BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c106744_g1_i1 len=255 path=[1:0-254]

Length=255
                                                                      Score     E

ref|XP_009615588.1|  PREDICTED: uncharacterized protein LOC104108294  47.4    4e-04   



>ref|XP_009615588.1| PREDICTED: uncharacterized protein LOC104108294 [Nicotiana tomentosiformis]
Length=546

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/71 (34%), Positives = 38/71 (54%), Gaps = 0/71 (0%)
 Frame = +1

Query  43   PRVGQQDRPEVSVFDGKDLVLEEFKVVVINVWNKLRKKLDDTSVEHISSLQESFLNTFAN  222
            P   Q+  P +S+FDG+++VL   K  ++N W K+  KL D + ++ SS Q         
Sbjct  442  PNFHQRSVPTMSIFDGRNIVLTLRKDFILNAWAKIHAKLKDLTADNASSFQFEIQVILEE  501

Query  223  LRKLDIDISPL  255
            +    +DISPL
Sbjct  502  MDGKRVDISPL  512



Lambda      K        H        a         alpha
   0.313    0.132    0.365    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 507510111836