIIDAYGVARYQEANPAVYSVITYPFLFAVM  428

Query  1490  FGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEF  1311
             FGDWGHGICLLL  LY L RE+KLS+QKLG   EM FGGRYV+L+MALFSIY G IYNEF
Sbjct  429   FGDWGHGICLLLGALYLLARERKLSTQKLGSFMEMLFGGRYVLLLMALFSIYCGLIYNEF  488

Query  1310  FSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKL  1131
             FSV F +FG SAY CRD +CSDA T+GL+K  +TY FGVDP+W G+RSELPFLNSLKMK+
Sbjct  489   FSVPFHIFGGSAYKCRDTTCSDAHTVGLVKYHNTYPFGVDPSWRGSRSELPFLNSLKMKM  548

Query  1130  SILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQ  951
             SILLG++QMNLGIILS+FNA +F S ++   QF+PQ+IFLN LFGYLS+LIIVKWCTGSQ
Sbjct  549   SILLGISQMNLGIILSFFNARFFGSSLDIRYQFVPQMIFLNGLFGYLSLLIIVKWCTGSQ  608

Query  950   ADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQH-NR  774
             ADLYHVMIYMFL PT+DLGENQLF GQ+  Q+VL++LAL++VPWML PKPF L++ +  R
Sbjct  609   ADLYHVMIYMFLSPTDDLGENQLFWGQRPLQIVLLILALIAVPWMLFPKPFALRNMYMER  668

Query  773   HQGQSYAPI----QDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTAS  606
              QG+SY  +     DLD   +         HEEF FSE+FVHQLIH+IEFVLG+VSNTAS
Sbjct  669   FQGRSYGLLGTSEADLD---VESDPARDHHHEEFNFSEIFVHQLIHSIEFVLGSVSNTAS  725

Query  605   YLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFL  426
             YLRLWALSLAHSELSTVFYEKVLLLAWGY+N+ I ++G  +F FAT  +LL+METLSAFL
Sbjct  726   YLRLWALSLAHSELSTVFYEKVLLLAWGYDNVFIRLIGLAVFAFATAFILLMMETLSAFL  785

Query  425   HALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             HALRLHWVEF NKFY GDGYKF PFSF L+ +  D
Sbjct  786   HALRLHWVEFMNKFYSGDGYKFRPFSFALISDNND  820



>ref|XP_007150235.1| hypothetical protein PHAVU_005G137800g [Phaseolus vulgaris]
 ref|XP_007150236.1| hypothetical protein PHAVU_005G137800g [Phaseolus vulgaris]
 gb|ESW22229.1| hypothetical protein PHAVU_005G137800g [Phaseolus vulgaris]
 gb|ESW22230.1| hypothetical protein PHAVU_005G137800g [Phaseolus vulgaris]
Length=820

 Score =   982 bits (2538),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 506/812 (62%), Positives = 633/812 (78%), Gaps = 3/812 (0%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             P MDL RSE M  VQLIIP+ESA  +++YLG+LGL+QF+DLNA+KSPFQRT+  Q+KR  
Sbjct  9     PSMDLMRSEKMTFVQLIIPVESAHRAISYLGELGLLQFRDLNADKSPFQRTFVNQVKRCA  68

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EM+RKLRFFKDQ+SKAG+ +S+ +  +  I  +DLE++L + E ELIE+N+N+DKL++S+
Sbjct  69    EMSRKLRFFKDQISKAGLLSSSRTVLEPDIDLEDLEMQLAEHEHELIEMNSNSDKLRQSY  128

Query  2387  NELVEYKLVLQKVGEFFHSARssaeaqqqeygssq-sgeesleapllsePDMSADTSKQV  2211
             NEL+E+K+VLQ+   F  S+ + A + ++E   +  S +  +E   L E +M   +S   
Sbjct  129   NELLEFKIVLQQACGFLVSSHNLALSDERELQENVFSNDAYVETASLLEQEMRPQSSNPS  188

Query  2210  RLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSG  2031
              L FISG++ K K + FER+LFRATRGN+L  Q+  DE ++DP+S E +EK VF+VF+SG
Sbjct  189   GLRFISGIICKSKVLRFERMLFRATRGNMLFNQAPADEEIMDPVSTEMIEKTVFVVFFSG  248

Query  2030  ERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSI  1851
             E+A+ KILKIC+AF AN YP  E++ KQ Q+  EVS ++++L+  ++AGI HR   L S+
Sbjct  249   EQARTKILKICEAFSANCYPVPEDISKQRQITREVSSRLTDLEATLEAGIRHRNKALASV  308

Query  1850  AEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNS  1671
              +   +W  +VRREK++Y TLNML+ DVTKKCLV EGW P  A  ++Q+ALQRA  DSNS
Sbjct  309   VDHLAKWMNMVRREKAVYDTLNMLNFDVTKKCLVGEGWCPLLAKTQMQEALQRATFDSNS  368

Query  1670  EIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVM  1491
             ++G IF  L   ESPPTYF+TN FT+ +QEIVDAYGVA+YQEANP V+T + FPFLFA+M
Sbjct  369   QVGIIFHPLEAVESPPTYFRTNTFTNPYQEIVDAYGVARYQEANPAVYTTIIFPFLFALM  428

Query  1490  FGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEF  1311
             FGDWGHGICLLL  L  + RE KLS+QKLG   EM FGGRYV+L+MALFSIY G IYNEF
Sbjct  429   FGDWGHGICLLLGALVLIARENKLSTQKLGSFMEMLFGGRYVLLLMALFSIYCGLIYNEF  488

Query  1310  FSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKL  1131
             FSV F +FG SAY CRD SC DA TIGL+K +D Y FGVDP+W G+RSELPFLNSLKMK+
Sbjct  489   FSVPFHIFGASAYKCRDSSCRDAHTIGLVKYQDPYPFGVDPSWRGSRSELPFLNSLKMKM  548

Query  1130  SILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQ  951
             SIL GVA MNLGIILSYFNA +F S ++   QF+PQIIFLN+LFGYLS+LII+KWCTGSQ
Sbjct  549   SILFGVAHMNLGIILSYFNARFFGSSLDIRYQFVPQIIFLNSLFGYLSLLIIIKWCTGSQ  608

Query  950   ADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQHN-R  774
             ADLYHVMIYMFL PT++LGENQLF GQK  Q+VL+LLA+++VPWML PKPFILK  H  R
Sbjct  609   ADLYHVMIYMFLSPTDNLGENQLFWGQKPLQIVLLLLAVIAVPWMLFPKPFILKKLHTER  668

Query  773   HQGQSYAPIQDLDESL-LvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLR  597
              QG++Y  +   +  +     S     HEEF FSEVFVHQ+IH IEFVLG+VSNTASYLR
Sbjct  669   FQGRNYGLLNTSEVDIEAEPDSARQHHHEEFNFSEVFVHQMIHAIEFVLGSVSNTASYLR  728

Query  596   LWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHAL  417
             LWALSLAHSELSTVFYEKVLLLAWGY+N++I +VG  +F FAT  +LL+ME+LSAFLHAL
Sbjct  729   LWALSLAHSELSTVFYEKVLLLAWGYDNLVIRLVGLTVFSFATAFILLMMESLSAFLHAL  788

Query  416   RLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             RLHWVEFQNKFY GDGYKF PFSF  + E++D
Sbjct  789   RLHWVEFQNKFYHGDGYKFRPFSFASLTEDDD  820



>ref|XP_010664757.1| PREDICTED: V-type proton ATPase subunit a3-like isoform X2 [Vitis 
vinifera]
Length=663

 Score =   981 bits (2537),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 486/655 (74%), Positives = 567/655 (87%), Gaps = 0/655 (0%)
 Frame = -2

Query  2741  MDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSGEM  2562
             MDL RSEPMQLVQLIIP+E+A  +++YLGDLGL QFKDLNAEKSPFQRTYA QIKR GEM
Sbjct  1     MDLLRSEPMQLVQLIIPVEAAYRTISYLGDLGLFQFKDLNAEKSPFQRTYATQIKRCGEM  60

Query  2561  ARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSFNE  2382
             ARKLRFFK+QM+KAG+S S  S  +     DDLEV+L + EAEL EI ANN+KLQR+++E
Sbjct  61    ARKLRFFKEQMTKAGLSPSTRSVARADFNLDDLEVQLAEFEAELTEIKANNEKLQRAYSE  120

Query  2381  LVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTSKQVRLG  2202
             LVEYKLVLQK GEFF+SA+++A A Q+E  +   GE S+++PLL E ++  D SKQV+LG
Sbjct  121   LVEYKLVLQKAGEFFYSAQNTAVAWQREVEAHHIGEGSIDSPLLLEQEILTDPSKQVKLG  180

Query  2201  FISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSGERA  2022
             F+SGLVP+EKSMAFERILFRATRGNV L+Q+ V++ VIDP+ GEK+EKNVF++F+SGER 
Sbjct  181   FVSGLVPREKSMAFERILFRATRGNVFLKQALVEDCVIDPVLGEKIEKNVFVIFFSGERV  240

Query  2021  KNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSIAEQ  1842
             KNKILKICDAFGANRYPF ++LGKQ Q+ITEVS ++ ELKT +DAG+LH  NLLQ+I  Q
Sbjct  241   KNKILKICDAFGANRYPFMDDLGKQYQMITEVSRRLLELKTTVDAGLLHWSNLLQTIGHQ  300

Query  1841  FDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNSEIG  1662
             F++WN LV++EKSIYHTLNMLSIDVTKKCLVAEGW P  AT +IQ+AL++A  DSNS++G
Sbjct  301   FEQWNHLVKKEKSIYHTLNMLSIDVTKKCLVAEGWCPVFATNQIQNALKQATFDSNSQLG  360

Query  1661  AIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGD  1482
             AIF+VL T+ESPPTYF+TNKFT  FQEIVDAYGVAKYQE NPGV+ I+TFPFLFAVMFGD
Sbjct  361   AIFQVLHTKESPPTYFRTNKFTLPFQEIVDAYGVAKYQEVNPGVYVIITFPFLFAVMFGD  420

Query  1481  WGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEFFSV  1302
             WGHGICLLLATLYF+++EKK SSQKLGDI EMTFGGRYVI+MMALFSIYTG IYNEFFSV
Sbjct  421   WGHGICLLLATLYFIVKEKKFSSQKLGDIMEMTFGGRYVIMMMALFSIYTGLIYNEFFSV  480

Query  1301  QFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKLSIL  1122
              FELFG SAY C DPSC  A+ +GLI+ R TY FGVDP WHG+RSELPFLNSLKMK+SIL
Sbjct  481   PFELFGPSAYECPDPSCRGASIVGLIRVRPTYPFGVDPKWHGSRSELPFLNSLKMKMSIL  540

Query  1121  LGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQADL  942
             LGVAQMNLGIIL YFNA +F + +N W QF+PQ+IFLN+LFGYLS+LIIVKWC GSQADL
Sbjct  541   LGVAQMNLGIILGYFNATFFGNNLNIWYQFVPQMIFLNSLFGYLSLLIIVKWCMGSQADL  600

Query  941   YHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQHN  777
             YHVMIYMFL PT+DLGENQLF GQK  QLVL+LLALVS+PWML PKPF+LK QH 
Sbjct  601   YHVMIYMFLSPTDDLGENQLFVGQKMLQLVLLLLALVSIPWMLFPKPFLLKKQHQ  655



>ref|XP_003538035.1| PREDICTED: vacuolar proton ATPase a1-like [Glycine max]
Length=818

 Score =   980 bits (2533),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 509/811 (63%), Positives = 632/811 (78%), Gaps = 3/811 (0%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             PPMDL RSE M  VQLIIP ESA  ++ YLG+LGL+QF+DLNAEKSPFQRT+  Q+KR  
Sbjct  9     PPMDLMRSEAMTFVQLIIPAESAHRAITYLGELGLLQFRDLNAEKSPFQRTFVNQVKRCA  68

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EM+RKLRFFKDQ++KAG+ +S  S  Q  I  +DLE++L + E ELIE+N+N++KLQ+S+
Sbjct  69    EMSRKLRFFKDQINKAGLMSSP-SVLQSDIYLEDLEIQLAEHEHELIEMNSNSEKLQQSY  127

Query  2387  NELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsge-esleapllsePDMSADTSKQV  2211
             NEL+E+K+VLQK   F  S+R +A +++ E   +     + +E P L E +M    S Q 
Sbjct  128   NELLEFKIVLQKACRFLVSSRGNACSEETELEENVFSNGDYIETPFLFEQEMRPAPSNQS  187

Query  2210  RLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSG  2031
              L FISG++ K K + FER+LFRATRGN+L   +  DE ++DPIS E VEK VF+VF+SG
Sbjct  188   GLRFISGMICKSKVLRFERMLFRATRGNMLFNHAPADEQIMDPISTEMVEKIVFVVFFSG  247

Query  2030  ERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSI  1851
             E+A+ KILKICDAFGAN YP  E+  KQ Q+ +EVS ++++L+  +DAGI  R   L S+
Sbjct  248   EQARTKILKICDAFGANCYPVPEDTNKQRQITSEVSSRLADLEATLDAGIRLRNKALASV  307

Query  1850  AEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNS  1671
                  +W  +VRREK++Y TLNML+ DVTKKCLV EGW P  A  +IQ+AL+RA  DS+S
Sbjct  308   GGHLTKWMDMVRREKAVYDTLNMLNFDVTKKCLVGEGWCPIFAKTQIQEALERATFDSSS  367

Query  1670  EIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVM  1491
             ++G IF  +   ESPPTYF+TN FTS +QEIVDAYGVA+YQEANP V+T + FPFLFAVM
Sbjct  368   QVGIIFHSMDALESPPTYFRTNSFTSPYQEIVDAYGVARYQEANPAVYTTIIFPFLFAVM  427

Query  1490  FGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEF  1311
             FGDWGHGICLLL  L  + R+ KLS+Q+LG   EM FGGRYV+L+M+LFSIY G IYNEF
Sbjct  428   FGDWGHGICLLLGALVLIARQSKLSTQRLGSFMEMLFGGRYVLLLMSLFSIYCGLIYNEF  487

Query  1310  FSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKL  1131
             FSV + +FG SAY C+D SC DA TIGL+K R+ Y FGVDP+W G+RSELPFLNSLKMK+
Sbjct  488   FSVPYHIFGASAYKCQDSSCRDAHTIGLVKYREPYPFGVDPSWRGSRSELPFLNSLKMKM  547

Query  1130  SILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQ  951
             SILLGV  MNLGI+LSYFNA +F + ++   QF+PQIIFLN LFGYLS+LI+VKWCTGSQ
Sbjct  548   SILLGVVHMNLGILLSYFNARFFGNSLDIRYQFVPQIIFLNCLFGYLSLLIVVKWCTGSQ  607

Query  950   ADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQHN-R  774
             ADLYHVMIYMFL P ++LGENQLF GQ+  Q+VL+LLA+++VPWML PKPFILK  +N R
Sbjct  608   ADLYHVMIYMFLSPFDNLGENQLFWGQRPLQVVLLLLAVIAVPWMLFPKPFILKKLYNER  667

Query  773   HQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLRL  594
              QG++Y  +   +  L ++       HEEF FSEVFVHQ+IH+IEFVLG+VSNTASYLRL
Sbjct  668   FQGRTYGVLNTSEVDLELEPDSARQYHEEFNFSEVFVHQMIHSIEFVLGSVSNTASYLRL  727

Query  593   WALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHALR  414
             WALSLAHSELSTVFYEKVLLLAWGY+N++I +VG  +F FAT  +LL+METLSAFLHALR
Sbjct  728   WALSLAHSELSTVFYEKVLLLAWGYDNLVIRLVGLAVFAFATAFILLMMETLSAFLHALR  787

Query  413   LHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             LHWVEFQNKFY GDGYKF PFSFV + EEE+
Sbjct  788   LHWVEFQNKFYSGDGYKFKPFSFVSLTEEEN  818



>ref|XP_002532256.1| vacuolar proton atpase, putative [Ricinus communis]
 gb|EEF30122.1| vacuolar proton atpase, putative [Ricinus communis]
Length=822

 Score =   979 bits (2531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 509/811 (63%), Positives = 635/811 (78%), Gaps = 2/811 (0%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             P MDL RSE M  VQLIIP+ESA  +++YLG+LGL+QF+DLNA+KSPFQRT+  Q+KR G
Sbjct  12    PAMDLMRSEKMTFVQLIIPVESAHRAISYLGELGLLQFRDLNADKSPFQRTFVNQVKRCG  71

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EM+RKLRFFKDQ++KAG+ +S     +  ++ ++LE++L + E EL+E+N+N +KLQRS+
Sbjct  72    EMSRKLRFFKDQINKAGLLSSTLPVVEPDVELEELELQLAEHEHELMEMNSNGEKLQRSY  131

Query  2387  NELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesl-eapllsePDMSADTSKQV  2211
             NEL+E+K+VLQK   F  S+ S A A+ +E   +        +   L E ++ +  S Q 
Sbjct  132   NELLEFKMVLQKAVAFLVSSNSHAVAEDRELNENVYSNNDYGDTASLLEQELRSAPSNQS  191

Query  2210  RLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSG  2031
              L FISG++P+ K + FER+LFRATRGN+L  Q+  DE ++DP+S E VEK VF+VF+SG
Sbjct  192   GLRFISGIIPRSKVLRFERMLFRATRGNMLFNQAPADEEIMDPVSAEMVEKTVFVVFFSG  251

Query  2030  ERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSI  1851
             E+A+ KILKIC+AFGAN YP  E++ KQ Q+  EV  ++SEL+  +DAG  HR   L SI
Sbjct  252   EQARTKILKICEAFGANCYPVTEDITKQRQITREVLSRLSELEATLDAGNRHRNKALASI  311

Query  1850  AEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNS  1671
                  +W  +VRREK++Y TLNML+ DVTKKCLV EGW P  A  +IQ+ALQRA  DSNS
Sbjct  312   GFHLTKWMKVVRREKAVYDTLNMLNFDVTKKCLVGEGWCPMFAKAQIQEALQRATFDSNS  371

Query  1670  EIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVM  1491
             ++G IF V    ESPPTYF+TN+FT+AFQEIVDAYGVA+YQEANP V+T++TFPFLFAVM
Sbjct  372   QVGIIFHVTEALESPPTYFRTNRFTNAFQEIVDAYGVARYQEANPAVYTVITFPFLFAVM  431

Query  1490  FGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEF  1311
             FGDWGHGICLL+  L  + RE KL SQKLG   EM FGGRYV+L+MA FSIY G IYNEF
Sbjct  432   FGDWGHGICLLIGALVLIARESKLGSQKLGSFMEMLFGGRYVLLLMAFFSIYCGLIYNEF  491

Query  1310  FSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKL  1131
             FSV F +FG SAY CRD +CSDA T+GLIK +D Y FGVDP+W G+RSELPFLNSLKMK+
Sbjct  492   FSVPFHIFGGSAYRCRDTTCSDAHTVGLIKYQDPYPFGVDPSWRGSRSELPFLNSLKMKM  551

Query  1130  SILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQ  951
             SILLGVAQMN+GI+LSYFNA +F S ++   QF+PQIIFLN LFGYLS+LII+KWC+GSQ
Sbjct  552   SILLGVAQMNVGILLSYFNARFFGSSLDIRYQFVPQIIFLNCLFGYLSLLIIIKWCSGSQ  611

Query  950   ADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQHN-R  774
             ADLYHVMIYMFL PT+DLGENQLF GQ+  Q++L+LLA+V+VPWML PKPFILK  +  R
Sbjct  612   ADLYHVMIYMFLSPTDDLGENQLFWGQRPLQIILLLLAVVAVPWMLFPKPFILKKLNTER  671

Query  773   HQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLRL  594
              QG++Y  +   +  L ++     S H++F FSEVFVHQ+IH+IEFVLGAVSNTASYLRL
Sbjct  672   FQGRTYGLLGTSEVDLDMEPGSARSHHDDFNFSEVFVHQMIHSIEFVLGAVSNTASYLRL  731

Query  593   WALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHALR  414
             WALSLAHSELSTVFYEKVLLLAWGY+ + + +VG  +F FAT  +LL+METLSAFLHALR
Sbjct  732   WALSLAHSELSTVFYEKVLLLAWGYDILAVRLVGLAVFAFATAFILLMMETLSAFLHALR  791

Query  413   LHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             LHWVEFQNKFY GDGYKF PFSF ++ ++ED
Sbjct  792   LHWVEFQNKFYYGDGYKFKPFSFSMITDDED  822



>ref|XP_007132168.1| hypothetical protein PHAVU_011G071600g [Phaseolus vulgaris]
 gb|ESW04162.1| hypothetical protein PHAVU_011G071600g [Phaseolus vulgaris]
Length=818

 Score =   979 bits (2531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 500/811 (62%), Positives = 628/811 (77%), Gaps = 3/811 (0%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             PPMDL RSE M  VQLIIP ES+  ++ YLG+LGLIQF+DLNAEKSPFQRT+  Q+KR  
Sbjct  9     PPMDLMRSEKMTFVQLIIPAESSHRAITYLGELGLIQFRDLNAEKSPFQRTFVNQVKRCA  68

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EM+RKLRFFKDQ++KAG+ +S  S  Q  I  +DLE++L + E ELIE+N+N++KL++S+
Sbjct  69    EMSRKLRFFKDQINKAGLMSSP-SVLQSDIHLEDLEIQLAEHEYELIEMNSNSEKLRKSY  127

Query  2387  NELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsge-esleapllsePDMSADTSKQV  2211
             NEL+E+K+VL+K   F  S+R +   +++E   +       +E P L E +++   S Q 
Sbjct  128   NELLEFKIVLEKACSFLVSSRGAVVPEERELEENVFSHGNYVETPFLFEQEITPAPSNQS  187

Query  2210  RLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSG  2031
              L FISG++ K K + FER+LFRATRGN+L  Q+  DE +IDPIS E VEK VF+VF+SG
Sbjct  188   GLRFISGIICKSKVLRFERMLFRATRGNMLFNQAPADEHIIDPISTEMVEKTVFVVFFSG  247

Query  2030  ERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSI  1851
             E+A+ KILKICDAFGAN YP  E++ KQ Q+ +EVS ++++L+  ++AGI HR   L S+
Sbjct  248   EQARIKILKICDAFGANCYPVPEDISKQRQITSEVSARLADLEATLEAGIRHRNKALASV  307

Query  1850  AEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNS  1671
                   W  +V+REKS+Y TLNML+ DVTKKCLV EGW P  A  +IQ+ALQRA  DSNS
Sbjct  308   GGPLTIWMDMVKREKSVYDTLNMLNFDVTKKCLVGEGWCPVFAKTQIQEALQRATFDSNS  367

Query  1670  EIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVM  1491
             E+G IF  +   ESPPTYF+TN FT  +QEIVDAYGVA+YQEANP V+T + FPFLFAVM
Sbjct  368   EVGIIFHSMDALESPPTYFRTNSFTGPYQEIVDAYGVARYQEANPAVYTTIIFPFLFAVM  427

Query  1490  FGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEF  1311
             FGDWGHGICLLL  L  + RE KLS+Q+LG   EM FGGRYV+L+M+LFSIY G IYNEF
Sbjct  428   FGDWGHGICLLLGALVLIARENKLSTQRLGSFMEMLFGGRYVLLLMSLFSIYCGLIYNEF  487

Query  1310  FSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKL  1131
             FSV + +FG SAY CRD +C DA T GL+K R+ Y FGVDP+W G+RSELPFLNSLKMK+
Sbjct  488   FSVPYHIFGASAYKCRDNTCRDAHTTGLVKYREPYPFGVDPSWRGSRSELPFLNSLKMKM  547

Query  1130  SILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQ  951
             SIL GV  MNLGIILSYFNAH+F S ++   QF+PQ+IFLN LFGYLS+LIIVKWCTGSQ
Sbjct  548   SILFGVVHMNLGIILSYFNAHFFGSLLDIRYQFVPQMIFLNCLFGYLSLLIIVKWCTGSQ  607

Query  950   ADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQHN-R  774
             ADLYHVMIYMFL P E+LG+NQLF GQ+  Q++L+LL++++VPWML PKPF+LK  HN R
Sbjct  608   ADLYHVMIYMFLSPFENLGDNQLFWGQRPLQVLLLLLSVIAVPWMLFPKPFMLKKLHNER  667

Query  773   HQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLRL  594
              QG++Y  +   +  L ++        ++F F+EVFVHQ+IH+IEFVLG+VSNTASYLRL
Sbjct  668   FQGRTYGVLHTSEVDLELEPGSARQHDDDFNFTEVFVHQMIHSIEFVLGSVSNTASYLRL  727

Query  593   WALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHALR  414
             WALSLAHSELSTVFYEKVLLLAWGY+N+++ +VG  +F FAT  +LL+ME+LSAFLHALR
Sbjct  728   WALSLAHSELSTVFYEKVLLLAWGYDNLVVRLVGLAVFSFATAFILLMMESLSAFLHALR  787

Query  413   LHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             LHWVEFQNKFY GDG KF PFSF  + E+E+
Sbjct  788   LHWVEFQNKFYHGDGCKFRPFSFASLTEDEN  818



>ref|XP_009606445.1| PREDICTED: V-type proton ATPase subunit a1-like isoform X1 [Nicotiana 
tomentosiformis]
Length=817

 Score =   979 bits (2530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 509/810 (63%), Positives = 629/810 (78%), Gaps = 1/810 (0%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             PPMDL RSE M  VQLIIP ESA  +V YLG LGL+QF+DLNAEKSPFQRT+  Q+KR  
Sbjct  8     PPMDLMRSEKMTFVQLIIPFESAHRAVTYLGQLGLLQFRDLNAEKSPFQRTFVNQVKRCA  67

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EM+RKLR+FKDQ+ KAG+       +Q  I+ ++LE++L + E ELIE+NAN++KL++S+
Sbjct  68    EMSRKLRYFKDQIHKAGLLPPPLPASQPDIELEELEIQLAEHEHELIEMNANSEKLRQSY  127

Query  2387  NELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTSKQVR  2208
             NEL+E+K+VLQK   F  S+  + + + +   +  S +   +   L E +M ++ S Q  
Sbjct  128   NELLEFKMVLQKASGFLVSSSHTTDQETELDENVYSNDNHADTASLLEQEMRSELSNQSG  187

Query  2207  LGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSGE  2028
             + FISG++ K K + FER+LFRATRGN+L  Q+  D+ ++DP S E VEK VF+VF+SGE
Sbjct  188   VRFISGIICKSKVVQFERMLFRATRGNMLFNQAVADDEILDPSSNEMVEKVVFVVFFSGE  247

Query  2027  RAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSIA  1848
             +A+ KILKIC+AFGAN YP  E+  K+ Q+  EV  ++SEL+T +DAG+ HR   L SI 
Sbjct  248   QARTKILKICEAFGANCYPVPEDTTKRRQITQEVLSRLSELETTLDAGLRHRDKALTSIG  307

Query  1847  EQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNSE  1668
                 +W  + + +K++Y TLNML+ DVTKKCLV EGW P  A  +IQ+ALQRA  DS+S+
Sbjct  308   YHLTKWINMAKTQKAVYDTLNMLNFDVTKKCLVGEGWCPIFAKTKIQEALQRATFDSSSQ  367

Query  1667  IGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMF  1488
             +G IF V+   ESPPTYF+TN FT+AFQEIVDAYGVAKYQEANP V+TIVTFPFLFAVMF
Sbjct  368   VGIIFHVMDAVESPPTYFRTNSFTNAFQEIVDAYGVAKYQEANPAVYTIVTFPFLFAVMF  427

Query  1487  GDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEFF  1308
             GDWGHGICLLL  L  + RE KLSSQKLG   EM FGGRYV+++M++FSIY G +YNEFF
Sbjct  428   GDWGHGICLLLGALVLIARESKLSSQKLGSFMEMLFGGRYVLVLMSIFSIYCGLLYNEFF  487

Query  1307  SVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKLS  1128
             SV F +FG SAY CRD +CSDA T+GL+K +D Y FGVDP+W G+RSELPFLNSLKMK+S
Sbjct  488   SVPFHIFGESAYKCRDATCSDARTVGLVKYKDPYPFGVDPSWRGSRSELPFLNSLKMKMS  547

Query  1127  ILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQA  948
             ILLGVAQMNLGIILSYFNAH+F S ++   QFIPQ+IFLN+LFGYLS+LI+VKWCTGSQA
Sbjct  548   ILLGVAQMNLGIILSYFNAHFFSSSIDIKYQFIPQVIFLNSLFGYLSLLILVKWCTGSQA  607

Query  947   DLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQH-NRH  771
             DLYHVMIYMFL P E LGEN+LF GQ   Q++L+LLALV+VPWML PKPFILK  H  R 
Sbjct  608   DLYHVMIYMFLSPFEALGENRLFWGQSVLQVILLLLALVAVPWMLFPKPFILKRLHMERF  667

Query  770   QGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLRLW  591
             QG++Y  +   +  +  +        EEF FSEVFVHQ+IH+IEFVLGAVSNTASYLRLW
Sbjct  668   QGRTYGILGTSEMGIDEEPGSARQHAEEFNFSEVFVHQMIHSIEFVLGAVSNTASYLRLW  727

Query  590   ALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHALRL  411
             ALSLAHSELSTVFYEKVLLLAWGY+NI+I +VG  +F FAT  +LL+METLSAFLHALRL
Sbjct  728   ALSLAHSELSTVFYEKVLLLAWGYDNIVIRLVGLAVFAFATTFILLMMETLSAFLHALRL  787

Query  410   HWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             HWVEFQNKFY GDGYKF PFSF L+ +++D
Sbjct  788   HWVEFQNKFYHGDGYKFKPFSFALLADDDD  817



>ref|XP_010253515.1| PREDICTED: V-type proton ATPase subunit a1-like [Nelumbo nucifera]
Length=818

 Score =   978 bits (2528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 502/811 (62%), Positives = 632/811 (78%), Gaps = 2/811 (0%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             PPMD  RSE M  VQLIIP+ESA  +V+Y+G+LGL+QFKDLNA+KSPFQRT+  Q+KR G
Sbjct  8     PPMDFLRSEKMIFVQLIIPVESAHRAVSYIGELGLLQFKDLNADKSPFQRTFVNQVKRCG  67

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EM+RKLRFFKDQ++KAG+        Q  I  ++LE++L + E ELIE+NAN++KL++S+
Sbjct  68    EMSRKLRFFKDQITKAGIVLPVRPAPQPDIDLEELEIQLAEHEHELIEMNANSEKLRQSY  127

Query  2387  NELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesle-apllsePDMSADTSKQV  2211
             +EL+E+K+VLQK G F  SA+S   AQ++E   +   ++       L E +M    S Q 
Sbjct  128   SELLEFKMVLQKAGGFLVSAQSHTVAQERELDENIYSKDDYADRASLLEQEMRPGPSNQA  187

Query  2210  RLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSG  2031
              L FISG++   K + FER+LFRATRGN+L  Q+  ++  IDP+S E VE+ VF+VF+SG
Sbjct  188   GLRFISGIICTSKILRFERMLFRATRGNMLFNQAPSEKYAIDPMSTEMVERTVFVVFFSG  247

Query  2030  ERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSI  1851
             ++AK KI++IC+AFGAN YP  E++ KQ Q+  EV  ++SEL+T +DAG+ HR   L SI
Sbjct  248   QQAKTKIMRICEAFGANCYPVPEDITKQRQITQEVLSRLSELETTLDAGLRHRNKALTSI  307

Query  1850  AEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNS  1671
                  +W ++VR+EK++Y TLNML+ DVTKKCLV EGW P  +  +I + LQRA  DSNS
Sbjct  308   GFHLRKWTIMVRKEKAVYDTLNMLNFDVTKKCLVGEGWCPIFSKPQIHNVLQRATLDSNS  367

Query  1670  EIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVM  1491
             ++G IF V+   ESPPTYF+TN FT+AFQEIVDAYGVA+YQEANP V+T++TFPFLFAVM
Sbjct  368   QVGIIFHVMDAVESPPTYFRTNCFTNAFQEIVDAYGVARYQEANPAVYTVITFPFLFAVM  427

Query  1490  FGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEF  1311
             FGDWGHGICLLL  +  + RE KL SQKLG   EM FGGRYVIL+M+LFSIY G IYNEF
Sbjct  428   FGDWGHGICLLLGAIILIARENKLGSQKLGSFMEMAFGGRYVILLMSLFSIYCGLIYNEF  487

Query  1310  FSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKL  1131
             FSV + +FG +AY CRD +C DA T GL+K RD Y FGVDP+W G+RSELPFLNSLKMK+
Sbjct  488   FSVPYHIFGGTAYKCRDTTCRDAHTAGLVKYRDPYPFGVDPSWRGSRSELPFLNSLKMKM  547

Query  1130  SILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQ  951
             SILLGV+QMNLGIILSYFNA +F S ++   QF+PQ+IFLN+LFGYLS+LI++KW TGSQ
Sbjct  548   SILLGVSQMNLGIILSYFNARFFGSSLDIRYQFVPQMIFLNSLFGYLSLLIVIKWYTGSQ  607

Query  950   ADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQH-NR  774
             ADLYHVMIYMFL PT++LGENQLF GQ+  Q++L+LLA+V+VPWMLLPKPFIL+ QH  R
Sbjct  608   ADLYHVMIYMFLSPTDNLGENQLFWGQRPLQILLLLLAIVAVPWMLLPKPFILRKQHLER  667

Query  773   HQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLRL  594
              QG++Y  +   +     +        EEF FSEVFVHQ+IH+IEFVLGAVSNTASYLRL
Sbjct  668   FQGRTYRMLGTSEMDPDGEPDSARQHLEEFNFSEVFVHQMIHSIEFVLGAVSNTASYLRL  727

Query  593   WALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHALR  414
             WALSLAHSELSTVFYEKVLLLAWGY+NI+I ++G ++F FAT  +LL+METLSAFLHALR
Sbjct  728   WALSLAHSELSTVFYEKVLLLAWGYDNILIRLIGLVVFAFATAFILLMMETLSAFLHALR  787

Query  413   LHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             LHWVEFQ+KFY GDGYKF PFSF  + +++D
Sbjct  788   LHWVEFQSKFYHGDGYKFKPFSFASLPDDDD  818



>ref|XP_010542602.1| PREDICTED: V-type proton ATPase subunit a1 [Tarenaya hassleriana]
Length=821

 Score =   978 bits (2527),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 508/815 (62%), Positives = 633/815 (78%), Gaps = 9/815 (1%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             P MDL RSE M LVQLIIP+ESA  SV+YLG+LGL+QF+DLNA+KSPFQRT+A Q+KR G
Sbjct  9     PSMDLMRSEKMTLVQLIIPVESAHRSVSYLGELGLLQFRDLNADKSPFQRTFANQVKRCG  68

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EM+RKLRFFKDQ+ K+ +      + +  I+ +DLE +L D E EL+E+N+N++KL++++
Sbjct  69    EMSRKLRFFKDQIDKSDLRLLPGHELEPDIELEDLERQLADHEHELLEMNSNSEKLRQTY  128

Query  2387  NELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgee-sleapllsePDMSADTSKQV  2211
             NEL+E+K+VLQK G F  S    A   + E   +        +   L E +M +  + Q 
Sbjct  129   NELLEFKIVLQKAGSFLVSGNVHAAGDETELHENTFSNNGYADTASLLEQEMRSGPANQS  188

Query  2210  RLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSG  2031
              L FISG++ +EK + FER+LFRATRGN+L  Q+  DE ++DP + + VEK VF+VF+SG
Sbjct  189   GLRFISGIISQEKILRFERMLFRATRGNMLFNQAPADEEIMDPATTQMVEKIVFVVFFSG  248

Query  2030  ERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSI  1851
             E+A+ KILKIC+AFGAN YP  E+  KQ QL  EV  ++S+L+  +DAG  HR N L ++
Sbjct  249   EQARTKILKICEAFGANCYPVPEDTTKQRQLTREVLSRLSDLEATLDAGTRHRNNALTTV  308

Query  1850  AEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNS  1671
               +  +W  +VRREK++Y TLNML+ DVTKKCLV EGW PT A  +IQ+ LQRA  DSNS
Sbjct  309   GLRLTKWMNMVRREKAVYDTLNMLNFDVTKKCLVGEGWCPTFAKTQIQEVLQRATFDSNS  368

Query  1670  EIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVM  1491
             ++G IF V+   ESPPTYF+TNKFT+AFQEI+DAYGVA+YQEANP V+++VT+PFLFAVM
Sbjct  369   QVGVIFHVMQAAESPPTYFRTNKFTNAFQEIIDAYGVARYQEANPAVYSVVTYPFLFAVM  428

Query  1490  FGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEF  1311
             FGDWGHGICLLL  LY L RE+KL +QKLG   EM FGGRYV+L+M+LFSIY G IYNEF
Sbjct  429   FGDWGHGICLLLGALYLLARERKLRTQKLGSFMEMLFGGRYVLLLMSLFSIYCGLIYNEF  488

Query  1310  FSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKL  1131
             FSV F +FG SAY CRD +CSDA T+GL+K RD Y+FGVDP+W G+RSELPFLNSLKMK+
Sbjct  489   FSVPFHIFGGSAYKCRDTTCSDAYTVGLVKYRDAYSFGVDPSWRGSRSELPFLNSLKMKM  548

Query  1130  SILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQ  951
             SILLG+AQMNLGIILS+FNA +F   ++   QF+PQ+IFLN+LFGYLS+LIIVKWCTGSQ
Sbjct  549   SILLGIAQMNLGIILSFFNARFFGCSLDIRYQFVPQMIFLNSLFGYLSLLIIVKWCTGSQ  608

Query  950   ADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQH-NR  774
             ADLYHVMIYMFL PT+DLGENQLF GQ+  Q+VL+L ALV+VPWML PKPF L+  +  R
Sbjct  609   ADLYHVMIYMFLSPTDDLGENQLFWGQRPLQIVLLLSALVAVPWMLFPKPFALRKMYMER  668

Query  773   HQGQSYAPIQ----DLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTAS  606
              QG++Y  +     DLD   +   S     H+EF FSE+FVHQLIH+IEFVLG+VSNTAS
Sbjct  669   FQGRAYGILGTSEVDLD---VQPDSARDQHHDEFNFSEIFVHQLIHSIEFVLGSVSNTAS  725

Query  605   YLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFL  426
             YLRLWALSLAHSELSTVFYEKVLLLAWGY+NI + ++G ++F FAT  +LL+METLSAFL
Sbjct  726   YLRLWALSLAHSELSTVFYEKVLLLAWGYDNIFVRLLGLVVFAFATAFILLMMETLSAFL  785

Query  425   HALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             HALRLHWVEF NKFY GDGYKF PFSF L+   +D
Sbjct  786   HALRLHWVEFMNKFYSGDGYKFRPFSFALITAADD  820



>ref|XP_010691625.1| PREDICTED: V-type proton ATPase subunit a1 [Beta vulgaris subsp. 
vulgaris]
Length=817

 Score =   977 bits (2526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 504/811 (62%), Positives = 636/811 (78%), Gaps = 3/811 (0%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             P MDL RSE M  VQLIIP+ESA  +++YLG+LGL+QF++LNA+KSPFQRT+  Q+KR  
Sbjct  8     PAMDLMRSEKMTFVQLIIPVESAHRAISYLGELGLLQFRELNADKSPFQRTFVNQVKRCA  67

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EM+RKLRFFKDQ+SKAG+S S +   Q  ++ ++LE++L + E ELIE N+N++KLQ+++
Sbjct  68    EMSRKLRFFKDQISKAGLSISGHPGMQPDLELEELEIRLAEHEHELIETNSNSEKLQQTY  127

Query  2387  NELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTSKQVR  2208
             NEL+E+K+VLQK G F    +S A A++ E     S ++ ++   L E ++   T  Q  
Sbjct  128   NELLEFKMVLQKAGAFLVPGKSPAVAEETELEEIHSSDDYVDTASLLEQEIRG-TPVQSG  186

Query  2207  LGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSGE  2028
             +  + G++ + K   FERILFRATRGN+L  Q+  D  + DP S E VEK VF+VF+SGE
Sbjct  187   IRCMCGIICRSKVPKFERILFRATRGNLLFNQAPADVYITDPTSSEMVEKTVFVVFFSGE  246

Query  2027  RAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSIA  1848
             +A+ KILKIC+AFGAN YP  EE+ KQ Q+  EVS +++EL+  +DAGI  R   L  + 
Sbjct  247   QARMKILKICEAFGANCYPVPEEINKQRQINKEVSSRLAELEATLDAGIRQRNKALADVG  306

Query  1847  EQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNSE  1668
                 RW  LVRREK++Y TLNML+ DVTKKCLV EGW P SA  +IQ+ALQRA   SNS+
Sbjct  307   FHLSRWMNLVRREKAVYDTLNMLNFDVTKKCLVGEGWCPISAKSQIQEALQRATFHSNSQ  366

Query  1667  IGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMF  1488
             +G IF  + T ESPPTYFKTN+FT+AFQEIVDAYGV++YQEANP V+T+VTFPFLFAVMF
Sbjct  367   VGIIFHAMDTVESPPTYFKTNRFTNAFQEIVDAYGVSRYQEANPAVYTVVTFPFLFAVMF  426

Query  1487  GDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEFF  1308
             GDWGHGICLL+  L+ + RE KLSSQ+LG   EM FGGRY++L+MALFSIY G IYNEFF
Sbjct  427   GDWGHGICLLMLALFLIAREGKLSSQRLGSFMEMLFGGRYIVLLMALFSIYCGLIYNEFF  486

Query  1307  SVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKLS  1128
             SV F +FG+SAY CRD +CSD+ T GL+K RD Y FGVDP+W G+RSELPFLNSLKMK+S
Sbjct  487   SVPFHIFGQSAYKCRDATCSDSYTAGLVKFRDPYPFGVDPSWRGSRSELPFLNSLKMKMS  546

Query  1127  ILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQA  948
             ILLGVAQMNLGI+LSYFNA YF + ++   QF+PQ+IFLN+LFGYLS+L+I+KWCTGS+A
Sbjct  547   ILLGVAQMNLGIMLSYFNARYFSNSLDIRYQFLPQMIFLNSLFGYLSLLVIIKWCTGSRA  606

Query  947   DLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQHN-RH  771
             DLYHVMIYMFL P EDLGEN+LF GQ+  Q++L+LLA+++VPWML PKPFILK  H+ R 
Sbjct  607   DLYHVMIYMFLSPFEDLGENELFWGQRPLQILLLLLAMIAVPWMLFPKPFILKKLHSERF  666

Query  770   QGQSYAPIQDLDESLL-vdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLRL  594
             QG++Y  +   +  L+    S     HE+F FSE+FVHQLIH+IEFVLGAVSNTASYLRL
Sbjct  667   QGRTYGILHSSEMDLVGEPDSARQHHHEDFNFSEIFVHQLIHSIEFVLGAVSNTASYLRL  726

Query  593   WALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHALR  414
             WALSLAHSELSTVFYEKVLLLAWGY+N+++ +VG  +F FAT  +LL+ME+LSAFLHALR
Sbjct  727   WALSLAHSELSTVFYEKVLLLAWGYDNLVVRLVGLAVFAFATAFILLMMESLSAFLHALR  786

Query  413   LHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             LHWVE+QNKFY GDGYKF PFSF ++ +E+D
Sbjct  787   LHWVEYQNKFYHGDGYKFRPFSFAILTDEDD  817



>ref|XP_003539739.1| PREDICTED: vacuolar proton ATPase a1-like [Glycine max]
Length=818

 Score =   977 bits (2525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 507/814 (62%), Positives = 634/814 (78%), Gaps = 3/814 (0%)
 Frame = -2

Query  2756  GCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIK  2577
             G  PPMDL RSE M  VQLIIP ESA  ++ YLG+LGL+QF+DLNAEKSPFQR +  Q+K
Sbjct  6     GNLPPMDLMRSETMTFVQLIIPAESAHRAINYLGELGLLQFRDLNAEKSPFQRIFVNQVK  65

Query  2576  RSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQ  2397
             R  EM+RKLRFF+DQ++KAG+ +S  S  Q  I  +DLE++L + E ELIE+N+N++KL+
Sbjct  66    RCAEMSRKLRFFEDQINKAGLMSSP-SVLQTDIYLEDLEIQLAEHEHELIEMNSNSEKLR  124

Query  2396  RSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsge-esleapllsePDMSADTS  2220
             +S+NEL+E+K+VLQK   F  S+  +A ++++E   +     + +E P L E +M    S
Sbjct  125   QSYNELLEFKIVLQKACRFLVSSHGNAFSEERELEENVFSNGDYIETPFLFEQEMRHAPS  184

Query  2219  KQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVF  2040
              Q  L FISG++ K K + FER+LFRATRGN+L   +  DE ++DPIS E VEK VF+VF
Sbjct  185   DQSGLRFISGIICKSKVLRFERMLFRATRGNMLFNHALADEQIMDPISTEMVEKIVFVVF  244

Query  2039  YSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLL  1860
             +SGE+A+ KILKICDAFGAN YP  E++ KQ Q+ +EVS ++++L+  +DAGI HR   L
Sbjct  245   FSGEQARTKILKICDAFGANCYPVPEDISKQRQITSEVSSRLADLEATLDAGIRHRNKAL  304

Query  1859  QSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHD  1680
              S+     +W  +VRREK++Y TLNML+ DVTKKCLV EGW P  A  +IQ+ALQRA  D
Sbjct  305   ASVGGHLTKWMDMVRREKAVYDTLNMLNFDVTKKCLVGEGWCPIFAKTQIQEALQRATFD  364

Query  1679  SNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLF  1500
             S+S++G IF  +   ESPPTYF+TN FTS +QEIVDAYGVA+YQEANP V+T + FPFLF
Sbjct  365   SSSQVGIIFHSMDALESPPTYFRTNSFTSPYQEIVDAYGVARYQEANPAVYTTIIFPFLF  424

Query  1499  AVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIY  1320
             AVMFGDWGHGICLLL  L  + R+ KLS+Q+LG   EM FGGRYV+L+M+LFSIY G IY
Sbjct  425   AVMFGDWGHGICLLLGALVLIARQSKLSTQRLGSFMEMLFGGRYVLLLMSLFSIYCGLIY  484

Query  1319  NEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLK  1140
             NEFFSV + +FG SAY CRD SC DA TIGL+K R+ Y FGVDP+W G+RSELPFLNSLK
Sbjct  485   NEFFSVPYHIFGPSAYKCRDNSCRDAHTIGLVKYREPYPFGVDPSWRGSRSELPFLNSLK  544

Query  1139  MKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCT  960
             MK+SILLGV  MNLGI+LSYFNA +F + ++   QF+PQ+IFLN LFGYLS+LI+VKWCT
Sbjct  545   MKMSILLGVVHMNLGILLSYFNARFFGNSLDIRYQFVPQMIFLNCLFGYLSLLIVVKWCT  604

Query  959   GSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQH  780
             GSQADLYHVMIYMFL P ++LGENQLF GQ+  Q+VL+LLA+++VPWML PKPFILK  H
Sbjct  605   GSQADLYHVMIYMFLSPFDNLGENQLFWGQRPLQVVLLLLAVIAVPWMLFPKPFILKKLH  664

Query  779   N-RHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASY  603
             N R QG++Y  + + +  L ++       HEEF FSEVFVHQ+IH+IEFVLG+VSNTASY
Sbjct  665   NERFQGRTYGVLNNSEVDLELEPDSARQHHEEFNFSEVFVHQMIHSIEFVLGSVSNTASY  724

Query  602   LRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLH  423
             LRLWALSLAHSELSTVFYEKVLLLAWGY+N++I +VG  +F FAT  +LL+METLSAFLH
Sbjct  725   LRLWALSLAHSELSTVFYEKVLLLAWGYDNLVIRLVGLAVFAFATAFILLMMETLSAFLH  784

Query  422   ALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             ALRLHWVEFQNKFY GDGYKF PFSF  + E+E+
Sbjct  785   ALRLHWVEFQNKFYSGDGYKFKPFSFASLTEDEN  818



>ref|XP_009759132.1| PREDICTED: V-type proton ATPase subunit a1-like isoform X1 [Nicotiana 
sylvestris]
Length=817

 Score =   976 bits (2524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 512/810 (63%), Positives = 629/810 (78%), Gaps = 1/810 (0%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             PPMDL RSE M  VQLIIP ESA  +V YLG LGL+QF+DLNAEKSPFQRT+  Q+KR  
Sbjct  8     PPMDLMRSEKMTFVQLIIPFESAHRAVTYLGQLGLLQFRDLNAEKSPFQRTFVNQVKRCA  67

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EM+RKLR+FKDQ+ KAG+       +Q  I+ ++LE++L + E ELIE+NAN++KL++S+
Sbjct  68    EMSRKLRYFKDQIHKAGLLPPPLPASQPDIELEELEIQLAEHEHELIEMNANSEKLRQSY  127

Query  2387  NELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTSKQVR  2208
             NEL+E+K+VLQK   F  S+  + + + +   +  S +   +   L E +M ++ S Q  
Sbjct  128   NELLEFKMVLQKASGFLVSSSHTTDQETELVENVYSNDNHADTASLLEQEMRSELSNQSG  187

Query  2207  LGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSGE  2028
             + F+SG++ K K + FER+LFRATRGN+L  Q+  D+ ++DP S E VEK VF+VF+SGE
Sbjct  188   VRFMSGIICKSKVVQFERMLFRATRGNMLFNQAVADDEILDPSSNEMVEKVVFVVFFSGE  247

Query  2027  RAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSIA  1848
             +A+ KILKIC+AFGAN YP  E+  K+ Q+  EV  ++SEL+T +DAG+ HR   L SI 
Sbjct  248   QARTKILKICEAFGANCYPVPEDTTKRRQITQEVLFRLSELETTLDAGLRHRDKALTSIG  307

Query  1847  EQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNSE  1668
                 +W  +V+ +K++Y TLNML+ DVTKKCLV EGW P  A  +IQ+ALQR   DS+S+
Sbjct  308   YHLTKWINMVKTQKAVYDTLNMLNFDVTKKCLVGEGWCPIFAKTKIQEALQRGTFDSSSQ  367

Query  1667  IGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMF  1488
             +G IF V+   ESPPTYF+TN FT+AFQEIVDAYGVAKYQEANP V+TIVTFPFLFAVMF
Sbjct  368   VGIIFHVMDAVESPPTYFRTNSFTNAFQEIVDAYGVAKYQEANPAVYTIVTFPFLFAVMF  427

Query  1487  GDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEFF  1308
             GDWGHGICLLL  L  + RE KLSSQKLG   EM FGGRYV+L+M++FSIY G IYNEFF
Sbjct  428   GDWGHGICLLLGALVLIARESKLSSQKLGSFMEMLFGGRYVLLLMSIFSIYCGLIYNEFF  487

Query  1307  SVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKLS  1128
             SV F +FG SAY CRD +CSDA T+GL+K  D Y FGVDP+W G+RSELPFLNSLKMK+S
Sbjct  488   SVPFHIFGDSAYKCRDATCSDARTVGLVKYNDPYPFGVDPSWRGSRSELPFLNSLKMKMS  547

Query  1127  ILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQA  948
             ILLGVAQMNLGIILSYFNA +F S ++   QFIPQIIFLN+LFGYLS+LI+VKWCTGSQA
Sbjct  548   ILLGVAQMNLGIILSYFNARFFSSSIDIKYQFIPQIIFLNSLFGYLSLLILVKWCTGSQA  607

Query  947   DLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQH-NRH  771
             DLYHVMIYMFL P E LGEN+LF GQ   Q++L+LLALV+VPWML PKPFILKS H  R 
Sbjct  608   DLYHVMIYMFLSPFEALGENRLFWGQSVLQVILLLLALVAVPWMLFPKPFILKSLHMERF  667

Query  770   QGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLRLW  591
             QG++Y  +   +  +  +    S   EEF FSEVFVHQ+IH+IEFVLGAVSNTASYLRLW
Sbjct  668   QGRTYGILGTSEMVIDEEPGSASQHAEEFNFSEVFVHQMIHSIEFVLGAVSNTASYLRLW  727

Query  590   ALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHALRL  411
             ALSLAHSELSTVFYEKVLLLAWGY+NI+I +VG  +F FAT  +LL+METLSAFLHALRL
Sbjct  728   ALSLAHSELSTVFYEKVLLLAWGYDNIVIRLVGLAVFAFATTFILLMMETLSAFLHALRL  787

Query  410   HWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             HWVEFQNKFY GDGYKF PFSF L+ +++D
Sbjct  788   HWVEFQNKFYHGDGYKFKPFSFALLADDDD  817



>ref|XP_004241262.1| PREDICTED: V-type proton ATPase subunit a1-like [Solanum lycopersicum]
Length=818

 Score =   976 bits (2524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 510/811 (63%), Positives = 624/811 (77%), Gaps = 2/811 (0%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             P MDL RSE M  VQLIIP ESA  ++ YLG LGL+QF+DLNAEKSPFQRT+  Q+KR  
Sbjct  8     PLMDLMRSEKMTFVQLIIPAESAHRAITYLGQLGLLQFRDLNAEKSPFQRTFVNQVKRCV  67

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EMARKLR+FKDQ+ KAG+       +Q     +++E++L + E ELIE+NAN++KL++S+
Sbjct  68    EMARKLRYFKDQIHKAGLFLPPLPASQPDTDLEEIEIRLAEHEHELIEMNANSEKLRQSY  127

Query  2387  NELVEYKLVLQKVGEFF-HSARssaeaqqqeygssqsgeesleapllsePDMSADTSKQV  2211
             NEL+E+K+VLQK   F   S+  + + + +   +  S +   +   L E +M ++ S Q 
Sbjct  128   NELLEFKMVLQKASGFLVSSSSHTTDREIELDENVYSNDNHGDTASLLEQEMRSEMSNQS  187

Query  2210  RLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSG  2031
              + FISG++ K K + FER+LFRATRGN+L  Q+  D+ ++DP S E VEK VF+VF+SG
Sbjct  188   GVRFISGIICKSKVLQFERMLFRATRGNMLFNQAVADDEILDPSSNEMVEKIVFVVFFSG  247

Query  2030  ERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSI  1851
             E+A+ KILKIC+AF AN YP  E+  K+ Q+  EV  ++SEL+T +DAG+ HR   L SI
Sbjct  248   EQARTKILKICEAFSANCYPVPEDTTKRRQITQEVLSRLSELETTLDAGLRHRDKALTSI  307

Query  1850  AEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNS  1671
                  +W  +V+ +K++Y TLNML+ DVTKKCLV EGW P  A  +IQ+ALQRA  DS+S
Sbjct  308   GYHLTKWINMVKTQKAVYDTLNMLNFDVTKKCLVGEGWCPIFAKTKIQEALQRATFDSSS  367

Query  1670  EIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVM  1491
             ++G IF V+   ESPPTYF+TN+FT+AFQEIVDAYGVAKYQEANP V+TIVTFPFLFAVM
Sbjct  368   QVGIIFHVMDAVESPPTYFRTNRFTNAFQEIVDAYGVAKYQEANPAVYTIVTFPFLFAVM  427

Query  1490  FGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEF  1311
             FGDWGHGICLLL  L  + RE KLSSQKLG   EM FGGRYV+L+M++FSIY G IYNEF
Sbjct  428   FGDWGHGICLLLGALVLIARESKLSSQKLGSFMEMVFGGRYVLLLMSIFSIYCGLIYNEF  487

Query  1310  FSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKL  1131
             FSV F +FG SAY CRD +CSDA T+GLIK +D Y FGVDP+W G+RSELPFLNSLKMK+
Sbjct  488   FSVPFHIFGDSAYRCRDATCSDAQTVGLIKYKDPYPFGVDPSWRGSRSELPFLNSLKMKM  547

Query  1130  SILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQ  951
             SILLGVAQMNLGIILSYFNA +F S ++   QFIPQIIFLN+LFGYLS+LIIVKWCTGSQ
Sbjct  548   SILLGVAQMNLGIILSYFNARFFSSSIDIKYQFIPQIIFLNSLFGYLSLLIIVKWCTGSQ  607

Query  950   ADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQH-NR  774
             ADLYHVMIYMFL P E LGEN+LF GQ   Q++L+LLAL++VPWML PKPFILK  H  R
Sbjct  608   ADLYHVMIYMFLSPFEALGENRLFWGQSVLQVILLLLALIAVPWMLFPKPFILKRLHMER  667

Query  773   HQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLRL  594
              QG++Y  +   +  +           EEF FSEVFVHQ+IH+IEFVLGAVSNTASYLRL
Sbjct  668   FQGRTYGILGTSEMGIDDQPDSARERAEEFNFSEVFVHQMIHSIEFVLGAVSNTASYLRL  727

Query  593   WALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHALR  414
             WALSLAHSELSTVFYEKVLLLAWGY NIII +VG  +F FAT  +LL+METLSAFLHALR
Sbjct  728   WALSLAHSELSTVFYEKVLLLAWGYENIIIRLVGLAVFAFATAFILLMMETLSAFLHALR  787

Query  413   LHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             LHWVEFQNKFY GDGYKF PFSF L+ +++D
Sbjct  788   LHWVEFQNKFYHGDGYKFMPFSFALLADDDD  818



>gb|AES67400.2| vacuolar proton ATPase a3-like protein [Medicago truncatula]
Length=818

 Score =   976 bits (2523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 503/810 (62%), Positives = 622/810 (77%), Gaps = 1/810 (0%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             PPMDL RSE M  VQLIIP ESA  +V+YLG+LGL+QF+DLNA+KSPFQRT+  Q+KR  
Sbjct  9     PPMDLMRSEKMTFVQLIIPAESAHRAVSYLGELGLLQFRDLNADKSPFQRTFVNQVKRCA  68

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EM+RKLRFFKDQ++KAG+ +S+ +  Q  I  +DLEV L + E ELIE+N+N+DKL++S+
Sbjct  69    EMSRKLRFFKDQVNKAGLMSSSRTLLQPDIDLEDLEVHLAEHEHELIEMNSNSDKLRQSY  128

Query  2387  NELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTSKQVR  2208
             NEL+E+K+VLQK   F  S+   A + + E   +    +                     
Sbjct  129   NELLEFKIVLQKACGFLISSHGRAVSGEIELQDNVYSNDDYIETASLLEQEMRPQPSTSG  188

Query  2207  LGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSGE  2028
             L FISG++ K K++ FER+LFRATRGN+   Q+   E ++DPI+ E +EK VF+VF+SGE
Sbjct  189   LRFISGIICKSKALRFERMLFRATRGNMFFNQAPAGEQIMDPITTEMIEKTVFVVFFSGE  248

Query  2027  RAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSIA  1848
             +A+ KILKIC+AFGAN YP  E++ K  Q+  EV+ ++++L+  +DAGI HR   L SIA
Sbjct  249   QARTKILKICEAFGANCYPVPEDISKHGQITREVTSRLTDLEATLDAGIRHRNKALSSIA  308

Query  1847  EQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNSE  1668
             +   +W  LVRREK++Y TLNML+ DVTKKCLV EGW P  A  ++Q+ALQRA  DSNS+
Sbjct  309   DHLAKWMDLVRREKAVYDTLNMLNFDVTKKCLVGEGWCPMIAKTQMQEALQRATFDSNSQ  368

Query  1667  IGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMF  1488
             +G IF  +   ESPPTYFKTN FT+ +QEIVDAYGVA+YQEANP V+T V FPFLFA+MF
Sbjct  369   VGIIFHQMDAVESPPTYFKTNTFTNPYQEIVDAYGVARYQEANPAVYTTVVFPFLFAMMF  428

Query  1487  GDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEFF  1308
             GDWGHGICLLL  L  +  E KLS+QKLG   EM FGGRYVIL+M+LFSIY G IYNEFF
Sbjct  429   GDWGHGICLLLGALILIAHENKLSTQKLGSFMEMLFGGRYVILLMSLFSIYCGLIYNEFF  488

Query  1307  SVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKLS  1128
             SV F +FG SA+ CRD SCSDA TIGL+K RD Y FGVDP+W G+RSEL FLNS+KMK+S
Sbjct  489   SVPFHIFGPSAFRCRDTSCSDAHTIGLVKYRDPYPFGVDPSWRGSRSELAFLNSMKMKMS  548

Query  1127  ILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQA  948
             IL GVA MNLGIILSYFNA +F S ++   QF+PQ+IFLN+LFGYLS+LII+KWCTGSQA
Sbjct  549   ILFGVAHMNLGIILSYFNARFFGSSLDIRYQFVPQMIFLNSLFGYLSLLIIIKWCTGSQA  608

Query  947   DLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQHN-RH  771
             DLYHVMIYMFL PT++LGENQLF GQ+  Q+VL+LLA+++VPWML PKPFILK  H  R 
Sbjct  609   DLYHVMIYMFLSPTDELGENQLFWGQRPLQIVLLLLAIIAVPWMLFPKPFILKKLHTERF  668

Query  770   QGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLRLW  591
             QG+SY  +   +  L V+       HE+F FSE+FVHQ+IH+IEFVLG+VSNTASYLRLW
Sbjct  669   QGRSYGILNTSEMDLEVEPDSAREHHEDFNFSEIFVHQMIHSIEFVLGSVSNTASYLRLW  728

Query  590   ALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHALRL  411
             ALSLAHSELSTVFYEKVLLLAWGY+N+II +VG  +F FAT  +LL+ME+LSAFLHALRL
Sbjct  729   ALSLAHSELSTVFYEKVLLLAWGYDNLIIRLVGLTVFAFATAFILLMMESLSAFLHALRL  788

Query  410   HWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             HWVEFQNKFY GDGYKF PFSF  + E++D
Sbjct  789   HWVEFQNKFYHGDGYKFKPFSFAALTEDDD  818



>ref|XP_007015507.1| Vacuolar proton ATPase A1 isoform 1 [Theobroma cacao]
 gb|EOY33126.1| Vacuolar proton ATPase A1 isoform 1 [Theobroma cacao]
Length=802

 Score =   976 bits (2523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 499/790 (63%), Positives = 624/790 (79%), Gaps = 2/790 (0%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             PPMDL RSE M LVQLIIP+ESA  +++YLG+LGL+QF+DLNAEKSPFQRT+  Q+KR G
Sbjct  12    PPMDLMRSEKMTLVQLIIPVESAHRAISYLGELGLLQFRDLNAEKSPFQRTFVNQVKRCG  71

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EM+RKLRFFKDQ+SKAG+ +S +   +  ++ ++LE++L + E ELIE+N+N++KL++++
Sbjct  72    EMSRKLRFFKDQISKAGLLSSLHPVVEPDVELEELEIQLAEHEHELIEMNSNSEKLRQTY  131

Query  2387  NELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTSKQVR  2208
             NEL+E+K+VLQK G F  S+ + A  +++E   +    +          +     + Q  
Sbjct  132   NELLEFKIVLQKAGGFLVSSNNHAVDEERELSENVYSNDGYVETASLL-EQEMRPADQSG  190

Query  2207  LGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSGE  2028
             L FISG++ K K++ FER+LFRATRGN+L   +   E ++DP+S E VEK VF+VF+SGE
Sbjct  191   LRFISGIICKSKALRFERMLFRATRGNMLFNHAPAGEEIMDPVSAEMVEKTVFVVFFSGE  250

Query  2027  RAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSIA  1848
             +AK KILKIC+AFGAN YP  +++ KQ Q+  EV  ++SEL+T +DAGI HR   L S+ 
Sbjct  251   QAKTKILKICEAFGANCYPVPDDISKQRQITREVLSRLSELETTLDAGIRHRNKALTSVG  310

Query  1847  EQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNSE  1668
                  W  +VRREK++Y TLNML+ DVTKKCLV EGW P  A  +IQ+ALQRA  DSNS+
Sbjct  311   YHLTHWMSMVRREKAVYDTLNMLNFDVTKKCLVGEGWCPIFAKAQIQEALQRATFDSNSQ  370

Query  1667  IGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMF  1488
             +G IF V+   ESPPTYF+TN+FT+A+QEIVDAYGVA+YQE+NP V+T++TFPFLFAVMF
Sbjct  371   VGIIFHVMDAVESPPTYFRTNRFTNAYQEIVDAYGVARYQESNPAVYTVITFPFLFAVMF  430

Query  1487  GDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEFF  1308
             GDWGHGICLLL  L  + RE +LS+QKLG   EM FGGRYV+L+M+LFSIY G IYNEFF
Sbjct  431   GDWGHGICLLLGALVLIARESRLSTQKLGSFMEMLFGGRYVLLLMSLFSIYCGLIYNEFF  490

Query  1307  SVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKLS  1128
             SV F +FG SAY CRD +C DA + GLIK RD Y FGVDP+W G+RSELPFLNSLKMK+S
Sbjct  491   SVPFHIFGGSAYKCRDATCRDAQSAGLIKFRDPYPFGVDPSWRGSRSELPFLNSLKMKMS  550

Query  1127  ILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQA  948
             ILLGVAQMNLGIILSYFNA +FR+ ++   QF+PQ+IFLN+LFGYLS+LII+KWCTGSQA
Sbjct  551   ILLGVAQMNLGIILSYFNARFFRNSLDIRYQFVPQMIFLNSLFGYLSLLIIIKWCTGSQA  610

Query  947   DLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQHN-RH  771
             DLYHVMIYMFL PT+DLG+N+LF GQ+  Q+VL+LLALV+VPWML PKPFILK  H+ R 
Sbjct  611   DLYHVMIYMFLSPTDDLGDNELFWGQRPLQIVLLLLALVAVPWMLFPKPFILKKLHSERF  670

Query  770   QGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLRLW  591
             QG++Y  +   +  L V+       HEEF FSEVFVHQ+IH+IEFVLGAVSNTASYLRLW
Sbjct  671   QGRTYGMLGTSEFDLDVEPDSARQHHEEFNFSEVFVHQMIHSIEFVLGAVSNTASYLRLW  730

Query  590   ALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHALRL  411
             ALSLAHSELSTVFYEKVLLLAWGY+NI+I +VG  +F FAT  +LL+METLSAFLHALRL
Sbjct  731   ALSLAHSELSTVFYEKVLLLAWGYDNIVIRLVGLAVFAFATAFILLMMETLSAFLHALRL  790

Query  410   HWVEFQNKFY  381
             HWVEFQNKFY
Sbjct  791   HWVEFQNKFY  800



>ref|XP_006843249.1| hypothetical protein AMTR_s00080p00100430 [Amborella trichopoda]
 gb|ERN04924.1| hypothetical protein AMTR_s00080p00100430 [Amborella trichopoda]
Length=821

 Score =   975 bits (2521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 515/814 (63%), Positives = 639/814 (79%), Gaps = 5/814 (1%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             P MD  RSE M LVQLIIP+ESA  +++YLGDLGL++FKDLNA+KSPFQRT+  Q+KR G
Sbjct  8     PAMDHMRSEQMTLVQLIIPVESAHGAISYLGDLGLLEFKDLNADKSPFQRTFVNQVKRCG  67

Query  2567  EMARKLRFFKDQMSKAGVSASAN-SDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRS  2391
             EM+RKLRFF DQ+SKAG+S+S+  S  Q  +  ++LE++L + E EL+E+NAN++KL R+
Sbjct  68    EMSRKLRFFSDQISKAGLSSSSTPSGMQREMDLEELEIQLAEHEIELLEMNANSEKLSRT  127

Query  2390  FNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeeslea-pllsePDMSADTSKQ  2214
             +NEL+E+K VLQK G F  SA+S   AQ+QE   +    E       L E ++    SKQ
Sbjct  128   YNELLEFKFVLQKAGGFLVSAQSHVIAQEQELDENVYSTEDYVEDMSLLEQELKQAPSKQ  187

Query  2213  VRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYS  2034
               L FISG++   K   FERILFRATRGN+L  Q+ +DE VIDP S EKV++ VF+VF+S
Sbjct  188   SGLRFISGIICSTKITRFERILFRATRGNMLFNQAPLDEYVIDPSSNEKVKRTVFVVFFS  247

Query  2033  GERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQS  1854
             GE+AK+K+LKIC+AFGAN YP  EE+ KQ Q+  EV  ++SE +  +DAGI HR   L S
Sbjct  248   GEQAKSKVLKICEAFGANCYPVPEEINKQRQITREVLSRLSEFEATLDAGIRHRNKALTS  307

Query  1853  IAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSN  1674
             I      W +LV++EK++Y TLNML+ DVTKKCLV EGW P  A  +IQ+ LQRA  DSN
Sbjct  308   IGYHLKEWTLLVKKEKAVYDTLNMLNFDVTKKCLVGEGWCPLFAKAQIQEVLQRATMDSN  367

Query  1673  SEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAV  1494
             S++G IF+V+   ESPPTYF+TN+FT AFQEIVDAYGVA+YQEANPGV+T++TFPFLFAV
Sbjct  368   SQVGTIFQVMDAEESPPTYFRTNRFTHAFQEIVDAYGVARYQEANPGVYTVITFPFLFAV  427

Query  1493  MFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNE  1314
             MFGDWGHGICLLL +L  +IREK+L SQKLG+  EM FGGRYVIL+MALFSIY G IYNE
Sbjct  428   MFGDWGHGICLLLGSLILIIREKRLGSQKLGNFMEMAFGGRYVILLMALFSIYCGLIYNE  487

Query  1313  FFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMK  1134
             FFSV F +FG SAY CRD +CSDA+ +GLIK R  Y FGVDP+W G+RSELPFLNSLKMK
Sbjct  488   FFSVPFHIFGHSAYRCRDLTCSDASRMGLIKYRGPYPFGVDPSWRGSRSELPFLNSLKMK  547

Query  1133  LSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGS  954
             +SILLGV QMNLGIILSYFN  +F S ++   QF+PQ+IFLN+LFGYL++LII+KWCTGS
Sbjct  548   MSILLGVVQMNLGIILSYFNGKFFGSSIDIRYQFVPQMIFLNSLFGYLALLIIIKWCTGS  607

Query  953   QADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQHN-  777
             QADLYHVMIYMFL P +DLGENQLF GQ+  Q++L+L+A+V+VPWML PKP IL+  H  
Sbjct  608   QADLYHVMIYMFLSPMDDLGENQLFWGQRPLQILLLLMAIVAVPWMLFPKPLILRKLHTE  667

Query  776   RHQGQSYAPI--QDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASY  603
             R QG++Y  +   +LD     D +     HE+F FSEVFVHQ+IH+IEFVLG+VSNTASY
Sbjct  668   RFQGRTYGILGTSELDFDSEPDSARSVRQHEDFNFSEVFVHQMIHSIEFVLGSVSNTASY  727

Query  602   LRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLH  423
             LRLWALSLAHSELSTVFYEKVL+L+WG+++I+I ++G  +F FAT  +LL+ME+LSAFLH
Sbjct  728   LRLWALSLAHSELSTVFYEKVLVLSWGFDSIVIRIIGLGVFAFATAFILLMMESLSAFLH  787

Query  422   ALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             ALRLHWVEFQNKFY+GDG+KF PFSF  +  EED
Sbjct  788   ALRLHWVEFQNKFYQGDGHKFKPFSFAALANEED  821



>ref|XP_011089858.1| PREDICTED: V-type proton ATPase subunit a1 isoform X1 [Sesamum 
indicum]
Length=820

 Score =   974 bits (2517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 511/814 (63%), Positives = 630/814 (77%), Gaps = 6/814 (1%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             P MDL RSE M   QLIIP+ESA  +++YLG+LGL+QF+DLN +KSPFQRT+  Q+KR  
Sbjct  8     PSMDLMRSEKMMFAQLIIPVESAHRAISYLGELGLLQFRDLNDDKSPFQRTFVNQVKRCA  67

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EM+RKLRFFKDQ+ KAG+  S +  +Q  I+ ++LE++L + E ELIE+N N++KLQ+++
Sbjct  68    EMSRKLRFFKDQIHKAGLMPSPHPVSQPDIELEELEIRLAEHEHELIEMNGNSEKLQQTY  127

Query  2387  NELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTSKQVR  2208
             NEL+E+K+VLQK G+F     S +E  + +     + + S    LL + +M    S Q  
Sbjct  128   NELLEFKMVLQKAGDFLVPGESHSEETELDENVYTNNDYSDTVSLLEQ-EMQPGPSNQSG  186

Query  2207  LGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSGE  2028
             + FISG++ K K + FER+LFRATRGN+L  Q+   + ++D  S E V+K VF+VF+SGE
Sbjct  187   VKFISGIICKSKVLRFERMLFRATRGNMLFNQAPAGDRILDRASNEMVQKTVFVVFFSGE  246

Query  2027  RAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSIA  1848
             +A+ KILKIC+AFGAN YP  E+  K+ Q+  EV  ++SEL+T +DAG+ HR   L SI 
Sbjct  247   QARKKILKICEAFGANCYPIPEDTTKRRQITREVLSRLSELETTLDAGLHHRDAALTSIG  306

Query  1847  EQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNSE  1668
              Q  +W  +VRREK+IY TLNML+ DVTKKCLV EGW P  A  +IQ+ALQRA  DSNS+
Sbjct  307   FQLTKWMNMVRREKAIYDTLNMLNFDVTKKCLVGEGWCPVFAKTKIQEALQRATFDSNSQ  366

Query  1667  IGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMF  1488
             +G IF V+ + E PPTYF+TN FT+A+QEIVDAYGVAKYQEANP V+TIVTFPFLFAVMF
Sbjct  367   MGIIFHVMDSVEPPPTYFRTNHFTNAYQEIVDAYGVAKYQEANPAVYTIVTFPFLFAVMF  426

Query  1487  GDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEFF  1308
             GDWGHGICLLL  L  + REK+L SQKLG   EM FGGRYV+LMM+LFSIY G IYNEFF
Sbjct  427   GDWGHGICLLLGALILIAREKRLGSQKLGSFMEMLFGGRYVLLMMSLFSIYCGLIYNEFF  486

Query  1307  SVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKLS  1128
             SV F +FG SAY CRD +CSDA ++GL+K RDTY FGVDP+W G+RSELPFLNSLKMK+S
Sbjct  487   SVPFHIFGTSAYKCRDATCSDARSVGLVKYRDTYPFGVDPSWRGSRSELPFLNSLKMKMS  546

Query  1127  ILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQA  948
             IL GVAQMNLGI+LSYFNA YF S ++   QF+PQ+IFLN+LFGYLS+LII+KWCTGSQA
Sbjct  547   ILFGVAQMNLGIVLSYFNARYFSSSLDIKYQFVPQMIFLNSLFGYLSLLIIIKWCTGSQA  606

Query  947   DLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQHN-RH  771
             DLYHVMIYMFL P E LGEN+LF GQ   Q++L+LLA+++VPWML PKPFILK  H  R 
Sbjct  607   DLYHVMIYMFLSPFEGLGENKLFWGQSVLQVILLLLAVIAVPWMLFPKPFILKRLHTERF  666

Query  770   QGQSYAPI--QDL--DESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASY  603
             QG++Y  +   D+  DE          S +EEF FSEVFVHQ+IH+IEFVLGAVSNTASY
Sbjct  667   QGRAYGILGTSDIYNDEEPDSARHPHESHNEEFNFSEVFVHQMIHSIEFVLGAVSNTASY  726

Query  602   LRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLH  423
             LRLWALSLAHSELSTVFYEKVLLLAWGY+N II +VG  +F FAT  +LL+METLSAFLH
Sbjct  727   LRLWALSLAHSELSTVFYEKVLLLAWGYDNFIIRLVGLAVFSFATAFILLMMETLSAFLH  786

Query  422   ALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             ALRLHWVEFQNKFY GDGYKF PFSF  + +++D
Sbjct  787   ALRLHWVEFQNKFYSGDGYKFRPFSFASLTDDDD  820



>ref|XP_004970481.1| PREDICTED: vacuolar proton ATPase a1-like [Setaria italica]
Length=818

 Score =   973 bits (2515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 506/811 (62%), Positives = 632/811 (78%), Gaps = 2/811 (0%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             PPMD  RSE M  VQLIIP ES+R++V YLG+LGL+QFKDLN +KSPFQR +  Q+KR  
Sbjct  8     PPMDHLRSEKMCFVQLIIPAESSRVAVTYLGELGLLQFKDLNEDKSPFQRIFVNQVKRCA  67

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EM+RKLRFF DQ++KAGV +S     +  I  ++LE +LG+ E EL+E+N N+DKLQ+++
Sbjct  68    EMSRKLRFFSDQINKAGVRSSVRPALEPDIDLEELEARLGEHEHELLEMNTNSDKLQQTY  127

Query  2387  NELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePD-MSADTSKQV  2211
             NEL+E+KLVL K G    S+ + A + ++E   +    E  E         +   +S   
Sbjct  128   NELLEFKLVLTKAGGILASSHNHAASAERELDENIYDREVDEGNAYLLEQGVHQGSSGNS  187

Query  2210  RLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSG  2031
              + F+SG++ K K++AFER+LFRATRGN+L  Q+   E V DPISGE+VEK VF+VF+SG
Sbjct  188   GVRFVSGIILKSKALAFERMLFRATRGNMLFNQAPAGEPVTDPISGEEVEKTVFVVFFSG  247

Query  2030  ERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSI  1851
             E+AK KILKICD+FGA+ YP  EE+ KQ Q+  EVS ++S+L+  +DAGI HR   L+S+
Sbjct  248   EQAKAKILKICDSFGASCYPVPEEMMKQRQIFNEVSARLSDLEVTLDAGIQHRNKALESV  307

Query  1850  AEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNS  1671
               Q  RW ++V++EK++Y TLNML+ DVTKKCLV EGW P  A  +I+D LQRA   SNS
Sbjct  308   GSQLWRWTIMVKKEKAVYDTLNMLNFDVTKKCLVGEGWCPIFAKSQIKDCLQRATLHSNS  367

Query  1670  EIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVM  1491
             ++G IF  + T ESPPTYF+T+KFT+AFQEIVDAYGVA+YQEANP V+++VTFPFLFAVM
Sbjct  368   QVGIIFHEMDTMESPPTYFRTDKFTNAFQEIVDAYGVARYQEANPAVYSVVTFPFLFAVM  427

Query  1490  FGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEF  1311
             FGDWGHGICLLL  L  ++REKKLSSQKLG   EM FGGRYVIL+MA+FSIY G IYNEF
Sbjct  428   FGDWGHGICLLLGALVLILREKKLSSQKLGSFMEMAFGGRYVILLMAIFSIYCGLIYNEF  487

Query  1310  FSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKL  1131
             FSV F +FG+SAY CR+ SCSDA T GLIK RD Y FGVDP+W G+RSELPFLNSLKMK+
Sbjct  488   FSVPFHIFGKSAYECREKSCSDAHTAGLIKVRDPYPFGVDPSWRGSRSELPFLNSLKMKM  547

Query  1130  SILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQ  951
             SIL+GVAQMNLGI+LSYF+A +  + ++   QFIPQ+IFLN+LFGYL++LI++KWCTGS+
Sbjct  548   SILMGVAQMNLGIVLSYFDARFHGNALDIRYQFIPQMIFLNSLFGYLALLILIKWCTGSK  607

Query  950   ADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQHN-R  774
             ADLYHVMIYMFL P  DLGENQLF GQK  Q++L+LLALV+VPWML PKPFILK  H  R
Sbjct  608   ADLYHVMIYMFLDPAGDLGENQLFWGQKELQILLLLLALVAVPWMLFPKPFILKKLHKER  667

Query  773   HQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLRL  594
              QG +Y  +   +     +     + H++F FSEVFVHQ+IH+IEFVLGAVSNTASYLRL
Sbjct  668   FQGHTYRFLGTSEMDPDSEPDSARARHDDFNFSEVFVHQMIHSIEFVLGAVSNTASYLRL  727

Query  593   WALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHALR  414
             WALSLAHSELSTVFYEK+LLLAWGY+++I+ +VG ++F FAT  +LL+METLSAFLHALR
Sbjct  728   WALSLAHSELSTVFYEKLLLLAWGYDSLIVKLVGLVVFAFATAFILLMMETLSAFLHALR  787

Query  413   LHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             LHWVEF NKFY GDGYKF PFSF L+ ++ED
Sbjct  788   LHWVEFMNKFYHGDGYKFKPFSFALLADDED  818



>gb|KHN05709.1| V-type proton ATPase 116 kDa subunit a isoform 1 [Glycine soja]
Length=818

 Score =   971 bits (2509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 505/814 (62%), Positives = 633/814 (78%), Gaps = 3/814 (0%)
 Frame = -2

Query  2756  GCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIK  2577
             G  PPMDL RSE M  VQLIIP ESA  ++ YLG+LGL+QF+DLNAEKSPFQR +  Q+K
Sbjct  6     GNLPPMDLMRSETMTFVQLIIPAESAHRAINYLGELGLLQFRDLNAEKSPFQRIFVNQVK  65

Query  2576  RSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQ  2397
             R  EM+RKLRFF+DQ++KAG+ +S  S  Q  I  +DLE++L + E ELIE+N+N++KL+
Sbjct  66    RCAEMSRKLRFFEDQINKAGLMSSP-SVLQTDIYLEDLEIQLAEHEHELIEMNSNSEKLR  124

Query  2396  RSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsge-esleapllsePDMSADTS  2220
             +S+NEL+E+K+VLQK   F  S+  +A ++++E   +     + +E P L E +M    S
Sbjct  125   QSYNELLEFKIVLQKACRFLVSSHGNAFSEERELEENVFSNGDYIETPFLFEQEMRHAPS  184

Query  2219  KQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVF  2040
              Q  L FISG++ K K + FER+LFRATRGN+L   +  DE ++DPIS E VEK VF+VF
Sbjct  185   DQSGLRFISGIICKSKVLRFERMLFRATRGNMLFNHALADEQIMDPISTEMVEKIVFVVF  244

Query  2039  YSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLL  1860
             +SGE+A+ KILKICDAFGAN YP  E++ KQ Q+ +EVS ++++L+  +DAGI  R   L
Sbjct  245   FSGEQARTKILKICDAFGANCYPVPEDISKQRQITSEVSSRLADLEATLDAGIRLRNKAL  304

Query  1859  QSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHD  1680
              S+     +W  +VRREK++Y TLNML+ DVTKKCLV EGW P  A  +IQ+ALQRA  D
Sbjct  305   ASVGGHLTKWMDMVRREKAVYDTLNMLNFDVTKKCLVGEGWCPIFAKTQIQEALQRATFD  364

Query  1679  SNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLF  1500
             S+S++G IF  +   ESPPTYF+T+ FTS +QEIVDAYGVA+YQEANP V+T + FPFLF
Sbjct  365   SSSQVGIIFHSMDALESPPTYFRTDSFTSPYQEIVDAYGVARYQEANPAVYTTIIFPFLF  424

Query  1499  AVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIY  1320
             AVMFGDWGHGICLLL  L  + R+ KLS+Q+LG   EM FGGRYV+L+M+LFSIY G IY
Sbjct  425   AVMFGDWGHGICLLLGALVLIARQSKLSTQRLGSFMEMLFGGRYVLLLMSLFSIYCGLIY  484

Query  1319  NEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLK  1140
             NEFFSV + +FG SAY CRD SC DA TIGL+K R+ Y FGVDP+W G+RSELPFLNSLK
Sbjct  485   NEFFSVPYHIFGPSAYKCRDNSCRDAHTIGLVKYREPYPFGVDPSWRGSRSELPFLNSLK  544

Query  1139  MKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCT  960
             MK+SILLGV  MNLGI+LSYFNA +F + ++   QF+PQ+IFLN LFGYLS+LI+VKWCT
Sbjct  545   MKMSILLGVVHMNLGILLSYFNARFFGNSLDIRYQFVPQMIFLNCLFGYLSLLIVVKWCT  604

Query  959   GSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQH  780
             GSQADLYHVMIYMFL P ++LGENQLF GQ+  Q+VL+LLA+++VPWML PKPFILK  H
Sbjct  605   GSQADLYHVMIYMFLSPFDNLGENQLFWGQRPLQVVLLLLAVIAVPWMLFPKPFILKKLH  664

Query  779   N-RHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASY  603
             N R QG++Y  + + +  L ++       HEEF FSEVFVHQ+IH+IEFVLG+VSNTASY
Sbjct  665   NERFQGRTYGVLNNSEVDLELEPDSARQHHEEFNFSEVFVHQMIHSIEFVLGSVSNTASY  724

Query  602   LRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLH  423
             LRLWALSLAHSELSTVFYEKVLLLAWGY+N++I +VG  +F FAT  +LL+METLSAFLH
Sbjct  725   LRLWALSLAHSELSTVFYEKVLLLAWGYDNLVIRLVGLAVFAFATAFILLMMETLSAFLH  784

Query  422   ALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             ALRLHWVEFQNKFY GDGYKF PFSF  + E+E+
Sbjct  785   ALRLHWVEFQNKFYSGDGYKFKPFSFASLTEDEN  818



>ref|XP_002988745.1| hypothetical protein SELMODRAFT_184043 [Selaginella moellendorffii]
 gb|EFJ10256.1| hypothetical protein SELMODRAFT_184043 [Selaginella moellendorffii]
Length=800

 Score =   970 bits (2507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 521/811 (64%), Positives = 639/811 (79%), Gaps = 15/811 (2%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             P M LFRSE M LVQLIIP+ESA  ++ +L +LG +QFKDLN EKSPFQRTYA Q+KR  
Sbjct  2     PKMHLFRSEDMTLVQLIIPVESAHGTLTHLAELGALQFKDLNPEKSPFQRTYANQVKRCD  61

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EM RKL++F DQ+ K+G+ AS  S  +  + FD+LEVK+ +LE E  E+N+N +KL+R+ 
Sbjct  62    EMLRKLQYFSDQLQKSGL-ASTPSAVESDLNFDELEVKINELEPEFREVNSNLEKLKRTR  120

Query  2387  NELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTSKQVR  2208
             NEL E+ LVL K G FF SAR +A +QQ+E  S   GE      L    +M  + SK+++
Sbjct  121   NELTEFLLVLDKAGAFFESARQNANSQQREDESISGGESIESPLLER--EMQVEPSKKLK  178

Query  2207  LGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSGE  2028
             +GFI+G++PK K+  FERI+FRATRGN+  +   +DE V DP +G++VEK VFLVF+SGE
Sbjct  179   VGFIAGVIPKHKANQFERIIFRATRGNMFYKCVPLDERVSDPATGDQVEKVVFLVFFSGE  238

Query  2027  RAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSIA  1848
             R++ KILKICDAFGANRYPF EE  K+ Q+  EVS ++SE++T +D    HR  +L++I 
Sbjct  239   RSRTKILKICDAFGANRYPFPEETLKRRQMRIEVSARLSEMQTTLDVSSDHRETVLKTIG  298

Query  1847  EQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNSE  1668
              Q + W  +V ++K +Y+ LNMLS+DVT KCLV E WSP  A   IQD L+ A  ++NS+
Sbjct  299   YQLEHWLEMVLKDKYVYNALNMLSMDVTSKCLVGEAWSPLGALPRIQDTLRYATVETNSQ  358

Query  1667  IGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMF  1488
             +  IF+VL T+E+PPTYF+ NKFTSAFQEIVDAYGV +YQEANPGVFTIVTFPFLFAVMF
Sbjct  359   VTTIFQVLHTKEAPPTYFQVNKFTSAFQEIVDAYGVGRYQEANPGVFTIVTFPFLFAVMF  418

Query  1487  GDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEFF  1308
             GDWGHGI LLLATL+ L+ E++L SQKLGDI EM F GRYV+L+M+LFSIYTGFIYNEFF
Sbjct  419   GDWGHGIVLLLATLWLLVNERRLGSQKLGDIMEMAFAGRYVLLLMSLFSIYTGFIYNEFF  478

Query  1307  SVQFELFGRSAYVCRDPSCSDATTIGLIKARD-TYAFGVDPAWHGTRSELPFLNSLKMKL  1131
             SV FE+FGRSAY C  PSCS++TT+GL+K RD  YAFGVDP WHG+RSELPFLNSLKMK+
Sbjct  479   SVPFEIFGRSAYKCETPSCSESTTVGLVKYRDKPYAFGVDPVWHGSRSELPFLNSLKMKM  538

Query  1130  SILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQ  951
             SI+LGVAQM LGI+LS FNA YF   ++ W QF+PQI+FL++LFGYLS LII+KW TGSQ
Sbjct  539   SIILGVAQMLLGIVLSLFNAVYFAQPLDIWFQFLPQILFLSSLFGYLSFLIILKWITGSQ  598

Query  950   ADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQH-NR  774
             ADLYHVMIYMFLGPT+DL  NQLF GQK  QL L+ +AL+SVPWMLLPKP IL+ QH  +
Sbjct  599   ADLYHVMIYMFLGPTDDLDGNQLFAGQKYFQLALLFIALISVPWMLLPKPLILRKQHLEK  658

Query  773   HQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLRL  594
              QG+ YA ++           H   +HEEFEFSE+FVHQLIHTIEFVLGAVSNTASYLRL
Sbjct  659   TQGEGYAGLE----------EHPDEEHEEFEFSEIFVHQLIHTIEFVLGAVSNTASYLRL  708

Query  593   WALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHALR  414
             WALSLAH+ELS VFYEKVLLLAWGY NI I+++GFI+F+ AT+GVLLVMETLSAFLHALR
Sbjct  709   WALSLAHAELSAVFYEKVLLLAWGYQNIFIILIGFIVFVCATVGVLLVMETLSAFLHALR  768

Query  413   LHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             LHWVEF NKFY GDGYKF P SFV + +E++
Sbjct  769   LHWVEFMNKFYVGDGYKFQPLSFVNLGKEDE  799



>gb|AES88702.2| vacuolar proton ATPase a3-like protein [Medicago truncatula]
Length=820

 Score =   969 bits (2504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 498/813 (61%), Positives = 621/813 (76%), Gaps = 5/813 (1%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             P MDL RSE M  VQ+IIP ESA   + YLG LGL+QF+DLNAEKSPFQRT+  Q+KR  
Sbjct  9     PSMDLMRSEKMTFVQIIIPAESAHRIITYLGQLGLLQFRDLNAEKSPFQRTFVNQVKRCA  68

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EM+RKLRF  DQ++KAG+  S++S  Q     +D+E +L + E E+IE+N+N++KLQ+S+
Sbjct  69    EMSRKLRFLMDQVNKAGI-MSSHSVLQSDTNLEDIETQLAEHEHEIIEMNSNSEKLQQSY  127

Query  2387  NELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMS---ADTSK  2217
             NEL+E+K+VLQK   F  S+   A ++++E   +    E            +      S 
Sbjct  128   NELLEFKIVLQKACNFLVSSHGHALSEERELVENVYSNEDFVETPFLFEQETMPGPSKSN  187

Query  2216  QVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFY  2037
             Q  L FISG++ K K + FER+LFRATRGN+L  Q+  DE ++DPIS E VEK VF+VF+
Sbjct  188   QSGLRFISGIICKSKVLRFERMLFRATRGNMLFNQAPADEQIMDPISTEMVEKTVFVVFF  247

Query  2036  SGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQ  1857
             SGE+A+ KILKIC+AFGAN YP  E++ KQ Q+  EVS ++++L+  +DAGI HR   L 
Sbjct  248   SGEQARTKILKICEAFGANCYPVPEDISKQRQITREVSSRLADLEATLDAGIRHRNKALS  307

Query  1856  SIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDS  1677
             S+     +W  +VRREK++Y TLNML+ DVTKKCLV EGW P  A  +IQDALQRA  DS
Sbjct  308   SVGGHLAKWMDMVRREKAVYDTLNMLNFDVTKKCLVGEGWCPIFAKAQIQDALQRATFDS  367

Query  1676  NSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFA  1497
             NS++GAI   +   ESPPTYF+TN FT+ +QEIVDAYGVA+YQEANP V+T + FPFLFA
Sbjct  368   NSQVGAILHSMDALESPPTYFRTNSFTNPYQEIVDAYGVARYQEANPAVYTTIIFPFLFA  427

Query  1496  VMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYN  1317
             VMFGDWGHGICLLL  L  +  E+KLS+Q+LG   EM FGGRYV+L+M+LFS+Y G IYN
Sbjct  428   VMFGDWGHGICLLLGALVLIAHERKLSNQRLGSFMEMLFGGRYVLLLMSLFSMYCGLIYN  487

Query  1316  EFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKM  1137
             EFFSV F +FG SAY CRD SC DA T GL+K R+ Y FGVDP+W G+RSELPFLNSLKM
Sbjct  488   EFFSVPFHIFGASAYKCRDSSCRDAHTTGLVKYREPYPFGVDPSWRGSRSELPFLNSLKM  547

Query  1136  KLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTG  957
             K+SIL GV  MNLGI+LSYFNAH+F S ++   QF+PQ+IFLN+LFGYLS+LI+VKWCTG
Sbjct  548   KMSILFGVVHMNLGILLSYFNAHFFGSSLDIRYQFVPQMIFLNSLFGYLSLLIVVKWCTG  607

Query  956   SQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQHN  777
             SQADLYH+MIYMFL P ++LGEN+LF GQ+  Q++L+LLAL++VPWML PKPFILK  HN
Sbjct  608   SQADLYHIMIYMFLSPFDNLGENELFWGQRPLQILLLLLALIAVPWMLFPKPFILKKLHN  667

Query  776   -RHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYL  600
              R QG++Y  +   +  L V+       HEEF F+EVFVHQ+IH+IEFVLG+VSNTASYL
Sbjct  668   ERFQGRNYGVLNTFEADLEVEPDSARQHHEEFNFNEVFVHQMIHSIEFVLGSVSNTASYL  727

Query  599   RLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHA  420
             RLWALSLAHSELSTVFYEKVLLLAWGY+N+II +VG ++F FAT  +LL+METLSAFLHA
Sbjct  728   RLWALSLAHSELSTVFYEKVLLLAWGYDNLIIRLVGLVVFAFATAFILLMMETLSAFLHA  787

Query  419   LRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             LRLHWVEFQNKFY GDGYKF PFSF  + E+E+
Sbjct  788   LRLHWVEFQNKFYHGDGYKFRPFSFATLTEDEN  820



>gb|EYU18884.1| hypothetical protein MIMGU_mgv1a001442mg [Erythranthe guttata]
Length=819

 Score =   969 bits (2504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 501/812 (62%), Positives = 619/812 (76%), Gaps = 3/812 (0%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             PPMDL RSE M LVQLIIP+ESA  +V+YLG+LGL+QF+DLN +KSPFQRT+  Q+KR  
Sbjct  8     PPMDLMRSEKMVLVQLIIPVESAHRAVSYLGELGLLQFRDLNDDKSPFQRTFVNQVKRCA  67

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EMARKLRF KD + KAG+  S +  ++  I+ ++LE++L + E  LIE+NAN++ LQ+++
Sbjct  68    EMARKLRFIKDHIHKAGLIPSPDPASEPDIELEELEIQLAEHEHGLIEMNANSEHLQQAY  127

Query  2387  NELVEYKLVLQKVGEFFHS-ARssaeaqqqeygssqsgeesleapllsePDMSADTSKQV  2211
             NEL+E+K+VL K G+F  S     A  + +   +    ++  +   L E ++    S Q 
Sbjct  128   NELLEFKMVLHKAGDFLSSNGSPVAAQETELDENVHISDDYADTSSLLEQELQPGPSNQS  187

Query  2210  RLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSG  2031
              + FISG++ K K + FER+LFR TRGN+L  Q+  D+ ++DP S E VEK VF+VF+S 
Sbjct  188   GVRFISGVICKSKILRFERMLFRTTRGNMLFNQASADDQILDPASNEMVEKTVFVVFFSS  247

Query  2030  ERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSI  1851
             E+ + KILKIC+AFGAN YP  EE  K+ Q+  EV   +SEL+T ++AG+ HR   L SI
Sbjct  248   EQVRIKILKICEAFGANCYPVPEEATKRRQISREVLSHLSELETTLEAGLQHRDKALTSI  307

Query  1850  AEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNS  1671
                  +W  +VRREK++Y TLNML+ DVTKKCLV EGW P  A  ++Q+ALQRA  DSNS
Sbjct  308   GLYLAKWMKMVRREKAVYDTLNMLNFDVTKKCLVGEGWCPIFAKTKVQEALQRATTDSNS  367

Query  1670  EIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVM  1491
             ++G IF V+ + E PPTYF+T+ FT+A+QEIVDAYGVAKYQEANP V+TIVTFPFLFAVM
Sbjct  368   QVGVIFHVMDSIEPPPTYFQTDDFTNAYQEIVDAYGVAKYQEANPAVYTIVTFPFLFAVM  427

Query  1490  FGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEF  1311
             FGDWGHGICLLL  LY +  EKK  SQKLG   EM +GGRYV+L+M+LFSIY G IYNEF
Sbjct  428   FGDWGHGICLLLGALYLIAHEKKFGSQKLGSFMEMLYGGRYVLLLMSLFSIYCGLIYNEF  487

Query  1310  FSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKL  1131
             FSV F +FG SAY CRD +CSD+ ++GLIK RD Y FGVDP+W G+RSELPFLNSLKMK+
Sbjct  488   FSVPFHIFGSSAYQCRDATCSDSRSVGLIKYRDAYPFGVDPSWRGSRSELPFLNSLKMKM  547

Query  1130  SILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQ  951
             SIL G+ QMNLGIILSY NA YF + ++   QF+PQIIFLN+LFGYLS+LII KWCTGSQ
Sbjct  548   SILFGIVQMNLGIILSYLNARYFGNSLDIKYQFVPQIIFLNSLFGYLSLLIITKWCTGSQ  607

Query  950   ADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQHN-R  774
             ADLYHVMIYMFL P EDLGENQLF GQ   Q+VL++LA+++VPWML PKPFILK  H  R
Sbjct  608   ADLYHVMIYMFLSPFEDLGENQLFWGQGVLQVVLLILAIIAVPWMLFPKPFILKKLHTER  667

Query  773   HQGQSYAPIQDLDE-SLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLR  597
              QG++Y  +   D     V  S      +EF FSEVFVHQ+IH IEFVLG+VSNTASYLR
Sbjct  668   FQGRTYGILGTSDSYDDEVPDSVRQPQPDEFNFSEVFVHQMIHAIEFVLGSVSNTASYLR  727

Query  596   LWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHAL  417
             LWALSLAHSELSTVFYEKVL+LAWGY+N+II +VG  +F FAT  +LL+METLSAFLHAL
Sbjct  728   LWALSLAHSELSTVFYEKVLVLAWGYDNLIIRLVGLAVFAFATAFILLMMETLSAFLHAL  787

Query  416   RLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             RLHWVEFQNKFY GDGYKF PFSF  ++EEED
Sbjct  788   RLHWVEFQNKFYSGDGYKFVPFSFAALNEEED  819



>ref|XP_002986306.1| hypothetical protein SELMODRAFT_182335 [Selaginella moellendorffii]
 gb|EFJ12515.1| hypothetical protein SELMODRAFT_182335 [Selaginella moellendorffii]
Length=800

 Score =   969 bits (2504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 519/811 (64%), Positives = 641/811 (79%), Gaps = 15/811 (2%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             P M LFRSE M LVQLIIP+ESA  ++ +L +LG +QFKDLN EKSPFQRTYA Q+KR  
Sbjct  2     PKMHLFRSEDMTLVQLIIPVESAHGTLTHLAELGALQFKDLNPEKSPFQRTYANQVKRCD  61

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EM RKL++F DQ+ K+G++ + ++   D + FD+LEVK+ +LE E  E+N+N +KL+R+ 
Sbjct  62    EMLRKLQYFSDQLQKSGLAPTPSAVESD-LNFDELEVKINELEPEFREVNSNLEKLKRTR  120

Query  2387  NELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTSKQVR  2208
             NEL E+ LVL K G FF SAR +A +QQ+E  S   GE      L    +M  + SK+++
Sbjct  121   NELTEFLLVLDKAGAFFESARQNANSQQREDESISGGESIESPLLER--EMQVEPSKKLK  178

Query  2207  LGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSGE  2028
             +GFI+G++PK K+  FERI+FRATRGN+  +   +DE V DP +G++VEK VFLVF+SGE
Sbjct  179   VGFIAGVIPKHKANQFERIIFRATRGNMFYKCVPLDERVSDPATGDQVEKVVFLVFFSGE  238

Query  2027  RAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSIA  1848
             R++ KILKICDAFGANRYPF EE  K+ Q+  EVS ++SE++T +D    HR  +L++I 
Sbjct  239   RSRTKILKICDAFGANRYPFPEETLKRRQMRIEVSARLSEMQTTLDVSSDHRETVLKTIG  298

Query  1847  EQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNSE  1668
              Q + W  +V ++K +Y+ LNMLS+DVT KCLV E WSP  A   IQD L+ A  ++NS+
Sbjct  299   YQLELWLEMVLKDKYVYNALNMLSMDVTSKCLVGEAWSPLGALPRIQDTLRYATVETNSQ  358

Query  1667  IGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMF  1488
             +  IF+VL T+E+PPTYF+ NKFTSAFQEIVDAYGV +YQEANPGVFTIVTFPFLFAVMF
Sbjct  359   VTTIFQVLHTKEAPPTYFQVNKFTSAFQEIVDAYGVGRYQEANPGVFTIVTFPFLFAVMF  418

Query  1487  GDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEFF  1308
             GDWGHGI LLLATL+ L+ E++L SQKLGDI EM F GRYV+L+M+LFSIYTGFIYNEFF
Sbjct  419   GDWGHGIVLLLATLWLLVNERRLGSQKLGDIMEMAFAGRYVLLLMSLFSIYTGFIYNEFF  478

Query  1307  SVQFELFGRSAYVCRDPSCSDATTIGLIKARD-TYAFGVDPAWHGTRSELPFLNSLKMKL  1131
             SV FE+FGRSAY C  PSCS++TT+GL+K RD  YAFGVDP WHG+RSELPFLNSLKMK+
Sbjct  479   SVPFEIFGRSAYKCETPSCSESTTVGLVKYRDRPYAFGVDPVWHGSRSELPFLNSLKMKM  538

Query  1130  SILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQ  951
             SI+LGVAQM LGI+LS FNA YF   ++ W QFIPQI+FL++LFGYLS LII+KW TGSQ
Sbjct  539   SIILGVAQMLLGIVLSLFNAVYFAQPLDIWFQFIPQILFLSSLFGYLSFLIILKWITGSQ  598

Query  950   ADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQH-NR  774
             ADLYHVMIYMFLGPT+DL  NQLF GQK  QL L+ +AL+SVPWMLLPKP IL+ QH  +
Sbjct  599   ADLYHVMIYMFLGPTDDLDGNQLFAGQKYFQLALLFIALISVPWMLLPKPLILRKQHLEK  658

Query  773   HQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLRL  594
              QG+ YA +++  +           +HEEFEFSE+FVHQLIHTIEFVLGAVSNTASYLRL
Sbjct  659   TQGEGYAGLEEHPDE----------EHEEFEFSEIFVHQLIHTIEFVLGAVSNTASYLRL  708

Query  593   WALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHALR  414
             WALSLAH+ELS VFYEKVLLLAWGY NI I+++GFI+F+ AT+GVLLVMETLSAFLHALR
Sbjct  709   WALSLAHAELSAVFYEKVLLLAWGYQNIFIILIGFIVFVCATVGVLLVMETLSAFLHALR  768

Query  413   LHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             LHWVEF NKFY GDGYKF P SFV + +E++
Sbjct  769   LHWVEFMNKFYVGDGYKFQPLSFVNLGKEDE  799



>ref|XP_006365749.1| PREDICTED: vacuolar proton ATPase a1-like isoform X1 [Solanum 
tuberosum]
Length=818

 Score =   968 bits (2503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 506/811 (62%), Positives = 622/811 (77%), Gaps = 2/811 (0%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             P MDL RSE M  VQLIIP ESA  ++ YLG LGL+QF+DLNA+KSPFQRT+  Q+KR  
Sbjct  8     PLMDLMRSEKMTFVQLIIPAESAHRAITYLGQLGLLQFRDLNAKKSPFQRTFVNQVKRCV  67

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EM RKLR+FKDQ+ KAG+       +Q   + +++E++L + E ELIE+NAN++KL++S+
Sbjct  68    EMGRKLRYFKDQIHKAGLLLPPLPASQPDTELEEIEIQLAEHEHELIEMNANSEKLRQSY  127

Query  2387  NELVEYKLVLQKVGEFF-HSARssaeaqqqeygssqsgeesleapllsePDMSADTSKQV  2211
             NEL+E+K+VLQK   F   S+  + + + +   +  S +   +   L E +M ++ S Q 
Sbjct  128   NELLEFKMVLQKASGFLVSSSSHTTDREIELDENVYSNDNHGDTASLIEQEMHSELSNQS  187

Query  2210  RLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSG  2031
              + FISG++   K + FER+LFRATRGN+L  Q+  D+ ++DP S E VEK VF+VF+SG
Sbjct  188   GVRFISGIICNSKVLQFERMLFRATRGNMLFNQAVADDEILDPSSNEMVEKIVFVVFFSG  247

Query  2030  ERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSI  1851
             E+A+ KILKIC+AF AN YP  E+  K+ Q+  EV  ++SEL+T +DAG+ HR   L SI
Sbjct  248   EQARTKILKICEAFSANCYPVPEDTTKRRQITQEVLSRLSELETTLDAGLRHRDKALTSI  307

Query  1850  AEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNS  1671
                  +W  +V+ +K++Y TLNML+ DVTKKCLV EGW P  A  +IQ+ALQRA  DS+S
Sbjct  308   GYHLTKWINMVKTQKAVYDTLNMLNFDVTKKCLVGEGWCPIFAKTKIQEALQRATFDSSS  367

Query  1670  EIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVM  1491
             ++G IF V+   ESPPTYF+TN+FT+AFQEIVDAYGVAKYQEANP V+TIVTFPFLFAVM
Sbjct  368   QVGIIFHVMDAVESPPTYFRTNRFTNAFQEIVDAYGVAKYQEANPAVYTIVTFPFLFAVM  427

Query  1490  FGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEF  1311
             FGDWGHGICLLL  L  + RE KLSSQKLG   EM FGGRYV+L+M++FSIY G IYNEF
Sbjct  428   FGDWGHGICLLLGALVLIARESKLSSQKLGSFMEMLFGGRYVLLLMSIFSIYCGLIYNEF  487

Query  1310  FSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKL  1131
             FSV F +FG SAY CRD +CSDA T+GLIK +D Y FGVDP+W G+RSELPFLNSLKMK+
Sbjct  488   FSVPFHIFGDSAYKCRDATCSDAQTVGLIKYKDPYPFGVDPSWRGSRSELPFLNSLKMKM  547

Query  1130  SILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQ  951
             SILLGVAQMNLGIILSYFNA +F S ++   QFIPQIIFLN+LFGYLS+L++VKWCTGSQ
Sbjct  548   SILLGVAQMNLGIILSYFNARFFSSSLDIKYQFIPQIIFLNSLFGYLSLLVVVKWCTGSQ  607

Query  950   ADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQH-NR  774
             ADLYHVMIYMFL P E LGEN+LF GQ   Q++L+LLAL++VPWML PKPFILK  H  R
Sbjct  608   ADLYHVMIYMFLSPFEALGENRLFWGQSVLQVILLLLALIAVPWMLFPKPFILKRLHMER  667

Query  773   HQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLRL  594
              QG++Y  +   +              EEF FSEVFVHQ+IH+IEFVLGAVSNTASYLRL
Sbjct  668   FQGRTYGMLGTSEMGSDDQPDSARERAEEFNFSEVFVHQMIHSIEFVLGAVSNTASYLRL  727

Query  593   WALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHALR  414
             WALSLAHSELSTVFYEKVLLLAWGY NIII +VG  +F FAT  +LL+METLSAFLHALR
Sbjct  728   WALSLAHSELSTVFYEKVLLLAWGYENIIIRLVGLAVFAFATAFILLMMETLSAFLHALR  787

Query  413   LHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             LHWVEFQNKFY GDGYKF PFSF L+ ++ED
Sbjct  788   LHWVEFQNKFYHGDGYKFMPFSFALLADDED  818



>ref|XP_004505946.1| PREDICTED: vacuolar proton ATPase a1-like [Cicer arietinum]
Length=820

 Score =   968 bits (2503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 497/814 (61%), Positives = 616/814 (76%), Gaps = 5/814 (1%)
 Frame = -2

Query  2750  FPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRS  2571
             FPPMDL RSE M  VQLIIP ESA  ++ YLG LGL+QF+DLNAEKSPFQRT+  Q+KR 
Sbjct  8     FPPMDLMRSEKMTFVQLIIPAESAHRAITYLGQLGLLQFRDLNAEKSPFQRTFVNQVKRC  67

Query  2570  GEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRS  2391
              EM+RKLRF  DQ +KAG+ +S +    D I  +D+E +L + E E+IE+N+N++KLQ++
Sbjct  68    AEMSRKLRFLMDQTNKAGIKSSCSVLKSD-IYLEDIETQLAEHEHEIIEMNSNSEKLQQA  126

Query  2390  FNELVEYKLVLQKVGEFF---HSARssaeaqqqeygssqsgeesleapllsePDMSADTS  2220
             +NEL+E+K+VLQK   F    H    + E + +E   S             E       S
Sbjct  127   YNELLEFKIVLQKACSFLVSNHGHAVAEERELEENVYSNGDFVETPFLFEQETLPGPSKS  186

Query  2219  KQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVF  2040
              Q  L FISG++ K K ++FERILFRATRGN+L  Q+  DE ++DPIS E VEK VF+VF
Sbjct  187   NQSGLRFISGIICKSKVLSFERILFRATRGNMLFNQAPADEQIMDPISTEMVEKTVFVVF  246

Query  2039  YSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLL  1860
             +SGE+A+ KILKIC+AFGAN YP  E++ KQ Q+  EVS ++++L+  +DAGI HR   L
Sbjct  247   FSGEQARTKILKICEAFGANCYPVPEDITKQRQITREVSSRLTDLEATLDAGIRHRNKAL  306

Query  1859  QSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHD  1680
              S+     +W  +VRREK++Y TLNML+ DVTKKCLV EGW P  A  +IQ+ LQRA  D
Sbjct  307   SSVGGHLAKWMDMVRREKAVYDTLNMLNFDVTKKCLVGEGWCPLIAKTQIQEVLQRATFD  366

Query  1679  SNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLF  1500
             SNS++G IF  +   ESPPTYF+TN FT+ +QEIVDAYGVA+YQE NP V+T + FPFLF
Sbjct  367   SNSQVGVIFHSMDALESPPTYFRTNSFTNPYQEIVDAYGVARYQEVNPAVYTTIIFPFLF  426

Query  1499  AVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIY  1320
             AVMFGDWGHGICLLL  L  +  E KLS+Q+LG   EM FGGRYVIL+M+LFS+Y G IY
Sbjct  427   AVMFGDWGHGICLLLGALVLIAHESKLSNQRLGSFMEMLFGGRYVILLMSLFSMYCGLIY  486

Query  1319  NEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLK  1140
             NEFFSV F +FG SAY CRD SC DA T GL+K R+ Y FGVDP+W G+RSELPFLNSLK
Sbjct  487   NEFFSVPFHIFGASAYKCRDISCRDAHTTGLVKYREPYPFGVDPSWRGSRSELPFLNSLK  546

Query  1139  MKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCT  960
             MK+SIL GV  MNLGI+LSYFNA +F S ++   QF+PQ+IFLN+LFGYLS+LI++KWCT
Sbjct  547   MKMSILFGVVHMNLGIMLSYFNARFFGSSLDIRYQFVPQMIFLNSLFGYLSLLIVLKWCT  606

Query  959   GSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQH  780
             GSQADLYH+MIYMFL P ++LGEN+LF GQ+  Q++L+LLA+++VPWML PKPFILK  H
Sbjct  607   GSQADLYHIMIYMFLSPFDNLGENELFWGQRPLQVLLLLLAVIAVPWMLFPKPFILKKLH  666

Query  779   N-RHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASY  603
             N R QG++Y  +   +  L V+        EEF FSEVFVHQ+IH+IEFVLG+VSNTASY
Sbjct  667   NERFQGRTYGMLNTSEADLEVEPDSARQHREEFNFSEVFVHQMIHSIEFVLGSVSNTASY  726

Query  602   LRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLH  423
             LRLWALSLAHSELSTVFYEKVLLLAWGY+N+II +VG ++F FAT  +LL+METLSAFLH
Sbjct  727   LRLWALSLAHSELSTVFYEKVLLLAWGYDNLIIRLVGLVVFAFATAFILLMMETLSAFLH  786

Query  422   ALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             ALRLHWVEFQNKFY GDGYKF PFSF  + E+E+
Sbjct  787   ALRLHWVEFQNKFYHGDGYKFRPFSFATLTEDEN  820



>ref|XP_002456592.1| hypothetical protein SORBIDRAFT_03g038990 [Sorghum bicolor]
 gb|EES01712.1| hypothetical protein SORBIDRAFT_03g038990 [Sorghum bicolor]
Length=799

 Score =   968 bits (2502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 506/813 (62%), Positives = 622/813 (77%), Gaps = 25/813 (3%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             PPMD  RSE M  VQLI+P ES+RL+V YLG+LGL+QFKDLN +KSPFQR +  Q+KR  
Sbjct  8     PPMDHMRSEKMCFVQLIMPAESSRLAVTYLGELGLLQFKDLNEDKSPFQRIFVNQVKRCA  67

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EM+RKLRFF DQ+++AG                    +LG+ E EL+E+N N+DKLQ+++
Sbjct  68    EMSRKLRFFSDQINRAGA-------------------RLGEHEHELLEMNTNSDKLQQTY  108

Query  2387  NELVEYKLVLQKVGEFF---HSARssaeaqqqeygssqsgeesleapllsePDMSADTSK  2217
             NEL+E+KLVL K G      H+  +SAE +  E       +E     L       A  + 
Sbjct  109   NELLEFKLVLSKAGGILASSHNHAASAERELDENIDDNGVDEGNAYLLEQGVHQRAHGNS  168

Query  2216  QVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFY  2037
              VR  F+SG++ K K++AFER+LFRATRGN+L  Q+   E V DPISGE+VEK VF+VF+
Sbjct  169   GVR--FVSGIILKSKALAFERMLFRATRGNMLFNQASAGEPVTDPISGEEVEKTVFVVFF  226

Query  2036  SGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQ  1857
             SGE+AK KILKICD+FGA+ YP  EE+ KQ Q+  EVS ++S+L+  +DAGI HR   L+
Sbjct  227   SGEQAKAKILKICDSFGASCYPVPEEMVKQRQIFNEVSARLSDLEVTLDAGIQHRNKALE  286

Query  1856  SIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDS  1677
             SI  Q  RW ++V++EK++Y TLNML+ DVTKKCLV EGW P  A  +I+D LQRA   S
Sbjct  287   SIGSQLWRWTIMVKKEKAVYDTLNMLNFDVTKKCLVGEGWCPIFAKSQIKDCLQRATLHS  346

Query  1676  NSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFA  1497
             NS++G IF  + T ESPPTYF+T+KFT+AFQEIVDAYGVA+YQEANP V+++VTFPFLFA
Sbjct  347   NSQVGTIFHEMDTIESPPTYFRTDKFTNAFQEIVDAYGVARYQEANPAVYSVVTFPFLFA  406

Query  1496  VMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYN  1317
             VMFGDWGHGICLLL  L  ++REK+LSSQKL    E+ FGGRYVIL+MA+FSIY G IYN
Sbjct  407   VMFGDWGHGICLLLGALVLIVREKRLSSQKLSSFMELAFGGRYVILLMAIFSIYCGLIYN  466

Query  1316  EFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKM  1137
             EFFSV F +FG+SAY CRD SCSDA TIGLIK RD Y FGVDP+W G+RSELPFLNSLKM
Sbjct  467   EFFSVPFHIFGKSAYECRDKSCSDAHTIGLIKVRDPYPFGVDPSWRGSRSELPFLNSLKM  526

Query  1136  KLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTG  957
             K+SIL+GVAQMNLGI+LSYF+A +  + ++   QFIPQ+IFLN+LFGYL++LI++KWCTG
Sbjct  527   KMSILMGVAQMNLGIVLSYFDARFHGNALDIRYQFIPQMIFLNSLFGYLALLILIKWCTG  586

Query  956   SQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQHN  777
             SQADLYHVMIYMFL P  DLGENQLF GQK  Q++L+LLALV+VPWML PKPFILK  H 
Sbjct  587   SQADLYHVMIYMFLDPAGDLGENQLFWGQKELQILLLLLALVAVPWMLFPKPFILKKLHK  646

Query  776   -RHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYL  600
              R QG +Y  +   +     +     + H++F FSEVFVHQ+IH+IEFVLGAVSNTASYL
Sbjct  647   ERFQGHTYRFLGTSEMDPDSEPDSARARHDDFNFSEVFVHQMIHSIEFVLGAVSNTASYL  706

Query  599   RLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHA  420
             RLWALSLAHSELSTVFYEK+LLLAWGY+N+I+ + G I+F FAT  +LL+METLSAFLHA
Sbjct  707   RLWALSLAHSELSTVFYEKLLLLAWGYDNLIVKLGGLIVFAFATAFILLMMETLSAFLHA  766

Query  419   LRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             LRLHWVEF NKFY GDGYKF PFSF L+ ++ED
Sbjct  767   LRLHWVEFMNKFYHGDGYKFKPFSFALLADDED  799



>ref|XP_011089368.1| PREDICTED: V-type proton ATPase subunit a1-like isoform X1 [Sesamum 
indicum]
Length=819

 Score =   967 bits (2500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 508/816 (62%), Positives = 632/816 (77%), Gaps = 11/816 (1%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             P MDL RSE M LVQLIIP+ESA  +V+YLG+LGL+QF+DLN +KSPFQRT+  Q+KR  
Sbjct  8     PAMDLMRSEKMMLVQLIIPVESAHRAVSYLGELGLLQFRDLNDDKSPFQRTFVNQVKRCA  67

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EM+RKLRF K+Q+ KAG++ S +   Q  I  ++LE++L + E  LIE+NAN++KLQ+++
Sbjct  68    EMSRKLRFIKEQIHKAGLTPSPSPAPQPDIDLEELEIQLEEHEHGLIEMNANSEKLQQTY  127

Query  2387  NELVEYKLVLQKVGEFFHS-ARssaeaqqqeygssqsgeesleapllsePDMSADTSKQV  2211
             NEL+E+K+VLQK G+F  S     A  + +   +    ++  E   L E +M    S Q 
Sbjct  128   NELLEFKMVLQKAGDFLLSTGSHVATQETELAENIHVNDDYAETSSLLEQEMLPGPSNQT  187

Query  2210  RLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSG  2031
              + FISG++ K K + FER+LFR TRGN+L  Q+  D+ ++DP + E VEK VF+VF+SG
Sbjct  188   GVRFISGIICKSKVLRFERMLFRTTRGNMLFNQAPTDDQILDPATNELVEKIVFVVFFSG  247

Query  2030  ERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSI  1851
             E+A+ KILKIC+AFGAN YP AE+  ++ Q+  EV   +S+L+T ++AG+ HR   L SI
Sbjct  248   EQARVKILKICEAFGANCYPVAEDTIRRRQITREVLSHLSDLETTLEAGLRHRDKALISI  307

Query  1850  AEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNS  1671
                  +W  +VRREK++Y TLNML+ DVTKKCLV EGW P  A  +IQ+ALQRA  DSNS
Sbjct  308   GFHLAKWMNMVRREKAVYDTLNMLNFDVTKKCLVGEGWCPIFAKTKIQEALQRATTDSNS  367

Query  1670  EIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVM  1491
             ++G IF V+ + ESPPTYFKTN  T+A+QEIVDAYGVAKYQEANP V+TI+TFPFLFAVM
Sbjct  368   QVGVIFHVMHSVESPPTYFKTNHLTNAYQEIVDAYGVAKYQEANPAVYTIITFPFLFAVM  427

Query  1490  FGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEF  1311
             FGDWGHGICLLL  L+ + REKKL SQKLG   EM FGGRYV+L+M+LFSIY G IYNEF
Sbjct  428   FGDWGHGICLLLGALFLIAREKKLGSQKLGSFMEMLFGGRYVLLLMSLFSIYCGLIYNEF  487

Query  1310  FSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKL  1131
             FSV F +FG SAY CRD +CSD+ ++GL+K +DTY FGVDP+W G+RSELPFLNSLKMK+
Sbjct  488   FSVPFHIFGNSAYRCRDTTCSDSRSVGLVKYQDTYPFGVDPSWRGSRSELPFLNSLKMKM  547

Query  1130  SILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQ  951
             SIL G+AQMNLGIILSYFNA YF + ++   QF+PQ+IFLN+LFGYLS+LII+KWC+GSQ
Sbjct  548   SILFGIAQMNLGIILSYFNARYFGNSLDIKYQFVPQMIFLNSLFGYLSLLIIIKWCSGSQ  607

Query  950   ADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQHN-R  774
             ADLYHVMIYMFL P EDLGEN+LF GQ   Q++L+LLA+++VPWML PKPFILK  H  R
Sbjct  608   ADLYHVMIYMFLSPFEDLGENKLFWGQNVLQVILLLLAVIAVPWMLFPKPFILKRLHTER  667

Query  773   HQGQSY-----APIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTA  609
              QG+SY     + I D +E      S      EEF FSEVFVHQ+IH+IEFVLGAVSNTA
Sbjct  668   FQGRSYTALGTSDIYDDEEP----DSAREPHLEEFNFSEVFVHQMIHSIEFVLGAVSNTA  723

Query  608   SYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAF  429
             SYLRLWALSLAHSELSTVFYEKVLLLAWGY+N++I +VG  +F FAT  +LL+METLSAF
Sbjct  724   SYLRLWALSLAHSELSTVFYEKVLLLAWGYDNLVIRLVGLAVFSFATAFILLMMETLSAF  783

Query  428   LHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             LHALRLHWVEFQNKFY GDGYKF PFSF  ++E+ED
Sbjct  784   LHALRLHWVEFQNKFYSGDGYKFRPFSFAALNEDED  819



>ref|XP_008805029.1| PREDICTED: vacuolar proton ATPase a1-like [Phoenix dactylifera]
Length=818

 Score =   967 bits (2500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 500/811 (62%), Positives = 626/811 (77%), Gaps = 3/811 (0%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             PPMD  RSE M  VQLIIP+ESA  ++ YLG+LG++QF+DLN +KSPFQRT+  Q+KR G
Sbjct  9     PPMDHLRSEKMSFVQLIIPVESAHRAITYLGELGMLQFRDLNDDKSPFQRTFVNQVKRCG  68

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EM+RKLRFF DQ+SKAG+++SA    Q  I  ++LEV+L + EAEL+E+N NN++L++++
Sbjct  69    EMSRKLRFFSDQISKAGITSSACPALQ-PISLEELEVQLAEHEAELLEMNMNNEQLRQAY  127

Query  2387  NELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMS-ADTSKQV  2211
             NEL+E+KLVL K G F  S+++     ++E   +   +E  +  L      + ++ S + 
Sbjct  128   NELLEFKLVLLKAGSFLGSSQNHEIPAERELDENVYSKEKDQESLSLFDQETLSEMSNKA  187

Query  2210  RLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSG  2031
              L FISG++ K K++ FER+LFR TRGN+   Q+  +E V+DP+SGE VEK VF+VF+SG
Sbjct  188   GLRFISGIICKWKALRFERLLFRTTRGNMFFNQAPAEEHVMDPVSGEMVEKIVFVVFFSG  247

Query  2030  ERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSI  1851
             E+AK KI+KIC+AFGAN YP  E+  KQ+Q+  EVS ++SEL+  +DAGI HR + L SI
Sbjct  248   EQAKTKIIKICEAFGANCYPVPEDTNKQSQMTREVSSRLSELEATLDAGIHHRNSALASI  307

Query  1850  AEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNS  1671
               Q  RW ++VR+EK++Y TLNML+ DVTKKCLV EGW P  A  +I+DALQRA  DSNS
Sbjct  308   GSQLWRWTIMVRKEKAVYDTLNMLNFDVTKKCLVGEGWCPIFAKPQIKDALQRATIDSNS  367

Query  1670  EIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVM  1491
             + G IF V+   ESPPTYF+TN+FT AFQEI+DAYGVA+YQEANP V++++TFPFLFAVM
Sbjct  368   QAGIIFHVMHAIESPPTYFRTNRFTHAFQEIIDAYGVARYQEANPAVYSVITFPFLFAVM  427

Query  1490  FGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEF  1311
             FGDWGHGICLLL +L  +IREK+L SQKLG    M FGGRYV+L+MALFSIY G IYNEF
Sbjct  428   FGDWGHGICLLLGSLLLIIREKRLGSQKLGSFMGMAFGGRYVLLLMALFSIYCGLIYNEF  487

Query  1310  FSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKL  1131
             FSV F +FG SAY CR+ SCSDA T GL+K  D Y FGVDP W G+ SELPFLNSLKMK+
Sbjct  488   FSVPFHIFGESAYKCREISCSDARTTGLVKYHDPYPFGVDPRWRGSLSELPFLNSLKMKM  547

Query  1130  SILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQ  951
             SIL GV+QMNLGIIL YFNA +  S ++   QF+PQ+IFLN+LFGYLS+LI++KWCTGSQ
Sbjct  548   SILFGVSQMNLGIILGYFNAKFRGSSLDIRYQFMPQMIFLNSLFGYLSLLILIKWCTGSQ  607

Query  950   ADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKS-QHNR  774
             ADLYHVMIYMFL PT DLGENQLF GQK  Q++L+LLA+V+VPWML PKPFIL+     R
Sbjct  608   ADLYHVMIYMFLDPTSDLGENQLFWGQKPLQILLLLLAIVAVPWMLFPKPFILRKLNMER  667

Query  773   HQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLRL  594
              QG++Y  +   +    ++        ++F F EVFVHQ+IH+IEFVLGAVSNTASYLRL
Sbjct  668   FQGRTYGILGTSEMDFDLEPDSGRQHLDDFNFGEVFVHQMIHSIEFVLGAVSNTASYLRL  727

Query  593   WALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHALR  414
             WALSLAHSELSTVFYEK+LLLAWGY+N II + G  +F FAT  +LL+METLSAFLHALR
Sbjct  728   WALSLAHSELSTVFYEKILLLAWGYDNPIIRIAGLAVFAFATAFILLMMETLSAFLHALR  787

Query  413   LHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             LHWVEF NKFY GDGYKF PFSF  + +EED
Sbjct  788   LHWVEFMNKFYHGDGYKFRPFSFASLADEED  818



>ref|NP_001044718.2| Os01g0834200 [Oryza sativa Japonica Group]
 dbj|BAD73785.1| putative vacuolar-type H(+)-ATPase [Oryza sativa Japonica Group]
 dbj|BAG94648.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF06632.2| Os01g0834200 [Oryza sativa Japonica Group]
Length=818

 Score =   966 bits (2498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 494/811 (61%), Positives = 626/811 (77%), Gaps = 2/811 (0%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             PPMD  RSE M  VQLIIP ESARL+V YLG+LGL+QFKDLN +KSPFQR +  Q+KR  
Sbjct  8     PPMDRLRSEKMCFVQLIIPAESARLAVTYLGELGLLQFKDLNEDKSPFQRIFVNQVKRCS  67

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EM+RKLRFF DQ++KAGV +S     Q  I  ++LE KL + E +L+E+N N++KL +++
Sbjct  68    EMSRKLRFFNDQINKAGVKSSVRPAMQPDIDLEELEAKLREHENDLLEMNTNSEKLLQTY  127

Query  2387  NELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePD-MSADTSKQV  2211
             NEL+E+K+VL K G    S+ + A   ++E       +E  +         +    S+  
Sbjct  128   NELLEFKMVLSKAGGILASSHNHAAPAERELDEHIYDKEMDDGNAYLLEQGVHLGASENS  187

Query  2210  RLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSG  2031
              + F+SG++ K K+MAFER+LFRATRGN+   Q+   E V DPISGE+VEK VF+VF+SG
Sbjct  188   GVKFVSGIILKSKAMAFERMLFRATRGNMFFNQAPAGEPVTDPISGEEVEKTVFVVFFSG  247

Query  2030  ERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSI  1851
             ++AK KILKIC +FGA+ YP  EE+ KQ Q+  EVSG++++L+  +DAGI HR   L+S+
Sbjct  248   DQAKAKILKICGSFGASCYPVPEEMVKQRQIFREVSGRLADLEATLDAGIQHRNKALESV  307

Query  1850  AEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNS  1671
               Q  RW ++V++EK++Y TLNML+ DVTKKCLV EGW P  A  +I+D LQRA   SNS
Sbjct  308   GSQLWRWTIMVKKEKAVYDTLNMLNFDVTKKCLVGEGWCPIFAKSQIKDVLQRATLHSNS  367

Query  1670  EIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVM  1491
             ++G IF  + T +SPPTYF+T+KFT+AFQEIVDAYG+A+Y+EANP V++++TFPFLFAVM
Sbjct  368   QVGIIFHEMDTIDSPPTYFQTDKFTNAFQEIVDAYGIARYEEANPAVYSVITFPFLFAVM  427

Query  1490  FGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEF  1311
             FGDWGHGICLLL     ++REKKLSSQKLG   EM FGGRYVIL+MALFSIY G IYNEF
Sbjct  428   FGDWGHGICLLLGACVLILREKKLSSQKLGSFMEMAFGGRYVILLMALFSIYCGLIYNEF  487

Query  1310  FSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKL  1131
             FSV F +FG+SAY CR+ +CSDA T GLIK RD Y FGVDP+W G+RSELPFLNSLKMK+
Sbjct  488   FSVPFHIFGKSAYECREKTCSDAHTAGLIKVRDPYPFGVDPSWRGSRSELPFLNSLKMKM  547

Query  1130  SILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQ  951
             SIL+GV QMNLGI+LSYF+A +  + ++   QFIPQ+IFLN+LFGYL++LI++KWCTGSQ
Sbjct  548   SILMGVTQMNLGIVLSYFDAKFHGNALDIRYQFIPQMIFLNSLFGYLALLILIKWCTGSQ  607

Query  950   ADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQHN-R  774
             ADLYHVMIYMFL P+ +LGENQLF GQK  Q++L+L+A+V+VPWML PKPFILK  H  R
Sbjct  608   ADLYHVMIYMFLDPSGNLGENQLFWGQKELQILLLLMAIVAVPWMLFPKPFILKKLHKER  667

Query  773   HQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLRL  594
              QG +Y  +   +     +     S H++F FSEVFVHQ+IH+IEFVLGAVSNTASYLRL
Sbjct  668   FQGHTYRFLGTSEMDPDSEPDSARSRHDDFNFSEVFVHQMIHSIEFVLGAVSNTASYLRL  727

Query  593   WALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHALR  414
             WALSLAHSELSTVFYEK+L+LAWGY+N+++ +VG +IF FAT  +LL ME+LSAFLHALR
Sbjct  728   WALSLAHSELSTVFYEKLLVLAWGYDNLVVKLVGLVIFSFATAFILLGMESLSAFLHALR  787

Query  413   LHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             LHWVEF NKFY GDGYKF PFSF L+ ++ED
Sbjct  788   LHWVEFMNKFYHGDGYKFRPFSFALLADDED  818



>gb|KHG14971.1| vatM [Gossypium arboreum]
Length=808

 Score =   965 bits (2494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 507/810 (63%), Positives = 628/810 (78%), Gaps = 14/810 (2%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             PPMDL RSE M LVQLIIP+ESA  +++YLG+LGL+QF+DLN+E+SPFQRT+  Q+KR G
Sbjct  12    PPMDLMRSEKMTLVQLIIPVESAHRAISYLGELGLLQFRDLNSERSPFQRTFVNQVKRCG  71

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EM+RKLRFFKDQ+SKAG+ +S +   +  ++ ++LE++L + E ELIE+N+N++KL+ ++
Sbjct  72    EMSRKLRFFKDQISKAGLLSSVHPVVEPDLELEELEIQLAEHEHELIEMNSNSEKLRVTY  131

Query  2387  NELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTSKQVR  2208
             NEL+E+KLVLQK   F   + S+    ++   +             S  +     + Q  
Sbjct  132   NELLEFKLVLQKACGFLLPS-SNHAVAEERELTENIYSNDDYVETASLLEQETRPADQSG  190

Query  2207  LGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSGE  2028
             L FISG++ K K++ FER+LFRATRGN+L  Q+   E ++DP+S E VEK VF+V +SGE
Sbjct  191   LRFISGIICKSKALRFERMLFRATRGNMLFNQAPAGEEIMDPLSAEMVEKTVFVVHFSGE  250

Query  2027  RAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSIA  1848
             +A+ KILKIC+AFGAN YP  +++ KQ Q+  EVS  +SEL+T +DAGI HR   L SI 
Sbjct  251   QARTKILKICEAFGANCYPVPDDISKQRQITREVSSHLSELETTLDAGIRHRNKALTSIG  310

Query  1847  EQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNSE  1668
                 +W  +VRREK++Y TLNML+ DVTKKCLV EGW P  A  +IQ+ALQRA  DS+S+
Sbjct  311   YHLTQWTSMVRREKAVYDTLNMLNFDVTKKCLVGEGWCPIFAKAQIQEALQRATFDSSSQ  370

Query  1667  IGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMF  1488
             +G IF V+   ESPPTYF+TN FT+A+QEIVDAYGVA+YQEANP V+T+VTFPFLFAVMF
Sbjct  371   VGIIFHVMDAVESPPTYFRTNHFTNAYQEIVDAYGVARYQEANPAVYTVVTFPFLFAVMF  430

Query  1487  GDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEFF  1308
             GDWGHGICLLL  L            KLG   EM FGGRYV+L+M+LFSIY G IYNEFF
Sbjct  431   GDWGHGICLLLGAL------------KLGSFMEMLFGGRYVLLLMSLFSIYCGLIYNEFF  478

Query  1307  SVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKLS  1128
             SV F +FG SAY CRD +CSDA + GLIK RD Y FGVDP+W G+RSELPFLNSLKMK+S
Sbjct  479   SVPFHIFGGSAYKCRDVTCSDAKSAGLIKFRDPYPFGVDPSWRGSRSELPFLNSLKMKMS  538

Query  1127  ILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQA  948
             ILLGVAQMNLGIILSYFNA +FRS ++   QF+PQ+IFLN+LFGYLS+LII+KWCTGSQA
Sbjct  539   ILLGVAQMNLGIILSYFNARFFRSSLDIRYQFVPQMIFLNSLFGYLSLLIIIKWCTGSQA  598

Query  947   DLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQHN-RH  771
             DLYHVMIYMFL PT+DLGEN+LF GQ+  Q+VL+LLALV+VPWML PKPFILK  H+ R 
Sbjct  599   DLYHVMIYMFLSPTDDLGENELFWGQRPLQIVLLLLALVAVPWMLFPKPFILKKLHSERF  658

Query  770   QGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLRLW  591
             QG++Y  +   +  L V+       HEEF FSEVFVHQ+IH+IEFVLGAVSNTASYLRLW
Sbjct  659   QGRTYGLLGSSEFDLDVEPDSARDHHEEFNFSEVFVHQMIHSIEFVLGAVSNTASYLRLW  718

Query  590   ALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHALRL  411
             ALSLAHSELSTVFYEKVLLLAWGY+NI+I ++G  +F FAT  +LL+METLSAFLHALRL
Sbjct  719   ALSLAHSELSTVFYEKVLLLAWGYDNIVIRLIGLAVFAFATAFILLMMETLSAFLHALRL  778

Query  410   HWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             HWVEFQNKFY GDGYKF PFSF L+ +++D
Sbjct  779   HWVEFQNKFYHGDGYKFKPFSFALITDDDD  808



>ref|XP_009410597.1| PREDICTED: vacuolar proton ATPase a1 [Musa acuminata subsp. malaccensis]
Length=818

 Score =   964 bits (2493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 512/814 (63%), Positives = 634/814 (78%), Gaps = 8/814 (1%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             P MD  RSE M LVQ+IIP+ESA  +V+YLG+LGL+Q KDLN +KSPFQRT+  Q+KR G
Sbjct  8     PSMDHLRSEDMSLVQVIIPVESAHRAVSYLGELGLLQLKDLNEDKSPFQRTFVNQVKRCG  67

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EM+RKLRFF DQ+SKAG++AS    +Q  I  ++LEV+L + EAEL+E+NAN++KL++++
Sbjct  68    EMSRKLRFFGDQISKAGITASPCPASQQVIDLEELEVRLSEHEAELLEMNANSEKLRQTY  127

Query  2387  NELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTSKQVR  2208
             NEL+E+KLVL K G F  +A++ A   + E   S   ++  E+  L E  +  + S +  
Sbjct  128   NELLEFKLVLLKAGGFLVAAQNHAVPAETELVESIYSKKDDESLFLLEQSVQPEPSSKAG  187

Query  2207  LGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSGE  2028
             L FISG++ K K + FER+LFRATRGN+   Q+   E V+DP+SGE VEK VF+VF+SGE
Sbjct  188   LRFISGIICKSKELTFERMLFRATRGNMFFNQAPAGEQVMDPVSGEMVEKTVFVVFFSGE  247

Query  2027  RAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSIA  1848
             +AKNKILKIC AFGA+ YP  EE  KQ QL  EVS ++SEL+  +DAG  HR   L SIA
Sbjct  248   QAKNKILKICQAFGASCYPVPEENSKQMQLTREVSLRLSELEATLDAGNRHRNKALASIA  307

Query  1847  EQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNSE  1668
              Q   W ++V++EK +Y TLNML+ DVTKKCLV EGW PT A  +I++AL+ A   SNS+
Sbjct  308   SQLWNWIIMVKKEKGVYDTLNMLNFDVTKKCLVGEGWCPTFAKPQIKEALEHASIHSNSQ  367

Query  1667  IGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMF  1488
             +G IF  + + ESPPTYF+TN FT AFQEIVDAYGVA+YQEANP V++++TFPFLFAVMF
Sbjct  368   VGIIFHDMDSFESPPTYFRTNWFTHAFQEIVDAYGVARYQEANPAVYSVITFPFLFAVMF  427

Query  1487  GDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEFF  1308
             GDWGHG+CLLL +L  ++REKKL SQKLG   EM FGGRYV+L+MALFSIY G IYNEFF
Sbjct  428   GDWGHGLCLLLGSLILILREKKLGSQKLGSFMEMAFGGRYVVLLMALFSIYCGLIYNEFF  487

Query  1307  SVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKLS  1128
             SV F++FG+SAY CRD SCSDA T GLIK RD Y FGVDP W G+RSELPFLNSLKMK+S
Sbjct  488   SVPFQIFGKSAYKCRDSSCSDAHTAGLIKYRDPYPFGVDPRWRGSRSELPFLNSLKMKMS  547

Query  1127  ILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQA  948
             ILLGV+QMNLGIILSYF+A +  S ++   QF+PQ+IFLN+LFGYL++LI++KWCTGSQA
Sbjct  548   ILLGVSQMNLGIILSYFDAKFHGSSLDVRYQFMPQMIFLNSLFGYLALLIVIKWCTGSQA  607

Query  947   DLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQHN-RH  771
             DLYHVMIYMFL PT DLGEN+LF GQK  Q++L+L+A+V+VPWML PKPFIL+  H  R 
Sbjct  608   DLYHVMIYMFLNPTGDLGENKLFWGQKELQILLLLMAIVAVPWMLFPKPFILRKLHTERF  667

Query  770   QGQSYAPI----QDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASY  603
             QG++Y  +     D+D       S     HE+F FSEVFVHQ+IH+IEFVLGAVSNTASY
Sbjct  668   QGRTYGILGTSEMDVDHD---PDSARRQHHEDFNFSEVFVHQMIHSIEFVLGAVSNTASY  724

Query  602   LRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLH  423
             LRLWALSLAHSELSTVFYEK+LLLAWGY+++II + G  +F FAT  +LL+METLSAFLH
Sbjct  725   LRLWALSLAHSELSTVFYEKLLLLAWGYDSVIIRIAGLAVFAFATAFILLMMETLSAFLH  784

Query  422   ALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             ALRLHWVEF  KFY GDGYKF PFSF L+ +EED
Sbjct  785   ALRLHWVEFMGKFYHGDGYKFKPFSFKLLADEED  818



>ref|XP_006409880.1| hypothetical protein EUTSA_v10016255mg [Eutrema salsugineum]
 gb|ESQ51333.1| hypothetical protein EUTSA_v10016255mg [Eutrema salsugineum]
Length=820

 Score =   963 bits (2490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 507/815 (62%), Positives = 630/815 (77%), Gaps = 9/815 (1%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             P MDL RSE M LVQLIIP+ESA  SV YLG+LGL+QF+DLNA+KSPFQRT+A Q+KR G
Sbjct  9     PQMDLMRSEKMTLVQLIIPVESAHRSVTYLGELGLLQFRDLNADKSPFQRTFANQVKRCG  68

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EM+RKLRFFKDQ+ KAG+  S   + +  I+  DLE +L + E E++E+N+N++KL++++
Sbjct  69    EMSRKLRFFKDQIDKAGLRCSPRHELEPDIELGDLERQLAEHEHEVLEMNSNSEKLRQTY  128

Query  2387  NELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgee-sleapllsePDMSADTSKQV  2211
             NEL+E+K+VLQK   F  S+ + A   + E           +E   L E +M  +   Q 
Sbjct  129   NELLEFKIVLQKASGFLVSSNAHAIGDETELHEGTYSNNGFIETASLLEQEMRPEPLNQS  188

Query  2210  RLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSG  2031
              L FISG++ KEK + FER+LFRATRGN+L  Q+  DE ++DP + E VEK VF+VF+SG
Sbjct  189   GLRFISGIINKEKLLRFERMLFRATRGNMLFNQTPSDEEIMDPSTSEMVEKIVFVVFFSG  248

Query  2030  ERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSI  1851
             E+AK KILKIC+AFGAN YP  E+  KQ QL  EV  ++S+L+  +DAGI HR N L S+
Sbjct  249   EQAKTKILKICEAFGANCYPVPEDTTKQRQLTREVLSRLSDLEATLDAGIRHRNNALNSV  308

Query  1850  AEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNS  1671
                  +W   VRREK++Y TLNML+ DVTKKCLV EGW PT A  +I + LQRA  DSNS
Sbjct  309   GYSLTKWMTTVRREKAVYDTLNMLNFDVTKKCLVGEGWCPTFAKTQIHEVLQRATFDSNS  368

Query  1670  EIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVM  1491
             ++G IF V+   ESPPTYF+TNK T+AFQEI+DAYGVA+YQEANP V+++VT+PFLFAVM
Sbjct  369   QVGVIFHVMQAVESPPTYFRTNKLTNAFQEIIDAYGVARYQEANPAVYSVVTYPFLFAVM  428

Query  1490  FGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEF  1311
             FGDWGHG+CLLL  LY L RE+KLS+QKLG   EM FGGRYVIL+MALFSIY G IYNEF
Sbjct  429   FGDWGHGLCLLLGALYLLARERKLSTQKLGSFMEMLFGGRYVILLMALFSIYCGLIYNEF  488

Query  1310  FSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKL  1131
             FSV F +FG SAY CRD +CSDA T+GL+K RD Y FGVDP+W G+RSELP+LNSLKMK+
Sbjct  489   FSVPFHIFGGSAYKCRDTTCSDAYTVGLVKYRDPYPFGVDPSWRGSRSELPYLNSLKMKM  548

Query  1130  SILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQ  951
             SILLG+AQMNLG+ILS+FNA +F S ++   QFIPQ+IFLN+LFGYLS+LII+KWCTGSQ
Sbjct  549   SILLGIAQMNLGLILSFFNARFFGSSLDIRYQFIPQMIFLNSLFGYLSLLIIIKWCTGSQ  608

Query  950   ADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQH-NR  774
             ADLYHVMIYMFL PTE+LG+N+LF GQ+  Q++L+L+A ++VPWML PKPF L+  H  R
Sbjct  609   ADLYHVMIYMFLSPTEELGDNELFWGQRPLQILLLLMAFIAVPWMLFPKPFALRKIHMER  668

Query  773   HQGQSYAPIQ----DLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTAS  606
              QG++Y  +     DLD   +   S      EEF FSE+FVHQLIH+IEFVLG+VSNTAS
Sbjct  669   FQGRTYGVLGTSEVDLD---VEPDSARGHQEEEFNFSEIFVHQLIHSIEFVLGSVSNTAS  725

Query  605   YLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFL  426
             YLRLWALSLAHSELSTVFYEKVLLLAWGY NI+I ++G  +F FAT  +LL+METLSAFL
Sbjct  726   YLRLWALSLAHSELSTVFYEKVLLLAWGYENILIRLIGVAVFAFATAFILLMMETLSAFL  785

Query  425   HALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             HALRLHWVEF  KF+ GDGYKF PFSF L+ ++++
Sbjct  786   HALRLHWVEFMGKFFNGDGYKFKPFSFALISDDDE  820



>ref|XP_010510601.1| PREDICTED: V-type proton ATPase subunit a1-like [Camelina sativa]
Length=821

 Score =   962 bits (2488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 503/813 (62%), Positives = 633/813 (78%), Gaps = 4/813 (0%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             P MDL RSE M LVQLIIP+ESA  S+ YLG+LGL+QF+DLNA+KSPFQRT+A Q+KR G
Sbjct  9     PQMDLMRSEKMTLVQLIIPVESAHRSITYLGELGLLQFRDLNADKSPFQRTFANQVKRCG  68

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EM+RKLRFFKDQ+ KAG+  S   + +  I+  DLE +L D E E++E+N+N++KL++++
Sbjct  69    EMSRKLRFFKDQIDKAGLRCSPRHEIEPDIELGDLERQLADHEHEVLEMNSNSEKLRQTY  128

Query  2387  NELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgee-sleapllsePDMSADTSKQV  2211
             NEL+E+K+VLQK   F  S+ + A  ++ E   S       +E   L E +M+   S Q 
Sbjct  129   NELLEFKIVLQKASGFLVSSNAHAIGEETELHESTYSNNGFIETASLLEQEMNPGPSSQS  188

Query  2210  RLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSG  2031
              L FISG++ K+K + FER+LFRATRGN+L  Q+  DE ++DP + E VEK VF+VF+SG
Sbjct  189   GLRFISGIINKDKLLRFERMLFRATRGNMLFNQTPSDEEIMDPSTSEMVEKIVFVVFFSG  248

Query  2030  ERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSI  1851
             E+A+ KILKIC+AFGAN YP  E+  KQ QL  EV  ++S+L+  +DAG  HR + L S+
Sbjct  249   EQARTKILKICEAFGANCYPVPEDTTKQRQLTREVLSRLSDLEATLDAGTRHRNSALNSV  308

Query  1850  AEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNS  1671
                   W   VRREK++Y TLNML+ DVTKKCLV EGW PT A  +I + LQRA  DSNS
Sbjct  309   GYSLTNWMTTVRREKAVYDTLNMLNFDVTKKCLVGEGWCPTFAKTQIHEVLQRATFDSNS  368

Query  1670  EIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVM  1491
             ++G IF V+   ESPPTYF+TNK T+AFQEI+DAYGVA+YQEANP V+++VT+PFLFAVM
Sbjct  369   QVGVIFHVMQAVESPPTYFRTNKLTNAFQEIIDAYGVARYQEANPAVYSVVTYPFLFAVM  428

Query  1490  FGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEF  1311
             FGDWGHG+CLLL  LY L RE+KLS+QKLG   EM FGGRYVIL+M+LFSIY G IYNEF
Sbjct  429   FGDWGHGLCLLLGALYLLARERKLSTQKLGSFMEMLFGGRYVILLMSLFSIYCGLIYNEF  488

Query  1310  FSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKL  1131
             FSV F +FG SAY CRD +CSDA T+GL+K RD Y FGVDP+W+G+RSELP+LNSLKMK+
Sbjct  489   FSVPFHIFGGSAYKCRDTTCSDAYTVGLVKYRDPYPFGVDPSWYGSRSELPYLNSLKMKM  548

Query  1130  SILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQ  951
             SILLG+AQMNLG+ILS+FNA +F S ++   QFIPQ+IFLN+LFGYLS+LII+KWCTGSQ
Sbjct  549   SILLGIAQMNLGLILSFFNARFFGSSLDIRYQFIPQMIFLNSLFGYLSLLIIIKWCTGSQ  608

Query  950   ADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQH-NR  774
             ADLYHVMIYMFL PTE+LGEN+LF GQ+  Q++L+L A ++VPWML PKPF L+  H  R
Sbjct  609   ADLYHVMIYMFLSPTEELGENELFWGQRPLQILLLLSAFIAVPWMLFPKPFALRKIHMER  668

Query  773   HQGQSYAPI--QDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYL  600
              QG++Y  +   ++D  +  D +      EEF FSE+FVHQLIH+IEFVLG+VSNTASYL
Sbjct  669   FQGRTYGVLGSSEVDLDVEPDSARGGHHEEEFNFSEIFVHQLIHSIEFVLGSVSNTASYL  728

Query  599   RLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHA  420
             RLWALSLAHSELSTVFYEKVLLLAWGY+NI+I ++G  +F FAT  +LL+METLSAFLHA
Sbjct  729   RLWALSLAHSELSTVFYEKVLLLAWGYDNILIRLIGVAVFAFATAFILLMMETLSAFLHA  788

Query  419   LRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             LRLHWVEF  KF+ GDGYKF PFSF L+ ++++
Sbjct  789   LRLHWVEFMGKFFHGDGYKFKPFSFALISDDDE  821



>ref|XP_003597149.1| V-type proton ATPase 116 kDa subunit a isoform [Medicago truncatula]
Length=824

 Score =   962 bits (2488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 501/816 (61%), Positives = 620/816 (76%), Gaps = 7/816 (1%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             PPMDL RSE M  VQLIIP ESA  +V+YLG+LGL+QF+DLNA+KSPFQRT+  Q+KR  
Sbjct  9     PPMDLMRSEKMTFVQLIIPAESAHRAVSYLGELGLLQFRDLNADKSPFQRTFVNQVKRCA  68

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EM+RKLRFFKDQ++KAG+ +S+ +  Q  I  +DLEV L + E ELIE+N+N+DKL++S+
Sbjct  69    EMSRKLRFFKDQVNKAGLMSSSRTLLQPDIDLEDLEVHLAEHEHELIEMNSNSDKLRQSY  128

Query  2387  NELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTSKQVR  2208
             NEL+E+K+VLQK   F  S+   A + + E   +    +                     
Sbjct  129   NELLEFKIVLQKACGFLISSHGRAVSGEIELQDNVYSNDDYIETASLLEQEMRPQPSTSG  188

Query  2207  LGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSGE  2028
             L FISG++ K K++ FER+LFRATRGN+   Q+   E ++DPI+ E +EK VF+VF+SGE
Sbjct  189   LRFISGIICKSKALRFERMLFRATRGNMFFNQAPAGEQIMDPITTEMIEKTVFVVFFSGE  248

Query  2027  RAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSIA  1848
             +A+ KILKIC+AFGAN YP  E++ K  Q+  EV+ ++++L+  +DAGI HR   L SIA
Sbjct  249   QARTKILKICEAFGANCYPVPEDISKHGQITREVTSRLTDLEATLDAGIRHRNKALSSIA  308

Query  1847  EQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNSE  1668
             +   +W  LVRREK++Y TLNML+ DVTKKCLV EGW P  A  ++Q+ALQRA  DSNS+
Sbjct  309   DHLAKWMDLVRREKAVYDTLNMLNFDVTKKCLVGEGWCPMIAKTQMQEALQRATFDSNSQ  368

Query  1667  IGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMF  1488
             +G IF  +   ESPPTYFKTN FT+ +QEIVDAYGVA+YQEANP V+T V FPFLFA+MF
Sbjct  369   VGIIFHQMDAVESPPTYFKTNTFTNPYQEIVDAYGVARYQEANPAVYTTVVFPFLFAMMF  428

Query  1487  GDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEFF  1308
             GDWGHGICLLL  L  +  E KLS+QKLG   EM FGGRYVIL+M+LFSIY G IYNEFF
Sbjct  429   GDWGHGICLLLGALILIAHENKLSTQKLGSFMEMLFGGRYVILLMSLFSIYCGLIYNEFF  488

Query  1307  SVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKLS  1128
             SV F +FG SA+ CRD SCSDA TIGL+K RD Y FGVDP+W G+RSEL FLNS+KMK+S
Sbjct  489   SVPFHIFGPSAFRCRDTSCSDAHTIGLVKYRDPYPFGVDPSWRGSRSELAFLNSMKMKMS  548

Query  1127  ILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQA  948
             IL GVA MNLGIILSYFNA +F S ++   QF+PQ+IFLN+LFGYLS+LII+KWCTGSQA
Sbjct  549   ILFGVAHMNLGIILSYFNARFFGSSLDIRYQFVPQMIFLNSLFGYLSLLIIIKWCTGSQA  608

Query  947   DLYHVMIYMFLGPTEDLGENQLFPGQKTTQlv---lvllalvsVPWMLLPKPFILKSQHN  777
             DLYHVMIYMFL PT++LGENQLF GQ+  Q+    L+LLA+++VPWML PKPFILK  H 
Sbjct  609   DLYHVMIYMFLSPTDELGENQLFWGQRPLQVSLIVLLLLAIIAVPWMLFPKPFILKKLHT  668

Query  776   -RHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYL  600
              R QG+SY  +   +  L V+       HE+F FSE+FVHQ+IH+IEFVLG+VSNTASYL
Sbjct  669   ERFQGRSYGILNTSEMDLEVEPDSAREHHEDFNFSEIFVHQMIHSIEFVLGSVSNTASYL  728

Query  599   RLWAL---SLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAF  429
             RLWAL    LAHSELSTVFYEKVLLLAWGY+N+II +VG  +F FAT  +LL+ME+LSAF
Sbjct  729   RLWALRFAHLAHSELSTVFYEKVLLLAWGYDNLIIRLVGLTVFAFATAFILLMMESLSAF  788

Query  428   LHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             LHALRLHWVEFQNKFY GDGYKF PFSF  + E++D
Sbjct  789   LHALRLHWVEFQNKFYHGDGYKFKPFSFAALTEDDD  824



>ref|XP_010414511.1| PREDICTED: V-type proton ATPase subunit a1 [Camelina sativa]
 ref|XP_010470069.1| PREDICTED: V-type proton ATPase subunit a1 [Camelina sativa]
Length=821

 Score =   962 bits (2487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 503/813 (62%), Positives = 632/813 (78%), Gaps = 4/813 (0%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             P MDL RSE M LVQLIIP+ESA  S+ YLG+LGL+QF+DLNA+KSPFQRT+A Q+KR G
Sbjct  9     PQMDLMRSEKMTLVQLIIPVESAHRSITYLGELGLLQFRDLNADKSPFQRTFANQVKRCG  68

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EM+RKLRFFKDQ+ KAG+  S   + +  I+  DLE +L D E E++E+N+N++KL++++
Sbjct  69    EMSRKLRFFKDQIDKAGLRCSPRHEIEPDIELGDLERQLADHEHEVLEMNSNSEKLRQTY  128

Query  2387  NELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgee-sleapllsePDMSADTSKQV  2211
             NEL+E+K+VLQK   F  S+ + A  ++ E   S       +E   L E +M+   S Q 
Sbjct  129   NELLEFKIVLQKASGFLVSSNAHAIGEETELHESTYSNNGFIETASLLEQEMNPGPSSQS  188

Query  2210  RLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSG  2031
              L FISG++ K+K + FER+LFRATRGN+L  Q+  DE ++DP + E VEK VF+VF+SG
Sbjct  189   GLRFISGIINKDKLLRFERMLFRATRGNMLFNQTPSDEEIMDPSTSEMVEKIVFVVFFSG  248

Query  2030  ERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSI  1851
             E+A+ KILKIC+AFGAN YP  E+  KQ QL  EV  ++S+L+  +DAG  HR + L S+
Sbjct  249   EQARTKILKICEAFGANCYPVPEDTTKQRQLTREVLSRLSDLEATLDAGTRHRNSALNSV  308

Query  1850  AEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNS  1671
                   W   VRREK++Y TLNML+ DVTKKCLV EGW PT A  +I + LQRA  DSNS
Sbjct  309   GYSLTNWMTTVRREKAVYDTLNMLNFDVTKKCLVGEGWCPTFAKTQIHEVLQRATFDSNS  368

Query  1670  EIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVM  1491
             ++G IF V+   ESPPTYF+TNK T+AFQEI+DAYGVA+YQEANP V+++VT+PFLFAVM
Sbjct  369   QVGVIFHVMQAVESPPTYFRTNKLTNAFQEIIDAYGVARYQEANPAVYSVVTYPFLFAVM  428

Query  1490  FGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEF  1311
             FGDWGHG+CLLL  LY L RE+KLS+QKLG   EM FGGRYVIL+M+LFSIY G IYNEF
Sbjct  429   FGDWGHGLCLLLGALYLLARERKLSTQKLGSFMEMLFGGRYVILLMSLFSIYCGLIYNEF  488

Query  1310  FSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKL  1131
             FSV F +FG SAY CRD +CSDA T+GL+K RD Y FGVDP+W+G+RSELP+LNSLKMK+
Sbjct  489   FSVPFHIFGGSAYKCRDTTCSDAYTVGLVKYRDPYPFGVDPSWYGSRSELPYLNSLKMKM  548

Query  1130  SILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQ  951
             SILLG+AQMNLG+ILS+FNA +F S ++   QFIPQ+IFLN+LFGYLS+LII+KWCTGSQ
Sbjct  549   SILLGIAQMNLGLILSFFNARFFGSSLDIRYQFIPQMIFLNSLFGYLSLLIIIKWCTGSQ  608

Query  950   ADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQH-NR  774
             ADLYHVMIYMFL PTE+LGEN+LF GQ+  Q++L+L A ++VPWML PKPF L+  H  R
Sbjct  609   ADLYHVMIYMFLSPTEELGENELFWGQRPLQILLLLSAFIAVPWMLFPKPFALRKIHMER  668

Query  773   HQGQSYAPI--QDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYL  600
              QG++Y  +   ++D  +  D +      EEF FSE+FVHQLIH+IEFVLG+VSNTASYL
Sbjct  669   FQGRTYGVLGSSEVDLDVEPDSARGGHHEEEFNFSEIFVHQLIHSIEFVLGSVSNTASYL  728

Query  599   RLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHA  420
             RLWALSLAHSELSTVFYEKVLLLAWGY NI+I ++G  +F FAT  +LL+METLSAFLHA
Sbjct  729   RLWALSLAHSELSTVFYEKVLLLAWGYENILIRLIGVAVFAFATAFILLMMETLSAFLHA  788

Query  419   LRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             LRLHWVEF  KF+ GDGYKF PFSF L+ ++++
Sbjct  789   LRLHWVEFMGKFFHGDGYKFKPFSFALISDDDE  821



>ref|XP_006644966.1| PREDICTED: vacuolar proton ATPase a1-like [Oryza brachyantha]
Length=818

 Score =   961 bits (2485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 491/811 (61%), Positives = 624/811 (77%), Gaps = 2/811 (0%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             PPMD  RSE M  VQLIIP ESARL+V YLG+LGL+QFKDLN +KSPFQR +  Q+KR  
Sbjct  8     PPMDHLRSEKMCFVQLIIPAESARLAVTYLGELGLLQFKDLNEDKSPFQRIFVNQVKRCA  67

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EM+RKLRFF DQ++KAGV +S     Q  I  ++LE KLG+ E +L+E+N N++KL +++
Sbjct  68    EMSRKLRFFSDQINKAGVKSSVRPVMQPDIDLEELEAKLGEHENDLLEMNTNSEKLLQTY  127

Query  2387  NELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePD-MSADTSKQV  2211
             NEL+E+KLVL K G    S+ + A   ++E       +E  +         +    S+  
Sbjct  128   NELLEFKLVLSKAGGILASSHNHATPVERELEEHIYDKEMDDGNAYLLEQGVHLGASENS  187

Query  2210  RLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSG  2031
              + F+SG++ K K++AFER+LFRATRGN+   Q+   E V DPISGE+VEK VF+VF+SG
Sbjct  188   GVKFVSGIILKSKALAFERMLFRATRGNMFFNQAPAGEPVTDPISGEEVEKTVFVVFFSG  247

Query  2030  ERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSI  1851
              +AK KILKIC +FGA+ YP  EE+ KQ Q+  EVS ++++L+  +DAGI HR   L+S+
Sbjct  248   NQAKAKILKICASFGASCYPVPEEMVKQRQIFREVSAQLADLEATLDAGIQHRNKALESV  307

Query  1850  AEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNS  1671
               Q  RW ++V++EK++Y TLNML+ DVTKKCLV EGW P  A  +I+D LQRA   SNS
Sbjct  308   GSQLWRWTIMVKKEKAVYDTLNMLNFDVTKKCLVGEGWCPIFAKPQIKDVLQRATLHSNS  367

Query  1670  EIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVM  1491
             ++G IF  + T +SPPTYF+T+KFT+ FQEIVDAYGVA+Y+E NP V++++TFPFLFAVM
Sbjct  368   QVGIIFHEMDTIDSPPTYFRTDKFTNGFQEIVDAYGVARYEEINPAVYSVITFPFLFAVM  427

Query  1490  FGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEF  1311
             FGDWGHGICLLL     ++REKKLSSQKLG   EM FGGRYVIL+MALFSIY G IYNEF
Sbjct  428   FGDWGHGICLLLGACVLILREKKLSSQKLGSFMEMAFGGRYVILLMALFSIYCGLIYNEF  487

Query  1310  FSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKL  1131
             FSV F +FG+SAY CR+ +CSDA T GLIK RD Y FGVDP+W G+RSELPFLNSLKMK+
Sbjct  488   FSVPFHIFGKSAYECREKTCSDAYTAGLIKVRDPYPFGVDPSWRGSRSELPFLNSLKMKM  547

Query  1130  SILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQ  951
             SIL+GV QMNLGI+LSYF+A +  + ++   QFIPQ+IFLN+LFGYL++LI++KWC+GSQ
Sbjct  548   SILMGVTQMNLGIVLSYFDAKFHGNALDIRYQFIPQMIFLNSLFGYLALLILIKWCSGSQ  607

Query  950   ADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQHN-R  774
             ADLYHVMIYMFL P  DLGENQLF GQK  Q++L+L+A+V+VPWML PKPFILK +H  R
Sbjct  608   ADLYHVMIYMFLDPAGDLGENQLFWGQKELQILLLLMAIVAVPWMLFPKPFILKKRHKER  667

Query  773   HQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLRL  594
              QG +Y  +   +     +     S H++F FSEVFVHQ+IH+IEFVLGAVSNTASYLRL
Sbjct  668   FQGHTYRFLGTSEMDPDSEPDSARSHHDDFNFSEVFVHQMIHSIEFVLGAVSNTASYLRL  727

Query  593   WALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHALR  414
             WALSLAHSELSTVFYEK+LLLAWGY+N+++ +VG ++F FAT  +LL+ME+LSAFLHALR
Sbjct  728   WALSLAHSELSTVFYEKLLLLAWGYDNLVVRLVGLVVFAFATAFILLMMESLSAFLHALR  787

Query  413   LHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             LHWVEF NKF+ GDGYKF PFSF L+ ++E+
Sbjct  788   LHWVEFMNKFFHGDGYKFMPFSFALLADDEE  818



>ref|XP_009133874.1| PREDICTED: vacuolar proton ATPase a1-like [Brassica rapa]
Length=819

 Score =   961 bits (2484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 506/814 (62%), Positives = 627/814 (77%), Gaps = 8/814 (1%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             P MDL RSE M LVQLIIP+ESA  SV YLG+LGL+QF+DLNA+KSPFQRT+A Q+KR G
Sbjct  9     PQMDLMRSEKMTLVQLIIPVESAHRSVTYLGELGLLQFRDLNADKSPFQRTFATQVKRCG  68

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EM+RKLRFFKDQ+ KAG+      + +  I+  DLE +L D E E++E+N+N++KL++++
Sbjct  69    EMSRKLRFFKDQIDKAGLRCLQRHELEPNIELGDLERQLADHEHEVLEMNSNSEKLRQTY  128

Query  2387  NELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTSKQVR  2208
             NEL+E+K+VLQK   F  S+ + A   + E   S           L E +M  +   Q  
Sbjct  129   NELLEFKIVLQKASGFLVSSNAHAIGDETELHESTYSNNGFIESSLLEQEMRPEPLNQSG  188

Query  2207  LGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSGE  2028
             L FISG++ K+K + FER+LFRATRGN+L  Q+  DE ++DP + E VEK VF+VF+SGE
Sbjct  189   LRFISGIINKDKLLRFERMLFRATRGNMLFNQTPSDEEIMDPSTSEMVEKIVFVVFFSGE  248

Query  2027  RAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSIA  1848
             +A+ KILKIC+AFGAN YP  E++ KQ QL  EV  ++S+L+  +DAG  HR N L  + 
Sbjct  249   QARTKILKICEAFGANCYPVPEDITKQRQLTREVLSRLSDLEATLDAGSRHRNNALNVVG  308

Query  1847  EQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNSE  1668
                 +W   VRREK++Y TLNML+ DVTKKCLV EGW PT A  +I + LQRA  DSNS+
Sbjct  309   YSLTKWMTTVRREKAVYDTLNMLNFDVTKKCLVGEGWCPTFAKTQIHEVLQRATSDSNSQ  368

Query  1667  IGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMF  1488
             +G IF V+   ESPPTYF+TNK T+AFQEI+DAYGVA+YQEANP V+++VT+PFLFAVMF
Sbjct  369   VGVIFHVMHAVESPPTYFRTNKLTNAFQEIIDAYGVARYQEANPAVYSVVTYPFLFAVMF  428

Query  1487  GDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEFF  1308
             GDWGHG+CLLL  LY L RE+KLS QKLG   EM FGGRYVIL+MALFSIY G IYNEFF
Sbjct  429   GDWGHGLCLLLGALYLLARERKLSKQKLGSFMEMLFGGRYVILLMALFSIYCGLIYNEFF  488

Query  1307  SVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKLS  1128
             SV F +FG SAY CRD +CSDA T GL+K RD Y FGVDP+W G+RSELP+LNSLKMK+S
Sbjct  489   SVPFHIFGGSAYKCRDTTCSDAYTAGLVKYRDPYPFGVDPSWRGSRSELPYLNSLKMKMS  548

Query  1127  ILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQA  948
             ILLG+AQMNLG+ILS+FNA +F S ++   QFIPQ+IFLN+LFGYLS+LII+KWCTGSQA
Sbjct  549   ILLGIAQMNLGLILSFFNARFFGSSLDIRYQFIPQMIFLNSLFGYLSLLIIIKWCTGSQA  608

Query  947   DLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQH-NRH  771
             DLYHVMIYMFL PTE+LGEN+LF GQ+  Q++L+LLA ++VPWML PKPF L+  H  R 
Sbjct  609   DLYHVMIYMFLSPTEELGENELFWGQRPLQILLLLLAFIAVPWMLFPKPFALRKIHMERF  668

Query  770   QGQSYAPIQ----DLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASY  603
             QG++Y  +     DLD   +   S  S   EEF FSE+FVHQLIH+IEFVLG+VSNTASY
Sbjct  669   QGRTYGLLGTSEVDLD---VDPDSARSHQEEEFNFSEIFVHQLIHSIEFVLGSVSNTASY  725

Query  602   LRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLH  423
             LRLWALSLAHSELSTVFYEKVLLLAWGY NI+I ++G ++F FAT  +LL+METLSAFLH
Sbjct  726   LRLWALSLAHSELSTVFYEKVLLLAWGYENILIRLIGVVVFAFATAFILLMMETLSAFLH  785

Query  422   ALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             ALRLHWVEF  KF+ GDGYKF PFSF L+ ++++
Sbjct  786   ALRLHWVEFMGKFFHGDGYKFKPFSFTLISDDDE  819



>ref|XP_008657093.1| PREDICTED: vacuolar proton ATPase a1 [Zea mays]
Length=818

 Score =   960 bits (2481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 504/813 (62%), Positives = 628/813 (77%), Gaps = 6/813 (1%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             PPMD  RSE M  VQLI+P ES+RL+V YLG+LGL+QFKDLN +KSPFQR +  Q+KR  
Sbjct  8     PPMDHMRSEKMCFVQLIMPAESSRLAVTYLGELGLLQFKDLNEDKSPFQRIFVNQVKRCA  67

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EM+RKL+FF DQ+++AG+ +S     +  I  ++LE +LG+ E EL+E+N N+DKL++++
Sbjct  68    EMSRKLKFFSDQINRAGLRSSVRPALEPDIDLEELEARLGEHEHELLEMNTNSDKLKQTY  127

Query  2387  NELVEYKLVLQKVGEFFHSARssaeaqqqeygssqs---geesleapllsePDMSADTSK  2217
             NEL+E+KLVL K G    S+ S A + + E   +       E     L       A    
Sbjct  128   NELLEFKLVLSKAGHILASSHSHAASAEHELDENIYDNGIHEGNAYLLEQGVHQGAHGHS  187

Query  2216  QVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFY  2037
              VR  F+SG++ K K++AFER+LFRATRGN+L  Q+   E V DPISGE+VEK VF+VF+
Sbjct  188   GVR--FVSGIILKSKALAFERMLFRATRGNMLFNQASAGEPVTDPISGEEVEKAVFVVFF  245

Query  2036  SGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQ  1857
             SGE+AK KILKICD+FGA+ YP  EE+ KQ Q+  EVS ++S+L+  +DAGI HR   L+
Sbjct  246   SGEQAKAKILKICDSFGASCYPVPEEMVKQRQIFNEVSARLSDLEVTLDAGIQHRNKALE  305

Query  1856  SIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDS  1677
             SI  Q  RW ++V++EK++Y TLNML+ DVTKKCLV EGW P  A  +I+D LQR+   S
Sbjct  306   SIGSQLWRWTIMVKKEKAVYDTLNMLNFDVTKKCLVGEGWCPIFAKSQIKDCLQRSTIHS  365

Query  1676  NSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFA  1497
             NS++G IF  + T ESPPTYF+T+KFT+AFQEIVDAYGVA+YQEANP V+++VTFPFLFA
Sbjct  366   NSQVGTIFHEMDTIESPPTYFRTDKFTNAFQEIVDAYGVARYQEANPAVYSVVTFPFLFA  425

Query  1496  VMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYN  1317
             VMFGDWGHGICLLL  L  ++REK+ SSQKLG   E+ FGGRYVIL+MA+FSIY G IYN
Sbjct  426   VMFGDWGHGICLLLGALVLILREKRFSSQKLGSFMELAFGGRYVILLMAIFSIYCGLIYN  485

Query  1316  EFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKM  1137
             EFFSV F +FG+SAY CRD SCSDA T GLIK R+ Y FGVDP+W G+RSELPFLNSLKM
Sbjct  486   EFFSVPFHIFGKSAYECRDKSCSDAHTFGLIKVREPYPFGVDPSWRGSRSELPFLNSLKM  545

Query  1136  KLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTG  957
             K+SIL+GVAQMNLGI+LSYF+A Y  + ++   QFIPQ+IFLN+LFGYL++LI++KWCTG
Sbjct  546   KMSILMGVAQMNLGIVLSYFDARYHGNALDIRYQFIPQMIFLNSLFGYLALLILIKWCTG  605

Query  956   SQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQHN  777
             SQADLYHVMIYMFL P  DLGENQLF GQK  Q++L+LLAL++VPWML PKPFILK  H 
Sbjct  606   SQADLYHVMIYMFLDPAGDLGENQLFWGQKELQILLLLLALIAVPWMLFPKPFILKKLHK  665

Query  776   -RHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYL  600
              R QG +Y  +   +     +     + H++F FSEVFVHQ+IH+IEFVLGAVSNTASYL
Sbjct  666   ERFQGHTYRFLGTSEMDPDSEPDSARARHDDFNFSEVFVHQMIHSIEFVLGAVSNTASYL  725

Query  599   RLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHA  420
             RLWALSLAHSELSTVFYEK+LLLAWGY+++I+  VG I+F FAT  +LL+METLSAFLHA
Sbjct  726   RLWALSLAHSELSTVFYEKLLLLAWGYDSLIVKFVGLIVFSFATAFILLMMETLSAFLHA  785

Query  419   LRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             LRLHWVEF NKFY GDGYKF PFSF L+ ++ED
Sbjct  786   LRLHWVEFMNKFYHGDGYKFKPFSFALLADDED  818



>ref|XP_006293692.1| hypothetical protein CARUB_v10022649mg [Capsella rubella]
 gb|EOA26590.1| hypothetical protein CARUB_v10022649mg [Capsella rubella]
Length=821

 Score =   959 bits (2480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 501/813 (62%), Positives = 633/813 (78%), Gaps = 4/813 (0%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             P MDL RSE M LVQLIIP+ESA  S+ YLG+LGL+QF+DLNA+KSPFQRT+A Q+KR G
Sbjct  9     PQMDLMRSEKMTLVQLIIPVESAHRSITYLGELGLLQFRDLNADKSPFQRTFANQVKRCG  68

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EM+RKLRFFKDQ+ KAG+  SA  + +  I+  DLE +L D E E++E+N+N++KL++++
Sbjct  69    EMSRKLRFFKDQIDKAGLRCSARHEIEPDIELGDLERQLADHEHEVLEMNSNSEKLRQTY  128

Query  2387  NELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgee-sleapllsePDMSADTSKQV  2211
             NEL+E+K+VLQK   F  S+ + A  ++ E   S       +E   L E +M+   S Q 
Sbjct  129   NELLEFKIVLQKASGFLVSSNAHAIGEETELNESTYSNNGFIETASLLEQEMNPGPSSQS  188

Query  2210  RLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSG  2031
              L FISG++ K+K + FER+LFRATRGN+L  Q+  DE ++DP + E VEK VF+VF+SG
Sbjct  189   GLRFISGIINKDKLLRFERMLFRATRGNMLFNQTPSDEEIMDPSTSEMVEKIVFVVFFSG  248

Query  2030  ERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSI  1851
             E+A+ KILKIC+AFGAN YP  E+  KQ QL  EV  ++S+L+  +DAG  HR N L S+
Sbjct  249   EQARTKILKICEAFGANCYPVPEDTTKQRQLTREVLSRLSDLEATLDAGTRHRNNALNSV  308

Query  1850  AEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNS  1671
                   W   VRREK++Y TLNML+ DVTKKCLV EGW PT A  +I + LQRA  DSNS
Sbjct  309   GYSLTNWMTTVRREKAVYDTLNMLNFDVTKKCLVGEGWCPTFAKTQIHEVLQRATFDSNS  368

Query  1670  EIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVM  1491
             ++G IF V+   E PPTYF+TNK T+AFQEI+DAYG+A+YQEANP V+++VT+PFLFAVM
Sbjct  369   QVGVIFHVMQAVEPPPTYFRTNKLTNAFQEIIDAYGIARYQEANPAVYSVVTYPFLFAVM  428

Query  1490  FGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEF  1311
             FGDWGHG+CLLL  L+ L REKKLS+QKLG   +M FGGRYVIL+M+LFSIY G IYNEF
Sbjct  429   FGDWGHGLCLLLGALFLLAREKKLSTQKLGSFMKMLFGGRYVILLMSLFSIYCGLIYNEF  488

Query  1310  FSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKL  1131
             FSV F +FG SAY CRD +CSDA T+GL+K RD Y FGVDP+W+G+RSELP+LNSLKMK+
Sbjct  489   FSVPFHIFGGSAYKCRDTTCSDAYTVGLVKYRDPYPFGVDPSWYGSRSELPYLNSLKMKM  548

Query  1130  SILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQ  951
             SILLG+AQMNLG++LS+FNA +F S ++   QFIPQ+IFLN+LFGYLS+LII+KWCTGSQ
Sbjct  549   SILLGIAQMNLGLLLSFFNARFFGSSLDIRYQFIPQMIFLNSLFGYLSLLIIIKWCTGSQ  608

Query  950   ADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQH-NR  774
             ADLYHVMIYMFL PTE+LGEN+LF GQ+  QL+L+L A ++VPWML PKPF L+  H  R
Sbjct  609   ADLYHVMIYMFLSPTEELGENELFWGQRPLQLLLLLSAFIAVPWMLFPKPFALRKIHMER  668

Query  773   HQGQSYAPI--QDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYL  600
              QG++Y  +   ++D  +  D +      EEF FSE+FVHQLIH+IEF+LG+VSNTASYL
Sbjct  669   FQGRTYGVLVSSEVDLEVEPDSARGGHHEEEFNFSEIFVHQLIHSIEFILGSVSNTASYL  728

Query  599   RLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHA  420
             RLWALSLAHSELSTVFYEKVLLLAWGY+NI+I ++G  +F FAT  +LL+METLSAFLHA
Sbjct  729   RLWALSLAHSELSTVFYEKVLLLAWGYDNILIRLIGLAVFAFATAFILLMMETLSAFLHA  788

Query  419   LRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             LRLHWVEF  KF+ GDGYKF PFSF L+ ++++
Sbjct  789   LRLHWVEFMGKFFHGDGYKFKPFSFALISDDDE  821



>ref|XP_006404588.1| hypothetical protein EUTSA_v10000048mg [Eutrema salsugineum]
 dbj|BAJ33782.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ46041.1| hypothetical protein EUTSA_v10000048mg [Eutrema salsugineum]
Length=617

 Score =   959 bits (2480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 482/617 (78%), Positives = 550/617 (89%), Gaps = 1/617 (0%)
 Frame = -2

Query  2168  MAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSGERAKNKILKICDAF  1989
             M FERILFRATRGN+ +RQS ++ESV+DP SGEK EKNVF+VFYSGERAK+KILKIC+AF
Sbjct  1     MVFERILFRATRGNIFIRQSVIEESVVDPNSGEKAEKNVFVVFYSGERAKSKILKICEAF  60

Query  1988  GANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSIAEQFDRWNVLVRRE  1809
             GANRYPF+EELG+QAQ++TEV+G+++ELKT I AG+  R  LL++I ++F++WN+ VR+E
Sbjct  61    GANRYPFSEELGRQAQMMTEVTGRLAELKTTIGAGLDQRKILLETIGDRFEQWNLKVRKE  120

Query  1808  KSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNSEIGAIFRVLGTRES  1629
             K+IYHTLNMLS+DVTKKCLV EGWSP  A  EIQDALQRA  DSNS++G+IF+VL T+E 
Sbjct  121   KAIYHTLNMLSLDVTKKCLVGEGWSPVFAATEIQDALQRAAVDSNSQVGSIFQVLRTKEM  180

Query  1628  PPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLLLAT  1449
             PPT+F+TNKFT+AFQEIVDAYGVAKYQEANP VFTIVTFPFLFAVMFGDWGHGICLLLAT
Sbjct  181   PPTFFRTNKFTTAFQEIVDAYGVAKYQEANPSVFTIVTFPFLFAVMFGDWGHGICLLLAT  240

Query  1448  LYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEFFSVQFELFGRSAYV  1269
             +Y ++REKKLSSQKLGDI EM FGGRYVI MM+LFSIYTG IYNEFFS+ + LF  SAY 
Sbjct  241   MYLILREKKLSSQKLGDIMEMAFGGRYVIFMMSLFSIYTGLIYNEFFSIPYPLFASSAYE  300

Query  1268  CRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKLSILLGVAQMNLGII  1089
             CRD SCS+ATTIGLIK RDTY FGVDP WHGTRSELPFLNSLKMK+SILLGVAQMNLGII
Sbjct  301   CRDASCSEATTIGLIKTRDTYPFGVDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGII  360

Query  1088  LSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQADLYHVMIYMFLGP  909
             +S+FNA +F+S VN W QF+PQ+IFLN LFGYLSVLII+KWCTGSQADLYHVMIYMFL P
Sbjct  361   MSFFNAKFFKSAVNVWFQFVPQMIFLNCLFGYLSVLIIIKWCTGSQADLYHVMIYMFLSP  420

Query  908   TEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQHN-RHQGQSYAPIQDLDE  732
              +DLGENQLFP QK  QL  + LALVSVPWMLLPKPFILK QH  RHQGQSYA + + DE
Sbjct  421   MDDLGENQLFPNQKIVQLTFLFLALVSVPWMLLPKPFILKKQHEARHQGQSYAQLDETDE  480

Query  731   SLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSTVF  552
             SL V+ +  S  HEEFEFSE+FVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELS+VF
Sbjct  481   SLQVETNGGSHGHEEFEFSEIFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVF  540

Query  551   YEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHALRLHWVEFQNKFYEGD  372
             YEKVLL+AWG+NNI IL+VG ++FIFAT+GVLLVMETLSAFLHALRLHWVE+QNKFYEGD
Sbjct  541   YEKVLLMAWGFNNIFILIVGILVFIFATVGVLLVMETLSAFLHALRLHWVEYQNKFYEGD  600

Query  371   GYKFDPFSFVLVDEEED  321
             GYKF PF+FVLV  E++
Sbjct  601   GYKFAPFTFVLVGNEDE  617



>ref|XP_010112349.1| V-type proton ATPase 116 kDa subunit a isoform 1 [Morus notabilis]
 gb|EXC33238.1| V-type proton ATPase 116 kDa subunit a isoform 1 [Morus notabilis]
Length=796

 Score =   957 bits (2474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 494/811 (61%), Positives = 614/811 (76%), Gaps = 25/811 (3%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             P MDL RSE M  VQLIIP+ESA  +V+YLG+LGL+QF+D+N +KSPFQRT+  Q+KR  
Sbjct  9     PAMDLMRSEKMTFVQLIIPVESAHRAVSYLGELGLLQFRDMNFDKSPFQRTFVNQVKRCA  68

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EM+RKLRFFK+Q+SKAG+ AS     Q  ++ ++LE++L + E EL E+N+N++KL++S+
Sbjct  69    EMSRKLRFFKEQISKAGLIASTRLVMQPDLELEELEIQLAEHEHELNEMNSNSEKLRQSY  128

Query  2387  NELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsge-esleapllsePDMSADTSKQV  2211
             NEL+E+K+VLQK G F  S ++ + ++++E   +       +E   L E +M    S Q 
Sbjct  129   NELLEFKMVLQKAGGFLVSNKTHSVSEERELDENIYSNDNYIETASLLEQEMRPGRSDQS  188

Query  2210  RLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSG  2031
              L FISG++ K K + FER+LFRATRGN+L  Q+  DE ++DP+S E VEK  F+VF+SG
Sbjct  189   SLRFISGIICKSKVLRFERMLFRATRGNMLFNQAPADEQIMDPLSTEMVEKMAFVVFFSG  248

Query  2030  ERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSI  1851
             E+A+ KILKIC+AFGA+ YP  E++ KQ Q+  EVS ++ EL+T +DAGI HR   L SI
Sbjct  249   EQARTKILKICEAFGASCYPVPEDVTKQRQITREVSSRLVELETTLDAGIRHRNKALTSI  308

Query  1850  AEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNS  1671
             +    +W  +VR+EK+++ TLNML+ DVTKKCLV EGW P  A  +IQ+ LQRA  DS+S
Sbjct  309   SFHLAKWMKMVRKEKAVFDTLNMLNFDVTKKCLVGEGWCPIFARTQIQEILQRATFDSSS  368

Query  1670  EIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVM  1491
             ++G IF  +   ESPPTYF+TN FT AFQEIVDAYGVA+YQEANP VFT++TFPFLFAVM
Sbjct  369   QVGIIFHEMDATESPPTYFRTNSFTGAFQEIVDAYGVARYQEANPAVFTVITFPFLFAVM  428

Query  1490  FGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEF  1311
             FGDWGHGICLLL  L  + RE KLS+QKLG + EM FGGRY++L+M+LFSIY G IYNEF
Sbjct  429   FGDWGHGICLLLGALVLIARESKLSTQKLGSMMEMLFGGRYILLLMSLFSIYCGLIYNEF  488

Query  1310  FSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKL  1131
             FSV + +FG SAY CRD +CSDA T GL+K RD Y FGVDP+W G+RSELPFLNSLKMK+
Sbjct  489   FSVPYHIFGGSAYKCRDATCSDAHTAGLVKFRDPYPFGVDPSWRGSRSELPFLNSLKMKM  548

Query  1130  SILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQ  951
             SILLGVAQMNLGI++SYFNA +FRS ++   QF+PQ+IFLN+LFGYLS+LII+KWCTGSQ
Sbjct  549   SILLGVAQMNLGIVISYFNACFFRSSIDIRYQFVPQMIFLNSLFGYLSLLIIIKWCTGSQ  608

Query  950   ADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQHN-R  774
             ADLYHVMIYMFL PT+DL                       VPWML PKPFILK  H  R
Sbjct  609   ADLYHVMIYMFLSPTDDL-----------------------VPWMLFPKPFILKKLHTER  645

Query  773   HQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLRL  594
              QG++Y  +   +  L V+       HEEF FSE+FVHQ+IH+IEFVLGAVSNTASYLRL
Sbjct  646   FQGRTYGILGTSEMDLDVEPDSARQQHEEFNFSEIFVHQMIHSIEFVLGAVSNTASYLRL  705

Query  593   WALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHALR  414
             WALSLAHSELSTVFYEKVLLLAWGY N  I +VG  +F FAT  +LL+METLSAFLHALR
Sbjct  706   WALSLAHSELSTVFYEKVLLLAWGYENFAIRLVGLAVFAFATAFILLMMETLSAFLHALR  765

Query  413   LHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             LHWVEFQNKFY GDGYKF PFSF  + E+ED
Sbjct  766   LHWVEFQNKFYHGDGYKFKPFSFATLAEDED  796



>emb|CDY63878.1| BnaCnng42810D [Brassica napus]
Length=850

 Score =   954 bits (2467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 509/822 (62%), Positives = 631/822 (77%), Gaps = 12/822 (1%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             P MDL RSE M LVQLIIP+ESA  SV YLG+LGL+QF+DLNA+KSPFQRT+A Q+KR G
Sbjct  9     PQMDLMRSEKMTLVQLIIPVESAHRSVTYLGELGLLQFRDLNADKSPFQRTFATQVKRCG  68

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EM+RKLRFFKDQ+ KAG+      + +  I+  DLE +L D E E++E+N+N++KL++++
Sbjct  69    EMSRKLRFFKDQIDKAGLRCLQRHELEPNIELGDLERQLADHEHEVLEMNSNSEKLRQTY  128

Query  2387  NELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgee-sleapllsePDMSADTSKQV  2211
             NEL+E+K+VLQK   F  S+ + A   + E   S       +E+  L E +M  +   Q 
Sbjct  129   NELLEFKIVLQKASGFLVSSNAHAIGDETELHESTYSNNGFIESSSLLEQEMRPEPLNQS  188

Query  2210  RLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSG  2031
              L FISG++ K+K + FER+LFRATRGN+L  Q+  DE ++DP + E VEKNVF+VF+SG
Sbjct  189   GLRFISGIINKDKLLRFERMLFRATRGNMLFNQTPSDEEIMDPSTSEMVEKNVFVVFFSG  248

Query  2030  ERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSI  1851
             E+A+ KILKIC+AFGAN YP  E++ KQ QL  EV  ++S+L+  +DAG  HR N L ++
Sbjct  249   EQARTKILKICEAFGANCYPVPEDITKQRQLTREVLSRLSDLEATLDAGSRHRNNALNAV  308

Query  1850  AEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNS  1671
                  +W   VRREK++Y TLNML+ DVTKKCLV EGW PT A  +I + LQRA  DSNS
Sbjct  309   GYSLTKWMTTVRREKAVYDTLNMLNFDVTKKCLVGEGWCPTFAKTQIHEVLQRATSDSNS  368

Query  1670  EIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVM  1491
             ++G IF V+   ESPPTYF+TNK T+AFQEI+DAYGVA+YQEANP V+++VT+PFLFAVM
Sbjct  369   QVGVIFHVMHAVESPPTYFRTNKLTNAFQEIIDAYGVARYQEANPAVYSVVTYPFLFAVM  428

Query  1490  FGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEF  1311
             FGDWGHG+CLLL  LY L RE+KLS QKLG   EM FGGRYVIL+MALFSIY G IYNEF
Sbjct  429   FGDWGHGLCLLLGALYLLARERKLSKQKLGSFMEMLFGGRYVILLMALFSIYCGLIYNEF  488

Query  1310  FSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKL  1131
             FSV F +FG SAY CRD +CSDA T GL+K RD Y FGVDP+W G+RSELP+LNSLKMK+
Sbjct  489   FSVPFHIFGGSAYKCRDTTCSDAYTAGLVKYRDPYPFGVDPSWRGSRSELPYLNSLKMKM  548

Query  1130  SILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQ  951
             SILLG+AQMNLG+ILS+FNA +F S ++   QFIPQ+IFLN+LFGYLS+LII+KWCTGSQ
Sbjct  549   SILLGIAQMNLGLILSFFNARFFGSSLDIRYQFIPQMIFLNSLFGYLSLLIIIKWCTGSQ  608

Query  950   ADLYHVMIYMFLGPTEDLGENQLFPGQ---KTTQlvlvllalvsVPWMLLPKPFILKSQH  780
             ADLYHVMIYMFL PTE+LGEN+LF GQ    +  ++L+LLA ++VPWML PKPF L+  H
Sbjct  609   ADLYHVMIYMFLSPTEELGENELFWGQPFAPSLLILLLLLAFIAVPWMLFPKPFALRKIH  668

Query  779   -NRHQGQSYAPIQ----DLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSN  615
               R QG++Y  +     DLD   +   S  S   EEF FSE+FVHQLIH+IEFVLG+VSN
Sbjct  669   MERFQGRTYGLLGTSEVDLD---VEPDSARSHQEEEFNFSEIFVHQLIHSIEFVLGSVSN  725

Query  614   TASYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLS  435
             TASYLRLWALSLAHSELSTVFYEKVLLLAWGY NI+I ++G ++F FAT  +LL+METLS
Sbjct  726   TASYLRLWALSLAHSELSTVFYEKVLLLAWGYENILIRLIGVVVFAFATAFILLMMETLS  785

Query  434   AFLHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED*CGA  309
             AFLHALRLHWVEF  KF+ GDGYKF PFSF L+ ++ D  G 
Sbjct  786   AFLHALRLHWVEFMGKFFHGDGYKFKPFSFTLISDDADALGV  827



>ref|XP_009140911.1| PREDICTED: vacuolar proton ATPase a1 [Brassica rapa]
Length=820

 Score =   954 bits (2466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 502/815 (62%), Positives = 629/815 (77%), Gaps = 9/815 (1%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             P MDL RSE M LVQLIIP+ESA   V YLG+LGL+QF+DLNA+KSPFQRT+A Q+KR G
Sbjct  9     PEMDLMRSEKMTLVQLIIPVESAHRCVTYLGELGLLQFRDLNADKSPFQRTFATQVKRCG  68

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EM+RKLRFFKDQ+ KAG+      + +  I+  DLE +L D E E++E+N+N++KL+ ++
Sbjct  69    EMSRKLRFFKDQIDKAGLRCLPRHEIEPDIELGDLERQLADHEHEVLEMNSNSEKLRLTY  128

Query  2387  NELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgee-sleapllsePDMSADTSKQV  2211
             NEL+E+K+VLQK   F  S+ + A   + E   S       +E+  L E +M  +   Q 
Sbjct  129   NELLEFKIVLQKASGFLVSSNAHAIGDETELHESTYSNNGFIESSSLLEQEMRHEPLNQS  188

Query  2210  RLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSG  2031
              L FISG++ K+K + FER+LFRATRGN+L  Q+  DE ++DP + E VEK VF+VF+SG
Sbjct  189   GLRFISGIINKDKLLRFERMLFRATRGNMLFNQTPSDEEIMDPSTSEMVEKIVFVVFFSG  248

Query  2030  ERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSI  1851
             E+A+ KILKIC+AFGAN YP  E+  KQ QL  EV  ++S+L+  +DAG  HR N L ++
Sbjct  249   EQARTKILKICEAFGANCYPVPEDTTKQRQLTREVLSRLSDLEATLDAGTRHRNNALNAV  308

Query  1850  AEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNS  1671
                  +W   VRREK++Y TLNML+ DVTKKCLV EGW PT A  +I + LQRA  DSNS
Sbjct  309   GYSLTKWMTTVRREKAVYDTLNMLNFDVTKKCLVGEGWCPTFAKTQIHEVLQRATFDSNS  368

Query  1670  EIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVM  1491
             ++G IF V+   ESPPTYF+TNK T+AFQEI+DAYGVA+YQ+ANP V+++VT+PFLFAVM
Sbjct  369   QVGVIFHVMQAVESPPTYFRTNKLTNAFQEIIDAYGVARYQQANPAVYSVVTYPFLFAVM  428

Query  1490  FGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEF  1311
             FGDWGHG+CLLL  LY L RE+KLS+QKLG   EM FGGRYVIL+MALFSIY G IYNEF
Sbjct  429   FGDWGHGLCLLLGALYLLARERKLSTQKLGSFMEMLFGGRYVILLMALFSIYCGLIYNEF  488

Query  1310  FSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKL  1131
             FSV F +FG SAY CRD +CSDA T+GL+K RD Y FGVDP+W G+R+ELP+LNSLKMK+
Sbjct  489   FSVPFHIFGGSAYKCRDATCSDAYTVGLVKYRDPYPFGVDPSWRGSRTELPYLNSLKMKM  548

Query  1130  SILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQ  951
             SILLG+AQMNLG+ILS+FNA +F S ++   QFIPQ+IFLN+LFGYLS+LII+KWCTGSQ
Sbjct  549   SILLGIAQMNLGLILSFFNARFFGSSLDIRYQFIPQMIFLNSLFGYLSLLIIIKWCTGSQ  608

Query  950   ADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQH-NR  774
             ADLYHVMIYMFL PTE+LGEN+LF GQ+  Q++L+L+A ++VPWML PKPF L+  H  R
Sbjct  609   ADLYHVMIYMFLSPTEELGENELFWGQRPLQILLLLMAFIAVPWMLFPKPFALRKIHMER  668

Query  773   HQGQSYAPIQ----DLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTAS  606
              QG++Y  +     DLD   +   S      EEF FSE+FVHQLIH+IEFVLG+VSNTAS
Sbjct  669   FQGRTYGVLGTSEVDLD---VEPDSARGHQEEEFNFSEIFVHQLIHSIEFVLGSVSNTAS  725

Query  605   YLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFL  426
             YLRLWALSLAHSELSTVFYEKVLLLAWGY NI+I ++G ++F FAT  +LL+METLSAFL
Sbjct  726   YLRLWALSLAHSELSTVFYEKVLLLAWGYENILIRLIGVVVFAFATAFILLMMETLSAFL  785

Query  425   HALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             HALRLHWVEF  KF+ GDGYKF PFSF L+ ++++
Sbjct  786   HALRLHWVEFMGKFFHGDGYKFKPFSFALISDDDE  820



>emb|CDX83292.1| BnaA03g22140D [Brassica napus]
Length=823

 Score =   953 bits (2464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 507/818 (62%), Positives = 631/818 (77%), Gaps = 12/818 (1%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             P MDL RSE M LVQLIIP+ESA  SV YLG+LGL+QF+DLNA+KSPFQRT+A Q+KR G
Sbjct  9     PQMDLMRSEKMTLVQLIIPVESAHRSVTYLGELGLLQFRDLNADKSPFQRTFATQVKRCG  68

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EM+RKLRFFKDQ+ KAG+      + +  I+  DLE +L D E E++E+N+N++KL++++
Sbjct  69    EMSRKLRFFKDQIDKAGLRCLQRHELEPNIELGDLERQLADHEHEVLEMNSNSEKLRQTY  128

Query  2387  NELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgee-sleapllsePDMSADTSKQV  2211
             NEL+E+K+VLQK   F  S+ + A   + E   S       +E+  L E +M  +   Q 
Sbjct  129   NELLEFKIVLQKASGFLVSSNAHAIGDETELHESTYSNNGFIESSSLLEQEMRPEPLNQS  188

Query  2210  RLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSG  2031
              L FISG++ K+K + FER+LFRATRGN+L  Q+  DE ++DP + E VEKNVF+VF+SG
Sbjct  189   GLRFISGIINKDKLLRFERMLFRATRGNMLFNQTPSDEEIMDPSTSEMVEKNVFVVFFSG  248

Query  2030  ERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSI  1851
             E+A+ KILKIC+AFGAN YP  E++ KQ QL  EV  ++S+L+  +DAG  HR N L ++
Sbjct  249   EQARTKILKICEAFGANCYPVPEDIIKQRQLTREVLSRLSDLEATLDAGSRHRNNALNAV  308

Query  1850  AEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNS  1671
                  +W   VRREK++Y TLNML+ DVTKKCLV EGW PT A  +I + LQRA  DSNS
Sbjct  309   GYSLTKWMTTVRREKAVYDTLNMLNFDVTKKCLVGEGWCPTFAKTQIHEVLQRATSDSNS  368

Query  1670  EIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVM  1491
             ++G IF V+   ESPPTYF+TNK T+AFQEI+DAYGVA+YQEANP V+++VT+PFLFAVM
Sbjct  369   QVGVIFHVMHAVESPPTYFRTNKLTNAFQEIIDAYGVARYQEANPAVYSVVTYPFLFAVM  428

Query  1490  FGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEF  1311
             FGDWGHG+CLLL  LY L RE+KLS QKLG   EM FGGRYVIL+MALFSIY G IYNEF
Sbjct  429   FGDWGHGLCLLLGALYLLARERKLSKQKLGSFMEMLFGGRYVILLMALFSIYCGLIYNEF  488

Query  1310  FSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKL  1131
             FSV F +FG SAY CRD +CSDA T GL+K RD Y FGVDP+W G+RSELP+LNSLKMK+
Sbjct  489   FSVPFHIFGGSAYKCRDTTCSDAYTAGLVKYRDPYPFGVDPSWRGSRSELPYLNSLKMKM  548

Query  1130  SILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQ  951
             SILLG+AQMNLG+ILS+FNA +F S ++   QFIPQ+IFLN+LFGYLS+LII+KWCTGSQ
Sbjct  549   SILLGIAQMNLGLILSFFNARFFGSSLDIRYQFIPQMIFLNSLFGYLSLLIIIKWCTGSQ  608

Query  950   ADLYHVMIYMFLGPTEDLGENQLFPGQ---KTTQlvlvllalvsVPWMLLPKPFILKSQH  780
             ADLYHVMIYMFL PTE+LGEN+LF GQ    +  ++L+LLA ++VPWML PKPF L+  H
Sbjct  609   ADLYHVMIYMFLSPTEELGENELFWGQPFAPSLLILLLLLAFIAVPWMLFPKPFALRKIH  668

Query  779   -NRHQGQSYAPIQ----DLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSN  615
               R QG++Y  +     DLD   +   S  S   EEF FSE+FVHQLIH+IEFVLG+VSN
Sbjct  669   MERFQGRTYGLLGTSEVDLD---VEPDSARSHQEEEFNFSEIFVHQLIHSIEFVLGSVSN  725

Query  614   TASYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLS  435
             TASYLRLWALSLAHSELSTVFYEKVLLLAWGY NI+I ++G ++F FAT  +LL+METLS
Sbjct  726   TASYLRLWALSLAHSELSTVFYEKVLLLAWGYENILIRLIGVVVFAFATAFILLMMETLS  785

Query  434   AFLHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             AFLHALRLHWVEF  KF+ GDGYKF PFSF L+ ++++
Sbjct  786   AFLHALRLHWVEFMGKFFHGDGYKFKPFSFTLISDDDE  823



>ref|XP_003564548.1| PREDICTED: V-type proton ATPase subunit a1 [Brachypodium distachyon]
Length=817

 Score =   953 bits (2463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 495/810 (61%), Positives = 621/810 (77%), Gaps = 1/810 (0%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             PPMD  RSE M  VQLI P ESARL+V YLG+LGL+QFKDLN +KSPFQR +  Q+KR  
Sbjct  8     PPMDHLRSEKMCFVQLIFPAESARLAVTYLGELGLLQFKDLNEDKSPFQRIFVNQVKRCA  67

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EM+RKL +F DQ++KAGV +S     Q  I  ++LE KL + E EL+E+N N+  LQ+++
Sbjct  68    EMSRKLNYFSDQINKAGVKSSVRPALQPEIDLEELEAKLAEHEHELLEMNTNSGTLQQTY  127

Query  2387  NELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTSKQVR  2208
             NEL+E+KLVL K G    S+ + A    +E        E  E             + +  
Sbjct  128   NELLEFKLVLSKAGGILASSHNHATPADRELDEHIYDNEGDEGNGYLLEQGIHQGTSESG  187

Query  2207  LGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSGE  2028
             + F+SG++ K K++AFER+LFRATRGN+   Q+   E V DPISGE+VEK VF+VF+SGE
Sbjct  188   VRFVSGIILKSKALAFERMLFRATRGNMFFNQASAGEPVNDPISGEEVEKTVFVVFFSGE  247

Query  2027  RAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSIA  1848
             +AK KIL+IC +FGA+ YP  EE+ KQ Q+  EVS ++++L+  +DAGI HR   L+S+ 
Sbjct  248   QAKAKILRICASFGASCYPVPEEMVKQRQIFREVSARLADLEVTLDAGIQHRNKALESVG  307

Query  1847  EQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNSE  1668
              Q  RW ++V++EK++Y TLNML+ DVTKKCLV EGW P  A  +I+D LQRA   SNS+
Sbjct  308   SQLWRWTIMVKKEKAVYDTLNMLNFDVTKKCLVGEGWCPIFAKSQIKDVLQRATLHSNSQ  367

Query  1667  IGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMF  1488
             IG IF  + T +SPPTYF+T+KFT+AFQEIVDAYGVA+Y+EANP V++++TFPFLFAVMF
Sbjct  368   IGIIFHEMDTTDSPPTYFRTDKFTNAFQEIVDAYGVARYEEANPAVYSVITFPFLFAVMF  427

Query  1487  GDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEFF  1308
             GDWGHGICLLL  L+ ++REKKLSSQKL   TEM FGGRYVIL+MALFSIY G IYNEFF
Sbjct  428   GDWGHGICLLLGALFLILREKKLSSQKLDSFTEMAFGGRYVILLMALFSIYCGLIYNEFF  487

Query  1307  SVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKLS  1128
             SV F +FG+SAY CR+ SCSDA T GL+K RD Y FGVDP+W G+RSELPFLNSLKMK+S
Sbjct  488   SVPFHIFGKSAYACRENSCSDAHTAGLLKVRDPYPFGVDPSWRGSRSELPFLNSLKMKMS  547

Query  1127  ILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQA  948
             IL+GV+QMNLGI+LSYF+A Y  + ++   QFIPQ+IFLN+LFGYL++LI++KWCTGS++
Sbjct  548   ILMGVSQMNLGILLSYFDAKYHGNVLDIRYQFIPQMIFLNSLFGYLALLILIKWCTGSKS  607

Query  947   DLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQHN-RH  771
             DLYHVMIYMFL P  DLGENQLF GQK  Q++L+LLA+V+VPWML PKPFILK  H  R 
Sbjct  608   DLYHVMIYMFLDPAGDLGENQLFWGQKELQILLLLLAIVAVPWMLFPKPFILKKLHKERF  667

Query  770   QGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLRLW  591
             QG +Y  +   +     +     + H++F FSEVFVHQ+IH+IEFVLGAVSNTASYLRLW
Sbjct  668   QGHTYRFLGTSEMDPDSEPDSARARHDDFNFSEVFVHQMIHSIEFVLGAVSNTASYLRLW  727

Query  590   ALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHALRL  411
             ALSLAHSELSTVFYEK+LLLAWGY+++I+ +VG  +F FAT  +LL+ME+LSAFLHALRL
Sbjct  728   ALSLAHSELSTVFYEKLLLLAWGYDSLIVKLVGLTVFAFATAFILLMMESLSAFLHALRL  787

Query  410   HWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             HWVEF NKFY GDGYKF PFSF L+ +EED
Sbjct  788   HWVEFMNKFYHGDGYKFKPFSFALLADEED  817



>ref|XP_009103695.1| PREDICTED: vacuolar proton ATPase a1-like [Brassica rapa]
Length=820

 Score =   952 bits (2461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 502/815 (62%), Positives = 628/815 (77%), Gaps = 9/815 (1%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             P MDL RSE M LVQLIIP+ESA   V YLG+LGL+QF+DLNA+KSPFQRT+A Q+KR G
Sbjct  9     PQMDLMRSEKMTLVQLIIPVESAHRCVTYLGELGLLQFRDLNADKSPFQRTFANQVKRCG  68

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EM+RKLRFFKDQ+ KAG+  S   + +  I+  DLE +L + E E++E+N+N++KL++++
Sbjct  69    EMSRKLRFFKDQIDKAGLRCSPRHELEPDIELGDLERQLAEHEHEVLEMNSNSEKLRQTY  128

Query  2387  NELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgee-sleapllsePDMSADTSKQV  2211
             NEL+E+K+VLQK   F  S+ + A   + E           +E   L E +M  +   Q 
Sbjct  129   NELLEFKIVLQKANGFLVSSNAHATGDETELHEGTYSNNGFIETSSLLEQEMRPEPLNQS  188

Query  2210  RLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSG  2031
              L FISG++ K+K + FER+LFRATRGN+L  Q+  DE ++DP + E VEK VF+VF+SG
Sbjct  189   GLRFISGIINKDKLLRFERMLFRATRGNMLFNQTPSDEEIMDPSTSEMVEKIVFVVFFSG  248

Query  2030  ERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSI  1851
             E+A+ KILKIC+AFGAN YP  E+  KQ QL  EV  ++S+L+  +DAG  HR + L ++
Sbjct  249   EQARTKILKICEAFGANCYPVPEDTTKQRQLTREVLSRLSDLEATLDAGTRHRNDALNAV  308

Query  1850  AEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNS  1671
                  +W   VRREK++Y TLNML+ DVTKKCLV EGW PT A  +I + LQRA  DSNS
Sbjct  309   GYSLTKWITTVRREKAVYDTLNMLNFDVTKKCLVGEGWCPTFAKTQIHEVLQRATFDSNS  368

Query  1670  EIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVM  1491
             ++G IF V+   ESPPTYF+TNK T+AFQEI+DAYGVA+YQEANP V+++VT+PFLFAVM
Sbjct  369   QVGVIFHVMQAVESPPTYFRTNKLTNAFQEIIDAYGVARYQEANPAVYSVVTYPFLFAVM  428

Query  1490  FGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEF  1311
             FGDWGHG+CLLL  LY L RE+KLSSQKLG   EM FGGRYVIL+MALFSIY G IYNEF
Sbjct  429   FGDWGHGLCLLLGALYLLARERKLSSQKLGSFMEMLFGGRYVILLMALFSIYCGLIYNEF  488

Query  1310  FSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKL  1131
             FSV F +FG SAY CRD +CSDA T+GL+K RD Y FGVDP+W G+RSELP+LNSLKMK+
Sbjct  489   FSVPFHIFGGSAYKCRDTTCSDAYTVGLVKYRDPYPFGVDPSWRGSRSELPYLNSLKMKM  548

Query  1130  SILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQ  951
             SILLG+AQMNLG+ILS+FNA +F S ++   QFIPQ+IFLN+LFGYLS+LII+KWCTGSQ
Sbjct  549   SILLGIAQMNLGLILSFFNARFFGSSLDIRYQFIPQMIFLNSLFGYLSLLIIIKWCTGSQ  608

Query  950   ADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQH-NR  774
             ADLYHVMIYMFL PTE+LGEN+LF GQ+  Q++L+L+A ++VPWML PKPF L+  H  R
Sbjct  609   ADLYHVMIYMFLSPTEELGENELFWGQRPLQILLLLMAFIAVPWMLFPKPFALRKIHMER  668

Query  773   HQGQSYAPIQ----DLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTAS  606
              QG++Y  +     DLD   +  GS      EEF FSE+FVHQLIH++EFVLG+VSNT S
Sbjct  669   FQGRTYGVLGTSEVDLD---VEPGSARGHQEEEFNFSEIFVHQLIHSLEFVLGSVSNTES  725

Query  605   YLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFL  426
             YLRLWALSLAHSELSTVFYEKVLLLAWGY NI+I ++G ++F FAT  +LL+METLSAFL
Sbjct  726   YLRLWALSLAHSELSTVFYEKVLLLAWGYENILIRLIGLVVFAFATAFILLMMETLSAFL  785

Query  425   HALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             HALRLHWVEF  KF+ GDGYKF PFSF L+  +++
Sbjct  786   HALRLHWVEFMGKFFHGDGYKFKPFSFALISNDDE  820



>ref|XP_001781151.1| predicted protein [Physcomitrella patens]
 gb|EDQ54019.1| predicted protein [Physcomitrella patens]
Length=818

 Score =   950 bits (2456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 515/817 (63%), Positives = 640/817 (78%), Gaps = 10/817 (1%)
 Frame = -2

Query  2741  MDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSGEM  2562
             MDLFRSE M LVQLIIP ESA  ++  L +LGL+QFKDLN EKSPFQRTYA Q+KR GEM
Sbjct  1     MDLFRSEEMSLVQLIIPAESAHDTITCLAELGLLQFKDLNPEKSPFQRTYANQLKRCGEM  60

Query  2561  ARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSFNE  2382
              RK+R+ +DQ++K+G ++S    T   I  ++LE KL +LEAEL+EINAN D+LQR+ +E
Sbjct  61    GRKIRYIQDQIAKSGKTSSYRPLTDKDINLNELETKLTELEAELLEINANTDRLQRTHSE  120

Query  2381  LVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleap---llsePDMSADTSKQV  2211
             L E +LVL K G  F SAR +A   Q +   +++G    EA    LL E +M  D SKQ 
Sbjct  121   LTELQLVLHKAGVLFGSARDAASTVQHQGADTENGSSIEEAVDYPLLQEQEMQTDPSKQA  180

Query  2210  RLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSG  2031
             RLGF++GL+ K K+ +FERI+FRATRGN+ L+Q+ ++++V+DP +GEKVEK VF++F+SG
Sbjct  181   RLGFVTGLISKAKAASFERIIFRATRGNMFLKQAPIEDAVLDPATGEKVEKTVFVLFFSG  240

Query  2030  ERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSI  1851
             ERA+ K++KIC+AFGANRY F ++  +Q Q+ +EV  ++ EL++ +DAGI HR N+  SI
Sbjct  241   ERARTKVVKICEAFGANRYHFPDDPNRQRQMKSEVDMRLVELQSTLDAGIHHRDNVFNSI  300

Query  1850  AEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNS  1671
                 ++W V+VRREK++Y TLNMLSIDVT+KCLVAEGW P SA  +I DALQRA H SNS
Sbjct  301   GYNLEKWAVMVRREKAVYVTLNMLSIDVTRKCLVAEGWCPVSAKPKIHDALQRAAHVSNS  360

Query  1670  EIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVM  1491
             ++  IF+VL T+E+PP+YF+TNKFTSAFQEIV+AYGV +YQEANPG FTI+TFPFLFAVM
Sbjct  361   QVNTIFQVLHTKETPPSYFETNKFTSAFQEIVEAYGVGRYQEANPGCFTIITFPFLFAVM  420

Query  1490  FGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEF  1311
             FGDWGHGICLLL  LY ++ EKKL S+KLGD  EM +GGRYVIL+MA+FSIYTGFIYNEF
Sbjct  421   FGDWGHGICLLLGALYLVLNEKKLGSKKLGDTMEMAYGGRYVILLMAMFSIYTGFIYNEF  480

Query  1310  FSVQFELFGRSAYVCRDP-----SCSDATTIGLIK-ARDTYAFGVDPAWHGTRSELPFLN  1149
             FSV F  FG SAY C DP     +C  ATT G+ K + + YAFG+DP WHG+RSELPF N
Sbjct  481   FSVSFGFFGGSAYQCPDPQYSVKNCPTATTSGVEKWSYEPYAFGIDPIWHGSRSELPFTN  540

Query  1148  SLKMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVK  969
             SLKMK+SILLG+ QMNLGI+LSYFNA YFRS ++ W QFIPQ++FLNALFGYLS LII+K
Sbjct  541   SLKMKMSILLGICQMNLGILLSYFNARYFRSALDVWYQFIPQLLFLNALFGYLSFLIILK  600

Query  968   WCTGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILK  789
             WC GS+ DLYH+MIYMFL PTEDLGENQLF GQ   Q+VL+L+ALV+VPWML PKP I++
Sbjct  601   WCQGSKPDLYHIMIYMFLSPTEDLGENQLFIGQTYVQIVLLLVALVAVPWMLFPKPLIMR  660

Query  788   SQH-NRHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNT  612
              QH  +  G++Y  +++ D            D EEFEFSEVFVHQ+IHTIEFVL +VSNT
Sbjct  661   KQHIQKMHGRTYGFLRESDTESTDLEVDVEHDEEEFEFSEVFVHQMIHTIEFVLNSVSNT  720

Query  611   ASYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSA  432
             ASYLRLWALSLAH++LS VFY++VL+ AW Y N II ++G I+F  AT+ VLL METLSA
Sbjct  721   ASYLRLWALSLAHAQLSAVFYDRVLMFAWEYTNPIIRLIGLIVFANATVVVLLCMETLSA  780

Query  431   FLHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             FLHALRLHWVEFQ KFY+GDGYKF PFSF  + EE+D
Sbjct  781   FLHALRLHWVEFQGKFYQGDGYKFHPFSFKTLFEEDD  817



>ref|XP_002879161.1| VHA-A1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55420.1| VHA-A1 [Arabidopsis lyrata subsp. lyrata]
Length=822

 Score =   948 bits (2451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 504/815 (62%), Positives = 629/815 (77%), Gaps = 7/815 (1%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             P MDL RSE M LVQLIIP+ESA  S+ YLG+LGL+QF+DLNA+KSPFQRT+A Q+KR G
Sbjct  9     PQMDLMRSEKMTLVQLIIPVESAHRSITYLGELGLLQFRDLNADKSPFQRTFANQVKRCG  68

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EM+RKLRFFKDQ+ KAG+  S   + +  I+  DLE +L D E E++E+N+N++KL++++
Sbjct  69    EMSRKLRFFKDQIDKAGLRCSPRHEIEPDIELGDLERQLADHEHEVLEMNSNSEKLRQTY  128

Query  2387  NELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgee-sleapllsePDMSADTSKQV  2211
             NEL+E+K+VL+K   F  S+ + A   + E   S       +E   L E +M+   S Q 
Sbjct  129   NELLEFKIVLEKASGFLVSSNAHAIGDETELHESTYSNNGFIETASLLEQEMNPGPSNQS  188

Query  2210  RLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSG  2031
              L FISG++ K+K + FER+LFRATRGN+L  Q+  DE ++DP + E VEK VF+VF+SG
Sbjct  189   GLRFISGIINKDKLLRFERMLFRATRGNMLFNQTTSDEEIMDPSTSEMVEKVVFVVFFSG  248

Query  2030  ERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSI  1851
             E+A+ KILKIC+AFGAN YP  E+  KQ QL  EV  ++S+L+  +DAG  HR N L S+
Sbjct  249   EQARTKILKICEAFGANCYPVPEDTTKQRQLTREVLSRLSDLEATLDAGTRHRNNALNSV  308

Query  1850  AEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNS  1671
                   W   VRREK++Y TLNML+ DVTKKCLV EGW PT A  +I + LQRA  DSNS
Sbjct  309   GYSLTNWMTTVRREKAVYDTLNMLNFDVTKKCLVGEGWCPTFAKTQIHEVLQRATFDSNS  368

Query  1670  EIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVM  1491
             ++G IF V+   ESPPTYF+TNK T+AFQEI+DAYGVA+YQEANP V+++VT+PFLFAVM
Sbjct  369   QVGVIFHVMQAVESPPTYFRTNKLTNAFQEIIDAYGVARYQEANPAVYSVVTYPFLFAVM  428

Query  1490  FGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEF  1311
             FGDWGHG+CLLL  LY L RE+KLS+QKLG   EM FGGRYVIL+MALFSIY G IYNEF
Sbjct  429   FGDWGHGLCLLLGALYLLARERKLSTQKLGSFMEMLFGGRYVILLMALFSIYCGLIYNEF  488

Query  1310  FSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKL  1131
             FSV F +FG SAY CRD +CSDA T+GL+K RD Y FGVDP+W G+R+ELP+LNSLKMK+
Sbjct  489   FSVPFHIFGGSAYKCRDTTCSDAYTVGLVKYRDPYPFGVDPSWRGSRTELPYLNSLKMKM  548

Query  1130  SILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQ  951
             SILLG+AQMNLG+ILS+FNA +F S ++   QFIPQ+IFLN+LFGYLS+LII+KWCTGSQ
Sbjct  549   SILLGIAQMNLGLILSFFNARFFGSSLDIRYQFIPQMIFLNSLFGYLSLLIIIKWCTGSQ  608

Query  950   ADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQH-NR  774
             ADLYHVMIYMFL PTE+LGEN+LF GQ++ Q++L+LLA ++VPWML PKPF L+  H  R
Sbjct  609   ADLYHVMIYMFLSPTEELGENELFWGQRSLQIMLLLLAFIAVPWMLFPKPFALRKIHMER  668

Query  773   HQGQSYAPIQ----DLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTAS  606
              QG++Y  +     DLD              EEF FSE+FVHQLIH+IEFVLG+VSNTAS
Sbjct  669   FQGRTYGVLGTSEVDLDVE-PDSARGGGHHEEEFNFSEIFVHQLIHSIEFVLGSVSNTAS  727

Query  605   YLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFL  426
             YLRLWALSLAHSELSTVFYEKVL+LAWGY NI+I ++G  +F FAT  +LL+METLSAFL
Sbjct  728   YLRLWALSLAHSELSTVFYEKVLILAWGYENILIRLIGVAVFAFATAFILLMMETLSAFL  787

Query  425   HALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             HALRLHWVEF  KF+ GDGYKF PFSF L+ ++++
Sbjct  788   HALRLHWVEFMGKFFNGDGYKFKPFSFALISDDDE  822



>gb|KHG14972.1| vatM [Gossypium arboreum]
Length=792

 Score =   944 bits (2440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 498/794 (63%), Positives = 615/794 (77%), Gaps = 14/794 (2%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             PPMDL RSE M LVQLIIP+ESA  +++YLG+LGL+QF+DLN+E+SPFQRT+  Q+KR G
Sbjct  12    PPMDLMRSEKMTLVQLIIPVESAHRAISYLGELGLLQFRDLNSERSPFQRTFVNQVKRCG  71

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EM+RKLRFFKDQ+SKAG+ +S +   +  ++ ++LE++L + E ELIE+N+N++KL+ ++
Sbjct  72    EMSRKLRFFKDQISKAGLLSSVHPVVEPDLELEELEIQLAEHEHELIEMNSNSEKLRVTY  131

Query  2387  NELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTSKQVR  2208
             NEL+E+KLVLQK   F   + S+    ++   +             S  +     + Q  
Sbjct  132   NELLEFKLVLQKACGFLLPS-SNHAVAEERELTENIYSNDDYVETASLLEQETRPADQSG  190

Query  2207  LGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSGE  2028
             L FISG++ K K++ FER+LFRATRGN+L  Q+   E ++DP+S E VEK VF+V +SGE
Sbjct  191   LRFISGIICKSKALRFERMLFRATRGNMLFNQAPAGEEIMDPLSAEMVEKTVFVVHFSGE  250

Query  2027  RAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSIA  1848
             +A+ KILKIC+AFGAN YP  +++ KQ Q+  EVS  +SEL+T +DAGI HR   L SI 
Sbjct  251   QARTKILKICEAFGANCYPVPDDISKQRQITREVSSHLSELETTLDAGIRHRNKALTSIG  310

Query  1847  EQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNSE  1668
                 +W  +VRREK++Y TLNML+ DVTKKCLV EGW P  A  +IQ+ALQRA  DS+S+
Sbjct  311   YHLTQWTSMVRREKAVYDTLNMLNFDVTKKCLVGEGWCPIFAKAQIQEALQRATFDSSSQ  370

Query  1667  IGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMF  1488
             +G IF V+   ESPPTYF+TN FT+A+QEIVDAYGVA+YQEANP V+T+VTFPFLFAVMF
Sbjct  371   VGIIFHVMDAVESPPTYFRTNHFTNAYQEIVDAYGVARYQEANPAVYTVVTFPFLFAVMF  430

Query  1487  GDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEFF  1308
             GDWGHGICLLL  L            KLG   EM FGGRYV+L+M+LFSIY G IYNEFF
Sbjct  431   GDWGHGICLLLGAL------------KLGSFMEMLFGGRYVLLLMSLFSIYCGLIYNEFF  478

Query  1307  SVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKLS  1128
             SV F +FG SAY CRD +CSDA + GLIK RD Y FGVDP+W G+RSELPFLNSLKMK+S
Sbjct  479   SVPFHIFGGSAYKCRDVTCSDAKSAGLIKFRDPYPFGVDPSWRGSRSELPFLNSLKMKMS  538

Query  1127  ILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQA  948
             ILLGVAQMNLGIILSYFNA +FRS ++   QF+PQ+IFLN+LFGYLS+LII+KWCTGSQA
Sbjct  539   ILLGVAQMNLGIILSYFNARFFRSSLDIRYQFVPQMIFLNSLFGYLSLLIIIKWCTGSQA  598

Query  947   DLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQHN-RH  771
             DLYHVMIYMFL PT+DLGEN+LF GQ+  Q+VL+LLALV+VPWML PKPFILK  H+ R 
Sbjct  599   DLYHVMIYMFLSPTDDLGENELFWGQRPLQIVLLLLALVAVPWMLFPKPFILKKLHSERF  658

Query  770   QGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLRLW  591
             QG++Y  +   +  L V+       HEEF FSEVFVHQ+IH+IEFVLGAVSNTASYLRLW
Sbjct  659   QGRTYGLLGSSEFDLDVEPDSARDHHEEFNFSEVFVHQMIHSIEFVLGAVSNTASYLRLW  718

Query  590   ALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHALRL  411
             ALSLAHSELSTVFYEKVLLLAWGY+NI+I ++G  +F FAT  +LL+METLSAFLHALRL
Sbjct  719   ALSLAHSELSTVFYEKVLLLAWGYDNIVIRLIGLAVFAFATAFILLMMETLSAFLHALRL  778

Query  410   HWVEFQNKFYEGDG  369
             HWVEFQNKFY GDG
Sbjct  779   HWVEFQNKFYHGDG  792



>ref|NP_850122.1| vacuolar proton ATPase A1 [Arabidopsis thaliana]
 sp|Q8RWZ7.1|VHAA1_ARATH RecName: Full=V-type proton ATPase subunit a1; Short=V-ATPase 
subunit a1; AltName: Full=V-type proton ATPase 95 kDa subunit 
a isoform 1; Short=V-ATPase 95 kDa isoform a1; AltName: Full=Vacuolar 
H(+)-ATPase subunit a isoform 1; AltName: Full=Vacuolar 
proton pump subunit a1; AltName: Full=Vacuolar proton 
translocating ATPase 95 kDa subunit a isoform 1 [Arabidopsis 
thaliana]
 gb|AAM14030.1| putative vacuolar proton-ATPase subunit [Arabidopsis thaliana]
 gb|AEC08134.1| vacuolar proton ATPase A1 [Arabidopsis thaliana]
Length=817

 Score =   944 bits (2439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 506/810 (62%), Positives = 624/810 (77%), Gaps = 7/810 (1%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             P MDL RSE M LVQLIIP+ESA  S+ YLG+LGL+QF+DLNA+KSPFQRT+A Q+KR G
Sbjct  9     PQMDLMRSEKMTLVQLIIPVESAHRSITYLGELGLLQFRDLNADKSPFQRTFANQVKRCG  68

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EM+RKLRFFKDQ+ KAG+  S   + +  I   DLE +L D E E++E+N+N++KL++++
Sbjct  69    EMSRKLRFFKDQIDKAGLRCSPRLEIEPDIALGDLERQLADHEHEVLEMNSNSEKLRQTY  128

Query  2387  NELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgee-sleapllsePDMSADTSKQV  2211
             NEL+E+K+VL+K   F  S+ + A  ++ E   S       +E   L E +M+   S Q 
Sbjct  129   NELLEFKIVLEKASGFLVSSNTHAIGEEIELHESTYSNNGFIETASLLEQEMNPGHSNQS  188

Query  2210  RLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSG  2031
              L FISG++ K+K + FER+LFRATRGN+L  Q+  DE ++DP + E VEK VF+VF+SG
Sbjct  189   GLRFISGIINKDKLLKFERMLFRATRGNMLFNQTTSDEEIMDPSTSEMVEKVVFVVFFSG  248

Query  2030  ERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSI  1851
             E+A+ KILKIC+AFGAN YP  E+  KQ QL  EV  ++S+L+  +DAG  HR N L S+
Sbjct  249   EQARTKILKICEAFGANCYPVPEDTTKQRQLTREVLSRLSDLEATLDAGTRHRNNALNSV  308

Query  1850  AEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNS  1671
                   W   VRREK++Y TLNML+ DVTKKCLV EGW PT A  +I + LQRA  DS+S
Sbjct  309   GYSLTNWITTVRREKAVYDTLNMLNFDVTKKCLVGEGWCPTFAKTQIHEVLQRATFDSSS  368

Query  1670  EIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVM  1491
             ++G IF V+   ESPPTYF+TNK T+AFQEI+DAYGVA+YQEANP V+++VT+PFLFAVM
Sbjct  369   QVGVIFHVMQAVESPPTYFRTNKLTNAFQEIIDAYGVARYQEANPAVYSVVTYPFLFAVM  428

Query  1490  FGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEF  1311
             FGDWGHG+CLLL  LY L RE+KLS+QKLG   EM FGGRYVIL+MALFSIY G IYNEF
Sbjct  429   FGDWGHGLCLLLGALYLLARERKLSTQKLGSFMEMLFGGRYVILLMALFSIYCGLIYNEF  488

Query  1310  FSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKL  1131
             FSV F +FG SAY CRD +CSDA T+GLIK RD Y FGVDP+W G+R+ELP+LNSLKMK+
Sbjct  489   FSVPFHIFGGSAYKCRDTTCSDAYTVGLIKYRDPYPFGVDPSWRGSRTELPYLNSLKMKM  548

Query  1130  SILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQ  951
             SILLG+AQMNLG+ILS+FNA +F S ++   QFIPQ+IFLN+LFGYLS+LII+KWCTGSQ
Sbjct  549   SILLGIAQMNLGLILSFFNARFFGSSLDIRYQFIPQMIFLNSLFGYLSLLIIIKWCTGSQ  608

Query  950   ADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQH-NR  774
             ADLYHVMIYMFL PTE+LGEN+LF GQ+  Q+VL+LLA ++VPWML PKPF L+  H  R
Sbjct  609   ADLYHVMIYMFLSPTEELGENELFWGQRPLQIVLLLLAFIAVPWMLFPKPFALRKIHMER  668

Query  773   HQGQSYAPI----QDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTAS  606
              QG++Y  +     DLD              EEF FSE+FVHQLIH+IEFVLG+VSNTAS
Sbjct  669   FQGRTYGVLVSSEVDLDVE-PDSARGGGHHEEEFNFSEIFVHQLIHSIEFVLGSVSNTAS  727

Query  605   YLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFL  426
             YLRLWALSLAHSELSTVFYEKVLLLAWGY NI+I ++G  +F FAT  +LL+METLSAFL
Sbjct  728   YLRLWALSLAHSELSTVFYEKVLLLAWGYENILIRLIGVAVFAFATAFILLMMETLSAFL  787

Query  425   HALRLHWVEFQNKFYEGDGYKFDPFSFVLV  336
             HALRLHWVEF  KF+ GDGYKF PFSF L+
Sbjct  788   HALRLHWVEFMGKFFNGDGYKFKPFSFALI  817



>emb|CDM85023.1| unnamed protein product [Triticum aestivum]
Length=817

 Score =   942 bits (2435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 493/810 (61%), Positives = 617/810 (76%), Gaps = 2/810 (0%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             PPMD  RSE M LVQLI P ESARL+V YLG+LGL+QFKDLN +KSPFQR +  Q+KR  
Sbjct  8     PPMDHLRSEKMCLVQLIFPAESARLAVTYLGELGLLQFKDLNEDKSPFQRIFVNQVKRCA  67

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EM RKL+FF DQ++KAGV +S     Q  I  ++LE KLG+ E EL+E+N N+  L++++
Sbjct  68    EMNRKLKFFSDQINKAGVKSSVRPALQPEIDLEELEAKLGEHEHELLEMNTNSGTLRQTY  127

Query  2387  NELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTSKQVR  2208
             NEL+E+KLVL K G    ++++ A     E       +E  +             + +  
Sbjct  128   NELLEFKLVLSKAGSILAASQNHATPADHELDEHIYDKEVDDGNGYLLEQGIYQGASESG  187

Query  2207  LGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSGE  2028
             + F+SG++ K K++AFER+LFR TRGN+   ++   E V+DP SGE+VEK VF+VF+SGE
Sbjct  188   VRFVSGIILKSKALAFERMLFRTTRGNMFFNEASAGEPVMDPSSGEEVEKTVFVVFFSGE  247

Query  2027  RAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSIA  1848
             +AK KIL+IC +FGAN YP  EE+ KQ Q+  EVS ++S+L+  +DAG  HR   L+S+ 
Sbjct  248   QAKAKILRICASFGANCYPVPEEIVKQRQIFREVSSRLSDLEATLDAGTQHRNKALESVG  307

Query  1847  EQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNSE  1668
              Q  RW ++V++EK++Y TLNML+ DVTKKCLV EGW P  A  +I+D LQRA   SNS+
Sbjct  308   SQLWRWILMVKKEKAVYDTLNMLNFDVTKKCLVGEGWCPIFAKSQIEDVLQRATLHSNSQ  367

Query  1667  IGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMF  1488
             +G IF  + T +SPPTYF+T+KFT+AFQEIVDAYGV +Y+E NP V++++TFPFLFAVMF
Sbjct  368   VGIIFHEMDTIDSPPTYFRTDKFTNAFQEIVDAYGVGRYEEINPAVYSVITFPFLFAVMF  427

Query  1487  GDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEFF  1308
             GDWGHGICLLL  L+ ++REKKLSSQKL   TEM FGGRYVIL+MALFSIY G IYNEFF
Sbjct  428   GDWGHGICLLLGALFLILREKKLSSQKLDSFTEMAFGGRYVILLMALFSIYCGLIYNEFF  487

Query  1307  SVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKLS  1128
             SV F +FG+SAY CR+ SCSDA T GL+K RD Y FGVDP+W G+RSELPFLNSLKMK+S
Sbjct  488   SVPFHIFGKSAYACRENSCSDAYTAGLVKVRDPYPFGVDPSWRGSRSELPFLNSLKMKMS  547

Query  1127  ILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQA  948
             IL+GV+QMNLGI+LSYF+A + ++ ++   QFIPQ+IFLN+LFGYLS+LI++KWCTGS+A
Sbjct  548   ILMGVSQMNLGILLSYFDAKFHKNALDIRYQFIPQLIFLNSLFGYLSLLILIKWCTGSKA  607

Query  947   DLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQHN-RH  771
             DLYHVMIYMFL P  DLGENQLF GQK  Q++L+LLALV+VPWML PKPFILK  H  R 
Sbjct  608   DLYHVMIYMFLDPAGDLGENQLFWGQKELQILLLLLALVAVPWMLFPKPFILKKLHKERF  667

Query  770   QGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLRLW  591
             QG SY  +   +     +     S H++F F EVFVHQ+IH+IEFVLGAVSNTASYLRLW
Sbjct  668   QGHSYRFLGTSEMDPDSEPDSARSRHDDFNFGEVFVHQMIHSIEFVLGAVSNTASYLRLW  727

Query  590   ALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHALRL  411
             ALSLAHSELSTVFYEK+LL AWGY+++I  +VG I+F FAT  +LL ME+LSAFLHALRL
Sbjct  728   ALSLAHSELSTVFYEKLLLFAWGYDSLIFKLVGLIVFAFATAFILLGMESLSAFLHALRL  787

Query  410   HWVEFQNKFYEGDGYKFDPFSF-VLVDEEE  324
             HWVEF NKFY GDGYKF PFSF  L D+EE
Sbjct  788   HWVEFMNKFYHGDGYKFKPFSFATLADDEE  817



>gb|EYU36217.1| hypothetical protein MIMGU_mgv1a001612mg [Erythranthe guttata]
Length=785

 Score =   939 bits (2426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 495/818 (61%), Positives = 602/818 (74%), Gaps = 49/818 (6%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             P MDL RSE M   QLIIP+E+A  +V+YLG LGL+QF+DLN +KSPFQRT+  Q+KR  
Sbjct  8     PSMDLMRSEEMIFTQLIIPVETAHRAVSYLGQLGLLQFRDLNEDKSPFQRTFVNQVKRCA  67

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EM+RKLRF KDQ+ KAG+  S++  +Q  I+ ++LE +L + E ELIE+N N++KLQ+++
Sbjct  68    EMSRKLRFLKDQIHKAGI-ISSHPASQPDIELEELESRLAEHEHELIEMNTNSEKLQQTY  126

Query  2387  NELVEYKLVLQKVGEFF-----HSARssaeaqqqeygssqsgeesleapllsePDMSADT  2223
             NEL+E+K+VLQK G+F      HSA       Q+          +      S  +   + 
Sbjct  127   NELLEFKMVLQKAGDFLVPSGNHSA------VQETELDENVCINNDYVDTESLLEQQPEP  180

Query  2222  SKQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLV  2043
             S Q  + F+SG++ K K ++FERILFR TRGN+L  Q+  D+ ++DP S E VE  +F+V
Sbjct  181   SNQSGVKFVSGIICKSKVLSFERILFRTTRGNMLFNQAPADDQIMDPASNEMVENTIFVV  240

Query  2042  FYSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNL  1863
             F+SGE+A+ KILKIC+AFGAN YP  EE  K+ Q+  EV  ++SEL+T +DAG+ HR   
Sbjct  241   FFSGEQARKKILKICEAFGANCYPVPEETTKRRQITREVLSRLSELETTLDAGLRHRDTA  300

Query  1862  LQSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGH  1683
             L SI+ Q  RW  +VRREK+IY TLNML+ DVTKKCLV EGW PT A  +IQ+ALQRA  
Sbjct  301   LTSISFQLSRWTNMVRREKAIYDTLNMLNFDVTKKCLVGEGWCPTFAKTKIQEALQRATF  360

Query  1682  DSNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFL  1503
             DSNS++G IF V+ + E PPTYF+TN FT+A+QEIVDAYGVAKYQEANP V+ +VTFPFL
Sbjct  361   DSNSQVGIIFHVMDSVELPPTYFRTNHFTNAYQEIVDAYGVAKYQEANPAVYAVVTFPFL  420

Query  1502  FAVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFI  1323
             FAVMFGDWGHGICLLL  L+ L REKK  SQKLG   EM FGGRYV+L+M+LFSIY G I
Sbjct  421   FAVMFGDWGHGICLLLGALFLLAREKKFGSQKLGSFMEMLFGGRYVLLLMSLFSIYCGLI  480

Query  1322  YNEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSL  1143
             YNEFFSV F +FG SAY CRD +CSDA T+GLIK RDTY FGVDP+W G+RSELPFLNSL
Sbjct  481   YNEFFSVPFHIFGSSAYNCRDATCSDAHTVGLIKDRDTYPFGVDPSWRGSRSELPFLNSL  540

Query  1142  KMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWC  963
             KMK+SIL G+AQMNLGIILSYFNA YF + ++   QF+PQ+IFLN+LFGYLS+LII+KWC
Sbjct  541   KMKMSILFGLAQMNLGIILSYFNARYFNNSLDIKYQFVPQMIFLNSLFGYLSLLIIIKWC  600

Query  962   TGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQ  783
             TGSQADLYHVMIYMFL P EDLG+N+LF GQ                             
Sbjct  601   TGSQADLYHVMIYMFLSPFEDLGDNKLFWGQ-----------------------------  631

Query  782   HNRHQGQSYAPI--QDL--DESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSN  615
               R QG++Y  +   D+  DE      S      EEF FSEVFVHQ+IH IEF+LGAVSN
Sbjct  632   -GRFQGRTYGVLGTSDMYNDEE---PDSARHPREEEFNFSEVFVHQMIHAIEFILGAVSN  687

Query  614   TASYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLS  435
             TASYLRLWALSLAHSELSTVFYEKVLLLAWGYNNIII +VG  +F FAT  +LL+METLS
Sbjct  688   TASYLRLWALSLAHSELSTVFYEKVLLLAWGYNNIIIRLVGLAVFAFATSFILLMMETLS  747

Query  434   AFLHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             AFLHALRLHWVEFQNKFY GDGYKF PFSF  + ++ED
Sbjct  748   AFLHALRLHWVEFQNKFYSGDGYKFRPFSFAALTDDED  785



>ref|XP_006365750.1| PREDICTED: vacuolar proton ATPase a1-like isoform X2 [Solanum 
tuberosum]
Length=790

 Score =   939 bits (2426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 488/810 (60%), Positives = 599/810 (74%), Gaps = 28/810 (3%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             P MDL RSE M  VQLIIP ESA  ++ YLG LGL+QF+DLNA+KSPFQRT+  Q+KR  
Sbjct  8     PLMDLMRSEKMTFVQLIIPAESAHRAITYLGQLGLLQFRDLNAKKSPFQRTFVNQVKRCV  67

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EM RKLR+FKDQ+ KAG+       +Q   + +++E++L + E ELIE+NAN++KL++S+
Sbjct  68    EMGRKLRYFKDQIHKAGLLLPPLPASQPDTELEEIEIQLAEHEHELIEMNANSEKLRQSY  127

Query  2387  NELVEYKLVLQKVGEFF-HSARssaeaqqqeygssqsgeesleapllsePDMSADTSKQV  2211
             NEL+E+K+VLQK   F   S+  + + + +   +  S +   +   L E +M ++ S Q 
Sbjct  128   NELLEFKMVLQKASGFLVSSSSHTTDREIELDENVYSNDNHGDTASLIEQEMHSELSNQS  187

Query  2210  RLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSG  2031
              + FISG++   K + FER+LFRATRGN+L  Q+  D+ ++DP S E VEK VF+VF+SG
Sbjct  188   GVRFISGIICNSKVLQFERMLFRATRGNMLFNQAVADDEILDPSSNEMVEKIVFVVFFSG  247

Query  2030  ERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSI  1851
             E+A+ KILKIC+AF AN YP  E+  K+ Q+  EV  ++SEL+T +DAG+ HR   L SI
Sbjct  248   EQARTKILKICEAFSANCYPVPEDTTKRRQITQEVLSRLSELETTLDAGLRHRDKALTSI  307

Query  1850  AEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNS  1671
                  +W  +V+ +K++Y TLNML+ DVTKKCLV EGW P  A  +IQ+ALQRA  DS+S
Sbjct  308   GYHLTKWINMVKTQKAVYDTLNMLNFDVTKKCLVGEGWCPIFAKTKIQEALQRATFDSSS  367

Query  1670  EIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVM  1491
             ++G IF V+   ESPPTYF+TN+FT+AFQEIVDAYGVAKYQEANP V+TIVTFPFLFAVM
Sbjct  368   QVGIIFHVMDAVESPPTYFRTNRFTNAFQEIVDAYGVAKYQEANPAVYTIVTFPFLFAVM  427

Query  1490  FGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEF  1311
             FGDWGHGICLLL  L  + RE KLSSQKLG   EM FGGRYV+L+M++FSIY G IYNEF
Sbjct  428   FGDWGHGICLLLGALVLIARESKLSSQKLGSFMEMLFGGRYVLLLMSIFSIYCGLIYNEF  487

Query  1310  FSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKL  1131
             FSV F +FG SAY CRD +CSDA T+GLIK +D Y FGVDP+W G+RSELPFLNSLKMK+
Sbjct  488   FSVPFHIFGDSAYKCRDATCSDAQTVGLIKYKDPYPFGVDPSWRGSRSELPFLNSLKMKM  547

Query  1130  SILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQ  951
             SILLGVAQMNLGIILSYFNA +F S ++   QFIPQIIFLN+LFGYLS+L++VKWCTGSQ
Sbjct  548   SILLGVAQMNLGIILSYFNARFFSSSLDIKYQFIPQIIFLNSLFGYLSLLVVVKWCTGSQ  607

Query  950   ADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQHNRH  771
             ADLYHVMIYMFL P E LGEN+LF GQ   Q                           R 
Sbjct  608   ADLYHVMIYMFLSPFEALGENRLFWGQSVLQ---------------------------RF  640

Query  770   QGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLRLW  591
             QG++Y  +   +              EEF FSEVFVHQ+IH+IEFVLGAVSNTASYLRLW
Sbjct  641   QGRTYGMLGTSEMGSDDQPDSARERAEEFNFSEVFVHQMIHSIEFVLGAVSNTASYLRLW  700

Query  590   ALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHALRL  411
             ALSLAHSELSTVFYEKVLLLAWGY NIII +VG  +F FAT  +LL+METLSAFLHALRL
Sbjct  701   ALSLAHSELSTVFYEKVLLLAWGYENIIIRLVGLAVFAFATAFILLMMETLSAFLHALRL  760

Query  410   HWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             HWVEFQNKFY GDGYKF PFSF L+ ++ED
Sbjct  761   HWVEFQNKFYHGDGYKFMPFSFALLADDED  790



>gb|EEC71752.1| hypothetical protein OsI_04326 [Oryza sativa Indica Group]
Length=806

 Score =   938 bits (2425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 485/811 (60%), Positives = 616/811 (76%), Gaps = 14/811 (2%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             PPMD  RSE M  VQLIIP ESARL+V YLG+LGL+QFKDLN +KSPFQR +  Q+KR  
Sbjct  8     PPMDHLRSEKMCFVQLIIPAESARLAVTYLGELGLLQFKDLNEDKSPFQRIFVNQVKRCS  67

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EM+RKLRFF DQ++KAGV +S     Q  I  ++LE KL + E +L+E+N N++KL +++
Sbjct  68    EMSRKLRFFNDQINKAGVKSSVRPAMQPDIDLEELEAKLREHENDLLEMNTNSEKLLQTY  127

Query  2387  NELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePD-MSADTSKQV  2211
             NEL+E+K+VL K G    S+ + A   ++E       +E  +         +    S+  
Sbjct  128   NELLEFKMVLSKAGGILASSHNHAAPAERELDEHIYDKEMDDGNAYLLEQGVHLGASENS  187

Query  2210  RLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSG  2031
              + F+SG++ K K+MAFER+LFRATRGN+   Q+   E V DPISGE+VEK VF+VF+SG
Sbjct  188   GVKFVSGIILKSKAMAFERMLFRATRGNMFFNQAPAGEPVTDPISGEEVEKTVFVVFFSG  247

Query  2030  ERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSI  1851
             ++AK KILKIC +FGA+ YP  EE+ KQ Q+  EVSG++++L+  +DAGI HR   L+S+
Sbjct  248   DQAKAKILKICGSFGASCYPVPEEMVKQRQIFREVSGRLADLEATLDAGIQHRNKALESV  307

Query  1850  AEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNS  1671
               Q  RW ++V++EK++Y TLNML+ DVTKKCLV EGW P  A  +I+D LQRA   SNS
Sbjct  308   GSQLWRWTIMVKKEKAVYDTLNMLNFDVTKKCLVGEGWCPIFAKSQIKDVLQRATLHSNS  367

Query  1670  EIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVM  1491
             ++G IF  + T +SPPTYF+T+KFT+AFQEIVDAYG+A+Y+EANP V++++TFPFLFAVM
Sbjct  368   QVGIIFHEMDTIDSPPTYFQTDKFTNAFQEIVDAYGIARYEEANPAVYSVITFPFLFAVM  427

Query  1490  FGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEF  1311
             FGDWGHGICLLL     ++REKKLSSQKLG   EM FGGRYVIL+MALFSIY G IYNEF
Sbjct  428   FGDWGHGICLLLGACVLILREKKLSSQKLGSFMEMAFGGRYVILLMALFSIYCGLIYNEF  487

Query  1310  FSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKL  1131
             FSV F +FG+SAY CR+ +CSDA T GLIK RD Y FGVDP+W G+RSELPFLNSLKMK+
Sbjct  488   FSVPFHIFGKSAYECREKTCSDAHTAGLIKVRDPYPFGVDPSWRGSRSELPFLNSLKMKM  547

Query  1130  SILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQ  951
             SIL+GV QMNLGI+LSYF+A +  + ++             +LFGYL++LI++KWCTGSQ
Sbjct  548   SILMGVTQMNLGIVLSYFDAKFHGNALDI------------SLFGYLALLILIKWCTGSQ  595

Query  950   ADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQHN-R  774
             ADLYHVMIYMFL P+ +LGENQLF GQK  Q++L+L+A+V+VPWML PKPFILK  H  R
Sbjct  596   ADLYHVMIYMFLDPSGNLGENQLFWGQKELQILLLLMAIVAVPWMLFPKPFILKKLHKER  655

Query  773   HQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLRL  594
              QG +Y  +   +     +     S H++F FSEVFVHQ+IH+IEFVLGAVSNTASYLRL
Sbjct  656   FQGHTYRFLGTSEMDPDSEPDSARSRHDDFNFSEVFVHQMIHSIEFVLGAVSNTASYLRL  715

Query  593   WALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHALR  414
             WALSLAHSELSTVFYEK+L+LAWGY+N+++ +VG +IF FAT  +LL ME+LSAFLHALR
Sbjct  716   WALSLAHSELSTVFYEKLLVLAWGYDNLVVKLVGLVIFSFATAFILLGMESLSAFLHALR  775

Query  413   LHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             LHWVEF NKFY GDGYKF PFSF L+ ++ED
Sbjct  776   LHWVEFMNKFYHGDGYKFRPFSFALLADDED  806



>ref|XP_002978460.1| hypothetical protein SELMODRAFT_109102 [Selaginella moellendorffii]
 gb|EFJ20446.1| hypothetical protein SELMODRAFT_109102 [Selaginella moellendorffii]
Length=811

 Score =   935 bits (2417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 490/811 (60%), Positives = 621/811 (77%), Gaps = 6/811 (1%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             PP+ L RSE M LV+++IP+ESA  +VAYLG LG++QF+DLN  KSP QR YA Q+KR G
Sbjct  2     PPLFLLRSEDMSLVRMVIPVESAHDTVAYLGQLGMLQFRDLNPGKSPTQRIYANQVKRCG  61

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EM R+LR+FK Q+  AG+  +A S  ++ +  D+LEVKL + E EL EI +N+ +L RS 
Sbjct  62    EMGRQLRYFKSQIESAGILIAARSTIENDVDLDELEVKLSEYETELKEIASNSARLFRSH  121

Query  2387  NELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTSKQVR  2208
              EL E++LVL K G FF S R+ A   Q+EY   +   +S    +    +M  D +K  +
Sbjct  122   AELTEFQLVLLKAGRFFTSGRAEAAFAQREYDDFEGSMDSPLLLIEQ--EMQTDPTKG-Q  178

Query  2207  LGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSGE  2028
             LG+++GL+PK K++ FERILFRATRGN++ + S V+  V DP +GEKVEK+VF+VF+SGE
Sbjct  179   LGYVTGLIPKLKTIQFERILFRATRGNMVFKSSVVERPVTDPATGEKVEKSVFVVFFSGE  238

Query  2027  RAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSIA  1848
             R + KI+KICDAFGA+RYP+ EE   Q Q+ +EV+G++SELK+ +DAG  HR  +L  I+
Sbjct  239   RTQAKIVKICDAFGASRYPYPEEPSLQRQMRSEVTGRLSELKSTLDAGTSHRDTVLAGIS  298

Query  1847  EQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNSE  1668
              Q D W ++V+REK++YH +N  ++DVT+KCLVAE WS      ++Q+AL RA  DSNS+
Sbjct  299   YQLDFWILMVQREKAVYHIMNKFNMDVTRKCLVAEAWSDFICEKQVQEALMRATVDSNSQ  358

Query  1667  IGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMF  1488
             +G IF+ + T++ PPT+FKTNK T AFQ IVDAYGVA+Y+EANP V+TIVTFPFLFAVMF
Sbjct  359   VGTIFQEIRTKDLPPTFFKTNKITGAFQGIVDAYGVARYKEANPAVYTIVTFPFLFAVMF  418

Query  1487  GDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEFF  1308
             GDWGHGI LLLATLY ++ E KL SQKLGDI  M FGGRYVIL+M++FSIYTGFIYNEFF
Sbjct  419   GDWGHGIVLLLATLYLILNEGKLGSQKLGDIMGMAFGGRYVILLMSIFSIYTGFIYNEFF  478

Query  1307  SVQFELFGRSAYVCRDPSCSDATTIGLIKARD-TYAFGVDPAWHGTRSELPFLNSLKMKL  1131
             SV F +FG SAYVCRDPSC D+ T GLIK    TY FG DP WHG+RSELPFLNS+KMK+
Sbjct  479   SVPFRIFGESAYVCRDPSCKDSRTAGLIKGPGYTYPFGFDPVWHGSRSELPFLNSVKMKM  538

Query  1130  SILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQ  951
             SILLGV  MNLG+ LSY+NA YF   ++ W QF+PQI+FL +LFGYLS+LII+KWC+GSQ
Sbjct  539   SILLGVVHMNLGLALSYYNASYFNEPLDIWYQFVPQILFLGSLFGYLSLLIIIKWCSGSQ  598

Query  950   ADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQH-NR  774
             ADLYHVMIYMFL PT+DLG NQLF GQ   Q  L+L+A+V+VP MLLPKP  LK +H  R
Sbjct  599   ADLYHVMIYMFLSPTDDLGPNQLFSGQTEVQCFLLLIAVVAVPTMLLPKPLALKKRHEER  658

Query  773   HQGQSYAPIQ-DLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLR  597
               G+SY  +    D   + +        EEF+F E FVHQ+I TIEFVLGAVSNTASYLR
Sbjct  659   THGRSYGILNAGSDGESVDNEHDHHHGEEEFDFGETFVHQMIETIEFVLGAVSNTASYLR  718

Query  596   LWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHAL  417
             LWALSLAH++LS VFY+KVL+LAW Y+N +IL++G  +FI AT+GVLL+METLSAFLHAL
Sbjct  719   LWALSLAHAQLSAVFYDKVLILAWSYHNTMILIIGGFVFICATVGVLLIMETLSAFLHAL  778

Query  416   RLHWVEFQNKFYEGDGYKFDPFSFVLVDEEE  324
             RLHWVEFQ KFY GDGY+F+PFSF  ++E++
Sbjct  779   RLHWVEFQGKFYGGDGYQFEPFSFATLEEDD  809



>ref|XP_002970298.1| hypothetical protein SELMODRAFT_93837 [Selaginella moellendorffii]
 gb|EFJ28428.1| hypothetical protein SELMODRAFT_93837 [Selaginella moellendorffii]
Length=811

 Score =   933 bits (2412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 490/811 (60%), Positives = 620/811 (76%), Gaps = 6/811 (1%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             PP+ L RSE M LV+++IP+ESA  +VAYLG LG++QF+DLN  KSP QR YA Q+KR G
Sbjct  2     PPLFLLRSEDMSLVRMVIPVESAHDTVAYLGQLGMLQFRDLNPGKSPTQRIYANQVKRCG  61

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EM R+LR+FK Q+  AG+  +A S  +  +  D+LEVKL + E EL EI +N+ +L RS 
Sbjct  62    EMGRQLRYFKSQIESAGILIAARSTIEKDVDLDELEVKLSEYETELKEIASNSARLFRSH  121

Query  2387  NELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTSKQVR  2208
              EL E++LVL K G FF S R+ A   Q+EY   +   +S    +    +M  D +K  +
Sbjct  122   AELTEFQLVLLKAGRFFTSGRAEAAFAQREYDDFEGSMDSPLLLIEQ--EMQTDPTKG-Q  178

Query  2207  LGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSGE  2028
             LG+++GL+PK K++ FERILFRATRGN++ + S V+  V DP +GEKVEK+VF+VF+SGE
Sbjct  179   LGYVTGLIPKLKTIQFERILFRATRGNMVFKSSVVERPVTDPATGEKVEKSVFVVFFSGE  238

Query  2027  RAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSIA  1848
             R + KI+KICDAFGA+RYP+ EE   Q Q+ +EV+G++SELK+ +DAG  HR  +L  I+
Sbjct  239   RTQAKIVKICDAFGASRYPYPEEPSLQRQMRSEVAGRLSELKSTLDAGTSHRDTVLAGIS  298

Query  1847  EQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNSE  1668
              Q D W ++V+REK++YH +N  ++DVT+KCLVAE WS      ++Q+AL RA  DSNS+
Sbjct  299   YQLDFWILMVQREKAVYHIMNKFNMDVTRKCLVAEAWSDFICEKQVQEALMRATVDSNSQ  358

Query  1667  IGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMF  1488
             +G IF+ + T++ PPT+FKTNK T AFQ IVDAYGVA+Y+EANP V+TIVTFPFLFAVMF
Sbjct  359   VGTIFQEIRTKDLPPTFFKTNKITGAFQGIVDAYGVARYKEANPAVYTIVTFPFLFAVMF  418

Query  1487  GDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEFF  1308
             GDWGHGI LLLATLY ++ E KL SQKLGDI  M FGGRYVIL+M++FSIYTGFIYNEFF
Sbjct  419   GDWGHGIVLLLATLYLILNEGKLGSQKLGDIMGMAFGGRYVILLMSIFSIYTGFIYNEFF  478

Query  1307  SVQFELFGRSAYVCRDPSCSDATTIGLIKARD-TYAFGVDPAWHGTRSELPFLNSLKMKL  1131
             SV F +FG SAYVCRDPSC D+ T GLIK    TY FG DP WHG+RSELPFLNS+KMK+
Sbjct  479   SVPFRIFGESAYVCRDPSCKDSRTAGLIKRPGYTYPFGFDPVWHGSRSELPFLNSVKMKM  538

Query  1130  SILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQ  951
             SILLGV  MNLG+ LSY+NA YF   ++ W QF+PQI+FL +LFGYLS+LII+KWC+GSQ
Sbjct  539   SILLGVVHMNLGLALSYYNASYFNEPLDIWYQFVPQILFLGSLFGYLSLLIIIKWCSGSQ  598

Query  950   ADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQH-NR  774
             ADLYHVMIYMFL PT+DLG NQLF GQ   Q  L+L+A+V+VP MLLPKP  LK +H  R
Sbjct  599   ADLYHVMIYMFLSPTDDLGPNQLFSGQTEVQCFLLLIAVVAVPTMLLPKPLALKKRHEER  658

Query  773   HQGQSYAPIQ-DLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLR  597
               G+SY  +    D   + +        EEF+F E FVHQ+I TIEFVLGAVSNTASYLR
Sbjct  659   THGRSYGILNAGSDGESVDNEHDHHHGEEEFDFGETFVHQMIETIEFVLGAVSNTASYLR  718

Query  596   LWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHAL  417
             LWALSLAH++LS VFY+KVL+LAW Y+N +IL++G  +FI AT+GVLL+METLSAFLHAL
Sbjct  719   LWALSLAHAQLSAVFYDKVLILAWSYHNTMILIIGGFVFICATVGVLLIMETLSAFLHAL  778

Query  416   RLHWVEFQNKFYEGDGYKFDPFSFVLVDEEE  324
             RLHWVEFQ KFY GDGY+F+PFSF  ++E++
Sbjct  779   RLHWVEFQGKFYGGDGYQFEPFSFATLEEDD  809



>emb|CDY53381.1| BnaA04g16460D [Brassica napus]
Length=799

 Score =   928 bits (2399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 490/814 (60%), Positives = 609/814 (75%), Gaps = 28/814 (3%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             P MDL RSE M LVQLIIP+ESA   V YLG+LGL+QF+DLNA+KSPFQRT+A Q+KR G
Sbjct  9     PEMDLMRSEKMTLVQLIIPVESAHRCVTYLGELGLLQFRDLNADKSPFQRTFATQVKRCG  68

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EM+RKLRFFKDQ+ KAG+      + +  I+  DLE +L D E E++E+N+N++KL+ ++
Sbjct  69    EMSRKLRFFKDQIDKAGLRCLPRHEIEPDIELGDLERQLADHEHEVLEMNSNSEKLRLTY  128

Query  2387  NELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgee-sleapllsePDMSADTSKQV  2211
             NEL+E+K+VLQK   F  S+ + A   + E   S       +E+  L E +M  +   Q 
Sbjct  129   NELLEFKIVLQKASGFLVSSNAHAIGDETELHESTYSNNGFIESSSLLEQEMRHEPLNQS  188

Query  2210  RLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSG  2031
              L FISG++ K+K + FER+LFRATRGN+L  Q+  DE ++DP + E VEK VF+VF+SG
Sbjct  189   GLRFISGIINKDKLLKFERMLFRATRGNMLFNQTPSDEEIMDPSTSEMVEKIVFVVFFSG  248

Query  2030  ERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSI  1851
             E+A+ KILKIC+AFGAN YP  E+  KQ QL  EV  ++S+L+  +DAG  HR N L ++
Sbjct  249   EQARTKILKICEAFGANCYPVPEDTTKQRQLTREVLSRLSDLEATLDAGTRHRNNALNAV  308

Query  1850  AEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNS  1671
                  +W   VRREK++Y TLNML+ DVTKKCLV EGW PT A  +I + LQRA  DSNS
Sbjct  309   GYSLTKWMTTVRREKAVYDTLNMLNFDVTKKCLVGEGWCPTFAKTQIHEVLQRATFDSNS  368

Query  1670  EIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVM  1491
             ++G IF V+   ESPPTYF+TNK T+AFQEI+DAYGVA+YQEANP V+++VT+PFLFAVM
Sbjct  369   QVGVIFHVMQAVESPPTYFRTNKLTNAFQEIIDAYGVARYQEANPAVYSVVTYPFLFAVM  428

Query  1490  FGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEF  1311
             FGDWGHG+CLLL  LY L RE+KLS+QKLG   EM FGGRYVIL+MALFSIY G IYNEF
Sbjct  429   FGDWGHGLCLLLGALYLLARERKLSTQKLGSFMEMLFGGRYVILLMALFSIYCGLIYNEF  488

Query  1310  FSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKL  1131
             FSV F +FG SAY CRD +CSDA T+GL+K RD Y FGVDP+W G+R+ELP+LNSLKMK+
Sbjct  489   FSVPFHIFGGSAYKCRDATCSDAYTVGLVKYRDPYPFGVDPSWRGSRTELPYLNSLKMKM  548

Query  1130  SILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQ  951
             SILLG+AQMNLG+ILS+FNA +F S ++   QFIPQ+IFLN+LFGYLS+LII+KWCTGSQ
Sbjct  549   SILLGIAQMNLGLILSFFNARFFGSSLDIRYQFIPQMIFLNSLFGYLSLLIIIKWCTGSQ  608

Query  950   ADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQHNRH  771
             ADLYHVMIYMFL PTE+LGEN+LF GQ+  Q                      K    R 
Sbjct  609   ADLYHVMIYMFLSPTEELGENELFWGQRPLQAR--------------------KIHMERF  648

Query  770   QGQSYAPIQ----DLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASY  603
             QG++Y  +     DLD   +   S      EEF FSE+FVHQLIH+IEFVLG+VSNTASY
Sbjct  649   QGRTYGVLGTSEVDLD---VEPDSARGHQEEEFNFSEIFVHQLIHSIEFVLGSVSNTASY  705

Query  602   LRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLH  423
             LRLWALSLAHSELSTVFYEKVLLLAWGY NI+I ++G ++F FAT  +LL+METLSAFLH
Sbjct  706   LRLWALSLAHSELSTVFYEKVLLLAWGYENILIRLIGVVVFAFATAFILLMMETLSAFLH  765

Query  422   ALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             ALRLHWVEF  KF+ GDGYKF PFSF L+ ++++
Sbjct  766   ALRLHWVEFMGKFFHGDGYKFKPFSFALISDDDE  799



>emb|CDY15756.1| BnaC04g15680D [Brassica napus]
Length=799

 Score =   925 bits (2390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 493/814 (61%), Positives = 609/814 (75%), Gaps = 28/814 (3%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             P MDL RSE M LVQLIIP+ESA   V YLG+LGL+QF+DLNA+KSPFQRT+A Q+KR G
Sbjct  9     PQMDLMRSEKMTLVQLIIPVESAHRCVTYLGELGLLQFRDLNADKSPFQRTFANQVKRCG  68

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EM+RKLRFFKDQ+ KAG+  S   + +  I+  DLE +L D E E++E+N+N++KL++++
Sbjct  69    EMSRKLRFFKDQIDKAGLRCSPRHELEPYIELGDLERQLADHEHEVLEMNSNSEKLRQTY  128

Query  2387  NELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgee-sleapllsePDMSADTSKQV  2211
             NEL+E+K+VLQK   F  S+ + A   + E           +E   L E +M  +   Q 
Sbjct  129   NELLEFKIVLQKANGFLVSSNAHATGDETELHEGTYSNNGFIETSSLLEQEMRPEPLNQS  188

Query  2210  RLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSG  2031
              L FISG++ K+K + FER+LFRATRGN+L  Q+  DE ++DP + E VEK VF+VF+SG
Sbjct  189   GLRFISGIINKDKLLRFERMLFRATRGNMLFNQTPSDEEIMDPSTSEMVEKIVFVVFFSG  248

Query  2030  ERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSI  1851
             E+A+ KILKIC+AFGAN YP  E+  KQ QL  EV  ++S+L+  +DAG  HR N L ++
Sbjct  249   EQARTKILKICEAFGANCYPVPEDTTKQRQLTREVLSRLSDLEATLDAGTRHRNNALNAV  308

Query  1850  AEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNS  1671
                  +W   VRREK++Y TLNML+ DVTKKCLV EGW PT A  +I + LQRA  DSNS
Sbjct  309   GYSLTKWMTTVRREKAVYDTLNMLNFDVTKKCLVGEGWCPTFAKTQIHEVLQRATFDSNS  368

Query  1670  EIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVM  1491
             ++G IF ++   ESPPTYF+TNK T+AFQEI+DAYGVA+YQEANP V+++VT+PFLFAVM
Sbjct  369   QVGVIFHIMQAVESPPTYFRTNKLTNAFQEIIDAYGVARYQEANPAVYSVVTYPFLFAVM  428

Query  1490  FGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEF  1311
             FGDWGHG+CLLL  LY L RE+KLSSQKLG   EM FGGRYVIL+MALFSIY G IYNEF
Sbjct  429   FGDWGHGLCLLLGALYLLTRERKLSSQKLGSFMEMLFGGRYVILLMALFSIYCGLIYNEF  488

Query  1310  FSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKL  1131
             FSV F +FG SAY CRD +CSDA T+GL+K RD Y FGVDP+W G+RSELP+LNSLKMK+
Sbjct  489   FSVPFHVFGGSAYKCRDTTCSDAYTVGLVKYRDPYPFGVDPSWRGSRSELPYLNSLKMKM  548

Query  1130  SILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQ  951
             SILLG+AQMNLG+ILS+FNA +F S ++   QFIPQ+IFLN+LFGYLS+LII+KWCTGSQ
Sbjct  549   SILLGIAQMNLGLILSFFNARFFGSSLDIRYQFIPQMIFLNSLFGYLSLLIIIKWCTGSQ  608

Query  950   ADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQHNRH  771
             ADLYHVMIYMFL PTE+LGEN+LF GQ+  Q                      K    R 
Sbjct  609   ADLYHVMIYMFLSPTEELGENELFWGQRPLQAQ--------------------KIHMERF  648

Query  770   QGQSYAPIQ----DLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASY  603
             QG++Y  +     DLD   +  GS      EEF FSE+FVHQLIH+IEFVLG+VSNTASY
Sbjct  649   QGRTYGVLGTSEVDLD---VEPGSARGHQEEEFNFSEIFVHQLIHSIEFVLGSVSNTASY  705

Query  602   LRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLH  423
             LRLWALSLAHSELSTVFYEKVLLLAWGY NI+I ++G ++F FAT  +LL+METLSAFLH
Sbjct  706   LRLWALSLAHSELSTVFYEKVLLLAWGYENILIRLIGLVVFAFATAFILLMMETLSAFLH  765

Query  422   ALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             ALRLHWVEF  KF+ GDGYKF PFSF LV  +++
Sbjct  766   ALRLHWVEFMGKFFHGDGYKFKPFSFALVSNDDE  799



>gb|KEH39308.1| vacuolar proton ATPase a3-like protein [Medicago truncatula]
Length=778

 Score =   917 bits (2370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 475/770 (62%), Positives = 589/770 (76%), Gaps = 1/770 (0%)
 Frame = -2

Query  2627  LNAEKSPFQRTYAAQIKRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLG  2448
             LNA+KSPFQRT+  Q+KR  EM+RKLRFFKDQ++KAG+ +S+ +  Q  I  +DLEV L 
Sbjct  9     LNADKSPFQRTFVNQVKRCAEMSRKLRFFKDQVNKAGLMSSSRTLLQPDIDLEDLEVHLA  68

Query  2447  DLEAELIEINANNDKLQRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgees  2268
             + E ELIE+N+N+DKL++S+NEL+E+K+VLQK   F  S+   A + + E   +    + 
Sbjct  69    EHEHELIEMNSNSDKLRQSYNELLEFKIVLQKACGFLISSHGRAVSGEIELQDNVYSNDD  128

Query  2267  leapllsePDMSADTSKQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVI  2088
                                 L FISG++ K K++ FER+LFRATRGN+   Q+   E ++
Sbjct  129   YIETASLLEQEMRPQPSTSGLRFISGIICKSKALRFERMLFRATRGNMFFNQAPAGEQIM  188

Query  2087  DPISGEKVEKNVFLVFYSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISE  1908
             DPI+ E +EK VF+VF+SGE+A+ KILKIC+AFGAN YP  E++ K  Q+  EV+ ++++
Sbjct  189   DPITTEMIEKTVFVVFFSGEQARTKILKICEAFGANCYPVPEDISKHGQITREVTSRLTD  248

Query  1907  LKTAIDAGILHRGNLLQSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPT  1728
             L+  +DAGI HR   L SIA+   +W  LVRREK++Y TLNML+ DVTKKCLV EGW P 
Sbjct  249   LEATLDAGIRHRNKALSSIADHLAKWMDLVRREKAVYDTLNMLNFDVTKKCLVGEGWCPM  308

Query  1727  SATIEIQDALQRAGHDSNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQ  1548
              A  ++Q+ALQRA  DSNS++G IF  +   ESPPTYFKTN FT+ +QEIVDAYGVA+YQ
Sbjct  309   IAKTQMQEALQRATFDSNSQVGIIFHQMDAVESPPTYFKTNTFTNPYQEIVDAYGVARYQ  368

Query  1547  EANPGVFTIVTFPFLFAVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRY  1368
             EANP V+T V FPFLFA+MFGDWGHGICLLL  L  +  E KLS+QKLG   EM FGGRY
Sbjct  369   EANPAVYTTVVFPFLFAMMFGDWGHGICLLLGALILIAHENKLSTQKLGSFMEMLFGGRY  428

Query  1367  VILMMALFSIYTGFIYNEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDP  1188
             VIL+M+LFSIY G IYNEFFSV F +FG SA+ CRD SCSDA TIGL+K RD Y FGVDP
Sbjct  429   VILLMSLFSIYCGLIYNEFFSVPFHIFGPSAFRCRDTSCSDAHTIGLVKYRDPYPFGVDP  488

Query  1187  AWHGTRSELPFLNSLKMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLN  1008
             +W G+RSEL FLNS+KMK+SIL GVA MNLGIILSYFNA +F S ++   QF+PQ+IFLN
Sbjct  489   SWRGSRSELAFLNSMKMKMSILFGVAHMNLGIILSYFNARFFGSSLDIRYQFVPQMIFLN  548

Query  1007  ALFGYLSVLIIVKWCTGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvs  828
             +LFGYLS+LII+KWCTGSQADLYHVMIYMFL PT++LGENQLF GQ+  Q+VL+LLA+++
Sbjct  549   SLFGYLSLLIIIKWCTGSQADLYHVMIYMFLSPTDELGENQLFWGQRPLQIVLLLLAIIA  608

Query  827   VPWMLLPKPFILKSQHN-RHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLI  651
             VPWML PKPFILK  H  R QG+SY  +   +  L V+       HE+F FSE+FVHQ+I
Sbjct  609   VPWMLFPKPFILKKLHTERFQGRSYGILNTSEMDLEVEPDSAREHHEDFNFSEIFVHQMI  668

Query  650   HTIEFVLGAVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFA  471
             H+IEFVLG+VSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGY+N+II +VG  +F FA
Sbjct  669   HSIEFVLGSVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYDNLIIRLVGLTVFAFA  728

Query  470   TIGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             T  +LL+ME+LSAFLHALRLHWVEFQNKFY GDGYKF PFSF  + E++D
Sbjct  729   TAFILLMMESLSAFLHALRLHWVEFQNKFYHGDGYKFKPFSFAALTEDDD  778



>ref|XP_010043693.1| PREDICTED: V-type proton ATPase subunit a1 isoform X2 [Eucalyptus 
grandis]
Length=752

 Score =   914 bits (2361),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 478/752 (64%), Positives = 593/752 (79%), Gaps = 4/752 (1%)
 Frame = -2

Query  2564  MARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSFN  2385
             M+RKLRFFKDQ+SKAG+ +S +S TQ  ++ ++LE++L + E EL E+NAN++KL++++N
Sbjct  1     MSRKLRFFKDQISKAGLISSLHSATQPDVELEELEIQLAEHEHELNEMNANSEKLRQAYN  60

Query  2384  ELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsge-esleapllsePDMSADTSKQVR  2208
             EL+E+K+VLQK G F  S +S    + +E   +     + +E   L E +M  +T +Q R
Sbjct  61    ELLEFKMVLQKAGGFLVSGKSPVAVEDRELDENIHSNGDYVETASLLEKEMRPETMEQSR  120

Query  2207  LGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSGE  2028
             + FISG++ K K   FER+LFRATRGN+L  Q   DE ++DP++ E VEK VF+VF+SGE
Sbjct  121   VRFISGIICKSKVQIFERMLFRATRGNMLFNQGPADEDIVDPVTSETVEKIVFVVFFSGE  180

Query  2027  RAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSIA  1848
             +A+ KILKIC+AF AN YP  E++ KQ Q+  EV  ++SE++T + AG  HR   L SI 
Sbjct  181   QARMKILKICEAFSANCYPVPEDITKQRQISQEVLSRLSEIETTLGAGYNHRNRALSSIQ  240

Query  1847  EQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNSE  1668
                ++W  +VRREK+IY TLNML+ DVTKKCLV EGW P  A  +IQ+ALQRA +DSNS+
Sbjct  241   FHLNKWMNMVRREKAIYDTLNMLNFDVTKKCLVGEGWCPIFAKAKIQEALQRATYDSNSQ  300

Query  1667  IGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMF  1488
             +G IF  +   ESPPT+F+TN+FTSAFQEIVDAYGVA+YQEANP V+T+VTFPFLFAVMF
Sbjct  301   VGIIFHEMDAPESPPTFFRTNRFTSAFQEIVDAYGVARYQEANPAVYTVVTFPFLFAVMF  360

Query  1487  GDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEFF  1308
             GDWGHGICLLL  L  + +E+KL+ QKLG   EM FGGRYV+L+M+LFSIY G IYNEFF
Sbjct  361   GDWGHGICLLLGALVLIAQERKLTGQKLGSFMEMLFGGRYVLLLMSLFSIYCGLIYNEFF  420

Query  1307  SVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKLS  1128
             SV F +FG SAY CRD SCSDA ++GLIK +D Y FGVDP+W G+RSELPFLNSLKMK+S
Sbjct  421   SVPFNIFGESAYKCRDTSCSDARSVGLIKYQDPYPFGVDPSWRGSRSELPFLNSLKMKMS  480

Query  1127  ILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQA  948
             ILLGV QMNLGIILSYFNA +F+S ++   QF+PQ+IFLN+LFGYLS+LII+KWCTGSQA
Sbjct  481   ILLGVVQMNLGIILSYFNARFFKSTLDIRFQFVPQVIFLNSLFGYLSLLIIIKWCTGSQA  540

Query  947   DLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQHN-RH  771
             DLYHVMIYMFL PT+DLGENQLF GQK  Q++L+LLAL++VPWML PKPFILK  H+ R 
Sbjct  541   DLYHVMIYMFLSPTDDLGENQLFWGQKPLQIILLLLALIAVPWMLFPKPFILKKLHSERF  600

Query  770   QGQSYAPI--QDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLR  597
             QG++Y  +   ++D     +       HEEF FSEVFVHQ+IH+IEFVLGAVSNTASYLR
Sbjct  601   QGRTYQMLGTSEMDIDGDTEPDSARQHHEEFNFSEVFVHQMIHSIEFVLGAVSNTASYLR  660

Query  596   LWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHAL  417
             LWALSLAHSELSTVFYEKVLLLAWGY+N+II +VG  +F FAT  +LL+METLSAFLHAL
Sbjct  661   LWALSLAHSELSTVFYEKVLLLAWGYDNLIIRLVGLAVFAFATAFILLMMETLSAFLHAL  720

Query  416   RLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             RLHWVEFQNKFY GDGYKF PFSF L+ EEED
Sbjct  721   RLHWVEFQNKFYHGDGYKFRPFSFSLLTEEED  752



>ref|XP_008445568.1| PREDICTED: vacuolar proton ATPase a3-like, partial [Cucumis melo]
Length=611

 Score =   912 bits (2357),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 464/611 (76%), Positives = 531/611 (87%), Gaps = 1/611 (0%)
 Frame = -2

Query  2150  LFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSGERAKNKILKICDAFGANRYP  1971
             LFR+TRGNV LRQ+ +D SV DP SG+KVEKNVF++FYSGERAK KI KIC+AFGANRYP
Sbjct  1     LFRSTRGNVYLRQAVIDGSVTDPASGDKVEKNVFVIFYSGERAKEKIRKICEAFGANRYP  60

Query  1970  FAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSIAEQFDRWNVLVRREKSIYHT  1791
             F ++LGKQ Q+ITEVS K+SELKT ID G +H   LLQ+I  Q++ WN+LV++EKS+YHT
Sbjct  61    FTDDLGKQFQMITEVSRKLSELKTTIDMGQVHGSQLLQTIGHQYELWNLLVKKEKSVYHT  120

Query  1790  LNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNSEIGAIFRVLGTRESPPTYFK  1611
             LNMLS+DVTKKCLV EGW P  AT +IQ  +Q+A  DS S+I AIF VL T+E+PPTYF+
Sbjct  121   LNMLSVDVTKKCLVGEGWCPVFATNQIQSVMQKATLDSKSQIEAIFHVLDTKEAPPTYFR  180

Query  1610  TNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLLLATLYFLIR  1431
             TNKFTS+FQEIVDAYGVAKYQEANPGV+TIVTFPFLFAVMFGDWGHGICLLLATLYF+IR
Sbjct  181   TNKFTSSFQEIVDAYGVAKYQEANPGVYTIVTFPFLFAVMFGDWGHGICLLLATLYFIIR  240

Query  1430  EKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEFFSVQFELFGRSAYVCRDPSC  1251
             EKK S QKLGDI EMTFGGRYVI+MMALFSIYTG IYNEFFSV FELFG SAY CRD SC
Sbjct  241   EKKFSGQKLGDIVEMTFGGRYVIMMMALFSIYTGLIYNEFFSVPFELFGPSAYGCRDTSC  300

Query  1250  SDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKLSILLGVAQMNLGIILSYFNA  1071
              DAT+IGL+K RDTY FGVDP WHGTRSELPFLNSLKMK+SILLGVAQMNLGIILSYFNA
Sbjct  301   RDATSIGLVKVRDTYPFGVDPKWHGTRSELPFLNSLKMKMSILLGVAQMNLGIILSYFNA  360

Query  1070  HYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQADLYHVMIYMFLGPTEDLGE  891
              +F   +N W QF+PQ+IFLN+LFGYLS+LIIVKW +GSQADLYHVMIYMFL PT+DLGE
Sbjct  361   KFFGESINIWYQFVPQMIFLNSLFGYLSLLIIVKWYSGSQADLYHVMIYMFLSPTDDLGE  420

Query  890   NQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQH-NRHQGQSYAPIQDLDESLLvdg  714
             NQLFPGQK  QL+L+L AL +VPWML PKP +LK Q+  RHQGQSY+ +   D++  ++ 
Sbjct  421   NQLFPGQKFLQLLLLLSALTAVPWMLFPKPLLLKKQNEERHQGQSYSVLHCTDDNHEIEP  480

Query  713   shdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSTVFYEKVLL  534
              H S  HEEF+ SEVFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELS+VFY+KVLL
Sbjct  481   HHGSHGHEEFDLSEVFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYDKVLL  540

Query  533   LAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFDP  354
             LAWG+N++II +VG  +FIFAT+GVLL+METLSAFLHALRLHWVEFQNKFY GDG+KF P
Sbjct  541   LAWGFNSLIIRIVGMAVFIFATVGVLLIMETLSAFLHALRLHWVEFQNKFYAGDGFKFSP  600

Query  353   FSFVLVDEEED  321
             FSF L+ EE++
Sbjct  601   FSFSLLREEDE  611



>emb|CDY04571.1| BnaA07g13970D [Brassica napus]
Length=794

 Score =   907 bits (2344),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 483/815 (59%), Positives = 605/815 (74%), Gaps = 35/815 (4%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             P MDL RSE M LVQLIIP+ESA   V YLG+LGL+QF+DLNA+KSPFQRT+A Q+KR G
Sbjct  9     PQMDLMRSEKMTLVQLIIPVESAHRCVTYLGELGLLQFRDLNADKSPFQRTFANQVKRCG  68

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EM+RKLRFFKDQ+ KAG+  S   + +  I+  DLE +L + E E++E+N+N++KL++++
Sbjct  69    EMSRKLRFFKDQIDKAGLRCSPRHELEPDIELGDLERQLAEHEHEVLEMNSNSEKLRQTY  128

Query  2387  NELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgee-sleapllsePDMSADTSKQV  2211
             NEL+E+K+VLQK   F  S+ + A   + E           +E   L E +M  +   Q 
Sbjct  129   NELLEFKIVLQKANGFLVSSNAHATGDETELHEGTYSNNGFIETSSLLEQEMRPEPLNQS  188

Query  2210  RLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSG  2031
              L FISG++ K+K + FER+LFRATRGN+L  Q+  DE ++DP + E VEK VF+VF+SG
Sbjct  189   GLRFISGIINKDKLLRFERMLFRATRGNMLFNQTPSDEEIMDPSTSEMVEKIVFVVFFSG  248

Query  2030  ERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSI  1851
             E+A+ KILKIC+AFGAN YP  E+  KQ QL  EV  ++S+L+  +DAG  HR + L ++
Sbjct  249   EQARTKILKICEAFGANCYPVPEDTTKQRQLTREVLSRLSDLEATLDAGTRHRNDALNAV  308

Query  1850  AEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNS  1671
                  +W   VRREK++Y TLNML+ DVTKKCLV EGW PT A  +I + LQRA  DSNS
Sbjct  309   GYSLTKWITTVRREKAVYDTLNMLNFDVTKKCLVGEGWCPTFAKTQIHEVLQRATFDSNS  368

Query  1670  EIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVM  1491
             ++G IF V+   ESPPTYF+TNK T+AFQEI+DAYGVA+YQEANP V+++VT+PFLFAVM
Sbjct  369   QVGVIFHVMQAVESPPTYFRTNKLTNAFQEIIDAYGVARYQEANPAVYSVVTYPFLFAVM  428

Query  1490  FGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEF  1311
             FGDWGHG+CLLL  LY L RE+KLSSQKLG   EM FGGRYVIL+MALFSIY G IYNEF
Sbjct  429   FGDWGHGLCLLLGALYLLARERKLSSQKLGSFMEMLFGGRYVILLMALFSIYCGLIYNEF  488

Query  1310  FSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKL  1131
             FSV F +FG SAY CRD +CSDA T+GL+K RD Y FGVDP+W G+RSELP+LNSLKMK+
Sbjct  489   FSVPFHIFGGSAYKCRDTTCSDAYTVGLVKYRDPYPFGVDPSWRGSRSELPYLNSLKMKM  548

Query  1130  SILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQ  951
             SILLG+AQMNLG+ILS+FNA +F S ++   QFIPQ+IFLN+LFGYLS+LII+KWCTGSQ
Sbjct  549   SILLGIAQMNLGLILSFFNARFFGSSLDIRYQFIPQMIFLNSLFGYLSLLIIIKWCTGSQ  608

Query  950   ADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQH-NR  774
             ADLYH+++ +                           A ++VPWML PKPF L+  H  R
Sbjct  609   ADLYHILLLLM--------------------------AFIAVPWMLFPKPFALRKIHMER  642

Query  773   HQGQSYAPIQ----DLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTAS  606
              QG++Y  +     DLD   +  GS      EEF FSE+FVHQLIH+IEFVLG+VSNTAS
Sbjct  643   FQGRTYGVLGTSEVDLD---VEPGSARGHQEEEFNFSEIFVHQLIHSIEFVLGSVSNTAS  699

Query  605   YLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFL  426
             YLRLWALSLAHSELSTVFYEKVLLLAWGY NI+I ++G ++F FAT  +LL+METLSAFL
Sbjct  700   YLRLWALSLAHSELSTVFYEKVLLLAWGYENILIRLIGLVVFAFATAFILLMMETLSAFL  759

Query  425   HALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             HALRLHWVEF  KF+ GDGYKF PFSF L+  +++
Sbjct  760   HALRLHWVEFMGKFFHGDGYKFKPFSFALISNDDE  794



>emb|CDX77187.1| BnaC04g39820D [Brassica napus]
Length=794

 Score =   905 bits (2338),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 481/815 (59%), Positives = 603/815 (74%), Gaps = 35/815 (4%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             P MDL RSE M LVQLIIP+ESA   V YLG+LGL+QF+DLNA+KSPFQRT+A Q+KR G
Sbjct  9     PEMDLMRSEKMTLVQLIIPVESAHRCVTYLGELGLLQFRDLNADKSPFQRTFATQVKRCG  68

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EM+RKLRFFKDQ+ KAG+      + +  I+  DLE +L + E E++E+N+N++KL+ ++
Sbjct  69    EMSRKLRFFKDQIDKAGLRCLPRHELEPDIELGDLERQLAEHEHEVLEMNSNSEKLRLTY  128

Query  2387  NELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgee-sleapllsePDMSADTSKQV  2211
             NEL+E+K+VLQK   F  S+ + A   + E   S       +E   L E +M  +   Q 
Sbjct  129   NELLEFKIVLQKASGFLVSSNAHAIGDETELHESTYSNNGFIENSSLLEQEMRHEPLNQS  188

Query  2210  RLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSG  2031
              L FISG++ K+K + FER+LFRATRGN+L  Q+  DE ++DP + E VEK VF+VF+SG
Sbjct  189   GLRFISGIINKDKLLKFERMLFRATRGNMLFNQTPSDEEIMDPSTSEMVEKIVFVVFFSG  248

Query  2030  ERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSI  1851
             E+A+ KILKIC+AFGAN YP  E+  KQ QL  EV  ++S+L+  +DAG  HR N L ++
Sbjct  249   EQARTKILKICEAFGANCYPVPEDTTKQRQLTREVLSRLSDLEATLDAGTRHRNNALNAV  308

Query  1850  AEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNS  1671
                  +W   VRREK++Y TLNML+ DVTKKCLV EGW PT A  +I + LQRA  DSNS
Sbjct  309   GYSLTKWMTTVRREKAVYDTLNMLNFDVTKKCLVGEGWCPTFAKTQIHEVLQRATFDSNS  368

Query  1670  EIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVM  1491
             ++G IF V+   ESPPTYF+TNK T+AFQEI+DAYGVA+YQEANP V+++VT+PFLFAVM
Sbjct  369   QVGVIFHVMQAVESPPTYFRTNKLTNAFQEIIDAYGVARYQEANPAVYSVVTYPFLFAVM  428

Query  1490  FGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEF  1311
             FGDWGHG+CLLL  LY L RE+KLS+QKLG   EM FGGRYVIL+MALFSIY G IYNEF
Sbjct  429   FGDWGHGLCLLLGALYLLARERKLSTQKLGSFMEMLFGGRYVILLMALFSIYCGLIYNEF  488

Query  1310  FSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKL  1131
             FSV F +FG SAY CRD +CSDA T GL+K RD Y FGVDP+W G+R+ELP+LNSLKMK+
Sbjct  489   FSVPFHIFGGSAYRCRDTTCSDAYTTGLVKYRDPYPFGVDPSWRGSRTELPYLNSLKMKM  548

Query  1130  SILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQ  951
             SILLG+AQMNLG+ILS+FNA +F S ++   QFIPQ+IFLN+LFGYLS+LII+KWCTGSQ
Sbjct  549   SILLGIAQMNLGLILSFFNARFFGSSLDIRYQFIPQMIFLNSLFGYLSLLIIIKWCTGSQ  608

Query  950   ADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQH-NR  774
             ADLYH+++ +                           A ++VPWML PKPF L+  H  R
Sbjct  609   ADLYHILLLLM--------------------------AFIAVPWMLFPKPFALRKIHMER  642

Query  773   HQGQSYAPIQ----DLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTAS  606
              QG++Y  +     DLD   +   S      EEF FSE+FVHQLIH+IEFVLG+VSNTAS
Sbjct  643   FQGRTYGVLGTSEVDLD---VEPDSARGHQEEEFNFSEIFVHQLIHSIEFVLGSVSNTAS  699

Query  605   YLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFL  426
             YLRLWALSLAHSELSTVFYEKVLLLAWGY NI+I ++G ++F FAT  +LL+METLSAFL
Sbjct  700   YLRLWALSLAHSELSTVFYEKVLLLAWGYENILIRLIGVVVFAFATAFILLMMETLSAFL  759

Query  425   HALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             HALRLHWVEF  KF+ GDGYKF PFSF L+ ++++
Sbjct  760   HALRLHWVEFMGKFFHGDGYKFKPFSFALISDDDE  794



>gb|EEE55633.1| hypothetical protein OsJ_03980 [Oryza sativa Japonica Group]
Length=789

 Score =   903 bits (2334),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 474/811 (58%), Positives = 603/811 (74%), Gaps = 31/811 (4%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             PPMD  RSE M  VQLIIP ESARL+V YLG+LGL+QFKDLN +KSPFQR          
Sbjct  8     PPMDRLRSEKMCFVQLIIPAESARLAVTYLGELGLLQFKDLNEDKSPFQRI---------  58

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
                     F +Q++KAGV +S     Q  I  ++LE KL + E +L+E+N N++KL +++
Sbjct  59    --------FVNQINKAGVKSSVRPAMQPDIDLEELEAKLREHENDLLEMNTNSEKLLQTY  110

Query  2387  NELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePD-MSADTSKQV  2211
             NEL+E+K+VL K G    S+ + A   ++E       +E  +         +    S+  
Sbjct  111   NELLEFKMVLSKAGGILASSHNHAAPAERELDEHIYDKEMDDGNAYLLEQGVHLGASENS  170

Query  2210  RLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSG  2031
              + F+SG++ K K+MAFER+LFRATRGN+   Q+   E V DPISGE+VEK VF+VF+SG
Sbjct  171   GVKFVSGIILKSKAMAFERMLFRATRGNMFFNQAPAGEPVTDPISGEEVEKTVFVVFFSG  230

Query  2030  ERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSI  1851
             ++AK KILKIC +FGA+ YP  EE+ KQ Q+  EVSG++++L+  +DAGI HR   L+S+
Sbjct  231   DQAKAKILKICGSFGASCYPVPEEMVKQRQIFREVSGRLADLEATLDAGIQHRNKALESV  290

Query  1850  AEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNS  1671
               Q  RW ++V++EK++Y TLNML+ DVTKKCLV EGW P  A  +I+D LQRA   SNS
Sbjct  291   GSQLWRWTIMVKKEKAVYDTLNMLNFDVTKKCLVGEGWCPIFAKSQIKDVLQRATLHSNS  350

Query  1670  EIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVM  1491
             ++G IF  + T +SPPTYF+T+KFT+AFQEIVDAYG+A+Y+EANP V++++TFPFLFAVM
Sbjct  351   QVGIIFHEMDTIDSPPTYFQTDKFTNAFQEIVDAYGIARYEEANPAVYSVITFPFLFAVM  410

Query  1490  FGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEF  1311
             FGDWGHGICLLL     ++REKKLSSQKLG   EM FGGRYVIL+MALFSIY G IYNEF
Sbjct  411   FGDWGHGICLLLGACVLILREKKLSSQKLGSFMEMAFGGRYVILLMALFSIYCGLIYNEF  470

Query  1310  FSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKL  1131
             FSV F +FG+SAY CR+ +CSDA T GLIK RD Y FGVDP+W G+RSELPFLNSLKMK+
Sbjct  471   FSVPFHIFGKSAYECREKTCSDAHTAGLIKVRDPYPFGVDPSWRGSRSELPFLNSLKMKM  530

Query  1130  SILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQ  951
             SIL+GV QMNLGI+LSYF+A +  + ++             +LFGYL++LI++KWCTGSQ
Sbjct  531   SILMGVTQMNLGIVLSYFDAKFHGNALDI------------SLFGYLALLILIKWCTGSQ  578

Query  950   ADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQHN-R  774
             ADLYHVMIYMFL P+ +LGENQLF GQK  Q++L+L+A+V+VPWML PKPFILK  H  R
Sbjct  579   ADLYHVMIYMFLDPSGNLGENQLFWGQKELQILLLLMAIVAVPWMLFPKPFILKKLHKER  638

Query  773   HQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLRL  594
              QG +Y  +   +     +     S H++F FSEVFVHQ+IH+IEFVLGAVSNTASYLRL
Sbjct  639   FQGHTYRFLGTSEMDPDSEPDSARSRHDDFNFSEVFVHQMIHSIEFVLGAVSNTASYLRL  698

Query  593   WALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHALR  414
             WALSLAHSELSTVFYEK+L+LAWGY+N+++ +VG +IF FAT  +LL ME+LSAFLHALR
Sbjct  699   WALSLAHSELSTVFYEKLLVLAWGYDNLVVKLVGLVIFSFATAFILLGMESLSAFLHALR  758

Query  413   LHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             LHWVEF NKFY GDGYKF PFSF L+ ++ED
Sbjct  759   LHWVEFMNKFYHGDGYKFRPFSFALLADDED  789



>ref|XP_008783708.1| PREDICTED: vacuolar proton ATPase a1-like isoform X2 [Phoenix 
dactylifera]
Length=750

 Score =   899 bits (2322),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 466/749 (62%), Positives = 577/749 (77%), Gaps = 3/749 (0%)
 Frame = -2

Query  2564  MARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSFN  2385
             MARKLRFF DQ+SKA ++++     Q  I  ++LEV+L + EAEL+E+N NN+KL+++ N
Sbjct  1     MARKLRFFSDQISKACITSAGRPAMQPDISLEELEVRLAEHEAELLEMNMNNEKLRQASN  60

Query  2384  ELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllse-PDMSADTSKQVR  2208
             EL+E+KLVL K G F  S+++ A   ++E   +   +E     L     +   +   +  
Sbjct  61    ELLEFKLVLLKAGSFLVSSQNHAVPAERELDENIYSKERDRESLSLLDQETPPEMLNKAG  120

Query  2207  LGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSGE  2028
             L FISG++ K K++ FER+LFR TRGN+   Q+   E V+DP+SGE VEK +F+VF+SGE
Sbjct  121   LRFISGIICKSKALRFERMLFRTTRGNMFFNQAPAGEHVMDPVSGEMVEKIIFVVFFSGE  180

Query  2027  RAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSIA  1848
             +AK KILKIC+AFGAN YP  E+  KQ Q+  EVS ++SEL+  +DAGI HR N L SI 
Sbjct  181   QAKTKILKICEAFGANCYPVPEDTSKQRQMTREVSSRLSELEATLDAGIRHRNNALASIG  240

Query  1847  EQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNSE  1668
              Q  +W ++VR+EK++Y TLN L+ DVTKKCLV EGW P  A  +IQDALQRA  DSNS+
Sbjct  241   SQLWKWTIMVRKEKAVYDTLNRLNFDVTKKCLVGEGWCPVFAKPQIQDALQRATIDSNSQ  300

Query  1667  IGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMF  1488
             +G IF V+   ESPPTYF+TN+FT AFQEI+DAYGVA+YQEANP V++++TFPFLFAVMF
Sbjct  301   VGIIFHVMNAIESPPTYFRTNRFTHAFQEIIDAYGVARYQEANPAVYSVITFPFLFAVMF  360

Query  1487  GDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEFF  1308
             GDWGHGICLLL + + ++REKK  SQKLG   EM FGGRYV+L+MALFSIY G IYNEFF
Sbjct  361   GDWGHGICLLLGSFFLIVREKKFGSQKLGSFMEMAFGGRYVLLLMALFSIYCGLIYNEFF  420

Query  1307  SVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKLS  1128
             SV F +FG SAY CRD +CSDA T GL+K RD YAFGVDP W G+RSELPFLNSLKMK+S
Sbjct  421   SVPFRIFGESAYKCRDTTCSDARTAGLVKYRDPYAFGVDPRWRGSRSELPFLNSLKMKMS  480

Query  1127  ILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQA  948
             ILLGV+QMNLGIILSYF+A +  S ++   QFIPQ+IFLN+LFGYLS+LI++KWCTGSQA
Sbjct  481   ILLGVSQMNLGIILSYFDAKFHGSSLDIRYQFIPQMIFLNSLFGYLSLLILIKWCTGSQA  540

Query  947   DLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQHN-RH  771
             DLYHVMIYMFL PT DLGEN+LF GQK  Q++L+LLA+V+VPWML PKPFIL+  +  R 
Sbjct  541   DLYHVMIYMFLDPTGDLGENRLFWGQKPLQILLLLLAIVAVPWMLFPKPFILRKLNTERF  600

Query  770   QGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLRLW  591
             QG++Y  +   +  L  +       H++F FSEVFVHQ+IH+IEFVLGAVSNTASYLRLW
Sbjct  601   QGRTYGILGTSEMDLDHEPDSARQRHDDFNFSEVFVHQMIHSIEFVLGAVSNTASYLRLW  660

Query  590   ALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHALRL  411
             ALSLAHSELSTVFYEK+LLLAWGY+N II + G  +F FAT  +LL+METLSAFLHALRL
Sbjct  661   ALSLAHSELSTVFYEKILLLAWGYDNPIIRIAGLTVFAFATAFILLMMETLSAFLHALRL  720

Query  410   HWVEFQNKFYEGDGYKFDPFSFV-LVDEE  327
             HWVEF +KFY GDGYKF PFSF  L DEE
Sbjct  721   HWVEFMSKFYHGDGYKFRPFSFASLADEE  749



>gb|AAD21487.2| putative vacuolar proton-ATPase subunit [Arabidopsis thaliana]
Length=780

 Score =   899 bits (2322),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 480/809 (59%), Positives = 595/809 (74%), Gaps = 42/809 (5%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             P MDL RSE M LVQLIIP+ESA  S+ YLG+LGL+QF+DLNA+KSPFQRT+A Q+KR G
Sbjct  9     PQMDLMRSEKMTLVQLIIPVESAHRSITYLGELGLLQFRDLNADKSPFQRTFANQVKRCG  68

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EM+RKLRFFKDQ+ KAG+  S   + +  I   DLE +L D E E++E+N+N++KL++++
Sbjct  69    EMSRKLRFFKDQIDKAGLRCSPRLEIEPDIALGDLERQLADHEHEVLEMNSNSEKLRQTY  128

Query  2387  NELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTSKQVR  2208
             NEL+E+K+VL+KVG F    RS + +            +          +M+   S Q  
Sbjct  129   NELLEFKIVLEKVGVFAFRLRSISISFLSLLIKQLFYSQ----------EMNPGHSNQSG  178

Query  2207  LGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSGE  2028
             L FISG++ K+K + FER+LFRATRGN+L  Q+  DE ++DP + E VEK VF+VF+SGE
Sbjct  179   LRFISGIINKDKLLKFERMLFRATRGNMLFNQTTSDEEIMDPSTSEMVEKVVFVVFFSGE  238

Query  2027  RAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSIA  1848
             +A+ KILKIC+AFGAN YP  E+  KQ QL  EV  ++S+L+  +DAG  HR N L S+ 
Sbjct  239   QARTKILKICEAFGANCYPVPEDTTKQRQLTREVLSRLSDLEATLDAGTRHRNNALNSVG  298

Query  1847  EQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNSE  1668
                  W   VRREK++Y TLNML+ DVTKKCLV EGW PT A  +I + LQRA  DS+S+
Sbjct  299   YSLTNWITTVRREKAVYDTLNMLNFDVTKKCLVGEGWCPTFAKTQIHEVLQRATFDSSSQ  358

Query  1667  IGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMF  1488
             +G IF V+   ESPPTYF+TNK T+AFQEI+DAYGVA+YQEANP V+++VT+PFLFAVMF
Sbjct  359   VGVIFHVMQAVESPPTYFRTNKLTNAFQEIIDAYGVARYQEANPAVYSVVTYPFLFAVMF  418

Query  1487  GDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEFF  1308
             GDWGHG+CLLL  LY L RE+KLS+QKLG   EM FGGRYVIL+MALFSIY G IYNEFF
Sbjct  419   GDWGHGLCLLLGALYLLARERKLSTQKLGSFMEMLFGGRYVILLMALFSIYCGLIYNEFF  478

Query  1307  SVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKLS  1128
             SV F +FG SAY CRD +CSDA T+GLIK RD Y FGVDP+W G+R+ELP+LNSLKMK+S
Sbjct  479   SVPFHIFGGSAYKCRDTTCSDAYTVGLIKYRDPYPFGVDPSWRGSRTELPYLNSLKMKMS  538

Query  1127  ILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQA  948
             ILLG+AQMNLG+ILS+FNA +F S ++   QFIPQ+IFLN+LFGYLS+LII+KWCTGSQA
Sbjct  539   ILLGIAQMNLGLILSFFNARFFGSSLDIRYQFIPQMIFLNSLFGYLSLLIIIKWCTGSQA  598

Query  947   DLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQH-NRH  771
             DLYH+++ +                           A ++VPWML PKPF L+  H  R 
Sbjct  599   DLYHIVLLLL--------------------------AFIAVPWMLFPKPFALRKIHMERF  632

Query  770   QGQSYAPI----QDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASY  603
             QG++Y  +     DLD              EEF FSE+FVHQLIH+IEFVLG+VSNTASY
Sbjct  633   QGRTYGVLVSSEVDLDVE-PDSARGGGHHEEEFNFSEIFVHQLIHSIEFVLGSVSNTASY  691

Query  602   LRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLH  423
             LRLWALSLAHSELSTVFYEKVLLLAWGY NI+I ++G  +F FAT  +LL+METLSAFLH
Sbjct  692   LRLWALSLAHSELSTVFYEKVLLLAWGYENILIRLIGVAVFAFATAFILLMMETLSAFLH  751

Query  422   ALRLHWVEFQNKFYEGDGYKFDPFSFVLV  336
             ALRLHWVEF  KF+ GDGYKF PFSF L+
Sbjct  752   ALRLHWVEFMGKFFNGDGYKFKPFSFALI  780



>gb|EPS62244.1| hypothetical protein M569_12548, partial [Genlisea aurea]
Length=757

 Score =   891 bits (2302),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 458/752 (61%), Positives = 576/752 (77%), Gaps = 4/752 (1%)
 Frame = -2

Query  2585  QIKRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANND  2406
             Q+KR  EM+RKLRFFKDQ+ KAG+  S    +   +  ++LEV+L D E ELIE+NAN +
Sbjct  1     QVKRCAEMSRKLRFFKDQVHKAGLIPSPGPPSHTELDIEELEVQLADHEHELIEMNANGE  60

Query  2405  KLQRSFNELVEYKLVLQKVGEFF-HSARssaeaqqqeygssqsgeesleapllsePDMSA  2229
             KLQ+S+NEL+E+K+VLQK G+F   +   S+    + + ++ +  +  +   L E +M  
Sbjct  61    KLQQSYNELLEFKMVLQKAGDFLVPNGSHSSAQDTELHENNYTNNDIPDTVSLLEQEMQP  120

Query  2228  DTSKQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVF  2049
               S    + FISG+V + K ++FER+LFR TRGN+L  Q   ++ ++DP S E +EK +F
Sbjct  121   GLSDHSGVKFISGMVCRSKVLSFERMLFRTTRGNMLFNQVPAEDKILDPSSNEMIEKTIF  180

Query  2048  LVFYSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRG  1869
             +VF+SGE+A+ KILKIC+AFGAN YP  E+  K+ Q+  EV  ++S+L+T ++AG+ HR 
Sbjct  181   MVFFSGEQARKKILKICEAFGANCYPIPEDTVKRRQISREVLSRLSDLETTLEAGLRHRY  240

Query  1868  NLLQSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRA  1689
               + SI     +W   VR EK+IY TLNML+ DVT+KCLV EGW P SA   I +ALQRA
Sbjct  241   TAISSINFHLTKWIHTVRMEKAIYDTLNMLNFDVTQKCLVGEGWCPVSAKAMIHEALQRA  300

Query  1688  GHDSNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFP  1509
               DSNS++G IF V+ + ESPPTYF+TN+FTSA+QEIVDAYGVAKYQEANP V+TIVTFP
Sbjct  301   SFDSNSQVGIIFHVIDSIESPPTYFRTNRFTSAYQEIVDAYGVAKYQEANPAVYTIVTFP  360

Query  1508  FLFAVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTG  1329
             FLFAVMFGDWGHGICLLL  L+ + REK+L+SQKLG   EM +GGRYV+L+M+LFSIY G
Sbjct  361   FLFAVMFGDWGHGICLLLGALFIIAREKRLASQKLGSFMEMLYGGRYVLLLMSLFSIYCG  420

Query  1328  FIYNEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLN  1149
              IYNEFFSV F +FGRSAY CRD +CSDA ++GLIK RDTY FGVDP+W G+RSELPFLN
Sbjct  421   LIYNEFFSVPFHIFGRSAYKCRDTTCSDARSVGLIKYRDTYPFGVDPSWRGSRSELPFLN  480

Query  1148  SLKMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVK  969
             SLKMK+SIL GV QMNLGI+LS+FNA YF + ++   QFIPQIIFLN+LFGYLS+LII+K
Sbjct  481   SLKMKMSILFGVVQMNLGIVLSFFNARYFSNSLDIRYQFIPQIIFLNSLFGYLSLLIIIK  540

Query  968   WCTGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILK  789
             WCTGSQADLYHVMIYMFL P EDLGEN+LF GQ   Q++L+LLA V+VPWML PKP ILK
Sbjct  541   WCTGSQADLYHVMIYMFLSPFEDLGENELFRGQGVLQVILLLLAAVAVPWMLFPKPLILK  600

Query  788   SQHN-RHQGQSYAPI--QDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVS  618
               H  R QG++Y  +   +++     D +      E+F FSEVFVHQ+IH+IEFVLGA+S
Sbjct  601   KLHTERFQGRTYGILGTSEMNPDEEPDSARHPRSGEDFNFSEVFVHQMIHSIEFVLGAIS  660

Query  617   NTASYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETL  438
             NTASYLRLWALSLAHSELSTVFYE+VLLL W Y+N+ + + G  +F FAT  +LL+METL
Sbjct  661   NTASYLRLWALSLAHSELSTVFYERVLLLCWSYDNLAVRLGGIAVFCFATAFILLMMETL  720

Query  437   SAFLHALRLHWVEFQNKFYEGDGYKFDPFSFV  342
             SAFLHALRLHWVEFQNKFY GDG+KF PFSF+
Sbjct  721   SAFLHALRLHWVEFQNKFYGGDGHKFTPFSFL  752



>gb|KHN22033.1| V-type proton ATPase 116 kDa subunit a isoform 1 [Glycine soja]
Length=749

 Score =   889 bits (2296),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 467/750 (62%), Positives = 583/750 (78%), Gaps = 3/750 (0%)
 Frame = -2

Query  2564  MARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSFN  2385
             M+RKLRFFKDQ++KAG+ +S  S  Q  I  +DLE++L + E ELIE+N+N++KLQ+S+N
Sbjct  1     MSRKLRFFKDQINKAGLMSSP-SVLQSDIYLEDLEIQLAEHEHELIEMNSNSEKLQQSYN  59

Query  2384  ELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsge-esleapllsePDMSADTSKQVR  2208
             EL+E+K+VLQK   F  S+R +A +++ E   +     + +E P L E +M    S Q  
Sbjct  60    ELLEFKIVLQKACRFLVSSRGNACSEETELEENVFSNGDYIETPFLFEQEMRPAPSNQSG  119

Query  2207  LGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSGE  2028
             L FISG++ K K + FER+LFRATRGN+L   +  DE ++DPIS E VEK VF+VF+SGE
Sbjct  120   LRFISGMICKSKVLRFERMLFRATRGNMLFNHAPADEQIMDPISTEMVEKIVFVVFFSGE  179

Query  2027  RAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSIA  1848
             +A+ KILKICDAFGAN YP  E+  KQ Q+ +EVS ++++L+  +DAGI  R   L S+ 
Sbjct  180   QARTKILKICDAFGANCYPVPEDTNKQRQITSEVSSRLADLEATLDAGIRLRNKALASVG  239

Query  1847  EQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNSE  1668
                 +W  +VRREK++Y TLNML+ DVTKKCLV EGW P  A  +IQ+AL+RA  DS+S+
Sbjct  240   GHLTKWMDMVRREKAVYDTLNMLNFDVTKKCLVGEGWCPIFAKTQIQEALERATFDSSSQ  299

Query  1667  IGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMF  1488
             +G IF  +   ESPPTYF+TN FTS +QEIVDAYGVA+YQEANP V+T + FPFLFAVMF
Sbjct  300   VGIIFHSMDALESPPTYFRTNSFTSPYQEIVDAYGVARYQEANPAVYTTIIFPFLFAVMF  359

Query  1487  GDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEFF  1308
             GDWGHGICLLL  L  + R+ KLS+Q+LG   EM FGGRYV+L+M+LFSIY G IYNEFF
Sbjct  360   GDWGHGICLLLGALVLIARQSKLSTQRLGSFMEMLFGGRYVLLLMSLFSIYCGLIYNEFF  419

Query  1307  SVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKLS  1128
             SV + +FG SAY C+D SC DA TIGL+K R+ Y FGVDP+W G+RSELPFLNSLKMK+S
Sbjct  420   SVPYHIFGASAYKCQDSSCRDAHTIGLVKYREPYPFGVDPSWRGSRSELPFLNSLKMKMS  479

Query  1127  ILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQA  948
             ILLGV  MNLGI+LSYFNA +F + ++   QF+PQIIFLN LFGYLS+LI+VKWCTGSQA
Sbjct  480   ILLGVVHMNLGILLSYFNARFFGNSLDIRYQFVPQIIFLNCLFGYLSLLIVVKWCTGSQA  539

Query  947   DLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQHN-RH  771
             DLYHVMIYMFL P ++LGENQLF GQ+  Q+VL+LLA+++VPWML PKPFILK  +N R 
Sbjct  540   DLYHVMIYMFLSPFDNLGENQLFWGQRPLQVVLLLLAVIAVPWMLFPKPFILKKLYNERF  599

Query  770   QGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLRLW  591
             QG++Y  +   +  L ++       HEEF FSEVFVHQ+IH+IEFVLG+VSNTASYLRLW
Sbjct  600   QGRTYGVLNTSEVDLELEPDSARQYHEEFNFSEVFVHQMIHSIEFVLGSVSNTASYLRLW  659

Query  590   ALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHALRL  411
             ALSLAHSELSTVFYEKVLLLAWGY+N++I +VG  +F FAT  +LL+METLSAFLHALRL
Sbjct  660   ALSLAHSELSTVFYEKVLLLAWGYDNLVIRLVGLAVFAFATAFILLMMETLSAFLHALRL  719

Query  410   HWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             HWVEFQNKFY GDGYKF PFSFV + EEE+
Sbjct  720   HWVEFQNKFYSGDGYKFKPFSFVSLTEEEN  749



>ref|XP_006365751.1| PREDICTED: vacuolar proton ATPase a1-like isoform X3 [Solanum 
tuberosum]
Length=760

 Score =   885 bits (2288),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 457/744 (61%), Positives = 566/744 (76%), Gaps = 2/744 (0%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             P MDL RSE M  VQLIIP ESA  ++ YLG LGL+QF+DLNA+KSPFQRT+  Q+KR  
Sbjct  8     PLMDLMRSEKMTFVQLIIPAESAHRAITYLGQLGLLQFRDLNAKKSPFQRTFVNQVKRCV  67

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EM RKLR+FKDQ+ KAG+       +Q   + +++E++L + E ELIE+NAN++KL++S+
Sbjct  68    EMGRKLRYFKDQIHKAGLLLPPLPASQPDTELEEIEIQLAEHEHELIEMNANSEKLRQSY  127

Query  2387  NELVEYKLVLQKVGEFF-HSARssaeaqqqeygssqsgeesleapllsePDMSADTSKQV  2211
             NEL+E+K+VLQK   F   S+  + + + +   +  S +   +   L E +M ++ S Q 
Sbjct  128   NELLEFKMVLQKASGFLVSSSSHTTDREIELDENVYSNDNHGDTASLIEQEMHSELSNQS  187

Query  2210  RLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSG  2031
              + FISG++   K + FER+LFRATRGN+L  Q+  D+ ++DP S E VEK VF+VF+SG
Sbjct  188   GVRFISGIICNSKVLQFERMLFRATRGNMLFNQAVADDEILDPSSNEMVEKIVFVVFFSG  247

Query  2030  ERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSI  1851
             E+A+ KILKIC+AF AN YP  E+  K+ Q+  EV  ++SEL+T +DAG+ HR   L SI
Sbjct  248   EQARTKILKICEAFSANCYPVPEDTTKRRQITQEVLSRLSELETTLDAGLRHRDKALTSI  307

Query  1850  AEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNS  1671
                  +W  +V+ +K++Y TLNML+ DVTKKCLV EGW P  A  +IQ+ALQRA  DS+S
Sbjct  308   GYHLTKWINMVKTQKAVYDTLNMLNFDVTKKCLVGEGWCPIFAKTKIQEALQRATFDSSS  367

Query  1670  EIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVM  1491
             ++G IF V+   ESPPTYF+TN+FT+AFQEIVDAYGVAKYQEANP V+TIVTFPFLFAVM
Sbjct  368   QVGIIFHVMDAVESPPTYFRTNRFTNAFQEIVDAYGVAKYQEANPAVYTIVTFPFLFAVM  427

Query  1490  FGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEF  1311
             FGDWGHGICLLL  L  + RE KLSSQKLG   EM FGGRYV+L+M++FSIY G IYNEF
Sbjct  428   FGDWGHGICLLLGALVLIARESKLSSQKLGSFMEMLFGGRYVLLLMSIFSIYCGLIYNEF  487

Query  1310  FSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKL  1131
             FSV F +FG SAY CRD +CSDA T+GLIK +D Y FGVDP+W G+RSELPFLNSLKMK+
Sbjct  488   FSVPFHIFGDSAYKCRDATCSDAQTVGLIKYKDPYPFGVDPSWRGSRSELPFLNSLKMKM  547

Query  1130  SILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQ  951
             SILLGVAQMNLGIILSYFNA +F S ++   QFIPQIIFLN+LFGYLS+L++VKWCTGSQ
Sbjct  548   SILLGVAQMNLGIILSYFNARFFSSSLDIKYQFIPQIIFLNSLFGYLSLLVVVKWCTGSQ  607

Query  950   ADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQH-NR  774
             ADLYHVMIYMFL P E LGEN+LF GQ   Q++L+LLAL++VPWML PKPFILK  H  R
Sbjct  608   ADLYHVMIYMFLSPFEALGENRLFWGQSVLQVILLLLALIAVPWMLFPKPFILKRLHMER  667

Query  773   HQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLRL  594
              QG++Y  +   +              EEF FSEVFVHQ+IH+IEFVLGAVSNTASYLRL
Sbjct  668   FQGRTYGMLGTSEMGSDDQPDSARERAEEFNFSEVFVHQMIHSIEFVLGAVSNTASYLRL  727

Query  593   WALSLAHSELSTVFYEKVLLLAWG  522
             WALSLAHSELSTVFYEKVLLLAWG
Sbjct  728   WALSLAHSELSTVFYEKVLLLAWG  751



>ref|XP_008348897.1| PREDICTED: vacuolar proton ATPase a3-like [Malus domestica]
Length=573

 Score =   884 bits (2285),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/573 (76%), Positives = 504/573 (88%), Gaps = 1/573 (0%)
 Frame = -2

Query  2759  GGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQI  2580
             G C PPMDLFRSEPMQLVQ+IIPIESA L+V+YLGDLGLIQFKDLN+EKSPFQRTYAAQI
Sbjct  2     GECCPPMDLFRSEPMQLVQIIIPIESAHLTVSYLGDLGLIQFKDLNSEKSPFQRTYAAQI  61

Query  2579  KRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKL  2400
             KRS EMARKLRFFK+QMSKA +  S ++   D +  DDLEVKLG+LEAELIEIN+N++KL
Sbjct  62    KRSAEMARKLRFFKEQMSKADLPPSKSARQVD-VNVDDLEVKLGELEAELIEINSNDEKL  120

Query  2399  QRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTS  2220
             QRS+NEL+EYKLVL+K G+FFHSA+SSA   Q+E  S   G+ESL+ PLL E + S D S
Sbjct  121   QRSYNELLEYKLVLEKAGDFFHSAQSSAVLHQRENESRDIGDESLDMPLLLEQETSTDPS  180

Query  2219  KQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVF  2040
             KQV+LGF++GLVP+EKS+AFERILFRATRGNV LRQ+ V+  V DP+SGEKVEKNVF+VF
Sbjct  181   KQVKLGFLTGLVPREKSLAFERILFRATRGNVFLRQTVVENPVTDPVSGEKVEKNVFVVF  240

Query  2039  YSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLL  1860
             YSGERAK+KILKICDAFGANRY F E+LG+Q Q+ITEVSG++SELKT ID G+L RG+LL
Sbjct  241   YSGERAKSKILKICDAFGANRYSFTEDLGRQYQMITEVSGRLSELKTTIDVGVLLRGSLL  300

Query  1859  QSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHD  1680
             Q+I + F++WN+LVR+EKSIYH LNMLS+DVTKKCLVAEGWSP  A+ +IQDALQRA  D
Sbjct  301   QTIGKHFEQWNLLVRKEKSIYHHLNMLSLDVTKKCLVAEGWSPVFASKQIQDALQRAAFD  360

Query  1679  SNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLF  1500
             SNS++GAIF+VL T+E+PPTYF+TNKFTS+FQEIVDAYGVAKYQEANP V+TIVTFPFLF
Sbjct  361   SNSQVGAIFQVLHTKEAPPTYFRTNKFTSSFQEIVDAYGVAKYQEANPAVYTIVTFPFLF  420

Query  1499  AVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIY  1320
             AVMFGDWGHGICLLLAT+Y + REKKLSSQKLGDI EM FGGRYVIL+MA+FSIYTGFIY
Sbjct  421   AVMFGDWGHGICLLLATIYLIGREKKLSSQKLGDIMEMAFGGRYVILLMAIFSIYTGFIY  480

Query  1319  NEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLK  1140
             NEFFSV FELFG SAY CRD SC DATT GLIK   TY FG+DP WHG+RSELPFLNSLK
Sbjct  481   NEFFSVPFELFGPSAYACRDLSCRDATTAGLIKVHPTYPFGLDPVWHGSRSELPFLNSLK  540

Query  1139  MKLSILLGVAQMNLGIILSYFNAHYFRSGVNKW  1041
             MK+SI++GV QMNLGI++SYFNA +F+S +N W
Sbjct  541   MKMSIIIGVVQMNLGIMISYFNARFFQSNLNVW  573



>ref|XP_007015508.1| Vacuolar proton ATPase A1 isoform 2 [Theobroma cacao]
 ref|XP_007015510.1| Vacuolar proton ATPase A1 isoform 2 [Theobroma cacao]
 gb|EOY33127.1| Vacuolar proton ATPase A1 isoform 2 [Theobroma cacao]
 gb|EOY33129.1| Vacuolar proton ATPase A1 isoform 2 [Theobroma cacao]
Length=740

 Score =   880 bits (2273),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/723 (61%), Positives = 563/723 (78%), Gaps = 2/723 (0%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             PPMDL RSE M LVQLIIP+ESA  +++YLG+LGL+QF+DLNAEKSPFQRT+  Q+KR G
Sbjct  12    PPMDLMRSEKMTLVQLIIPVESAHRAISYLGELGLLQFRDLNAEKSPFQRTFVNQVKRCG  71

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EM+RKLRFFKDQ+SKAG+ +S +   +  ++ ++LE++L + E ELIE+N+N++KL++++
Sbjct  72    EMSRKLRFFKDQISKAGLLSSLHPVVEPDVELEELEIQLAEHEHELIEMNSNSEKLRQTY  131

Query  2387  NELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTSKQVR  2208
             NEL+E+K+VLQK G F  S+ + A  +++E   +    +          +     + Q  
Sbjct  132   NELLEFKIVLQKAGGFLVSSNNHAVDEERELSENVYSNDGYVETASLL-EQEMRPADQSG  190

Query  2207  LGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSGE  2028
             L FISG++ K K++ FER+LFRATRGN+L   +   E ++DP+S E VEK VF+VF+SGE
Sbjct  191   LRFISGIICKSKALRFERMLFRATRGNMLFNHAPAGEEIMDPVSAEMVEKTVFVVFFSGE  250

Query  2027  RAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSIA  1848
             +AK KILKIC+AFGAN YP  +++ KQ Q+  EV  ++SEL+T +DAGI HR   L S+ 
Sbjct  251   QAKTKILKICEAFGANCYPVPDDISKQRQITREVLSRLSELETTLDAGIRHRNKALTSVG  310

Query  1847  EQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNSE  1668
                  W  +VRREK++Y TLNML+ DVTKKCLV EGW P  A  +IQ+ALQRA  DSNS+
Sbjct  311   YHLTHWMSMVRREKAVYDTLNMLNFDVTKKCLVGEGWCPIFAKAQIQEALQRATFDSNSQ  370

Query  1667  IGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMF  1488
             +G IF V+   ESPPTYF+TN+FT+A+QEIVDAYGVA+YQE+NP V+T++TFPFLFAVMF
Sbjct  371   VGIIFHVMDAVESPPTYFRTNRFTNAYQEIVDAYGVARYQESNPAVYTVITFPFLFAVMF  430

Query  1487  GDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEFF  1308
             GDWGHGICLLL  L  + RE +LS+QKLG   EM FGGRYV+L+M+LFSIY G IYNEFF
Sbjct  431   GDWGHGICLLLGALVLIARESRLSTQKLGSFMEMLFGGRYVLLLMSLFSIYCGLIYNEFF  490

Query  1307  SVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKLS  1128
             SV F +FG SAY CRD +C DA + GLIK RD Y FGVDP+W G+RSELPFLNSLKMK+S
Sbjct  491   SVPFHIFGGSAYKCRDATCRDAQSAGLIKFRDPYPFGVDPSWRGSRSELPFLNSLKMKMS  550

Query  1127  ILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQA  948
             ILLGVAQMNLGIILSYFNA +FR+ ++   QF+PQ+IFLN+LFGYLS+LII+KWCTGSQA
Sbjct  551   ILLGVAQMNLGIILSYFNARFFRNSLDIRYQFVPQMIFLNSLFGYLSLLIIIKWCTGSQA  610

Query  947   DLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQHN-RH  771
             DLYHVMIYMFL PT+DLG+N+LF GQ+  Q+VL+LLALV+VPWML PKPFILK  H+ R 
Sbjct  611   DLYHVMIYMFLSPTDDLGDNELFWGQRPLQIVLLLLALVAVPWMLFPKPFILKKLHSERF  670

Query  770   QGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLRLW  591
             QG++Y  +   +  L V+       HEEF FSEVFVHQ+IH+IEFVLGAVSNTASYLRLW
Sbjct  671   QGRTYGMLGTSEFDLDVEPDSARQHHEEFNFSEVFVHQMIHSIEFVLGAVSNTASYLRLW  730

Query  590   ALS  582
             ALS
Sbjct  731   ALS  733



>ref|XP_001769505.1| predicted protein [Physcomitrella patens]
 gb|EDQ65666.1| predicted protein [Physcomitrella patens]
Length=802

 Score =   869 bits (2245),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 465/801 (58%), Positives = 607/801 (76%), Gaps = 9/801 (1%)
 Frame = -2

Query  2741  MDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSGEM  2562
             MDLFRSE M  VQLIIP+E+A  +V YL +LGLIQ  DLN+ KSPFQR +A+Q KR  EM
Sbjct  1     MDLFRSEEMNKVQLIIPVEAAHNTVTYLAELGLIQLIDLNSGKSPFQRPFASQTKRCEEM  60

Query  2561  ARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSFNE  2382
             ARKLR+F+DQ+ +A  +       +  +K ++LE+KL +LE EL+E N N++KL+RS++E
Sbjct  61    ARKLRWFQDQLLRAKQTPVCRHTLERELKLEELEMKLTELETELLESNCNSEKLKRSYSE  120

Query  2381  LVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTSKQVRLG  2202
             L+E  LVL K    F+SAR +A+ Q+++       E+     LL + + S + SKQ +LG
Sbjct  121   LMEMGLVLHKTSTSFNSARRTADIQRRQPDLIVDAEDVNHPFLLEQ-EASINPSKQAQLG  179

Query  2201  FISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSGERA  2022
             F++GLV   K  +FERILF ATRGN+  ++S   + V DP SGE+VEK VF+VF++GERA
Sbjct  180   FVAGLVVNSKCHSFERILFHATRGNMYFKRSTQADFVADPASGEQVEKVVFIVFFAGERA  239

Query  2021  KNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSIAEQ  1842
             + KI KIC+ FG NRYPF E+  +Q  +  EVS ++SEL+  +++G++HR N+  ++   
Sbjct  240   RLKITKICETFGVNRYPFPEDSARQGLMKVEVSTRLSELQATLNSGVVHRQNVFTNLGYN  299

Query  1841  FDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNSEIG  1662
              D W  +VRREK++Y  LNMLS+DVT KCLVAEGW P     +IQDALQRA  DSNS++ 
Sbjct  300   LDHWIGMVRREKAVYCALNMLSVDVTSKCLVAEGWCPVKTKPQIQDALQRATVDSNSQLS  359

Query  1661  AIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGD  1482
             +IF V+ T+ESPPT+++TNKFT+ FQEIV+AYGVA+YQEANPG FTIVTFPFLFAVMFGD
Sbjct  360   SIFHVVQTKESPPTFYETNKFTAPFQEIVNAYGVARYQEANPGCFTIVTFPFLFAVMFGD  419

Query  1481  WGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEFFSV  1302
             WGHGI LL A LY +++E    S+KLGD   M FGGRY+IL+M++FSIYTGFIYNEFFSV
Sbjct  420   WGHGIALLSAALYLILKENHFESKKLGDFMTMAFGGRYIILLMSIFSIYTGFIYNEFFSV  479

Query  1301  QFELFGRSAYVCRDPSCSDATTIGLIKARD-TYAFGVDPAWHGTRSELPFLNSLKMKLSI  1125
                ++  SAY CR+  CSDA+ IGL+K  +  Y FG+DPAWHG+R+ELPF NSLKMK+S+
Sbjct  480   PIFIWD-SAYSCRENDCSDASRIGLVKWSELPYPFGLDPAWHGSRTELPFTNSLKMKMSV  538

Query  1124  LLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQAD  945
             L+GV+Q+NLG++LS++NA +  S ++ W QF+PQ++FLN+LFGYLS+LI++KWC GS+AD
Sbjct  539   LMGVSQLNLGLMLSWWNADFNHSKLDFWYQFVPQLLFLNSLFGYLSMLIVIKWCQGSKAD  598

Query  944   LYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQH-NRHQ  768
             LYHVMIYMFL P+E LGENQLF GQ   Q +LV++AL +VPWML PKPF L+  H  R Q
Sbjct  599   LYHVMIYMFLSPSEPLGENQLFWGQNYFQRMLVMIALAAVPWMLFPKPFKLRKLHEQRMQ  658

Query  767   GQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLRLWA  588
             G+ Y  +   D       S D    EEF F+E+FVHQ+IHTIEFVLG VSNTASYLRLWA
Sbjct  659   GRIYGVLGGSDTE-----SVDLEHEEEFNFNEIFVHQMIHTIEFVLGTVSNTASYLRLWA  713

Query  587   LSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHALRLH  408
             LSLAH++LS+VF+EK L+L++ Y+N  + + G ++F F T+GVLL+ME+LSA LHALRLH
Sbjct  714   LSLAHAQLSSVFFEKFLVLSFSYSNPFVRLTGLVMFAFVTVGVLLLMESLSALLHALRLH  773

Query  407   WVEFQNKFYEGDGYKFDPFSF  345
             WVEFQNKFY GDGYKF PFSF
Sbjct  774   WVEFQNKFYAGDGYKFMPFSF  794



>ref|XP_007225586.1| hypothetical protein PRUPE_ppa001483m1g, partial [Prunus persica]
 gb|EMJ26785.1| hypothetical protein PRUPE_ppa001483m1g, partial [Prunus persica]
Length=574

 Score =   860 bits (2223),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/571 (76%), Positives = 503/571 (88%), Gaps = 0/571 (0%)
 Frame = -2

Query  2759  GGCFPPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQI  2580
             G C P MDL RSEPMQL QLIIPIES+R +++YLGDLGL QFKDLNAEKSPFQRTYA QI
Sbjct  3     GECCPTMDLLRSEPMQLAQLIIPIESSRHAISYLGDLGLFQFKDLNAEKSPFQRTYATQI  62

Query  2579  KRSGEMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKL  2400
             KR GEMAR+LRFFK+QM KAG+S S  S T + I  D++EVKLG+LEAEL+EINANN+ L
Sbjct  63    KRCGEMARRLRFFKEQMKKAGLSPSTRSTTGNDIDLDNMEVKLGELEAELLEINANNEHL  122

Query  2399  QRSFNELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTS  2220
             QR+++EL+EYKLVLQK GEFF+SA+SSA AQQ+++    S E+S+++PLL E +M+ D S
Sbjct  123   QRTYSELLEYKLVLQKAGEFFNSAQSSAAAQQRQFERQHSIEKSIDSPLLLEQEMTTDPS  182

Query  2219  KQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVF  2040
             K V+LGF+SGLVP+EKSM FERILFRATRGNV L+Q+ V++ V+DP+SG+KVEKNVF++F
Sbjct  183   KHVKLGFVSGLVPREKSMTFERILFRATRGNVFLKQAVVNDRVVDPVSGDKVEKNVFIIF  242

Query  2039  YSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLL  1860
             YSGERAKNKILKIC+AFGANRYPF ++LGKQ Q+ITEVSGK+SELK  IDAG+LHR +LL
Sbjct  243   YSGERAKNKILKICEAFGANRYPFTDDLGKQFQMITEVSGKLSELKITIDAGLLHRSSLL  302

Query  1859  QSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHD  1680
             Q+I  Q + WN+LV++EKSIYHTLNMLSIDVTK CLVAEGW P  A+ +IQ+ALQRA  D
Sbjct  303   QTIGHQHELWNLLVKKEKSIYHTLNMLSIDVTKMCLVAEGWCPVYASNQIQNALQRASFD  362

Query  1679  SNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLF  1500
             S+S++GAIF+VL T+ESPPTYF+TNKFTSAFQEIVDAYGVAKYQEANPGV+TIVTFPFLF
Sbjct  363   SSSQVGAIFQVLQTKESPPTYFRTNKFTSAFQEIVDAYGVAKYQEANPGVYTIVTFPFLF  422

Query  1499  AVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIY  1320
             AVMFGDWGHGICLLLATLYF+IRE+K SSQKLGDI EMTFGGRYVI+MMALFSIYTG IY
Sbjct  423   AVMFGDWGHGICLLLATLYFIIRERKFSSQKLGDIVEMTFGGRYVIMMMALFSIYTGLIY  482

Query  1319  NEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLK  1140
             NEFFSV FELFG SAY CRD SCSDATT+GL K R TY FGVDP WHG+RSELPFLNSLK
Sbjct  483   NEFFSVPFELFGPSAYGCRDQSCSDATTVGLSKVRGTYPFGVDPKWHGSRSELPFLNSLK  542

Query  1139  MKLSILLGVAQMNLGIILSYFNAHYFRSGVN  1047
             MK+SILLGVAQMNLGIILSYFNA +F   +N
Sbjct  543   MKMSILLGVAQMNLGIILSYFNAKFFGDNLN  573



>gb|KDO73121.1| hypothetical protein CISIN_1g003454mg [Citrus sinensis]
Length=684

 Score =   849 bits (2193),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/641 (66%), Positives = 517/641 (81%), Gaps = 1/641 (0%)
 Frame = -2

Query  2240  DMSADTSKQVRLGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVE  2061
             D+ A  S Q  L FISG++ K K + FER+LFRATRGN+L  Q+  DE ++DP++ E VE
Sbjct  44    DIRAGPSNQSGLRFISGIICKSKVLRFERMLFRATRGNMLFNQAPADEEIMDPVTAEMVE  103

Query  2060  KNVFLVFYSGERAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGI  1881
             K +F+VF+SGE+A+ KILKIC+AFGAN YP +E+L KQ Q+I EV  ++SEL+  +DAGI
Sbjct  104   KTIFVVFFSGEQARTKILKICEAFGANCYPVSEDLTKQRQIIREVLSRLSELEATLDAGI  163

Query  1880  LHRGNLLQSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDA  1701
              HR   L SI     +W  +VRREK++Y TLNML+ DVTKKCLV EGW P  A  +IQ+ 
Sbjct  164   RHRNKALTSIGFHLTKWMNMVRREKAVYDTLNMLNFDVTKKCLVGEGWCPIFAKAQIQEV  223

Query  1700  LQRAGHDSNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTI  1521
             LQRA  DSNS++G IF V+ + ESPPTYF+TN+FT+AFQEIVDAYGVA+YQEANP V+ +
Sbjct  224   LQRATFDSNSQVGTIFHVMDSMESPPTYFRTNRFTNAFQEIVDAYGVARYQEANPAVYAV  283

Query  1520  VTFPFLFAVMFGDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFS  1341
             +TFPFLFAVMFGDWGHGICLLL  L  + RE+KL +QKLG   EM FGGRYV+L+M+LFS
Sbjct  284   ITFPFLFAVMFGDWGHGICLLLGALVLIARERKLGNQKLGSFMEMLFGGRYVLLLMSLFS  343

Query  1340  IYTGFIYNEFFSVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSEL  1161
             IY G IYNEFFSV + +FG SAY CRD +CSDA T GL+K R+ Y FGVDP+W G+RSEL
Sbjct  344   IYCGLIYNEFFSVPYHIFGGSAYRCRDTTCSDAYTAGLVKYREPYPFGVDPSWRGSRSEL  403

Query  1160  PFLNSLKMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVL  981
             PFLNSLKMK+SILLGV QMNLGIILSYF+A +F S ++   QF+PQ+IFLN+LFGYLS+L
Sbjct  404   PFLNSLKMKMSILLGVTQMNLGIILSYFDARFFGSSLDIRYQFVPQLIFLNSLFGYLSLL  463

Query  980   IIVKWCTGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKP  801
             II+KWCTGSQADLYHVMIYMFL PT+DLGEN+LF GQ+  Q++L+LLA V+VPWML PKP
Sbjct  464   IIIKWCTGSQADLYHVMIYMFLSPTDDLGENELFWGQRPLQILLLLLATVAVPWMLFPKP  523

Query  800   FILKSQHN-RHQGQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGA  624
             FIL+  H  R QG++Y  +   +  L V+       HE+F FSE+FVHQ+IH+IEFVLGA
Sbjct  524   FILRKLHTERFQGRTYGILGTSEMDLEVEPDSARQHHEDFNFSEIFVHQMIHSIEFVLGA  583

Query  623   VSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVME  444
             VSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGY+N++I +VG  +F FAT  +LL+ME
Sbjct  584   VSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYDNLVIRLVGLAVFAFATAFILLMME  643

Query  443   TLSAFLHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEED  321
             TLSAFLHALRLHWVEFQNKFY GDGYKF PFSF L+++EED
Sbjct  644   TLSAFLHALRLHWVEFQNKFYHGDGYKFRPFSFALINDEED  684



>ref|XP_004165227.1| PREDICTED: LOW QUALITY PROTEIN: vacuolar proton ATPase a2-like 
[Cucumis sativus]
Length=541

 Score =   836 bits (2160),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/541 (80%), Positives = 487/541 (90%), Gaps = 1/541 (0%)
 Frame = -2

Query  1940  LITEVSGKISELKTAIDAGILHRGNLLQSIAEQFDRWNVLVRREKSIYHTLNMLSIDVTK  1761
             +I EVSGK+SELKT ID G+LHRGNLLQ+I E F+ WN+L R+EKSIYH LNMLS+DVTK
Sbjct  1     MIAEVSGKLSELKTTIDIGLLHRGNLLQTIGEHFENWNLLARKEKSIYHILNMLSLDVTK  60

Query  1760  KCLVAEGWSPTSATIEIQDALQRAGHDSNSEIGAIFRVLGTRESPPTYFKTNKFTSAFQE  1581
             KCLVAEGW P  AT +IQDALQRA  DSNS++G IF+VL T E+PPTYF+TNKF+SAFQE
Sbjct  61    KCLVAEGWGPVFATKQIQDALQRAASDSNSQVGPIFQVLLTTEAPPTYFRTNKFSSAFQE  120

Query  1580  IVDAYGVAKYQEANPGVFTIVTFPFLFAVMFGDWGHGICLLLATLYFLIREKKLSSQKLG  1401
             IVDAYGVA+YQEANPGV+TIVTFPFLFAVMFGDWGHGICLLLATLYF++RE KLSSQKLG
Sbjct  121   IVDAYGVARYQEANPGVYTIVTFPFLFAVMFGDWGHGICLLLATLYFILREXKLSSQKLG  180

Query  1400  DITEMTFGGRYVILMMALFSIYTGFIYNEFFSVQFELFGRSAYVCRDPSCSDATTIGLIK  1221
             DITEM FGGRYVILMM+LFSIYTG IYNEFFSV F LFGRSAY CR P CSD+TT+GL+K
Sbjct  181   DITEMAFGGRYVILMMSLFSIYTGLIYNEFFSVPFGLFGRSAYACRSPDCSDSTTVGLLK  240

Query  1220  ARDTYAFGVDPAWHGTRSELPFLNSLKMKLSILLGVAQMNLGIILSYFNAHYFRSGVNKW  1041
                TY FG+DP WHGTRSELPFLNSLKMK+SILLGVAQMNLGII+SYFNA +FR+ +N W
Sbjct  241   VGSTYPFGLDPVWHGTRSELPFLNSLKMKMSILLGVAQMNLGIIISYFNATFFRNSINIW  300

Query  1040  CQFIPQIIFLNALFGYLSVLIIVKWCTGSQADLYHVMIYMFLGPTEDLGENQLFPGQKTT  861
              QF+PQ+IFLN+LFGYLS+LII+KWCTGS ADLYHVMIYMFLGPTEDL ENQLFPGQK  
Sbjct  301   FQFLPQMIFLNSLFGYLSLLIIIKWCTGSNADLYHVMIYMFLGPTEDLAENQLFPGQKNV  360

Query  860   QlvlvllalvsVPWMLLPKPFILKSQH-NRHQGQSYAPIQDLDESLLvdgshdssdheef  684
             Q+VL+LLALV+VPWMLLPKPF+LK QH  R QGQSYAP+   D+SL +D  HDS  HEEF
Sbjct  361   QIVLLLLALVAVPWMLLPKPFLLKRQHEQRFQGQSYAPLPSGDDSLELDSHHDSHGHEEF  420

Query  683   efsevfvHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYNNiii  504
             EFSE+FVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELS+VFY+KVL+L+ G+NNIII
Sbjct  421   EFSEIFVHQLIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYDKVLVLSAGFNNIII  480

Query  503   lvvgfiifiFATIGVLLVMETLSAFLHALRLHWVEFQNKFYEGDGYKFDPFSFVLVDEEE  324
             L+VG I+FIFAT+GVLL+METLSAFLHALRLHWVEFQNKFYEGDGYKF PFSF L+DE++
Sbjct  481   LIVGIIVFIFATVGVLLLMETLSAFLHALRLHWVEFQNKFYEGDGYKFHPFSFALLDEDD  540

Query  323   D  321
             D
Sbjct  541   D  541



>ref|XP_007015512.1| Vacuolar proton ATPase A1 isoform 6 [Theobroma cacao]
 gb|EOY33131.1| Vacuolar proton ATPase A1 isoform 6 [Theobroma cacao]
Length=672

 Score =   835 bits (2158),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/656 (61%), Positives = 514/656 (78%), Gaps = 1/656 (0%)
 Frame = -2

Query  2747  PPMDLFRSEPMQLVQLIIPIESARLSVAYLGDLGLIQFKDLNAEKSPFQRTYAAQIKRSG  2568
             PPMDL RSE M LVQLIIP+ESA  +++YLG+LGL+QF+DLNAEKSPFQRT+  Q+KR G
Sbjct  12    PPMDLMRSEKMTLVQLIIPVESAHRAISYLGELGLLQFRDLNAEKSPFQRTFVNQVKRCG  71

Query  2567  EMARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSF  2388
             EM+RKLRFFKDQ+SKAG+ +S +   +  ++ ++LE++L + E ELIE+N+N++KL++++
Sbjct  72    EMSRKLRFFKDQISKAGLLSSLHPVVEPDVELEELEIQLAEHEHELIEMNSNSEKLRQTY  131

Query  2387  NELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTSKQVR  2208
             NEL+E+K+VLQK G F  S+ + A  +++E   +    +          +     + Q  
Sbjct  132   NELLEFKIVLQKAGGFLVSSNNHAVDEERELSENVYSNDGYVETASLL-EQEMRPADQSG  190

Query  2207  LGFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSGE  2028
             L FISG++ K K++ FER+LFRATRGN+L   +   E ++DP+S E VEK VF+VF+SGE
Sbjct  191   LRFISGIICKSKALRFERMLFRATRGNMLFNHAPAGEEIMDPVSAEMVEKTVFVVFFSGE  250

Query  2027  RAKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSIA  1848
             +AK KILKIC+AFGAN YP  +++ KQ Q+  EV  ++SEL+T +DAGI HR   L S+ 
Sbjct  251   QAKTKILKICEAFGANCYPVPDDISKQRQITREVLSRLSELETTLDAGIRHRNKALTSVG  310

Query  1847  EQFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNSE  1668
                  W  +VRREK++Y TLNML+ DVTKKCLV EGW P  A  +IQ+ALQRA  DSNS+
Sbjct  311   YHLTHWMSMVRREKAVYDTLNMLNFDVTKKCLVGEGWCPIFAKAQIQEALQRATFDSNSQ  370

Query  1667  IGAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMF  1488
             +G IF V+   ESPPTYF+TN+FT+A+QEIVDAYGVA+YQE+NP V+T++TFPFLFAVMF
Sbjct  371   VGIIFHVMDAVESPPTYFRTNRFTNAYQEIVDAYGVARYQESNPAVYTVITFPFLFAVMF  430

Query  1487  GDWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEFF  1308
             GDWGHGICLLL  L  + RE +LS+QKLG   EM FGGRYV+L+M+LFSIY G IYNEFF
Sbjct  431   GDWGHGICLLLGALVLIARESRLSTQKLGSFMEMLFGGRYVLLLMSLFSIYCGLIYNEFF  490

Query  1307  SVQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKLS  1128
             SV F +FG SAY CRD +C DA + GLIK RD Y FGVDP+W G+RSELPFLNSLKMK+S
Sbjct  491   SVPFHIFGGSAYKCRDATCRDAQSAGLIKFRDPYPFGVDPSWRGSRSELPFLNSLKMKMS  550

Query  1127  ILLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQA  948
             ILLGVAQMNLGIILSYFNA +FR+ ++   QF+PQ+IFLN+LFGYLS+LII+KWCTGSQA
Sbjct  551   ILLGVAQMNLGIILSYFNARFFRNSLDIRYQFVPQMIFLNSLFGYLSLLIIIKWCTGSQA  610

Query  947   DLYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQH  780
             DLYHVMIYMFL PT+DLG+N+LF GQ+  Q+VL+LLALV+VPWML PKPFILK + 
Sbjct  611   DLYHVMIYMFLSPTDDLGDNELFWGQRPLQIVLLLLALVAVPWMLFPKPFILKKRR  666



>gb|EMT21067.1| hypothetical protein F775_21366 [Aegilops tauschii]
Length=737

 Score =   827 bits (2136),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/749 (59%), Positives = 558/749 (74%), Gaps = 14/749 (2%)
 Frame = -2

Query  2564  MARKLRFFKDQMSKAGVSASANSDTQDAIKFDDLEVKLGDLEAELIEINANNDKLQRSFN  2385
             M RKL+FF DQ++KAGV +S     Q  I  ++LE KLG+ E EL+E+N N+  L++++N
Sbjct  1     MNRKLKFFSDQINKAGVKSSVRPALQPEIDLEELEAKLGEHEHELLEMNTNSGTLRQTYN  60

Query  2384  ELVEYKLVLQKVGEFFHSARssaeaqqqeygssqsgeesleapllsePDMSADTSKQVRL  2205
             EL+E+KLVL K G    ++++ A     E       +E  +             + +  +
Sbjct  61    ELLEFKLVLSKAGSILAASQNHATPADHELDEHIYDKEVDDGNGYLLEQGIHQGASESGV  120

Query  2204  GFISGLVPKEKSMAFERILFRATRGNVLLRQSEVDESVIDPISGEKVEKNVFLVFYSGER  2025
              F+SG++ K K++AFER+LFR TRGN+   ++   E V+DP SGE+VEK VF+VF+SGE+
Sbjct  121   RFVSGIILKSKALAFERMLFRTTRGNMFFNEASAGEPVMDPSSGEEVEKTVFVVFFSGEQ  180

Query  2024  AKNKILKICDAFGANRYPFAEELGKQAQLITEVSGKISELKTAIDAGILHRGNLLQSIAE  1845
             AK KIL+IC +FGAN YP  EE+ KQ Q+  E S ++S+L+  +DAG  HR   L+S+  
Sbjct  181   AKAKILRICASFGANCYPVPEEIVKQRQIFREGSSRLSDLEVTLDAGTQHRNKALESVGS  240

Query  1844  QFDRWNVLVRREKSIYHTLNMLSIDVTKKCLVAEGWSPTSATIEIQDALQRAGHDSNSEI  1665
             Q  RW ++V++EK++Y TLNML+ DVTKKCLV EGW P  A  +I+D LQRA   SNS++
Sbjct  241   QLWRWILMVKKEKAVYDTLNMLNFDVTKKCLVGEGWCPIFAKSQIEDVLQRATLHSNSQV  300

Query  1664  GAIFRVLGTRESPPTYFKTNKFTSAFQEIVDAYGVAKYQEANPGVFTIVTFPFLFAVMFG  1485
             G IF  + T +SPPTYF+T+KFT+AFQEIVDAYGV +Y+E NP V++++TFPFLFAVMFG
Sbjct  301   GIIFHEMDTIDSPPTYFRTDKFTNAFQEIVDAYGVGRYEEINPAVYSVITFPFLFAVMFG  360

Query  1484  DWGHGICLLLATLYFLIREKKLSSQKLGDITEMTFGGRYVILMMALFSIYTGFIYNEFFS  1305
             DWGHGICLLL  L+ ++REKKLSSQKL   TEM FGGRYVIL+MALFSIY G IYNEFFS
Sbjct  361   DWGHGICLLLGALFLILREKKLSSQKLDSFTEMAFGGRYVILLMALFSIYCGLIYNEFFS  420

Query  1304  VQFELFGRSAYVCRDPSCSDATTIGLIKARDTYAFGVDPAWHGTRSELPFLNSLKMKLSI  1125
             V F +FG+SAY CR+ SCSDA T GL+K RD Y FGVDP+W G+RSELPFLNSLKMK+SI
Sbjct  421   VPFHIFGKSAYACRENSCSDAYTAGLVKVRDPYPFGVDPSWRGSRSELPFLNSLKMKMSI  480

Query  1124  LLGVAQMNLGIILSYFNAHYFRSGVNKWCQFIPQIIFLNALFGYLSVLIIVKWCTGSQAD  945
             L+GV+QMNLGI+LSYF+A + ++ ++             +LFGYLS+LI++KWCTGS+AD
Sbjct  481   LMGVSQMNLGILLSYFDAKFHKNALDI------------SLFGYLSLLILIKWCTGSKAD  528

Query  944   LYHVMIYMFLGPTEDLGENQLFPGQKTTQlvlvllalvsVPWMLLPKPFILKSQHN-RHQ  768
             LYHVMIYMFL P  DLGENQLF GQK  Q++L+LLALV+VPWML PKPFILK  H  R Q
Sbjct  529   LYHVMIYMFLDPAGDLGENQLFWGQKELQILLLLLALVAVPWMLFPKPFILKKLHKERFQ  588

Query  767   GQSYAPIQDLDESLLvdgshdssdheefefsevfvHQLIHTIEFVLGAVSNTASYLRLWA  588
             G SY  +   +     +     S H++F F EVFVHQ+IH+IEFVLGAVSNTASYLRLWA
Sbjct  589   GHSYRFLGTSEMDPDSEPDSARSRHDDFNFGEVFVHQMIHSIEFVLGAVSNTASYLRLWA  648

Query  587   LSLAHSELSTVFYEKVLLLAWGYNNiiilvvgfiifiFATIGVLLVMETLSAFLHALRLH  408
             LSLAHSELSTVFYEK+LL AWGY+++I  +VG I+F FAT  +LL ME+LSAFLHALRLH
Sbjct  649   LSLAHSELSTVFYEKLLLFAWGYDSLIFKLVGLIVFAFATAFILLGMESLSAFLHALRLH  708

Query  407   WVEFQNKFYEGDGYKFDPFSF-VLVDEEE  324
             WVEF NKFY GDGYKF PFSF  L D+EE
Sbjct  709   WVEFMNKFYHGDGYKFKPFSFATLADDEE  737



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 9291060879870