BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c1063_g1_i1 len=1022 path=[1083:0-303 20:304-1021]

Length=1022
                                                                      Score     E

ref|XP_007157336.1|  hypothetical protein PHAVU_002G061600g             334   9e-111   
gb|KDP25639.1|  hypothetical protein JCGZ_20795                         329   2e-109   
ref|XP_009611023.1|  PREDICTED: adenine phosphoribosyltransferase 3     327   1e-108   
ref|XP_011081216.1|  PREDICTED: adenine phosphoribosyltransferase 4     325   4e-108   
ref|XP_007039902.1|  Adenine phosphoribosyl transferase 4               324   1e-107   
ref|XP_011018283.1|  PREDICTED: adenine phosphoribosyltransferase...    324   2e-107   
ref|XP_004511667.1|  PREDICTED: adenine phosphoribosyltransferase...    323   4e-107   
ref|XP_006368184.1|  MtN30 family protein                               322   1e-106   
ref|XP_002268529.3|  PREDICTED: adenine phosphoribosyltransferase 3     323   2e-106   Vitis vinifera
ref|XP_009802437.1|  PREDICTED: adenine phosphoribosyltransferase...    320   3e-106   
gb|KHN34953.1|  Adenine phosphoribosyltransferase 1, chloroplastic      320   3e-106   
gb|KHG11970.1|  Adenine phosphoribosyltransferase 1, chloroplastic      320   5e-106   
ref|XP_006355483.1|  PREDICTED: adenine phosphoribosyltransferase...    320   7e-106   
ref|XP_009347506.1|  PREDICTED: adenine phosphoribosyltransferase...    319   1e-105   
emb|CDP09925.1|  unnamed protein product                                318   2e-105   
ref|XP_010259005.1|  PREDICTED: adenine phosphoribosyltransferase...    318   5e-105   
ref|NP_001238434.1|  uncharacterized protein LOC100306411               317   5e-105   
ref|XP_003525806.1|  PREDICTED: adenine phosphoribosyltransferase...    317   7e-105   
ref|XP_004516845.1|  PREDICTED: adenine phosphoribosyltransferase...    317   8e-105   
ref|XP_010053440.1|  PREDICTED: adenine phosphoribosyltransferase...    317   9e-105   
ref|XP_006477237.1|  PREDICTED: adenine phosphoribosyltransferase...    315   5e-104   
ref|XP_010264225.1|  PREDICTED: adenine phosphoribosyltransferase...    315   5e-104   
ref|XP_009340909.1|  PREDICTED: adenine phosphoribosyltransferase 3     315   6e-104   
ref|XP_004245742.1|  PREDICTED: adenine phosphoribosyltransferase 4     315   6e-104   
ref|XP_003550899.1|  PREDICTED: adenine phosphoribosyltransferase...    315   6e-104   
gb|KHN42708.1|  Adenine phosphoribosyltransferase 1, chloroplastic      314   8e-104   
ref|XP_006440356.1|  hypothetical protein CICLE_v10022476mg             314   1e-103   
gb|KGN55891.1|  hypothetical protein Csa_3G033230                       316   1e-103   
ref|XP_009376028.1|  PREDICTED: adenine phosphoribosyltransferase...    313   2e-103   
gb|KHN09793.1|  Adenine phosphoribosyltransferase 1, chloroplastic      313   3e-103   
ref|XP_007209667.1|  hypothetical protein PRUPE_ppa012146mg             313   3e-103   
ref|XP_008346604.1|  PREDICTED: adenine phosphoribosyltransferase...    313   4e-103   
ref|XP_002529782.1|  Adenine phosphoribosyltransferase, putative        313   7e-103   Ricinus communis
ref|XP_004298655.1|  PREDICTED: adenine phosphoribosyltransferase...    311   2e-102   
ref|XP_008437119.1|  PREDICTED: adenine phosphoribosyltransferase...    310   3e-102   
ref|XP_008381154.1|  PREDICTED: adenine phosphoribosyltransferase...    310   3e-102   
ref|XP_003611278.1|  Adenine phosphoribosyltransferase-like protein     310   4e-102   
ref|XP_008786997.1|  PREDICTED: adenine phosphoribosyltransferase 1     308   2e-101   
ref|XP_004150643.1|  PREDICTED: adenine phosphoribosyltransferase...    308   3e-101   
ref|XP_010919499.1|  PREDICTED: adenine phosphoribosyltransferase...    308   3e-101   
ref|XP_010093697.1|  Adenine phosphoribosyltransferase 1                308   4e-101   
ref|XP_008796830.1|  PREDICTED: adenine phosphoribosyltransferase...    307   5e-101   
ref|XP_004147592.1|  PREDICTED: adenine phosphoribosyltransferase...    307   5e-101   
ref|XP_010676164.1|  PREDICTED: adenine phosphoribosyltransferase 3     307   5e-101   
ref|XP_008448875.1|  PREDICTED: adenine phosphoribosyltransferase 1     307   6e-101   
ref|XP_010933699.1|  PREDICTED: adenine phosphoribosyltransferase...    305   3e-100   
ref|XP_010055519.1|  PREDICTED: adenine phosphoribosyltransferase...    300   3e-98    
ref|XP_009411555.1|  PREDICTED: adenine phosphoribosyltransferase...    300   6e-98    
ref|XP_010539719.1|  PREDICTED: adenine phosphoribosyltransferase...    299   1e-97    
ref|XP_009388017.1|  PREDICTED: adenine phosphoribosyltransferase...    298   2e-97    
ref|XP_010439313.1|  PREDICTED: adenine phosphoribosyltransferase 3     298   2e-97    
ref|XP_008356523.1|  PREDICTED: adenine phosphoribosyltransferase...    298   2e-97    
ref|XP_006288749.1|  hypothetical protein CARUB_v10002066mg             298   2e-97    
ref|XP_009382402.1|  PREDICTED: adenine phosphoribosyltransferase...    298   3e-97    
ref|XP_011018282.1|  PREDICTED: adenine phosphoribosyltransferase...    298   4e-97    
ref|NP_192981.1|  adenine phosphoribosyl transferase 4                  297   4e-97    Arabidopsis thaliana [mouse-ear cress]
emb|CDX94098.1|  BnaC07g37320D                                          297   5e-97    
ref|XP_009137262.1|  PREDICTED: adenine phosphoribosyltransferase...    297   6e-97    
ref|XP_006284605.1|  hypothetical protein CARUB_v10005836mg             297   7e-97    
ref|NP_001059653.1|  Os07g0484800                                       296   8e-97    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010455686.1|  PREDICTED: adenine phosphoribosyltransferase 4     295   3e-96    
ref|XP_010448870.1|  PREDICTED: adenine phosphoribosyltransferase...    295   3e-96    
ref|XP_006413645.1|  hypothetical protein EUTSA_v10026345mg             295   4e-96    
ref|NP_193988.1|  adenine phosphoribosyl transferase 3                  295   5e-96    Arabidopsis thaliana [mouse-ear cress]
gb|KFK28814.1|  hypothetical protein AALP_AA7G052500                    295   5e-96    
gb|AAM61081.1|  adenine phosphoribosyltransferase (EC 2.4.2.7)-li...    294   1e-95    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010422208.1|  PREDICTED: adenine phosphoribosyltransferase...    293   1e-95    
ref|NP_001235110.1|  uncharacterized protein LOC100526858               293   1e-95    
ref|XP_009389092.1|  PREDICTED: adenine phosphoribosyltransferase...    293   3e-95    
ref|XP_006657702.1|  PREDICTED: adenine phosphoribosyltransferase...    293   4e-95    
ref|XP_010433437.1|  PREDICTED: adenine phosphoribosyltransferase...    292   5e-95    
ref|XP_009137261.1|  PREDICTED: adenine phosphoribosyltransferase...    291   2e-94    
gb|KFK31977.1|  hypothetical protein AALP_AA6G184400                    288   1e-93    
ref|XP_009407806.1|  PREDICTED: adenine phosphoribosyltransferase...    288   2e-93    
gb|EEE67177.1|  hypothetical protein OsJ_24266                          288   5e-93    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004238096.2|  PREDICTED: adenine phosphoribosyltransferase...    286   6e-93    
ref|XP_006413644.1|  hypothetical protein EUTSA_v10026345mg             286   6e-93    
gb|EEC82040.1|  hypothetical protein OsI_26014                          286   2e-92    Oryza sativa Indica Group [Indian rice]
ref|XP_006433626.1|  hypothetical protein CICLE_v10002024mg             289   2e-92    
ref|XP_010422209.1|  PREDICTED: adenine phosphoribosyltransferase...    285   3e-92    
ref|XP_006472289.1|  PREDICTED: adenine phosphoribosyltransferase...    288   3e-92    
gb|KDP41633.1|  hypothetical protein JCGZ_16040                         287   3e-92    
ref|XP_010091232.1|  Adenine phosphoribosyltransferase 1                287   5e-92    
ref|XP_008377969.1|  PREDICTED: adenine phosphoribosyltransferase...    286   8e-92    
gb|ABK24246.1|  unknown                                                 284   9e-92    Picea sitchensis
ref|XP_010433445.1|  PREDICTED: adenine phosphoribosyltransferase...    283   1e-91    
ref|XP_002285252.1|  PREDICTED: adenine phosphoribosyltransferase...    283   1e-91    Vitis vinifera
ref|XP_006362057.1|  PREDICTED: adenine phosphoribosyltransferase...    286   1e-91    
ref|XP_008444567.1|  PREDICTED: adenine phosphoribosyltransferase...    283   2e-91    
gb|ABK26880.1|  unknown                                                 283   2e-91    Picea sitchensis
gb|ADD09567.1|  adeninephosphoribosyl transferase                       283   2e-91    Trifolium repens [creeping white clover]
gb|AFK48306.1|  unknown                                                 283   3e-91    
ref|XP_010546549.1|  PREDICTED: adenine phosphoribosyltransferase...    283   3e-91    
gb|ABK24001.1|  unknown                                                 282   3e-91    Picea sitchensis
ref|XP_008444565.1|  PREDICTED: adenine phosphoribosyltransferase...    285   3e-91    
ref|XP_007226017.1|  hypothetical protein PRUPE_ppa010396mg             285   4e-91    
ref|XP_009354103.1|  PREDICTED: LOW QUALITY PROTEIN: adenine phos...    284   4e-91    
ref|XP_008220317.1|  PREDICTED: adenine phosphoribosyltransferase...    284   5e-91    
ref|XP_011039673.1|  PREDICTED: adenine phosphoribosyltransferase...    281   9e-91    
ref|XP_002510107.1|  Adenine phosphoribosyltransferase, putative        284   1e-90    Ricinus communis
gb|KHG27880.1|  Adenine phosphoribosyltransferase 1, chloroplasti...    283   1e-90    
ref|XP_006368185.1|  hypothetical protein POPTR_0001s00360g             280   1e-90    
ref|XP_010272349.1|  PREDICTED: adenine phosphoribosyltransferase...    281   1e-90    
ref|XP_002308672.1|  adenine phosphoribosyltransferase 2 family p...    281   1e-90    Populus trichocarpa [western balsam poplar]
ref|XP_004501529.1|  PREDICTED: adenine phosphoribosyltransferase...    283   1e-90    
gb|ABB86271.1|  adenine phosphoribosyltransferase-like                  281   1e-90    Solanum tuberosum [potatoes]
ref|XP_008445234.1|  PREDICTED: adenine phosphoribosyltransferase...    281   2e-90    
ref|XP_004138720.1|  PREDICTED: adenine phosphoribosyltransferase...    281   2e-90    
ref|XP_004963031.1|  PREDICTED: adenine phosphoribosyltransferase...    283   2e-90    
ref|XP_007018522.1|  Adenine phosphoribosyl transferase 1 isoform 1     283   2e-90    
ref|XP_010919500.1|  PREDICTED: adenine phosphoribosyltransferase...    280   2e-90    
ref|XP_004142889.1|  PREDICTED: adenine phosphoribosyltransferase...    283   3e-90    
ref|XP_010241565.1|  PREDICTED: adenine phosphoribosyltransferase...    280   3e-90    
ref|XP_010999861.1|  PREDICTED: adenine phosphoribosyltransferase...    282   3e-90    
gb|AID51452.1|  adenine phosphoribosyl transferase                      282   4e-90    
ref|XP_010250184.1|  PREDICTED: adenine phosphoribosyltransferase 5     280   5e-90    
ref|XP_008792565.1|  PREDICTED: adenine phosphoribosyltransferase...    281   5e-90    
tpg|DAA55001.1|  TPA: adenine phosphoribosyltransferase 1               281   6e-90    
ref|XP_002443459.1|  hypothetical protein SORBIDRAFT_08g019790          281   7e-90    Sorghum bicolor [broomcorn]
gb|ACF84896.1|  unknown                                                 279   8e-90    Zea mays [maize]
ref|XP_006841148.1|  hypothetical protein AMTR_s00086p00140110          278   9e-90    
ref|XP_008219511.1|  PREDICTED: adenine phosphoribosyltransferase...    279   1e-89    
gb|KHG06934.1|  Adenine phosphoribosyltransferase 2 -like protein       279   1e-89    
ref|XP_007223517.1|  hypothetical protein PRUPE_ppa011918mg             278   1e-89    
ref|XP_004501528.1|  PREDICTED: adenine phosphoribosyltransferase...    280   2e-89    
emb|CBI36342.3|  unnamed protein product                                278   2e-89    
ref|XP_002265016.1|  PREDICTED: adenine phosphoribosyltransferase 5     278   2e-89    Vitis vinifera
ref|XP_004290961.1|  PREDICTED: adenine phosphoribosyltransferase...    281   2e-89    
ref|XP_006413643.1|  hypothetical protein EUTSA_v10026345mg             277   2e-89    
ref|XP_006374831.1|  hypothetical protein POPTR_0014s01740g             278   2e-89    
ref|XP_002320694.1|  adenine phosphoribosyltransferase 1 family p...    280   3e-89    Populus trichocarpa [western balsam poplar]
ref|XP_009787204.1|  PREDICTED: adenine phosphoribosyltransferase...    280   3e-89    
gb|EYU36373.1|  hypothetical protein MIMGU_mgv1a012117mg                280   3e-89    
ref|XP_008378385.1|  PREDICTED: adenine phosphoribosyltransferase...    278   4e-89    
ref|XP_007226016.1|  hypothetical protein PRUPE_ppa010396mg             277   4e-89    
ref|XP_010556446.1|  PREDICTED: adenine phosphoribosyltransferase...    277   4e-89    
ref|XP_008378386.1|  PREDICTED: adenine phosphoribosyltransferase...    278   6e-89    
ref|NP_001148948.1|  LOC100282568                                       276   7e-89    Zea mays [maize]
gb|AHB86969.1|  adenine phosphoribosyltransferase                       276   7e-89    
ref|XP_009354102.1|  PREDICTED: adenine phosphoribosyltransferase...    277   7e-89    
gb|AFK39608.1|  unknown                                                 276   8e-89    
ref|XP_002517658.1|  Adenine phosphoribosyltransferase, putative        276   9e-89    Ricinus communis
ref|XP_008393742.1|  PREDICTED: adenine phosphoribosyltransferase...    278   1e-88    
ref|XP_011036576.1|  PREDICTED: adenine phosphoribosyltransferase 5     276   1e-88    
ref|XP_009629597.1|  PREDICTED: adenine phosphoribosyltransferase...    275   2e-88    
ref|XP_002324303.1|  adenine phosphoribosyltransferase 2 family p...    276   2e-88    Populus trichocarpa [western balsam poplar]
ref|XP_008394106.1|  PREDICTED: adenine phosphoribosyltransferase...    275   2e-88    
ref|XP_009355759.1|  PREDICTED: adenine phosphoribosyltransferase...    275   2e-88    
ref|XP_009346190.1|  PREDICTED: adenine phosphoribosyltransferase...    275   2e-88    
ref|XP_010907390.1|  PREDICTED: adenine phosphoribosyltransferase...    276   3e-88    
ref|XP_002515495.1|  Adenine phosphoribosyltransferase, putative        276   3e-88    Ricinus communis
ref|XP_007023255.1|  Adenine phosphoribosyl transferase 2 isoform 1     275   5e-88    
emb|CDO98165.1|  unnamed protein product                                274   6e-88    
emb|CDY11808.1|  BnaC03g57700D                                          276   8e-88    
ref|XP_009109802.1|  PREDICTED: adenine phosphoribosyltransferase...    275   1e-87    
ref|NP_001151512.1|  LOC100285146                                       273   1e-87    Zea mays [maize]
ref|XP_007136748.1|  hypothetical protein PHAVU_009G070900g             275   1e-87    
gb|KHG11428.1|  Adenine phosphoribosyltransferase 2 -like protein       275   1e-87    
ref|XP_009611592.1|  PREDICTED: adenine phosphoribosyltransferase...    273   1e-87    
ref|XP_009109803.1|  PREDICTED: adenine phosphoribosyltransferase...    275   1e-87    
ref|XP_009788183.1|  PREDICTED: adenine phosphoribosyltransferase...    273   2e-87    
gb|KDP37067.1|  hypothetical protein JCGZ_06123                         273   2e-87    
emb|CDY56189.1|  BnaC05g51080D                                          273   2e-87    
gb|KEH31657.1|  adenine phosphoribosyltransferase-like protein          272   2e-87    
ref|XP_011074363.1|  PREDICTED: adenine phosphoribosyltransferase...    275   3e-87    
ref|XP_008785773.1|  PREDICTED: adenine phosphoribosyltransferase...    272   3e-87    
ref|XP_007137006.1|  hypothetical protein PHAVU_009G092200g             273   3e-87    
ref|XP_010460503.1|  PREDICTED: adenine phosphoribosyltransferase...    275   3e-87    
gb|KFK28982.1|  hypothetical protein AALP_AA7G073200                    274   3e-87    
ref|XP_009399108.1|  PREDICTED: adenine phosphoribosyltransferase...    272   4e-87    
ref|XP_010688209.1|  PREDICTED: adenine phosphoribosyltransferase...    275   5e-87    
ref|XP_009360540.1|  PREDICTED: adenine phosphoribosyltransferase...    274   6e-87    
ref|XP_010933700.1|  PREDICTED: adenine phosphoribosyltransferase...    270   6e-87    
ref|XP_009113762.1|  PREDICTED: adenine phosphoribosyltransferase...    271   6e-87    
gb|KCW71999.1|  hypothetical protein EUGRSUZ_E00451                     271   7e-87    
ref|XP_006303303.1|  hypothetical protein CARUB_v10010115mg             273   8e-87    
ref|XP_006303304.1|  hypothetical protein CARUB_v10010115mg             273   1e-86    
ref|XP_010911922.1|  PREDICTED: adenine phosphoribosyltransferase...    271   1e-86    
ref|XP_010460504.1|  PREDICTED: adenine phosphoribosyltransferase...    273   1e-86    
ref|XP_006415758.1|  hypothetical protein EUTSA_v10008627mg             270   2e-86    
ref|XP_010499225.1|  PREDICTED: adenine phosphoribosyltransferase...    272   2e-86    
ref|XP_010478084.1|  PREDICTED: adenine phosphoribosyltransferase...    272   2e-86    
ref|XP_010499224.1|  PREDICTED: adenine phosphoribosyltransferase...    272   2e-86    
ref|XP_010061685.1|  PREDICTED: adenine phosphoribosyltransferase 1     273   2e-86    
gb|AAP85303.1|  adenine phosphoribosyltransferase                       270   3e-86    Brassica napus [oilseed rape]
ref|XP_002890728.1|  hypothetical protein ARALYDRAFT_472949             272   3e-86    
ref|XP_007023256.1|  Adenine phosphoribosyl transferase 2 isoform 2     271   3e-86    
gb|KCW68663.1|  hypothetical protein EUGRSUZ_F02260                     270   3e-86    
ref|XP_004291447.1|  PREDICTED: adenine phosphoribosyltransferase...    270   3e-86    
ref|XP_006415759.1|  hypothetical protein EUTSA_v10008627mg             271   4e-86    
ref|XP_006450395.1|  hypothetical protein CICLE_v10009485mg             270   4e-86    
ref|XP_008219510.1|  PREDICTED: adenine phosphoribosyltransferase...    270   5e-86    
ref|NP_849714.1|  adenine phosphoribosyl transferase 1                  269   6e-86    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001053244.1|  Os04g0504000                                       270   6e-86    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003525929.1|  PREDICTED: adenine phosphoribosyltransferase...    270   7e-86    
emb|CDX90088.1|  BnaA08g18960D                                          271   8e-86    
ref|NP_564284.1|  adenine phosphoribosyl transferase 1                  271   8e-86    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001237718.1|  uncharacterized protein LOC100499904               269   1e-85    
ref|XP_007011830.1|  Adenine phosphoribosyltransferase 5 isoform 1      268   1e-85    
sp|Q43199.1|APT1_WHEAT  RecName: Full=Adenine phosphoribosyltrans...    268   2e-85    Triticum aestivum [Canadian hard winter wheat]
emb|CDP01209.1|  unnamed protein product                                268   2e-85    
dbj|BAB08003.1|  Adenine phosphoribosyltransferase                      267   2e-85    Hordeum vulgare [barley]
ref|XP_010696453.1|  PREDICTED: adenine phosphoribosyltransferase 5     268   3e-85    
ref|XP_003575349.1|  PREDICTED: adenine phosphoribosyltransferase...    269   3e-85    
dbj|BAK06072.1|  predicted protein                                      268   3e-85    
gb|EAY94764.1|  hypothetical protein OsI_16544                          268   3e-85    Oryza sativa Indica Group [Indian rice]
ref|XP_006664692.1|  PREDICTED: uncharacterized protein LOC102699275    274   4e-85    
ref|XP_004501526.1|  PREDICTED: adenine phosphoribosyltransferase...    269   4e-85    
gb|EAY83709.1|  hypothetical protein OsI_38931                          266   5e-85    Oryza sativa Indica Group [Indian rice]
gb|KHN07067.1|  Adenine phosphoribosyltransferase 2                     267   7e-85    
gb|AEC10980.1|  adenine phosphoribosyltransferase                       266   8e-85    
dbj|BAJ91692.1|  predicted protein                                      267   1e-84    
dbj|BAJ97272.1|  predicted protein                                      267   1e-84    
gb|AFK34858.1|  unknown                                                 265   2e-84    
gb|KHN04446.1|  Adenine phosphoribosyltransferase 1, chloroplastic      267   2e-84    
ref|NP_001242331.1|  uncharacterized protein LOC100810609               265   3e-84    
ref|XP_003578157.1|  PREDICTED: adenine phosphoribosyltransferase 1     266   3e-84    
ref|XP_010048954.1|  PREDICTED: adenine phosphoribosyltransferase...    265   4e-84    
ref|XP_002285191.1|  PREDICTED: adenine phosphoribosyltransferase 5     265   4e-84    Vitis vinifera
ref|NP_178122.1|  adenine phosphoribosyl transferase 2                  265   4e-84    Arabidopsis thaliana [mouse-ear cress]
ref|NP_196677.1|  adenine phosphoribosyltransferase 5                   264   5e-84    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010240093.1|  PREDICTED: adenine phosphoribosyltransferase...    265   5e-84    
ref|XP_006652485.1|  PREDICTED: adenine phosphoribosyltransferase...    265   5e-84    
gb|EAZ21049.1|  hypothetical protein OsJ_36694                          264   6e-84    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001236749.1|  uncharacterized protein LOC100305792               266   6e-84    
ref|XP_010541605.1|  PREDICTED: adenine phosphoribosyltransferase...    264   8e-84    
emb|CAA65610.1|  adenine phosphoribosyltransferase                      264   8e-84    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006450396.1|  hypothetical protein CICLE_v10009485mg             263   1e-83    
emb|CDP13534.1|  unnamed protein product                                263   1e-83    
ref|XP_010241566.1|  PREDICTED: adenine phosphoribosyltransferase...    263   1e-83    
emb|CAN64503.1|  hypothetical protein VITISV_016996                     266   2e-83    Vitis vinifera
ref|XP_006826704.1|  hypothetical protein AMTR_s00137p00101330          263   2e-83    
ref|XP_004976147.1|  PREDICTED: adenine phosphoribosyltransferase...    264   2e-83    
ref|XP_004953097.1|  PREDICTED: adenine phosphoribosyltransferase...    264   2e-83    
ref|XP_004172405.1|  PREDICTED: adenine phosphoribosyltransferase...    261   2e-83    
ref|XP_010539727.1|  PREDICTED: adenine phosphoribosyltransferase...    262   2e-83    
ref|XP_010430019.1|  PREDICTED: adenine phosphoribosyltransferase 2     263   2e-83    
ref|XP_004501527.1|  PREDICTED: adenine phosphoribosyltransferase...    265   2e-83    
ref|XP_008676904.1|  PREDICTED: uncharacterized protein LOC100275...    263   3e-83    
ref|NP_001047421.1|  Os02g0613900                                       263   3e-83    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002446754.1|  hypothetical protein SORBIDRAFT_06g021810          263   3e-83    Sorghum bicolor [broomcorn]
gb|ABB69070.1|  adenine phosphoribosyltransferase                       262   3e-83    Ceratodon purpureus
ref|XP_010417755.1|  PREDICTED: adenine phosphoribosyltransferase...    262   3e-83    
dbj|BAD19719.1|  putative adenine phosphoribosyltransferase form 2      264   4e-83    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010472994.1|  PREDICTED: adenine phosphoribosyltransferase...    262   4e-83    
ref|XP_001769439.1|  predicted protein                                  261   6e-83    
ref|XP_003603366.1|  Adenine phosphoribosyltransferase                  261   7e-83    
gb|ABK23131.1|  unknown                                                 265   8e-83    Picea sitchensis
ref|XP_004501525.1|  PREDICTED: adenine phosphoribosyltransferase...    264   9e-83    
ref|XP_009104443.1|  PREDICTED: adenine phosphoribosyltransferase 2     261   9e-83    
gb|AES73617.2|  adenine phosphoribosyltransferase-like protein          261   1e-82    
ref|NP_001067164.1|  Os12g0589100                                       262   1e-82    Oryza sativa Japonica Group [Japonica rice]
emb|CDY67125.1|  BnaCnng53700D                                          260   2e-82    
emb|CDX97085.1|  BnaC09g45400D                                          260   2e-82    
gb|ACG43027.1|  adenine phosphoribosyltransferase 2                     261   2e-82    Zea mays [maize]
ref|XP_006399616.1|  hypothetical protein EUTSA_v10014752mg             259   4e-82    
emb|CDX69780.1|  BnaA10g21290D                                          259   4e-82    
gb|AFK39802.1|  unknown                                                 259   4e-82    
ref|XP_010519949.1|  PREDICTED: adenine phosphoribosyltransferase...    259   5e-82    
emb|CDY51110.1|  BnaCnng20130D                                          259   5e-82    
ref|XP_007209666.1|  hypothetical protein PRUPE_ppa012146mg             258   5e-82    
ref|XP_002887848.1|  hypothetical protein ARALYDRAFT_895993             259   6e-82    
ref|XP_011081440.1|  PREDICTED: adenine phosphoribosyltransferase...    259   6e-82    
ref|XP_010090622.1|  Adenine phosphoribosyltransferase 2                259   7e-82    
ref|XP_010491811.1|  PREDICTED: adenine phosphoribosyltransferase...    258   8e-82    
ref|XP_006288722.1|  hypothetical protein CARUB_v10002033mg             258   9e-82    
ref|XP_010419669.1|  PREDICTED: adenine phosphoribosyltransferase 5     258   1e-81    
dbj|BAK01179.1|  predicted protein                                      259   1e-81    
ref|XP_002452441.1|  hypothetical protein SORBIDRAFT_04g025930          259   1e-81    Sorghum bicolor [broomcorn]
ref|XP_009121988.1|  PREDICTED: adenine phosphoribosyltransferase...    258   1e-81    
gb|AFW72321.1|  adenine phosphoribosyltransferase 2                     259   2e-81    
ref|NP_001149656.1|  adenine phosphoribosyltransferase 2                259   2e-81    Zea mays [maize]
ref|XP_004501346.1|  PREDICTED: adenine phosphoribosyltransferase...    258   2e-81    
ref|XP_009125789.1|  PREDICTED: adenine phosphoribosyltransferase...    258   2e-81    
ref|XP_009413673.1|  PREDICTED: adenine phosphoribosyltransferase...    257   2e-81    
gb|KFK25395.1|  hypothetical protein AALP_AA8G108700                    257   3e-81    
emb|CDY58772.1|  BnaCnng33750D                                          261   4e-81    
ref|XP_003544611.1|  PREDICTED: adenine phosphoribosyltransferase...    256   5e-81    
ref|XP_008668632.1|  PREDICTED: adenine phosphoribosyltransferase...    259   7e-81    
ref|XP_009106769.1|  PREDICTED: adenine phosphoribosyltransferase...    256   7e-81    
emb|CDX87290.1|  BnaA07g35830D                                          259   1e-80    
ref|XP_008668630.1|  PREDICTED: adenine phosphoribosyltransferase...    259   2e-80    
ref|XP_010259006.1|  PREDICTED: adenine phosphoribosyltransferase...    253   2e-80    
gb|EMS65268.1|  Adenine phosphoribosyltransferase 1                     254   3e-80    
ref|XP_010521540.1|  PREDICTED: adenine phosphoribosyltransferase...    254   3e-80    
tpg|DAA37053.1|  TPA: adenine phosphoribosyltransferase 2               260   4e-80    
gb|EYU21661.1|  hypothetical protein MIMGU_mgv1a014541mg                254   5e-80    
ref|XP_003550183.1|  PREDICTED: adenine phosphoribosyltransferase...    253   9e-80    
ref|XP_011081444.1|  PREDICTED: adenine phosphoribosyltransferase...    253   1e-79    
ref|XP_007161200.1|  hypothetical protein PHAVU_001G050500g             253   1e-79    
ref|XP_011073413.1|  PREDICTED: adenine phosphoribosyltransferase 5     253   1e-79    
ref|XP_010063477.1|  PREDICTED: adenine phosphoribosyltransferase...    253   1e-79    
ref|NP_001185104.1|  adenine phosphoribosyl transferase 1               256   2e-79    
ref|XP_008676902.1|  PREDICTED: uncharacterized protein LOC100275...    252   1e-78    
ref|XP_009393731.1|  PREDICTED: adenine phosphoribosyltransferase...    249   2e-78    
emb|CAA77094.1|  MtN30                                                  247   5e-78    
gb|AAF99737.1|AC004557_16  F17L21.24                                    250   5e-78    
gb|KDP33578.1|  hypothetical protein JCGZ_07149                         248   9e-78    
gb|AFK44053.1|  unknown                                                 245   3e-77    
emb|CAE02939.3|  OSJNBa0014K14.11                                       253   9e-77    
ref|XP_006450397.1|  hypothetical protein CICLE_v10009485mg             246   1e-76    
gb|KCW68661.1|  hypothetical protein EUGRSUZ_F02260                     247   1e-76    
gb|EMT09096.1|  Adenine phosphoribosyltransferase 2                     245   2e-76    
ref|XP_008676905.1|  PREDICTED: uncharacterized protein LOC100275...    244   3e-76    
gb|EPS67728.1|  hypothetical protein M569_07048                         244   4e-76    
ref|XP_009611593.1|  PREDICTED: adenine phosphoribosyltransferase...    243   4e-76    
gb|AAP81746.1|  adenine phosphoribosyltransferase                       245   4e-76    
ref|XP_006601159.1|  PREDICTED: adenine phosphoribosyltransferase...    244   4e-76    
ref|XP_003603367.1|  Adenine phosphoribosyltransferase                  243   4e-76    
gb|EMS45491.1|  Adenine phosphoribosyltransferase 2                     244   5e-76    
gb|AFK36244.1|  unknown                                                 242   5e-76    
gb|KEH35918.1|  adenine phosphoribosyltransferase-like protein          243   5e-76    
ref|XP_009125788.1|  PREDICTED: adenine phosphoribosyltransferase...    244   9e-76    
gb|EPS58815.1|  hypothetical protein M569_15999                         243   1e-75    
ref|NP_001142731.1|  uncharacterized protein LOC100275070               243   1e-75    
ref|NP_849365.1|  adenine phosphoribosyl transferase 4                  242   2e-75    
gb|ACN39999.1|  unknown                                                 240   4e-75    
ref|NP_001105243.1|  adenine phosphoribosyltransferase1                 242   4e-75    
ref|XP_007011831.1|  Adenine phosphoribosyl transferase 2 isoform 2     242   1e-74    
tpg|DAA37052.1|  TPA: hypothetical protein ZEAMMB73_296476              242   1e-74    
ref|XP_010664522.1|  PREDICTED: adenine phosphoribosyltransferase...    237   5e-74    
ref|XP_006389747.1|  hypothetical protein EUTSA_v10019519mg             238   6e-74    
gb|KDO61778.1|  hypothetical protein CISIN_1g028297mg                   239   8e-74    
ref|XP_006596097.1|  PREDICTED: adenine phosphoribosyltransferase...    236   3e-73    
ref|XP_008668631.1|  PREDICTED: adenine phosphoribosyltransferase...    240   5e-73    
ref|XP_002989535.1|  hypothetical protein SELMODRAFT_428069             235   6e-73    
gb|AFU67074.1|  adenine phosphoribosyl transferase                      234   8e-73    
ref|XP_010541606.1|  PREDICTED: adenine phosphoribosyltransferase...    233   2e-72    
ref|XP_006450394.1|  hypothetical protein CICLE_v10009485mg             233   2e-72    
ref|XP_006596098.1|  PREDICTED: adenine phosphoribosyltransferase...    234   2e-72    
gb|ABA99160.1|  Adenine phosphoribosyltransferase 1, putative           234   3e-72    
ref|XP_006647509.1|  PREDICTED: adenine phosphoribosyltransferase...    233   5e-72    
gb|EMT24642.1|  Adenine phosphoribosyltransferase 1                     233   7e-72    
ref|XP_002964274.1|  hypothetical protein SELMODRAFT_406084             232   8e-72    
ref|XP_008676903.1|  PREDICTED: uncharacterized protein LOC100275...    233   1e-71    
ref|XP_010521541.1|  PREDICTED: adenine phosphoribosyltransferase...    231   2e-71    
emb|CAN74618.1|  hypothetical protein VITISV_026185                     233   3e-71    
ref|XP_010911921.1|  PREDICTED: adenine phosphoribosyltransferase...    231   3e-71    
ref|XP_006579626.1|  PREDICTED: adenine phosphoribosyltransferase...    229   6e-71    
ref|XP_006600832.1|  PREDICTED: adenine phosphoribosyltransferase...    224   7e-69    
ref|XP_010422210.1|  PREDICTED: adenine phosphoribosyltransferase...    223   2e-68    
ref|XP_008238580.1|  PREDICTED: adenine phosphoribosyltransferase...    222   4e-68    
emb|CAN61395.1|  hypothetical protein VITISV_013328                     225   2e-67    
ref|XP_002949638.1|  hypothetical protein VOLCADRAFT_104397             221   3e-67    
gb|KCW71998.1|  hypothetical protein EUGRSUZ_E00451                     218   2e-66    
gb|KDO61777.1|  hypothetical protein CISIN_1g028297mg                   218   2e-66    
gb|EEC73590.1|  hypothetical protein OsI_08056                          218   2e-65    
gb|AFW62964.1|  hypothetical protein ZEAMMB73_860237                    214   7e-65    
gb|AFW62963.1|  hypothetical protein ZEAMMB73_860237                    214   8e-65    
ref|XP_003544612.1|  PREDICTED: adenine phosphoribosyltransferase...    214   9e-65    
gb|KEH35917.1|  adenine phosphoribosyltransferase-like protein          213   4e-64    
ref|XP_005650313.1|  adenine phosphoribosyltransferase                  209   8e-63    
ref|XP_009126870.1|  PREDICTED: adenine phosphoribosyltransferase...    210   9e-63    
ref|XP_006288723.1|  hypothetical protein CARUB_v10002033mg             207   3e-62    
gb|EYU30306.1|  hypothetical protein MIMGU_mgv1a0146722mg               205   6e-62    
tpg|DAA47300.1|  TPA: hypothetical protein ZEAMMB73_040727              205   1e-61    
ref|XP_006600831.1|  PREDICTED: adenine phosphoribosyltransferase...    206   1e-61    
gb|KFM23518.1|  Adenine phosphoribosyltransferase 1                     206   1e-61    
ref|XP_008796829.1|  PREDICTED: adenine phosphoribosyltransferase...    206   5e-61    
ref|XP_005843965.1|  hypothetical protein CHLNCDRAFT_27518              205   3e-60    
ref|XP_008394107.1|  PREDICTED: adenine phosphoribosyltransferase...    202   3e-60    
ref|XP_001691572.1|  hypothetical protein CHLREDRAFT_145209             202   4e-60    
ref|XP_009346191.1|  PREDICTED: adenine phosphoribosyltransferase...    202   4e-60    
ref|XP_009106770.1|  PREDICTED: adenine phosphoribosyltransferase...    202   6e-60    
emb|CDY42182.1|  BnaC03g65030D                                          195   2e-57    
ref|WP_020508417.1|  adenine phosphoribosyltransferase                  191   9e-56    
ref|WP_010572459.1|  adenine phosphoribosyltransferase                  186   8e-54    
ref|WP_004429486.1|  adenine phosphoribosyltransferase                  186   1e-53    
ref|WP_002998961.1|  adenine phosphoribosyltransferase                  186   1e-53    
gb|EAZ23801.1|  hypothetical protein OsJ_07513                          184   1e-53    
ref|WP_026939098.1|  adenine phosphoribosyltransferase                  186   1e-53    
ref|WP_007091598.1|  MULTISPECIES: adenine phosphoribosyltransferase    186   1e-53    
ref|WP_002179923.1|  adenine phosphoribosyltransferase                  186   1e-53    
ref|WP_005354605.1|  adenine phosphoribosyltransferase                  186   1e-53    
ref|WP_002102016.1|  adenine phosphoribosyltransferase                  185   2e-53    
ref|WP_004449699.1|  adenine phosphoribosyltransferase                  185   2e-53    
ref|WP_014190343.1|  adenine phosphoribosyltransferase                  185   2e-53    
ref|WP_027354902.1|  adenine phosphoribosyltransferase                  184   3e-53    
ref|WP_004750155.1|  MULTISPECIES: adenine phosphoribosyltransferase    184   3e-53    
ref|WP_017213376.1|  adenine phosphoribosyltransferase                  184   3e-53    
ref|WP_016760929.1|  adenine phosphoribosyltransferase                  184   3e-53    
ref|WP_002153522.1|  adenine phosphoribosyltransferase                  184   4e-53    
ref|WP_024495683.1|  adenine phosphoribosyltransferase                  184   4e-53    
ref|WP_017808765.1|  adenine phosphoribosyltransferase                  184   4e-53    
ref|WP_005630756.1|  adenine phosphoribosyltransferase                  184   4e-53    
ref|WP_020784920.1|  adenine phosphoribosyltransferase                  184   4e-53    
ref|WP_004759988.1|  adenine phosphoribosyltransferase                  184   4e-53    
ref|WP_004435571.1|  adenine phosphoribosyltransferase                  184   4e-53    
ref|WP_020249673.1|  hypothetical protein                               184   4e-53    
ref|WP_000029425.1|  adenine phosphoribosyltransferase                  184   5e-53    
ref|WP_035497600.1|  adenine phosphoribosyltransferase                  184   5e-53    
ref|WP_010514444.1|  adenine phosphoribosyltransferase                  184   5e-53    
ref|WP_020779412.1|  adenine phosphoribosyltransferase                  184   5e-53    
ref|WP_004500836.1|  MULTISPECIES: adenine phosphoribosyltransferase    184   6e-53    
ref|WP_004425963.1|  adenine phosphoribosyltransferase                  184   7e-53    
ref|WP_005646519.1|  adenine phosphoribosyltransferase                  184   7e-53    
ref|WP_005663528.1|  adenine phosphoribosyltransferase                  184   7e-53    
ref|WP_002762948.1|  adenine phosphoribosyltransferase                  184   7e-53    
ref|WP_036768571.1|  adenine phosphoribosyltransferase                  184   7e-53    
ref|WP_005657614.1|  adenine phosphoribosyltransferase                  184   7e-53    
ref|WP_005650156.1|  adenine phosphoribosyltransferase                  183   9e-53    
ref|WP_005652951.1|  adenine phosphoribosyltransferase                  183   1e-52    
ref|WP_016545639.1|  adenine phosphoribosyltransferase                  183   1e-52    
ref|WP_001329649.1|  adenine phosphoribosyltransferase                  183   1e-52    
ref|WP_018247740.1|  hypothetical protein                               183   1e-52    
gb|EIE01151.1|  adenine phosphoribosyltransferase                       184   1e-52    
ref|WP_009639092.1|  adenine phosphoribosyltransferase                  183   1e-52    
ref|WP_036089889.1|  adenine phosphoribosyltransferase                  183   1e-52    
dbj|BAP89362.1|  adenine phosphoribosyltransferase                      183   1e-52    
ref|WP_014550691.1|  adenine phosphoribosyltransferase                  183   1e-52    
ref|WP_005642172.1|  adenine phosphoribosyltransferase                  182   2e-52    
ref|WP_010579349.1|  adenine phosphoribosyltransferase                  182   2e-52    
ref|WP_020783150.1|  adenine phosphoribosyltransferase                  182   2e-52    
ref|WP_006995861.1|  MULTISPECIES: adenine phosphoribosyltransferase    182   2e-52    
ref|WP_004471439.1|  adenine phosphoribosyltransferase                  182   2e-52    
ref|WP_004459597.1|  MULTISPECIES: adenine phosphoribosyltransferase    182   3e-52    
ref|WP_009500013.1|  adenine phosphoribosyltransferase                  182   3e-52    
gb|AGX32616.1|  adenine phosphoribosyltransferase                       182   3e-52    
ref|WP_007791524.1|  Adenine phosphoribosyltransferase                  182   3e-52    
gb|EMJ99534.1|  adenine phosphoribosyltransferase                       182   3e-52    
ref|WP_011671361.1|  adenine phosphoribosyltransferase                  182   3e-52    
ref|WP_000029426.1|  adenine phosphoribosyltransferase                  182   3e-52    
ref|WP_029030600.1|  adenine phosphoribosyltransferase                  182   3e-52    
ref|WP_023478292.1|  adenine phosphoribosyltransferase                  182   4e-52    
ref|WP_004386902.1|  MULTISPECIES: adenine phosphoribosyltransferase    182   4e-52    
ref|WP_022730527.1|  adenine phosphoribosyltransferase                  181   4e-52    
ref|WP_005638208.1|  adenine phosphoribosyltransferase                  182   4e-52    
ref|WP_038328083.1|  adenine phosphoribosyltransferase                  182   4e-52    
ref|WP_018126397.1|  hypothetical protein                               181   4e-52    
ref|WP_039467293.1|  adenine phosphoribosyltransferase                  181   5e-52    
ref|WP_006562516.1|  adenine phosphoribosyltransferase                  181   5e-52    
ref|WP_028863899.1|  adenine phosphoribosyltransferase                  181   5e-52    
ref|WP_027634073.1|  adenine phosphoribosyltransferase                  181   6e-52    
ref|WP_002726057.1|  MULTISPECIES: adenine phosphoribosyltransferase    181   6e-52    
ref|WP_039056175.1|  adenine phosphoribosyltransferase                  181   7e-52    
dbj|GAL51098.1|  adenine phosphoribosyltransferase                      181   7e-52    
ref|WP_032218179.1|  adenine phosphoribosyltransferase                  181   7e-52    
ref|WP_005628840.1|  adenine phosphoribosyltransferase                  181   7e-52    
ref|WP_005094545.1|  adenine phosphoribosyltransferase                  181   7e-52    
ref|WP_017856276.1|  adenine phosphoribosyltransferase                  181   7e-52    
ref|WP_004467663.1|  adenine phosphoribosyltransferase                  181   8e-52    
ref|WP_011770579.1|  adenine phosphoribosyltransferase                  181   8e-52    
ref|WP_005052987.1|  adenine phosphoribosyltransferase                  181   8e-52    
ref|WP_040090080.1|  adenine phosphoribosyltransferase                  181   9e-52    
ref|WP_001309305.1|  adenine phosphoribosyltransferase                  181   9e-52    
ref|WP_025120381.1|  MULTISPECIES: adenine phosphoribosyltransferase    181   1e-51    
gb|KHO52937.1|  Adenine phosphoribosyltransferase                       180   1e-51    
ref|WP_005695747.1|  adenine phosphoribosyltransferase                  181   1e-51    
ref|WP_032259259.1|  adenine phosphoribosyltransferase                  181   1e-51    
ref|WP_002431408.1|  adenine phosphoribosyltransferase                  181   1e-51    
ref|WP_027712809.1|  adenine phosphoribosyltransferase                  180   1e-51    
ref|WP_035385000.1|  adenine phosphoribosyltransferase                  181   1e-51    
ref|WP_000127356.1|  MULTISPECIES: adenine phosphoribosyltransferase    180   1e-51    
gb|AHA63411.1|  Adenine phosphoribosyltransferase                       181   1e-51    
ref|WP_039671409.1|  adenine phosphoribosyltransferase                  180   1e-51    
ref|WP_021180126.1|  Adenine phosphoribosyltransferase                  180   1e-51    
ref|WP_007706173.1|  MULTISPECIES: Adenine phosphoribosyltransferase    180   1e-51    
ref|WP_024913910.1|  adenine phosphoribosyltransferase                  180   1e-51    
ref|WP_001301904.1|  adenine phosphoribosyltransferase                  180   1e-51    
ref|WP_012764640.1|  MULTISPECIES: adenine phosphoribosyltransferase    180   1e-51    
ref|WP_000621283.1|  adenine phosphoribosyltransferase                  181   1e-51    
ref|WP_024254854.1|  adenine phosphoribosyltransferase                  180   1e-51    
ref|WP_019614133.1|  adenine phosphoribosyltransferase                  180   1e-51    
ref|WP_005634802.1|  adenine phosphoribosyltransferase                  180   2e-51    
ref|WP_039263965.1|  adenine phosphoribosyltransferase                  180   2e-51    
ref|WP_007673642.1|  Adenine phosphoribosyltransferase                  180   2e-51    
ref|WP_015835508.1|  adenine phosphoribosyltransferase                  181   2e-51    
ref|WP_034945403.1|  adenine phosphoribosyltransferase                  180   2e-51    
ref|WP_016238288.1|  adenine phosphoribosyltransferase                  180   2e-51    
ref|WP_039258683.1|  adenine phosphoribosyltransferase                  180   2e-51    
ref|WP_005300263.1|  adenine phosphoribosyltransferase                  180   2e-51    
ref|WP_032331023.1|  adenine phosphoribosyltransferase                  180   2e-51    
ref|WP_021516962.1|  adenine phosphoribosyltransferase                  180   2e-51    
ref|WP_005659655.1|  adenine phosphoribosyltransferase                  180   2e-51    
ref|WP_032200718.1|  adenine phosphoribosyltransferase                  180   2e-51    
ref|WP_038354584.1|  adenine phosphoribosyltransferase                  180   2e-51    
ref|WP_012904876.1|  adenine phosphoribosyltransferase                  180   2e-51    
pdb|2DY0|A  Chain A, Crystal Structure Of Project Jw0458 From Esc...    180   2e-51    
gb|KGD90805.1|  adenine phosphoribosyltransferase                       180   2e-51    
ref|WP_000127359.1|  MULTISPECIES: adenine phosphoribosyltransferase    180   2e-51    
ref|WP_014168911.1|  adenine phosphoribosyltransferase                  180   2e-51    
ref|WP_037425226.1|  adenine phosphoribosyltransferase                  180   2e-51    
ref|XP_003494807.1|  PREDICTED: esterase ybfF-like                      187   2e-51    
ref|WP_034889616.1|  adenine phosphoribosyltransferase                  180   2e-51    
ref|WP_013396713.1|  adenine phosphoribosyltransferase                  180   2e-51    
ref|WP_028012195.1|  adenine phosphoribosyltransferase                  180   2e-51    
ref|WP_011110826.1|  adenine phosphoribosyltransferase                  179   2e-51    
ref|WP_001538654.1|  adenine phosphoribosyltransferase                  180   2e-51    
ref|WP_001526710.1|  adenine phosphoribosyltransferase                  180   2e-51    
ref|WP_021544809.1|  adenine phosphoribosyltransferase                  180   2e-51    
ref|WP_010428187.1|  MULTISPECIES: adenine phosphoribosyltransferase    179   3e-51    
ref|WP_015249609.1|  adenine phosphoribosyltransferase                  179   3e-51    
gb|KGY27947.1|  adenine phosphoribosyltransferase                       179   3e-51    
ref|WP_039104728.1|  adenine phosphoribosyltransferase                  179   3e-51    
ref|WP_011235082.1|  adenine phosphoribosyltransferase                  179   3e-51    
ref|WP_011866034.1|  adenine phosphoribosyltransferase                  180   3e-51    
ref|WP_032638554.1|  adenine phosphoribosyltransferase                  179   3e-51    
ref|WP_010368992.1|  MULTISPECIES: adenine phosphoribosyltransferase    179   3e-51    
ref|WP_001489630.1|  adenine phosphoribosyltransferase                  179   3e-51    
ref|WP_017891861.1|  adenine phosphoribosyltransferase                  179   3e-51    



>ref|XP_007157336.1| hypothetical protein PHAVU_002G061600g [Phaseolus vulgaris]
 gb|ESW29330.1| hypothetical protein PHAVU_002G061600g [Phaseolus vulgaris]
Length=230

 Score =   334 bits (856),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 168/207 (81%), Positives = 185/207 (89%), Gaps = 3/207 (1%)
 Frame = -2

Query  934  FSFLSAFHLLSITLLSFFLHFTRQCRTMSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQD  755
            FSFL +F +L  TLL   L     C TMSA+++ DPR+ GI+++IRVVP+FPK GIMFQD
Sbjct  23   FSFLCSFPILPCTLLK--LTSPLIC-TMSAYKDQDPRLHGIKTKIRVVPNFPKSGIMFQD  79

Query  754  ITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIEARGFIFGPSIALAIGAKFVPLRKPKK  575
            ITTLLLDPKAFKDTIDLFVERYKGKNIS+VAGIEARGFIFGP IALAIGAKFVPLRKPKK
Sbjct  80   ITTLLLDPKAFKDTIDLFVERYKGKNISVVAGIEARGFIFGPPIALAIGAKFVPLRKPKK  139

Query  574  LPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALVVDDLIATGGTLCAAMDLLERAGAEVV  395
            LPGKVI QEY LEYG DC+EMHVGAVE G+RALVVDDLIATGGTLCAAMDLLER GAEVV
Sbjct  140  LPGKVISQEYILEYGRDCIEMHVGAVEPGERALVVDDLIATGGTLCAAMDLLERVGAEVV  199

Query  394  ECACVIEIPDLKGQERLNGKPLYVLVQ  314
            ECACVIE+P+LKG+ERLNGKPLYVLV+
Sbjct  200  ECACVIELPELKGRERLNGKPLYVLVE  226



>gb|KDP25639.1| hypothetical protein JCGZ_20795 [Jatropha curcas]
Length=182

 Score =   329 bits (843),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 159/180 (88%), Positives = 175/180 (97%), Gaps = 0/180 (0%)
 Frame = -2

Query  853  MSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI  674
            MSA+R++DPRI GIQ++IRVVP+FPK GIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI
Sbjct  1    MSAYRDEDPRIHGIQTKIRVVPNFPKEGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI  60

Query  673  SIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVE  494
            S+VAGIEARGFIFGP IALAIGAKFVPLRKPKKLPG+VIR++Y LEYGSDCLEMHVGAV+
Sbjct  61   SVVAGIEARGFIFGPPIALAIGAKFVPLRKPKKLPGEVIREQYVLEYGSDCLEMHVGAVK  120

Query  493  AGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
             G+RALVVDDLIATGGTLCAAM+LLERAGAEVVECACVIE+PDLKG+ERLNGKPLYVLV+
Sbjct  121  TGERALVVDDLIATGGTLCAAMNLLERAGAEVVECACVIELPDLKGRERLNGKPLYVLVE  180



>ref|XP_009611023.1| PREDICTED: adenine phosphoribosyltransferase 3 [Nicotiana tomentosiformis]
Length=182

 Score =   327 bits (837),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 161/182 (88%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = -2

Query  853  MSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI  674
            MSA ++ DPRI  IQSRIRVVP FPKPGIMFQDITTLLLDPKAFKDTIDLFVERYK KNI
Sbjct  1    MSACKDQDPRIHAIQSRIRVVPDFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKSKNI  60

Query  673  SIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVE  494
            S+VAGIEARGFIFGP IALAIGAKFVPLRKP KLPGKV +QEYDLEYGSDCLEMH+GAVE
Sbjct  61   SVVAGIEARGFIFGPPIALAIGAKFVPLRKPNKLPGKVFKQEYDLEYGSDCLEMHIGAVE  120

Query  493  AGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
            AG+RALVVDDLIATGGTL AAMDLLERAGAEVVECACVIEIPDLKG+E+LNGKPLYVLV+
Sbjct  121  AGERALVVDDLIATGGTLRAAMDLLERAGAEVVECACVIEIPDLKGKEQLNGKPLYVLVE  180

Query  313  EK  308
             +
Sbjct  181  SQ  182



>ref|XP_011081216.1| PREDICTED: adenine phosphoribosyltransferase 4 [Sesamum indicum]
Length=182

 Score =   325 bits (834),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 168/182 (92%), Gaps = 0/182 (0%)
 Frame = -2

Query  853  MSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI  674
            MS  + DDPRI  IQSRIRVVP+FPKPGIMFQDITTLLLDPK FKDTIDLFVERYK KNI
Sbjct  1    MSVLKADDPRIPAIQSRIRVVPNFPKPGIMFQDITTLLLDPKVFKDTIDLFVERYKSKNI  60

Query  673  SIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVE  494
            S+VAG+EARGFIFGP IALAIGAKFVPLRKPKKLPGKV RQEYDLEYGSDCLEMHVGAV 
Sbjct  61   SVVAGVEARGFIFGPPIALAIGAKFVPLRKPKKLPGKVFRQEYDLEYGSDCLEMHVGAVA  120

Query  493  AGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
             G+RALVVDDLIATGGTLCAAMDLLERAGAEV+ECACVIEIP LKG+ERLNGKP+YVLV 
Sbjct  121  PGERALVVDDLIATGGTLCAAMDLLERAGAEVLECACVIEIPALKGRERLNGKPVYVLVD  180

Query  313  EK  308
             +
Sbjct  181  SQ  182



>ref|XP_007039902.1| Adenine phosphoribosyl transferase 4 [Theobroma cacao]
 gb|EOY24403.1| Adenine phosphoribosyl transferase 4 [Theobroma cacao]
Length=182

 Score =   324 bits (831),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 170/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  853  MSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI  674
            MSA+R+ DPRI GIQS+IRVVP FPKPGIMFQDITTLLLDPKAFKDT+DLFVERYKGKNI
Sbjct  1    MSAYRDKDPRIHGIQSKIRVVPDFPKPGIMFQDITTLLLDPKAFKDTVDLFVERYKGKNI  60

Query  673  SIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVE  494
            S+VAGIEARGFIFGP IAL IGAKFVPLRKPKKLPGKVI +EY LEYG DCL+MHVGAVE
Sbjct  61   SVVAGIEARGFIFGPPIALEIGAKFVPLRKPKKLPGKVISEEYVLEYGRDCLQMHVGAVE  120

Query  493  AGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
             G+RALVVDDLIATGGTLCAAM+LLER GAEVVECACVIE+PDLKG+ERLNGKPLYVLV+
Sbjct  121  PGERALVVDDLIATGGTLCAAMNLLERVGAEVVECACVIELPDLKGRERLNGKPLYVLVE  180



>ref|XP_011018283.1| PREDICTED: adenine phosphoribosyltransferase 3 isoform X2 [Populus 
euphratica]
Length=182

 Score =   324 bits (830),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 156/180 (87%), Positives = 174/180 (97%), Gaps = 0/180 (0%)
 Frame = -2

Query  853  MSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI  674
            MSA+R++DPRI  I++RIRVVP+FPKPGIMFQDITTLLL+PKAFKDTIDLFVERYKGKNI
Sbjct  1    MSAYRDEDPRIHAIKTRIRVVPNFPKPGIMFQDITTLLLNPKAFKDTIDLFVERYKGKNI  60

Query  673  SIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVE  494
            S+VAGIEARGFIFGP IALAIGAKFVPLRKPKKLPG+VI ++Y LEYG DCLEMHVGAV+
Sbjct  61   SVVAGIEARGFIFGPPIALAIGAKFVPLRKPKKLPGEVISEKYILEYGRDCLEMHVGAVK  120

Query  493  AGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
            +G+RALVVDDLIATGGTLCAAM+LLERAGAEVVECACVIE+PDLKG+ERLNGKPLYVLV+
Sbjct  121  SGERALVVDDLIATGGTLCAAMNLLERAGAEVVECACVIELPDLKGRERLNGKPLYVLVE  180



>ref|XP_004511667.1| PREDICTED: adenine phosphoribosyltransferase 1, chloroplastic-like 
[Cicer arietinum]
Length=184

 Score =   323 bits (827),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 157/180 (87%), Positives = 169/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  853  MSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI  674
            MSA+   DPR+ GI+++IRVVP+FPK GIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI
Sbjct  1    MSAYTHQDPRLHGIKTKIRVVPNFPKSGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI  60

Query  673  SIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVE  494
            S+VAGIEARGFIFGP IALAIGAKFVPLRKPKKLPGKVI QEY LEYG DCLEMHVGAVE
Sbjct  61   SVVAGIEARGFIFGPPIALAIGAKFVPLRKPKKLPGKVISQEYILEYGRDCLEMHVGAVE  120

Query  493  AGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
             GDRA+VVDDLIATGGTLCAAMDLLER GAEVVECACVIE+P+LKG+ERLNGKPLYVLV+
Sbjct  121  TGDRAIVVDDLIATGGTLCAAMDLLERVGAEVVECACVIELPELKGRERLNGKPLYVLVE  180



>ref|XP_006368184.1| MtN30 family protein [Populus trichocarpa]
 gb|ERP64753.1| MtN30 family protein [Populus trichocarpa]
Length=182

 Score =   322 bits (824),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 155/180 (86%), Positives = 174/180 (97%), Gaps = 0/180 (0%)
 Frame = -2

Query  853  MSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI  674
            MSA+R++DPRI  I++RIRVVP+FPKPGIMFQDITTLLL+PKAFKDTIDLFVERYKGKNI
Sbjct  1    MSAYRDEDPRIHDIKTRIRVVPNFPKPGIMFQDITTLLLNPKAFKDTIDLFVERYKGKNI  60

Query  673  SIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVE  494
            S+VAGIEARGFIFGP IALAIGAKFVPLRKP+KLPG+VI ++Y LEYG DCLEMHVGAV+
Sbjct  61   SVVAGIEARGFIFGPPIALAIGAKFVPLRKPRKLPGEVISEKYILEYGRDCLEMHVGAVK  120

Query  493  AGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
            +G+RALVVDDLIATGGTLCAAM+LLERAGAEVVECACVIE+PDLKG+ERLNGKPLYVLV+
Sbjct  121  SGERALVVDDLIATGGTLCAAMNLLERAGAEVVECACVIELPDLKGRERLNGKPLYVLVE  180



>ref|XP_002268529.3| PREDICTED: adenine phosphoribosyltransferase 3 [Vitis vinifera]
Length=241

 Score =   323 bits (828),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 156/181 (86%), Positives = 172/181 (95%), Gaps = 0/181 (0%)
 Frame = -2

Query  856  TMSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKN  677
            TMSA ++ DPRI GI+++IRVVP+FPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKN
Sbjct  59   TMSACKDQDPRIHGIKTKIRVVPNFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKN  118

Query  676  ISIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAV  497
            IS+VAGIEARGFIFGP IALAIGAKFVPLRKP+KLPG+VI +EY LEYG DCLEMHVGAV
Sbjct  119  ISVVAGIEARGFIFGPPIALAIGAKFVPLRKPRKLPGEVISEEYILEYGRDCLEMHVGAV  178

Query  496  EAGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLV  317
            E GDRALVVDDLIATGGTLCAAM+LLER GAEVVECACVIE+PDLKG++RLNGKPLY+LV
Sbjct  179  EPGDRALVVDDLIATGGTLCAAMNLLERVGAEVVECACVIELPDLKGRDRLNGKPLYILV  238

Query  316  Q  314
            +
Sbjct  239  E  239



>ref|XP_009802437.1| PREDICTED: adenine phosphoribosyltransferase 3-like [Nicotiana 
sylvestris]
Length=182

 Score =   320 bits (821),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 169/182 (93%), Gaps = 0/182 (0%)
 Frame = -2

Query  853  MSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI  674
            MS  ++ DPRI  IQSRIRVVP FPKPGIMFQDITTLLLDPKAFKDTIDLFVERYK KNI
Sbjct  1    MSGCKDQDPRIHAIQSRIRVVPDFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKAKNI  60

Query  673  SIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVE  494
            S+VAGIEARGFIFGP IALAIGAKFVPLRKP KLPGKV +QEYDLEYGSDCLEMH+GAVE
Sbjct  61   SVVAGIEARGFIFGPPIALAIGAKFVPLRKPNKLPGKVFKQEYDLEYGSDCLEMHIGAVE  120

Query  493  AGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
            AG+RALVVDDLIATGGTL AAM+LLERAGAEVVECACVIEIP LKG+E+LNGKPLYVLV+
Sbjct  121  AGERALVVDDLIATGGTLRAAMNLLERAGAEVVECACVIEIPYLKGKEQLNGKPLYVLVE  180

Query  313  EK  308
             +
Sbjct  181  SQ  182



>gb|KHN34953.1| Adenine phosphoribosyltransferase 1, chloroplastic [Glycine soja]
Length=184

 Score =   320 bits (821),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 156/180 (87%), Positives = 170/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  853  MSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI  674
            MSA+++ D R+ GI+++IRVVP+FPK GIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI
Sbjct  1    MSAYKDQDTRLHGIKTKIRVVPNFPKSGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI  60

Query  673  SIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVE  494
            S+VAGIEARGFIFGP IALAIGAKFVPLRKPKKLPGKVI QEY LEYG DCLEMHVGAVE
Sbjct  61   SVVAGIEARGFIFGPPIALAIGAKFVPLRKPKKLPGKVISQEYILEYGRDCLEMHVGAVE  120

Query  493  AGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
             G+RALVVDDLIATGGTLCAAMDLLER GAEVVECACVIE+P+LKG+ERLNGKPLYVLV+
Sbjct  121  PGERALVVDDLIATGGTLCAAMDLLERVGAEVVECACVIELPELKGRERLNGKPLYVLVE  180



>gb|KHG11970.1| Adenine phosphoribosyltransferase 1, chloroplastic [Gossypium 
arboreum]
Length=182

 Score =   320 bits (820),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 155/180 (86%), Positives = 169/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  853  MSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI  674
            MSA+R+ DPRI GIQS+IRVVP+FPKPGIMFQDITTLLLDPKAFKDT+DLFVERYKGKNI
Sbjct  1    MSAYRDKDPRIHGIQSKIRVVPNFPKPGIMFQDITTLLLDPKAFKDTVDLFVERYKGKNI  60

Query  673  SIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVE  494
            S+VAGIEARGFIFG  IAL IGAKFVPLRKP KLPGKVI +EY+LEYG DCLEMH+GAVE
Sbjct  61   SVVAGIEARGFIFGTPIALEIGAKFVPLRKPNKLPGKVILEEYELEYGRDCLEMHLGAVE  120

Query  493  AGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
             G+RALVVDDLIATGGTLCAAM LLER GAEVVECACVIE+PDLKG+ERLNGKPLYVL++
Sbjct  121  PGERALVVDDLIATGGTLCAAMKLLERVGAEVVECACVIELPDLKGRERLNGKPLYVLLE  180



>ref|XP_006355483.1| PREDICTED: adenine phosphoribosyltransferase 1, chloroplastic-like 
[Solanum tuberosum]
Length=182

 Score =   320 bits (819),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 156/180 (87%), Positives = 170/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  853  MSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI  674
            MSA ++ DPRI  IQSRIRVVP+FPKPGIMFQDITTLLLDPKAFKDTIDLFVERYK K+I
Sbjct  1    MSACKDQDPRIHAIQSRIRVVPNFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKDKSI  60

Query  673  SIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVE  494
            S+VAGIEARGFIFGP IALAIGAKFVPLRKP KLPGKV +QEYDLEYGSDCLEMH+ AVE
Sbjct  61   SVVAGIEARGFIFGPPIALAIGAKFVPLRKPNKLPGKVFKQEYDLEYGSDCLEMHIEAVE  120

Query  493  AGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
            AG+RALVVDDLIATGGT+ AAM+LLERAGAEVVECACVIEIP+LKG+E+LNGKPLYVLV+
Sbjct  121  AGERALVVDDLIATGGTVSAAMNLLERAGAEVVECACVIEIPELKGKEKLNGKPLYVLVE  180



>ref|XP_009347506.1| PREDICTED: adenine phosphoribosyltransferase 3-like [Pyrus x 
bretschneideri]
Length=182

 Score =   319 bits (818),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 155/180 (86%), Positives = 170/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  853  MSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI  674
            MS  +++DPRI GI+++IRVVP+FPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI
Sbjct  1    MSILKDEDPRIHGIKTKIRVVPNFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI  60

Query  673  SIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVE  494
            S+VAGIEARGFIFGP IALAIGAKFVPLRKPKKLPG VI +EY LEYG DCLEMHVGAVE
Sbjct  61   SVVAGIEARGFIFGPPIALAIGAKFVPLRKPKKLPGDVIFEEYTLEYGRDCLEMHVGAVE  120

Query  493  AGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
             GDRALVVDDLIATGGTLCAAM+LLER GAEVVECAC+IE+PDL+G+ERLNGKPLYVLV+
Sbjct  121  LGDRALVVDDLIATGGTLCAAMNLLERVGAEVVECACLIELPDLQGRERLNGKPLYVLVE  180



>emb|CDP09925.1| unnamed protein product [Coffea canephora]
Length=182

 Score =   318 bits (816),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 157/182 (86%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = -2

Query  853  MSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI  674
            MSA R+DDPRI  IQS+IRVVP+FPKPGIMFQDITTLLLDPKAFKD+IDLFV+RYKGKNI
Sbjct  1    MSACRDDDPRIRSIQSKIRVVPNFPKPGIMFQDITTLLLDPKAFKDSIDLFVDRYKGKNI  60

Query  673  SIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVE  494
            S+VAGIEARGFIFGP IALAIGAKFVPLRK KKLPGKV R+EYDLEYGSDC+EMHVGAV+
Sbjct  61   SVVAGIEARGFIFGPPIALAIGAKFVPLRKRKKLPGKVYREEYDLEYGSDCIEMHVGAVD  120

Query  493  AGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
             G+RALVVDDLIATGGTL AAM+LLERA AEVVECACVIEIPDLKG++RLNGKPLYVLV+
Sbjct  121  PGERALVVDDLIATGGTLRAAMNLLERAEAEVVECACVIEIPDLKGRDRLNGKPLYVLVE  180

Query  313  EK  308
             +
Sbjct  181  SQ  182



>ref|XP_010259005.1| PREDICTED: adenine phosphoribosyltransferase 4 isoform X1 [Nelumbo 
nucifera]
Length=182

 Score =   318 bits (814),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 155/180 (86%), Positives = 170/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  853  MSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI  674
            MSA + +DPRI GI++RIRVVP FPKPGIMFQDITTLLLDPKAFKDT+DLFVERYKGK+I
Sbjct  1    MSACKIEDPRIHGIKTRIRVVPDFPKPGIMFQDITTLLLDPKAFKDTVDLFVERYKGKDI  60

Query  673  SIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVE  494
            S+VAGIEARGFIFGP IALAIGAKFVPLRKP+KLPGKVI +EY LEYG+DCLEMHVGAV+
Sbjct  61   SVVAGIEARGFIFGPPIALAIGAKFVPLRKPRKLPGKVISEEYVLEYGTDCLEMHVGAVD  120

Query  493  AGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
             GDRALVVDDLIATGGTLCAAM LLER GAEVVECACVIE+PDLKG+ERLNGKPLY+LV+
Sbjct  121  PGDRALVVDDLIATGGTLCAAMKLLERVGAEVVECACVIELPDLKGRERLNGKPLYILVE  180



>ref|NP_001238434.1| uncharacterized protein LOC100306411 [Glycine max]
 gb|ACU14569.1| unknown [Glycine max]
Length=184

 Score =   317 bits (813),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 155/180 (86%), Positives = 169/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  853  MSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI  674
            MSA+++ D R+ GI+++IRVVP+FPK GIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI
Sbjct  1    MSAYKDQDTRLHGIKTKIRVVPNFPKSGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI  60

Query  673  SIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVE  494
            S+VAGIEARGFIFGP IALAI AKFVPLRKPKKLPGKVI QEY LEYG DCLEMHVGAVE
Sbjct  61   SVVAGIEARGFIFGPPIALAIRAKFVPLRKPKKLPGKVISQEYILEYGRDCLEMHVGAVE  120

Query  493  AGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
             G+RALVVDDLIATGGTLCAAMDLLER GAEVVECACVIE+P+LKG+ERLNGKPLYVLV+
Sbjct  121  PGERALVVDDLIATGGTLCAAMDLLERVGAEVVECACVIELPELKGRERLNGKPLYVLVE  180



>ref|XP_003525806.1| PREDICTED: adenine phosphoribosyltransferase 1, chloroplastic-like 
isoform X1 [Glycine max]
 gb|KHN04340.1| Adenine phosphoribosyltransferase 1, chloroplastic [Glycine soja]
Length=186

 Score =   317 bits (813),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 154/180 (86%), Positives = 170/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  853  MSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI  674
            MSA+R++DPR+ GI+++IRVVP+FPKPGIMFQDITTLLLDP+ FKDTIDLFVERYKGKNI
Sbjct  1    MSAYRDEDPRLHGIKTKIRVVPNFPKPGIMFQDITTLLLDPRVFKDTIDLFVERYKGKNI  60

Query  673  SIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVE  494
            S+VAGIEARGFIFG  IALAIGAKFVPLRKPKKLPGKVI QEY LEYG DCLEMHVGAVE
Sbjct  61   SVVAGIEARGFIFGSPIALAIGAKFVPLRKPKKLPGKVISQEYILEYGRDCLEMHVGAVE  120

Query  493  AGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
             G+RALVVDDLIATGGTLCAAMDLLER GAEVVEC CVIE+P+LKG+ERLNGKPL+VLV+
Sbjct  121  PGERALVVDDLIATGGTLCAAMDLLERVGAEVVECGCVIELPELKGRERLNGKPLHVLVE  180



>ref|XP_004516845.1| PREDICTED: adenine phosphoribosyltransferase 1, chloroplastic-like 
[Cicer arietinum]
Length=184

 Score =   317 bits (812),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 155/180 (86%), Positives = 167/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  853  MSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI  674
            MS +R  DPR+  I++RIRVVP FPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI
Sbjct  1    MSLYRSQDPRLHAIKNRIRVVPDFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI  60

Query  673  SIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVE  494
            SIVAGIEARGFIFGP IALAIGAKFVPLRKPKKLPGKVI QEY LEYG DCLEMHVG VE
Sbjct  61   SIVAGIEARGFIFGPPIALAIGAKFVPLRKPKKLPGKVISQEYILEYGRDCLEMHVGGVE  120

Query  493  AGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
             G+RALVVDDL+ATGGTLCAAMDLLER GAE+VECACVIE+P+LKG+ERLNGKPL+VLV+
Sbjct  121  HGERALVVDDLVATGGTLCAAMDLLERVGAEIVECACVIELPELKGRERLNGKPLFVLVE  180



>ref|XP_010053440.1| PREDICTED: adenine phosphoribosyltransferase 4-like [Eucalyptus 
grandis]
 gb|KCW77736.1| hypothetical protein EUGRSUZ_D02033 [Eucalyptus grandis]
 gb|KCW77737.1| hypothetical protein EUGRSUZ_D02033 [Eucalyptus grandis]
Length=182

 Score =   317 bits (812),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 153/180 (85%), Positives = 171/180 (95%), Gaps = 0/180 (0%)
 Frame = -2

Query  853  MSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI  674
            MSA ++ DPRI GI+++IRVVP+FPKPGIMFQDITTLLLDP+AF+DTIDLFVERYKGKNI
Sbjct  1    MSAHKDKDPRIHGIKTKIRVVPNFPKPGIMFQDITTLLLDPQAFRDTIDLFVERYKGKNI  60

Query  673  SIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVE  494
            S+VAGIEARGFIFGP IALAIGAKFVPLRKPKKLPG+VI +EY LEYG DCL+MHVGAVE
Sbjct  61   SVVAGIEARGFIFGPPIALAIGAKFVPLRKPKKLPGEVISEEYVLEYGRDCLQMHVGAVE  120

Query  493  AGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
             GDRALVVDDLIATGGTLCAAM+LLER GA+VVECACVIE+PDLKG+ERL+GKPLYVLV+
Sbjct  121  PGDRALVVDDLIATGGTLCAAMNLLERVGAQVVECACVIELPDLKGRERLHGKPLYVLVE  180



>ref|XP_006477237.1| PREDICTED: adenine phosphoribosyltransferase 1-like [Citrus sinensis]
 gb|KDO61493.1| hypothetical protein CISIN_1g030119mg [Citrus sinensis]
Length=182

 Score =   315 bits (807),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 152/180 (84%), Positives = 169/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  853  MSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI  674
            MSA+++ D RI+GI+ +IRVVP+FPKPGIMFQDITTLLL PK FKDTID+FVERYKGKNI
Sbjct  1    MSAYKDKDARINGIKDQIRVVPNFPKPGIMFQDITTLLLKPKEFKDTIDMFVERYKGKNI  60

Query  673  SIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVE  494
            S+VAGIEARGFIFGP IALAIGAKFVPLRKPKKLPGKVI +EY LEYG DCLEMHVGAVE
Sbjct  61   SVVAGIEARGFIFGPPIALAIGAKFVPLRKPKKLPGKVISEEYILEYGRDCLEMHVGAVE  120

Query  493  AGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
            + +RALVVDDLIATGGTLCAA++LLER GAEVVECACVIE+PDLKG+ERLNGKPLYVLV+
Sbjct  121  SAERALVVDDLIATGGTLCAAINLLERVGAEVVECACVIELPDLKGRERLNGKPLYVLVE  180



>ref|XP_010264225.1| PREDICTED: adenine phosphoribosyltransferase 4-like [Nelumbo 
nucifera]
Length=182

 Score =   315 bits (807),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 152/180 (84%), Positives = 169/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  853  MSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI  674
            MSA +++DPRI  I++RIRVVP+FPK GIMFQDITTLLLDPKAFKDT+DLFVERYKGKNI
Sbjct  1    MSACKDEDPRISNIKTRIRVVPNFPKSGIMFQDITTLLLDPKAFKDTVDLFVERYKGKNI  60

Query  673  SIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVE  494
            S+VAGIEARGFIFGP IALAIGAKFVPLRKP+KLPG+VI +EY LEYG+DCLEMH+GAVE
Sbjct  61   SVVAGIEARGFIFGPPIALAIGAKFVPLRKPRKLPGEVISEEYVLEYGTDCLEMHIGAVE  120

Query  493  AGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
             GD ALVVDDLIATGGTLCAAM LLER GAEVVECACVIE+PDLKG+ERLNGKPLY+LV+
Sbjct  121  PGDCALVVDDLIATGGTLCAAMKLLERVGAEVVECACVIELPDLKGRERLNGKPLYILVE  180



>ref|XP_009340909.1| PREDICTED: adenine phosphoribosyltransferase 3 [Pyrus x bretschneideri]
Length=182

 Score =   315 bits (806),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 154/180 (86%), Positives = 169/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  853  MSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI  674
            MS  +++DPRI GI+++IRVVP+FPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI
Sbjct  1    MSILKDEDPRIHGIKTKIRVVPNFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI  60

Query  673  SIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVE  494
            S+VAGIEARGFIFGP IALAIGAKFVPLRKPKKLPG VI +EY LEYG D LEMHVGAVE
Sbjct  61   SVVAGIEARGFIFGPPIALAIGAKFVPLRKPKKLPGDVIFEEYTLEYGRDRLEMHVGAVE  120

Query  493  AGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
             GDRALVVDDLIATGGTLCAAM+LLER GAEVVECAC+IE+PDL+G+ERLNGKPLYVLV+
Sbjct  121  LGDRALVVDDLIATGGTLCAAMNLLERVGAEVVECACLIELPDLQGRERLNGKPLYVLVE  180



>ref|XP_004245742.1| PREDICTED: adenine phosphoribosyltransferase 4 [Solanum lycopersicum]
Length=182

 Score =   315 bits (806),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 154/180 (86%), Positives = 168/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  853  MSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI  674
            MSA +  DPRI  IQS IRVVP+FPKPGIMFQDITTLLLDPKAFKDTIDLFVERY+ K+I
Sbjct  1    MSACKGQDPRIHAIQSTIRVVPNFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYRDKSI  60

Query  673  SIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVE  494
            S+VAGIEARGFIFGP IALAIGAKFVPLRKP KLPGKV +QEYDLEYGSDCLEMH+ AVE
Sbjct  61   SVVAGIEARGFIFGPPIALAIGAKFVPLRKPNKLPGKVFKQEYDLEYGSDCLEMHIEAVE  120

Query  493  AGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
            AG+RALVVDDLIATGGT+ AAM+LLERAGAEVVECACVIEIP+LKG+E+LNGKPLYVLV+
Sbjct  121  AGERALVVDDLIATGGTVSAAMNLLERAGAEVVECACVIEIPELKGKEKLNGKPLYVLVE  180



>ref|XP_003550899.1| PREDICTED: adenine phosphoribosyltransferase 1, chloroplastic-like 
isoform X1 [Glycine max]
Length=186

 Score =   315 bits (807),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 154/180 (86%), Positives = 168/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  853  MSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI  674
            MS +R++DPR+  I+++IRVVP+FPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI
Sbjct  1    MSTYRDEDPRLHDIKTKIRVVPNFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI  60

Query  673  SIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVE  494
            S+VAGIEARGFIFG  IALAIGAKFVPLRKPKKLPGKVI QEY LEYG DCLEMHVGAVE
Sbjct  61   SVVAGIEARGFIFGSPIALAIGAKFVPLRKPKKLPGKVISQEYILEYGRDCLEMHVGAVE  120

Query  493  AGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
             G+RALVVDDLIATGGTLCAAMDLLER GAEVVEC CVIE+P+LKG+ERLNGK LYVLV+
Sbjct  121  PGERALVVDDLIATGGTLCAAMDLLERVGAEVVECGCVIELPELKGRERLNGKALYVLVE  180



>gb|KHN42708.1| Adenine phosphoribosyltransferase 1, chloroplastic [Glycine soja]
Length=184

 Score =   314 bits (805),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 154/180 (86%), Positives = 169/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  853  MSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI  674
            MSA+++ DPR+ GI+++IRVVP+FPK G+MF DITTLLLDPKAFKDTIDLFVERYKGKNI
Sbjct  1    MSAYKDQDPRLHGIKTKIRVVPNFPKSGLMFLDITTLLLDPKAFKDTIDLFVERYKGKNI  60

Query  673  SIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVE  494
            S+VAGIEARGFIFGP IALAIGAKFVPLRKPKKLPGKVI QEY LEYG DCLEMHVGAVE
Sbjct  61   SVVAGIEARGFIFGPPIALAIGAKFVPLRKPKKLPGKVISQEYILEYGRDCLEMHVGAVE  120

Query  493  AGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
             G+RALVVDDLIATGGTLCAAMDLLER GAEVVECACVIE+P+LKG+ERLNGKPL VLV+
Sbjct  121  PGERALVVDDLIATGGTLCAAMDLLERVGAEVVECACVIELPELKGRERLNGKPLCVLVE  180



>ref|XP_006440356.1| hypothetical protein CICLE_v10022476mg [Citrus clementina]
 gb|ESR53596.1| hypothetical protein CICLE_v10022476mg [Citrus clementina]
Length=182

 Score =   314 bits (804),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 152/180 (84%), Positives = 169/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  853  MSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI  674
            MSA+++ D RI+GI+ +IRVVP+FPKPGIMFQDITTLLL PK FKDTID+FVERYKGKNI
Sbjct  1    MSAYKDKDARINGIKDQIRVVPNFPKPGIMFQDITTLLLKPKEFKDTIDMFVERYKGKNI  60

Query  673  SIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVE  494
            S+VAGIEARGFIFGP IALAIGAKFVPLRKPKKLPGKVI +EY LEYG+DCLEMHVGAVE
Sbjct  61   SVVAGIEARGFIFGPPIALAIGAKFVPLRKPKKLPGKVISEEYILEYGTDCLEMHVGAVE  120

Query  493  AGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
              +RALVVDDLIATGGTLCAA++LLER GAEVVECACVIE+PDLKG+ERLNGKPLYVLV+
Sbjct  121  PEERALVVDDLIATGGTLCAAINLLERVGAEVVECACVIELPDLKGRERLNGKPLYVLVE  180



>gb|KGN55891.1| hypothetical protein Csa_3G033230 [Cucumis sativus]
Length=231

 Score =   316 bits (809),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 160/233 (69%), Positives = 192/233 (82%), Gaps = 7/233 (3%)
 Frame = -2

Query  991  LHSLFHSIYSPYIFSPFQPFS----FLSAFHLLSITLLSFFLHFTRQCRTMSAFREDDPR  824
            + SLF + + P++       +    FLS FH L I+            RT+    E+DPR
Sbjct  1    MQSLFPTPFLPFLIPSSNNTTKHRLFLS-FHFLQISENRESNKLITMSRTIE--EEEDPR  57

Query  823  IDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIEARG  644
            I+GI+++IRVVP+FPKPGI+FQDITTLLL+PKAFKDTIDLFVERYKGKNIS+VAGIEARG
Sbjct  58   INGIRTKIRVVPNFPKPGILFQDITTLLLEPKAFKDTIDLFVERYKGKNISVVAGIEARG  117

Query  643  FIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALVVDD  464
            FIFGP IALAIGAKFVPLRKPKKLPG+V+ +EY LEYG DC+EMHVGAVEAG+RALVVDD
Sbjct  118  FIFGPPIALAIGAKFVPLRKPKKLPGEVMHEEYVLEYGRDCIEMHVGAVEAGERALVVDD  177

Query  463  LIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQEKK  305
            LIATGGTL AA++LLERAGAEVVECACVIE+P+LKG+ERL+GK LY+LV+ ++
Sbjct  178  LIATGGTLSAAINLLERAGAEVVECACVIELPELKGRERLSGKSLYILVEYRR  230



>ref|XP_009376028.1| PREDICTED: adenine phosphoribosyltransferase 3-like [Pyrus x 
bretschneideri]
Length=182

 Score =   313 bits (802),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 153/180 (85%), Positives = 169/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  853  MSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI  674
            M   +++DPRI GI+++IRVVP+FPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI
Sbjct  1    MLVLKDEDPRIHGIKTKIRVVPNFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI  60

Query  673  SIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVE  494
            S+VAGIEARGFIFGP IALAIGAKFVPLRKPKKLPG VI +EY LEYGSD LEMHVGAVE
Sbjct  61   SVVAGIEARGFIFGPPIALAIGAKFVPLRKPKKLPGDVIFEEYTLEYGSDRLEMHVGAVE  120

Query  493  AGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
             G+RALVVDDLIATGGTLCAAM+LLER GAEVVECAC+IE+PDL+G+ERLNGKPLYVLV+
Sbjct  121  LGERALVVDDLIATGGTLCAAMNLLERVGAEVVECACLIELPDLQGRERLNGKPLYVLVE  180



>gb|KHN09793.1| Adenine phosphoribosyltransferase 1, chloroplastic [Glycine soja]
Length=186

 Score =   313 bits (802),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 153/180 (85%), Positives = 168/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  853  MSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI  674
            MS +R++DPR+  I+++IRVVP+FPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI
Sbjct  1    MSTYRDEDPRLHDIKTKIRVVPNFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI  60

Query  673  SIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVE  494
            S+VAGIEARGFIFG  IALAIGAKFVPLRKPKKLPGKVI QEY LEYG DCLE+HVGAVE
Sbjct  61   SVVAGIEARGFIFGSPIALAIGAKFVPLRKPKKLPGKVISQEYILEYGRDCLEIHVGAVE  120

Query  493  AGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
             G+RALVVDDLIATGGTLCAAMDLLER GAEVVEC CVIE+P+LKG+ERLNGK LYVLV+
Sbjct  121  PGERALVVDDLIATGGTLCAAMDLLERVGAEVVECGCVIELPELKGRERLNGKALYVLVE  180



>ref|XP_007209667.1| hypothetical protein PRUPE_ppa012146mg [Prunus persica]
 ref|XP_008238579.1| PREDICTED: adenine phosphoribosyltransferase 1 isoform X1 [Prunus 
mume]
 gb|EMJ10866.1| hypothetical protein PRUPE_ppa012146mg [Prunus persica]
Length=182

 Score =   313 bits (801),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 153/180 (85%), Positives = 169/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  853  MSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI  674
            MS F+++DPRI GI+++IRVVP+FPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI
Sbjct  1    MSVFKDEDPRIHGIKTKIRVVPNFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI  60

Query  673  SIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVE  494
            S+VAGIEARGFIFGP IALAIGAKFVPLRKP+KLPG VI +EY LEYG D LEMHVGAVE
Sbjct  61   SVVAGIEARGFIFGPPIALAIGAKFVPLRKPRKLPGDVIFEEYTLEYGRDRLEMHVGAVE  120

Query  493  AGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
             G+RALVVDDLIATGGTLCAAM+LLER GAEVVECACVIE+PDL+G+ RLNGKPLYVLV+
Sbjct  121  LGERALVVDDLIATGGTLCAAMNLLERVGAEVVECACVIELPDLQGRVRLNGKPLYVLVE  180



>ref|XP_008346604.1| PREDICTED: adenine phosphoribosyltransferase 1-like [Malus domestica]
Length=182

 Score =   313 bits (801),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 152/180 (84%), Positives = 169/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  853  MSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI  674
            MS  +++DPRI GI+++IRVVP+FPKPGIMFQDITTLLLDPK+FKDTIDLFVERYKGKNI
Sbjct  1    MSVLKDEDPRIHGIKTKIRVVPNFPKPGIMFQDITTLLLDPKSFKDTIDLFVERYKGKNI  60

Query  673  SIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVE  494
            S+VAGIEARGFIFGP IALAIGAKFVPLRKPKKLPG VI +EY LEYG D LEMHVGAVE
Sbjct  61   SVVAGIEARGFIFGPPIALAIGAKFVPLRKPKKLPGDVIFEEYTLEYGRDRLEMHVGAVE  120

Query  493  AGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
             G+RALVVDDLIATGGTLCAAM+LLER GAEVVECAC+IE+PDL+G+ERLNGKPLYVLV+
Sbjct  121  LGERALVVDDLIATGGTLCAAMNLLERVGAEVVECACLIELPDLQGRERLNGKPLYVLVE  180



>ref|XP_002529782.1| Adenine phosphoribosyltransferase, putative [Ricinus communis]
 gb|EEF32596.1| Adenine phosphoribosyltransferase, putative [Ricinus communis]
Length=206

 Score =   313 bits (802),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 152/175 (87%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = -2

Query  853  MSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI  674
            MSA R++DPRI GIQ++IRVVP+FPKPGIMFQDITTLLLDP AFKDTIDLFVERYKGKNI
Sbjct  1    MSAHRDEDPRIHGIQTKIRVVPNFPKPGIMFQDITTLLLDPIAFKDTIDLFVERYKGKNI  60

Query  673  SIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVE  494
            S+VAGIEARGFIFGP IALAIGAKFV LRKP+KLPG+VI +EY LEYG+DCLEMHVGAV+
Sbjct  61   SVVAGIEARGFIFGPPIALAIGAKFVLLRKPRKLPGEVISEEYVLEYGTDCLEMHVGAVK  120

Query  493  AGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPL  329
            +G+RALVVDDLIATGGTLCAAM+LLERAGAEVVECACVIE+PDLKG+ERLNGKPL
Sbjct  121  SGERALVVDDLIATGGTLCAAMNLLERAGAEVVECACVIELPDLKGRERLNGKPL  175



>ref|XP_004298655.1| PREDICTED: adenine phosphoribosyltransferase 1-like [Fragaria 
vesca subsp. vesca]
Length=182

 Score =   311 bits (796),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 150/180 (83%), Positives = 167/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  853  MSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI  674
            MSA ++ DPR+  I+++IRVVP+FPKPGIMFQDITTLLLDPKAFKDTID+FVERYKGKNI
Sbjct  1    MSALKDQDPRVHSIKTKIRVVPNFPKPGIMFQDITTLLLDPKAFKDTIDMFVERYKGKNI  60

Query  673  SIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVE  494
            S+VAGIEARGFIFGP IALAIGAKFVPLRKP+KLPG V+ +EY LEYG D LEMHVGAVE
Sbjct  61   SVVAGIEARGFIFGPPIALAIGAKFVPLRKPRKLPGDVLFEEYTLEYGRDRLEMHVGAVE  120

Query  493  AGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
             GDRALVVDDLIATGGTLCAAM LLER GAEVVECAC+IE+PDL+G+ERLNGKPLYVLV+
Sbjct  121  QGDRALVVDDLIATGGTLCAAMSLLERVGAEVVECACLIELPDLQGRERLNGKPLYVLVE  180



>ref|XP_008437119.1| PREDICTED: adenine phosphoribosyltransferase 1-like [Cucumis 
melo]
Length=182

 Score =   310 bits (795),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 150/180 (83%), Positives = 171/180 (95%), Gaps = 0/180 (0%)
 Frame = -2

Query  853  MSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI  674
            MSA+R++DPRI GI+++IRVVP FP+PGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI
Sbjct  1    MSAYRDEDPRIHGIRTKIRVVPDFPQPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI  60

Query  673  SIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVE  494
            S+VAGIEARGFIFGP IALAIGAKF+PLRKP+KLPG+VI ++Y LEYGSDCLEMHVGAV+
Sbjct  61   SVVAGIEARGFIFGPPIALAIGAKFIPLRKPRKLPGEVISEKYILEYGSDCLEMHVGAVK  120

Query  493  AGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
              +RALVVDDLIATGGTLCAAM+LLERAGAEV+ECACVIE+P LKG+ERLN KPL+VLV+
Sbjct  121  PHERALVVDDLIATGGTLCAAMNLLERAGAEVIECACVIELPVLKGRERLNDKPLFVLVE  180



>ref|XP_008381154.1| PREDICTED: adenine phosphoribosyltransferase 1-like [Malus domestica]
Length=182

 Score =   310 bits (795),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 151/180 (84%), Positives = 168/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  853  MSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI  674
            M   +++DPRI GI+++IRVVP+FPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI
Sbjct  1    MLVLKDEDPRIHGIKTKIRVVPNFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI  60

Query  673  SIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVE  494
            S+VAGIEARGFIFGP IALAIGAKFVPLRKP+KLPG VI +EY LEYG D LEMHVGAVE
Sbjct  61   SVVAGIEARGFIFGPPIALAIGAKFVPLRKPRKLPGDVIFEEYTLEYGKDRLEMHVGAVE  120

Query  493  AGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
             G+RALVVDDLIATGGTLCAAM+LLER GAEVVECAC+IE+PDL+G+ERLNGKPLYVLV+
Sbjct  121  LGERALVVDDLIATGGTLCAAMNLLERVGAEVVECACLIELPDLQGRERLNGKPLYVLVE  180



>ref|XP_003611278.1| Adenine phosphoribosyltransferase-like protein [Medicago truncatula]
 gb|AES94236.1| adenine phosphoribosyltransferase-like protein [Medicago truncatula]
 gb|AFK34018.1| unknown [Medicago truncatula]
Length=186

 Score =   310 bits (795),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 154/182 (85%), Positives = 167/182 (92%), Gaps = 2/182 (1%)
 Frame = -2

Query  853  MSAF--REDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGK  680
            MSA+     DPR+ GI+++IRVVP FPK GIMFQDITTLLLDPKAFKDTIDLFVERYKGK
Sbjct  1    MSAYTNHNQDPRLHGIKTKIRVVPDFPKAGIMFQDITTLLLDPKAFKDTIDLFVERYKGK  60

Query  679  NISIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGA  500
            NIS+VAGIEARGFIFGP IALAIGAKFVPLRKPKKLPGKVI QEY LEYG DCLEMHVGA
Sbjct  61   NISVVAGIEARGFIFGPPIALAIGAKFVPLRKPKKLPGKVISQEYILEYGRDCLEMHVGA  120

Query  499  VEAGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVL  320
            VE G+RA+VVDDLIATGGTL AAM+LLER GAEVVECACVIE+P+LKG+ERLNGKPLYVL
Sbjct  121  VETGERAIVVDDLIATGGTLGAAMNLLERVGAEVVECACVIELPELKGRERLNGKPLYVL  180

Query  319  VQ  314
            V+
Sbjct  181  VE  182



>ref|XP_008786997.1| PREDICTED: adenine phosphoribosyltransferase 1 [Phoenix dactylifera]
Length=184

 Score =   308 bits (790),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 146/178 (82%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = -2

Query  841  REDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVA  662
            RE DPRI+GI S IRVVP+FPKPGIMFQDITTLLLDPKAFK+T+DLFVERY GK+I++VA
Sbjct  7    REQDPRIEGIASSIRVVPNFPKPGIMFQDITTLLLDPKAFKNTVDLFVERYTGKDITVVA  66

Query  661  GIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDR  482
            GIEARGFIFGP IALAIGAKF+PLRKP+KLPG+VI +EY LEYG+DCL+MH+GAV+ GDR
Sbjct  67   GIEARGFIFGPPIALAIGAKFIPLRKPRKLPGEVISEEYVLEYGTDCLQMHIGAVQPGDR  126

Query  481  ALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQEK  308
            ALVVDDLIATGGTLCAA+ LLERAGAEVVECACVIE+P+LKG+ERLNGKPLY+LV+ +
Sbjct  127  ALVVDDLIATGGTLCAAIKLLERAGAEVVECACVIELPELKGRERLNGKPLYILVESR  184



>ref|XP_004150643.1| PREDICTED: adenine phosphoribosyltransferase 1, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004164453.1| PREDICTED: adenine phosphoribosyltransferase 1, chloroplastic-like 
[Cucumis sativus]
Length=186

 Score =   308 bits (789),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 147/178 (83%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = -2

Query  838  EDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAG  659
            E+DPRI+GI+++IRVVP+FPKPGI+FQDITTLLL+PKAFKDTIDLFVERYKGKNIS+VAG
Sbjct  8    EEDPRINGIRTKIRVVPNFPKPGILFQDITTLLLEPKAFKDTIDLFVERYKGKNISVVAG  67

Query  658  IEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRA  479
            IEARGFIFGP IALAIGAKFVPLRKPKKLPG+V+ +EY LEYG DC+EMHVGAVEAG+RA
Sbjct  68   IEARGFIFGPPIALAIGAKFVPLRKPKKLPGEVMHEEYVLEYGRDCIEMHVGAVEAGERA  127

Query  478  LVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQEKK  305
            LVVDDLIATGGTL AA++LLERAGAEVVECACVIE+P+LKG+ERL+GK LY+LV+ ++
Sbjct  128  LVVDDLIATGGTLSAAINLLERAGAEVVECACVIELPELKGRERLSGKSLYILVEYRR  185



>ref|XP_010919499.1| PREDICTED: adenine phosphoribosyltransferase 1 isoform X1 [Elaeis 
guineensis]
Length=184

 Score =   308 bits (788),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 146/178 (82%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = -2

Query  841  REDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVA  662
            RE DPRI+GI S IRVVP+FPKPGIMFQDITTLLLDPKAFK+T+DLFVERY GK+I++VA
Sbjct  7    REQDPRIEGIASSIRVVPNFPKPGIMFQDITTLLLDPKAFKNTVDLFVERYTGKDITVVA  66

Query  661  GIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDR  482
            GIEARGFIFGP IALAIGAKF+PLRKP+KLPG+VI +EY LEYG+DCL+MH+GAV  GDR
Sbjct  67   GIEARGFIFGPPIALAIGAKFIPLRKPRKLPGEVISEEYVLEYGTDCLQMHIGAVHPGDR  126

Query  481  ALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQEK  308
            ALVVDDLIATGGTLCAA+ LLERAGAEVVECACVIE+P+LKG+ERLNGKPLY+LV+ +
Sbjct  127  ALVVDDLIATGGTLCAAIKLLERAGAEVVECACVIELPELKGRERLNGKPLYILVESR  184



>ref|XP_010093697.1| Adenine phosphoribosyltransferase 1 [Morus notabilis]
 gb|EXB54477.1| Adenine phosphoribosyltransferase 1 [Morus notabilis]
Length=188

 Score =   308 bits (788),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 153/186 (82%), Positives = 170/186 (91%), Gaps = 6/186 (3%)
 Frame = -2

Query  853  MSAFREDDPRIDGIQSRIRVVPHFPKPG------IMFQDITTLLLDPKAFKDTIDLFVER  692
            MSA +++DPRI GI+++IRVVP+FPKPG      IMFQDITTLLLDPKAFKDTIDLFVER
Sbjct  1    MSALKDEDPRIHGIKTKIRVVPNFPKPGAVQCAGIMFQDITTLLLDPKAFKDTIDLFVER  60

Query  691  YKGKNISIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEM  512
            YKGKNIS+VAGIEARGFIFGP IALAIGAKFVPLRKP+KLPG+VI +EY LEYG D LEM
Sbjct  61   YKGKNISVVAGIEARGFIFGPPIALAIGAKFVPLRKPRKLPGEVIFKEYTLEYGKDRLEM  120

Query  511  HVGAVEAGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKP  332
            HVGAVE G+ ALVVDDLIATGGTLCAAM+LLER GAEVVECACVIE+PDL+G+ERLNGKP
Sbjct  121  HVGAVEPGEHALVVDDLIATGGTLCAAMNLLERVGAEVVECACVIELPDLQGRERLNGKP  180

Query  331  LYVLVQ  314
            LYVLV+
Sbjct  181  LYVLVE  186



>ref|XP_008796830.1| PREDICTED: adenine phosphoribosyltransferase 1-like isoform X2 
[Phoenix dactylifera]
Length=184

 Score =   307 bits (787),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 146/178 (82%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = -2

Query  841  REDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVA  662
            +E DPRI+GI S IRVVP+FPKPGIMFQDITTLLLDPKAFK+T+DLFVERY GK+I++VA
Sbjct  7    KEQDPRIEGIASTIRVVPNFPKPGIMFQDITTLLLDPKAFKNTVDLFVERYTGKDITVVA  66

Query  661  GIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDR  482
            GIEARGFIFGP IALAIGAKFVPLRKP+KLPG+VI +EY LEYG+DCL+MH+GAV+ GDR
Sbjct  67   GIEARGFIFGPPIALAIGAKFVPLRKPRKLPGEVISEEYVLEYGTDCLQMHIGAVQPGDR  126

Query  481  ALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQEK  308
            ALVVDDLIATGGTLCAA+ LLERAGAEVVECACVIE+P+LKG+ERLNGKPLY+LV+ +
Sbjct  127  ALVVDDLIATGGTLCAAIKLLERAGAEVVECACVIELPELKGRERLNGKPLYILVESR  184



>ref|XP_004147592.1| PREDICTED: adenine phosphoribosyltransferase 1-like [Cucumis 
sativus]
 gb|KGN50225.1| hypothetical protein Csa_5G160770 [Cucumis sativus]
Length=182

 Score =   307 bits (787),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 149/180 (83%), Positives = 171/180 (95%), Gaps = 0/180 (0%)
 Frame = -2

Query  853  MSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI  674
            MSA+R++DPRI GI++RIRVVP+FP+PGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI
Sbjct  1    MSAYRDEDPRIHGIRTRIRVVPNFPQPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI  60

Query  673  SIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVE  494
            S+VAGIEARGFIFGP IALAIGAKF+PLRKP+KLPG+VI ++Y LEYGSDCLEMHVGAV+
Sbjct  61   SVVAGIEARGFIFGPPIALAIGAKFIPLRKPRKLPGEVISEKYILEYGSDCLEMHVGAVK  120

Query  493  AGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
              +RALVVDDLIATGGTL AAM+LLERAGAEV+ECACVIE+P LKG+E+LN KPL+VLV+
Sbjct  121  PHERALVVDDLIATGGTLRAAMNLLERAGAEVIECACVIELPVLKGREQLNDKPLFVLVE  180



>ref|XP_010676164.1| PREDICTED: adenine phosphoribosyltransferase 3 [Beta vulgaris 
subsp. vulgaris]
Length=182

 Score =   307 bits (787),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 148/180 (82%), Positives = 167/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  853  MSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI  674
            MS    DDPR+  I+++IRV+P+FPKPGIMFQDITTLLLD K+FKDTIDLFVERYK KNI
Sbjct  1    MSLCNGDDPRVHDIKTKIRVIPNFPKPGIMFQDITTLLLDAKSFKDTIDLFVERYKSKNI  60

Query  673  SIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVE  494
            S+VAGIEARGFIFGP IALAIGAKFVPLRKP+KLPG+VI +EY LEYG DCLEMHVGAVE
Sbjct  61   SVVAGIEARGFIFGPPIALAIGAKFVPLRKPRKLPGEVISEEYVLEYGRDCLEMHVGAVE  120

Query  493  AGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
            AG+RALVVDDL+ATGGTLCAAM+LLERAGAEVVECAC+IE+PDLKG+ERL GKPLY+LV+
Sbjct  121  AGERALVVDDLVATGGTLCAAMNLLERAGAEVVECACLIELPDLKGRERLKGKPLYILVE  180



>ref|XP_008448875.1| PREDICTED: adenine phosphoribosyltransferase 1 [Cucumis melo]
Length=186

 Score =   307 bits (787),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 147/175 (84%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = -2

Query  838  EDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAG  659
            E+DPRI+GI+++IRVVP+FPKPGIMFQDITTLLL+PKAFKDTIDLFVERYKGKNIS+VAG
Sbjct  8    EEDPRINGIRTKIRVVPNFPKPGIMFQDITTLLLEPKAFKDTIDLFVERYKGKNISVVAG  67

Query  658  IEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRA  479
            IEARGFIFGP IALAIGAKFVPLRKPKKLPG+V+ +EY LEYG DC+EMHVGAV+AG+RA
Sbjct  68   IEARGFIFGPPIALAIGAKFVPLRKPKKLPGEVMHEEYVLEYGRDCIEMHVGAVKAGERA  127

Query  478  LVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
            LVVDDLIATGGTL AA++LLERAGAEVVECACVIE+P+LKG+ERL+GK LY+LV+
Sbjct  128  LVVDDLIATGGTLSAAINLLERAGAEVVECACVIELPELKGRERLSGKSLYILVE  182



>ref|XP_010933699.1| PREDICTED: adenine phosphoribosyltransferase 3-like isoform X1 
[Elaeis guineensis]
Length=184

 Score =   305 bits (782),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 146/176 (83%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = -2

Query  841  REDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVA  662
            +E DPRI+GI S IRVVP FPKPGIMFQDITTLLLDPKAFK+T+DLFVERY GK+I++VA
Sbjct  7    KEQDPRIEGIASTIRVVPDFPKPGIMFQDITTLLLDPKAFKNTVDLFVERYTGKDITVVA  66

Query  661  GIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDR  482
            GIEARGFIFGP IALAIGAKFVPLRKP+KLPG+VI +EY LEYG+DCL+MH+GAV+ GDR
Sbjct  67   GIEARGFIFGPPIALAIGAKFVPLRKPRKLPGEVISEEYVLEYGTDCLQMHIGAVQPGDR  126

Query  481  ALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
            ALVVDDLIATGGTLCAA+ LLERAGAEVVECACVIE+P+LKG+ERLNGKPLY+LV+
Sbjct  127  ALVVDDLIATGGTLCAAIKLLERAGAEVVECACVIELPELKGRERLNGKPLYILVE  182



>ref|XP_010055519.1| PREDICTED: adenine phosphoribosyltransferase 3-like [Eucalyptus 
grandis]
 gb|KCW72000.1| hypothetical protein EUGRSUZ_E00451 [Eucalyptus grandis]
Length=182

 Score =   300 bits (769),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 147/180 (82%), Positives = 165/180 (92%), Gaps = 0/180 (0%)
 Frame = -2

Query  853  MSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI  674
            MSA +++DPR+ GI+SRIRVVP FPKPGIMFQDITTLLLD KAFKD IDLFVERYK +NI
Sbjct  1    MSADKDEDPRMYGIKSRIRVVPDFPKPGIMFQDITTLLLDSKAFKDAIDLFVERYKDRNI  60

Query  673  SIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVE  494
            S+VAGIEARGFIFGP IALAIGAKFVPLRKP KLPG+VI ++Y LEYG DCL+MH+GAV+
Sbjct  61   SVVAGIEARGFIFGPPIALAIGAKFVPLRKPGKLPGEVISEDYVLEYGKDCLQMHIGAVQ  120

Query  493  AGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
              +RALVVDDLIATGGTLCAAM+LLER GAEVVECACVIE+PDLKG+ERL GKPLYVLV+
Sbjct  121  PEERALVVDDLIATGGTLCAAMNLLERVGAEVVECACVIELPDLKGRERLKGKPLYVLVE  180



>ref|XP_009411555.1| PREDICTED: adenine phosphoribosyltransferase 4-like [Musa acuminata 
subsp. malaccensis]
Length=184

 Score =   300 bits (767),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = -2

Query  838  EDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAG  659
            E DPRI GI + IRVVP FPK GIMFQDITTLLLDPKAFK+T+DLFVERY GK++S+VAG
Sbjct  8    EQDPRIGGIAASIRVVPDFPKKGIMFQDITTLLLDPKAFKNTVDLFVERYIGKDVSVVAG  67

Query  658  IEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRA  479
            IEARGFIFGP IALAIGAKFVPLRKP+KLPG+VI ++Y LEYG+DCLEMHVGAV+ GD A
Sbjct  68   IEARGFIFGPPIALAIGAKFVPLRKPRKLPGEVISEKYVLEYGTDCLEMHVGAVQPGDHA  127

Query  478  LVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQEK  308
            LVVDDLIATGGTLCAAM+LLERAGAEVVECACVIE+P+LKG+E+LNGKPLYVLV+ +
Sbjct  128  LVVDDLIATGGTLCAAMNLLERAGAEVVECACVIELPELKGREKLNGKPLYVLVESR  184



>ref|XP_010539719.1| PREDICTED: adenine phosphoribosyltransferase 3 isoform X1 [Tarenaya 
hassleriana]
Length=183

 Score =   299 bits (765),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 145/175 (83%), Positives = 164/175 (94%), Gaps = 0/175 (0%)
 Frame = -2

Query  838  EDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAG  659
            ++DPRIDGI+++IRVVPHFPK GIMFQDITTLLLDPKAFKDTIDLFVERY+ +NIS+VAG
Sbjct  7    QEDPRIDGIKTKIRVVPHFPKKGIMFQDITTLLLDPKAFKDTIDLFVERYRDRNISVVAG  66

Query  658  IEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRA  479
            IEARGFIFGP IALAIGAKFVPLRKPKKLPG+ I +EY+LEYG D LEMHVGAVE+GD A
Sbjct  67   IEARGFIFGPPIALAIGAKFVPLRKPKKLPGETIFEEYELEYGRDRLEMHVGAVESGDTA  126

Query  478  LVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
            LVVDDLIATGGTLCAAM+LLER GA+VVECACVIE+P+LKG++RL GKPL VLV+
Sbjct  127  LVVDDLIATGGTLCAAMNLLERVGAQVVECACVIELPELKGRQRLKGKPLCVLVE  181



>ref|XP_009388017.1| PREDICTED: adenine phosphoribosyltransferase 4-like [Musa acuminata 
subsp. malaccensis]
 gb|ADW83715.1| adenine phosphoribosyltransferase [Musa acuminata AAA Group]
Length=184

 Score =   298 bits (764),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 144/178 (81%), Positives = 164/178 (92%), Gaps = 0/178 (0%)
 Frame = -2

Query  841  REDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVA  662
            +E DPRI GI + IRVVP FPK GIMFQDITTLLLDPKAFK+T+DLFVERY GKNIS+VA
Sbjct  7    KEQDPRIQGIAASIRVVPDFPKKGIMFQDITTLLLDPKAFKNTVDLFVERYSGKNISVVA  66

Query  661  GIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDR  482
            GIEARGFIFGP IALAIGAKFVPLRKP+KLPG+VI ++Y LEYG+DCLEMHVGA++  DR
Sbjct  67   GIEARGFIFGPPIALAIGAKFVPLRKPRKLPGEVISEKYVLEYGTDCLEMHVGAIQPCDR  126

Query  481  ALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQEK  308
            ALVVDDL+ATGGTL AAM+LLERAGAEVVECACVIE+P+LKG+ERLNGKPLYVL++ +
Sbjct  127  ALVVDDLVATGGTLRAAMNLLERAGAEVVECACVIELPELKGRERLNGKPLYVLMESR  184



>ref|XP_010439313.1| PREDICTED: adenine phosphoribosyltransferase 3 [Camelina sativa]
Length=183

 Score =   298 bits (764),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 145/175 (83%), Positives = 165/175 (94%), Gaps = 0/175 (0%)
 Frame = -2

Query  838  EDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAG  659
            E+DPRI+GI+++IRVVP FPK GIMFQDITT+LLDPKAFKDTIDLFVERY+ KNIS+VAG
Sbjct  7    EEDPRINGIKTKIRVVPDFPKKGIMFQDITTVLLDPKAFKDTIDLFVERYRDKNISVVAG  66

Query  658  IEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRA  479
            IEARGFIFGP IALAIGAKFVPLRKPKKLPG+ I +EY+LEYG+D LEMH+GAVEAGDRA
Sbjct  67   IEARGFIFGPPIALAIGAKFVPLRKPKKLPGETIFEEYELEYGNDRLEMHIGAVEAGDRA  126

Query  478  LVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
            LVVDDLIATGGTLCAA++LLER GAEVVECACVIE+PDLKG++RL GKPL +LV+
Sbjct  127  LVVDDLIATGGTLCAAINLLERVGAEVVECACVIELPDLKGRQRLKGKPLCMLVE  181



>ref|XP_008356523.1| PREDICTED: adenine phosphoribosyltransferase 1-like [Malus domestica]
Length=177

 Score =   298 bits (763),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 145/172 (84%), Positives = 161/172 (94%), Gaps = 0/172 (0%)
 Frame = -2

Query  853  MSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI  674
            MS  +++DPRI GI+++IRVVP+FPKPGIMFQDITTLLLDPK+FKDTIDLFVERYKGKNI
Sbjct  1    MSVLKDEDPRIHGIKTKIRVVPNFPKPGIMFQDITTLLLDPKSFKDTIDLFVERYKGKNI  60

Query  673  SIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVE  494
            S+VAGIEARGFIFGP IALAIGAKFVPLRKPKKLPG VI +EY LEYG D LEMHVGAVE
Sbjct  61   SVVAGIEARGFIFGPPIALAIGAKFVPLRKPKKLPGDVIFEEYTLEYGRDRLEMHVGAVE  120

Query  493  AGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNG  338
             G+RALVVDDLIATGGTLCAAM+LLER GAEVVECAC+IE+PDL+G+ERLNG
Sbjct  121  LGERALVVDDLIATGGTLCAAMNLLERVGAEVVECACLIELPDLQGRERLNG  172



>ref|XP_006288749.1| hypothetical protein CARUB_v10002066mg [Capsella rubella]
 gb|EOA21647.1| hypothetical protein CARUB_v10002066mg [Capsella rubella]
Length=183

 Score =   298 bits (763),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 146/173 (84%), Positives = 162/173 (94%), Gaps = 0/173 (0%)
 Frame = -2

Query  832  DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIE  653
            DPRIDGI+++IRVVP FPK GIMFQDITTLLLDPKAFKDTIDLFVERY+  NIS+VAGIE
Sbjct  9    DPRIDGIKTKIRVVPDFPKKGIMFQDITTLLLDPKAFKDTIDLFVERYRDMNISVVAGIE  68

Query  652  ARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALV  473
            ARGFIFGPSIALAIGAKFVPLRKPKKLPG++I +EY+LEYGSD LEMHV AV++GDRALV
Sbjct  69   ARGFIFGPSIALAIGAKFVPLRKPKKLPGEIIFEEYELEYGSDRLEMHVEAVDSGDRALV  128

Query  472  VDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
            VDDLIATGGTL AAM+LL R GAEVVECACVIE+P+LKG+ERL GKPLYVLV+
Sbjct  129  VDDLIATGGTLSAAMNLLRRVGAEVVECACVIELPELKGRERLEGKPLYVLVE  181



>ref|XP_009382402.1| PREDICTED: adenine phosphoribosyltransferase 4-like [Musa acuminata 
subsp. malaccensis]
Length=186

 Score =   298 bits (762),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 142/178 (80%), Positives = 165/178 (93%), Gaps = 0/178 (0%)
 Frame = -2

Query  841  REDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVA  662
            ++ DPRI+GI + IRVVP FPK GIMFQDITTLLLDPK FK+T+DLFVERY GK+IS+VA
Sbjct  9    QKQDPRIEGIAASIRVVPDFPKKGIMFQDITTLLLDPKTFKNTVDLFVERYLGKDISVVA  68

Query  661  GIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDR  482
            GIEARGFIFGP IALAIGAKF+PLRKP+KLPG+VI ++Y LEYG+DCLEMHVGAV+ GD 
Sbjct  69   GIEARGFIFGPPIALAIGAKFIPLRKPRKLPGEVISEKYVLEYGTDCLEMHVGAVQPGDH  128

Query  481  ALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQEK  308
            ALVVDDLIATGGTLCAAM+LLERAGAEVVECACVIE+P+LKG+E+LNGKPLY+LV+ +
Sbjct  129  ALVVDDLIATGGTLCAAMNLLERAGAEVVECACVIELPELKGREKLNGKPLYILVESR  186



>ref|XP_011018282.1| PREDICTED: adenine phosphoribosyltransferase 3 isoform X1 [Populus 
euphratica]
Length=187

 Score =   298 bits (762),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 143/165 (87%), Positives = 159/165 (96%), Gaps = 0/165 (0%)
 Frame = -2

Query  853  MSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI  674
            MSA+R++DPRI  I++RIRVVP+FPKPGIMFQDITTLLL+PKAFKDTIDLFVERYKGKNI
Sbjct  1    MSAYRDEDPRIHAIKTRIRVVPNFPKPGIMFQDITTLLLNPKAFKDTIDLFVERYKGKNI  60

Query  673  SIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVE  494
            S+VAGIEARGFIFGP IALAIGAKFVPLRKPKKLPG+VI ++Y LEYG DCLEMHVGAV+
Sbjct  61   SVVAGIEARGFIFGPPIALAIGAKFVPLRKPKKLPGEVISEKYILEYGRDCLEMHVGAVK  120

Query  493  AGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLK  359
            +G+RALVVDDLIATGGTLCAAM+LLERAGAEVVECACVIE+PDLK
Sbjct  121  SGERALVVDDLIATGGTLCAAMNLLERAGAEVVECACVIELPDLK  165



>ref|NP_192981.1| adenine phosphoribosyl transferase 4 [Arabidopsis thaliana]
 sp|Q9SU38.1|APT4_ARATH RecName: Full=Adenine phosphoribosyltransferase 4; Short=AtAPT4 
[Arabidopsis thaliana]
 emb|CAB41714.1| putative adenine phosphoribosyltransferase [Arabidopsis thaliana]
 emb|CAB78287.1| putative adenine phosphoribosyltransferase [Arabidopsis thaliana]
 gb|AAM91623.1| putative adenine phosphoribosyltransferase [Arabidopsis thaliana]
 gb|AEE83133.1| adenine phosphoribosyl transferase 4 [Arabidopsis thaliana]
Length=182

 Score =   297 bits (761),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 164/180 (91%), Gaps = 0/180 (0%)
 Frame = -2

Query  853  MSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI  674
            MS     DPRIDGI+++IRVVP FPK GIMFQDITTLLLDPKAFKDTIDLFVERY+  NI
Sbjct  1    MSENEVKDPRIDGIKTKIRVVPDFPKKGIMFQDITTLLLDPKAFKDTIDLFVERYRDMNI  60

Query  673  SIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVE  494
            S+VAGIEARGFIFG  IALAIGAKFVPLRKPKKLPG++I +EY+LEYGSD LEMHV AV+
Sbjct  61   SVVAGIEARGFIFGSPIALAIGAKFVPLRKPKKLPGQIIFEEYELEYGSDRLEMHVEAVD  120

Query  493  AGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
            +GDRALVVDDLIATGGTLCAAM+LL+R GAEV+ECACVIE+P+LKG+ERL GKPLYVLV+
Sbjct  121  SGDRALVVDDLIATGGTLCAAMNLLKRVGAEVIECACVIELPELKGRERLEGKPLYVLVE  180



>emb|CDX94098.1| BnaC07g37320D [Brassica napus]
Length=183

 Score =   297 bits (761),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 144/176 (82%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = -2

Query  841  REDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVA  662
            +E+DPRI+GI+++IRVVP FPK GIMFQDITT+LLDPKAFKDTIDLFVERY+ KNIS+VA
Sbjct  6    QEEDPRINGIKTKIRVVPDFPKKGIMFQDITTVLLDPKAFKDTIDLFVERYRDKNISVVA  65

Query  661  GIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDR  482
            GIEARGF+FGP IALAIGAKFVPLRKPKKLPG+ I +EY+LEYG+D LEMHVGAVEAGDR
Sbjct  66   GIEARGFLFGPPIALAIGAKFVPLRKPKKLPGETIFEEYELEYGNDRLEMHVGAVEAGDR  125

Query  481  ALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
            ALVVDDLIATGGTLCAA++LLER GAEVVECACVIE+P+LKG++RL GKPL +LV+
Sbjct  126  ALVVDDLIATGGTLCAAINLLERVGAEVVECACVIELPELKGRQRLKGKPLCMLVE  181



>ref|XP_009137262.1| PREDICTED: adenine phosphoribosyltransferase 1 isoform X2 [Brassica 
rapa]
 emb|CDX98754.1| BnaA03g45390D [Brassica napus]
Length=183

 Score =   297 bits (760),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 144/176 (82%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = -2

Query  841  REDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVA  662
            +E+DPRI+GI+++IRVVP FPK GIMFQDITT+LLDPKAFKDTIDLFVERY+ KNIS+VA
Sbjct  6    QEEDPRINGIKTKIRVVPDFPKKGIMFQDITTVLLDPKAFKDTIDLFVERYRDKNISVVA  65

Query  661  GIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDR  482
            GIEARGF+FGP IALAIGAKFVPLRKPKKLPG+ I +EY+LEYG+D LEMHVGAVEAGDR
Sbjct  66   GIEARGFLFGPPIALAIGAKFVPLRKPKKLPGETIFEEYELEYGNDRLEMHVGAVEAGDR  125

Query  481  ALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
            ALVVDDLIATGGTLCAA++LLER GAEVVECACVIE+P+LKG++RL GKPL +LV+
Sbjct  126  ALVVDDLIATGGTLCAAINLLERVGAEVVECACVIELPELKGRQRLKGKPLCMLVE  181



>ref|XP_006284605.1| hypothetical protein CARUB_v10005836mg [Capsella rubella]
 ref|XP_010434021.1| PREDICTED: adenine phosphoribosyltransferase 3 [Camelina sativa]
 gb|EOA17503.1| hypothetical protein CARUB_v10005836mg [Capsella rubella]
Length=183

 Score =   297 bits (760),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 144/175 (82%), Positives = 165/175 (94%), Gaps = 0/175 (0%)
 Frame = -2

Query  838  EDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAG  659
            E+DPRI+GI+++IRVVP FPK GIMFQDITT+LLDPKAFKDTIDLFVERY+ KNIS+VAG
Sbjct  7    EEDPRINGIKTKIRVVPDFPKKGIMFQDITTVLLDPKAFKDTIDLFVERYRDKNISVVAG  66

Query  658  IEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRA  479
            IEARGFIFGP IALAIGAKFVPLRKPKKLPG+ I +EY+LEYG+D LEMH+GAVEAGDRA
Sbjct  67   IEARGFIFGPPIALAIGAKFVPLRKPKKLPGETIFEEYELEYGNDRLEMHIGAVEAGDRA  126

Query  478  LVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
            LVVDDLIATGGTLCAA++LLER GAEVVECACVIE+P+LKG++RL GKPL +LV+
Sbjct  127  LVVDDLIATGGTLCAAINLLERVGAEVVECACVIELPELKGRQRLKGKPLCMLVE  181



>ref|NP_001059653.1| Os07g0484800 [Oryza sativa Japonica Group]
 dbj|BAC81171.1| putative adenine phosphoribosyl transferase [Oryza sativa Japonica 
Group]
 dbj|BAF21567.1| Os07g0484800 [Oryza sativa Japonica Group]
 dbj|BAG98416.1| unnamed protein product [Oryza sativa Japonica Group]
Length=187

 Score =   296 bits (759),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 141/174 (81%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = -2

Query  835  DDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGI  656
             DPR   I S IRVVP+FPKPGIMFQDITTLLL+P  FKDTIDLFVERY GK IS+VAG+
Sbjct  11   QDPRTQAIASTIRVVPNFPKPGIMFQDITTLLLNPPVFKDTIDLFVERYTGKGISVVAGV  70

Query  655  EARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRAL  476
            EARGFIFGP IALAIGAKF+PLRKP KLPG+V+ +EY+LEYG+DCLEMHVGAV+ G+RAL
Sbjct  71   EARGFIFGPPIALAIGAKFIPLRKPNKLPGEVMSKEYELEYGADCLEMHVGAVQPGERAL  130

Query  475  VVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
            VVDDL+ATGGTLCAA+ LLERAGAEVVECACVIE+P+LKG+ERLNGKPLYVLV+
Sbjct  131  VVDDLVATGGTLCAAIVLLERAGAEVVECACVIELPELKGRERLNGKPLYVLVE  184



>ref|XP_010455686.1| PREDICTED: adenine phosphoribosyltransferase 4 [Camelina sativa]
Length=182

 Score =   295 bits (755),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 162/180 (90%), Gaps = 0/180 (0%)
 Frame = -2

Query  853  MSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI  674
            MS     DPRIDGI+++IRVVP FPK GIMFQDITTLLLDPKAFKDTIDLFVERY+  NI
Sbjct  1    MSENEVKDPRIDGIKTKIRVVPDFPKKGIMFQDITTLLLDPKAFKDTIDLFVERYRHMNI  60

Query  673  SIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVE  494
            S+VAGIEARGFIFG  IALAIGAKFVPLRKPKKLPG++I +EY+LEYGSD LEMHV AV+
Sbjct  61   SVVAGIEARGFIFGAPIALAIGAKFVPLRKPKKLPGEIIFEEYELEYGSDRLEMHVEAVD  120

Query  493  AGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
            +GDRALVVDDLIATGGTLCAAM+LL R GAEVVECACVIE+P+L G+ERL GKPLYVLV+
Sbjct  121  SGDRALVVDDLIATGGTLCAAMNLLRRVGAEVVECACVIELPELNGRERLEGKPLYVLVE  180



>ref|XP_010448870.1| PREDICTED: adenine phosphoribosyltransferase 3-like [Camelina 
sativa]
Length=183

 Score =   295 bits (755),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 143/175 (82%), Positives = 164/175 (94%), Gaps = 0/175 (0%)
 Frame = -2

Query  838  EDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAG  659
            E+DPRI+GI+++IRVVP FPK GIMFQDITT+LLDPKAFKDTIDLFVERY+ KNIS+VAG
Sbjct  7    EEDPRINGIKTKIRVVPDFPKKGIMFQDITTVLLDPKAFKDTIDLFVERYRDKNISVVAG  66

Query  658  IEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRA  479
            IEARGFIFGP IALAIGAKFVPLRKPKKLPG+ I +EY+LEYG+D LEMH+GAVEAGDRA
Sbjct  67   IEARGFIFGPPIALAIGAKFVPLRKPKKLPGETIFEEYELEYGNDRLEMHIGAVEAGDRA  126

Query  478  LVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
            LVVDDLIATGGTLCAA++LLER G EVVECACVIE+P+LKG++RL GKPL +LV+
Sbjct  127  LVVDDLIATGGTLCAAINLLERVGEEVVECACVIELPELKGRQRLKGKPLCMLVE  181



>ref|XP_006413645.1| hypothetical protein EUTSA_v10026345mg [Eutrema salsugineum]
 gb|ESQ55098.1| hypothetical protein EUTSA_v10026345mg [Eutrema salsugineum]
Length=183

 Score =   295 bits (755),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 145/181 (80%), Positives = 168/181 (93%), Gaps = 1/181 (1%)
 Frame = -2

Query  853  MSAFRED-DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKN  677
            MS  +E+ DPRI+GI+++IRVVP FPK GIMFQDITT+LLDPKAFKDTIDLFVERY+ KN
Sbjct  1    MSGNKEEVDPRINGIKTKIRVVPDFPKKGIMFQDITTVLLDPKAFKDTIDLFVERYRDKN  60

Query  676  ISIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAV  497
            IS+VAGIEARGF+FGP IALAIGAKFVPLRKPKKLPG+ I +EY+LEYG+D LEMHVGAV
Sbjct  61   ISVVAGIEARGFLFGPPIALAIGAKFVPLRKPKKLPGETIFEEYELEYGNDRLEMHVGAV  120

Query  496  EAGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLV  317
            EAGDRALVVDDLIATGGTLCAA++LLER GAEVVECACVIE+P+LKG+++L GKPL +LV
Sbjct  121  EAGDRALVVDDLIATGGTLCAAINLLERVGAEVVECACVIELPELKGRQKLKGKPLCMLV  180

Query  316  Q  314
            +
Sbjct  181  E  181



>ref|NP_193988.1| adenine phosphoribosyl transferase 3 [Arabidopsis thaliana]
 ref|XP_002867761.1| hypothetical protein ARALYDRAFT_492612 [Arabidopsis lyrata subsp. 
lyrata]
 sp|Q9SUW2.1|APT3_ARATH RecName: Full=Adenine phosphoribosyltransferase 3 [Arabidopsis 
thaliana]
 emb|CAA22162.1| adenine phosphoribosyltransferase (EC 2.4.2.7)-like protein [Arabidopsis 
thaliana]
 emb|CAB79212.1| adenine phosphoribosyltransferase (EC 2.4.2.7)-like protein [Arabidopsis 
thaliana]
 gb|AAO22778.1| putative adenine phosphoribosyltransferase [Arabidopsis thaliana]
 gb|AAO42406.1| putative adenine phosphoribosyltransferase [Arabidopsis thaliana]
 gb|EFH44020.1| hypothetical protein ARALYDRAFT_492612 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AEE84625.1| adenine phosphoribosyl transferase 3 [Arabidopsis thaliana]
Length=183

 Score =   295 bits (754),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 143/175 (82%), Positives = 164/175 (94%), Gaps = 0/175 (0%)
 Frame = -2

Query  838  EDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAG  659
            E+DPRI GI+++IRVVP FPK GIMFQDITT+LLDPKAFKDTIDLFVERY+ KNIS+VAG
Sbjct  7    EEDPRIHGIKTKIRVVPDFPKKGIMFQDITTVLLDPKAFKDTIDLFVERYRDKNISVVAG  66

Query  658  IEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRA  479
            IEARGF+FGP IALAIGAKFVPLRKPKKLPG+ I +EY+LEYG+D LEMH+GAVEAGDRA
Sbjct  67   IEARGFLFGPPIALAIGAKFVPLRKPKKLPGETIFEEYELEYGNDRLEMHIGAVEAGDRA  126

Query  478  LVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
            LVVDDLIATGGTLCAA++LLER GAEVVECACVIE+P+LKG++RL GKPL +LV+
Sbjct  127  LVVDDLIATGGTLCAAINLLERVGAEVVECACVIELPELKGRQRLKGKPLCMLVE  181



>gb|KFK28814.1| hypothetical protein AALP_AA7G052500 [Arabis alpina]
Length=183

 Score =   295 bits (754),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 143/175 (82%), Positives = 164/175 (94%), Gaps = 0/175 (0%)
 Frame = -2

Query  838  EDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAG  659
            E+DPRI+GI+++IRVVP FPK GIMFQDITT+LLDPKAFKDTIDLFVERY+ KNIS+VAG
Sbjct  7    EEDPRINGIKTKIRVVPDFPKKGIMFQDITTVLLDPKAFKDTIDLFVERYRDKNISVVAG  66

Query  658  IEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRA  479
            IEARGF+FGP IALAIGAKFVPLRKPKKLPG+ I +EY+LEYG+D LEMHVGAVE GDRA
Sbjct  67   IEARGFLFGPPIALAIGAKFVPLRKPKKLPGETIFEEYELEYGNDRLEMHVGAVEVGDRA  126

Query  478  LVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
            LVVDDLIATGGTLCAA++LLER GAEVVECACVIE+P+LKG++RL GKPL +LV+
Sbjct  127  LVVDDLIATGGTLCAAINLLERVGAEVVECACVIELPELKGRQRLKGKPLCMLVE  181



>gb|AAM61081.1| adenine phosphoribosyltransferase (EC 2.4.2.7)-like protein [Arabidopsis 
thaliana]
Length=183

 Score =   294 bits (752),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 142/175 (81%), Positives = 164/175 (94%), Gaps = 0/175 (0%)
 Frame = -2

Query  838  EDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAG  659
            E+DPRI GI+++IRVVP FPK GIMFQDITT+LLDPKAFKDTIDLFVERY+ KNIS+VAG
Sbjct  7    EEDPRIHGIKTKIRVVPDFPKKGIMFQDITTVLLDPKAFKDTIDLFVERYRDKNISVVAG  66

Query  658  IEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRA  479
            IEARGF+FGP IALAIGAKFVPLRKPKKLPG+ I +EY+LEYG+D LEMH+GAVEAGDR+
Sbjct  67   IEARGFLFGPPIALAIGAKFVPLRKPKKLPGETIFEEYELEYGNDRLEMHIGAVEAGDRS  126

Query  478  LVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
            LVVDDLIATGGTLCAA++LLER GAEVVECACVIE+P+LKG++RL GKPL +LV+
Sbjct  127  LVVDDLIATGGTLCAAINLLERVGAEVVECACVIELPELKGRQRLKGKPLCMLVE  181



>ref|XP_010422208.1| PREDICTED: adenine phosphoribosyltransferase 4-like isoform X1 
[Camelina sativa]
Length=182

 Score =   293 bits (751),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 145/180 (81%), Positives = 162/180 (90%), Gaps = 0/180 (0%)
 Frame = -2

Query  853  MSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI  674
            MS     DPRIDGI+++IRVVP FPK GIMFQDITTLLLDPKAFKDTIDLFVERY+  NI
Sbjct  1    MSENEVKDPRIDGIKTKIRVVPDFPKKGIMFQDITTLLLDPKAFKDTIDLFVERYRHMNI  60

Query  673  SIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVE  494
            S+VAGIEARGFIFG  IALAIGAKFVPLRKPKKLPG++I +EY+LEYGSD LEMHV AV+
Sbjct  61   SVVAGIEARGFIFGTPIALAIGAKFVPLRKPKKLPGEIIFEEYELEYGSDRLEMHVEAVD  120

Query  493  AGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
            +GDRALVVDDLIATGGTLCAAM+LL R GA+VVECACVIE+P+L G+ERL GKPLYVLV+
Sbjct  121  SGDRALVVDDLIATGGTLCAAMNLLRRVGADVVECACVIELPELNGRERLEGKPLYVLVE  180



>ref|NP_001235110.1| uncharacterized protein LOC100526858 [Glycine max]
 gb|ACU15866.1| unknown [Glycine max]
Length=175

 Score =   293 bits (750),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 161/180 (89%), Gaps = 9/180 (5%)
 Frame = -2

Query  853  MSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI  674
            MSA+++ DPR+ GI+++IRVVP+FPK G+MF DITTLLLDPKAFKD+IDLFVERYKGKNI
Sbjct  1    MSAYKDQDPRLHGIKTKIRVVPNFPKSGLMFLDITTLLLDPKAFKDSIDLFVERYKGKNI  60

Query  673  SIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVE  494
            S+VAGIEARGFIFGP IALAIGAKFVPLRKPKKLPGKVI QEY LEYG DCLEMHVGA  
Sbjct  61   SVVAGIEARGFIFGPPIALAIGAKFVPLRKPKKLPGKVISQEYILEYGRDCLEMHVGA--  118

Query  493  AGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
                   VDDLIATGGTLCAAMDLLER GAEVVECACVIE+P+LKG+ERLNGKPL VLV+
Sbjct  119  -------VDDLIATGGTLCAAMDLLERVGAEVVECACVIELPELKGRERLNGKPLCVLVE  171



>ref|XP_009389092.1| PREDICTED: adenine phosphoribosyltransferase 3-like [Musa acuminata 
subsp. malaccensis]
Length=184

 Score =   293 bits (749),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 141/176 (80%), Positives = 160/176 (91%), Gaps = 0/176 (0%)
 Frame = -2

Query  841  REDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVA  662
            +E DPRI  I S IRVVP FPK GIMFQDITTLLLDPKAFKDT DLFVERY GK IS+VA
Sbjct  7    KEQDPRIRRIASSIRVVPDFPKKGIMFQDITTLLLDPKAFKDTADLFVERYTGKGISVVA  66

Query  661  GIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDR  482
            G+EARGFIFGP IALAIGAKF+PLRKP+KLPG+VI + Y LEYG+DCL+MHVGAV+ G+R
Sbjct  67   GVEARGFIFGPPIALAIGAKFIPLRKPRKLPGEVISENYVLEYGTDCLQMHVGAVQPGER  126

Query  481  ALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
            ALVVDDLIATGGTLCAA+ LLERAGAEVVECACVIE+P+LKG+E+LNGKPLY+L++
Sbjct  127  ALVVDDLIATGGTLCAAISLLERAGAEVVECACVIELPELKGREKLNGKPLYILME  182



>ref|XP_006657702.1| PREDICTED: adenine phosphoribosyltransferase 1, chloroplastic-like 
[Oryza brachyantha]
Length=188

 Score =   293 bits (749),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 139/174 (80%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = -2

Query  835  DDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGI  656
             DPR  GI S IRVVP+FPKPGIMFQDITTLL++PK FKDTIDLFVERY GK IS VAG+
Sbjct  12   QDPRTQGIASTIRVVPNFPKPGIMFQDITTLLVNPKVFKDTIDLFVERYTGKGISAVAGV  71

Query  655  EARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRAL  476
            EARGFIFGP IALAIGAKF+PLRKP KLPG+V+ +EY LEYG+DCL+MHVGAV+ G+RAL
Sbjct  72   EARGFIFGPPIALAIGAKFIPLRKPNKLPGEVMSEEYVLEYGADCLQMHVGAVQPGERAL  131

Query  475  VVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
            VVDDL+ATGGTLCAA+ LLERAGAEVVECACVIE+P+LKG+ERL GKPLY+LV+
Sbjct  132  VVDDLVATGGTLCAAIALLERAGAEVVECACVIELPELKGRERLKGKPLYILVE  185



>ref|XP_010433437.1| PREDICTED: adenine phosphoribosyltransferase 4-like isoform X1 
[Camelina sativa]
Length=182

 Score =   292 bits (747),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 145/180 (81%), Positives = 161/180 (89%), Gaps = 0/180 (0%)
 Frame = -2

Query  853  MSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI  674
            MS     DPRIDGI+++IRVVP FPK GIMFQDITTLLLDPKAFKDTIDLFVERY+  NI
Sbjct  1    MSENEVKDPRIDGIKTKIRVVPDFPKKGIMFQDITTLLLDPKAFKDTIDLFVERYRHMNI  60

Query  673  SIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVE  494
            S+VAGIEARGFIFG  IALAIGAKFVPLRKPKKLPG++I +EY+LEYGSD LEMHV AV+
Sbjct  61   SVVAGIEARGFIFGVPIALAIGAKFVPLRKPKKLPGEIIFEEYELEYGSDRLEMHVEAVD  120

Query  493  AGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
            +GDRALVVDDLIATGGTLCAAM+LL R GAEVVECACVIE+P+L G+ERL GK LYVLV+
Sbjct  121  SGDRALVVDDLIATGGTLCAAMNLLRRVGAEVVECACVIELPELNGRERLEGKALYVLVE  180



>ref|XP_009137261.1| PREDICTED: adenine phosphoribosyltransferase 1 isoform X1 [Brassica 
rapa]
Length=190

 Score =   291 bits (744),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 144/183 (79%), Positives = 166/183 (91%), Gaps = 7/183 (4%)
 Frame = -2

Query  841  REDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVA  662
            +E+DPRI+GI+++IRVVP FPK GIMFQDITT+LLDPKAFKDTIDLFVERY+ KNIS+VA
Sbjct  6    QEEDPRINGIKTKIRVVPDFPKKGIMFQDITTVLLDPKAFKDTIDLFVERYRDKNISVVA  65

Query  661  GIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDR  482
            GIEARGF+FGP IALAIGAKFVPLRKPKKLPG+ I +EY+LEYG+D LEMHVGAVEAGDR
Sbjct  66   GIEARGFLFGPPIALAIGAKFVPLRKPKKLPGETIFEEYELEYGNDRLEMHVGAVEAGDR  125

Query  481  ALVVDDLIATGGTLCAAMDLL-------ERAGAEVVECACVIEIPDLKGQERLNGKPLYV  323
            ALVVDDLIATGGTLCAA++LL       ER GAEVVECACVIE+P+LKG++RL GKPL +
Sbjct  126  ALVVDDLIATGGTLCAAINLLEFSWTVSERVGAEVVECACVIELPELKGRQRLKGKPLCM  185

Query  322  LVQ  314
            LV+
Sbjct  186  LVE  188



>gb|KFK31977.1| hypothetical protein AALP_AA6G184400 [Arabis alpina]
Length=182

 Score =   288 bits (738),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 144/180 (80%), Positives = 160/180 (89%), Gaps = 0/180 (0%)
 Frame = -2

Query  853  MSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI  674
            MS    +DPRI GI+++IRVVP FPK GIMFQDITTLLLDPKAF+DTIDLFVERY+  NI
Sbjct  1    MSGNEVNDPRIYGIKTKIRVVPDFPKKGIMFQDITTLLLDPKAFQDTIDLFVERYRDMNI  60

Query  673  SIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVE  494
            S+VAGIEARGFIFG  IALAIGAKFVPLRKPKKLPG+ I +EY+LEYGSD LEMHV AV 
Sbjct  61   SVVAGIEARGFIFGSPIALAIGAKFVPLRKPKKLPGETIFEEYELEYGSDRLEMHVEAVN  120

Query  493  AGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
             GDRALV+DDLIATGGTLCAAM+LLER GAEVVECACVIE+P+LKG+ERL GKPL VLV+
Sbjct  121  PGDRALVIDDLIATGGTLCAAMNLLERVGAEVVECACVIELPELKGRERLGGKPLCVLVE  180



>ref|XP_009407806.1| PREDICTED: adenine phosphoribosyltransferase 4-like [Musa acuminata 
subsp. malaccensis]
Length=184

 Score =   288 bits (737),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 140/176 (80%), Positives = 159/176 (90%), Gaps = 0/176 (0%)
 Frame = -2

Query  841  REDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVA  662
            ++ D RI  I S IRVVP FPK GIMFQDITTLLL+PKAFKDT+DLFVE+Y G+ IS+VA
Sbjct  7    KKQDTRIQRIASSIRVVPDFPKKGIMFQDITTLLLEPKAFKDTVDLFVEQYTGRGISVVA  66

Query  661  GIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDR  482
            G+EARGFIFGP IALAIGAKFVPLRKP+KLPG+VI + Y LEYGSDCLEMHVGAV+ G+R
Sbjct  67   GVEARGFIFGPPIALAIGAKFVPLRKPRKLPGEVISENYILEYGSDCLEMHVGAVQPGER  126

Query  481  ALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
            ALVVDDLIATGGTLCAA+ LLERAGAEV+ECACVIE+P+LKG+ RLNGKPLYVLV+
Sbjct  127  ALVVDDLIATGGTLCAAISLLERAGAEVLECACVIELPELKGRGRLNGKPLYVLVE  182



>gb|EEE67177.1| hypothetical protein OsJ_24266 [Oryza sativa Japonica Group]
Length=202

 Score =   288 bits (736),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 141/189 (75%), Positives = 159/189 (84%), Gaps = 15/189 (8%)
 Frame = -2

Query  835  DDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGI  656
             DPR   I S IRVVP+FPKPGIMFQDITTLLL+P  FKDTIDLFVERY GK IS+VAG+
Sbjct  11   QDPRTQAIASTIRVVPNFPKPGIMFQDITTLLLNPPVFKDTIDLFVERYTGKGISVVAGV  70

Query  655  EARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRAL  476
            EARGFIFGP IALAIGAKF+PLRKP KLPG+V+ +EY+LEYG+DCLEMHVGAV+ G+RAL
Sbjct  71   EARGFIFGPPIALAIGAKFIPLRKPNKLPGEVMSKEYELEYGADCLEMHVGAVQPGERAL  130

Query  475  VVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDL---------------KGQERLN  341
            VVDDL+ATGGTLCAA+ LLERAGAEVVECACVIE+P+L               KG+ERLN
Sbjct  131  VVDDLVATGGTLCAAIVLLERAGAEVVECACVIELPELKATESVASHTCLTLPKGRERLN  190

Query  340  GKPLYVLVQ  314
            GKPLYVLV+
Sbjct  191  GKPLYVLVE  199



>ref|XP_004238096.2| PREDICTED: adenine phosphoribosyltransferase 1, chloroplastic-like 
[Solanum lycopersicum]
Length=180

 Score =   286 bits (733),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 142/173 (82%), Positives = 156/173 (90%), Gaps = 0/173 (0%)
 Frame = -2

Query  832  DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIE  653
            D RI GI S IRV+P FPKPGIMFQDITTLLLDPKAFKDTIDLFVERYK KNIS+VAGIE
Sbjct  8    DERIAGIASAIRVIPDFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKDKNISVVAGIE  67

Query  652  ARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALV  473
            ARGFIFGP IALAIGAKFVP+RKPKKLPG+VI +EY LEYG+D +EMHVGAV+AG+RALV
Sbjct  68   ARGFIFGPPIALAIGAKFVPMRKPKKLPGEVISEEYSLEYGTDKIEMHVGAVQAGERALV  127

Query  472  VDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
            VDDLIATGGTL AA+ LLER G EVVECACVIE+P+LKG+ERL  KPL+VLV 
Sbjct  128  VDDLIATGGTLSAAIRLLERVGVEVVECACVIELPELKGRERLGDKPLFVLVS  180



>ref|XP_006413644.1| hypothetical protein EUTSA_v10026345mg [Eutrema salsugineum]
 gb|ESQ55097.1| hypothetical protein EUTSA_v10026345mg [Eutrema salsugineum]
Length=181

 Score =   286 bits (733),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 143/181 (79%), Positives = 166/181 (92%), Gaps = 3/181 (2%)
 Frame = -2

Query  853  MSAFRED-DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKN  677
            MS  +E+ DPRI+GI+++IRVVP FPK GIMFQDITT+LLDPKAFKDTIDLFVERY+ KN
Sbjct  1    MSGNKEEVDPRINGIKTKIRVVPDFPKKGIMFQDITTVLLDPKAFKDTIDLFVERYRDKN  60

Query  676  ISIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAV  497
            IS+VA  EARGF+FGP IALAIGAKFVPLRKPKKLPG+ I +EY+LEYG+D LEMHVGAV
Sbjct  61   ISVVA--EARGFLFGPPIALAIGAKFVPLRKPKKLPGETIFEEYELEYGNDRLEMHVGAV  118

Query  496  EAGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLV  317
            EAGDRALVVDDLIATGGTLCAA++LLER GAEVVECACVIE+P+LKG+++L GKPL +LV
Sbjct  119  EAGDRALVVDDLIATGGTLCAAINLLERVGAEVVECACVIELPELKGRQKLKGKPLCMLV  178

Query  316  Q  314
            +
Sbjct  179  E  179



>gb|EEC82040.1| hypothetical protein OsI_26014 [Oryza sativa Indica Group]
Length=202

 Score =   286 bits (733),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 140/189 (74%), Positives = 158/189 (84%), Gaps = 15/189 (8%)
 Frame = -2

Query  835  DDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGI  656
             DPR   I S IRVVP+FPKPGIMFQDITTLLL+P  FKDTIDLFVERY GK IS+VAG+
Sbjct  11   QDPRTQAIASTIRVVPNFPKPGIMFQDITTLLLNPPVFKDTIDLFVERYTGKGISVVAGV  70

Query  655  EARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRAL  476
            EARGFIFGP IALAIGAKF+PLRKP KLPG+V+ +EY+LEYG+DCLEMHVGAV+  +RAL
Sbjct  71   EARGFIFGPPIALAIGAKFIPLRKPNKLPGEVMSKEYELEYGADCLEMHVGAVQPSERAL  130

Query  475  VVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDL---------------KGQERLN  341
            VVDDL+ATGGTLCAA+ LLERAGAEVVECACVIE+P+L               KG+ERLN
Sbjct  131  VVDDLVATGGTLCAAIVLLERAGAEVVECACVIELPELKATESVASHTCLTLPKGRERLN  190

Query  340  GKPLYVLVQ  314
            GKPLYVLV+
Sbjct  191  GKPLYVLVE  199



>ref|XP_006433626.1| hypothetical protein CICLE_v10002024mg [Citrus clementina]
 gb|ESR46866.1| hypothetical protein CICLE_v10002024mg [Citrus clementina]
Length=295

 Score =   289 bits (740),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 147/221 (67%), Positives = 173/221 (78%), Gaps = 5/221 (2%)
 Frame = -2

Query  964  SPYIFSPFQ---PFSFLSAFHLLSITLLSFFLHFTRQCRTMSA--FREDDPRIDGIQSRI  800
            SP+I +P     P +    + +    L S     + Q + M++   +  DPRI GI S I
Sbjct  74   SPWIAAPSSVRLPLNRSQNYRIALPPLHSTVSGDSTQPQQMASADVKAQDPRIAGISSAI  133

Query  799  RVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIEARGFIFGPSIA  620
            RV+P FPKPGIMFQDITTLLLD KAF+DTIDLFVERYK KNIS+VAGIEARGFIFGP IA
Sbjct  134  RVIPDFPKPGIMFQDITTLLLDTKAFRDTIDLFVERYKDKNISVVAGIEARGFIFGPPIA  193

Query  619  LAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALVVDDLIATGGTL  440
            LAIGAKFVP+RKPKKLPG+VI +EY LEYG D +EMHVGAV+AG+RAL+VDDL+ATGGTL
Sbjct  194  LAIGAKFVPMRKPKKLPGEVISEEYSLEYGKDVMEMHVGAVQAGERALIVDDLVATGGTL  253

Query  439  CAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLV  317
             AA+ LLER G  VVECACVIE+P+LKG+ERL  KPL+VLV
Sbjct  254  SAAIRLLERVGVHVVECACVIELPELKGRERLGEKPLFVLV  294



>ref|XP_010422209.1| PREDICTED: adenine phosphoribosyltransferase 4-like isoform X2 
[Camelina sativa]
Length=180

 Score =   285 bits (728),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 143/180 (79%), Positives = 160/180 (89%), Gaps = 2/180 (1%)
 Frame = -2

Query  853  MSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI  674
            MS     DPRIDGI+++IRVVP FPK GIMFQDITTLLLDPKAFKDTIDLFVERY+  NI
Sbjct  1    MSENEVKDPRIDGIKTKIRVVPDFPKKGIMFQDITTLLLDPKAFKDTIDLFVERYRHMNI  60

Query  673  SIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVE  494
            S+VA  EARGFIFG  IALAIGAKFVPLRKPKKLPG++I +EY+LEYGSD LEMHV AV+
Sbjct  61   SVVA--EARGFIFGTPIALAIGAKFVPLRKPKKLPGEIIFEEYELEYGSDRLEMHVEAVD  118

Query  493  AGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
            +GDRALVVDDLIATGGTLCAAM+LL R GA+VVECACVIE+P+L G+ERL GKPLYVLV+
Sbjct  119  SGDRALVVDDLIATGGTLCAAMNLLRRVGADVVECACVIELPELNGRERLEGKPLYVLVE  178



>ref|XP_006472289.1| PREDICTED: adenine phosphoribosyltransferase 1, chloroplastic-like 
[Citrus sinensis]
Length=274

 Score =   288 bits (737),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 147/221 (67%), Positives = 173/221 (78%), Gaps = 5/221 (2%)
 Frame = -2

Query  964  SPYIFSPFQ---PFSFLSAFHLLSITLLSFFLHFTRQCRTMSA--FREDDPRIDGIQSRI  800
            SP+I +P     P +    + +    L S     + Q + M++   +  DPRI GI S I
Sbjct  53   SPWIAAPSSVRLPLNRSQNYRIALPPLHSTVSGDSTQPQQMASADVKAQDPRIAGISSAI  112

Query  799  RVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIEARGFIFGPSIA  620
            RV+P FPKPGIMFQDITTLLLD KAF+DTIDLFVERYK KNIS+VAGIEARGFIFGP IA
Sbjct  113  RVIPDFPKPGIMFQDITTLLLDTKAFRDTIDLFVERYKDKNISVVAGIEARGFIFGPPIA  172

Query  619  LAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALVVDDLIATGGTL  440
            LAIGAKFVP+RKPKKLPG+VI +EY LEYG D +EMHVGAV+AG+RAL+VDDL+ATGGTL
Sbjct  173  LAIGAKFVPMRKPKKLPGEVISEEYSLEYGKDVMEMHVGAVQAGERALIVDDLVATGGTL  232

Query  439  CAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLV  317
             AA+ LLER G  VVECACVIE+P+LKG+ERL  KPL+VLV
Sbjct  233  SAAIRLLERVGVHVVECACVIELPELKGRERLGEKPLFVLV  273



>gb|KDP41633.1| hypothetical protein JCGZ_16040 [Jatropha curcas]
Length=252

 Score =   287 bits (735),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 139/184 (76%), Positives = 159/184 (86%), Gaps = 0/184 (0%)
 Frame = -2

Query  865  QCRTMSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYK  686
            Q R M+   E DPRI+ I S IRV+P FPK GI+FQDITTLLLD +AFKDTIDLFVERYK
Sbjct  66   QVRGMAGQDEKDPRIERISSSIRVIPDFPKKGILFQDITTLLLDTRAFKDTIDLFVERYK  125

Query  685  GKNISIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHV  506
            GK+IS+VAGIEARGFIFGP IALAIGAKFVP+RKP KLPG+VI +EY LEYG D +EMHV
Sbjct  126  GKDISVVAGIEARGFIFGPPIALAIGAKFVPMRKPNKLPGEVISEEYSLEYGKDVMEMHV  185

Query  505  GAVEAGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLY  326
            GAV+ G+RALV+DDLIATGGTLCAA+ LLER G +VVECACVIE+P+LKG+ERL  KPL+
Sbjct  186  GAVQEGERALVIDDLIATGGTLCAAIRLLERVGVDVVECACVIELPELKGRERLGDKPLF  245

Query  325  VLVQ  314
            VLV 
Sbjct  246  VLVS  249



>ref|XP_010091232.1| Adenine phosphoribosyltransferase 1 [Morus notabilis]
 gb|EXB43795.1| Adenine phosphoribosyltransferase 1 [Morus notabilis]
Length=262

 Score =   287 bits (735),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 141/182 (77%), Positives = 157/182 (86%), Gaps = 0/182 (0%)
 Frame = -2

Query  859  RTMSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGK  680
            R M++    D RI  I S IRV+P+FPKPGIMFQDITTLLLD KAFKDTIDLFVERYK K
Sbjct  79   REMASEDGQDLRIARIASAIRVIPNFPKPGIMFQDITTLLLDTKAFKDTIDLFVERYKDK  138

Query  679  NISIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGA  500
             IS+VAGIEARGFIFGP IALAIGAKFVP+RKP KLPG VI +EY LEYG+D +EMHVGA
Sbjct  139  AISVVAGIEARGFIFGPPIALAIGAKFVPMRKPNKLPGAVISEEYSLEYGTDKMEMHVGA  198

Query  499  VEAGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVL  320
            VEAG+RALV+DDLIATGGTLCAA+ LLER G EVVECACVIE+P+LKG+ERL  KPL+VL
Sbjct  199  VEAGERALVIDDLIATGGTLCAAIRLLERVGVEVVECACVIELPELKGRERLGNKPLFVL  258

Query  319  VQ  314
            V 
Sbjct  259  VN  260



>ref|XP_008377969.1| PREDICTED: adenine phosphoribosyltransferase 1-like [Malus domestica]
Length=249

 Score =   286 bits (732),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 140/184 (76%), Positives = 158/184 (86%), Gaps = 0/184 (0%)
 Frame = -2

Query  865  QCRTMSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYK  686
            +   M+A    DPR+  I S IRV+P FPKPGI+FQDITTLLLD KAFKDTIDLFVERYK
Sbjct  63   KVEAMAAEDGQDPRLARISSAIRVIPDFPKPGILFQDITTLLLDTKAFKDTIDLFVERYK  122

Query  685  GKNISIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHV  506
             K IS+VAG+EARGFIFGP IALAIGAKFVPLRKPKKLPGKVI +EY LEYG+D +EMHV
Sbjct  123  DKEISVVAGVEARGFIFGPPIALAIGAKFVPLRKPKKLPGKVISEEYSLEYGTDTMEMHV  182

Query  505  GAVEAGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLY  326
            GAVEAG+RAL++DDLIATGGTL AA+ LLER G  VVECACVIE+P+LKG+ERL GKPL+
Sbjct  183  GAVEAGERALIIDDLIATGGTLGAAIRLLERVGVHVVECACVIELPELKGRERLAGKPLF  242

Query  325  VLVQ  314
            VLV 
Sbjct  243  VLVS  246



>gb|ABK24246.1| unknown [Picea sitchensis]
Length=182

 Score =   284 bits (726),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 158/180 (88%), Gaps = 0/180 (0%)
 Frame = -2

Query  853  MSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI  674
            MSA  + D R+ GI   IRVVP FPKPGIMFQDITTLLLD KAF+D ID+FVERYK KNI
Sbjct  1    MSASEDGDARVQGIFDAIRVVPDFPKPGIMFQDITTLLLDHKAFRDCIDIFVERYKDKNI  60

Query  673  SIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVE  494
            S+VAGIEARGFIFGP IALAIGAKFVP+RKPKKLPG+VI +EY LEYG+D +EMHVGAV+
Sbjct  61   SVVAGIEARGFIFGPPIALAIGAKFVPIRKPKKLPGEVISEEYALEYGTDRIEMHVGAVQ  120

Query  493  AGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
             GDR LVVDDLIATGGTL AAM LLER GAEVVECACVIE+P+LKG+ERL GKPL++LV+
Sbjct  121  PGDRTLVVDDLIATGGTLSAAMRLLERVGAEVVECACVIELPELKGRERLGGKPLFILVE  180



>ref|XP_010433445.1| PREDICTED: adenine phosphoribosyltransferase 4-like isoform X2 
[Camelina sativa]
Length=180

 Score =   283 bits (725),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 143/180 (79%), Positives = 159/180 (88%), Gaps = 2/180 (1%)
 Frame = -2

Query  853  MSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI  674
            MS     DPRIDGI+++IRVVP FPK GIMFQDITTLLLDPKAFKDTIDLFVERY+  NI
Sbjct  1    MSENEVKDPRIDGIKTKIRVVPDFPKKGIMFQDITTLLLDPKAFKDTIDLFVERYRHMNI  60

Query  673  SIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVE  494
            S+VA  EARGFIFG  IALAIGAKFVPLRKPKKLPG++I +EY+LEYGSD LEMHV AV+
Sbjct  61   SVVA--EARGFIFGVPIALAIGAKFVPLRKPKKLPGEIIFEEYELEYGSDRLEMHVEAVD  118

Query  493  AGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
            +GDRALVVDDLIATGGTLCAAM+LL R GAEVVECACVIE+P+L G+ERL GK LYVLV+
Sbjct  119  SGDRALVVDDLIATGGTLCAAMNLLRRVGAEVVECACVIELPELNGRERLEGKALYVLVE  178



>ref|XP_002285252.1| PREDICTED: adenine phosphoribosyltransferase 1, chloroplastic 
isoform X1 [Vitis vinifera]
 emb|CBI19413.3| unnamed protein product [Vitis vinifera]
Length=182

 Score =   283 bits (725),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 139/180 (77%), Positives = 158/180 (88%), Gaps = 0/180 (0%)
 Frame = -2

Query  853  MSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI  674
            M++    D RI  I S IRV+P FPKPGIMFQDITTLLLDP+AFKDTIDLFVERYKGKNI
Sbjct  1    MASEDAQDHRIARISSAIRVIPDFPKPGIMFQDITTLLLDPQAFKDTIDLFVERYKGKNI  60

Query  673  SIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVE  494
            S+VAGIEARGFIFGP IALAIGAKFVP+RKP KLPG VI QEY LEYG+D +EMHVGAV+
Sbjct  61   SVVAGIEARGFIFGPPIALAIGAKFVPMRKPNKLPGAVISQEYALEYGTDKIEMHVGAVQ  120

Query  493  AGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
            AG+RALV+DDLIATGGTLCAA++LLER   +VVECACVIE+P+LKG++RL  KPL+VLV 
Sbjct  121  AGERALVIDDLIATGGTLCAAINLLERVEVDVVECACVIELPELKGRDRLGDKPLFVLVS  180



>ref|XP_006362057.1| PREDICTED: adenine phosphoribosyltransferase 1, chloroplastic-like 
[Solanum tuberosum]
Length=268

 Score =   286 bits (733),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 141/173 (82%), Positives = 155/173 (90%), Gaps = 0/173 (0%)
 Frame = -2

Query  832  DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIE  653
            D RI GI S IRV+P FPKPGIMFQDITTLLLDPKAFKDTIDLFVERYK KNIS+VAGIE
Sbjct  96   DERIAGIASAIRVIPDFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKDKNISVVAGIE  155

Query  652  ARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALV  473
            ARGFIFGP IALAIGAKFVP+RKPKKLPG+VI +EY LEYG+D +EMHVGAV+AG+RALV
Sbjct  156  ARGFIFGPPIALAIGAKFVPMRKPKKLPGEVISEEYSLEYGTDKMEMHVGAVQAGERALV  215

Query  472  VDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
            VDDLIATGGTL AA+ LLER G EV ECACVIE+P+LKG+ERL  KPL+VLV 
Sbjct  216  VDDLIATGGTLTAAIRLLERVGVEVFECACVIELPELKGRERLGDKPLFVLVS  268



>ref|XP_008444567.1| PREDICTED: adenine phosphoribosyltransferase 1, chloroplastic 
isoform X2 [Cucumis melo]
Length=183

 Score =   283 bits (724),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 139/180 (77%), Positives = 158/180 (88%), Gaps = 0/180 (0%)
 Frame = -2

Query  853  MSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI  674
            M++  + DPRI  I   IRV+P FPKPGI+FQDITTLLLD KAFKDTIDLFVERY+GK+I
Sbjct  1    MASTDKQDPRIPKISKAIRVIPDFPKPGILFQDITTLLLDTKAFKDTIDLFVERYRGKDI  60

Query  673  SIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVE  494
            S+VAGIEARGFIFGP IALAIGAKFVP+RKPKKLPG+VI +EY LEYG+D +EMHVGAVE
Sbjct  61   SVVAGIEARGFIFGPPIALAIGAKFVPMRKPKKLPGEVISEEYSLEYGTDKIEMHVGAVE  120

Query  493  AGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
            AG+RALV+DDLIATGGTLCAA+ LLER G EVVECACVIE+  LKG+ERL  KPL+VLV 
Sbjct  121  AGERALVIDDLIATGGTLCAAISLLERVGVEVVECACVIELDGLKGRERLGDKPLFVLVN  180



>gb|ABK26880.1| unknown [Picea sitchensis]
 gb|ABK26961.1| unknown [Picea sitchensis]
 gb|ACN40689.1| unknown [Picea sitchensis]
Length=182

 Score =   283 bits (723),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 158/180 (88%), Gaps = 0/180 (0%)
 Frame = -2

Query  853  MSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI  674
            MSA  + D R+ GI   IRVVP FPKPGIMFQDITTLLLD KAF+D ID+FVERYK KNI
Sbjct  1    MSASVDGDARVQGIFDAIRVVPDFPKPGIMFQDITTLLLDHKAFRDCIDIFVERYKDKNI  60

Query  673  SIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVE  494
            S+VAGIEARGFIFGP IALAIGAKFVP+RKPKKLPG+VI +EY LEYG+D +EMHVGAV+
Sbjct  61   SVVAGIEARGFIFGPPIALAIGAKFVPIRKPKKLPGEVISEEYALEYGTDRIEMHVGAVQ  120

Query  493  AGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
             GDR LVVDDLIATGGTL AAM LLER GAEVVECACVIE+P+LKG+ERL GKPL++LV+
Sbjct  121  PGDRTLVVDDLIATGGTLSAAMRLLERVGAEVVECACVIELPELKGRERLGGKPLFILVE  180



>gb|ADD09567.1| adeninephosphoribosyl transferase [Trifolium repens]
 gb|ADD09581.1| adeninephosphoribosyl transferase [Trifolium repens]
Length=186

 Score =   283 bits (723),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 134/176 (76%), Positives = 158/176 (90%), Gaps = 0/176 (0%)
 Frame = -2

Query  841  REDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVA  662
            ++ DPRI GI S IR++P FPKPGIMFQDITTLLLD KAFKDTIDLFVERY+ +NIS+VA
Sbjct  7    KDQDPRIAGISSAIRIIPDFPKPGIMFQDITTLLLDTKAFKDTIDLFVERYRDQNISVVA  66

Query  661  GIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDR  482
            G+EARGFIFGP IALAIGAKFVP+RKPKKLPG+VI +EY LEYG+D +EMHVGAV+ G+R
Sbjct  67   GVEARGFIFGPPIALAIGAKFVPMRKPKKLPGEVISEEYSLEYGTDKIEMHVGAVKPGER  126

Query  481  ALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
            ALV+DDLIATGGTLCAA+ LLER G  VVECACVIE+P+LKG+E+L GK L++LV+
Sbjct  127  ALVIDDLIATGGTLCAAIKLLERVGVTVVECACVIELPELKGREKLGGKSLFILVE  182



>gb|AFK48306.1| unknown [Medicago truncatula]
 gb|KEH35806.1| adenine phosphoribosyltransferase-like protein [Medicago truncatula]
Length=184

 Score =   283 bits (723),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 135/180 (75%), Positives = 158/180 (88%), Gaps = 0/180 (0%)
 Frame = -2

Query  853  MSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI  674
            M++    DPRI  I S IR++P FPKPGIMFQDITTLLLD KAFKDTIDLFVERY+ +NI
Sbjct  1    MASKDSQDPRIARISSSIRIIPDFPKPGIMFQDITTLLLDTKAFKDTIDLFVERYRDQNI  60

Query  673  SIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVE  494
            S+VAG+EARGFIFGP IALAIGAKFVP+RKPKKLPG+VI +EY LEYG+D +EMHVGAV+
Sbjct  61   SVVAGVEARGFIFGPPIALAIGAKFVPMRKPKKLPGEVISEEYSLEYGTDKIEMHVGAVQ  120

Query  493  AGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
             G+RALV+DDLIATGGTLCAA+ LLER G  VVECACVIE+P+LKG+ +L GKPL+VLV+
Sbjct  121  TGERALVIDDLIATGGTLCAAIKLLERVGVTVVECACVIELPELKGRAKLGGKPLFVLVE  180



>ref|XP_010546549.1| PREDICTED: adenine phosphoribosyltransferase 5-like [Tarenaya 
hassleriana]
Length=213

 Score =   283 bits (725),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 134/177 (76%), Positives = 157/177 (89%), Gaps = 0/177 (0%)
 Frame = -2

Query  838  EDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAG  659
            E DPR+  I   IRV+P+FPK GIMFQDITTLLLDPKAFK T+D+FV+RY+   IS+VAG
Sbjct  9    EGDPRLQAISEAIRVIPNFPKKGIMFQDITTLLLDPKAFKHTVDIFVDRYRDMKISVVAG  68

Query  658  IEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRA  479
            +EARGF+FGP IALAIGAKFVPLRKP+KLPG+VI QEY+LEYG DCLEMHVGAV  G+RA
Sbjct  69   VEARGFMFGPPIALAIGAKFVPLRKPRKLPGEVISQEYELEYGEDCLEMHVGAVVPGERA  128

Query  478  LVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQEK  308
            LV+DDL+ATGGTLCAA++LLER GAEVVECACVI +PD+KGQERL GKPLY+LV+ +
Sbjct  129  LVIDDLVATGGTLCAAINLLERMGAEVVECACVIGLPDVKGQERLKGKPLYILVEPR  185



>gb|ABK24001.1| unknown [Picea sitchensis]
 gb|ABK25813.1| unknown [Picea sitchensis]
Length=182

 Score =   282 bits (722),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 137/182 (75%), Positives = 163/182 (90%), Gaps = 0/182 (0%)
 Frame = -2

Query  853  MSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI  674
            M+A ++ D R+ GI S IRVVP+FPKPGIMFQDITTLLLDPKAF+D ID+FV+RYK K I
Sbjct  1    MAACKDGDLRVRGISSAIRVVPNFPKPGIMFQDITTLLLDPKAFRDAIDIFVDRYKDKEI  60

Query  673  SIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVE  494
            S+VAGIEARGF+FGP IALAIGAKFVP+RKP+KLPG+VI +EY LEYG D LEMHVGAV+
Sbjct  61   SVVAGIEARGFLFGPPIALAIGAKFVPMRKPRKLPGEVIAEEYVLEYGKDRLEMHVGAVQ  120

Query  493  AGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
             G+RAL+VDDLIATGGTLCAA+ LLERAGAEVVECACVIE+P+LKG+ +L+GK LY+LV+
Sbjct  121  PGERALIVDDLIATGGTLCAAIKLLERAGAEVVECACVIELPELKGRGKLDGKALYILVE  180

Query  313  EK  308
             +
Sbjct  181  SR  182



>ref|XP_008444565.1| PREDICTED: adenine phosphoribosyltransferase 1 isoform X1 [Cucumis 
melo]
Length=261

 Score =   285 bits (729),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 149/229 (65%), Positives = 171/229 (75%), Gaps = 17/229 (7%)
 Frame = -2

Query  1000 NCILHSLFHSIYSPYIFSPFQPFSFLSAFHLLSITLLSFFLHFTRQCRTMSAFREDDPRI  821
            +C  H L H    P  FSP                 L   +  T   + M++  + DPRI
Sbjct  47   SCRTHLLTHFPQHPSSFSP-----------------LRCNVRKTVPDQEMASTDKQDPRI  89

Query  820  DGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIEARGF  641
              I   IRV+P FPKPGI+FQDITTLLLD KAFKDTIDLFVERY+GK+IS+VAGIEARGF
Sbjct  90   PKISKAIRVIPDFPKPGILFQDITTLLLDTKAFKDTIDLFVERYRGKDISVVAGIEARGF  149

Query  640  IFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALVVDDL  461
            IFGP IALAIGAKFVP+RKPKKLPG+VI +EY LEYG+D +EMHVGAVEAG+RALV+DDL
Sbjct  150  IFGPPIALAIGAKFVPMRKPKKLPGEVISEEYSLEYGTDKIEMHVGAVEAGERALVIDDL  209

Query  460  IATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
            IATGGTLCAA+ LLER G EVVECACVIE+  LKG+ERL  KPL+VLV 
Sbjct  210  IATGGTLCAAISLLERVGVEVVECACVIELDGLKGRERLGDKPLFVLVN  258



>ref|XP_007226017.1| hypothetical protein PRUPE_ppa010396mg [Prunus persica]
 gb|EMJ27216.1| hypothetical protein PRUPE_ppa010396mg [Prunus persica]
Length=251

 Score =   285 bits (728),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 140/184 (76%), Positives = 156/184 (85%), Gaps = 0/184 (0%)
 Frame = -2

Query  865  QCRTMSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYK  686
            Q R M+A    DPR+  I S IRV+P FPKPGI+FQDITTLLLD KAFKDTIDLFVERYK
Sbjct  65   QVRAMAAEDGKDPRLARISSAIRVIPDFPKPGILFQDITTLLLDTKAFKDTIDLFVERYK  124

Query  685  GKNISIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHV  506
             K IS+VAGIEARGFIFGP IALAIGAKFVP+RKP KLPGKVI +EY LEYG+D +EMHV
Sbjct  125  DKEISVVAGIEARGFIFGPPIALAIGAKFVPMRKPNKLPGKVISEEYSLEYGTDIMEMHV  184

Query  505  GAVEAGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLY  326
            GAVEAG+RAL++DDLIATGGTL AA+ LLER G  VVECACVIE+P LKG+ERL  KPL+
Sbjct  185  GAVEAGERALIIDDLIATGGTLGAALRLLERVGVHVVECACVIELPGLKGRERLGDKPLF  244

Query  325  VLVQ  314
            VLV 
Sbjct  245  VLVN  248



>ref|XP_009354103.1| PREDICTED: LOW QUALITY PROTEIN: adenine phosphoribosyltransferase 
1-like [Pyrus x bretschneideri]
Length=249

 Score =   284 bits (727),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 139/184 (76%), Positives = 158/184 (86%), Gaps = 0/184 (0%)
 Frame = -2

Query  865  QCRTMSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYK  686
            +   M+A    DPR+  I S IRV+P FPKPGI+FQDITTLLLD KAFKDTIDLFVERYK
Sbjct  63   KVEAMAAEDSRDPRLARISSAIRVIPDFPKPGILFQDITTLLLDTKAFKDTIDLFVERYK  122

Query  685  GKNISIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHV  506
             K IS+VAG+EARGFIFGP IALAIGAKFVP+RKPKKLPGKVI +EY LEYG+D +EMHV
Sbjct  123  DKEISVVAGVEARGFIFGPPIALAIGAKFVPMRKPKKLPGKVISEEYSLEYGTDTMEMHV  182

Query  505  GAVEAGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLY  326
            GAVEAG+RAL++DDLIATGGTL AA+ LLER GA VVECACVIE+P+LKG+ERL  KPL+
Sbjct  183  GAVEAGERALIIDDLIATGGTLGAAIRLLERVGAHVVECACVIELPELKGRERLAEKPLF  242

Query  325  VLVQ  314
            VLV 
Sbjct  243  VLVS  246



>ref|XP_008220317.1| PREDICTED: adenine phosphoribosyltransferase 1-like [Prunus mume]
Length=251

 Score =   284 bits (727),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 139/184 (76%), Positives = 156/184 (85%), Gaps = 0/184 (0%)
 Frame = -2

Query  865  QCRTMSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYK  686
            Q R M+A    DPR+  I S IRV+P FPKPGI+FQDITTLLLD KAFKDTIDLFVERYK
Sbjct  65   QVRAMAAEDGKDPRLARISSAIRVIPDFPKPGILFQDITTLLLDTKAFKDTIDLFVERYK  124

Query  685  GKNISIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHV  506
             K IS+VAG+EARGFIFGP IALAIGAKFVP+RKP KLPGKVI +EY LEYG+D +EMHV
Sbjct  125  DKEISVVAGVEARGFIFGPPIALAIGAKFVPMRKPNKLPGKVISEEYSLEYGTDIMEMHV  184

Query  505  GAVEAGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLY  326
            GAVEAG+RAL++DDLIATGGTL AA+ LLER G  VVECACVIE+P LKG+ERL  KPL+
Sbjct  185  GAVEAGERALIIDDLIATGGTLGAALRLLERVGVHVVECACVIELPGLKGRERLGDKPLF  244

Query  325  VLVQ  314
            VLV 
Sbjct  245  VLVN  248



>ref|XP_011039673.1| PREDICTED: adenine phosphoribosyltransferase 5-like [Populus 
euphratica]
Length=191

 Score =   281 bits (720),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 131/178 (74%), Positives = 159/178 (89%), Gaps = 0/178 (0%)
 Frame = -2

Query  838  EDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAG  659
            + DPR+ GI   IRVVPHFPK GIMFQDITTLLLD KAFKDT+D+FV+RY+  NIS+VAG
Sbjct  9    KSDPRLQGISEAIRVVPHFPKQGIMFQDITTLLLDHKAFKDTVDIFVDRYRDMNISVVAG  68

Query  658  IEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRA  479
            +EARGF+FGP+IALAIGAKFVPLRKP+KLPG+VI + Y+LEYG+DCLE+HVGAV+ G+RA
Sbjct  69   VEARGFMFGPAIALAIGAKFVPLRKPRKLPGEVISEAYELEYGTDCLEIHVGAVQPGERA  128

Query  478  LVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQEKK  305
            +V+DDL+ATGGTL AA+ LLER GAEV+ECACVI +PD KGQ RLNGKPLY+LV+ ++
Sbjct  129  IVIDDLVATGGTLSAAISLLERVGAEVIECACVIGVPDAKGQCRLNGKPLYILVEPRQ  186



>ref|XP_002510107.1| Adenine phosphoribosyltransferase, putative [Ricinus communis]
 gb|EEF52294.1| Adenine phosphoribosyltransferase, putative [Ricinus communis]
Length=253

 Score =   284 bits (726),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 137/183 (75%), Positives = 160/183 (87%), Gaps = 0/183 (0%)
 Frame = -2

Query  865  QCRTMSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYK  686
            Q + M+A  + D RI+ I S IRV+P FPKPGI+FQDITTLLLD KAFKDTIDLFVERYK
Sbjct  68   QNQKMAAQDDKDNRIERISSSIRVIPDFPKPGILFQDITTLLLDTKAFKDTIDLFVERYK  127

Query  685  GKNISIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHV  506
             ++IS+VAGIEARGFIFGP IALAIGAKFVP+RKP KLPG+V+ +EY LEYG+D +EMHV
Sbjct  128  ERDISVVAGIEARGFIFGPPIALAIGAKFVPMRKPNKLPGEVVSEEYSLEYGTDKMEMHV  187

Query  505  GAVEAGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLY  326
            GAV+AG+RALV+DDLIATGGTLCAA+ LLER G EVVECACVIE+P+LKG+ERL   PL+
Sbjct  188  GAVQAGERALVIDDLIATGGTLCAAIRLLERVGVEVVECACVIELPELKGRERLGQTPLF  247

Query  325  VLV  317
            VLV
Sbjct  248  VLV  250



>gb|KHG27880.1| Adenine phosphoribosyltransferase 1, chloroplastic -like protein 
[Gossypium arboreum]
Length=240

 Score =   283 bits (724),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 134/182 (74%), Positives = 157/182 (86%), Gaps = 0/182 (0%)
 Frame = -2

Query  856  TMSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKN  677
             M++  E DPRI  I S IRV+P FPKPGI+FQDITTLLLD KAF+DTIDLFVERY+GK+
Sbjct  58   NMASQDEQDPRISNISSAIRVIPDFPKPGIIFQDITTLLLDTKAFRDTIDLFVERYRGKD  117

Query  676  ISIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAV  497
            IS+VAGIEARGFIFGP IALAIGAKFVP+RKP KLPG+V+ +EY LEYG D +EMHV AV
Sbjct  118  ISVVAGIEARGFIFGPPIALAIGAKFVPMRKPNKLPGEVLSEEYSLEYGKDTMEMHVDAV  177

Query  496  EAGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLV  317
            +AG+RAL++DDL+ATGGTL AA+ LLER G  VVECACVIE+P+LKG+ERL GKPL+VLV
Sbjct  178  KAGERALIIDDLVATGGTLSAAISLLERVGVHVVECACVIELPELKGRERLGGKPLFVLV  237

Query  316  QE  311
              
Sbjct  238  SS  239



>ref|XP_006368185.1| hypothetical protein POPTR_0001s00360g [Populus trichocarpa]
 gb|ERP64754.1| hypothetical protein POPTR_0001s00360g [Populus trichocarpa]
Length=157

 Score =   280 bits (716),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 136/153 (89%), Positives = 149/153 (97%), Gaps = 0/153 (0%)
 Frame = -2

Query  772  GIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIEARGFIFGPSIALAIGAKFVP  593
            GIMFQDITTLLL+PKAFKDTIDLFVERYKGKNIS+VAGIEARGFIFGP IALAIGAKFVP
Sbjct  3    GIMFQDITTLLLNPKAFKDTIDLFVERYKGKNISVVAGIEARGFIFGPPIALAIGAKFVP  62

Query  592  LRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALVVDDLIATGGTLCAAMDLLER  413
            LRKP+KLPG+VI ++Y LEYG DCLEMHVGAV++G+RALVVDDLIATGGTLCAAM+LLER
Sbjct  63   LRKPRKLPGEVISEKYILEYGRDCLEMHVGAVKSGERALVVDDLIATGGTLCAAMNLLER  122

Query  412  AGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
            AGAEVVECACVIE+PDLKG+ERLNGKPLYVLV+
Sbjct  123  AGAEVVECACVIELPDLKGRERLNGKPLYVLVE  155



>ref|XP_010272349.1| PREDICTED: adenine phosphoribosyltransferase 1, chloroplastic 
[Nelumbo nucifera]
Length=182

 Score =   281 bits (718),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 139/180 (77%), Positives = 157/180 (87%), Gaps = 0/180 (0%)
 Frame = -2

Query  853  MSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI  674
            M+A    D R+  I S IRV+P FPKPGIMFQDITTLLLD KAFKDTID+FVERY+ KNI
Sbjct  1    MAAEDGHDHRLARIASSIRVIPDFPKPGIMFQDITTLLLDTKAFKDTIDMFVERYRDKNI  60

Query  673  SIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVE  494
            S+VAG+EARGFIFGP IALAIGAKFVPLRKPKKLPG+VI +EY LEYG+D +EMHVGAVE
Sbjct  61   SVVAGVEARGFIFGPPIALAIGAKFVPLRKPKKLPGEVISEEYSLEYGTDKMEMHVGAVE  120

Query  493  AGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
            AG+RALV+DDLIATGGTL AA+ LLER G EVVECACVIE+P+LKG+ERL  KPL+VLV 
Sbjct  121  AGERALVIDDLIATGGTLAAAIKLLERVGVEVVECACVIELPELKGRERLGDKPLFVLVS  180



>ref|XP_002308672.1| adenine phosphoribosyltransferase 2 family protein [Populus trichocarpa]
 gb|EEE92195.1| adenine phosphoribosyltransferase 2 family protein [Populus trichocarpa]
Length=191

 Score =   281 bits (719),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 130/179 (73%), Positives = 160/179 (89%), Gaps = 0/179 (0%)
 Frame = -2

Query  838  EDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAG  659
            + DPR+ GI   IRVVPHFPK GIMFQDITTLLLD K FKDT+D+FV+RY+  NIS+VAG
Sbjct  9    KSDPRLQGISEAIRVVPHFPKQGIMFQDITTLLLDHKVFKDTVDIFVDRYRDMNISVVAG  68

Query  658  IEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRA  479
            +EARGF+FGP+IALAIGAKFVPLRKP+KLPG+VI + Y+LEYG+DCLE+HVGAV+ G+RA
Sbjct  69   VEARGFMFGPAIALAIGAKFVPLRKPRKLPGEVISEAYELEYGTDCLEIHVGAVQPGERA  128

Query  478  LVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQEKKL  302
            +V+DDL+ATGGTL AA+ LLER GAEV+ECACVI +PD+KGQ RLNGKPLY+LV+ +++
Sbjct  129  IVIDDLVATGGTLSAAISLLERVGAEVIECACVIGVPDIKGQCRLNGKPLYILVEPRQI  187



>ref|XP_004501529.1| PREDICTED: adenine phosphoribosyltransferase 1, chloroplastic-like 
isoform X5 [Cicer arietinum]
Length=240

 Score =   283 bits (723),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 147/227 (65%), Positives = 174/227 (77%), Gaps = 8/227 (4%)
 Frame = -2

Query  988  HSLFHSIYSPYIFSP--FQPFSFLSAFHLLSITLLSFFLHFTRQCRTMSAFREDDPRIDG  815
            +SLF S  +P + S   F P S      + + T  S  L   R     S  ++ DPRI  
Sbjct  16   NSLFGSAVTPTLPSSLRFPPLSL----TIPNSTSSSIRLRSLRSSEMAS--QDQDPRIAR  69

Query  814  IQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIEARGFIF  635
            I S IRV+P FPKPGIMFQDITTLLLD KAFKDTIDLFVERY+ +NIS+VAG+EARGFIF
Sbjct  70   ISSAIRVIPDFPKPGIMFQDITTLLLDTKAFKDTIDLFVERYRDQNISVVAGVEARGFIF  129

Query  634  GPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALVVDDLIA  455
            GP IALAIGAKFVP+RKPKKLPG+VI +EY LEYG+D +EMHVGAV+ G+RALV+DDLIA
Sbjct  130  GPPIALAIGAKFVPMRKPKKLPGEVISEEYSLEYGTDKIEMHVGAVQPGERALVIDDLIA  189

Query  454  TGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
            TGGTLCAA+ LLER    VVECACVIE+P+LKG+ERL  + L+VLV+
Sbjct  190  TGGTLCAAIKLLERVEVTVVECACVIELPELKGRERLGDRSLFVLVE  236



>gb|ABB86271.1| adenine phosphoribosyltransferase-like [Solanum tuberosum]
Length=182

 Score =   281 bits (718),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 140/173 (81%), Positives = 154/173 (89%), Gaps = 0/173 (0%)
 Frame = -2

Query  832  DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIE  653
            D RI GI S IRV+P FPKPGIMFQDITTLLLDPKAFKDTIDLFVERYK KNIS+VAGIE
Sbjct  10   DERIAGIASAIRVIPDFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKDKNISVVAGIE  69

Query  652  ARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALV  473
            ARGFIFGP IALAIGAKFVP+RKPKKLPG+VI +EY LEYG+D +EMHVGAV+AG+ ALV
Sbjct  70   ARGFIFGPPIALAIGAKFVPMRKPKKLPGEVISEEYSLEYGTDKMEMHVGAVQAGECALV  129

Query  472  VDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
            VDDLIATGGTL AA+ LLER G EV ECACVIE+P+LKG+ERL  KPL+VLV 
Sbjct  130  VDDLIATGGTLSAAIRLLERVGVEVFECACVIELPELKGRERLGDKPLFVLVS  182



>ref|XP_008445234.1| PREDICTED: adenine phosphoribosyltransferase 2-like [Cucumis 
melo]
Length=191

 Score =   281 bits (718),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 159/177 (90%), Gaps = 0/177 (0%)
 Frame = -2

Query  832  DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIE  653
            DPR+ GI   IRVVPHFPKPGIMFQDITTLLLD KAFKDT+D+FV+RY+G NIS+VAG+E
Sbjct  11   DPRLQGISQAIRVVPHFPKPGIMFQDITTLLLDHKAFKDTVDIFVDRYRGMNISVVAGVE  70

Query  652  ARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALV  473
            ARGF+FGPSIAL+IGAKFVPLRKP+KLPG+VI + YDLEYG+DCLEM + AV+ G+RALV
Sbjct  71   ARGFMFGPSIALSIGAKFVPLRKPRKLPGEVISEAYDLEYGTDCLEMQIDAVKTGERALV  130

Query  472  VDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQEKKL  302
            +DDL+ATGGTL AA+ LLER GAEVVECACV+ + ++KGQ RL+GKPLY+LV+ ++L
Sbjct  131  IDDLVATGGTLSAAIRLLERMGAEVVECACVVGLREVKGQRRLDGKPLYILVEPRQL  187



>ref|XP_004138720.1| PREDICTED: adenine phosphoribosyltransferase 2-like [Cucumis 
sativus]
 ref|XP_004170530.1| PREDICTED: adenine phosphoribosyltransferase 2-like [Cucumis 
sativus]
 gb|KGN62962.1| hypothetical protein Csa_2G381870 [Cucumis sativus]
Length=191

 Score =   281 bits (718),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 159/177 (90%), Gaps = 0/177 (0%)
 Frame = -2

Query  832  DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIE  653
            DPR+ GI   IRVVPHFPKPGIMFQDITTLLLD KAFKDT+D+FV+RY+G NIS+VAG+E
Sbjct  11   DPRLQGISQAIRVVPHFPKPGIMFQDITTLLLDHKAFKDTVDIFVDRYRGMNISVVAGVE  70

Query  652  ARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALV  473
            ARGF+FGPSIAL+IGAKFVPLRKP+KLPG+VI + YDLEYG+DCLEM + AV+ G+RALV
Sbjct  71   ARGFMFGPSIALSIGAKFVPLRKPRKLPGEVISEAYDLEYGTDCLEMQIDAVKTGERALV  130

Query  472  VDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQEKKL  302
            +DDL+ATGGTL AA+ LLER GAEVVECACV+ + ++KGQ RL+GKPLY+LV+ ++L
Sbjct  131  IDDLVATGGTLSAAIRLLERMGAEVVECACVVGLREVKGQRRLDGKPLYILVEPRQL  187



>ref|XP_004963031.1| PREDICTED: adenine phosphoribosyltransferase 1-like [Setaria 
italica]
Length=243

 Score =   283 bits (723),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 137/181 (76%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = -2

Query  856  TMSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKN  677
            T  A    D R+ GI S IRV+P FPKPGIMFQDITTLLLDPKAF+DTIDLFVERYK + 
Sbjct  61   TAVAMASGDARVAGIASSIRVIPDFPKPGIMFQDITTLLLDPKAFRDTIDLFVERYKDQG  120

Query  676  ISIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAV  497
            I++VAG+EARGFIFGP IALAIGAKFVPLRKPKKLPG+VI +EY LEYG+D +EMHVGAV
Sbjct  121  ITVVAGVEARGFIFGPPIALAIGAKFVPLRKPKKLPGEVISEEYSLEYGTDKIEMHVGAV  180

Query  496  EAGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLV  317
            EA DRALVVDDLIATGGTLCAA+ LLER GA+VVECACVIE+P+LKG+++L  +P++VLV
Sbjct  181  EANDRALVVDDLIATGGTLCAAVKLLERVGAKVVECACVIELPELKGRDKLGDRPVFVLV  240

Query  316  Q  314
            +
Sbjct  241  K  241



>ref|XP_007018522.1| Adenine phosphoribosyl transferase 1 isoform 1 [Theobroma cacao]
 ref|XP_007018523.1| Adenine phosphoribosyl transferase 1 isoform 1 [Theobroma cacao]
 gb|EOY15747.1| Adenine phosphoribosyl transferase 1 isoform 1 [Theobroma cacao]
 gb|EOY15748.1| Adenine phosphoribosyl transferase 1 isoform 1 [Theobroma cacao]
Length=256

 Score =   283 bits (724),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 147/231 (64%), Positives = 173/231 (75%), Gaps = 5/231 (2%)
 Frame = -2

Query  1000 NCILHSLFHSIYSPYIFSPFQP--FSFLSAFHLLSITLLSFFLHFTRQCRTMSAFREDDP  827
            N +         +PY  SP QP      +    L   L S     T Q + M++  E DP
Sbjct  27   NAVFPERNRGWIAPY--SPLQPPELRLRNYQRALPPVLCSGSDSVTNQ-QQMASQDERDP  83

Query  826  RIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIEAR  647
            RI  I S IRV+P FPKPGI+FQDITTLLLD KAF+DTIDLFVERY+GK+IS+VAGIEAR
Sbjct  84   RISKISSVIRVIPDFPKPGILFQDITTLLLDIKAFRDTIDLFVERYRGKDISVVAGIEAR  143

Query  646  GFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALVVD  467
            GFIFGP IALAIGAKFVP+RKP KLPG+VI +EY LEYG+D +EMHVGAV+AGDRAL++D
Sbjct  144  GFIFGPPIALAIGAKFVPMRKPNKLPGEVISEEYSLEYGTDKMEMHVGAVQAGDRALIID  203

Query  466  DLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
            DL+ATGGTL AA+ LLER G  VVECACVIE+P+LKG+ERL   PL+VLV 
Sbjct  204  DLVATGGTLSAAIRLLERVGVHVVECACVIELPELKGRERLGDTPLFVLVS  254



>ref|XP_010919500.1| PREDICTED: adenine phosphoribosyltransferase 1 isoform X2 [Elaeis 
guineensis]
Length=168

 Score =   280 bits (715),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 134/161 (83%), Positives = 151/161 (94%), Gaps = 0/161 (0%)
 Frame = -2

Query  841  REDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVA  662
            RE DPRI+GI S IRVVP+FPKPGIMFQDITTLLLDPKAFK+T+DLFVERY GK+I++VA
Sbjct  7    REQDPRIEGIASSIRVVPNFPKPGIMFQDITTLLLDPKAFKNTVDLFVERYTGKDITVVA  66

Query  661  GIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDR  482
            GIEARGFIFGP IALAIGAKF+PLRKP+KLPG+VI +EY LEYG+DCL+MH+GAV  GDR
Sbjct  67   GIEARGFIFGPPIALAIGAKFIPLRKPRKLPGEVISEEYVLEYGTDCLQMHIGAVHPGDR  126

Query  481  ALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLK  359
            ALVVDDLIATGGTLCAA+ LLERAGAEVVECACVIE+P+LK
Sbjct  127  ALVVDDLIATGGTLCAAIKLLERAGAEVVECACVIELPELK  167



>ref|XP_004142889.1| PREDICTED: adenine phosphoribosyltransferase 1, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004168429.1| PREDICTED: adenine phosphoribosyltransferase 1, chloroplastic-like 
[Cucumis sativus]
 gb|KGN62454.1| hypothetical protein Csa_2G354800 [Cucumis sativus]
Length=260

 Score =   283 bits (723),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 143/200 (72%), Positives = 164/200 (82%), Gaps = 0/200 (0%)
 Frame = -2

Query  913  HLLSITLLSFFLHFTRQCRTMSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLD  734
            H  S + L   +  T   + M+   + DPRI  I   IRV+P FPKPGI+FQDITTLLLD
Sbjct  58   HTSSFSPLRCNVRKTVPDQVMAPTDKQDPRIPKISKAIRVIPDFPKPGILFQDITTLLLD  117

Query  733  PKAFKDTIDLFVERYKGKNISIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIR  554
             KAFKDTIDLFVERY+GK+IS+VAGIEARGFIFGP IALAIGAKFVP+RKPKKLPG+VI 
Sbjct  118  TKAFKDTIDLFVERYRGKDISVVAGIEARGFIFGPPIALAIGAKFVPMRKPKKLPGEVIS  177

Query  553  QEYDLEYGSDCLEMHVGAVEAGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIE  374
            +EY LEYG+D +EMHVGAVEAG+RALV+DDLIATGGTLCAA+ LLER G EVVECACVIE
Sbjct  178  EEYSLEYGTDKIEMHVGAVEAGERALVIDDLIATGGTLCAAIRLLERVGVEVVECACVIE  237

Query  373  IPDLKGQERLNGKPLYVLVQ  314
            +  LKG+ERL  KPL+VLV 
Sbjct  238  LDGLKGRERLGDKPLFVLVN  257



>ref|XP_010241565.1| PREDICTED: adenine phosphoribosyltransferase 5-like isoform X1 
[Nelumbo nucifera]
Length=189

 Score =   280 bits (716),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 133/177 (75%), Positives = 158/177 (89%), Gaps = 0/177 (0%)
 Frame = -2

Query  832  DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIE  653
            DPR+  I   IRVVPHFPKPGIMFQDITTLLLD KAFKDT+D+FV+RY+  +IS+VAG+E
Sbjct  11   DPRLQAISEAIRVVPHFPKPGIMFQDITTLLLDHKAFKDTVDIFVDRYRDMDISVVAGVE  70

Query  652  ARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALV  473
            ARGF+FGPSIALAIGAKFVPLRKP+KLPG+VI + Y LEYG+DCLEMHVGAV+ G+RALV
Sbjct  71   ARGFMFGPSIALAIGAKFVPLRKPRKLPGEVISESYVLEYGTDCLEMHVGAVQPGERALV  130

Query  472  VDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQEKKL  302
            +DDL+ATGGTL AA+ LLER GAEVVECACVI +P+ KG+ RLNGKPLY+LV+ ++L
Sbjct  131  IDDLVATGGTLSAAIRLLERVGAEVVECACVIGLPENKGERRLNGKPLYILVEPREL  187



>ref|XP_010999861.1| PREDICTED: adenine phosphoribosyltransferase 1-like [Populus 
euphratica]
Length=255

 Score =   282 bits (722),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 140/186 (75%), Positives = 159/186 (85%), Gaps = 1/186 (1%)
 Frame = -2

Query  868  RQCRTM-SAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVER  692
            +Q R M +A  + DPRI  I S IRV+P FPKPGIMFQDITTLLLD KAFKDTIDLFVER
Sbjct  68   KQDREMATADEQQDPRIARISSAIRVIPDFPKPGIMFQDITTLLLDTKAFKDTIDLFVER  127

Query  691  YKGKNISIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEM  512
            Y+ KNIS+VAG+EARGFIFGP IALAIGAKFVP+RKP KLPG+VI +EY LEYG+D +EM
Sbjct  128  YRDKNISVVAGVEARGFIFGPPIALAIGAKFVPMRKPNKLPGEVISEEYSLEYGTDKMEM  187

Query  511  HVGAVEAGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKP  332
            HVGAVEAG+RALV+DDLIATGGTLCAA+ LLER G  VVECACVIE+  LKG+ERL  +P
Sbjct  188  HVGAVEAGERALVIDDLIATGGTLCAAVKLLERVGVHVVECACVIELLGLKGRERLGDRP  247

Query  331  LYVLVQ  314
            L+VLV 
Sbjct  248  LFVLVN  253



>gb|AID51452.1| adenine phosphoribosyl transferase [Astragalus membranaceus]
Length=251

 Score =   282 bits (722),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 135/178 (76%), Positives = 157/178 (88%), Gaps = 0/178 (0%)
 Frame = -2

Query  847  AFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISI  668
            A ++ D RI  I S IRV+P FPKPGIMFQDITTLLLD KAFKDTIDLFVERY+ +NIS+
Sbjct  70   ASKDQDQRIAKISSAIRVIPDFPKPGIMFQDITTLLLDTKAFKDTIDLFVERYRDQNISV  129

Query  667  VAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAG  488
            VAGIEARGFIFGP IALAIGAKFVP+RKPKKLPG+VI +EY LEYG+D +EMHVGAV+AG
Sbjct  130  VAGIEARGFIFGPPIALAIGAKFVPMRKPKKLPGEVISEEYSLEYGTDKIEMHVGAVQAG  189

Query  487  DRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
            +RAL++DDLIATGGTLCAA+ LLER G  VVECACVIE+P+LKG+ERL  K L++LV+
Sbjct  190  ERALIIDDLIATGGTLCAAIKLLERVGVNVVECACVIELPELKGRERLGDKSLFILVE  247



>ref|XP_010250184.1| PREDICTED: adenine phosphoribosyltransferase 5 [Nelumbo nucifera]
 ref|XP_010250185.1| PREDICTED: adenine phosphoribosyltransferase 5 [Nelumbo nucifera]
 ref|XP_010250186.1| PREDICTED: adenine phosphoribosyltransferase 5 [Nelumbo nucifera]
Length=189

 Score =   280 bits (715),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 133/177 (75%), Positives = 158/177 (89%), Gaps = 0/177 (0%)
 Frame = -2

Query  832  DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIE  653
            DPR+  I   IRVVPHFPKPGIMFQDITTLLLD KAFKDT+D+FV+RY+  +IS+VAG+E
Sbjct  11   DPRLQAISEAIRVVPHFPKPGIMFQDITTLLLDHKAFKDTVDIFVDRYRDMDISVVAGVE  70

Query  652  ARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALV  473
            ARGF+FGPSIALAIGAKFVPLRKP+KLPG+VI + Y LEYG+DCLEMHVGAV+ G+RALV
Sbjct  71   ARGFMFGPSIALAIGAKFVPLRKPRKLPGEVISEAYVLEYGTDCLEMHVGAVQPGERALV  130

Query  472  VDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQEKKL  302
            +DDL+ATGGTL AA+ LLER GAEVVECACVI +P+ KG+ RLNGKPLY+LV+ ++L
Sbjct  131  IDDLVATGGTLSAAIRLLERVGAEVVECACVIGLPENKGERRLNGKPLYILVEPREL  187



>ref|XP_008792565.1| PREDICTED: adenine phosphoribosyltransferase 1-like [Phoenix 
dactylifera]
Length=224

 Score =   281 bits (718),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 137/182 (75%), Positives = 161/182 (88%), Gaps = 0/182 (0%)
 Frame = -2

Query  859  RTMSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGK  680
            + M++    D R+  I S IRV+P FPKPGIMFQDITTLLLD KAF+DTID+FVERY+ K
Sbjct  42   KAMASEDGKDHRLARISSSIRVIPDFPKPGIMFQDITTLLLDHKAFRDTIDIFVERYREK  101

Query  679  NISIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGA  500
            NISIVAGIEARGFIFGP IALAIGAKFVP+RKPKKLPG+VI +EY LEYG+D +EMHVGA
Sbjct  102  NISIVAGIEARGFIFGPPIALAIGAKFVPMRKPKKLPGEVISEEYALEYGTDKMEMHVGA  161

Query  499  VEAGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVL  320
            V+ GDRALV+DDLIATGGTLCAA+ L+ERAGAEVVECACVIE+P+LKG+ERL  +P++VL
Sbjct  162  VQPGDRALVIDDLIATGGTLCAAVRLIERAGAEVVECACVIELPELKGRERLGDRPVFVL  221

Query  319  VQ  314
            V+
Sbjct  222  VK  223



>tpg|DAA55001.1| TPA: adenine phosphoribosyltransferase 1 [Zea mays]
Length=223

 Score =   281 bits (718),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 135/185 (73%), Positives = 162/185 (88%), Gaps = 0/185 (0%)
 Frame = -2

Query  868  RQCRTMSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERY  689
            R+ + + A    D R+ GI S IRV+P FPKPGIMFQDITTLLLDPKAF+DTIDLFVERY
Sbjct  36   RRGQAVVAMASADARLAGIASSIRVIPDFPKPGIMFQDITTLLLDPKAFRDTIDLFVERY  95

Query  688  KGKNISIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMH  509
            K + I++VAG+EARGFIFGP IALAIGAKFVPLRKPKKLPG+VI +EY LEYG+D +EMH
Sbjct  96   KDQGITVVAGVEARGFIFGPPIALAIGAKFVPLRKPKKLPGEVISEEYSLEYGTDKIEMH  155

Query  508  VGAVEAGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPL  329
            VGAV+A DRALVVDDLIATGGTLCAA+ L+ER GA+VVECACVIE+P+LKG+++L  +P+
Sbjct  156  VGAVQANDRALVVDDLIATGGTLCAAVKLIERVGAKVVECACVIELPELKGRDKLGDRPV  215

Query  328  YVLVQ  314
            +VLV+
Sbjct  216  FVLVE  220



>ref|XP_002443459.1| hypothetical protein SORBIDRAFT_08g019790 [Sorghum bicolor]
 gb|EES17297.1| hypothetical protein SORBIDRAFT_08g019790 [Sorghum bicolor]
Length=227

 Score =   281 bits (718),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 136/185 (74%), Positives = 161/185 (87%), Gaps = 0/185 (0%)
 Frame = -2

Query  868  RQCRTMSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERY  689
            R  + + A    D R+ GI S IRV+P FPKPGIMFQDITTLLLDPKAF+DTIDLFVERY
Sbjct  40   RGRQAVVAMASADARLAGIASSIRVIPDFPKPGIMFQDITTLLLDPKAFRDTIDLFVERY  99

Query  688  KGKNISIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMH  509
            K + I++VAG+EARGFIFGP IALAIGAKFVPLRKPKKLPG+VI +EY LEYG+D +EMH
Sbjct  100  KDQGITVVAGVEARGFIFGPPIALAIGAKFVPLRKPKKLPGEVISEEYSLEYGTDKIEMH  159

Query  508  VGAVEAGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPL  329
            VGAV+A DRALVVDDLIATGGTLCAA+ LLER GA+VVECACVIE+P+LKG+++L  +P+
Sbjct  160  VGAVQANDRALVVDDLIATGGTLCAAVKLLERVGAKVVECACVIELPELKGRDKLGDRPV  219

Query  328  YVLVQ  314
            +VLV+
Sbjct  220  FVLVE  224



>gb|ACF84896.1| unknown [Zea mays]
 gb|ACF86183.1| unknown [Zea mays]
 gb|ACN29058.1| unknown [Zea mays]
 tpg|DAA47299.1| TPA: adenine phosphoribosyltransferase 1 [Zea mays]
Length=180

 Score =   279 bits (713),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 133/173 (77%), Positives = 157/173 (91%), Gaps = 0/173 (0%)
 Frame = -2

Query  832  DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIE  653
            D R+ GI S IRV+P FPKPGIMFQDITTLLLDPKAF+DTIDLFVERYK + I++VAG+E
Sbjct  5    DARLAGIASSIRVIPDFPKPGIMFQDITTLLLDPKAFRDTIDLFVERYKDQGITVVAGVE  64

Query  652  ARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALV  473
            ARGFIFGP IALAIGAKFVPLRKPKKLPG+VI +EY LEYG+D +EMHVGAV+A DRALV
Sbjct  65   ARGFIFGPPIALAIGAKFVPLRKPKKLPGEVISEEYSLEYGTDKIEMHVGAVQANDRALV  124

Query  472  VDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
            VDDLIATGGTLCAA+ L+ER GA+VVECACVIE+P+LKG+++L  +P++VLV+
Sbjct  125  VDDLIATGGTLCAAVKLIERVGAKVVECACVIELPELKGRDKLGDRPVFVLVE  177



>ref|XP_006841148.1| hypothetical protein AMTR_s00086p00140110 [Amborella trichopoda]
 gb|ERN02823.1| hypothetical protein AMTR_s00086p00140110 [Amborella trichopoda]
Length=170

 Score =   278 bits (711),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 133/165 (81%), Positives = 150/165 (91%), Gaps = 0/165 (0%)
 Frame = -2

Query  853  MSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI  674
            MS    +DPRI GI S IRVVP+FPKPGIMFQDITTLLLDP+AFK+T+DLFVERYKGKNI
Sbjct  1    MSTCNNEDPRIHGIASSIRVVPNFPKPGIMFQDITTLLLDPQAFKNTVDLFVERYKGKNI  60

Query  673  SIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVE  494
            S+VAGIEARGFIFGP IAL IGAKFVPLRKP+KLPG+VI +EY LEYG DCLEMH+GAV+
Sbjct  61   SVVAGIEARGFIFGPPIALEIGAKFVPLRKPRKLPGEVISEEYVLEYGRDCLEMHIGAVQ  120

Query  493  AGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLK  359
             GDRALVVDDL+ATGGTLCAA++LLER GA+VVECACVI +P+LK
Sbjct  121  QGDRALVVDDLVATGGTLCAAINLLERVGADVVECACVIGLPELK  165



>ref|XP_008219511.1| PREDICTED: adenine phosphoribosyltransferase 2 isoform X2 [Prunus 
mume]
Length=191

 Score =   279 bits (713),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 158/177 (89%), Gaps = 0/177 (0%)
 Frame = -2

Query  832  DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIE  653
            DPR+  I   IRVVPHFPKPGIMFQDITTLLLD KAFK T+D+FV+RY+  +IS+VAG+E
Sbjct  11   DPRLQAISEAIRVVPHFPKPGIMFQDITTLLLDHKAFKHTVDIFVDRYRDMDISVVAGVE  70

Query  652  ARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALV  473
            ARGF+FGPSIALAIGAKFVPLRKP+KLPG+VI + Y+LEYG+DCLEMHVGAV+ G+RALV
Sbjct  71   ARGFMFGPSIALAIGAKFVPLRKPRKLPGEVISEAYELEYGTDCLEMHVGAVQPGERALV  130

Query  472  VDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQEKKL  302
            +DDLIATGGTL AA+ LLER GAEVVEC CV+ +P++KGQ RLNGKPLY+LV+ +++
Sbjct  131  IDDLIATGGTLSAAITLLERVGAEVVECGCVVGLPEVKGQCRLNGKPLYILVEPREI  187



>gb|KHG06934.1| Adenine phosphoribosyltransferase 2 -like protein [Gossypium 
arboreum]
Length=191

 Score =   279 bits (713),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 158/177 (89%), Gaps = 0/177 (0%)
 Frame = -2

Query  832  DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIE  653
            DPR+  I   IRVVPHFPKPGIMFQDITTLLLD KAFKDT+D+FV+RY+  +IS+VAG+E
Sbjct  11   DPRLQAISDAIRVVPHFPKPGIMFQDITTLLLDHKAFKDTVDIFVDRYRDMDISVVAGVE  70

Query  652  ARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALV  473
            ARGF+FGPSIALAIGAKFVPLRKP+KLPG+VI + YDLEYGSDCLEMHVGAV+ G+R +V
Sbjct  71   ARGFMFGPSIALAIGAKFVPLRKPRKLPGEVIAETYDLEYGSDCLEMHVGAVQPGERVIV  130

Query  472  VDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQEKKL  302
            +DDL+ATGGTL AA+ LLER GA+VVECACVI + ++KGQ RLNGKPLY+LV+ +++
Sbjct  131  IDDLVATGGTLSAAIRLLERVGAQVVECACVIGLREVKGQRRLNGKPLYILVEPREI  187



>ref|XP_007223517.1| hypothetical protein PRUPE_ppa011918mg [Prunus persica]
 gb|EMJ24716.1| hypothetical protein PRUPE_ppa011918mg [Prunus persica]
Length=191

 Score =   278 bits (712),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 158/177 (89%), Gaps = 0/177 (0%)
 Frame = -2

Query  832  DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIE  653
            DPR+  I   IRVVPHFPKPGIMFQDITTLLLD KAFK T+D+FV+RY+  +IS+VAG+E
Sbjct  11   DPRLQAISEAIRVVPHFPKPGIMFQDITTLLLDHKAFKHTVDIFVDRYRDMDISVVAGVE  70

Query  652  ARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALV  473
            ARGF+FGPSIALAIGAKFVPLRKP+KLPG+VI + Y+LEYG+DCLEMHVGAV+ G+RAL+
Sbjct  71   ARGFMFGPSIALAIGAKFVPLRKPRKLPGEVISEAYELEYGTDCLEMHVGAVQPGERALI  130

Query  472  VDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQEKKL  302
            +DDLIATGGTL AA+ LLER GAEVVEC CVI +P++KGQ RLNGKPLY+LV+ +++
Sbjct  131  IDDLIATGGTLSAAITLLERVGAEVVECGCVIGLPEVKGQCRLNGKPLYILVEPREI  187



>ref|XP_004501528.1| PREDICTED: adenine phosphoribosyltransferase 1, chloroplastic-like 
isoform X4 [Cicer arietinum]
Length=248

 Score =   280 bits (717),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 146/230 (63%), Positives = 176/230 (77%), Gaps = 6/230 (3%)
 Frame = -2

Query  988  HSLFHSIYSPYIFSP--FQPFSFL---SAFHLLSITLLSFFLHFTRQCRTMSAFREDDPR  824
            +SLF S  +P + S   F P S     S    + +  L      + Q   M++ ++ DPR
Sbjct  16   NSLFGSAVTPTLPSSLRFPPLSLTIPNSTSSSIRLRSLRSSASDSSQVTEMAS-QDQDPR  74

Query  823  IDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIEARG  644
            I  I S IRV+P FPKPGIMFQDITTLLLD KAFKDTIDLFVERY+ +NIS+VAG+EARG
Sbjct  75   IARISSAIRVIPDFPKPGIMFQDITTLLLDTKAFKDTIDLFVERYRDQNISVVAGVEARG  134

Query  643  FIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALVVDD  464
            FIFGP IALAIGAKFVP+RKPKKLPG+VI +EY LEYG+D +EMHVGAV+ G+RALV+DD
Sbjct  135  FIFGPPIALAIGAKFVPMRKPKKLPGEVISEEYSLEYGTDKIEMHVGAVQPGERALVIDD  194

Query  463  LIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
            LIATGGTLCAA+ LLER    VVECACVIE+P+LKG+ERL  + L+VLV+
Sbjct  195  LIATGGTLCAAIKLLERVEVTVVECACVIELPELKGRERLGDRSLFVLVE  244



>emb|CBI36342.3| unnamed protein product [Vitis vinifera]
Length=186

 Score =   278 bits (711),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/178 (76%), Positives = 156/178 (88%), Gaps = 0/178 (0%)
 Frame = -2

Query  838  EDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAG  659
            + DPR+  I   IRVVPHFPK GIMFQDITTLLLD KAFKDT+D+FV+RY+   IS+VAG
Sbjct  9    QGDPRLKAISEAIRVVPHFPKQGIMFQDITTLLLDHKAFKDTVDIFVDRYRDMGISVVAG  68

Query  658  IEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRA  479
            +EARGF+FGPSIALAIGAKFVPLRKPKKLPG+VI + Y LEYG+D LEMHVGAV+ G+RA
Sbjct  69   VEARGFMFGPSIALAIGAKFVPLRKPKKLPGEVISEAYVLEYGTDRLEMHVGAVQPGERA  128

Query  478  LVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQEKK  305
            LV+DDLIATGGTLCAA+ LLER GAEVVECACVI +P+ KGQ RLNGKPLY+LV+ +K
Sbjct  129  LVIDDLIATGGTLCAAIKLLERVGAEVVECACVIGLPEAKGQCRLNGKPLYILVEPRK  186



>ref|XP_002265016.1| PREDICTED: adenine phosphoribosyltransferase 5 [Vitis vinifera]
Length=192

 Score =   278 bits (711),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/178 (76%), Positives = 156/178 (88%), Gaps = 0/178 (0%)
 Frame = -2

Query  838  EDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAG  659
            + DPR+  I   IRVVPHFPK GIMFQDITTLLLD KAFKDT+D+FV+RY+   IS+VAG
Sbjct  15   QGDPRLKAISEAIRVVPHFPKQGIMFQDITTLLLDHKAFKDTVDIFVDRYRDMGISVVAG  74

Query  658  IEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRA  479
            +EARGF+FGPSIALAIGAKFVPLRKPKKLPG+VI + Y LEYG+D LEMHVGAV+ G+RA
Sbjct  75   VEARGFMFGPSIALAIGAKFVPLRKPKKLPGEVISEAYVLEYGTDRLEMHVGAVQPGERA  134

Query  478  LVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQEKK  305
            LV+DDLIATGGTLCAA+ LLER GAEVVECACVI +P+ KGQ RLNGKPLY+LV+ +K
Sbjct  135  LVIDDLIATGGTLCAAIKLLERVGAEVVECACVIGLPEAKGQCRLNGKPLYILVEPRK  192



>ref|XP_004290961.1| PREDICTED: adenine phosphoribosyltransferase 1, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=258

 Score =   281 bits (718),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/184 (73%), Positives = 154/184 (84%), Gaps = 0/184 (0%)
 Frame = -2

Query  865  QCRTMSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYK  686
            Q   M+A    DPR++ I S IRV+P FPKPGIMFQDITTLLLD +AFKDTIDL VERYK
Sbjct  71   QVEEMAAGDVQDPRLERIASSIRVIPDFPKPGIMFQDITTLLLDTQAFKDTIDLLVERYK  130

Query  685  GKNISIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHV  506
             K IS+VAGIEARGFIFGP IALAIGAKFVP+RKP KLPGKVI +EY LEYG+D +EMHV
Sbjct  131  DKEISVVAGIEARGFIFGPPIALAIGAKFVPMRKPNKLPGKVISEEYSLEYGTDTMEMHV  190

Query  505  GAVEAGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLY  326
            GAVEAG+RAL++DDLIATGGTL AA+ LLER G  VVECACVI +P+LKG+ERL   PL+
Sbjct  191  GAVEAGERALIIDDLIATGGTLGAAIRLLERVGVTVVECACVIALPELKGRERLGDNPLF  250

Query  325  VLVQ  314
            VL+ 
Sbjct  251  VLIN  254



>ref|XP_006413643.1| hypothetical protein EUTSA_v10026345mg [Eutrema salsugineum]
 gb|ESQ55096.1| hypothetical protein EUTSA_v10026345mg [Eutrema salsugineum]
Length=172

 Score =   277 bits (709),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 137/166 (83%), Positives = 155/166 (93%), Gaps = 1/166 (1%)
 Frame = -2

Query  853  MSAFRED-DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKN  677
            MS  +E+ DPRI+GI+++IRVVP FPK GIMFQDITT+LLDPKAFKDTIDLFVERY+ KN
Sbjct  1    MSGNKEEVDPRINGIKTKIRVVPDFPKKGIMFQDITTVLLDPKAFKDTIDLFVERYRDKN  60

Query  676  ISIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAV  497
            IS+VAGIEARGF+FGP IALAIGAKFVPLRKPKKLPG+ I +EY+LEYG+D LEMHVGAV
Sbjct  61   ISVVAGIEARGFLFGPPIALAIGAKFVPLRKPKKLPGETIFEEYELEYGNDRLEMHVGAV  120

Query  496  EAGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLK  359
            EAGDRALVVDDLIATGGTLCAA++LLER GAEVVECACVIE+P+LK
Sbjct  121  EAGDRALVVDDLIATGGTLCAAINLLERVGAEVVECACVIELPELK  166



>ref|XP_006374831.1| hypothetical protein POPTR_0014s01740g [Populus trichocarpa]
 gb|ERP52628.1| hypothetical protein POPTR_0014s01740g [Populus trichocarpa]
Length=183

 Score =   278 bits (710),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 136/179 (76%), Positives = 154/179 (86%), Gaps = 0/179 (0%)
 Frame = -2

Query  850  SAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNIS  671
            +A  + DPRI  I S IRV+P FPKPGIMFQDITTLLLD KAFKDTIDLFVERY+ KNIS
Sbjct  3    TADEQQDPRIARISSAIRVIPDFPKPGIMFQDITTLLLDTKAFKDTIDLFVERYRDKNIS  62

Query  670  IVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEA  491
            +VAG+EARGFIFGP IALAIGAKFVP+RKP KLPG+VI +EY LEYG+D +EMHVGAVEA
Sbjct  63   VVAGVEARGFIFGPPIALAIGAKFVPMRKPNKLPGEVISEEYSLEYGTDKMEMHVGAVEA  122

Query  490  GDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
            G+ ALV+DDLIATGGTLCAA+ LLER G  VVECACVIE+  LKG+ERL  +PL+VLV 
Sbjct  123  GEHALVIDDLIATGGTLCAAVKLLERVGVHVVECACVIELLGLKGRERLGDRPLFVLVN  181



>ref|XP_002320694.1| adenine phosphoribosyltransferase 1 family protein [Populus trichocarpa]
 gb|EEE99009.1| adenine phosphoribosyltransferase 1 family protein [Populus trichocarpa]
Length=255

 Score =   280 bits (716),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 139/186 (75%), Positives = 158/186 (85%), Gaps = 1/186 (1%)
 Frame = -2

Query  868  RQCRTM-SAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVER  692
            +Q R M +A  + DPRI  I S IRV+P FPKPGIMFQDITTLLLD KAFKDTIDLFVER
Sbjct  68   KQDREMATADEQQDPRIARISSAIRVIPDFPKPGIMFQDITTLLLDTKAFKDTIDLFVER  127

Query  691  YKGKNISIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEM  512
            Y+ KNIS+VAG+EARGFIFGP IALAIGAKFVP+RKP KLPG+VI +EY LEYG+D +EM
Sbjct  128  YRDKNISVVAGVEARGFIFGPPIALAIGAKFVPMRKPNKLPGEVISEEYSLEYGTDKMEM  187

Query  511  HVGAVEAGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKP  332
            HVGAVEAG+ ALV+DDLIATGGTLCAA+ LLER G  VVECACVIE+  LKG+ERL  +P
Sbjct  188  HVGAVEAGEHALVIDDLIATGGTLCAAVKLLERVGVHVVECACVIELLGLKGRERLGDRP  247

Query  331  LYVLVQ  314
            L+VLV 
Sbjct  248  LFVLVN  253



>ref|XP_009787204.1| PREDICTED: adenine phosphoribosyltransferase 1-like [Nicotiana 
sylvestris]
Length=274

 Score =   280 bits (717),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 137/173 (79%), Positives = 154/173 (89%), Gaps = 0/173 (0%)
 Frame = -2

Query  832  DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIE  653
            D RI  I S IRV+P FPKPGIMFQDITTLLLD KAFKDTIDLF+ERYK KNIS+VAGIE
Sbjct  100  DDRIARISSSIRVIPDFPKPGIMFQDITTLLLDTKAFKDTIDLFLERYKDKNISVVAGIE  159

Query  652  ARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALV  473
            ARGFIFGP IALAIGAKFVP+RKPKKLPG+VI +EY LEYG+D +EMHVGAV+AG+RALV
Sbjct  160  ARGFIFGPPIALAIGAKFVPMRKPKKLPGEVISEEYSLEYGTDKIEMHVGAVQAGERALV  219

Query  472  VDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
            VDDLIATGGTL AA+ LLER G EVVECAC+IE+P+LKG++RL  KPL+VLV 
Sbjct  220  VDDLIATGGTLAAAIRLLERVGVEVVECACLIELPELKGRDRLGDKPLFVLVS  272



>gb|EYU36373.1| hypothetical protein MIMGU_mgv1a012117mg [Erythranthe guttata]
Length=261

 Score =   280 bits (716),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 141/188 (75%), Positives = 157/188 (84%), Gaps = 1/188 (1%)
 Frame = -2

Query  874  FTRQCRTMSA-FREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFV  698
             TR     SA   E D RI  I S IRV+P FPKPGIMFQDITTLLLD KAFKDTIDLFV
Sbjct  71   LTRAAHMASANVGETDDRISRISSTIRVIPDFPKPGIMFQDITTLLLDHKAFKDTIDLFV  130

Query  697  ERYKGKNISIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCL  518
            ERYK KNI++VAGIEARGFIFGP IALAIGAKFVP+RKPKKLPGKVI +EY LEYG+D +
Sbjct  131  ERYKDKNINVVAGIEARGFIFGPPIALAIGAKFVPMRKPKKLPGKVISEEYSLEYGTDKM  190

Query  517  EMHVGAVEAGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNG  338
            EMHVGAVEAG+RAL+VDDLIATGGTL AA+ LLER    VVECACVIE+P+LKG+++L  
Sbjct  191  EMHVGAVEAGERALIVDDLIATGGTLNAAIRLLERVEVTVVECACVIELPELKGRDKLGD  250

Query  337  KPLYVLVQ  314
            KPL+VLV 
Sbjct  251  KPLFVLVS  258



>ref|XP_008378385.1| PREDICTED: adenine phosphoribosyltransferase 2-like isoform X1 
[Malus domestica]
Length=217

 Score =   278 bits (712),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 156/177 (88%), Gaps = 0/177 (0%)
 Frame = -2

Query  832  DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIE  653
            DPR+  I   IRVVPHFPKPGIMFQDITTLLLD K FK  +D+FV+RY+  +IS+VAG+E
Sbjct  11   DPRLQAISEAIRVVPHFPKPGIMFQDITTLLLDHKTFKHVVDIFVDRYRDMDISVVAGVE  70

Query  652  ARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALV  473
            ARGF+FGPSIALAIGAKFVPLRKP+KLPG+VI + Y+LEYG+DCLEMHVGAV+ G+RALV
Sbjct  71   ARGFMFGPSIALAIGAKFVPLRKPRKLPGEVISEAYELEYGTDCLEMHVGAVQPGERALV  130

Query  472  VDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQEKKL  302
            +DDLIATGGTL AA+ LLER GAEVVEC CVI +P++KGQ RLNGKPLY+LV+ ++L
Sbjct  131  IDDLIATGGTLSAAIRLLERVGAEVVECGCVIGLPEVKGQCRLNGKPLYILVEPREL  187



>ref|XP_007226016.1| hypothetical protein PRUPE_ppa010396mg [Prunus persica]
 gb|EMJ27215.1| hypothetical protein PRUPE_ppa010396mg [Prunus persica]
Length=183

 Score =   277 bits (708),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 138/180 (77%), Positives = 154/180 (86%), Gaps = 0/180 (0%)
 Frame = -2

Query  853  MSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI  674
            M+A    DPR+  I S IRV+P FPKPGI+FQDITTLLLD KAFKDTIDLFVERYK K I
Sbjct  1    MAAEDGKDPRLARISSAIRVIPDFPKPGILFQDITTLLLDTKAFKDTIDLFVERYKDKEI  60

Query  673  SIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVE  494
            S+VAGIEARGFIFGP IALAIGAKFVP+RKP KLPGKVI +EY LEYG+D +EMHVGAVE
Sbjct  61   SVVAGIEARGFIFGPPIALAIGAKFVPMRKPNKLPGKVISEEYSLEYGTDIMEMHVGAVE  120

Query  493  AGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
            AG+RAL++DDLIATGGTL AA+ LLER G  VVECACVIE+P LKG+ERL  KPL+VLV 
Sbjct  121  AGERALIIDDLIATGGTLGAALRLLERVGVHVVECACVIELPGLKGRERLGDKPLFVLVN  180



>ref|XP_010556446.1| PREDICTED: adenine phosphoribosyltransferase 1, chloroplastic 
[Tarenaya hassleriana]
Length=182

 Score =   277 bits (708),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 134/173 (77%), Positives = 155/173 (90%), Gaps = 0/173 (0%)
 Frame = -2

Query  832  DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIE  653
            DPRI  I S IRV+P+FPKPGIMFQDITTLLLD +AFKDTIDLFVERYKGK+IS+VAG+E
Sbjct  8    DPRIPKIASAIRVIPNFPKPGIMFQDITTLLLDTQAFKDTIDLFVERYKGKDISVVAGVE  67

Query  652  ARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALV  473
            ARGFIFGP IALAIGAKFVP+RKPKKLPG+VI +EY LEYG+D +EMHVGAV+ G+RALV
Sbjct  68   ARGFIFGPPIALAIGAKFVPMRKPKKLPGEVISEEYSLEYGTDKIEMHVGAVQPGERALV  127

Query  472  VDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
            +DDLIATGGTLCAA+ LLER G +VVECACVIE+ +LKG+E+L   PL+VLV 
Sbjct  128  IDDLIATGGTLCAAIRLLERVGVKVVECACVIELAELKGREKLGETPLFVLVS  180



>ref|XP_008378386.1| PREDICTED: adenine phosphoribosyltransferase 2-like isoform X2 
[Malus domestica]
Length=214

 Score =   278 bits (710),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 156/177 (88%), Gaps = 0/177 (0%)
 Frame = -2

Query  832  DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIE  653
            DPR+  I   IRVVPHFPKPGIMFQDITTLLLD K FK  +D+FV+RY+  +IS+VAG+E
Sbjct  11   DPRLQAISEAIRVVPHFPKPGIMFQDITTLLLDHKTFKHVVDIFVDRYRDMDISVVAGVE  70

Query  652  ARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALV  473
            ARGF+FGPSIALAIGAKFVPLRKP+KLPG+VI + Y+LEYG+DCLEMHVGAV+ G+RALV
Sbjct  71   ARGFMFGPSIALAIGAKFVPLRKPRKLPGEVISEAYELEYGTDCLEMHVGAVQPGERALV  130

Query  472  VDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQEKKL  302
            +DDLIATGGTL AA+ LLER GAEVVEC CVI +P++KGQ RLNGKPLY+LV+ ++L
Sbjct  131  IDDLIATGGTLSAAIRLLERVGAEVVECGCVIGLPEVKGQCRLNGKPLYILVEPREL  187



>ref|NP_001148948.1| LOC100282568 [Zea mays]
 gb|ACG33603.1| adenine phosphoribosyltransferase 1 [Zea mays]
Length=180

 Score =   276 bits (706),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 132/173 (76%), Positives = 156/173 (90%), Gaps = 0/173 (0%)
 Frame = -2

Query  832  DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIE  653
            D R+ GI S IRV+P FPKPGIMFQDITTLLLDPKAF+DTIDLFVERYK + I++VAG+E
Sbjct  5    DARLAGIASSIRVIPDFPKPGIMFQDITTLLLDPKAFRDTIDLFVERYKDQGITVVAGVE  64

Query  652  ARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALV  473
            ARGFIFGP IALAIGAKFVPLRKPKKLPG+VI +EY LEYG+D +EMHVGAV+A DRALV
Sbjct  65   ARGFIFGPPIALAIGAKFVPLRKPKKLPGEVISEEYSLEYGTDKIEMHVGAVQANDRALV  124

Query  472  VDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
            VDDLIATGGTLCAA+ L+ER GA+V ECACVIE+P+LKG+++L  +P++VLV+
Sbjct  125  VDDLIATGGTLCAAVKLIERVGAKVFECACVIELPELKGRDKLGDRPVFVLVE  177



>gb|AHB86969.1| adenine phosphoribosyltransferase [Sedum alfredii]
Length=182

 Score =   276 bits (707),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 134/173 (77%), Positives = 153/173 (88%), Gaps = 0/173 (0%)
 Frame = -2

Query  832  DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIE  653
            D RI GI S IRV+P FPKPGI+FQDITTLLLD KAFKD IDLFVERYKGKNI++VAGIE
Sbjct  8    DQRIAGITSAIRVIPDFPKPGILFQDITTLLLDVKAFKDAIDLFVERYKGKNITVVAGIE  67

Query  652  ARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALV  473
            ARGFIFGP IALAIGAKFVPLRKP+KLPG VI +EY LEYG+D +EMH+GAV  G+R L+
Sbjct  68   ARGFIFGPPIALAIGAKFVPLRKPRKLPGPVISEEYSLEYGTDKIEMHIGAVHEGERVLI  127

Query  472  VDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
            +DDLIATGGTLCAA+ LLER GAEVVECACVIE+P+LKG+++L  KPL+VLV 
Sbjct  128  IDDLIATGGTLCAAIKLLERVGAEVVECACVIELPELKGKDKLGCKPLFVLVS  180



>ref|XP_009354102.1| PREDICTED: adenine phosphoribosyltransferase 1, chloroplastic-like 
[Pyrus x bretschneideri]
Length=199

 Score =   277 bits (708),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 135/184 (73%), Positives = 155/184 (84%), Gaps = 0/184 (0%)
 Frame = -2

Query  865  QCRTMSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYK  686
            +   M+A    DPR+  + S IRV+P FPKPGI+F DITTLLLD KAFKDTIDLFVERYK
Sbjct  13   KVEAMAAEDGQDPRLARLSSAIRVIPDFPKPGILFYDITTLLLDTKAFKDTIDLFVERYK  72

Query  685  GKNISIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHV  506
             K IS+VAG+EARGFIFGP IALAIGAKFVP+RKP KLPGKVI +EY LEYG+D +EMHV
Sbjct  73   DKEISVVAGVEARGFIFGPPIALAIGAKFVPMRKPNKLPGKVISEEYSLEYGTDIMEMHV  132

Query  505  GAVEAGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLY  326
            GAVEAG+RAL++DDLIATGGTL AA+ LLER G  VVECACVIE+P+LKG+ERL  KPL+
Sbjct  133  GAVEAGERALIIDDLIATGGTLGAAIKLLERVGVHVVECACVIELPELKGRERLGEKPLF  192

Query  325  VLVQ  314
            VLV 
Sbjct  193  VLVS  196



>gb|AFK39608.1| unknown [Lotus japonicus]
Length=179

 Score =   276 bits (706),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 133/173 (77%), Positives = 153/173 (88%), Gaps = 0/173 (0%)
 Frame = -2

Query  832  DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIE  653
            DPRI  I S IRV+P FPKPGIMFQDITTLLLDPKAFKDTIDLFVERY+ +NIS+VAG+E
Sbjct  5    DPRIATISSAIRVIPDFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYRDQNISVVAGVE  64

Query  652  ARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALV  473
            ARGFIFGP IALAIGAKFVP+RKPKKLPG VI +EY LEYG+D +EMHVGAV+AG+RAL+
Sbjct  65   ARGFIFGPPIALAIGAKFVPMRKPKKLPGPVISEEYSLEYGTDKIEMHVGAVQAGERALI  124

Query  472  VDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
            +DDLIATGGTL AA+ LLER   +VVECACV+E+P+LKG+ERL  K L+VLV 
Sbjct  125  IDDLIATGGTLSAAIRLLERVEVQVVECACVVELPELKGRERLGDKALFVLVN  177



>ref|XP_002517658.1| Adenine phosphoribosyltransferase, putative [Ricinus communis]
 gb|EEF44822.1| Adenine phosphoribosyltransferase, putative [Ricinus communis]
Length=186

 Score =   276 bits (706),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 130/178 (73%), Positives = 157/178 (88%), Gaps = 0/178 (0%)
 Frame = -2

Query  838  EDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAG  659
            + DPR+  I   IRVVPHFPK GIMFQDITTLLLDPKAFK T+D+FV+RY+  +IS+VAG
Sbjct  9    QGDPRLKAISDAIRVVPHFPKQGIMFQDITTLLLDPKAFKYTVDIFVDRYRDMDISVVAG  68

Query  658  IEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRA  479
            +EARGFIFGPSIALAIGAKFVPLRKPKKLPG+VI + Y LEYG+DCLEMH+GAV+ G+RA
Sbjct  69   VEARGFIFGPSIALAIGAKFVPLRKPKKLPGEVISEAYVLEYGTDCLEMHIGAVKHGERA  128

Query  478  LVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQEKK  305
            +++DDL+ATGGTL AA+ LLER GAEV+ECACVI +P+ KGQ RLNGKPLY+LV+ ++
Sbjct  129  IIIDDLVATGGTLSAAIRLLERVGAEVIECACVIGLPEFKGQCRLNGKPLYILVEPRQ  186



>ref|XP_008393742.1| PREDICTED: adenine phosphoribosyltransferase 1-like [Malus domestica]
Length=250

 Score =   278 bits (711),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 151/242 (62%), Positives = 173/242 (71%), Gaps = 20/242 (8%)
 Frame = -2

Query  985  SLFHSIYSPYIFSPFQPFSFLSAFHLLSITLLSFFLHFTR------------------QC  860
            SLF S  + + FSP   F   +A  L S      F+ F                    + 
Sbjct  8    SLFSS--NSFTFSPAVAFRTPAAKTLSSAAAALPFIRFPNYRSARPPPCCSVGKSEALKV  65

Query  859  RTMSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGK  680
              M+A    D R+  I S IRV+P+FPKPGI+FQDITTLLLD KAFKDTIDLFVERYK K
Sbjct  66   EAMAAEDGQDLRLARISSAIRVIPNFPKPGILFQDITTLLLDTKAFKDTIDLFVERYKDK  125

Query  679  NISIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGA  500
             IS+VAG+EARGFIFGP IALAIGAKFVPLRKPKKLPGKVI +EY LEYG+D +EMHVGA
Sbjct  126  EISVVAGVEARGFIFGPPIALAIGAKFVPLRKPKKLPGKVISEEYSLEYGTDKIEMHVGA  185

Query  499  VEAGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVL  320
            VEAG+RAL+ DDLIATGGTL AA+ LLER G  VVECACVIE+P+LKG+ERL  KPL+VL
Sbjct  186  VEAGERALIXDDLIATGGTLGAAIRLLERVGVHVVECACVIELPELKGRERLGEKPLFVL  245

Query  319  VQ  314
            V 
Sbjct  246  VS  247



>ref|XP_011036576.1| PREDICTED: adenine phosphoribosyltransferase 5 [Populus euphratica]
Length=212

 Score =   276 bits (707),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 158/177 (89%), Gaps = 0/177 (0%)
 Frame = -2

Query  832  DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIE  653
            DPR+ GI   IRVVPHFPKPGIMFQDITTLLLD KAFKDT+D+FV+RY+   IS+VAG+E
Sbjct  32   DPRLQGISEAIRVVPHFPKPGIMFQDITTLLLDHKAFKDTVDIFVDRYRDMGISVVAGVE  91

Query  652  ARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALV  473
            ARGF+FGP+IALAIGAKFVPLRKP+KLPG+VI + Y+LEYG+DCLEMHVGAVE G+RA+V
Sbjct  92   ARGFMFGPAIALAIGAKFVPLRKPRKLPGEVIAEAYELEYGTDCLEMHVGAVEPGERAIV  151

Query  472  VDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQEKKL  302
            +DDL+ATGGTL AA+ LLER  AEVVECACVI + ++KGQ RLNGKPLY+LV+ +++
Sbjct  152  IDDLVATGGTLSAAIRLLERMEAEVVECACVIGLREVKGQCRLNGKPLYILVEPRQI  208



>ref|XP_009629597.1| PREDICTED: adenine phosphoribosyltransferase 1, chloroplastic 
[Nicotiana tomentosiformis]
Length=184

 Score =   275 bits (704),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 137/173 (79%), Positives = 153/173 (88%), Gaps = 0/173 (0%)
 Frame = -2

Query  832  DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIE  653
            D RI  I S IRV+P FPKPGIMFQDITTLLLD KAFK TIDLFVERYK KNIS+VAGIE
Sbjct  10   DDRIVRISSSIRVIPDFPKPGIMFQDITTLLLDTKAFKYTIDLFVERYKDKNISVVAGIE  69

Query  652  ARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALV  473
            ARGFIFGP IALAIGAKFVP+RKPKKLPG+VI +EY LEYG+D +EMHVGAV+AG+RALV
Sbjct  70   ARGFIFGPPIALAIGAKFVPMRKPKKLPGEVISEEYSLEYGTDKIEMHVGAVQAGERALV  129

Query  472  VDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
            VDDLIATGGTL AA+ LLER G EVVECAC+IE+P+LKG++RL  KPL+VLV 
Sbjct  130  VDDLIATGGTLTAAIRLLERVGVEVVECACLIELPELKGRDRLGDKPLFVLVS  182



>ref|XP_002324303.1| adenine phosphoribosyltransferase 2 family protein [Populus trichocarpa]
 gb|EEF02868.1| adenine phosphoribosyltransferase 2 family protein [Populus trichocarpa]
Length=191

 Score =   276 bits (705),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 158/177 (89%), Gaps = 0/177 (0%)
 Frame = -2

Query  832  DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIE  653
            DPR+ GI   IRVVPHFPKPGIMFQDITTLLLD KAFKDT+D+FV+RY+   IS+VAG+E
Sbjct  11   DPRLQGISEAIRVVPHFPKPGIMFQDITTLLLDHKAFKDTVDIFVDRYRDMGISVVAGVE  70

Query  652  ARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALV  473
            ARGF+FGP+IALAIGAKFVPLRKP+KLPG+VI + Y+LEYG+DCLEMHVGAVE G+RA+V
Sbjct  71   ARGFMFGPAIALAIGAKFVPLRKPRKLPGEVIAEAYELEYGTDCLEMHVGAVEPGERAIV  130

Query  472  VDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQEKKL  302
            +DDL+ATGGTL AA+ LLER  AEVVECACVI + ++KGQ RLNGKPLY+LV+ +++
Sbjct  131  IDDLVATGGTLSAAIRLLERMEAEVVECACVIGLREVKGQCRLNGKPLYILVEPRQI  187



>ref|XP_008394106.1| PREDICTED: adenine phosphoribosyltransferase 2-like isoform X1 
[Malus domestica]
Length=191

 Score =   275 bits (704),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 130/177 (73%), Positives = 156/177 (88%), Gaps = 0/177 (0%)
 Frame = -2

Query  832  DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIE  653
            DPR+  I   IRVVPHFPKPGIMFQDITTLLLD KAFK  +D+FV+RY+  +IS+VAG+E
Sbjct  11   DPRLQAISEAIRVVPHFPKPGIMFQDITTLLLDHKAFKHVVDIFVDRYRDMDISVVAGVE  70

Query  652  ARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALV  473
            ARGF+FGPS+ALAIGAKFVPLRKP+KLPG+VI + Y+LEYG+DCLEMHVGA + G+RALV
Sbjct  71   ARGFMFGPSVALAIGAKFVPLRKPRKLPGEVISEAYELEYGTDCLEMHVGAAQPGERALV  130

Query  472  VDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQEKKL  302
            +DDLIATGGTL AA+ LLER GAEVVEC CVI +P++KGQ RLNGKPLY+LV+ ++L
Sbjct  131  IDDLIATGGTLSAAIRLLERVGAEVVECGCVIGLPEVKGQCRLNGKPLYILVEPRQL  187



>ref|XP_009355759.1| PREDICTED: adenine phosphoribosyltransferase 5-like [Pyrus x 
bretschneideri]
Length=191

 Score =   275 bits (704),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 130/177 (73%), Positives = 156/177 (88%), Gaps = 0/177 (0%)
 Frame = -2

Query  832  DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIE  653
            DPR+  I   IRVVPHFPKPGIMFQDITTLLLD KAFK  +D+FV+RY+  +IS+VAG+E
Sbjct  11   DPRLQAISEAIRVVPHFPKPGIMFQDITTLLLDHKAFKHVVDIFVDRYRDMDISVVAGVE  70

Query  652  ARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALV  473
            ARGF+FGPS+ALAIGAKFVPLRKP+KLPG+VI + Y+LEYG+DCLEMHVGA + G+RALV
Sbjct  71   ARGFMFGPSVALAIGAKFVPLRKPRKLPGEVISEAYELEYGTDCLEMHVGAAQPGERALV  130

Query  472  VDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQEKKL  302
            +DDLIATGGTL AA+ LLER GAEVVEC CVI +P++KGQ RLNGKPLY+LV+ ++L
Sbjct  131  IDDLIATGGTLSAAIRLLERVGAEVVECGCVIGLPEVKGQCRLNGKPLYILVEPREL  187



>ref|XP_009346190.1| PREDICTED: adenine phosphoribosyltransferase 5-like isoform X1 
[Pyrus x bretschneideri]
Length=191

 Score =   275 bits (704),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 130/177 (73%), Positives = 156/177 (88%), Gaps = 0/177 (0%)
 Frame = -2

Query  832  DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIE  653
            DPR+  I   IRVVPHFPKPGIMFQDITTLLLD KAFK  +D+FV+RY+  +IS+VAG+E
Sbjct  11   DPRLQAISEAIRVVPHFPKPGIMFQDITTLLLDHKAFKHVVDIFVDRYRDMDISVVAGVE  70

Query  652  ARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALV  473
            ARGF+FGPS+ALAIGAKFVPLRKP+KLPG+VI + Y+LEYG+DCLEMHVGA + G+RALV
Sbjct  71   ARGFMFGPSVALAIGAKFVPLRKPRKLPGEVISEAYELEYGTDCLEMHVGAAQPGERALV  130

Query  472  VDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQEKKL  302
            +DDLIATGGTL AA+ LLER GAEVVEC CVI +P++KGQ RLNGKPLY+LV+ ++L
Sbjct  131  IDDLIATGGTLSAAIRLLERVGAEVVECGCVIGLPEVKGQCRLNGKPLYILVEPREL  187



>ref|XP_010907390.1| PREDICTED: adenine phosphoribosyltransferase 1-like [Elaeis guineensis]
Length=219

 Score =   276 bits (706),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 134/182 (74%), Positives = 160/182 (88%), Gaps = 0/182 (0%)
 Frame = -2

Query  859  RTMSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGK  680
            + M++    D R+  I S IRV+P FPKPGIMFQDITTLLLD KAF+DTID+FVERY+ K
Sbjct  37   KAMASEDGKDHRLARISSSIRVIPDFPKPGIMFQDITTLLLDHKAFRDTIDIFVERYREK  96

Query  679  NISIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGA  500
            NIS+VAGIEARGFIFGP IALAIGAKFVP+RKPKKLPG+VI +EY LEYG+D +EMHVGA
Sbjct  97   NISVVAGIEARGFIFGPPIALAIGAKFVPMRKPKKLPGEVISEEYALEYGTDKMEMHVGA  156

Query  499  VEAGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVL  320
            V+ GDRALV+DDLIATGGTLCAA+ LLER GA+VVECACVIE+P+LKG+E+L  +P++VL
Sbjct  157  VQPGDRALVIDDLIATGGTLCAAVRLLERVGADVVECACVIELPELKGREKLGHRPVFVL  216

Query  319  VQ  314
            V+
Sbjct  217  VK  218



>ref|XP_002515495.1| Adenine phosphoribosyltransferase, putative [Ricinus communis]
 gb|EEF46944.1| Adenine phosphoribosyltransferase, putative [Ricinus communis]
Length=213

 Score =   276 bits (705),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 130/177 (73%), Positives = 157/177 (89%), Gaps = 0/177 (0%)
 Frame = -2

Query  832  DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIE  653
            DPR+  I   IRVVPHFPKPGIMFQDITTLL D KAFKD +D+FV+RY+   IS+VAG+E
Sbjct  11   DPRLQAISEAIRVVPHFPKPGIMFQDITTLLPDHKAFKDAVDIFVDRYRNMGISVVAGVE  70

Query  652  ARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALV  473
            ARGF+FGPSIALAIGAKFVPLRKP+KLPG+VI ++Y LEYG+DCLEMHVGAV+ G+RAL+
Sbjct  71   ARGFMFGPSIALAIGAKFVPLRKPRKLPGEVISEKYVLEYGTDCLEMHVGAVQPGERALI  130

Query  472  VDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQEKKL  302
            +DDL+ATGGTL AA+ LLER GAEVVECACVI +P++KGQ RLNGKPLY+LV+ +++
Sbjct  131  IDDLVATGGTLSAAIRLLERVGAEVVECACVIGLPEVKGQRRLNGKPLYILVEPREI  187



>ref|XP_007023255.1| Adenine phosphoribosyl transferase 2 isoform 1 [Theobroma cacao]
 gb|EOY25877.1| Adenine phosphoribosyl transferase 2 isoform 1 [Theobroma cacao]
Length=215

 Score =   275 bits (704),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 129/178 (72%), Positives = 156/178 (88%), Gaps = 0/178 (0%)
 Frame = -2

Query  838  EDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAG  659
            + DPR+  I   IRVVPHFPKPGIMFQDITTLLLD K FKDT+D+FV+RY+   IS+VAG
Sbjct  13   QGDPRLKAISEAIRVVPHFPKPGIMFQDITTLLLDHKCFKDTVDIFVDRYRDMAISVVAG  72

Query  658  IEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRA  479
            +EARGF+FGPS+ALAIGAKFVPLRKP+KLPG+VI + Y LEYG+DCLEMHVGAV+ G+RA
Sbjct  73   VEARGFMFGPSVALAIGAKFVPLRKPRKLPGEVISEAYVLEYGTDCLEMHVGAVQPGERA  132

Query  478  LVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQEKK  305
            LV+DDL+ATGGTL AA+ LLER GAEVVECACV+ + ++KGQ RLNGKPLY+LV+ ++
Sbjct  133  LVIDDLVATGGTLSAAIRLLERVGAEVVECACVVGLREVKGQHRLNGKPLYILVEPRQ  190



>emb|CDO98165.1| unnamed protein product [Coffea canephora]
Length=186

 Score =   274 bits (701),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 130/176 (74%), Positives = 154/176 (88%), Gaps = 0/176 (0%)
 Frame = -2

Query  832  DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIE  653
            DPR+ GI   IRV+PHFPKPGIMFQDITTLLLD KAFKDTID+FVERY+  +IS+VAG+E
Sbjct  11   DPRLQGISDAIRVIPHFPKPGIMFQDITTLLLDHKAFKDTIDIFVERYREMDISVVAGVE  70

Query  652  ARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALV  473
            ARGF+FGPSIALAIGAKF+PLRKP KLPG VI + Y+LEYGSDCLEMHVGAV+ G+R LV
Sbjct  71   ARGFMFGPSIALAIGAKFLPLRKPGKLPGSVISEAYELEYGSDCLEMHVGAVQPGERVLV  130

Query  472  VDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQEKK  305
            +DDL+ATGGTL AA+ LL+R GAEVVEC CVI +P+ KG+  LNGKPLY+LV+ ++
Sbjct  131  IDDLVATGGTLSAAIRLLDRVGAEVVECCCVIGVPEFKGRCSLNGKPLYILVEPRQ  186



>emb|CDY11808.1| BnaC03g57700D [Brassica napus]
Length=240

 Score =   276 bits (705),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 138/198 (70%), Positives = 162/198 (82%), Gaps = 2/198 (1%)
 Frame = -2

Query  904  SITLLSFFLHFTRQCRTMSAFRED--DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDP  731
            S T L  F        +  A +ED  DPRI  I S IRV+P FPKPGIMFQDITTLLLD 
Sbjct  38   STTSLRLFPCAAVSRESEMAAKEDGQDPRIPKIASSIRVIPDFPKPGIMFQDITTLLLDT  97

Query  730  KAFKDTIDLFVERYKGKNISIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQ  551
            +AFKDTID+FVERYKGK IS+VAG+EARGFIFGP IALAIGAKFVP+RKPKKLPGKVI +
Sbjct  98   EAFKDTIDVFVERYKGKGISVVAGVEARGFIFGPPIALAIGAKFVPMRKPKKLPGKVISE  157

Query  550  EYDLEYGSDCLEMHVGAVEAGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEI  371
            EY LEYG+D +EMHVGAVE G+RA+++DDLIATGGTL AA+ LLER G ++VECACVIE+
Sbjct  158  EYSLEYGTDKIEMHVGAVEPGERAIIIDDLIATGGTLAAAIRLLERVGVKIVECACVIEL  217

Query  370  PDLKGQERLNGKPLYVLV  317
            P+LKG+E+L   PL++LV
Sbjct  218  PELKGREKLGEAPLFILV  235



>ref|XP_009109802.1| PREDICTED: adenine phosphoribosyltransferase 1-like isoform X1 
[Brassica rapa]
Length=241

 Score =   275 bits (704),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 137/198 (69%), Positives = 161/198 (81%), Gaps = 2/198 (1%)
 Frame = -2

Query  904  SITLLSFFLHFTRQCRTMSAFRED--DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDP  731
            S T L  F        +  A +ED  DPRI  I S IRV+P FPKPGIMFQDITTLLLD 
Sbjct  39   STTSLGLFTCAAVSRESEMAAKEDGQDPRIPKIASSIRVIPDFPKPGIMFQDITTLLLDT  98

Query  730  KAFKDTIDLFVERYKGKNISIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQ  551
            +AFKDTID+FVERYKGK IS+VAG+EARGFIFGP IALAIGAKFVP+RKPKKLPGKVI +
Sbjct  99   EAFKDTIDIFVERYKGKGISVVAGVEARGFIFGPPIALAIGAKFVPMRKPKKLPGKVISE  158

Query  550  EYDLEYGSDCLEMHVGAVEAGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEI  371
            EY LEYG+D +EMHVGAVE G+RA+++DDLIATGGTL AA+ LLER G ++VECACVIE+
Sbjct  159  EYSLEYGTDKIEMHVGAVEPGERAIIIDDLIATGGTLAAAIRLLERVGVKIVECACVIEL  218

Query  370  PDLKGQERLNGKPLYVLV  317
            P+L G+E+L   PL++LV
Sbjct  219  PELNGREKLGEAPLFILV  236



>ref|NP_001151512.1| LOC100285146 [Zea mays]
 gb|ACG43134.1| adenine phosphoribosyltransferase 1 [Zea mays]
Length=180

 Score =   273 bits (698),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 130/173 (75%), Positives = 155/173 (90%), Gaps = 0/173 (0%)
 Frame = -2

Query  832  DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIE  653
            D R+ GI S IRV+P FPKPGIMFQDITTLLLDPKAF+DTID+FVERYK + I++VAG+E
Sbjct  5    DARLAGIASSIRVIPDFPKPGIMFQDITTLLLDPKAFRDTIDVFVERYKDQGITVVAGVE  64

Query  652  ARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALV  473
            ARGFIFGP IALAI AKFVPLRKPKKLPG+VI +EY LEYG+D +EMHVGAV+A DRALV
Sbjct  65   ARGFIFGPPIALAISAKFVPLRKPKKLPGEVISEEYSLEYGTDKIEMHVGAVQANDRALV  124

Query  472  VDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
            VDDLIATGGTLCAA+ L+ER GA+VVECACVIE+ +LKG+++L  +P++VLV+
Sbjct  125  VDDLIATGGTLCAAVKLIERVGAKVVECACVIELAELKGRDKLGDRPVFVLVE  177



>ref|XP_007136748.1| hypothetical protein PHAVU_009G070900g [Phaseolus vulgaris]
 gb|ESW08742.1| hypothetical protein PHAVU_009G070900g [Phaseolus vulgaris]
Length=246

 Score =   275 bits (704),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 130/175 (74%), Positives = 157/175 (90%), Gaps = 0/175 (0%)
 Frame = -2

Query  838  EDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAG  659
            + DPR++ I S IRV+P FPKPGI+FQDITTLLLDPKAFKDTIDLFVERY+ +NI++VAG
Sbjct  69   QQDPRLERISSAIRVIPDFPKPGILFQDITTLLLDPKAFKDTIDLFVERYRDQNINVVAG  128

Query  658  IEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRA  479
            +EARGFIFGP IALAIGAKFVP+RKP KLPG+VI +EY LEYG+D +EMHVGAV+ G+RA
Sbjct  129  VEARGFIFGPPIALAIGAKFVPMRKPNKLPGEVISEEYSLEYGTDKIEMHVGAVQPGERA  188

Query  478  LVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
            LV+DDLIATGGTL AA+ LLER G +VVECAC+IE+P+LKG++RL  KPL+VLV+
Sbjct  189  LVIDDLIATGGTLDAAIKLLERVGVDVVECACLIELPELKGRDRLGDKPLFVLVK  243



>gb|KHG11428.1| Adenine phosphoribosyltransferase 2 -like protein [Gossypium 
arboreum]
Length=224

 Score =   275 bits (702),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 130/178 (73%), Positives = 155/178 (87%), Gaps = 0/178 (0%)
 Frame = -2

Query  838  EDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAG  659
            + DPR+  I   IRVVPHFPKPGIMFQDITTLLLD KAFKDT+D+FV+RY+   IS+VAG
Sbjct  10   QGDPRLKAISEAIRVVPHFPKPGIMFQDITTLLLDHKAFKDTVDIFVDRYRDMGISVVAG  69

Query  658  IEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRA  479
            +EARGF+FGPSIALAIGAKFVPLRKP+KLPG+VI + Y LEYG DCLEMHVGAV+ G+RA
Sbjct  70   VEARGFMFGPSIALAIGAKFVPLRKPRKLPGEVISESYVLEYGKDCLEMHVGAVQPGERA  129

Query  478  LVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQEKK  305
            LV+DDL+ATGGTL AA+ LLERAGA VVECACV+ + ++KGQ  LNGKPLY+LV+ ++
Sbjct  130  LVIDDLVATGGTLSAAIRLLERAGAHVVECACVVGLREVKGQHGLNGKPLYILVEPRQ  187



>ref|XP_009611592.1| PREDICTED: adenine phosphoribosyltransferase 5 isoform X1 [Nicotiana 
tomentosiformis]
Length=190

 Score =   273 bits (698),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 130/177 (73%), Positives = 153/177 (86%), Gaps = 0/177 (0%)
 Frame = -2

Query  832  DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIE  653
            D R+ GI   IRVVP FPKPGIMFQDITTLLL+ K FKDT+D+FV+RYK  +IS VAGIE
Sbjct  11   DSRLQGISEAIRVVPDFPKPGIMFQDITTLLLNHKVFKDTVDIFVDRYKDMDISAVAGIE  70

Query  652  ARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALV  473
            ARGF+FGPS+ALAIGAKFVPLRKP KLPGKVI + Y+LEYG DCLEMHVGAV+ GDRA++
Sbjct  71   ARGFMFGPSVALAIGAKFVPLRKPGKLPGKVIAESYELEYGKDCLEMHVGAVQQGDRAVI  130

Query  472  VDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQEKKL  302
            +DDL+ATGGTL AA+ LLER GAEVVEC CVI +P++KGQ RL GKPLY+LV+ ++L
Sbjct  131  LDDLVATGGTLSAAIKLLERMGAEVVECGCVIGVPEVKGQSRLKGKPLYILVEPREL  187



>ref|XP_009109803.1| PREDICTED: adenine phosphoribosyltransferase 1-like isoform X2 
[Brassica rapa]
Length=240

 Score =   275 bits (703),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 138/198 (70%), Positives = 163/198 (82%), Gaps = 3/198 (2%)
 Frame = -2

Query  904  SITLLSFFLHFTRQCRTMSAFRED--DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDP  731
            S T L  F     +   M+A +ED  DPRI  I S IRV+P FPKPGIMFQDITTLLLD 
Sbjct  39   STTSLGLFTCAVSRESEMAA-KEDGQDPRIPKIASSIRVIPDFPKPGIMFQDITTLLLDT  97

Query  730  KAFKDTIDLFVERYKGKNISIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQ  551
            +AFKDTID+FVERYKGK IS+VAG+EARGFIFGP IALAIGAKFVP+RKPKKLPGKVI +
Sbjct  98   EAFKDTIDIFVERYKGKGISVVAGVEARGFIFGPPIALAIGAKFVPMRKPKKLPGKVISE  157

Query  550  EYDLEYGSDCLEMHVGAVEAGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEI  371
            EY LEYG+D +EMHVGAVE G+RA+++DDLIATGGTL AA+ LLER G ++VECACVIE+
Sbjct  158  EYSLEYGTDKIEMHVGAVEPGERAIIIDDLIATGGTLAAAIRLLERVGVKIVECACVIEL  217

Query  370  PDLKGQERLNGKPLYVLV  317
            P+L G+E+L   PL++LV
Sbjct  218  PELNGREKLGEAPLFILV  235



>ref|XP_009788183.1| PREDICTED: adenine phosphoribosyltransferase 5-like [Nicotiana 
sylvestris]
Length=190

 Score =   273 bits (698),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 129/177 (73%), Positives = 154/177 (87%), Gaps = 0/177 (0%)
 Frame = -2

Query  832  DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIE  653
            D R+ GI   IRVVP FPKPGIMFQDITTLLL+ K FKDT+D+FV+RYK  +IS+VAGIE
Sbjct  11   DSRLQGISEAIRVVPDFPKPGIMFQDITTLLLNHKVFKDTVDIFVDRYKEMDISVVAGIE  70

Query  652  ARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALV  473
            ARGF+FGPS+ALAIGAKFVPLRKP KLPGKVI + Y+LEYG DCLEMHVGAV+ GD+A++
Sbjct  71   ARGFMFGPSVALAIGAKFVPLRKPGKLPGKVIAESYELEYGKDCLEMHVGAVQQGDKAVI  130

Query  472  VDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQEKKL  302
            +DDL+ATGGTL AA+ LLER GAEVVEC CVI +P++KGQ RL GKPLY+LV+ ++L
Sbjct  131  LDDLVATGGTLSAAIKLLERMGAEVVECGCVIGVPEVKGQSRLKGKPLYILVEPREL  187



>gb|KDP37067.1| hypothetical protein JCGZ_06123 [Jatropha curcas]
Length=189

 Score =   273 bits (697),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 127/178 (71%), Positives = 156/178 (88%), Gaps = 0/178 (0%)
 Frame = -2

Query  838  EDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAG  659
            + DPR+  I   IRVVPHFPKPGIMFQDITTLLLD K FKDT+D+F++RY+   IS+VAG
Sbjct  9    QGDPRLKAISDAIRVVPHFPKPGIMFQDITTLLLDHKTFKDTVDIFIDRYRDMAISVVAG  68

Query  658  IEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRA  479
            +EARGFIFGPSIALAIGAKFVPLRKPKKLPG+VI +EY LEYG+DCLE+H+GA++ G+RA
Sbjct  69   VEARGFIFGPSIALAIGAKFVPLRKPKKLPGEVISEEYVLEYGNDCLEIHIGAIKHGERA  128

Query  478  LVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQEKK  305
            +++DDL+ATGGTL AA+ LLER GAEVVECACVI +P+ KG+  LNGKPLY+LV+ ++
Sbjct  129  IIIDDLVATGGTLSAAITLLERVGAEVVECACVIGLPEFKGRLGLNGKPLYILVEPRQ  186



>emb|CDY56189.1| BnaC05g51080D [Brassica napus]
Length=185

 Score =   273 bits (697),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 134/179 (75%), Positives = 154/179 (86%), Gaps = 2/179 (1%)
 Frame = -2

Query  847  AFRED--DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI  674
            A +ED  DPRI  I S IRV+P FPKPGIMFQDITTLLLD +AFKDTID+FVERYKGK I
Sbjct  2    ATKEDVQDPRIPKIASSIRVIPDFPKPGIMFQDITTLLLDTEAFKDTIDIFVERYKGKGI  61

Query  673  SIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVE  494
            S+VAG+EARGFIFGP IALAIGAKFVPLRKPKKLPGKVI +EY LEYG+D +EMHVGAVE
Sbjct  62   SVVAGVEARGFIFGPPIALAIGAKFVPLRKPKKLPGKVISEEYSLEYGTDKIEMHVGAVE  121

Query  493  AGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLV  317
             G+RA+++DDLIATGGTL AA+ LLER G  + ECACVIE+P LKG+E+L   PL++LV
Sbjct  122  PGERAIIIDDLIATGGTLAAAIRLLERVGVTIAECACVIELPVLKGREKLGETPLFILV  180



>gb|KEH31657.1| adenine phosphoribosyltransferase-like protein [Medicago truncatula]
Length=166

 Score =   272 bits (695),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = -2

Query  766  MFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIEARGFIFGPSIALAIGAKFVPLR  587
            MFQDIT LLLDPKAFKDT+DLFVERYKGKNISIVAGIEARGFIFGP IALAIGAKFVPLR
Sbjct  1    MFQDITPLLLDPKAFKDTVDLFVERYKGKNISIVAGIEARGFIFGPPIALAIGAKFVPLR  60

Query  586  KPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALVVDDLIATGGTLCAAMDLLERAG  407
            KPKKLPGKVI QEY LEYG DCLEMHVG VE G+RALVVDDLIATGGTLCAAMDLL R G
Sbjct  61   KPKKLPGKVISQEYILEYGRDCLEMHVGGVEHGERALVVDDLIATGGTLCAAMDLLGRVG  120

Query  406  AEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
            AE+VECACVIE+P+LKG+ERLNGKPLYVL++
Sbjct  121  AEIVECACVIELPELKGRERLNGKPLYVLIE  151



>ref|XP_011074363.1| PREDICTED: adenine phosphoribosyltransferase 1-like [Sesamum 
indicum]
Length=257

 Score =   275 bits (703),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 132/174 (76%), Positives = 152/174 (87%), Gaps = 0/174 (0%)
 Frame = -2

Query  832  DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIE  653
            D RI  I S IRV+P FPKPGI+FQDITTLLLDPKAFKDTIDLFVERYK KNI++VAG+E
Sbjct  83   DDRISRISSTIRVIPDFPKPGILFQDITTLLLDPKAFKDTIDLFVERYKDKNINVVAGVE  142

Query  652  ARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALV  473
            ARGFIFGP IALAIGAKFVP+RKPKKLPG+VI +EY LEYG+D +EMHVGAV+ G+RA+V
Sbjct  143  ARGFIFGPPIALAIGAKFVPMRKPKKLPGEVISEEYSLEYGTDTMEMHVGAVQPGERAIV  202

Query  472  VDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQE  311
            VDDLIATGGTL AA+ LLER G  VVECACVIE+P+L+G+ +L  KPL+VLV  
Sbjct  203  VDDLIATGGTLNAAIRLLERVGVTVVECACVIELPELEGRVKLGNKPLFVLVSS  256



>ref|XP_008785773.1| PREDICTED: adenine phosphoribosyltransferase 2-like [Phoenix 
dactylifera]
Length=184

 Score =   272 bits (696),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 128/176 (73%), Positives = 152/176 (86%), Gaps = 0/176 (0%)
 Frame = -2

Query  832  DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIE  653
            DPR+  I + IRVVPHFPKPGIMF DITTLLL PK FKD +++FV+RY+   IS VAGIE
Sbjct  9    DPRLQAISAAIRVVPHFPKPGIMFNDITTLLLHPKVFKDVVEIFVDRYRDMEISAVAGIE  68

Query  652  ARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALV  473
            ARGFIFGPSIALAIGAKF+PLRKPKKLPG+V  + Y+LEYG+DCLEMHVGAV  G+R LV
Sbjct  69   ARGFIFGPSIALAIGAKFIPLRKPKKLPGEVFSEAYELEYGTDCLEMHVGAVHPGERVLV  128

Query  472  VDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQEKK  305
            +DDL+ATGGTLCAA+ LLERAGAEVVECACV+ +P  KG+ RLNGKP+Y+LV+ ++
Sbjct  129  IDDLVATGGTLCAAIRLLERAGAEVVECACVVGLPKFKGRCRLNGKPVYILVECRR  184



>ref|XP_007137006.1| hypothetical protein PHAVU_009G092200g [Phaseolus vulgaris]
 gb|ESW09000.1| hypothetical protein PHAVU_009G092200g [Phaseolus vulgaris]
Length=194

 Score =   273 bits (697),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 130/176 (74%), Positives = 155/176 (88%), Gaps = 0/176 (0%)
 Frame = -2

Query  832  DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIE  653
            DPR+  I   IRVVPHFPK GIMFQDITTLLLD KAFKDT+D+FV+RY+  +IS+VAGIE
Sbjct  11   DPRLQAISQAIRVVPHFPKHGIMFQDITTLLLDHKAFKDTVDIFVDRYRDMHISVVAGIE  70

Query  652  ARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALV  473
            ARGF+FGPS+AL IGAKFVPLRKP+KLPG+VI ++Y LEYG+DCLE+HVGAV+ G+RA+V
Sbjct  71   ARGFLFGPSVALGIGAKFVPLRKPRKLPGEVISEKYALEYGTDCLELHVGAVQPGERAIV  130

Query  472  VDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQEKK  305
            +DDL+ATGGTL A + LLER GAEVVECACVI +PD+KGQ RL GKPLYVLV+ +K
Sbjct  131  IDDLVATGGTLSAGVKLLERVGAEVVECACVIGVPDVKGQCRLIGKPLYVLVEPRK  186



>ref|XP_010460503.1| PREDICTED: adenine phosphoribosyltransferase 1, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=250

 Score =   275 bits (702),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 136/205 (66%), Positives = 163/205 (80%), Gaps = 2/205 (1%)
 Frame = -2

Query  922  SAFHLLSITLLSFFLHFTRQCRTMSAFRED--DPRIDGIQSRIRVVPHFPKPGIMFQDIT  749
            ++  L S T+++         R      ED  DPRI  I S IRV+P FPKPGIMFQDIT
Sbjct  44   NSLRLFSSTVVAAAAAAAAASRDSEMATEDVQDPRIAKIASSIRVIPDFPKPGIMFQDIT  103

Query  748  TLLLDPKAFKDTIDLFVERYKGKNISIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLP  569
            TLLLD +AFKDTI LFVERYK K+IS+VAG+EARGFIFGP IALAIGAKFVP+RKPKKLP
Sbjct  104  TLLLDTEAFKDTIALFVERYKDKDISVVAGVEARGFIFGPPIALAIGAKFVPMRKPKKLP  163

Query  568  GKVIRQEYDLEYGSDCLEMHVGAVEAGDRALVVDDLIATGGTLCAAMDLLERAGAEVVEC  389
            GKVI +EY LEYG+D +EMHVGAVE G+RA+++DDLIATGGTL AA+ LLER G ++VEC
Sbjct  164  GKVISEEYSLEYGTDKIEMHVGAVEPGERAIIIDDLIATGGTLAAAIRLLERVGVKIVEC  223

Query  388  ACVIEIPDLKGQERLNGKPLYVLVQ  314
            ACVIE+P+LKG+++L   PL+VLV 
Sbjct  224  ACVIELPELKGKDKLGETPLFVLVS  248



>gb|KFK28982.1| hypothetical protein AALP_AA7G073200 [Arabis alpina]
Length=245

 Score =   274 bits (701),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 132/186 (71%), Positives = 159/186 (85%), Gaps = 1/186 (1%)
 Frame = -2

Query  871  TRQCRTMSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVER  692
            +R C  M+     DPRI  I S IRV+P FPKPGIMFQDITTLLLD +AFKDTI++FVER
Sbjct  59   SRDCE-MATDNGQDPRIAKISSSIRVIPDFPKPGIMFQDITTLLLDTEAFKDTINMFVER  117

Query  691  YKGKNISIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEM  512
            Y+GK+IS+VAG+EARGFIFGP IALAIGAKFVP+RKPKKLPGKVI +EY LEYG+D +EM
Sbjct  118  YEGKDISVVAGVEARGFIFGPPIALAIGAKFVPMRKPKKLPGKVISEEYSLEYGTDKIEM  177

Query  511  HVGAVEAGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKP  332
            HVGAVE G+RA+++DDLIATGGTL AA+ LLER G ++VECACVIE+P+LKG+++L   P
Sbjct  178  HVGAVEPGERAIIIDDLIATGGTLAAAIRLLERVGVKIVECACVIELPELKGKDKLGETP  237

Query  331  LYVLVQ  314
            L+VLV 
Sbjct  238  LFVLVS  243



>ref|XP_009399108.1| PREDICTED: adenine phosphoribosyltransferase 1, chloroplastic 
[Musa acuminata subsp. malaccensis]
Length=182

 Score =   272 bits (695),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 132/180 (73%), Positives = 157/180 (87%), Gaps = 0/180 (0%)
 Frame = -2

Query  853  MSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI  674
            M++   +DPR+  I S IRV+P FPKPGIMFQDITTLLLD +AF+ TID+FVERY+ K I
Sbjct  1    MASEGGEDPRLPRIASTIRVIPDFPKPGIMFQDITTLLLDHEAFRHTIDMFVERYRDKRI  60

Query  673  SIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVE  494
            ++VAGIEARGFIFGP IALAIG KFVP+RKPKKLPG+VI +EY LEYG+D +EMHVGAV+
Sbjct  61   TVVAGIEARGFIFGPPIALAIGCKFVPMRKPKKLPGEVISEEYSLEYGTDIMEMHVGAVQ  120

Query  493  AGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
             GDRALV+DDLIATGGTL AA+ LLER GAEVVECACVIE+P+L+G +RL GKPL+VLV+
Sbjct  121  PGDRALVIDDLIATGGTLAAAIRLLERVGAEVVECACVIELPELQGYQRLGGKPLFVLVK  180



>ref|XP_010688209.1| PREDICTED: adenine phosphoribosyltransferase 1-like [Beta vulgaris 
subsp. vulgaris]
Length=259

 Score =   275 bits (702),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 128/173 (74%), Positives = 154/173 (89%), Gaps = 0/173 (0%)
 Frame = -2

Query  832  DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIE  653
            D RI  I S IRV+P+FPKPG+MFQDITT+LLDPKAFKDTIDLFVERYKGK+IS+VAG+E
Sbjct  85   DDRISKIASTIRVIPNFPKPGVMFQDITTMLLDPKAFKDTIDLFVERYKGKDISVVAGVE  144

Query  652  ARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALV  473
            ARGFIFGP IALAIGAKFVP+RKP KLPG+VI +EY LEYG+D +EMHVGAVE G+RA++
Sbjct  145  ARGFIFGPPIALAIGAKFVPMRKPGKLPGEVISEEYSLEYGTDKMEMHVGAVETGERAII  204

Query  472  VDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
            +DDLIATGGTL AA+ LLER   +VVECAC+IE+P+LKG+E+L   PL+VL++
Sbjct  205  IDDLIATGGTLLAAIKLLERVKVQVVECACLIELPELKGREKLGDNPLFVLIK  257



>ref|XP_009360540.1| PREDICTED: adenine phosphoribosyltransferase 1-like [Pyrus x 
bretschneideri]
Length=250

 Score =   274 bits (700),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 137/184 (74%), Positives = 155/184 (84%), Gaps = 0/184 (0%)
 Frame = -2

Query  865  QCRTMSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYK  686
            +   M+A    D R+  I S IRV+  FPKPGI+FQDITTLLLD KAFKDTIDLFVERYK
Sbjct  64   KVEAMAAEDGQDLRLARISSAIRVIRDFPKPGILFQDITTLLLDTKAFKDTIDLFVERYK  123

Query  685  GKNISIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHV  506
             K IS+VAG+EARGFIFGP IALAIGAKFVPLRKPKKLPGKVI +EY LEYG+D +EMHV
Sbjct  124  DKEISVVAGVEARGFIFGPPIALAIGAKFVPLRKPKKLPGKVISEEYSLEYGTDKIEMHV  183

Query  505  GAVEAGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLY  326
            GAVEAG+RAL++DDLIATGGTL AA+ LLER G  VVECACVIE+P+LKG+ERL  KPL+
Sbjct  184  GAVEAGERALIIDDLIATGGTLGAAIRLLERVGVHVVECACVIELPELKGRERLGEKPLF  243

Query  325  VLVQ  314
            VLV 
Sbjct  244  VLVS  247



>ref|XP_010933700.1| PREDICTED: adenine phosphoribosyltransferase 3-like isoform X2 
[Elaeis guineensis]
Length=159

 Score =   270 bits (691),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 129/153 (84%), Positives = 147/153 (96%), Gaps = 0/153 (0%)
 Frame = -2

Query  772  GIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIEARGFIFGPSIALAIGAKFVP  593
            GIMFQDITTLLLDPKAFK+T+DLFVERY GK+I++VAGIEARGFIFGP IALAIGAKFVP
Sbjct  5    GIMFQDITTLLLDPKAFKNTVDLFVERYTGKDITVVAGIEARGFIFGPPIALAIGAKFVP  64

Query  592  LRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALVVDDLIATGGTLCAAMDLLER  413
            LRKP+KLPG+VI +EY LEYG+DCL+MH+GAV+ GDRALVVDDLIATGGTLCAA+ LLER
Sbjct  65   LRKPRKLPGEVISEEYVLEYGTDCLQMHIGAVQPGDRALVVDDLIATGGTLCAAIKLLER  124

Query  412  AGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
            AGAEVVECACVIE+P+LKG+ERLNGKPLY+LV+
Sbjct  125  AGAEVVECACVIELPELKGRERLNGKPLYILVE  157



>ref|XP_009113762.1| PREDICTED: adenine phosphoribosyltransferase 1, chloroplastic 
[Brassica rapa]
 emb|CDY27617.1| BnaA09g27900D [Brassica napus]
Length=185

 Score =   271 bits (694),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 132/179 (74%), Positives = 154/179 (86%), Gaps = 2/179 (1%)
 Frame = -2

Query  847  AFRED--DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI  674
            A +ED  DPRI  I S IRV+P FPKPGIMFQDITTLLLD +AFKDT+D+FVERYKGK I
Sbjct  2    ATKEDVQDPRIPKIASSIRVIPDFPKPGIMFQDITTLLLDTEAFKDTVDIFVERYKGKGI  61

Query  673  SIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVE  494
            S+VAG+EARGFIFGP IALAIGAKFVP+RKPKKLPGKVI +EY LEYG+D +EMHVGAVE
Sbjct  62   SVVAGVEARGFIFGPPIALAIGAKFVPMRKPKKLPGKVISEEYSLEYGTDKIEMHVGAVE  121

Query  493  AGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLV  317
             G+RA+++DDLIATGGTL AA+ LLER G  + ECACVIE+P LKG+E+L   PL++LV
Sbjct  122  PGERAIIIDDLIATGGTLAAAIRLLERVGVTIAECACVIELPVLKGREKLGETPLFILV  180



>gb|KCW71999.1| hypothetical protein EUGRSUZ_E00451 [Eucalyptus grandis]
Length=171

 Score =   271 bits (692),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 137/180 (76%), Positives = 154/180 (86%), Gaps = 11/180 (6%)
 Frame = -2

Query  853  MSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI  674
            MSA +++DPR+ GI+SRIRVVP FPKPGIMFQDITTLLLD KAFKD IDLFVERYK +NI
Sbjct  1    MSADKDEDPRMYGIKSRIRVVPDFPKPGIMFQDITTLLLDSKAFKDAIDLFVERYKDRNI  60

Query  673  SIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVE  494
            S+VAGIEARGFIFGP IALAIGAKFVPLRKP KLPG+VI ++Y LEYG DCL+MH+GAV+
Sbjct  61   SVVAGIEARGFIFGPPIALAIGAKFVPLRKPGKLPGEVISEDYVLEYGKDCLQMHIGAVQ  120

Query  493  AGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
              +RALVVDDLIAT           ER GAEVVECACVIE+PDLKG+ERL GKPLYVLV+
Sbjct  121  PEERALVVDDLIAT-----------ERVGAEVVECACVIELPDLKGRERLKGKPLYVLVE  169



>ref|XP_006303303.1| hypothetical protein CARUB_v10010115mg [Capsella rubella]
 gb|EOA36201.1| hypothetical protein CARUB_v10010115mg [Capsella rubella]
Length=244

 Score =   273 bits (699),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 135/195 (69%), Positives = 158/195 (81%), Gaps = 2/195 (1%)
 Frame = -2

Query  892  LSFFLHFTRQCRTMSAFRED--DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFK  719
            L  F       R      ED  DPRI  I + IRV+P FPKPGIMFQDITTLLLD +AFK
Sbjct  48   LRLFSSAAAASRDSEMATEDVQDPRIAKIAASIRVIPDFPKPGIMFQDITTLLLDTEAFK  107

Query  718  DTIDLFVERYKGKNISIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDL  539
            DTI LFV+RYKGK+IS+VAG+EARGFIFGP IALAIGAKFVP+RKPKKLPGKVI +EY L
Sbjct  108  DTIALFVDRYKGKDISVVAGVEARGFIFGPPIALAIGAKFVPMRKPKKLPGKVISEEYSL  167

Query  538  EYGSDCLEMHVGAVEAGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLK  359
            EYG+D +EMHVGAVE G+RA+++DDLIATGGTL AA+ LLER G ++VECACVIE+P+LK
Sbjct  168  EYGTDKIEMHVGAVEPGERAIIIDDLIATGGTLAAAIRLLERVGVKIVECACVIELPELK  227

Query  358  GQERLNGKPLYVLVQ  314
            G+E+L   PL+VLV 
Sbjct  228  GKEKLGETPLFVLVS  242



>ref|XP_006303304.1| hypothetical protein CARUB_v10010115mg [Capsella rubella]
 gb|EOA36202.1| hypothetical protein CARUB_v10010115mg [Capsella rubella]
Length=246

 Score =   273 bits (698),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 130/173 (75%), Positives = 153/173 (88%), Gaps = 0/173 (0%)
 Frame = -2

Query  832  DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIE  653
            DPRI  I + IRV+P FPKPGIMFQDITTLLLD +AFKDTI LFV+RYKGK+IS+VAG+E
Sbjct  72   DPRIAKIAASIRVIPDFPKPGIMFQDITTLLLDTEAFKDTIALFVDRYKGKDISVVAGVE  131

Query  652  ARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALV  473
            ARGFIFGP IALAIGAKFVP+RKPKKLPGKVI +EY LEYG+D +EMHVGAVE G+RA++
Sbjct  132  ARGFIFGPPIALAIGAKFVPMRKPKKLPGKVISEEYSLEYGTDKIEMHVGAVEPGERAII  191

Query  472  VDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
            +DDLIATGGTL AA+ LLER G ++VECACVIE+P+LKG+E+L   PL+VLV 
Sbjct  192  IDDLIATGGTLAAAIRLLERVGVKIVECACVIELPELKGKEKLGETPLFVLVS  244



>ref|XP_010911922.1| PREDICTED: adenine phosphoribosyltransferase 2-like isoform X2 
[Elaeis guineensis]
Length=184

 Score =   271 bits (692),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 129/176 (73%), Positives = 151/176 (86%), Gaps = 0/176 (0%)
 Frame = -2

Query  832  DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIE  653
            DPR+  I + IRVVPHFPKPGIMF DITTLLL PK FKD +++FV+RY+   IS VAGIE
Sbjct  9    DPRLQAISAAIRVVPHFPKPGIMFNDITTLLLRPKVFKDVVEIFVDRYRDMGISAVAGIE  68

Query  652  ARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALV  473
            ARGFIFGPSIAL IGAKF+PLRKPKKLPG+VI + Y LEYG+DCLEMHVGAV  G+R LV
Sbjct  69   ARGFIFGPSIALGIGAKFIPLRKPKKLPGEVISEAYVLEYGTDCLEMHVGAVHPGERVLV  128

Query  472  VDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQEKK  305
            +DDL+ATGGTLCAA+ LLERAGAEVVECACV+ +P  KG+ RLNGKP+YVLV+ ++
Sbjct  129  IDDLVATGGTLCAAIRLLERAGAEVVECACVVGLPKFKGRCRLNGKPVYVLVECRR  184



>ref|XP_010460504.1| PREDICTED: adenine phosphoribosyltransferase 1, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=249

 Score =   273 bits (698),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 130/173 (75%), Positives = 152/173 (88%), Gaps = 0/173 (0%)
 Frame = -2

Query  832  DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIE  653
            DPRI  I S IRV+P FPKPGIMFQDITTLLLD +AFKDTI LFVERYK K+IS+VAG+E
Sbjct  75   DPRIAKIASSIRVIPDFPKPGIMFQDITTLLLDTEAFKDTIALFVERYKDKDISVVAGVE  134

Query  652  ARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALV  473
            ARGFIFGP IALAIGAKFVP+RKPKKLPGKVI +EY LEYG+D +EMHVGAVE G+RA++
Sbjct  135  ARGFIFGPPIALAIGAKFVPMRKPKKLPGKVISEEYSLEYGTDKIEMHVGAVEPGERAII  194

Query  472  VDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
            +DDLIATGGTL AA+ LLER G ++VECACVIE+P+LKG+++L   PL+VLV 
Sbjct  195  IDDLIATGGTLAAAIRLLERVGVKIVECACVIELPELKGKDKLGETPLFVLVS  247



>ref|XP_006415758.1| hypothetical protein EUTSA_v10008627mg [Eutrema salsugineum]
 ref|XP_006415760.1| hypothetical protein EUTSA_v10008627mg [Eutrema salsugineum]
 gb|ESQ34111.1| hypothetical protein EUTSA_v10008627mg [Eutrema salsugineum]
 gb|ESQ34113.1| hypothetical protein EUTSA_v10008627mg [Eutrema salsugineum]
Length=182

 Score =   270 bits (690),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 130/180 (72%), Positives = 153/180 (85%), Gaps = 0/180 (0%)
 Frame = -2

Query  853  MSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI  674
            M+     DPRI  I S IRV+P FPKPGIMF DITTLLLD +AFKDTIDLFVERYKGK I
Sbjct  1    MATEDGQDPRIPKIASSIRVIPDFPKPGIMFHDITTLLLDTEAFKDTIDLFVERYKGKGI  60

Query  673  SIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVE  494
            S+VAG+EARGFIFGP IALAIGAKFVP+RKPKKLPGKVI +EY LEYG+D +EMHVGAVE
Sbjct  61   SVVAGVEARGFIFGPPIALAIGAKFVPMRKPKKLPGKVISEEYSLEYGTDKIEMHVGAVE  120

Query  493  AGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
             G+RA+++DDLIATGGTL AA+ LLER G ++VECACVIE+P+ KG+E+L   PL++L+ 
Sbjct  121  PGERAIIIDDLIATGGTLSAAVRLLERVGVKIVECACVIELPECKGREKLGETPLFILIS  180



>ref|XP_010499225.1| PREDICTED: adenine phosphoribosyltransferase 1, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=244

 Score =   272 bits (696),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 130/173 (75%), Positives = 152/173 (88%), Gaps = 0/173 (0%)
 Frame = -2

Query  832  DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIE  653
            DPRI  I S IRV+P FPKPGIMFQDITTLLLD +AFKDTI LFVERYK K+IS+VAG+E
Sbjct  70   DPRIAKIASSIRVIPDFPKPGIMFQDITTLLLDTEAFKDTIALFVERYKDKDISVVAGVE  129

Query  652  ARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALV  473
            ARGFIFGP IALAIGAKFVP+RKPKKLPGKVI +EY LEYG+D +EMHVGAVE G+RA++
Sbjct  130  ARGFIFGPPIALAIGAKFVPMRKPKKLPGKVISEEYSLEYGTDKIEMHVGAVEPGERAII  189

Query  472  VDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
            +DDLIATGGTL AA+ LLER G ++VECACVIE+P+LKG+++L   PL+VLV 
Sbjct  190  IDDLIATGGTLAAAIRLLERVGVKIVECACVIELPELKGKDKLGETPLFVLVS  242



>ref|XP_010478084.1| PREDICTED: adenine phosphoribosyltransferase 1, chloroplastic 
[Camelina sativa]
Length=246

 Score =   272 bits (696),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 130/173 (75%), Positives = 152/173 (88%), Gaps = 0/173 (0%)
 Frame = -2

Query  832  DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIE  653
            DPRI  I S IRV+P FPKPGIMFQDITTLLLD +AFKDTI LFVERYK K+IS+VAG+E
Sbjct  72   DPRIAKIASSIRVIPDFPKPGIMFQDITTLLLDTEAFKDTIALFVERYKDKDISVVAGVE  131

Query  652  ARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALV  473
            ARGFIFGP IALAIGAKFVP+RKPKKLPGKVI +EY LEYG+D +EMHVGAVE G+RA++
Sbjct  132  ARGFIFGPPIALAIGAKFVPMRKPKKLPGKVISEEYSLEYGTDKIEMHVGAVEPGERAII  191

Query  472  VDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
            +DDLIATGGTL AA+ LLER G ++VECACVIE+P+LKG+++L   PL+VLV 
Sbjct  192  IDDLIATGGTLAAAIRLLERVGVKIVECACVIELPELKGKDKLGETPLFVLVS  244



>ref|XP_010499224.1| PREDICTED: adenine phosphoribosyltransferase 1, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=245

 Score =   272 bits (696),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 130/173 (75%), Positives = 152/173 (88%), Gaps = 0/173 (0%)
 Frame = -2

Query  832  DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIE  653
            DPRI  I S IRV+P FPKPGIMFQDITTLLLD +AFKDTI LFVERYK K+IS+VAG+E
Sbjct  71   DPRIAKIASSIRVIPDFPKPGIMFQDITTLLLDTEAFKDTIALFVERYKDKDISVVAGVE  130

Query  652  ARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALV  473
            ARGFIFGP IALAIGAKFVP+RKPKKLPGKVI +EY LEYG+D +EMHVGAVE G+RA++
Sbjct  131  ARGFIFGPPIALAIGAKFVPMRKPKKLPGKVISEEYSLEYGTDKIEMHVGAVEPGERAII  190

Query  472  VDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
            +DDLIATGGTL AA+ LLER G ++VECACVIE+P+LKG+++L   PL+VLV 
Sbjct  191  IDDLIATGGTLAAAIRLLERVGVKIVECACVIELPELKGKDKLGETPLFVLVS  243



>ref|XP_010061685.1| PREDICTED: adenine phosphoribosyltransferase 1 [Eucalyptus grandis]
 gb|KCW68662.1| hypothetical protein EUGRSUZ_F02260 [Eucalyptus grandis]
Length=258

 Score =   273 bits (697),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 130/180 (72%), Positives = 156/180 (87%), Gaps = 1/180 (1%)
 Frame = -2

Query  853  MSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI  674
            M++    DPR+  I S IRV+P FPKPGIMFQDITTLLL+P+AFKDTIDLFVERY+ +NI
Sbjct  77   MASQGGQDPRLAKIASSIRVIPDFPKPGIMFQDITTLLLNPEAFKDTIDLFVERYREQNI  136

Query  673  SIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVE  494
            S+VAG+EARGFIFGP IALAIGAKFVP+R P ++ G+VI +EY LEYG+D +EMHVGAV+
Sbjct  137  SVVAGVEARGFIFGPPIALAIGAKFVPMRNP-QITGEVISEEYSLEYGTDTMEMHVGAVQ  195

Query  493  AGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
             GDRAL+VDDLIATGGTLCAA+ L+ER GAEVVECAC IE+P+LKG++RL  KPL+VLV 
Sbjct  196  PGDRALIVDDLIATGGTLCAAIKLIERVGAEVVECACAIELPELKGRDRLGDKPLFVLVS  255



>gb|AAP85303.1| adenine phosphoribosyltransferase [Brassica napus]
Length=204

 Score =   270 bits (691),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 132/177 (75%), Positives = 155/177 (88%), Gaps = 2/177 (1%)
 Frame = -2

Query  841  RED--DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISI  668
            +ED  DPRI  I S IRV+P FPKPGIMFQDITTLLLD +AFKDTID+FVERYK K IS+
Sbjct  23   KEDGQDPRIPKIASSIRVIPDFPKPGIMFQDITTLLLDTEAFKDTIDIFVERYKCKGISV  82

Query  667  VAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAG  488
            VAG+EARGFIFGP IALAIGAKFVP+RKPKKLPGKVI +EY LEYG+D +EMHVGAVE G
Sbjct  83   VAGVEARGFIFGPPIALAIGAKFVPMRKPKKLPGKVISEEYSLEYGTDKIEMHVGAVEPG  142

Query  487  DRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLV  317
            +RA+++DDLIATGGTL AA+ LLER G ++VECACVIE+P+LKG+E+L   PL++LV
Sbjct  143  ERAIIIDDLIATGGTLAAAIRLLERVGVKIVECACVIELPELKGREKLGEAPLFILV  199



>ref|XP_002890728.1| hypothetical protein ARALYDRAFT_472949 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66987.1| hypothetical protein ARALYDRAFT_472949 [Arabidopsis lyrata subsp. 
lyrata]
Length=242

 Score =   272 bits (695),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 130/174 (75%), Positives = 151/174 (87%), Gaps = 0/174 (0%)
 Frame = -2

Query  832  DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIE  653
            DPRI  I S IRV+P FPKPGIMFQDITTLLLD +AFKDTI LFV+RYK K IS+VAG+E
Sbjct  67   DPRIAKIASSIRVIPDFPKPGIMFQDITTLLLDTEAFKDTIALFVDRYKDKGISVVAGVE  126

Query  652  ARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALV  473
            ARGFIFGP IALAIGAKFVP+RKPKKLPGKVI +EY LEYG+D +EMHVGAVE G+RA++
Sbjct  127  ARGFIFGPPIALAIGAKFVPMRKPKKLPGKVISEEYSLEYGTDTIEMHVGAVEPGERAII  186

Query  472  VDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQE  311
            +DDLIATGGTL AA+ LLER G ++VECACVIE+P+LKG+E+L   PL+VLV  
Sbjct  187  IDDLIATGGTLAAAIRLLERVGVKIVECACVIELPELKGKEKLGETPLFVLVSS  240



>ref|XP_007023256.1| Adenine phosphoribosyl transferase 2 isoform 2 [Theobroma cacao]
 gb|EOY25878.1| Adenine phosphoribosyl transferase 2 isoform 2 [Theobroma cacao]
Length=216

 Score =   271 bits (692),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 129/179 (72%), Positives = 156/179 (87%), Gaps = 1/179 (1%)
 Frame = -2

Query  838  EDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAG  659
            + DPR+  I   IRVVPHFPKPGIMFQDITTLLLD K FKDT+D+FV+RY+   IS+VAG
Sbjct  13   QGDPRLKAISEAIRVVPHFPKPGIMFQDITTLLLDHKCFKDTVDIFVDRYRDMAISVVAG  72

Query  658  IEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRA  479
            +EARGF+FGPS+ALAIGAKFVPLRKP+KLPG+VI + Y LEYG+DCLEMHVGAV+ G+RA
Sbjct  73   VEARGFMFGPSVALAIGAKFVPLRKPRKLPGEVISEAYVLEYGTDCLEMHVGAVQPGERA  132

Query  478  LVVDDLIATGGTLCAAMDLL-ERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQEKK  305
            LV+DDL+ATGGTL AA+ LL ER GAEVVECACV+ + ++KGQ RLNGKPLY+LV+ ++
Sbjct  133  LVIDDLVATGGTLSAAIRLLVERVGAEVVECACVVGLREVKGQHRLNGKPLYILVEPRQ  191



>gb|KCW68663.1| hypothetical protein EUGRSUZ_F02260 [Eucalyptus grandis]
Length=182

 Score =   270 bits (689),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 130/180 (72%), Positives = 156/180 (87%), Gaps = 1/180 (1%)
 Frame = -2

Query  853  MSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI  674
            M++    DPR+  I S IRV+P FPKPGIMFQDITTLLL+P+AFKDTIDLFVERY+ +NI
Sbjct  1    MASQGGQDPRLAKIASSIRVIPDFPKPGIMFQDITTLLLNPEAFKDTIDLFVERYREQNI  60

Query  673  SIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVE  494
            S+VAG+EARGFIFGP IALAIGAKFVP+R P ++ G+VI +EY LEYG+D +EMHVGAV+
Sbjct  61   SVVAGVEARGFIFGPPIALAIGAKFVPMRNP-QITGEVISEEYSLEYGTDTMEMHVGAVQ  119

Query  493  AGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
             GDRAL+VDDLIATGGTLCAA+ L+ER GAEVVECAC IE+P+LKG++RL  KPL+VLV 
Sbjct  120  PGDRALIVDDLIATGGTLCAAIKLIERVGAEVVECACAIELPELKGRDRLGDKPLFVLVS  179



>ref|XP_004291447.1| PREDICTED: adenine phosphoribosyltransferase 2-like [Fragaria 
vesca subsp. vesca]
Length=190

 Score =   270 bits (689),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 130/177 (73%), Positives = 156/177 (88%), Gaps = 1/177 (1%)
 Frame = -2

Query  832  DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIE  653
            DPR+  I   IRVVPHFPK GIMFQDITTLLLD KAFK T+D+FV+RY+  +IS+VA +E
Sbjct  11   DPRLQAISEAIRVVPHFPKQGIMFQDITTLLLDHKAFKHTVDIFVDRYRDMDISVVA-VE  69

Query  652  ARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALV  473
            ARGF+FGP+IALAIGAKFVPLRKP+KLPG+VI + Y+LEYG+DCLEMHVGAV+ G+RALV
Sbjct  70   ARGFMFGPAIALAIGAKFVPLRKPRKLPGEVISEAYELEYGTDCLEMHVGAVQPGERALV  129

Query  472  VDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQEKKL  302
            +DDLIATGGTL AA+ LLER GAEVVEC CVI +P++KGQ RLNGKPLY+LV+ ++L
Sbjct  130  IDDLIATGGTLSAAISLLERVGAEVVECGCVIGLPEVKGQCRLNGKPLYILVEPREL  186



>ref|XP_006415759.1| hypothetical protein EUTSA_v10008627mg [Eutrema salsugineum]
 gb|ESQ34112.1| hypothetical protein EUTSA_v10008627mg [Eutrema salsugineum]
Length=242

 Score =   271 bits (694),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 129/174 (74%), Positives = 151/174 (87%), Gaps = 0/174 (0%)
 Frame = -2

Query  835  DDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGI  656
             DPRI  I S IRV+P FPKPGIMF DITTLLLD +AFKDTIDLFVERYKGK IS+VAG+
Sbjct  67   QDPRIPKIASSIRVIPDFPKPGIMFHDITTLLLDTEAFKDTIDLFVERYKGKGISVVAGV  126

Query  655  EARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRAL  476
            EARGFIFGP IALAIGAKFVP+RKPKKLPGKVI +EY LEYG+D +EMHVGAVE G+RA+
Sbjct  127  EARGFIFGPPIALAIGAKFVPMRKPKKLPGKVISEEYSLEYGTDKIEMHVGAVEPGERAI  186

Query  475  VVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
            ++DDLIATGGTL AA+ LLER G ++VECACVIE+P+ KG+E+L   PL++L+ 
Sbjct  187  IIDDLIATGGTLSAAVRLLERVGVKIVECACVIELPECKGREKLGETPLFILIS  240



>ref|XP_006450395.1| hypothetical protein CICLE_v10009485mg [Citrus clementina]
 ref|XP_006483385.1| PREDICTED: adenine phosphoribosyltransferase 2-like isoform X1 
[Citrus sinensis]
 gb|ESR63635.1| hypothetical protein CICLE_v10009485mg [Citrus clementina]
 gb|KDO61775.1| hypothetical protein CISIN_1g028297mg [Citrus sinensis]
Length=190

 Score =   270 bits (689),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 129/175 (74%), Positives = 153/175 (87%), Gaps = 0/175 (0%)
 Frame = -2

Query  832  DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIE  653
            DPR+ GI   IRVVP FP PGIMFQDITTLLLD KAFKDT+D+FV+RY+   IS+VAGIE
Sbjct  11   DPRLQGISKAIRVVPDFPIPGIMFQDITTLLLDHKAFKDTVDIFVDRYRDMGISVVAGIE  70

Query  652  ARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALV  473
            ARGF+FGPSIALAIGAKFVPLRKP KLPG+VI + Y LEYG+D LEMHVGA+E G+RALV
Sbjct  71   ARGFVFGPSIALAIGAKFVPLRKPNKLPGEVISEAYVLEYGTDRLEMHVGAIEPGERALV  130

Query  472  VDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQEK  308
            +DDL+ATGGTL AA+ LLER GAEVVECACV+ +P+++GQ RL+GKPLY+LV+ +
Sbjct  131  IDDLVATGGTLSAAVRLLERMGAEVVECACVVGLPEVRGQRRLDGKPLYILVEPR  185



>ref|XP_008219510.1| PREDICTED: adenine phosphoribosyltransferase 2 isoform X1 [Prunus 
mume]
Length=205

 Score =   270 bits (690),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 131/191 (69%), Positives = 158/191 (83%), Gaps = 14/191 (7%)
 Frame = -2

Query  832  DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIE  653
            DPR+  I   IRVVPHFPKPGIMFQDITTLLLD KAFK T+D+FV+RY+  +IS+VAG+E
Sbjct  11   DPRLQAISEAIRVVPHFPKPGIMFQDITTLLLDHKAFKHTVDIFVDRYRDMDISVVAGVE  70

Query  652  ARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALV  473
            ARGF+FGPSIALAIGAKFVPLRKP+KLPG+VI + Y+LEYG+DCLEMHVGAV+ G+RALV
Sbjct  71   ARGFMFGPSIALAIGAKFVPLRKPRKLPGEVISEAYELEYGTDCLEMHVGAVQPGERALV  130

Query  472  VDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLK--------------GQERLNGK  335
            +DDLIATGGTL AA+ LLER GAEVVEC CV+ +P++K              GQ RLNGK
Sbjct  131  IDDLIATGGTLSAAITLLERVGAEVVECGCVVGLPEVKCYAVELLLMIVTFQGQCRLNGK  190

Query  334  PLYVLVQEKKL  302
            PLY+LV+ +++
Sbjct  191  PLYILVEPREI  201



>ref|NP_849714.1| adenine phosphoribosyl transferase 1 [Arabidopsis thaliana]
 gb|AAG40397.1|AF325045_1 At1g27450 [Arabidopsis thaliana]
 emb|CAA41497.1| adenine phosphoribosyltransferase [Arabidopsis thaliana]
 gb|AAA20677.1| adenine phosphoribosyltransferase [Arabidopsis thaliana]
 gb|AAM91580.1| adenine phosphoribosyltransferase 1, APRT [Arabidopsis thaliana]
 gb|AAN15689.1| adenine phosphoribosyltransferase 1, APRT [Arabidopsis thaliana]
 gb|AEE30832.1| adenine phosphoribosyl transferase 1 [Arabidopsis thaliana]
Length=183

 Score =   269 bits (687),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 129/173 (75%), Positives = 151/173 (87%), Gaps = 0/173 (0%)
 Frame = -2

Query  832  DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIE  653
            DPRI  I S IRV+P FPKPGIMFQDITTLLLD +AFKDTI LFV+RYK K IS+VAG+E
Sbjct  8    DPRIAKIASSIRVIPDFPKPGIMFQDITTLLLDTEAFKDTIALFVDRYKDKGISVVAGVE  67

Query  652  ARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALV  473
            ARGFIFGP IALAIGAKFVP+RKPKKLPGKVI +EY LEYG+D +EMHVGAVE G+RA++
Sbjct  68   ARGFIFGPPIALAIGAKFVPMRKPKKLPGKVISEEYSLEYGTDTIEMHVGAVEPGERAII  127

Query  472  VDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
            +DDLIATGGTL AA+ LLER G ++VECACVIE+P+LKG+E+L    L+VLV+
Sbjct  128  IDDLIATGGTLAAAIRLLERVGVKIVECACVIELPELKGKEKLGETSLFVLVK  180



>ref|NP_001053244.1| Os04g0504000 [Oryza sativa Japonica Group]
 gb|AAO85795.1| adenine phosphoribosyltransferase form 2 [Oryza sativa Indica 
Group]
 emb|CAE05550.1| OSJNBb0116K07.3 [Oryza sativa Japonica Group]
 dbj|BAF15158.1| Os04g0504000 [Oryza sativa Japonica Group]
 gb|EEE61285.1| hypothetical protein OsJ_15369 [Oryza sativa Japonica Group]
Length=212

 Score =   270 bits (690),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 128/179 (72%), Positives = 150/179 (84%), Gaps = 0/179 (0%)
 Frame = -2

Query  841  REDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVA  662
            R  DPR+  I   IRVVPHFPKPGIMF DIT LLL P AFKD +D+FVERY+G  I+ VA
Sbjct  34   RAADPRLQAISDAIRVVPHFPKPGIMFNDITALLLRPAAFKDAVDMFVERYRGMRIAAVA  93

Query  661  GIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDR  482
            GIEARGFIFGP+IALAIGAKF+PLRKPKKLPG+VI + Y LEYG+DCLEMHVGA E G+R
Sbjct  94   GIEARGFIFGPAIALAIGAKFIPLRKPKKLPGEVISETYILEYGTDCLEMHVGATEPGER  153

Query  481  ALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQEKK  305
             +VVDDL+ATGGTLCAA+ LLERAGA+VVECAC+I +P  K   +LNGKP+Y+LV+ +K
Sbjct  154  VVVVDDLVATGGTLCAAIKLLERAGADVVECACLIGLPKYKNFYKLNGKPVYILVESRK  212



>ref|XP_003525929.1| PREDICTED: adenine phosphoribosyltransferase 1, chloroplastic-like 
[Glycine max]
 gb|KHN45153.1| Adenine phosphoribosyltransferase 1, chloroplastic [Glycine soja]
Length=235

 Score =   270 bits (691),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 135/228 (59%), Positives = 169/228 (74%), Gaps = 0/228 (0%)
 Frame = -2

Query  997  CILHSLFHSIYSPYIFSPFQPFSFLSAFHLLSITLLSFFLHFTRQCRTMSAFREDDPRID  818
            C  +S   +    +    F P   +S+   L+ T L       +  R  S   + D R+ 
Sbjct  5    CCSNSGVSATLPSFPCPRFPPLIAISSIRFLNSTPLRSTASPRQVTRMASKNAQQDTRLA  64

Query  817  GIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIEARGFI  638
             I S IRV+P FPKPGI+FQDITTLLLD KAFKDT+DLFVERY+ +NI++VAG+EARGFI
Sbjct  65   RIASAIRVIPDFPKPGILFQDITTLLLDTKAFKDTVDLFVERYRDQNINVVAGVEARGFI  124

Query  637  FGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALVVDDLI  458
            FGP IALAIGAKFVP+RKP KLPG+VI +EY LEYG+D +EMHVGAV+ G+RAL++DDLI
Sbjct  125  FGPPIALAIGAKFVPMRKPNKLPGEVISEEYSLEYGTDKMEMHVGAVQPGERALIIDDLI  184

Query  457  ATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
            ATGGTL AA+ LLER G  VVECACVIE+P+LKG++RL  K L+VL++
Sbjct  185  ATGGTLGAAIKLLERVGVHVVECACVIELPELKGRDRLGDKSLFVLIK  232



>emb|CDX90088.1| BnaA08g18960D [Brassica napus]
Length=245

 Score =   271 bits (692),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 132/177 (75%), Positives = 155/177 (88%), Gaps = 2/177 (1%)
 Frame = -2

Query  841  RED--DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISI  668
            +ED  DPRI  I S IRV+P FPKPGIMFQDITTLLLD +AFKDTID+FVERYK K IS+
Sbjct  64   KEDGQDPRIPKIASSIRVIPDFPKPGIMFQDITTLLLDTEAFKDTIDIFVERYKCKGISV  123

Query  667  VAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAG  488
            VAG+EARGFIFGP IALAIGAKFVP+RKPKKLPGKVI +EY LEYG+D +EMHVGAVE G
Sbjct  124  VAGVEARGFIFGPPIALAIGAKFVPMRKPKKLPGKVISEEYSLEYGTDKIEMHVGAVEPG  183

Query  487  DRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLV  317
            +RA+++DDLIATGGTL AA+ LLER G ++VECACVIE+P+LKG+E+L   PL++LV
Sbjct  184  ERAIIIDDLIATGGTLAAAIRLLERVGVKIVECACVIELPELKGREKLGEAPLFILV  240



>ref|NP_564284.1| adenine phosphoribosyl transferase 1 [Arabidopsis thaliana]
 sp|P31166.2|APT1_ARATH RecName: Full=Adenine phosphoribosyltransferase 1, chloroplastic; 
Short=APRT 1; Short=AtAPT1; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAM60891.1| adenine phosphoribosyltransferase 1, APRT [Arabidopsis thaliana]
 gb|AEE30831.1| adenine phosphoribosyl transferase 1 [Arabidopsis thaliana]
Length=243

 Score =   271 bits (692),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 135/208 (65%), Positives = 162/208 (78%), Gaps = 0/208 (0%)
 Frame = -2

Query  937  PFSFLSAFHLLSITLLSFFLHFTRQCRTMSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQ  758
            P S   + H  + +L  F      +   M+     DPRI  I S IRV+P FPKPGIMFQ
Sbjct  33   PPSIRLSNHRSTTSLRLFSSAAASRDSEMATEDVQDPRIAKIASSIRVIPDFPKPGIMFQ  92

Query  757  DITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIEARGFIFGPSIALAIGAKFVPLRKPK  578
            DITTLLLD +AFKDTI LFV+RYK K IS+VAG+EARGFIFGP IALAIGAKFVP+RKPK
Sbjct  93   DITTLLLDTEAFKDTIALFVDRYKDKGISVVAGVEARGFIFGPPIALAIGAKFVPMRKPK  152

Query  577  KLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALVVDDLIATGGTLCAAMDLLERAGAEV  398
            KLPGKVI +EY LEYG+D +EMHVGAVE G+RA+++DDLIATGGTL AA+ LLER G ++
Sbjct  153  KLPGKVISEEYSLEYGTDTIEMHVGAVEPGERAIIIDDLIATGGTLAAAIRLLERVGVKI  212

Query  397  VECACVIEIPDLKGQERLNGKPLYVLVQ  314
            VECACVIE+P+LKG+E+L    L+VLV+
Sbjct  213  VECACVIELPELKGKEKLGETSLFVLVK  240



>ref|NP_001237718.1| uncharacterized protein LOC100499904 [Glycine max]
 gb|ACU14114.1| unknown [Glycine max]
 gb|KHN08146.1| Adenine phosphoribosyltransferase 2 [Glycine soja]
Length=198

 Score =   269 bits (687),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/176 (73%), Positives = 153/176 (87%), Gaps = 0/176 (0%)
 Frame = -2

Query  832  DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIE  653
            DPR+  I   IRVVPHFPK GIMFQDITTLLLD KAFKDT+D+FV+RY+  +IS+VAGIE
Sbjct  11   DPRLQAISQAIRVVPHFPKHGIMFQDITTLLLDHKAFKDTVDIFVDRYRDMHISVVAGIE  70

Query  652  ARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALV  473
            ARGF+FGPSIAL IGAKFVPLRKP+KLPG+VI ++Y LEYG+DCLE+HVGA + G+RA++
Sbjct  71   ARGFMFGPSIALGIGAKFVPLRKPRKLPGEVISEKYALEYGTDCLELHVGAAQPGERAII  130

Query  472  VDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQEKK  305
            +DDL+ATGGTL A + LLER GAEVVECACVI +PD+KGQ R  GKPLYVLV+ +K
Sbjct  131  IDDLVATGGTLSAGVKLLERVGAEVVECACVIGVPDVKGQCRSIGKPLYVLVEPRK  186



>ref|XP_007011830.1| Adenine phosphoribosyltransferase 5 isoform 1 [Theobroma cacao]
 gb|EOY29449.1| Adenine phosphoribosyltransferase 5 isoform 1 [Theobroma cacao]
Length=191

 Score =   268 bits (686),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 127/177 (72%), Positives = 155/177 (88%), Gaps = 0/177 (0%)
 Frame = -2

Query  832  DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIE  653
            DPR+  I   IRVVPHFPK GIMFQDITTLLLD KAFKDT+D+FV+RY+   +S+VAG+E
Sbjct  11   DPRLQAISDAIRVVPHFPKQGIMFQDITTLLLDHKAFKDTVDIFVDRYRDMGVSVVAGVE  70

Query  652  ARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALV  473
            ARGF+FGPSIALAIGAKFVPLRKPKKLPG+VI + Y+LEYG+DCLEMHV AV  G+RA+V
Sbjct  71   ARGFMFGPSIALAIGAKFVPLRKPKKLPGEVIAEAYELEYGTDCLEMHVEAVHPGERAIV  130

Query  472  VDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQEKKL  302
            +DDL+ATGGTL AA+ LLER GAEVVECACVI + +++GQ RL+GKPLY+LV+ +++
Sbjct  131  IDDLVATGGTLSAAIRLLERVGAEVVECACVIGLREVQGQRRLDGKPLYILVEPREV  187



>sp|Q43199.1|APT1_WHEAT RecName: Full=Adenine phosphoribosyltransferase 1; Short=APRT 
1 [Triticum aestivum]
 gb|AAA80609.1| adenine phosphoribosyltransferase form 1 [Triticum aestivum]
Length=181

 Score =   268 bits (684),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 126/173 (73%), Positives = 153/173 (88%), Gaps = 0/173 (0%)
 Frame = -2

Query  832  DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIE  653
            D R++ I S IR +P+FPKPGI+FQDITTLLLDP+AF+DT DLFVERYK K+I++VAG+E
Sbjct  4    DGRVERIASSIRAIPNFPKPGILFQDITTLLLDPQAFRDTTDLFVERYKDKDITVVAGVE  63

Query  652  ARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALV  473
            ARGFIFGP IALAIGAKFVP+RKPKKLPG+VI +EY LEYG+D +EMHVGAV+  DR L+
Sbjct  64   ARGFIFGPPIALAIGAKFVPIRKPKKLPGEVISEEYSLEYGTDKIEMHVGAVQPNDRVLI  123

Query  472  VDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
            VDDLIATGGTLCAA  L+ER GA+VVECACVIE+P+LKG+++L   P++VLVQ
Sbjct  124  VDDLIATGGTLCAAAKLIERVGAKVVECACVIELPELKGRDKLGDMPVFVLVQ  176



>emb|CDP01209.1| unnamed protein product [Coffea canephora]
Length=182

 Score =   268 bits (684),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 130/173 (75%), Positives = 151/173 (87%), Gaps = 0/173 (0%)
 Frame = -2

Query  832  DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIE  653
            D RI  I S IRV+  FPKPGI FQDITTLLLDP+AFKD IDLFVERYK +NI++VAGIE
Sbjct  10   DDRIPRIASTIRVIQDFPKPGIQFQDITTLLLDPRAFKDAIDLFVERYKDQNINVVAGIE  69

Query  652  ARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALV  473
            ARGFIFGP IALA+GAKFVP+RKPKKLPG+VI +EY LEYG+D +EMHVGAV++G+RALV
Sbjct  70   ARGFIFGPPIALAMGAKFVPMRKPKKLPGEVISEEYSLEYGTDKMEMHVGAVQSGERALV  129

Query  472  VDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
            VDDLIATGGTL AA+ LLER G  VVECACVIE+P+LKG++RL  KPL+VL+ 
Sbjct  130  VDDLIATGGTLSAAIRLLERVGVHVVECACVIELPELKGRDRLGDKPLFVLIS  182



>dbj|BAB08003.1| Adenine phosphoribosyltransferase [Hordeum vulgare subsp. vulgare]
Length=181

 Score =   267 bits (683),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 126/173 (73%), Positives = 153/173 (88%), Gaps = 0/173 (0%)
 Frame = -2

Query  832  DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIE  653
            D R++ I S IR +P+FPKPGI+FQDITTLLLDP+AF+DT DLFVERYK K+I++VAG+E
Sbjct  4    DGRVERIASSIRAIPNFPKPGILFQDITTLLLDPQAFRDTTDLFVERYKDKSITVVAGVE  63

Query  652  ARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALV  473
            ARGFIFGP IALAIGAKFVP+RKPKKLPG+VI +EY LEYG+D +EMHVGAV+  DR L+
Sbjct  64   ARGFIFGPPIALAIGAKFVPIRKPKKLPGEVISEEYSLEYGTDKIEMHVGAVQPNDRVLI  123

Query  472  VDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
            VDDLIATGGTLCAA  L+ER GA+VVECACVIE+P+LKG+++L   P++VLVQ
Sbjct  124  VDDLIATGGTLCAAAKLIERVGAKVVECACVIELPELKGRDKLGDLPVFVLVQ  176



>ref|XP_010696453.1| PREDICTED: adenine phosphoribosyltransferase 5 [Beta vulgaris 
subsp. vulgaris]
Length=207

 Score =   268 bits (685),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 127/177 (72%), Positives = 154/177 (87%), Gaps = 0/177 (0%)
 Frame = -2

Query  832  DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIE  653
            DPR+  I   IRVVPHFPK GIMFQDITTLLLD KAFK TID+FV+RY+  +IS+VAG+E
Sbjct  11   DPRLQAISEAIRVVPHFPKQGIMFQDITTLLLDHKAFKHTIDIFVDRYRDMDISVVAGVE  70

Query  652  ARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALV  473
            ARGF+FGP IALAIGAKFVPLRKP+KLPG+VI + Y+LEYG+DCLEMHVGAV+ G+RAL+
Sbjct  71   ARGFMFGPPIALAIGAKFVPLRKPRKLPGEVISESYELEYGTDCLEMHVGAVQPGERALI  130

Query  472  VDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQEKKL  302
            +DDL+ATGGTLCAA+ LLER GAEV ECACVI +P++K + +L G PLYVLV+ ++L
Sbjct  131  IDDLVATGGTLCAAIRLLERVGAEVAECACVIGLPEVKDKFKLRGTPLYVLVEPRQL  187



>ref|XP_003575349.1| PREDICTED: adenine phosphoribosyltransferase 4-like [Brachypodium 
distachyon]
Length=227

 Score =   269 bits (687),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 126/173 (73%), Positives = 149/173 (86%), Gaps = 0/173 (0%)
 Frame = -2

Query  832  DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIE  653
            DPR+ GI   IRVVPHFPK GIMF DITTLLL P  FKD +D+FVERY+G  I+ VAGIE
Sbjct  52   DPRLQGISDAIRVVPHFPKQGIMFNDITTLLLRPGVFKDAVDIFVERYRGMGIAAVAGIE  111

Query  652  ARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALV  473
            ARGFIFGP+IALAIGAKF+PLRKPKKLPG+VI + Y LEYG+DCLEMHVGA+E G+R L+
Sbjct  112  ARGFIFGPAIALAIGAKFIPLRKPKKLPGEVISETYVLEYGTDCLEMHVGAIEHGERVLI  171

Query  472  VDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
            VDDL+ATGGTLCAA++LLERAGA+V+ECAC+I +P  K   +LNGKP+YVLV+
Sbjct  172  VDDLVATGGTLCAAINLLERAGADVIECACLIGLPKFKDFYKLNGKPVYVLVE  224



>dbj|BAK06072.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=224

 Score =   268 bits (686),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 127/173 (73%), Positives = 150/173 (87%), Gaps = 0/173 (0%)
 Frame = -2

Query  832  DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIE  653
            DPR+ GI   IRVVPHFPKPGIMF DITTLLL P  FKD +D+FVERY+G +I+ VAGIE
Sbjct  46   DPRLQGISDAIRVVPHFPKPGIMFNDITTLLLRPGVFKDAVDIFVERYRGMDIAAVAGIE  105

Query  652  ARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALV  473
            ARGFIFGP+IALAIGAKF+PLRKPKKLPG+VI + Y LEYG+DCLEMHVGA+E  +R L+
Sbjct  106  ARGFIFGPAIALAIGAKFIPLRKPKKLPGEVISETYVLEYGTDCLEMHVGAIEPRERVLI  165

Query  472  VDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
            VDDL+ATGGTLCAA++LLERAGA+VVECAC+I +P  K   +LNGKP+YVLV+
Sbjct  166  VDDLVATGGTLCAAINLLERAGADVVECACLIGLPKFKDFYKLNGKPVYVLVE  218



>gb|EAY94764.1| hypothetical protein OsI_16544 [Oryza sativa Indica Group]
Length=212

 Score =   268 bits (685),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 127/179 (71%), Positives = 149/179 (83%), Gaps = 0/179 (0%)
 Frame = -2

Query  841  REDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVA  662
            R  DPR+  I   IRVVPHFPKPGIMF DIT LLL P  FKD +D+FVERY+G  I+ VA
Sbjct  34   RAADPRLQAISDAIRVVPHFPKPGIMFNDITALLLRPAVFKDAVDMFVERYRGMRIAAVA  93

Query  661  GIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDR  482
            GIEARGFIFGP+IALAIGAKF+PLRKPKKLPG+VI + Y LEYG+DCLEMHVGA E G+R
Sbjct  94   GIEARGFIFGPAIALAIGAKFIPLRKPKKLPGEVISETYILEYGTDCLEMHVGATEPGER  153

Query  481  ALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQEKK  305
             +VVDDL+ATGGTLCAA+ LLERAGA+VVECAC+I +P  K   +LNGKP+Y+LV+ +K
Sbjct  154  VVVVDDLVATGGTLCAAIKLLERAGADVVECACLIGLPKYKNFYKLNGKPVYILVESRK  212



>ref|XP_006664692.1| PREDICTED: uncharacterized protein LOC102699275 [Oryza brachyantha]
Length=399

 Score =   274 bits (701),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 135/194 (70%), Positives = 161/194 (83%), Gaps = 4/194 (2%)
 Frame = -2

Query  895  LLSFFLHFTRQCRTMSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKD  716
            L +FFL      R+   F   D R+  I S IRV+P FPKPGIMFQDITT+LL P+AF+D
Sbjct  208  LSAFFLPLM-HLRSTGGF---DARVARIASTIRVIPDFPKPGIMFQDITTMLLKPEAFRD  263

Query  715  TIDLFVERYKGKNISIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLE  536
            TIDLFVERYK K I+++AG+EARGFIFGP IALA+GAKFVPLRKPKKLPGKVI +EY LE
Sbjct  264  TIDLFVERYKDKGITVIAGVEARGFIFGPPIALALGAKFVPLRKPKKLPGKVISEEYSLE  323

Query  535  YGSDCLEMHVGAVEAGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKG  356
            YG+D +EMHVGA E  DRA+VVDDLIATGGTL AA+ LLERAGAEVVECACVIE+P+LKG
Sbjct  324  YGTDKIEMHVGAAEPNDRAVVVDDLIATGGTLSAAVKLLERAGAEVVECACVIELPELKG  383

Query  355  QERLNGKPLYVLVQ  314
            +++L  +P++VLV+
Sbjct  384  RDKLGNRPVFVLVK  397



>ref|XP_004501526.1| PREDICTED: adenine phosphoribosyltransferase 1, chloroplastic-like 
isoform X2 [Cicer arietinum]
Length=258

 Score =   269 bits (688),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 140/212 (66%), Positives = 163/212 (77%), Gaps = 6/212 (3%)
 Frame = -2

Query  988  HSLFHSIYSPYIFSP--FQPFSFLSAFHLLSITLLSFFLHFTRQCRTMSAFREDDPRIDG  815
            +SLF S  +P + S   F P S      + + T  S  L   R   T  A ++ DPRI  
Sbjct  16   NSLFGSAVTPTLPSSLRFPPLSL----TIPNSTSSSIRLRSLRSSVTEMASQDQDPRIAR  71

Query  814  IQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIEARGFIF  635
            I S IRV+P FPKPGIMFQDITTLLLD KAFKDTIDLFVERY+ +NIS+VAG+EARGFIF
Sbjct  72   ISSAIRVIPDFPKPGIMFQDITTLLLDTKAFKDTIDLFVERYRDQNISVVAGVEARGFIF  131

Query  634  GPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALVVDDLIA  455
            GP IALAIGAKFVP+RKPKKLPG+VI +EY LEYG+D +EMHVGAV+ G+RALV+DDLIA
Sbjct  132  GPPIALAIGAKFVPMRKPKKLPGEVISEEYSLEYGTDKIEMHVGAVQPGERALVIDDLIA  191

Query  454  TGGTLCAAMDLLERAGAEVVECACVIEIPDLK  359
            TGGTLCAA+ LLER    VVECACVIE+P+LK
Sbjct  192  TGGTLCAAIKLLERVEVTVVECACVIELPELK  223



>gb|EAY83709.1| hypothetical protein OsI_38931 [Oryza sativa Indica Group]
Length=186

 Score =   266 bits (681),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 127/173 (73%), Positives = 153/173 (88%), Gaps = 0/173 (0%)
 Frame = -2

Query  832  DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIE  653
            + R+  I S IRV+P FPKPGIMFQDITT+LL P AF+DTI+LFVERYK K I+++AG+E
Sbjct  12   EARVARIASTIRVIPDFPKPGIMFQDITTMLLKPDAFRDTIELFVERYKDKGITVIAGVE  71

Query  652  ARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALV  473
            ARGFIFGP IALA+GAKFVPLRKPKKLPG+VI +EY LEYG+D +EMHVGAVE  DRA+V
Sbjct  72   ARGFIFGPPIALALGAKFVPLRKPKKLPGEVISEEYSLEYGTDKIEMHVGAVEPNDRAVV  131

Query  472  VDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
            VDDLIATGGTL AA+ L+ERAGAEVVECACVIE+P+LKG+++L  KP++VLV+
Sbjct  132  VDDLIATGGTLSAAVKLIERAGAEVVECACVIELPELKGRDKLGNKPVFVLVK  184



>gb|KHN07067.1| Adenine phosphoribosyltransferase 2 [Glycine soja]
Length=198

 Score =   267 bits (682),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 127/176 (72%), Positives = 153/176 (87%), Gaps = 0/176 (0%)
 Frame = -2

Query  832  DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIE  653
            DPR+  I   IRVVPHFP  GIMFQDITTLLLD KAFKDT+D+FV+RY+  +IS+VAGIE
Sbjct  11   DPRLQAISQAIRVVPHFPIHGIMFQDITTLLLDHKAFKDTVDIFVDRYRDTHISVVAGIE  70

Query  652  ARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALV  473
            ARGF+FGPSIAL IGAKFVPLRKP+KLPG+VI ++Y LEYG+DCLE+HVGAV+ G+RA++
Sbjct  71   ARGFMFGPSIALGIGAKFVPLRKPRKLPGEVISEKYALEYGTDCLELHVGAVQPGERAII  130

Query  472  VDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQEKK  305
            +DDL+ATGGT+ A + LLER GAEVVECACVI +PD+KGQ R  GKPLYVLV+ +K
Sbjct  131  IDDLVATGGTMSAGVKLLERVGAEVVECACVIGVPDVKGQCRRIGKPLYVLVEPRK  186



>gb|AEC10980.1| adenine phosphoribosyltransferase [Camellia sinensis]
Length=189

 Score =   266 bits (680),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 125/177 (71%), Positives = 158/177 (89%), Gaps = 2/177 (1%)
 Frame = -2

Query  832  DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIE  653
            DPR+DGI   IRV+PHFPKPGIMFQDITTLLL+ KAFKDT+D+FV+RY+  +IS+VA  E
Sbjct  11   DPRLDGISEAIRVIPHFPKPGIMFQDITTLLLNHKAFKDTVDIFVDRYRYMDISVVA--E  68

Query  652  ARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALV  473
            ARGF+FGPSIALAIGAKFVPLRKP+KLPGKVI + Y LEYG+DCLEMHV AV+ G+RA++
Sbjct  69   ARGFMFGPSIALAIGAKFVPLRKPRKLPGKVISEAYVLEYGTDCLEMHVDAVQPGERAVI  128

Query  472  VDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQEKKL  302
            +DD++ATGGTL AA+ LLER  AEVVECACV+ +P++KGQ+RLNGKPL++L++ +++
Sbjct  129  IDDIVATGGTLSAAIRLLERVEAEVVECACVVGLPEVKGQQRLNGKPLFILLEPRQI  185



>dbj|BAJ91692.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=239

 Score =   267 bits (683),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 127/189 (67%), Positives = 158/189 (84%), Gaps = 0/189 (0%)
 Frame = -2

Query  880  LHFTRQCRTMSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLF  701
            +   R+  + +     D R++ I S IR +P+FPKPGI+FQDITTLLLDP+AF+DT DLF
Sbjct  46   VRLRRRRGSAAVAMASDGRVERIASSIRAIPNFPKPGILFQDITTLLLDPQAFRDTTDLF  105

Query  700  VERYKGKNISIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDC  521
            VERYK K+I++VAG+EARGFIFGP IALAIGAKFVP+RKPKKLPG+VI +EY LEYG+D 
Sbjct  106  VERYKDKSITVVAGVEARGFIFGPPIALAIGAKFVPIRKPKKLPGEVISEEYSLEYGTDK  165

Query  520  LEMHVGAVEAGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLN  341
            +EMHVGAV+  DR L+VDDLIATGGTLCAA  L+ER GA+VVECACVIE+P+LKG+++L 
Sbjct  166  IEMHVGAVQPNDRVLIVDDLIATGGTLCAAAKLIERVGAKVVECACVIELPELKGRDKLG  225

Query  340  GKPLYVLVQ  314
              P++VLVQ
Sbjct  226  DLPVFVLVQ  234



>dbj|BAJ97272.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=239

 Score =   267 bits (683),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 127/189 (67%), Positives = 158/189 (84%), Gaps = 0/189 (0%)
 Frame = -2

Query  880  LHFTRQCRTMSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLF  701
            +   R+  + +     D R++ I S IR +P+FPKPGI+FQDITTLLLDP+AF+DT DLF
Sbjct  46   VRLRRRRGSAAVAMASDGRVERIASSIRAIPNFPKPGILFQDITTLLLDPQAFRDTTDLF  105

Query  700  VERYKGKNISIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDC  521
            VERYK K+I++VAG+EARGFIFGP IALAIGAKFVP+RKPKKLPG+VI +EY LEYG+D 
Sbjct  106  VERYKDKSITVVAGVEARGFIFGPPIALAIGAKFVPIRKPKKLPGEVISEEYSLEYGTDK  165

Query  520  LEMHVGAVEAGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLN  341
            +EMHVGAV+  DR L+VDDLIATGGTLCAA  L+ER GA+VVECACVIE+P+LKG+++L 
Sbjct  166  IEMHVGAVQPNDRVLIVDDLIATGGTLCAAAKLIERVGAKVVECACVIELPELKGRDKLG  225

Query  340  GKPLYVLVQ  314
              P++VLVQ
Sbjct  226  DLPVFVLVQ  234



>gb|AFK34858.1| unknown [Lotus japonicus]
Length=191

 Score =   265 bits (678),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 128/177 (72%), Positives = 153/177 (86%), Gaps = 0/177 (0%)
 Frame = -2

Query  832  DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIE  653
            DPR+  I   I VVPHFPK GIMFQDITTLLLD KAFKDTID+FV+RY+  +IS+VAGIE
Sbjct  11   DPRLQAITKAITVVPHFPKKGIMFQDITTLLLDHKAFKDTIDIFVDRYRDMHISVVAGIE  70

Query  652  ARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALV  473
            ARGF+FGPSIAL IGAKFVPLRKP+KLPG+V  ++Y LEYG+DCLE+HV AV+ G+RA+V
Sbjct  71   ARGFLFGPSIALGIGAKFVPLRKPRKLPGEVFSEKYSLEYGTDCLELHVDAVQPGERAIV  130

Query  472  VDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQEKKL  302
            +DDL+ATGGTL A + LLERA AEVVECACVI +PD+KGQ RL GKPLYVLV+ +++
Sbjct  131  IDDLVATGGTLSAGVKLLERAHAEVVECACVIGVPDVKGQCRLIGKPLYVLVEPRQV  187



>gb|KHN04446.1| Adenine phosphoribosyltransferase 1, chloroplastic [Glycine soja]
Length=236

 Score =   267 bits (682),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 128/179 (72%), Positives = 152/179 (85%), Gaps = 0/179 (0%)
 Frame = -2

Query  850  SAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNIS  671
            S   + D R+  I S IRV+P FPKPGI+FQDITTLLLD KAFKDTIDLFVERY+ +NI+
Sbjct  55   SKNSQQDTRLARIASAIRVIPDFPKPGILFQDITTLLLDTKAFKDTIDLFVERYRDQNIN  114

Query  670  IVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEA  491
            +VAG+EARGFIFGP IALAIGAKFVP+RKP KLPG+VI +EY LEYG+D +EMHVGAV+ 
Sbjct  115  VVAGVEARGFIFGPPIALAIGAKFVPMRKPNKLPGEVISEEYSLEYGTDKMEMHVGAVQP  174

Query  490  GDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
            G+RAL++DDLIATGGTL AA+ LLER G  VVECACVIE+P+LKG+ERL  K L+VL+ 
Sbjct  175  GERALIIDDLIATGGTLGAAIKLLERVGVHVVECACVIELPELKGRERLGDKSLFVLIN  233



>ref|NP_001242331.1| uncharacterized protein LOC100810609 [Glycine max]
 gb|ACU21556.1| unknown [Glycine max]
Length=193

 Score =   265 bits (677),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 126/176 (72%), Positives = 152/176 (86%), Gaps = 0/176 (0%)
 Frame = -2

Query  832  DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIE  653
            DPR+  I   IRVVPHFP  GIMFQDITTLLLD KAFKDT+D+FV+RY+  +IS+VAGIE
Sbjct  11   DPRLQAISQAIRVVPHFPIHGIMFQDITTLLLDHKAFKDTVDIFVDRYRDTHISVVAGIE  70

Query  652  ARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALV  473
            ARGF+FGPSIAL IGAKFVPLRKP+KLPG+VI ++Y LEYG+DCLE+HVGAV+ G+R ++
Sbjct  71   ARGFMFGPSIALGIGAKFVPLRKPRKLPGEVISEKYALEYGTDCLELHVGAVQPGERTII  130

Query  472  VDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQEKK  305
            +DDL+ATGGT+ A + LLER GAEVVECACVI +PD+KGQ R  GKPLYVLV+ +K
Sbjct  131  IDDLVATGGTMSAGVKLLERVGAEVVECACVIGVPDVKGQCRRIGKPLYVLVEPRK  186



>ref|XP_003578157.1| PREDICTED: adenine phosphoribosyltransferase 1 [Brachypodium 
distachyon]
Length=224

 Score =   266 bits (680),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 128/173 (74%), Positives = 152/173 (88%), Gaps = 0/173 (0%)
 Frame = -2

Query  832  DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIE  653
            D R++ I S IRV+P FPKPGI+FQDITTLLLDP+AF DT DLFVERYK K I++VAG+E
Sbjct  50   DGRVERIASTIRVIPDFPKPGILFQDITTLLLDPQAFHDTTDLFVERYKDKGITVVAGVE  109

Query  652  ARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALV  473
            ARGFIFGP IALAIGAKFVP+RKPKKLPG+VI +EY LEYG+D +EMHVGAV   DRAL+
Sbjct  110  ARGFIFGPPIALAIGAKFVPIRKPKKLPGEVISEEYSLEYGTDKIEMHVGAVLPSDRALI  169

Query  472  VDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
            VDDLIATGGTLCAA  L+ER GAEVVECACVIE+P+LKG+++L  +P++VLV+
Sbjct  170  VDDLIATGGTLCAAAKLIERVGAEVVECACVIELPELKGRDKLGDRPVFVLVK  222



>ref|XP_010048954.1| PREDICTED: adenine phosphoribosyltransferase 5-like [Eucalyptus 
grandis]
 gb|KCW81377.1| hypothetical protein EUGRSUZ_C02760 [Eucalyptus grandis]
Length=191

 Score =   265 bits (676),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 153/175 (87%), Gaps = 0/175 (0%)
 Frame = -2

Query  832  DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIE  653
            DPR+  I   IRVVP FPKPGIMFQDITTLLLD KAFKDT+D+FV+RY+  ++S+VAG+E
Sbjct  11   DPRLQAISRAIRVVPDFPKPGIMFQDITTLLLDHKAFKDTVDIFVDRYRDMDVSVVAGVE  70

Query  652  ARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALV  473
            ARGF+FGP+IALAIGAKFVPLRKP+KLPG+VI + Y LEYG+DCLEMHVGAVE G+RA+V
Sbjct  71   ARGFMFGPAIALAIGAKFVPLRKPRKLPGEVIAESYVLEYGTDCLEMHVGAVEPGERAIV  130

Query  472  VDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQEK  308
            +DDL+ATGGTL AA+ LLER GAEVVECACVI +P++K   R+ GKPLY+LV+ +
Sbjct  131  IDDLVATGGTLSAAIKLLERVGAEVVECACVIGLPEVKDCCRIKGKPLYILVEPR  185



>ref|XP_002285191.1| PREDICTED: adenine phosphoribosyltransferase 5 [Vitis vinifera]
 emb|CBI21058.3| unnamed protein product [Vitis vinifera]
Length=191

 Score =   265 bits (676),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 123/172 (72%), Positives = 152/172 (88%), Gaps = 0/172 (0%)
 Frame = -2

Query  832  DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIE  653
            DPR+  I   +R+VPHFPKPGIMFQDITTLLLD KAFK T+++FV+RY+  +IS+VAG+E
Sbjct  11   DPRLQAISEALRIVPHFPKPGIMFQDITTLLLDHKAFKGTVEIFVDRYRDMDISVVAGVE  70

Query  652  ARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALV  473
            ARGF+FGPS+ALAIGAKFVPLRKPKKLPG+VI ++Y+LEYG+D LEMHVGAV  G+RALV
Sbjct  71   ARGFLFGPSVALAIGAKFVPLRKPKKLPGEVISEDYELEYGTDRLEMHVGAVHPGERALV  130

Query  472  VDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLV  317
            +DD +ATGGTL AA+ LL+R GAEVVECACV+ +P+++GQ RLNG PLY+LV
Sbjct  131  IDDFVATGGTLSAAIRLLKRVGAEVVECACVVGLPEVEGQSRLNGTPLYILV  182



>ref|NP_178122.1| adenine phosphoribosyl transferase 2 [Arabidopsis thaliana]
 sp|Q42563.1|APT2_ARATH RecName: Full=Adenine phosphoribosyltransferase 2; Short=APRT 
2; Short=AtAPT2 [Arabidopsis thaliana]
 gb|AAD55485.1|AC009322_25 adenine phosphoribosyltransferase [Arabidopsis thaliana]
 emb|CAA65609.1| adenine phosphoribosyltransferase [Arabidopsis thaliana]
 gb|AAL57714.1| At1g80050/F18B13_14 [Arabidopsis thaliana]
 gb|AAN64513.1| At1g80050/F18B13_14 [Arabidopsis thaliana]
 gb|AEE36351.1| adenine phosphoribosyl transferase 2 [Arabidopsis thaliana]
Length=192

 Score =   265 bits (676),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 126/178 (71%), Positives = 151/178 (85%), Gaps = 0/178 (0%)
 Frame = -2

Query  838  EDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAG  659
            + DPR+  I   IRV+PHFPK GIMFQDITTLLLDP AFK  +D+FV+RYK  NIS+VAG
Sbjct  9    QGDPRLKAISDAIRVIPHFPKTGIMFQDITTLLLDPVAFKHVVDIFVDRYKHMNISLVAG  68

Query  658  IEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRA  479
            +EARGFIFGP IALAIGAKFVPLRKP KLPG+VI +EY+LEYG DCLEM V AV++ +RA
Sbjct  69   VEARGFIFGPPIALAIGAKFVPLRKPGKLPGRVISEEYELEYGRDCLEMSVEAVKSEERA  128

Query  478  LVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQEKK  305
            L++DDL+ATGGTL A+++LLERAGAEVVECACV+ +P  KGQ +L GKPLYVLV+  +
Sbjct  129  LIIDDLVATGGTLSASINLLERAGAEVVECACVVGLPKFKGQCKLKGKPLYVLVEPNQ  186



>ref|NP_196677.1| adenine phosphoribosyltransferase 5 [Arabidopsis thaliana]
 ref|XP_002871460.1| hypothetical protein ARALYDRAFT_487948 [Arabidopsis lyrata subsp. 
lyrata]
 sp|Q9LFP0.1|APT5_ARATH RecName: Full=Adenine phosphoribosyltransferase 5; Short=AtAPT5 
[Arabidopsis thaliana]
 emb|CAB96651.1| adenine phosphoribosyltransferase-like protein [Arabidopsis thaliana]
 gb|AAO42064.1| putative adenine phosphoribosyltransferase [Arabidopsis thaliana]
 gb|AAO50610.1| putative adenine phosphoribosyltransferase [Arabidopsis thaliana]
 gb|EFH47719.1| hypothetical protein ARALYDRAFT_487948 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AED91640.1| adenine phosphoribosyltransferase 5 [Arabidopsis thaliana]
Length=191

 Score =   264 bits (675),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 128/177 (72%), Positives = 150/177 (85%), Gaps = 0/177 (0%)
 Frame = -2

Query  832  DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIE  653
            DPR++ I + IRVVP+FPK GIMFQDITTLLLD KAFK TID+FV+RYK   IS+VAG+E
Sbjct  11   DPRLEAISAAIRVVPNFPKKGIMFQDITTLLLDHKAFKHTIDIFVDRYKDMQISVVAGVE  70

Query  652  ARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALV  473
            ARGF+FGPSIALAIGAKF+PLRKP KLPGKVI + Y+LEYG D LEMHVGAVE  +R ++
Sbjct  71   ARGFLFGPSIALAIGAKFIPLRKPGKLPGKVISESYELEYGHDRLEMHVGAVEPRERVII  130

Query  472  VDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQEKKL  302
            +DDL+ATGGTL AAM LLE  GAEVVECACVI +P++KGQ +L GKPLYVLV+   L
Sbjct  131  IDDLVATGGTLSAAMSLLESQGAEVVECACVIGLPEVKGQHKLKGKPLYVLVEPSGL  187



>ref|XP_010240093.1| PREDICTED: adenine phosphoribosyltransferase 2-like [Brachypodium 
distachyon]
Length=203

 Score =   265 bits (676),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 148/179 (83%), Gaps = 0/179 (0%)
 Frame = -2

Query  841  REDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVA  662
            R  DPR+ GI   IRVVPHFPKPGIMF DIT LLL P  FKD +D+FVERY+G  I+ VA
Sbjct  25   RAADPRLQGISDAIRVVPHFPKPGIMFNDITALLLRPGVFKDAVDMFVERYRGMGIAAVA  84

Query  661  GIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDR  482
            GIEARGF+FGP+IALAIGAKF+PLRKP KLPG+VI + Y LEYG+DCLEMHVGA E G+R
Sbjct  85   GIEARGFVFGPAIALAIGAKFIPLRKPGKLPGEVISETYVLEYGTDCLEMHVGATEQGER  144

Query  481  ALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQEKK  305
             +VVDDL+ATGGTL AA+ LLERAGA+VVECAC+I +P  K   +LNGKP+Y+LV+ +K
Sbjct  145  VVVVDDLVATGGTLSAAIRLLERAGADVVECACLIGLPKFKDFYKLNGKPVYILVESRK  203



>ref|XP_006652485.1| PREDICTED: adenine phosphoribosyltransferase 2-like [Oryza brachyantha]
Length=212

 Score =   265 bits (677),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 126/179 (70%), Positives = 148/179 (83%), Gaps = 0/179 (0%)
 Frame = -2

Query  841  REDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVA  662
            R  DPR+ GI   IRVVPHFPKPGIMF DIT LLL P  FKD +D+FVERY+G  I+ VA
Sbjct  34   RAADPRLQGISDAIRVVPHFPKPGIMFNDITALLLRPAVFKDAVDMFVERYRGMGIAAVA  93

Query  661  GIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDR  482
            GIEARGFIFGP+IALAIGAKF+PLRKPKKLPG+VI + Y LEYG+DCLEMHVGA E G+R
Sbjct  94   GIEARGFIFGPAIALAIGAKFIPLRKPKKLPGEVISETYVLEYGTDCLEMHVGATEPGER  153

Query  481  ALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQEKK  305
             +VVDDL+ATGGTL AA+ LLERAGA+VVECAC+I +P  K   +LNG P+Y+LV+ +K
Sbjct  154  VVVVDDLVATGGTLSAAIKLLERAGADVVECACLIGLPKYKNFYKLNGIPVYILVESRK  212



>gb|EAZ21049.1| hypothetical protein OsJ_36694 [Oryza sativa Japonica Group]
Length=186

 Score =   264 bits (674),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 126/173 (73%), Positives = 152/173 (88%), Gaps = 0/173 (0%)
 Frame = -2

Query  832  DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIE  653
            + R+  I S IRV+P FPKPGIMFQDITT+LL P AF+DTI+LFVERYK K I+++AG+E
Sbjct  12   EARVARIASTIRVIPDFPKPGIMFQDITTMLLKPDAFRDTIELFVERYKDKGITVIAGVE  71

Query  652  ARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALV  473
            ARGFIFGP IALA+GAKFVPLRKPKKLPG+VI +EY LEYG+D +EMHVGAVE   RA+V
Sbjct  72   ARGFIFGPPIALALGAKFVPLRKPKKLPGEVISEEYSLEYGTDKIEMHVGAVEPNGRAVV  131

Query  472  VDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
            VDDLIATGGTL AA+ L+ERAGAEVVECACVIE+P+LKG+++L  KP++VLV+
Sbjct  132  VDDLIATGGTLSAAVKLIERAGAEVVECACVIELPELKGRDKLGNKPVFVLVK  184



>ref|NP_001236749.1| uncharacterized protein LOC100305792 [Glycine max]
 gb|ACU13653.1| unknown [Glycine max]
Length=236

 Score =   266 bits (679),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 127/179 (71%), Positives = 152/179 (85%), Gaps = 0/179 (0%)
 Frame = -2

Query  850  SAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNIS  671
            S   + D R+  I S IRV+P FPKPGI+FQDITTLLLD KAFKDTIDLFVERY+ +NI+
Sbjct  55   SKNSQQDTRLARIASAIRVIPDFPKPGILFQDITTLLLDTKAFKDTIDLFVERYRDQNIN  114

Query  670  IVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEA  491
            +VAG+EARGFIFGP IALAIGAKFVP+RKP KLPG+VI +EY LEYG++ +EMHVGAV+ 
Sbjct  115  VVAGVEARGFIFGPPIALAIGAKFVPMRKPNKLPGEVISEEYSLEYGTNKMEMHVGAVQP  174

Query  490  GDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
            G+RAL++DDLIATGGTL AA+ LLER G  VVECACVIE+P+LKG+ERL  K L+VL+ 
Sbjct  175  GERALIIDDLIATGGTLGAAIKLLERVGVHVVECACVIELPELKGRERLGDKSLFVLIN  233



>ref|XP_010541605.1| PREDICTED: adenine phosphoribosyltransferase 5 isoform X1 [Tarenaya 
hassleriana]
Length=192

 Score =   264 bits (674),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 127/177 (72%), Positives = 150/177 (85%), Gaps = 0/177 (0%)
 Frame = -2

Query  832  DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIE  653
            DPR++ I + IRVVP+FPK GIMFQDITTLLLD KAFK TID+FV+RYK  ++S+VAG+E
Sbjct  11   DPRLEAISAAIRVVPNFPKKGIMFQDITTLLLDYKAFKHTIDIFVDRYKDMHVSVVAGVE  70

Query  652  ARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALV  473
            ARGF+FGPSIALA+GAKFVPLRKP KLPG VI + YDLEYG DCLEMHV AV+AG+R +V
Sbjct  71   ARGFMFGPSIALALGAKFVPLRKPGKLPGNVISKSYDLEYGHDCLEMHVDAVKAGERVIV  130

Query  472  VDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQEKKL  302
            +DDL+ATGGTL AA+ LLE   AEVVECACVI +P++KGQ  L GKPLYVLV+   L
Sbjct  131  IDDLVATGGTLSAAISLLESVEAEVVECACVIGLPEVKGQHMLKGKPLYVLVEPSGL  187



>emb|CAA65610.1| adenine phosphoribosyltransferase [Arabidopsis thaliana]
Length=192

 Score =   264 bits (674),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 125/178 (70%), Positives = 151/178 (85%), Gaps = 0/178 (0%)
 Frame = -2

Query  838  EDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAG  659
            + DPR+  I   IRV+PHFPK GIMFQDITT+LLDP AFK  +D+FV+RYK  NIS+VAG
Sbjct  9    QGDPRLKAISDAIRVIPHFPKTGIMFQDITTMLLDPVAFKHVVDIFVDRYKHMNISLVAG  68

Query  658  IEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRA  479
            +EARGFIFGP IALAIGAKFVPLRKP KLPG+VI +EY+LEYG DCLEM V AV++ +RA
Sbjct  69   VEARGFIFGPPIALAIGAKFVPLRKPGKLPGRVISEEYELEYGRDCLEMSVEAVKSEERA  128

Query  478  LVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQEKK  305
            L++DDL+ATGGTL A+++LLERAGAEVVECACV+ +P  KGQ +L GKPLYVLV+  +
Sbjct  129  LIIDDLVATGGTLSASINLLERAGAEVVECACVVGLPKFKGQCKLKGKPLYVLVEPNQ  186



>ref|XP_006450396.1| hypothetical protein CICLE_v10009485mg [Citrus clementina]
 ref|XP_006450398.1| hypothetical protein CICLE_v10009485mg [Citrus clementina]
 ref|XP_006483386.1| PREDICTED: adenine phosphoribosyltransferase 2-like isoform X2 
[Citrus sinensis]
 gb|ESR63636.1| hypothetical protein CICLE_v10009485mg [Citrus clementina]
 gb|ESR63638.1| hypothetical protein CICLE_v10009485mg [Citrus clementina]
 gb|KDO61776.1| hypothetical protein CISIN_1g028297mg [Citrus sinensis]
Length=188

 Score =   263 bits (673),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 129/175 (74%), Positives = 151/175 (86%), Gaps = 2/175 (1%)
 Frame = -2

Query  832  DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIE  653
            DPR+ GI   IRVVP FP PGIMFQDITTLLLD KAFKDT+D+FV+RY+   IS+VAGIE
Sbjct  11   DPRLQGISKAIRVVPDFPIPGIMFQDITTLLLDHKAFKDTVDIFVDRYRDMGISVVAGIE  70

Query  652  ARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALV  473
            ARGF+FGPSIALAIGAKFVPLRKP KLPG+VI + Y LEYG+D LEMHVGA+E G+RALV
Sbjct  71   ARGFVFGPSIALAIGAKFVPLRKPNKLPGEVISEAYVLEYGTDRLEMHVGAIEPGERALV  130

Query  472  VDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQEK  308
            +DDL+ATGGTL AA+ LLER GAEVVECACV+ +P+  GQ RL+GKPLY+LV+ +
Sbjct  131  IDDLVATGGTLSAAVRLLERMGAEVVECACVVGLPE--GQRRLDGKPLYILVEPR  183



>emb|CDP13534.1| unnamed protein product [Coffea canephora]
Length=192

 Score =   263 bits (672),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/178 (71%), Positives = 151/178 (85%), Gaps = 1/178 (1%)
 Frame = -2

Query  832  DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIE  653
            DPR+  I   IRV+PHFPKPGIMFQDITTLLL+ K FKDT+D+FV+RYK  +IS+VAGIE
Sbjct  11   DPRLQAISDAIRVIPHFPKPGIMFQDITTLLLNHKVFKDTVDIFVDRYKDMDISVVAGIE  70

Query  652  ARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALV  473
            ARGF+FGPSIALAIGAKFVPLRKP KLPG VI + Y+LEYG DCLEMH+ AV+ G+RA+V
Sbjct  71   ARGFMFGPSIALAIGAKFVPLRKPGKLPGDVISEAYELEYGKDCLEMHIDAVQRGERAVV  130

Query  472  VDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKG-QERLNGKPLYVLVQEKKL  302
            +DDL+ATGGTL AA+ LLE   AEVVECACVI +P+ KG Q RLNGKPLY+LV+ ++ 
Sbjct  131  IDDLVATGGTLSAAIKLLESMEAEVVECACVIGLPEAKGRQSRLNGKPLYILVEPREF  188



>ref|XP_010241566.1| PREDICTED: adenine phosphoribosyltransferase 5-like isoform X2 
[Nelumbo nucifera]
Length=179

 Score =   263 bits (671),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 128/177 (72%), Positives = 151/177 (85%), Gaps = 10/177 (6%)
 Frame = -2

Query  832  DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIE  653
            DPR+  I   IRVVPHFPKPGIMFQDITTLLLD KAFKDT+D+FV+RY+  +IS+VAG+E
Sbjct  11   DPRLQAISEAIRVVPHFPKPGIMFQDITTLLLDHKAFKDTVDIFVDRYRDMDISVVAGVE  70

Query  652  ARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALV  473
            ARGF+FGPSIALAIGAKFVPLRKP+KLP          EYG+DCLEMHVGAV+ G+RALV
Sbjct  71   ARGFMFGPSIALAIGAKFVPLRKPRKLP----------EYGTDCLEMHVGAVQPGERALV  120

Query  472  VDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQEKKL  302
            +DDL+ATGGTL AA+ LLER GAEVVECACVI +P+ KG+ RLNGKPLY+LV+ ++L
Sbjct  121  IDDLVATGGTLSAAIRLLERVGAEVVECACVIGLPENKGERRLNGKPLYILVEPREL  177



>emb|CAN64503.1| hypothetical protein VITISV_016996 [Vitis vinifera]
Length=264

 Score =   266 bits (679),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 136/178 (76%), Positives = 146/178 (82%), Gaps = 26/178 (15%)
 Frame = -2

Query  769  IMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAG-----------------------  659
            IMFQDITTLLLDPKAFKDTIDLFVERYKGKNIS+VAG                       
Sbjct  85   IMFQDITTLLLDPKAFKDTIDLFVERYKGKNISVVAGKVWKVGPVEVLVLKLGTITCDMV  144

Query  658  ---IEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAG  488
               IEARGFIFGP IALAIGAKFVPLRKP+KLPG+VI +EY LEYG DCLEMHVGAVE G
Sbjct  145  WRGIEARGFIFGPPIALAIGAKFVPLRKPRKLPGEVISEEYILEYGRDCLEMHVGAVEPG  204

Query  487  DRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
            DRALVVDDLIATGGTLCAAM+LLER GAEVVECACVIE+PDLKG++RLNGKPLY+LV+
Sbjct  205  DRALVVDDLIATGGTLCAAMNLLERVGAEVVECACVIELPDLKGRDRLNGKPLYILVE  262



>ref|XP_006826704.1| hypothetical protein AMTR_s00137p00101330 [Amborella trichopoda]
 gb|ERM93941.1| hypothetical protein AMTR_s00137p00101330 [Amborella trichopoda]
Length=182

 Score =   263 bits (671),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 127/165 (77%), Positives = 144/165 (87%), Gaps = 0/165 (0%)
 Frame = -2

Query  853  MSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI  674
            MSA    D R+  I S IRV+P+FPKPGIMFQDITTLLLD KAF+DTID+ VERYK KNI
Sbjct  1    MSASEHADDRLQRISSSIRVIPNFPKPGIMFQDITTLLLDHKAFRDTIDILVERYKDKNI  60

Query  673  SIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVE  494
            ++VAG+EARGFIFGP IAL IGAKFVPLRKPKKLPG+VI +EY LEYG+D +EMHVGAV+
Sbjct  61   TVVAGVEARGFIFGPPIALGIGAKFVPLRKPKKLPGEVISEEYSLEYGTDRMEMHVGAVQ  120

Query  493  AGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLK  359
             GDRALVVDDLIATGGTLCAA+ LLER GAEV ECAC+IE+P+LK
Sbjct  121  PGDRALVVDDLIATGGTLCAALKLLERVGAEVFECACIIELPELK  165



>ref|XP_004976147.1| PREDICTED: adenine phosphoribosyltransferase 2-like [Setaria 
italica]
Length=211

 Score =   264 bits (674),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/176 (71%), Positives = 148/176 (84%), Gaps = 0/176 (0%)
 Frame = -2

Query  832  DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIE  653
            DPR+ GI   IRVVPHFPKPGIMF DIT LLL P  FKD +D+FVERY+G +I+ VAGIE
Sbjct  36   DPRLQGISDAIRVVPHFPKPGIMFNDITPLLLRPAVFKDAVDMFVERYRGMDIAAVAGIE  95

Query  652  ARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALV  473
            ARGFIFGP+IALAIGAKF+PLRKPKKLPG    + Y LEYG+DCLEMHVGA+E G+RA+V
Sbjct  96   ARGFIFGPAIALAIGAKFIPLRKPKKLPGDAFSESYVLEYGTDCLEMHVGAIEPGERAVV  155

Query  472  VDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQEKK  305
            VDDL+ATGGTL AA+ LLERAGA+VVECAC+I +P  K   +LNGKP+Y+LV+ +K
Sbjct  156  VDDLVATGGTLSAAIRLLERAGADVVECACLIGLPKFKDFYKLNGKPVYILVESRK  211



>ref|XP_004953097.1| PREDICTED: adenine phosphoribosyltransferase 2-like [Setaria 
italica]
Length=229

 Score =   264 bits (675),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/176 (71%), Positives = 148/176 (84%), Gaps = 0/176 (0%)
 Frame = -2

Query  832  DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIE  653
            DPR+ GI   IRVVPHFPK GIMF DITTLLL P  FKD +DLFVERY+G  I  VAGIE
Sbjct  51   DPRLQGISDAIRVVPHFPKEGIMFNDITTLLLRPGVFKDAVDLFVERYRGMGIDAVAGIE  110

Query  652  ARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALV  473
            ARGFIFGP+IALAIGAKF+PLRKP+KLPG+VI ++Y LEYG+DCLEMHVGA+E  +  ++
Sbjct  111  ARGFIFGPAIALAIGAKFIPLRKPRKLPGEVISEKYVLEYGTDCLEMHVGAIEPAEHVII  170

Query  472  VDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQEKK  305
            VDDL+ATGGTLCAA+ LLERAGAEVVECAC+I +P  K   +LNGKP+YVLV+ ++
Sbjct  171  VDDLVATGGTLCAAIRLLERAGAEVVECACLIGLPKFKNFYKLNGKPVYVLVESRE  226



>ref|XP_004172405.1| PREDICTED: adenine phosphoribosyltransferase 1-like, partial 
[Cucumis sativus]
Length=154

 Score =   261 bits (668),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/152 (85%), Positives = 144/152 (95%), Gaps = 0/152 (0%)
 Frame = -2

Query  769  IMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIEARGFIFGPSIALAIGAKFVPL  590
            IMFQDITTLLLDPKAFKDTIDLFVERYKGKNIS+VAGIEARGFIFGP IALAIGAKF+PL
Sbjct  1    IMFQDITTLLLDPKAFKDTIDLFVERYKGKNISVVAGIEARGFIFGPPIALAIGAKFIPL  60

Query  589  RKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALVVDDLIATGGTLCAAMDLLERA  410
            RKP+KLPG+VI ++Y LEYGSDCLEMHVGAV+  +RALVVDDLIATGGTL AAM+LLERA
Sbjct  61   RKPRKLPGEVISEKYILEYGSDCLEMHVGAVKPHERALVVDDLIATGGTLRAAMNLLERA  120

Query  409  GAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
            GAEV+ECACVIE+P LKG+E+LN KPL+VLV+
Sbjct  121  GAEVIECACVIELPVLKGREQLNDKPLFVLVE  152



>ref|XP_010539727.1| PREDICTED: adenine phosphoribosyltransferase 3 isoform X2 [Tarenaya 
hassleriana]
Length=173

 Score =   262 bits (669),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/157 (82%), Positives = 145/157 (92%), Gaps = 0/157 (0%)
 Frame = -2

Query  778  KPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIEARGFIFGPSIALAIGAKF  599
            + GIMFQDITTLLLDPKAFKDTIDLFVERY+ +NIS+VAGIEARGFIFGP IALAIGAKF
Sbjct  17   RGGIMFQDITTLLLDPKAFKDTIDLFVERYRDRNISVVAGIEARGFIFGPPIALAIGAKF  76

Query  598  VPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALVVDDLIATGGTLCAAMDLL  419
            VPLRKPKKLPG+ I +EY+LEYG D LEMHVGAVE+GD ALVVDDLIATGGTLCAAM+LL
Sbjct  77   VPLRKPKKLPGETIFEEYELEYGRDRLEMHVGAVESGDTALVVDDLIATGGTLCAAMNLL  136

Query  418  ERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQEK  308
            ER GA+VVECACVIE+P+LKG++RL GKPL VLV+ +
Sbjct  137  ERVGAQVVECACVIELPELKGRQRLKGKPLCVLVEYR  173



>ref|XP_010430019.1| PREDICTED: adenine phosphoribosyltransferase 2 [Camelina sativa]
Length=194

 Score =   263 bits (671),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/178 (71%), Positives = 152/178 (85%), Gaps = 0/178 (0%)
 Frame = -2

Query  838  EDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAG  659
            + DPR+  I   IRV+PHFPK GIMFQDITTLLLDP AFK  +D+FV+RYK  NIS+VAG
Sbjct  9    QGDPRLKAISDAIRVIPHFPKTGIMFQDITTLLLDPVAFKHVVDIFVDRYKHMNISLVAG  68

Query  658  IEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRA  479
            +EARGFIFGP IALAIGAKFVPLRKP KLPG+VI +EY+LEYGSD LEM V AV++ +RA
Sbjct  69   VEARGFIFGPPIALAIGAKFVPLRKPGKLPGRVISEEYELEYGSDRLEMSVEAVKSDERA  128

Query  478  LVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQEKK  305
            L++DDL+ATGGTL A+++LLERAGAEVVECACV+ +P  KGQ +L GKPLYVLV+ ++
Sbjct  129  LIIDDLVATGGTLSASINLLERAGAEVVECACVVGLPKFKGQCKLKGKPLYVLVEPRE  186



>ref|XP_004501527.1| PREDICTED: adenine phosphoribosyltransferase 1, chloroplastic-like 
isoform X3 [Cicer arietinum]
Length=256

 Score =   265 bits (677),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 139/212 (66%), Positives = 162/212 (76%), Gaps = 8/212 (4%)
 Frame = -2

Query  988  HSLFHSIYSPYIFSP--FQPFSFLSAFHLLSITLLSFFLHFTRQCRTMSAFREDDPRIDG  815
            +SLF S  +P + S   F P S      + + T  S  L   R     S  ++ DPRI  
Sbjct  16   NSLFGSAVTPTLPSSLRFPPLSL----TIPNSTSSSIRLRSLRSSEMAS--QDQDPRIAR  69

Query  814  IQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIEARGFIF  635
            I S IRV+P FPKPGIMFQDITTLLLD KAFKDTIDLFVERY+ +NIS+VAG+EARGFIF
Sbjct  70   ISSAIRVIPDFPKPGIMFQDITTLLLDTKAFKDTIDLFVERYRDQNISVVAGVEARGFIF  129

Query  634  GPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALVVDDLIA  455
            GP IALAIGAKFVP+RKPKKLPG+VI +EY LEYG+D +EMHVGAV+ G+RALV+DDLIA
Sbjct  130  GPPIALAIGAKFVPMRKPKKLPGEVISEEYSLEYGTDKIEMHVGAVQPGERALVIDDLIA  189

Query  454  TGGTLCAAMDLLERAGAEVVECACVIEIPDLK  359
            TGGTLCAA+ LLER    VVECACVIE+P+LK
Sbjct  190  TGGTLCAAIKLLERVEVTVVECACVIELPELK  221



>ref|XP_008676904.1| PREDICTED: uncharacterized protein LOC100275070 isoform X3 [Zea 
mays]
 gb|AFW62960.1| hypothetical protein ZEAMMB73_860237 [Zea mays]
Length=215

 Score =   263 bits (673),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 126/177 (71%), Positives = 151/177 (85%), Gaps = 1/177 (1%)
 Frame = -2

Query  832  DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIE  653
            DPR+ GI   IRVVPHFPK GIMF DITTLLL P+ FKD +DLFVERY+G  I  VAGIE
Sbjct  39   DPRLQGISDAIRVVPHFPKQGIMFNDITTLLLRPRVFKDAVDLFVERYRGMGIDAVAGIE  98

Query  652  ARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVE-AGDRAL  476
            ARGF+FGP+IALAIGAKF+PLRKP+KLPG+VI ++Y LEYG+DCLEM VGA+E +G+R L
Sbjct  99   ARGFVFGPAIALAIGAKFIPLRKPRKLPGEVISEKYVLEYGTDCLEMRVGAIERSGERVL  158

Query  475  VVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQEKK  305
            V+DDL+ATGGTLCAA+ LLERAGA+VVECACVI +P  K   +LNGKP+YVLV+ ++
Sbjct  159  VIDDLVATGGTLCAAIRLLERAGADVVECACVIGLPKFKDLYKLNGKPVYVLVESRE  215



>ref|NP_001047421.1| Os02g0613900 [Oryza sativa Japonica Group]
 dbj|BAD19718.1| putative adenine phosphoribosyltransferase form 2 [Oryza sativa 
Japonica Group]
 dbj|BAF09335.1| Os02g0613900 [Oryza sativa Japonica Group]
 dbj|BAG92139.1| unnamed protein product [Oryza sativa Japonica Group]
Length=213

 Score =   263 bits (672),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 125/176 (71%), Positives = 149/176 (85%), Gaps = 0/176 (0%)
 Frame = -2

Query  832  DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIE  653
            DPR+ GI   IRVVPHFPK GIMF DIT LLL P  FKD +D+FVERY+G  I+ VAGIE
Sbjct  35   DPRLQGISDAIRVVPHFPKQGIMFNDITPLLLRPGVFKDAVDIFVERYRGMAIAAVAGIE  94

Query  652  ARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALV  473
            ARGFIFGP+IALAIGAKF+PLRKPKKLPG+VI + Y LEYG+DCL+MHVGA+E G+R L+
Sbjct  95   ARGFIFGPAIALAIGAKFIPLRKPKKLPGEVISETYVLEYGTDCLQMHVGAIEPGERVLI  154

Query  472  VDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQEKK  305
            VDDL+ATGGTLCAA+ LLERAGA+VVECAC+I +P  K   +LNGKP+YVLV+ ++
Sbjct  155  VDDLVATGGTLCAAIRLLERAGADVVECACLIGLPKFKDFYKLNGKPVYVLVESRE  210



>ref|XP_002446754.1| hypothetical protein SORBIDRAFT_06g021810 [Sorghum bicolor]
 gb|EES11082.1| hypothetical protein SORBIDRAFT_06g021810 [Sorghum bicolor]
Length=211

 Score =   263 bits (672),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 125/176 (71%), Positives = 146/176 (83%), Gaps = 0/176 (0%)
 Frame = -2

Query  832  DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIE  653
            DPR+ GI   IRVVPHFPKPGIMF DIT LLL P  FKD +D+FVERY+G  I+ VAGIE
Sbjct  36   DPRLQGISDAIRVVPHFPKPGIMFNDITELLLRPGVFKDAVDMFVERYRGMGIAAVAGIE  95

Query  652  ARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALV  473
            ARGFIFGP+IALAIGAKF+PLRKPKKLPG+V  + Y LEYG DCLEMHVGA+E G+R +V
Sbjct  96   ARGFIFGPAIALAIGAKFIPLRKPKKLPGEVFSESYVLEYGMDCLEMHVGAIEPGERVVV  155

Query  472  VDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQEKK  305
            VDDL+ATGGTL AA+ LLERAGA VVECAC+I +P  K   +LNGKP+Y+LV+ +K
Sbjct  156  VDDLVATGGTLSAAIRLLERAGANVVECACLIGLPKFKDFYKLNGKPVYILVESRK  211



>gb|ABB69070.1| adenine phosphoribosyltransferase [Ceratodon purpureus]
Length=184

 Score =   262 bits (669),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 152/180 (84%), Gaps = 0/180 (0%)
 Frame = -2

Query  853  MSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI  674
            MSA +  DPRI  I   IR +P FP  GIMF+D+TTLLLD KAFKDTID+FVERY+ + I
Sbjct  1    MSATKHGDPRIQYISDSIRAIPDFPHKGIMFRDVTTLLLDHKAFKDTIDIFVERYRDQKI  60

Query  673  SIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVE  494
             ++ GIEARGFIFGP IALAIGAKFVP+RKP+KLPG VIRQEY LEYG+DC+EMHVGA+E
Sbjct  61   DVIVGIEARGFIFGPPIALAIGAKFVPMRKPRKLPGPVIRQEYSLEYGTDCIEMHVGAIE  120

Query  493  AGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
              +R +++DDLIATGGTL AA+ LL++ GAE+VEC C+IE+ DLKG+E+L+GKPLY+LV+
Sbjct  121  KDERVVLIDDLIATGGTLGAAIKLLDQVGAEIVECGCLIELVDLKGREKLSGKPLYILVE  180



>ref|XP_010417755.1| PREDICTED: adenine phosphoribosyltransferase 2-like [Camelina 
sativa]
Length=194

 Score =   262 bits (670),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 126/179 (70%), Positives = 152/179 (85%), Gaps = 0/179 (0%)
 Frame = -2

Query  838  EDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAG  659
            + DPR+  I   IRV+PHFPK GIMFQDITTLLLDP AFK  +D+FV+RYK  NIS+VAG
Sbjct  9    QGDPRLKAISDAIRVIPHFPKTGIMFQDITTLLLDPVAFKHVVDIFVDRYKHMNISLVAG  68

Query  658  IEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRA  479
            +EARGFIFGP IALAIGAKFVPLRKP KLPG+VI +EY+LEYGSD LEM V AV++ +RA
Sbjct  69   VEARGFIFGPPIALAIGAKFVPLRKPGKLPGRVISEEYELEYGSDRLEMSVEAVKSDERA  128

Query  478  LVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQEKKL  302
            L++DDL+ATGGTL A+++LLERAGAEVVECACV+ +P  KGQ +L GKPLYVLV+ ++ 
Sbjct  129  LIIDDLVATGGTLSASINLLERAGAEVVECACVVGLPKFKGQCKLKGKPLYVLVEPREF  187



>dbj|BAD19719.1| putative adenine phosphoribosyltransferase form 2 [Oryza sativa 
Japonica Group]
 dbj|BAG91514.1| unnamed protein product [Oryza sativa Japonica Group]
Length=238

 Score =   264 bits (674),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 125/176 (71%), Positives = 149/176 (85%), Gaps = 0/176 (0%)
 Frame = -2

Query  832  DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIE  653
            DPR+ GI   IRVVPHFPK GIMF DIT LLL P  FKD +D+FVERY+G  I+ VAGIE
Sbjct  60   DPRLQGISDAIRVVPHFPKQGIMFNDITPLLLRPGVFKDAVDIFVERYRGMAIAAVAGIE  119

Query  652  ARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALV  473
            ARGFIFGP+IALAIGAKF+PLRKPKKLPG+VI + Y LEYG+DCL+MHVGA+E G+R L+
Sbjct  120  ARGFIFGPAIALAIGAKFIPLRKPKKLPGEVISETYVLEYGTDCLQMHVGAIEPGERVLI  179

Query  472  VDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQEKK  305
            VDDL+ATGGTLCAA+ LLERAGA+VVECAC+I +P  K   +LNGKP+YVLV+ ++
Sbjct  180  VDDLVATGGTLCAAIRLLERAGADVVECACLIGLPKFKDFYKLNGKPVYVLVESRE  235



>ref|XP_010472994.1| PREDICTED: adenine phosphoribosyltransferase 2-like [Camelina 
sativa]
Length=194

 Score =   262 bits (669),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 126/179 (70%), Positives = 152/179 (85%), Gaps = 0/179 (0%)
 Frame = -2

Query  838  EDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAG  659
            + DPR+  I   IRVVPHFPK GIMFQDITTLLLDP AFK  +D+FV+RYK  NIS+VAG
Sbjct  9    QGDPRLKAISDAIRVVPHFPKTGIMFQDITTLLLDPVAFKHVVDIFVDRYKHMNISLVAG  68

Query  658  IEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRA  479
            +EARGFIFGP IALAIGAKFVPLRKP KLPG+V+ +EY+LEYGSD LEM V AV++ +RA
Sbjct  69   VEARGFIFGPPIALAIGAKFVPLRKPGKLPGRVLSEEYELEYGSDRLEMSVEAVKSDERA  128

Query  478  LVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQEKKL  302
            L++DDL+ATGGTL A+++LLERAGAEVVECACV+ +P  KGQ +L GKPLYVLV+ ++ 
Sbjct  129  LIIDDLVATGGTLSASINLLERAGAEVVECACVVGLPKFKGQCKLKGKPLYVLVEPREF  187



>ref|XP_001769439.1| predicted protein [Physcomitrella patens]
 gb|AAZ42360.1| adenine phosphoribosyltransferase [Physcomitrella patens]
 gb|EDQ65808.1| predicted protein [Physcomitrella patens]
Length=184

 Score =   261 bits (667),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 121/180 (67%), Positives = 153/180 (85%), Gaps = 0/180 (0%)
 Frame = -2

Query  853  MSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNI  674
            MSA ++ DPRI  I   IR +P FP  GIMF+D+TTLLLD KAFKDTID+FVERY+ + +
Sbjct  1    MSASKDGDPRIQYISDSIRTIPDFPHKGIMFRDVTTLLLDHKAFKDTIDIFVERYRDQKV  60

Query  673  SIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVE  494
             ++ GIEARGFIFGP IALAIGAKFVP+RKP+KLPG VIR+EY LEYG+DC+EMHVGA+E
Sbjct  61   DVIVGIEARGFIFGPPIALAIGAKFVPMRKPRKLPGPVIREEYSLEYGTDCIEMHVGAIE  120

Query  493  AGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQ  314
              +R ++VDDLIATGGTL AA+ LL++  AE+VECAC++E+ DLKG+E+L+GKPLY+LV+
Sbjct  121  KNERVVIVDDLIATGGTLGAAIKLLDKVEAEIVECACLVELVDLKGREKLSGKPLYILVE  180



>ref|XP_003603366.1| Adenine phosphoribosyltransferase [Medicago truncatula]
Length=194

 Score =   261 bits (668),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 123/177 (69%), Positives = 154/177 (87%), Gaps = 0/177 (0%)
 Frame = -2

Query  832  DPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAGIE  653
            DPR+  I   IRV+PHFPK GIMFQDITTLLLD KAFKDT+D+FV+RY+  +IS+VAGIE
Sbjct  11   DPRLQHISQSIRVIPHFPKNGIMFQDITTLLLDHKAFKDTVDIFVDRYRDMHISVVAGIE  70

Query  652  ARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRALV  473
            ARGF+FG ++AL IGAKFVPLRKP+KLPG+V  ++Y LEYG+DCLEMHVGAV+ G+RA+V
Sbjct  71   ARGFVFGSAVALGIGAKFVPLRKPRKLPGEVFFEKYSLEYGTDCLEMHVGAVQPGERAIV  130

Query  472  VDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQEKKL  302
            +DDL+ATGGTL A + LLERA AEVVECACVI +P++KG+ +L GKPLYVLV+ +++
Sbjct  131  IDDLVATGGTLSAGIKLLERAKAEVVECACVIGVPEVKGRCKLLGKPLYVLVEPRQV  187



>gb|ABK23131.1| unknown [Picea sitchensis]
Length=289

 Score =   265 bits (676),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 132/167 (79%), Positives = 145/167 (87%), Gaps = 0/167 (0%)
 Frame = -2

Query  856  TMSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKN  677
            TMSA  + D R+ GI   IRVVP FPKPGIMFQDITTLLLD KAF+D ID+FVERYK KN
Sbjct  106  TMSASEDGDARVQGIFDAIRVVPDFPKPGIMFQDITTLLLDHKAFRDCIDIFVERYKDKN  165

Query  676  ISIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAV  497
            IS+VAGIEARGFIFGP IALAIGAKFVP+RKPKKLPG+VI +EY LEYG+D +EMHVGAV
Sbjct  166  ISVVAGIEARGFIFGPPIALAIGAKFVPIRKPKKLPGEVISEEYALEYGTDRIEMHVGAV  225

Query  496  EAGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKG  356
            + GDR LVVDDLIATGGTL AAM LLER GAEVVECACVIE+P+LK 
Sbjct  226  QPGDRTLVVDDLIATGGTLSAAMRLLERVGAEVVECACVIELPELKS  272



>ref|XP_004501525.1| PREDICTED: adenine phosphoribosyltransferase 1, chloroplastic-like 
isoform X1 [Cicer arietinum]
Length=264

 Score =   264 bits (674),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 145/166 (87%), Gaps = 0/166 (0%)
 Frame = -2

Query  856  TMSAFREDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKN  677
            T  A ++ DPRI  I S IRV+P FPKPGIMFQDITTLLLD KAFKDTIDLFVERY+ +N
Sbjct  64   TEMASQDQDPRIARISSAIRVIPDFPKPGIMFQDITTLLLDTKAFKDTIDLFVERYRDQN  123

Query  676  ISIVAGIEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAV  497
            IS+VAG+EARGFIFGP IALAIGAKFVP+RKPKKLPG+VI +EY LEYG+D +EMHVGAV
Sbjct  124  ISVVAGVEARGFIFGPPIALAIGAKFVPMRKPKKLPGEVISEEYSLEYGTDKIEMHVGAV  183

Query  496  EAGDRALVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLK  359
            + G+RALV+DDLIATGGTLCAA+ LLER    VVECACVIE+P+LK
Sbjct  184  QPGERALVIDDLIATGGTLCAAIKLLERVEVTVVECACVIELPELK  229



>ref|XP_009104443.1| PREDICTED: adenine phosphoribosyltransferase 2 [Brassica rapa]
 emb|CDX67942.1| BnaA07g19820D [Brassica napus]
Length=192

 Score =   261 bits (667),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 151/179 (84%), Gaps = 0/179 (0%)
 Frame = -2

Query  838  EDDPRIDGIQSRIRVVPHFPKPGIMFQDITTLLLDPKAFKDTIDLFVERYKGKNISIVAG  659
            + DPR+  I   IRV+PHFPK GIMFQDITTLLLDP AFK  +D+FV+RYK  NIS+VAG
Sbjct  9    QGDPRLQAISDAIRVIPHFPKTGIMFQDITTLLLDPVAFKHVVDIFVDRYKHMNISLVAG  68

Query  658  IEARGFIFGPSIALAIGAKFVPLRKPKKLPGKVIRQEYDLEYGSDCLEMHVGAVEAGDRA  479
            +EARGFIFGP IALAIGAKF+PLRKP KLPG+VI +EY+LEYG+D LEM V AV++ +RA
Sbjct  69   VEARGFIFGPPIALAIGAKFIPLRKPGKLPGRVISEEYELEYGNDRLEMSVEAVKSHERA  128

Query  478  LVVDDLIATGGTLCAAMDLLERAGAEVVECACVIEIPDLKGQERLNGKPLYVLVQEKKL  302
            LV+DDL+ATGGTL A+++LLERAGAEVVECACV+ +P  KG  +L GKPLYVLV+  +L
Sbjct  129  LVIDDLVATGGTLSASINLLERAGAEVVECACVVGLPKFKGHCKLKGKPLYVLVEPSQL  187



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2369537585113