BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c1062_g2_i1 len=1355 path=[7521:0-1354]

Length=1355
                                                                      Score     E

gb|AAQ72498.1|  MADS-box protein 12                                     371   2e-123   Petunia x hybrida [garden petunia]
ref|XP_009608616.1|  PREDICTED: developmental protein SEPALLATA 1...    371   2e-123   
ref|NP_001234201.1|  TAGL2 transcription factor                         370   7e-123   
ref|XP_009757151.1|  PREDICTED: developmental protein SEPALLATA 1...    369   2e-122   
ref|XP_006338336.1|  PREDICTED: developmental protein SEPALLATA 1...    368   3e-122   
ref|NP_001233911.1|  MADS-box protein                                   368   4e-122   
ref|XP_009608615.1|  PREDICTED: developmental protein SEPALLATA 1...    367   1e-121   
ref|XP_010315869.1|  PREDICTED: MADS-box protein isoform X1             363   2e-120   
ref|XP_009757345.1|  PREDICTED: developmental protein SEPALLATA 1...    361   1e-119   
ref|XP_009589584.1|  PREDICTED: developmental protein SEPALLATA 1...    361   2e-119   
ref|XP_009757152.1|  PREDICTED: developmental protein SEPALLATA 1...    358   3e-118   
gb|AAK21248.1|AF335235_1  MADS-box transcription factor FBP5            357   4e-118   Petunia x hybrida [garden petunia]
ref|XP_009608617.1|  PREDICTED: developmental protein SEPALLATA 1...    356   2e-117   
emb|CDP02339.1|  unnamed protein product                                347   5e-114   
ref|XP_011099041.1|  PREDICTED: developmental protein SEPALLATA 1...    345   4e-113   
ref|XP_011099040.1|  PREDICTED: developmental protein SEPALLATA 1...    340   2e-111   
emb|CAA64741.1|  DEFH49                                                 336   1e-109   Antirrhinum majus [garden snapdragon]
emb|CAL36576.1|  deficiens H49 homologue                                335   2e-109   Misopates orontium
dbj|BAK09619.1|  MADS-box transcription factor                          332   6e-108   
ref|XP_009589591.1|  PREDICTED: developmental protein SEPALLATA 1...    330   1e-107   
ref|XP_009589597.1|  PREDICTED: developmental protein SEPALLATA 1...    328   5e-107   
gb|AHW58036.1|  SEP1/2                                                  329   6e-107   
ref|XP_009757346.1|  PREDICTED: developmental protein SEPALLATA 1...    328   1e-106   
dbj|BAO74162.1|  MADS-box transcription factor SEP1.2                   319   4e-103   
ref|NP_001268109.1|  MADS-box protein 2                                 315   1e-101   
gb|KDP24297.1|  hypothetical protein JCGZ_25593                         309   4e-99    
ref|XP_010660492.1|  PREDICTED: MADS-box protein 2 isoform X1           309   4e-99    
ref|XP_006602962.1|  PREDICTED: developmental protein SEPALLATA 1...    308   1e-98    
ref|XP_007032865.1|  K-box region and MADS-box transcription fact...    305   8e-98    
ref|XP_010260833.1|  PREDICTED: MADS-box protein CMB1                   304   4e-97    
ref|XP_006593703.1|  PREDICTED: developmental protein SEPALLATA 1...    304   4e-97    
gb|ADU15478.1|  SEP1                                                    303   6e-97    
ref|XP_003531877.1|  PREDICTED: developmental protein SEPALLATA 1...    303   1e-96    
ref|XP_003552609.1|  PREDICTED: developmental protein SEPALLATA 1...    301   5e-96    
gb|AHH28266.1|  MADS-box transcription factor                           301   6e-96    
ref|XP_006482430.1|  PREDICTED: developmental protein SEPALLATA 1...    300   1e-95    
gb|AAP83376.1|  SEPALLATA1-like MADS-box                                298   2e-95    Solanum lycopersicum
ref|XP_006603756.1|  PREDICTED: MADS-box protein isoform X1             299   3e-95    
gb|KHG17252.1|  Developmental SEPALLATA 2 -like protein                 298   4e-95    
ref|XP_004154725.1|  PREDICTED: developmental protein SEPALLATA 2...    299   4e-95    
gb|AEJ76841.1|  MADS17                                                  298   4e-95    
ref|XP_008464576.1|  PREDICTED: developmental protein SEPALLATA 1...    298   4e-95    
gb|EPS70807.1|  hypothetical protein M569_03954                         299   5e-95    
emb|CAN59955.1|  hypothetical protein VITISV_006723                     298   5e-95    Vitis vinifera
ref|XP_008230291.1|  PREDICTED: developmental protein SEPALLATA 1...    297   1e-94    
ref|XP_003544012.1|  PREDICTED: developmental protein SEPALLATA 1...    297   1e-94    
ref|NP_001267667.1|  developmental protein SEPALLATA 2-like             297   1e-94    
ref|XP_010257958.1|  PREDICTED: developmental protein SEPALLATA 1       296   2e-94    
gb|AAY30858.1|  MADS-box transcription factor                           296   2e-94    Prunus dulcis [sweet almond]
ref|XP_004507289.1|  PREDICTED: developmental protein SEPALLATA 1...    296   3e-94    
ref|NP_001238296.1|  MADS-box protein                                   296   3e-94    
ref|XP_006585806.1|  PREDICTED: developmental protein SEPALLATA 1...    296   3e-94    
gb|ACD39982.1|  MADS1                                                   296   3e-94    Carica papaya [mamon]
ref|XP_004507287.1|  PREDICTED: developmental protein SEPALLATA 1...    296   4e-94    
ref|XP_010694125.1|  PREDICTED: developmental protein SEPALLATA 1...    296   5e-94    
ref|XP_006430949.1|  hypothetical protein CICLE_v10012593mg             295   6e-94    
gb|AGW23364.1|  MADS box protein MADS62                                 295   1e-93    
gb|AFO68772.1|  agamous-like protein 2                                  295   1e-93    
emb|CAH04878.1|  MADS domain protein                                    295   1e-93    Gerbera hybrid cultivar
ref|XP_009373782.1|  PREDICTED: developmental protein SEPALLATA 1...    295   1e-93    
ref|XP_008230289.1|  PREDICTED: developmental protein SEPALLATA 1...    295   2e-93    
gb|AHH28272.1|  MADS-box transcription factor                           294   2e-93    
ref|XP_011021072.1|  PREDICTED: developmental protein SEPALLATA 2...    294   2e-93    
ref|XP_002306051.2|  hypothetical protein POPTR_0004s11440g             294   2e-93    Populus trichocarpa [western balsam poplar]
ref|XP_008341807.1|  PREDICTED: developmental protein SEPALLATA 1...    294   3e-93    
ref|XP_007215876.1|  hypothetical protein PRUPE_ppa010548mg             293   4e-93    
gb|AAP83397.1|  SEPALLATA1-like MADS-box                                292   5e-93    Petunia x hybrida [garden petunia]
ref|XP_011014957.1|  PREDICTED: developmental protein SEPALLATA 2...    293   8e-93    
gb|ABF50239.1|  SEPALLATA                                               291   8e-93    Nicotiana langsdorffii x Nicotiana sanderae
ref|XP_007139420.1|  hypothetical protein PHAVU_008G027900g             292   1e-92    
gb|ABG78619.1|  MADS4                                                   291   2e-92    Populus tomentosa [Chinese white poplar]
gb|AAC25922.1|  MADS-box protein 1                                      291   2e-92    Malus domestica [apple tree]
ref|XP_010694117.1|  PREDICTED: developmental protein SEPALLATA 1...    291   2e-92    
ref|XP_008230292.1|  PREDICTED: developmental protein SEPALLATA 1...    291   3e-92    
gb|KHN29767.1|  Developmental protein SEPALLATA 2                       291   4e-92    
ref|XP_007215877.1|  hypothetical protein PRUPE_ppa010548mg             290   7e-92    
gb|AFM30904.1|  transcription factor MADS4                              290   1e-91    
ref|XP_004507288.1|  PREDICTED: developmental protein SEPALLATA 1...    290   1e-91    
ref|XP_010694134.1|  PREDICTED: developmental protein SEPALLATA 1...    290   1e-91    
ref|NP_001280893.1|  developmental protein SEPALLATA 1                  290   1e-91    
gb|KEH25149.1|  MADS-box transcription factor                           289   2e-91    
ref|XP_003621519.1|  MADS-box protein                                   289   3e-91    
ref|XP_009373783.1|  PREDICTED: developmental protein SEPALLATA 1...    288   3e-91    
ref|XP_008230290.1|  PREDICTED: developmental protein SEPALLATA 1...    288   4e-91    
gb|AFU81295.1|  SEPALLATA1                                              288   5e-91    
gb|AAP83411.1|  SEPALLATA1-like MADS-box                                286   5e-91    Syringa vulgaris
ref|XP_007151389.1|  hypothetical protein PHAVU_004G042300g             288   6e-91    
gb|AAL08423.2|AF185574_1  transcription factor MAGL4                    288   8e-91    Populus tremuloides
ref|XP_010029406.1|  PREDICTED: developmental protein SEPALLATA 1       287   1e-90    
gb|ADR83588.1|  Sepallata 1-like protein                                286   2e-90    
gb|AGS42240.1|  MADS-box protein                                        286   3e-90    
ref|XP_007151388.1|  hypothetical protein PHAVU_004G042300g             284   6e-90    
gb|AET98846.1|  SEPALLATA1                                              285   6e-90    
gb|AAZ77748.1|  AGL2-like MADS box 3                                    285   8e-90    Castanea mollissima
gb|AAX69068.1|  MADS box protein M6                                     285   8e-90    Pisum sativum [garden pea]
gb|AFK42306.1|  unknown                                                 285   9e-90    
ref|XP_009378252.1|  PREDICTED: developmental protein SEPALLATA 1...    285   1e-89    
ref|XP_004491903.1|  PREDICTED: developmental protein SEPALLATA 1...    284   2e-89    
gb|ABD65406.1|  MADS-box protein                                        284   2e-89    Diospyros kaki [Japanese persimmon]
gb|AES77737.2|  MADS-box transcription factor                           283   7e-89    
gb|AEF59025.1|  MADS-1                                                  282   2e-88    
ref|XP_004304204.1|  PREDICTED: developmental protein SEPALLATA 2...    281   2e-88    
gb|ADC79693.1|  SEPALLATA1-like protein                                 280   6e-88    Akebia trifoliata
gb|AEL33631.1|  SEPALLATA1                                              279   2e-87    
gb|AIC33051.1|  flower development transporter SEP1                     277   6e-87    
gb|ADL36751.1|  MADS domain class transcription factor                  277   7e-87    
ref|XP_004491904.1|  PREDICTED: developmental protein SEPALLATA 1...    278   7e-87    
ref|XP_010558530.1|  PREDICTED: developmental protein SEPALLATA 1       277   1e-86    
gb|AFO68777.1|  agamous-like protein 2                                  275   2e-86    
ref|XP_002263039.1|  PREDICTED: MADS-box protein CMB1 isoform X2        275   4e-86    Vitis vinifera
gb|AGV54737.1|  developmental protein SEPALLATA 2-like protein          275   5e-86    
ref|XP_008365428.1|  PREDICTED: developmental protein SEPALLATA 1...    275   7e-86    
ref|XP_010099309.1|  Developmental protein SEPALLATA 2                  275   8e-86    
gb|ADL36750.1|  MADS domain class transcription factor                  274   1e-85    
gb|AFO68778.1|  agamous-like protein 2                                  273   1e-85    
gb|AGL94767.1|  MADS-box protein 1                                      273   2e-85    
ref|XP_008357795.1|  PREDICTED: LOW QUALITY PROTEIN: developmenta...    273   2e-85    
ref|XP_009415892.1|  PREDICTED: agamous-like MADS-box protein AGL...    273   3e-85    
gb|AIE44769.1|  putative MADS-domain transcription factor AGL2          273   3e-85    
emb|CDY26462.1|  BnaC09g42060D                                          273   4e-85    
gb|AAA32732.1|  transcription factor                                    272   8e-85    Arabidopsis thaliana [mouse-ear cress]
gb|AIU94433.1|  MADS-box transcription factor 2 isoform 1               271   2e-84    
gb|AFX72877.1|  MADS-box protein SEP2A                                  271   2e-84    
ref|XP_009121545.1|  PREDICTED: developmental protein SEPALLATA 1       271   3e-84    
ref|XP_006408426.1|  hypothetical protein EUTSA_v10021390mg             271   3e-84    
gb|ACJ64678.1|  MADS-box protein MADS2                                  270   3e-84    Musa acuminata AAA Group [Cavendish banana]
emb|CDY34718.1|  BnaA01g33070D                                          271   3e-84    
gb|ABD60322.1|  SEP2                                                    270   4e-84    Boechera stricta
gb|KFK25803.1|  hypothetical protein AALP_AA8G163200                    270   7e-84    
gb|AFO68775.1|  agamous-like protein 2                                  269   7e-84    
emb|CBI27678.3|  unnamed protein product                                269   9e-84    
ref|XP_002873742.1|  hypothetical protein ARALYDRAFT_909555             269   1e-83    
gb|AGW23594.1|  MADS1                                                   269   1e-83    
ref|XP_009131500.1|  PREDICTED: developmental protein SEPALLATA 1...    269   1e-83    
emb|CAA04920.1|  MdMADS9                                                268   2e-83    Malus domestica [apple tree]
gb|AGT20511.1|  SEP2.a                                                  269   2e-83    
ref|XP_006400104.1|  hypothetical protein EUTSA_v10014493mg             268   2e-83    
ref|XP_008801852.1|  PREDICTED: agamous-like MADS-box protein AGL...    268   3e-83    
dbj|BAM34478.1|  MADS-box transcription factor                          268   3e-83    
gb|AIU94434.1|  MADS-box transcription factor 2 isoform 2               268   4e-83    
ref|XP_009117898.1|  PREDICTED: developmental protein SEPALLATA 2       268   5e-83    
ref|XP_010463632.1|  PREDICTED: developmental protein SEPALLATA 2...    268   6e-83    
ref|XP_010485469.1|  PREDICTED: developmental protein SEPALLATA 2       267   7e-83    
ref|XP_006298399.1|  hypothetical protein CARUB_v10014470mg             267   9e-83    
emb|CDX69499.1|  BnaA10g18480D                                          267   1e-82    
ref|XP_010470619.1|  PREDICTED: developmental protein SEPALLATA 2...    266   1e-82    
ref|NP_001268114.1|  MADS-box protein 4                                 266   1e-82    
ref|XP_010549963.1|  PREDICTED: developmental protein SEPALLATA 1       266   2e-82    
gb|AAF12701.2|  Apetala 1 protein                                       265   2e-82    Populus tremuloides
ref|XP_010913017.1|  PREDICTED: agamous-like MADS-box protein AGL...    266   2e-82    
ref|XP_002263410.2|  PREDICTED: MADS-box protein CMB1                   266   3e-82    Vitis vinifera
ref|XP_009147359.1|  PREDICTED: developmental protein SEPALLATA 2...    265   4e-82    
ref|XP_009761698.1|  PREDICTED: MADS-box protein CMB1-like              265   4e-82    
ref|XP_007045799.1|  MADS-box transcription factor                      265   5e-82    
gb|AIU94430.1|  MADS-box transcription factor 2 isoform 2               265   5e-82    
gb|AIU94432.1|  MADS-box transcription factor 2 isoform 3               265   6e-82    
ref|XP_009419371.1|  PREDICTED: agamous-like MADS-box protein AGL...    265   6e-82    
emb|CDY57524.1|  BnaA05g33600D                                          265   7e-82    
ref|XP_010653929.1|  PREDICTED: MADS-box protein 4 isoform X1           265   7e-82    
ref|XP_010663486.1|  PREDICTED: MADS-box protein CMB1 isoform X1        265   7e-82    
dbj|BAD10944.1|  SEPALLATA1 homologous protein                          265   1e-81    Silene latifolia
ref|XP_007043947.1|  K-box region and MADS-box transcription fact...    264   1e-81    
gb|ACJ64681.1|  MADS-box protein MADS4                                  263   2e-81    Musa acuminata AAA Group [Cavendish banana]
gb|AAX15924.1|  AGL9.2                                                  263   2e-81    Persea americana
ref|XP_011020782.1|  PREDICTED: agamous-like MADS-box protein AGL...    263   3e-81    
gb|AGT20512.1|  SEP2.b                                                  263   3e-81    
ref|XP_002884314.1|  SEPALLATA2                                         263   3e-81    
emb|CDX78653.1|  BnaA03g05650D                                          263   4e-81    
gb|AAX15923.1|  AGL9.1                                                  262   4e-81    Persea americana
gb|AAF76381.1|AF068723_1  MADS-box protein MADS4                        262   6e-81    Nicotiana tabacum [American tobacco]
dbj|BAC80255.1|  MADS-box transcription factor                          262   6e-81    Houttuynia cordata [chameleon-plant]
gb|AAU82009.1|  SEPALLATA2                                              262   8e-81    Arabidopsis thaliana [mouse-ear cress]
gb|AHW52536.1|  SEPALLATA-like MADS-box protein 1                       261   9e-81    
ref|NP_186880.1|  developmental protein SEPALLATA 2                     261   1e-80    Arabidopsis thaliana [mouse-ear cress]
gb|AAO42085.1|  putative floral homeotic protein AGL4                   261   2e-80    Arabidopsis thaliana [mouse-ear cress]
gb|AHY82573.1|  MADS-box protein 6                                      261   2e-80    
ref|XP_010681125.1|  PREDICTED: MADS-box protein CMB1-like              261   2e-80    
gb|ACB69510.1|  SEPALLATA3-like MADS-box protein                        260   3e-80    Crocus sativus [saffron crocus]
emb|CAN84110.1|  hypothetical protein VITISV_036170                     260   3e-80    Vitis vinifera
gb|ADU56817.1|  MADS-box protein AGL2 subfamily                         260   3e-80    
ref|XP_009598871.1|  PREDICTED: MADS-box protein CMB1-like              260   3e-80    
gb|AAP83390.1|  SEPALLATA1-like MADS-box                                259   4e-80    Pachysandra terminalis
emb|CDX70651.1|  BnaC03g07350D                                          260   4e-80    
emb|CAC81072.1|  MADS box transcription factor                          260   4e-80    Daucus carota subsp. sativus
gb|ADC79703.1|  SEPALLATA3-like protein                                 259   6e-80    Pachysandra terminalis
gb|ABC70706.1|  MADS-box transcription factor                           259   6e-80    Asparagus virgatus
ref|XP_006579436.1|  PREDICTED: uncharacterized protein LOC100805...    259   9e-80    
ref|XP_007037631.1|  K-box region and MADS-box transcription fact...    265   1e-79    
ref|XP_011036099.1|  PREDICTED: agamous-like MADS-box protein AGL...    258   1e-79    
ref|XP_006579435.1|  PREDICTED: uncharacterized protein LOC100805...    258   1e-79    
gb|AAX13298.1|  MADS box protein SEP3                                   258   1e-79    Lotus japonicus
gb|ADU15479.1|  SEP4                                                    258   2e-79    
gb|AAQ83834.1|  MADS box protein                                        258   2e-79    Asparagus officinalis
gb|AHM92084.1|  MADS-box protein 8                                      258   2e-79    
gb|AAU82031.1|  SEPALLATA2                                              258   2e-79    Arabidopsis lyrata subsp. petraea
ref|XP_006579434.1|  PREDICTED: uncharacterized protein LOC100805...    258   2e-79    
ref|NP_568322.1|  MADS box transcription factor SEPALLATA 1             258   2e-79    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006288512.1|  hypothetical protein CARUB_v10001783mg             258   2e-79    
ref|XP_007043949.1|  K-box region and MADS-box transcription fact...    258   3e-79    
gb|AFO68790.1|  agamous-like protein 234                                257   3e-79    
gb|KHN34832.1|  MADS-box transcription factor 1                         258   3e-79    
dbj|BAC80254.1|  MADS-box transcription factor                          258   3e-79    Houttuynia cordata [chameleon-plant]
gb|ADD25190.1|  SEP1                                                    257   3e-79    Nelumbo nucifera [Indian lotus]
ref|XP_010917558.1|  PREDICTED: agamous-like MADS-box protein AGL...    257   4e-79    
ref|XP_006585132.1|  PREDICTED: MADS-box transcription factor 1-l...    257   4e-79    
ref|XP_006579433.1|  PREDICTED: uncharacterized protein LOC100805...    257   4e-79    
emb|CAX65570.1|  GRCD4 protein                                          257   4e-79    Gerbera hybrid cultivar
gb|AAX15922.1|  AGL2                                                    257   5e-79    Acorus americanus [sweetflag]
ref|XP_010453727.1|  PREDICTED: developmental protein SEPALLATA 1       257   5e-79    
gb|AEW50208.1|  SEP1                                                    257   5e-79    
ref|XP_006585131.1|  PREDICTED: MADS-box transcription factor 1-l...    257   6e-79    
ref|XP_006440804.1|  hypothetical protein CICLE_v10021357mg             259   6e-79    
gb|ADJ67238.1|  MADS box transcription factor 6                         257   6e-79    
ref|XP_010420253.1|  PREDICTED: developmental protein SEPALLATA 1...    257   6e-79    
ref|NP_001284431.1|  agamous-like MADS-box protein AGL9 homolog         256   7e-79    
ref|XP_004140534.1|  PREDICTED: agamous-like MADS-box protein AGL...    256   7e-79    
ref|XP_008240082.1|  PREDICTED: MADS-box protein CMB1-like              257   8e-79    
ref|XP_006585130.1|  PREDICTED: MADS-box transcription factor 1-l...    256   8e-79    
gb|ADC79694.1|  SEPALLATA1-like protein                                 256   9e-79    Akebia trifoliata
ref|XP_008811035.1|  PREDICTED: agamous-like MADS-box protein AGL...    256   1e-78    
ref|XP_006585129.1|  PREDICTED: MADS-box transcription factor 1-l...    256   1e-78    
ref|XP_008222191.1|  PREDICTED: agamous-like MADS-box protein AGL...    256   1e-78    
ref|XP_007223808.1|  hypothetical protein PRUPE_ppa010679mg             256   2e-78    
gb|AEN75254.1|  transcription factor MADS3                              256   2e-78    
gb|ADC79704.1|  SEPALLATA3-like protein                                 255   2e-78    Pachysandra terminalis
gb|ADC79707.1|  SEPALLATA1-like protein                                 255   2e-78    Euptelea pleiosperma
gb|ABQ85951.1|  MADS-box transcription factor SEP-like 2                255   3e-78    Trochodendron aralioides
gb|KHG25284.1|  Agamous-like MADS-box protein AGL9                      255   3e-78    
ref|XP_009600809.1|  PREDICTED: agamous-like MADS-box protein AGL...    255   3e-78    
gb|AEJ76840.1|  MADS16                                                  255   3e-78    
ref|XP_006856372.1|  hypothetical protein AMTR_s00047p00190220          255   4e-78    
gb|KHG04329.1|  MADS-box CMB1                                           255   4e-78    
dbj|BAM36705.1|  MADS transcriptional factor SEP3 homolog               254   5e-78    
ref|XP_009788435.1|  PREDICTED: MADS-box protein CMB1-like              254   5e-78    
gb|AEL33633.1|  SEPALLATA3                                              254   6e-78    
gb|AHY82574.1|  MADS-box protein 7                                      254   6e-78    
gb|AAO22982.1|  MADS-box transcription factor CDM44                     254   6e-78    Chrysanthemum x morifolium [florist's chrysanthemum]
dbj|BAM71399.1|  transcription factor                                   254   7e-78    
ref|NP_001289529.1|  agamous-like MADS-box protein AGL9 homolog         254   7e-78    
dbj|BAG55316.1|  transcription factor                                   254   9e-78    Petunia integrifolia subsp. inflata
gb|AHJ80843.1|  SEPALLATA3                                              254   9e-78    
ref|XP_006477713.1|  PREDICTED: developmental protein SEPALLATA 1...    254   1e-77    
sp|Q03489.2|AGL9_PETHY  RecName: Full=Agamous-like MADS-box prote...    253   1e-77    Petunia x hybrida [garden petunia]
gb|AHH28254.1|  MADS-box transcription factor                           253   1e-77    
gb|ACB69509.1|  SEPALLATA3-like MADS-box protein                        253   1e-77    Crocus sativus [saffron crocus]
gb|AAN15182.1|  MADS box protein GHMADS-1                               253   1e-77    Gossypium hirsutum [American cotton]
gb|AAZ95252.1|  MADS box protein SEP1                                   253   1e-77    Dendrobium crumenatum
ref|XP_007209505.1|  hypothetical protein PRUPE_ppa010391mg             253   1e-77    
ref|XP_009337956.1|  PREDICTED: MADS-box protein CMB1-like              253   1e-77    
gb|AHM92083.1|  MADS-box protein 7                                      253   1e-77    
gb|AFS60086.1|  MADS box transcription factor SEP1                      253   2e-77    
gb|ADP09004.1|  SEP3-like protein                                       253   2e-77    
ref|XP_007163780.1|  hypothetical protein PHAVU_001G263400g             253   2e-77    
gb|ABQ85952.1|  MADS-box transcription factor SEP-like 3                252   2e-77    Trochodendron aralioides
ref|XP_007043948.1|  K-box region and MADS-box transcription fact...    253   2e-77    
gb|ABC70710.1|  MADS-box transcription factor                           253   2e-77    Asparagus officinalis
gb|AFX72879.1|  MADS-box protein SEP3                                   253   2e-77    
gb|ABK41485.1|  putative MADS box protein                               253   3e-77    Elaeis guineensis
ref|XP_010917559.1|  PREDICTED: agamous-like MADS-box protein AGL...    253   3e-77    
dbj|BAK09620.1|  MADS-box transcription factor                          253   3e-77    
ref|XP_007163779.1|  hypothetical protein PHAVU_001G263400g             252   3e-77    
ref|NP_001234384.1|  agamous-like MADS-box protein AGL9 homolog         252   4e-77    
gb|AAO49811.1|  SEP3-related MADS-box protein                           252   4e-77    Populus tremuloides
gb|AFH66785.1|  SEP-like MADS-box protein                               252   4e-77    
gb|AIC33052.1|  flower development transporter SEP3                     252   4e-77    
gb|ACA24481.1|  agamous-like 9 protein 1                                251   5e-77    
dbj|BAN89460.1|  sepallata 3                                            252   5e-77    
ref|XP_006352168.1|  PREDICTED: agamous-like MADS-box protein AGL...    252   5e-77    
ref|XP_006440806.1|  hypothetical protein CICLE_v10021357mg             254   5e-77    
gb|AHW58034.1|  SEP3                                                    252   5e-77    
gb|AEL33632.1|  SEPALLATA2                                              252   5e-77    
gb|AAT46095.1|  SEPALLATA-like protein                                  252   5e-77    Akebia trifoliata
gb|ADJ67241.1|  MADS box transcription factor 11                        252   5e-77    
ref|XP_010250667.1|  PREDICTED: agamous-like MADS-box protein AGL...    251   6e-77    
ref|XP_006415783.1|  hypothetical protein EUTSA_v10008591mg             252   6e-77    
ref|XP_006437995.1|  hypothetical protein CICLE_v10032507mg             251   6e-77    
gb|AEX58640.1|  AGL2-2                                                  251   6e-77    
gb|KHN24051.1|  MADS-box transcription factor 1                         251   6e-77    
ref|NP_001281016.1|  MADS-box protein CMB1-like                         252   6e-77    
ref|XP_004299281.1|  PREDICTED: MADS-box protein CMB1-like              252   7e-77    
ref|XP_011086825.1|  PREDICTED: agamous-like MADS-box protein AGL...    251   7e-77    
gb|AIU94287.1|  SEPALLATA1-like protein                                 251   8e-77    
gb|AAX15920.1|  AGL9                                                    251   8e-77    
ref|XP_008811033.1|  PREDICTED: agamous-like MADS-box protein AGL...    251   8e-77    
ref|XP_008811037.1|  PREDICTED: agamous-like MADS-box protein AGL...    251   9e-77    
ref|XP_006345102.1|  PREDICTED: MADS-box protein CMB1-like              251   9e-77    
gb|KCW48935.1|  hypothetical protein EUGRSUZ_K02546                     251   1e-76    
gb|AAK21249.1|AF335236_1  MADS-box transcription factor FBP9            251   1e-76    
ref|XP_003601749.1|  MADS-box transcription factor                      251   1e-76    
gb|KDP26829.1|  hypothetical protein JCGZ_17987                         251   2e-76    
ref|NP_001119230.1|  MADS box transcription factor SEPALLATA 1          251   2e-76    
ref|NP_001236390.1|  MADS transcription factor                          250   2e-76    
ref|XP_004504398.1|  PREDICTED: agamous-like MADS-box protein AGL...    250   2e-76    
ref|XP_008801850.1|  PREDICTED: agamous-like MADS-box protein AGL...    251   3e-76    
ref|XP_002890717.1|  hypothetical protein ARALYDRAFT_472923             250   3e-76    
ref|XP_008801853.1|  PREDICTED: agamous-like MADS-box protein AGL...    249   4e-76    
ref|XP_008811034.1|  PREDICTED: agamous-like MADS-box protein AGL...    250   4e-76    
gb|ADC79706.1|  SEPALLATA3-like protein                                 249   4e-76    
ref|XP_009788128.1|  PREDICTED: MADS-box protein CMB1-like              249   4e-76    
gb|ABE02212.1|  SEP-like                                                249   4e-76    
emb|CAA04323.1|  MADS-box protein                                       249   4e-76    
gb|AEX92976.1|  MADS box protein 1                                      249   7e-76    
gb|AEJ76842.1|  MADS18                                                  249   8e-76    
gb|AAX15918.1|  AGL9                                                    249   8e-76    
gb|AEX58639.1|  AGL2-1                                                  249   8e-76    
gb|ADU15477.1|  SEP3                                                    249   1e-75    
ref|XP_004504397.1|  PREDICTED: agamous-like MADS-box protein AGL...    248   1e-75    
ref|XP_003549578.1|  PREDICTED: MADS-box protein CMB1-like              248   1e-75    
ref|XP_006477714.1|  PREDICTED: developmental protein SEPALLATA 1...    249   1e-75    
ref|XP_004237061.1|  PREDICTED: MADS-box protein CMB1 isoform X1        248   1e-75    
gb|ADF49576.1|  transcription factor MADS-box 2                         248   1e-75    
ref|XP_003538541.1|  PREDICTED: MADS-box transcription factor 1-l...    248   1e-75    
gb|AET04966.2|  MADS-box transcription factor                           248   1e-75    
ref|XP_004502275.1|  PREDICTED: MADS-box transcription factor 1-l...    248   2e-75    
gb|KHG12954.1|  MADS-box CMB1                                           248   2e-75    
ref|XP_006354102.1|  PREDICTED: MADS-box protein CMB1-like              248   2e-75    
emb|CAA64742.1|  DEFH72                                                 248   2e-75    
ref|NP_001289232.1|  agamous-like MADS-box protein AGL9 homolog         248   2e-75    
emb|CAL36578.1|  deficiens H200 homologue                               248   2e-75    
sp|Q39685.1|CMB1_DIACA  RecName: Full=MADS-box protein CMB1             247   2e-75    
emb|CAA64743.1|  DEFH200                                                247   3e-75    
gb|KFK44483.1|  developmental protein sepallata 3                       248   3e-75    
ref|XP_004502274.1|  PREDICTED: MADS-box transcription factor 1-l...    247   3e-75    
ref|NP_001234380.1|  MADS-box protein 1                                 247   4e-75    
gb|AHH28301.1|  MADS-box transcription factor                           246   4e-75    
gb|AAF22138.1|AF129875_1  MADS box transcription factor MADS1           247   4e-75    
dbj|BAC80253.1|  MADS-box transcription factor                          247   4e-75    
ref|NP_001275579.1|  MADS-box protein CMB1-like                         247   5e-75    
gb|KHN18378.1|  MADS-box protein CMB1                                   246   6e-75    
gb|AGV31155.1|  E-class MADS-box protein                                246   6e-75    
ref|XP_009372256.1|  PREDICTED: agamous-like MADS-box protein AGL...    247   6e-75    
sp|O65874.1|MTF1_PEA  RecName: Full=MADS-box transcription factor 1     246   6e-75    
ref|XP_006591442.1|  PREDICTED: MADS-box transcription factor 1-l...    246   7e-75    
ref|XP_010025292.1|  PREDICTED: agamous-like MADS-box protein AGL...    246   8e-75    
gb|ABC70707.1|  MADS-box transcription factor                           246   8e-75    
gb|AAD09206.1|  putative MADS-box family transcription factor           246   9e-75    
ref|XP_010936438.1|  PREDICTED: agamous-like MADS-box protein AGL...    246   9e-75    
emb|CAX65571.1|  GRCD5 protein                                          246   9e-75    
ref|NP_850953.1|  MADs box transcription factor SEPALLATA3              246   1e-74    
dbj|BAM34481.1|  MADS-box transcription factor                          246   1e-74    
gb|ACU13166.1|  unknown                                                 244   1e-74    
gb|AEO45959.1|  SEPALLATA3-like protein                                 246   1e-74    
gb|ABS17562.1|  SEPALLATA 3-like protein                                245   2e-74    
dbj|BAM34480.1|  MADS-box transcription factor                          245   2e-74    
gb|AJC01940.1|  MADS-box protein                                        245   2e-74    
ref|NP_564214.2|  MADs box transcription factor SEPALLATA3              245   2e-74    
ref|XP_006437994.1|  hypothetical protein CICLE_v10032507mg             245   2e-74    
ref|XP_010913018.1|  PREDICTED: agamous-like MADS-box protein AGL...    245   2e-74    
emb|CDP00462.1|  unnamed protein product                                245   2e-74    
ref|NP_001280756.1|  agamous-like MADS-box protein AGL9 homolog         245   2e-74    
gb|AAK21254.1|AF335241_1  MADS-box transcription factor FBP23           245   2e-74    
dbj|BAF34912.1|  MADS-box protein                                       245   3e-74    
ref|XP_010319477.1|  PREDICTED: MADS-box protein CMB1 isoform X2        244   3e-74    
gb|ACO72983.1|  SEP3-like MADS-box protein                              244   4e-74    
ref|XP_007155209.1|  hypothetical protein PHAVU_003G182800g             244   4e-74    
sp|Q38694.1|AGL9_ARADE  RecName: Full=Agamous-like MADS-box prote...    244   4e-74    
ref|XP_002311352.1|  MADS-box protein 4                                 244   4e-74    
ref|XP_006363565.1|  PREDICTED: MADS-box protein CMB1-like              244   5e-74    
ref|XP_010499199.1|  PREDICTED: developmental protein SEPALLATA 3...    244   5e-74    
gb|AFU81296.1|  SEPALLATA3                                              244   5e-74    
ref|XP_010499198.1|  PREDICTED: developmental protein SEPALLATA 3...    244   5e-74    
gb|AAY21913.2|  putative MADS box protein                               244   6e-74    
ref|XP_008340236.1|  PREDICTED: agamous-like MADS-box protein AGL...    244   7e-74    
ref|XP_006660815.1|  PREDICTED: MADS-box transcription factor 8-like    244   7e-74    
gb|AGW23350.1|  MADS box protein MADS48                                 244   7e-74    
gb|ACA24482.1|  agamous-like 9 protein 2                                244   8e-74    
ref|XP_006437996.1|  hypothetical protein CICLE_v10032507mg             244   9e-74    
ref|XP_009384296.1|  PREDICTED: MADS-box transcription factor 8-like    243   9e-74    
gb|AFO68791.1|  agamous-like protein 234                                243   9e-74    
gb|AGH61294.1|  sepallata 3                                             243   1e-73    
gb|AFO68776.1|  agamous-like protein 2                                  242   1e-73    
sp|O04067.1|AGL9_SINAL  RecName: Full=Agamous-like MADS-box prote...    243   1e-73    
gb|AHM92085.1|  MADS-box protein 9                                      243   1e-73    
ref|XP_010460483.1|  PREDICTED: developmental protein SEPALLATA 3...    243   1e-73    
ref|XP_009102995.1|  PREDICTED: agamous-like MADS-box protein AGL...    243   1e-73    
gb|KHN15201.1|  MADS-box protein CMB1                                   243   2e-73    
ref|XP_010460482.1|  PREDICTED: developmental protein SEPALLATA 3...    243   2e-73    
ref|XP_006477711.1|  PREDICTED: developmental protein SEPALLATA 1...    243   2e-73    
ref|XP_006848294.1|  hypothetical protein AMTR_s00013p00103080          243   2e-73    
ref|XP_010478051.1|  PREDICTED: developmental protein SEPALLATA 3...    243   2e-73    
gb|ABD62860.1|  SEP3.2                                                  242   2e-73    
gb|ABD19719.1|  SEP3-like MADS-box protein                              243   2e-73    
ref|XP_010478049.1|  PREDICTED: developmental protein SEPALLATA 3...    243   2e-73    
gb|AHW52539.1|  SEPALLATA-like MADS-box protein 4                       243   2e-73    
dbj|BAM34479.1|  MADS-box transcription factor                          242   2e-73    
emb|CDY03905.1|  BnaC07g11300D                                          243   3e-73    
ref|XP_004974003.1|  PREDICTED: MADS-box transcription factor 7-like    242   3e-73    
gb|ABI60898.1|  MADS-box transcription factor                           242   3e-73    
ref|NP_001289804.1|  MADS-box transcription factor 8                    242   3e-73    
ref|XP_008786031.1|  PREDICTED: truncated transcription factor CA...    242   3e-73    
gb|AAQ83836.1|  MADS box protein                                        241   4e-73    
ref|XP_006437997.1|  hypothetical protein CICLE_v10032507mg             242   5e-73    
gb|AHH28303.1|  MADS-box transcription factor                           241   5e-73    
ref|XP_009102994.1|  PREDICTED: agamous-like MADS-box protein AGL...    242   5e-73    
emb|CDY15724.1|  BnaA07g08950D                                          241   6e-73    
ref|XP_010499197.1|  PREDICTED: developmental protein SEPALLATA 3...    241   6e-73    
ref|XP_010499195.1|  PREDICTED: developmental protein SEPALLATA 3...    241   8e-73    
dbj|BAJ11578.1|  transcription factor                                   241   9e-73    
ref|NP_001105153.1|  MADS6                                              241   1e-72    
gb|ABD17387.1|  MADS-box protein SEP3                                   241   1e-72    
gb|AEE60891.1|  MADS-box protein 5                                      241   1e-72    
dbj|BAB70747.1|  putative MADS-domain transcription factor MpMADS13     240   1e-72    
gb|ABD62861.1|  SEP3.1                                                  240   1e-72    
emb|CAE46179.1|  AGL2-like MADS box transcription factor                239   1e-72    
gb|AFU61112.1|  MADS-box transcription factor MADS-RIN                  240   1e-72    
gb|ABD17386.1|  MADS-box protein SEP3-1                                 243   2e-72    
ref|NP_001280849.1|  MADS-box protein CMB1-like                         240   2e-72    
gb|AAT37484.1|  MADS5 protein                                           240   2e-72    
ref|XP_010025293.1|  PREDICTED: agamous-like MADS-box protein AGL...    240   2e-72    
ref|XP_010460481.1|  PREDICTED: developmental protein SEPALLATA 3...    240   2e-72    
ref|NP_001234670.1|  MADS-box transcription factor                      240   2e-72    
gb|ADU56820.1|  MADS-box protein AGL2 subfamily                         239   2e-72    
ref|NP_001242365.1|  uncharacterized protein LOC100797819               240   2e-72    
ref|XP_010478050.1|  PREDICTED: developmental protein SEPALLATA 3...    240   3e-72    
ref|XP_010460480.1|  PREDICTED: developmental protein SEPALLATA 3...    240   3e-72    
gb|ADD10733.1|  MADS-domain transcription factor                        239   3e-72    
gb|AHH28302.1|  MADS-box transcription factor                           238   3e-72    
ref|XP_009773223.1|  PREDICTED: MADS-box protein CMB1-like isofor...    240   4e-72    
ref|XP_010478048.1|  PREDICTED: developmental protein SEPALLATA 3...    239   4e-72    
ref|NP_001289642.1|  developmental protein SEPALLATA 1-like             239   4e-72    
gb|ABJ98752.1|  MADS-box transcription factor MADS-RIN                  239   4e-72    
gb|ACG32829.1|  SRF-type transcription factor family protein            239   4e-72    
ref|XP_002445814.1|  hypothetical protein SORBIDRAFT_07g026200          239   5e-72    
gb|EEC84853.1|  hypothetical protein OsI_31966                          239   5e-72    
gb|AAT37486.1|  MADS7 protein                                           239   5e-72    
gb|ABF57929.1|  MADS-box transcription factor TaAGL28                   239   5e-72    
ref|NP_001242742.1|  uncharacterized protein LOC100805078               238   7e-72    
gb|AGT20513.1|  SEP3                                                    239   7e-72    
ref|XP_010530562.1|  PREDICTED: developmental protein SEPALLATA 3...    239   7e-72    
emb|CAB97355.1|  MADS-box protein 9                                     239   7e-72    
dbj|BAF75017.1|  MADS-box protein                                       239   7e-72    
dbj|BAF75016.1|  MADS-box protein                                       239   7e-72    
ref|NP_001063613.1|  Os09g0507200                                       239   8e-72    
emb|CDY27603.1|  BnaA09g28040D                                          239   8e-72    
ref|XP_004957289.1|  PREDICTED: MADS-box transcription factor 8-l...    238   9e-72    
gb|AHW52538.1|  SEPALLATA-like MADS-box protein 3                       238   9e-72    
ref|XP_003518786.1|  PREDICTED: developmental protein SEPALLATA 1...    238   9e-72    
gb|AAR01779.1|  MADS-box protein                                        238   9e-72    
dbj|BAF75018.1|  MADS-box protein                                       238   1e-71    
gb|AAT37483.1|  MADS4 protein                                           238   1e-71    
emb|CDX84935.1|  BnaC05g21200D                                          238   1e-71    
gb|AAT37485.1|  MADS6 protein                                           238   1e-71    
ref|XP_010530561.1|  PREDICTED: developmental protein SEPALLATA 3...    238   1e-71    
gb|AHM92068.1|  MADS-box protein 8                                      238   1e-71    
ref|XP_009625300.1|  PREDICTED: MADS-box protein CMB1-like              238   1e-71    
ref|XP_009113782.1|  PREDICTED: agamous-like MADS-box protein AGL...    238   1e-71    
ref|XP_009113783.1|  PREDICTED: agamous-like MADS-box protein AGL...    238   1e-71    
gb|ABF57918.1|  MADS-box transcription factor TaAGL16                   238   1e-71    
gb|ACF78403.1|  unknown                                                 238   2e-71    
ref|XP_010320555.1|  PREDICTED: MADS-box transcription factor iso...    237   2e-71    
gb|AAK21247.1|AF335234_1  MADS-box transcription factor FBP4            238   2e-71    
gb|AAT37482.1|  MADS3 protein                                           238   2e-71    
gb|AHW58033.1|  SEP4                                                    237   2e-71    
ref|XP_010531079.1|  PREDICTED: developmental protein SEPALLATA 3...    238   2e-71    
ref|XP_006477712.1|  PREDICTED: developmental protein SEPALLATA 1...    238   2e-71    
dbj|BAL05005.1|  putative MADS box protein                              237   2e-71    
gb|ACB69511.1|  SEPALLATA3-like MADS-box protein                        236   3e-71    
gb|AAF13262.1|AF198176_1  MADS box protein DOMADS3                      236   3e-71    
ref|XP_010531071.1|  PREDICTED: developmental protein SEPALLATA 3...    237   3e-71    
gb|AAO45877.1|  MADS5                                                   237   3e-71    
ref|XP_009372255.1|  PREDICTED: agamous-like MADS-box protein AGL...    237   5e-71    
gb|AAX15919.1|  AGL2                                                    236   5e-71    
gb|AHC54144.1|  sepallata-like MADS box transcription factor 3          234   5e-71    
gb|ABF67487.1|  MADS-domain transcription factor                        236   7e-71    
ref|XP_004957288.1|  PREDICTED: MADS-box transcription factor 8-l...    236   7e-71    
gb|ABF57932.1|  MADS-box transcription factor TaAGL30                   236   9e-71    
dbj|BAC79181.1|  MADS-box protein                                       235   9e-71    
emb|CAM59053.1|  MIKC-type MADS-box transcription factor WM10A          236   1e-70    
ref|XP_009773224.1|  PREDICTED: MADS-box protein CMB1-like isofor...    235   1e-70    
ref|XP_006484143.1|  PREDICTED: agamous-like MADS-box protein AGL...    236   1e-70    
ref|XP_008459849.1|  PREDICTED: agamous-like MADS-box protein AGL...    234   1e-70    
ref|NP_001288311.1|  MADS-box transcription factor 7-like               235   1e-70    
ref|XP_011018962.1|  PREDICTED: MADS-box protein CMB1-like              234   2e-70    
ref|XP_010090648.1|  Agamous-like MADS-box protein AGL9-like protein    235   2e-70    
gb|AFO68773.1|  agamous-like protein 2                                  233   2e-70    
ref|NP_001234837.1|  MADS-box transcription factor                      234   3e-70    
ref|NP_001105525.1|  MADS27                                             234   3e-70    
ref|XP_009386196.1|  PREDICTED: MADS-box transcription factor 1-l...    234   4e-70    
gb|AEQ75499.1|  MADS-domain transcription factor                        232   4e-70    
gb|AAQ11687.1|  MADS box protein                                        234   5e-70    
gb|ABV23569.2|  MADS-box protein                                        234   5e-70    
gb|AFO68789.1|  floral-binding protein 9                                233   5e-70    
ref|XP_010045613.1|  PREDICTED: MADS-box protein CMB1-like              234   6e-70    
tpg|DAA40489.1|  TPA: zea mays MADS7                                    236   6e-70    
gb|AGT21645.1|  PFRIN                                                   233   7e-70    
ref|XP_008340234.1|  PREDICTED: agamous-like MADS-box protein AGL...    234   9e-70    
gb|ACB69512.1|  SEPALLATA3-like MADS-box protein                        233   1e-69    
gb|ACB45304.1|  MIKC-type MADS-box transcription factor WM10A           233   1e-69    
dbj|BAD38890.1|  MADS box transcription factor                          233   2e-69    
dbj|BAD10945.1|  SEPALLATA3 homologous protein                          233   2e-69    
gb|AHH28273.1|  MADS-box transcription factor                           229   2e-69    
ref|XP_002460491.1|  hypothetical protein SORBIDRAFT_02g029310          232   2e-69    
ref|XP_003516451.1|  PREDICTED: developmental protein SEPALLATA 1...    232   2e-69    
gb|EMS49687.1|  MADS-box transcription factor 7                         232   2e-69    
ref|XP_006348663.1|  PREDICTED: MADS-box protein CMB1-like              237   2e-69    
ref|NP_001233976.1|  MADS-box transcription factor MADS-rin             237   2e-69    
emb|CAA04322.1|  MADS-box protein                                       231   3e-69    
ref|XP_006659622.1|  PREDICTED: MADS-box transcription factor 7-like    231   4e-69    
gb|KCW83762.1|  hypothetical protein EUGRSUZ_B00633                     232   5e-69    
ref|XP_008801851.1|  PREDICTED: agamous-like MADS-box protein AGL...    232   5e-69    



>gb|AAQ72498.1| MADS-box protein 12 [Petunia x hybrida]
Length=246

 Score =   371 bits (953),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 200/246 (81%), Positives = 223/246 (91%), Gaps = 0/246 (0%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             +NM K+LERYQKCSYGTLEVN+ +KDNEQ++Y+EYLKLK KYESLQRYQRHLLGEDLGPL
Sbjct  61    NNMFKSLERYQKCSYGTLEVNQSSKDNEQNNYREYLKLKAKYESLQRYQRHLLGEDLGPL  120

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             NID++E+LE QLDTSLKHIRSTRTQ++LDQLSDLQTKEKLW+EANK LE KLEE Y +N+
Sbjct  121   NIDDLENLEVQLDTSLKHIRSTRTQLMLDQLSDLQTKEKLWVEANKVLERKLEEIYAENS  180

Query  835   LQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvnav  1014
             LQQ WG GEQS  Y  QH  Q+ GFFQPLEC+STL IG+NP+ TS QITA TNAQNVN +
Sbjct  181   LQQSWGGGEQSVTYGHQHNAQSQGFFQPLECNSTLQIGYNPITTSRQITAVTNAQNVNGM  240

Query  1015  LPGWML  1032
             +PGWML
Sbjct  241   VPGWML  246



>ref|XP_009608616.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X2 
[Nicotiana tomentosiformis]
Length=245

 Score =   371 bits (952),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 203/246 (83%), Positives = 225/246 (91%), Gaps = 1/246 (0%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLC+AEVALIVFSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCEAEVALIVFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             +NMLKTL+RYQKCSYGTLEVNR  KDNEQ+SY+EYLKLK KYESLQRYQRHLLGEDLGPL
Sbjct  61    NNMLKTLDRYQKCSYGTLEVNRSIKDNEQNSYREYLKLKAKYESLQRYQRHLLGEDLGPL  120

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             NID+++HLE QLD SLKHIRSTRTQ++LDQL+DLQ+KEKLWLEANK LE KLEE Y +NN
Sbjct  121   NIDDLDHLEVQLDNSLKHIRSTRTQLMLDQLTDLQSKEKLWLEANKVLERKLEEIYAENN  180

Query  835   LQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvnav  1014
             LQQPWG GEQS  Y QQHA Q+ GFFQPL+C+S L IG++P+ TSSQITA TNAQNVN +
Sbjct  181   LQQPWGGGEQSITYGQQHA-QSQGFFQPLDCNSILQIGYDPITTSSQITAVTNAQNVNGM  239

Query  1015  LPGWML  1032
             +PGWML
Sbjct  240   VPGWML  245



>ref|NP_001234201.1| TAGL2 transcription factor [Solanum lycopersicum]
 gb|AAM33104.2| TAGL2 transcription factor [Solanum lycopersicum]
Length=246

 Score =   370 bits (949),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 203/246 (83%), Positives = 222/246 (90%), Gaps = 0/246 (0%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVAL+VFSNRGKLYEF ST
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALLVFSNRGKLYEFCST  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             SNMLKTL+RYQKCSYGTLEVNR  KDNEQSSY+EYLKLK KYESLQRYQRHLLG++LGPL
Sbjct  61    SNMLKTLDRYQKCSYGTLEVNRSIKDNEQSSYREYLKLKAKYESLQRYQRHLLGDELGPL  120

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
              ID++EHLE QLDTSLKHIRSTRTQM+LDQLSDLQTKEKLW EANK LE K+EE Y +NN
Sbjct  121   TIDDLEHLEVQLDTSLKHIRSTRTQMMLDQLSDLQTKEKLWNEANKVLERKMEEIYAENN  180

Query  835   LQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvnav  1014
             +QQ WG GEQS  Y QQ   Q+ GFFQPLEC+S+L IG++P+ TSSQITA TNAQNVN +
Sbjct  181   MQQAWGGGEQSLNYGQQQHPQSQGFFQPLECNSSLQIGYDPITTSSQITAVTNAQNVNGM  240

Query  1015  LPGWML  1032
             +PGWML
Sbjct  241   IPGWML  246



>ref|XP_009757151.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X1 
[Nicotiana sylvestris]
Length=245

 Score =   369 bits (946),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 205/247 (83%), Positives = 227/247 (92%), Gaps = 3/247 (1%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLC+AEVALI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCEAEVALIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRP-NKDNEQssykeylklkgkyeslQRYQRHLLGEDLGP  651
             +NMLKTL+RYQKCSYGTLEVNR   KDNEQSS +EYLKLK KYESLQRYQRHLLGEDLGP
Sbjct  61    NNMLKTLDRYQKCSYGTLEVNRSIIKDNEQSSCREYLKLKAKYESLQRYQRHLLGEDLGP  120

Query  652   LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDN  831
             LNID+++HLE QLDTSLKHIRSTRTQ++LDQL+DLQ+KEKLWLEANK LE KLEE Y +N
Sbjct  121   LNIDDLDHLEVQLDTSLKHIRSTRTQLMLDQLTDLQSKEKLWLEANKLLERKLEEIYTEN  180

Query  832   NLQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvna  1011
             NLQQPWG GEQS  YSQQHA Q+ GFFQPL+C+STL IG++P+ TSSQITA TNAQNVN 
Sbjct  181   NLQQPWG-GEQSVTYSQQHA-QSQGFFQPLDCNSTLQIGYDPITTSSQITAVTNAQNVNG  238

Query  1012  vLPGWML  1032
             ++PGWML
Sbjct  239   MVPGWML  245



>ref|XP_006338336.1| PREDICTED: developmental protein SEPALLATA 1-like [Solanum tuberosum]
Length=246

 Score =   368 bits (945),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 203/246 (83%), Positives = 222/246 (90%), Gaps = 0/246 (0%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVAL+VFSNRGKLYEF ST
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALLVFSNRGKLYEFCST  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             +NMLKTL+RYQKCSYGTLEVNR  KDNEQSSY+EYLKLK KYESLQRYQRHLLG++LGPL
Sbjct  61    NNMLKTLDRYQKCSYGTLEVNRSIKDNEQSSYREYLKLKAKYESLQRYQRHLLGDELGPL  120

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
              ID++EHLE QLDTSLKHIRSTRTQM+LDQLSDLQTKEKLW EANK LE K+EE Y +NN
Sbjct  121   TIDDLEHLEVQLDTSLKHIRSTRTQMMLDQLSDLQTKEKLWNEANKVLERKMEEIYAENN  180

Query  835   LQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvnav  1014
             LQQ WG GEQS  Y QQ   Q+ GFFQPLEC+S+L IG++P+ TSSQITA TNAQNVN +
Sbjct  181   LQQTWGGGEQSLNYGQQQHPQSQGFFQPLECNSSLQIGYDPITTSSQITAVTNAQNVNGM  240

Query  1015  LPGWML  1032
             +PGWML
Sbjct  241   IPGWML  246



>ref|NP_001233911.1| MADS-box protein [Solanum lycopersicum]
 emb|CAC83066.1| MADS-box protein [Solanum lycopersicum]
Length=246

 Score =   368 bits (944),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 202/246 (82%), Positives = 222/246 (90%), Gaps = 0/246 (0%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVAL+VFSNRGKLYEF ST
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALLVFSNRGKLYEFCST  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             +NMLKTL+RYQKCSYGTLEVNR  KDNEQSSY+EYLKLK KYESLQRYQRHLLG++LGPL
Sbjct  61    NNMLKTLDRYQKCSYGTLEVNRSIKDNEQSSYREYLKLKAKYESLQRYQRHLLGDELGPL  120

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
              ID++EHLE QLDTSLKHIRSTRTQM+LDQLSDLQTKEKLW EANK LE K+EE Y +NN
Sbjct  121   TIDDLEHLEVQLDTSLKHIRSTRTQMMLDQLSDLQTKEKLWNEANKVLERKMEEIYAENN  180

Query  835   LQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvnav  1014
             +QQ WG GEQS  Y QQ   Q+ GFFQPLEC+S+L IG++P+ TSSQITA TNAQNVN +
Sbjct  181   MQQAWGGGEQSLNYGQQQHPQSQGFFQPLECNSSLQIGYDPITTSSQITAVTNAQNVNGM  240

Query  1015  LPGWML  1032
             +PGWML
Sbjct  241   IPGWML  246



>ref|XP_009608615.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X1 
[Nicotiana tomentosiformis]
Length=246

 Score =   367 bits (941),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 203/247 (82%), Positives = 225/247 (91%), Gaps = 2/247 (1%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLC+AEVALIVFSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCEAEVALIVFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             +NMLKTL+RYQKCSYGTLEVNR  KDNEQ+SY+EYLKLK KYESLQRYQRHLLGEDLGPL
Sbjct  61    NNMLKTLDRYQKCSYGTLEVNRSIKDNEQNSYREYLKLKAKYESLQRYQRHLLGEDLGPL  120

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             NID+++HLE QLD SLKHIRSTRTQ++LDQL+DLQ+KEKLWLEANK LE KLEE Y +NN
Sbjct  121   NIDDLDHLEVQLDNSLKHIRSTRTQLMLDQLTDLQSKEKLWLEANKVLERKLEEIYAENN  180

Query  835   LQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIG-FNPVATSSQItaatnaqnvna  1011
             LQQPWG GEQS  Y QQHA Q+ GFFQPL+C+S L IG ++P+ TSSQITA TNAQNVN 
Sbjct  181   LQQPWGGGEQSITYGQQHA-QSQGFFQPLDCNSILQIGRYDPITTSSQITAVTNAQNVNG  239

Query  1012  vLPGWML  1032
             ++PGWML
Sbjct  240   MVPGWML  246



>ref|XP_010315869.1| PREDICTED: MADS-box protein isoform X1 [Solanum lycopersicum]
Length=247

 Score =   363 bits (933),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 202/247 (82%), Positives = 222/247 (90%), Gaps = 1/247 (0%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVAL+VFSNRGKLYEF ST
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALLVFSNRGKLYEFCST  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             +NMLKTL+RYQKCSYGTLEVNR  KDNEQSSY+EYLKLK KYESLQRYQRHLLG++LGPL
Sbjct  61    NNMLKTLDRYQKCSYGTLEVNRSIKDNEQSSYREYLKLKAKYESLQRYQRHLLGDELGPL  120

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESK-LEEFYVDN  831
              ID++EHLE QLDTSLKHIRSTRTQM+LDQLSDLQTKEKLW EANK LE K +EE Y +N
Sbjct  121   TIDDLEHLEVQLDTSLKHIRSTRTQMMLDQLSDLQTKEKLWNEANKVLERKQMEEIYAEN  180

Query  832   NLQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvna  1011
             N+QQ WG GEQS  Y QQ   Q+ GFFQPLEC+S+L IG++P+ TSSQITA TNAQNVN 
Sbjct  181   NMQQAWGGGEQSLNYGQQQHPQSQGFFQPLECNSSLQIGYDPITTSSQITAVTNAQNVNG  240

Query  1012  vLPGWML  1032
             ++PGWML
Sbjct  241   MIPGWML  247



>ref|XP_009757345.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X1 
[Nicotiana sylvestris]
Length=245

 Score =   361 bits (927),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 199/247 (81%), Positives = 222/247 (90%), Gaps = 3/247 (1%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELK+IENKINRQVTFAKRRNGLLKKAYELSVLC+AEVALI+FS RGKLYEFSST
Sbjct  1     MGRGRVELKKIENKINRQVTFAKRRNGLLKKAYELSVLCEAEVALIIFSTRGKLYEFSST  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKD-NEQssykeylklkgkyeslQRYQRHLLGEDLGP  651
             SN LKTLERYQKCSYGTLEV +  +D NE+  Y+EYLKLK KYESLQRYQRHLLG++LGP
Sbjct  61    SNTLKTLERYQKCSYGTLEVKQSGRDSNEEKFYREYLKLKAKYESLQRYQRHLLGDELGP  120

Query  652   LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDN  831
             LNIDE+EHLE QLDTSLKHI+STRTQ++LDQLSDLQTKEKLW+EANK LE KLEE Y +N
Sbjct  121   LNIDELEHLELQLDTSLKHIKSTRTQLMLDQLSDLQTKEKLWIEANKGLERKLEEIYAEN  180

Query  832   NLQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvna  1011
             NLQQ WG GEQSGAYSQQH  QT GFFQPLEC+STL IG++P A+SSQIT  T+ QN+N 
Sbjct  181   NLQQSWGGGEQSGAYSQQHP-QTQGFFQPLECNSTLQIGYDP-ASSSQITGVTSGQNING  238

Query  1012  vLPGWML  1032
             ++PGWML
Sbjct  239   IVPGWML  245



>ref|XP_009589584.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X1 
[Nicotiana tomentosiformis]
Length=245

 Score =   361 bits (926),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 199/247 (81%), Positives = 223/247 (90%), Gaps = 3/247 (1%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELK+IENKINRQVTFAKRRNGLLKKAYELSVLC+AEVALI+FS RGKLYEFSST
Sbjct  1     MGRGRVELKKIENKINRQVTFAKRRNGLLKKAYELSVLCEAEVALIIFSTRGKLYEFSST  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKD-NEQssykeylklkgkyeslQRYQRHLLGEDLGP  651
             SN LKTLERYQKCSYGTLEV +  +D NE+  Y+EYLKLK KYESLQRYQRHLLG++LGP
Sbjct  61    SNTLKTLERYQKCSYGTLEVKQSGRDSNEEKFYREYLKLKAKYESLQRYQRHLLGDELGP  120

Query  652   LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDN  831
             LNIDE+EHLE QLDTSLKHI+STRTQ++LDQL+DLQTKEKLW+EANK LE KLEE Y +N
Sbjct  121   LNIDELEHLELQLDTSLKHIKSTRTQLMLDQLTDLQTKEKLWIEANKGLERKLEEIYAEN  180

Query  832   NLQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvna  1011
             NLQQ WG GEQSGAYSQQH  QT GFFQPLEC+STL IG++P A+SSQITA T+ QN+N 
Sbjct  181   NLQQSWGGGEQSGAYSQQHP-QTQGFFQPLECNSTLQIGYDP-ASSSQITAVTSGQNING  238

Query  1012  vLPGWML  1032
             ++PGWML
Sbjct  239   IVPGWML  245



>ref|XP_009757152.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X2 
[Nicotiana sylvestris]
Length=240

 Score =   358 bits (918),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 202/247 (82%), Positives = 224/247 (91%), Gaps = 8/247 (3%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLC+AEVALI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCEAEVALIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRP-NKDNEQssykeylklkgkyeslQRYQRHLLGEDLGP  651
             +NMLKTL+RYQKCSYGTLEVNR   KDNEQSS +EYLKLK KYESLQRYQRHLLGEDLGP
Sbjct  61    NNMLKTLDRYQKCSYGTLEVNRSIIKDNEQSSCREYLKLKAKYESLQRYQRHLLGEDLGP  120

Query  652   LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDN  831
             LNID+++HLE QLDTSLKHIRSTRTQ++LDQL+DLQ+KEKLWLEAN     KLEE Y +N
Sbjct  121   LNIDDLDHLEVQLDTSLKHIRSTRTQLMLDQLTDLQSKEKLWLEAN-----KLEEIYTEN  175

Query  832   NLQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvna  1011
             NLQQPWG GEQS  YSQQHA Q+ GFFQPL+C+STL IG++P+ TSSQITA TNAQNVN 
Sbjct  176   NLQQPWG-GEQSVTYSQQHA-QSQGFFQPLDCNSTLQIGYDPITTSSQITAVTNAQNVNG  233

Query  1012  vLPGWML  1032
             ++PGWML
Sbjct  234   MVPGWML  240



>gb|AAK21248.1|AF335235_1 MADS-box transcription factor FBP5 [Petunia x hybrida]
Length=246

 Score =   357 bits (917),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 200/248 (81%), Positives = 224/248 (90%), Gaps = 4/248 (2%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELK+IENKINRQVTFAKRRNGLLKKAYELSVLC+AEVALI+FSNRGKLYEFSST
Sbjct  1     MGRGRVELKKIENKINRQVTFAKRRNGLLKKAYELSVLCEAEVALIIFSNRGKLYEFSST  60

Query  475   SNMLKTLERYQKCSYGTLEVN-RPNKD-NEQssykeylklkgkyeslQRYQRHLLGEDLG  648
             SNM+KTL+RYQKCSYGTLEVN R  KD NE+  Y+EYLKLK KYESLQRYQR LLG++LG
Sbjct  61    SNMVKTLDRYQKCSYGTLEVNHRSVKDNNEERIYREYLKLKAKYESLQRYQRQLLGDELG  120

Query  649   PLNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVD  828
             PLNIDE+EHLE QLD+SLK I+STRTQ++LDQLSDLQTKEKLW+EANK LE KLE+ Y +
Sbjct  121   PLNIDELEHLELQLDSSLKLIKSTRTQLMLDQLSDLQTKEKLWVEANKVLERKLEQIYAE  180

Query  829   NNLQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvn  1008
             NN+QQ WG GEQSGAY QQHA QT GFFQPLEC+STL IG++P ATSSQITA T+ QNVN
Sbjct  181   NNIQQSWGGGEQSGAYGQQHA-QTQGFFQPLECNSTLQIGYDP-ATSSQITAVTSGQNVN  238

Query  1009  avLPGWML  1032
              ++PGWML
Sbjct  239   GIIPGWML  246



>ref|XP_009608617.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X3 
[Nicotiana tomentosiformis]
Length=241

 Score =   356 bits (913),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 200/247 (81%), Positives = 222/247 (90%), Gaps = 7/247 (3%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLC+AEVALIVFSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCEAEVALIVFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             +NMLKTL+RYQKCSYGTLEVNR  KDNEQ+SY+EYLKLK KYESLQRYQRHLLGEDLGPL
Sbjct  61    NNMLKTLDRYQKCSYGTLEVNRSIKDNEQNSYREYLKLKAKYESLQRYQRHLLGEDLGPL  120

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             NID+++HLE QLD SLKHIRSTRTQ++LDQL+DLQ+KEKLWLEAN     KLEE Y +NN
Sbjct  121   NIDDLDHLEVQLDNSLKHIRSTRTQLMLDQLTDLQSKEKLWLEAN-----KLEEIYAENN  175

Query  835   LQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIG-FNPVATSSQItaatnaqnvna  1011
             LQQPWG GEQS  Y QQHA Q+ GFFQPL+C+S L IG ++P+ TSSQITA TNAQNVN 
Sbjct  176   LQQPWGGGEQSITYGQQHA-QSQGFFQPLDCNSILQIGRYDPITTSSQITAVTNAQNVNG  234

Query  1012  vLPGWML  1032
             ++PGWML
Sbjct  235   MVPGWML  241



>emb|CDP02339.1| unnamed protein product [Coffea canephora]
Length=245

 Score =   347 bits (890),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 197/247 (80%), Positives = 222/247 (90%), Gaps = 3/247 (1%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             SNML+TLERYQ+CSYG +EV+   K+ EQSSYKEYLKLKGKYESLQRYQRHLLG+DLGPL
Sbjct  61    SNMLRTLERYQRCSYGAVEVSHSAKEIEQSSYKEYLKLKGKYESLQRYQRHLLGDDLGPL  120

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             NI+++EHLEHQL++SLK +RSTRTQ++LDQLSDLQTKEKLWLEANK LE KLEE Y +N+
Sbjct  121   NINDLEHLEHQLESSLKLVRSTRTQVMLDQLSDLQTKEKLWLEANKALERKLEEIYAENH  180

Query  835   LQQPW-GPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvna  1011
             L Q W G GEQS  YSQQH+ Q+ GFFQPLEC S L IG+NP A+SSQITA TNAQNV+ 
Sbjct  181   LHQSWGGGGEQSSTYSQQHS-QSQGFFQPLECSSGLQIGYNP-ASSSQITAVTNAQNVSG  238

Query  1012  vLPGWML  1032
             ++PGWML
Sbjct  239   LVPGWML  245



>ref|XP_011099041.1| PREDICTED: developmental protein SEPALLATA 1 isoform X2 [Sesamum 
indicum]
Length=246

 Score =   345 bits (884),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 193/247 (78%), Positives = 217/247 (88%), Gaps = 2/247 (1%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             SNMLKTLERYQKCSYG+LEVN P KD EQSSY+EYLKLK KYESLQRYQR LLG+DLGPL
Sbjct  61    SNMLKTLERYQKCSYGSLEVNHPGKDIEQSSYREYLKLKAKYESLQRYQRQLLGDDLGPL  120

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             NI+++EH+EHQL+TSLKHIRSTRTQ++LDQL+DLQTKEKL L+ANK LE KLEE Y  N 
Sbjct  121   NINDLEHIEHQLETSLKHIRSTRTQVMLDQLADLQTKEKLMLDANKALERKLEEIYAANQ  180

Query  835   LQQPW-GPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvna  1011
             LQQ W G GEQS  Y+  H   + GFFQPL+C+STL IG+N   +SSQ+TAAT+ QNVN 
Sbjct  181   LQQSWVGGGEQSSTYTHHHP-HSQGFFQPLDCNSTLQIGYNDPVSSSQMTAATDVQNVNG  239

Query  1012  vLPGWML  1032
             ++PGWML
Sbjct  240   LIPGWML  246



>ref|XP_011099040.1| PREDICTED: developmental protein SEPALLATA 1 isoform X1 [Sesamum 
indicum]
Length=247

 Score =   340 bits (873),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 180/248 (73%), Positives = 203/248 (82%), Gaps = 3/248 (1%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyesl-QRYQRHLLGEDLGP  651
             SNMLKTLERYQKCSYG+LEVN P KD EQ S               QRYQR LLG+DLGP
Sbjct  61    SNMLKTLERYQKCSYGSLEVNHPGKDIEQQSSYREYLKLKAKYESLQRYQRQLLGDDLGP  120

Query  652   LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDN  831
             LNI+++EH+EHQL+TSLKHIRSTRTQ++LDQL+DLQTKEKL L+ANK LE KLEE Y  N
Sbjct  121   LNINDLEHIEHQLETSLKHIRSTRTQVMLDQLADLQTKEKLMLDANKALERKLEEIYAAN  180

Query  832   NLQQPW-GPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvn  1008
              LQQ W G GEQS  Y+  H   + GFFQPL+C+STL IG+N   +SSQ+TAAT+ QNVN
Sbjct  181   QLQQSWVGGGEQSSTYTHHHP-HSQGFFQPLDCNSTLQIGYNDPVSSSQMTAATDVQNVN  239

Query  1009  avLPGWML  1032
              ++PGWML
Sbjct  240   GLIPGWML  247



>emb|CAA64741.1| DEFH49 [Antirrhinum majus]
Length=247

 Score =   336 bits (861),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 188/247 (76%), Positives = 214/247 (87%), Gaps = 1/247 (0%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             SNMLKT+ERYQK SYG+LEVN   KD E SSYKEYLKLK KYESLQ YQRHLLG+DLGPL
Sbjct  61    SNMLKTIERYQKSSYGSLEVNHQAKDIEASSYKEYLKLKSKYESLQGYQRHLLGDDLGPL  120

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             N++++EHLEHQL+TSLKHIRSTRTQ++LDQLSDLQTKEK+ ++ANK LE KLEE Y  N+
Sbjct  121   NMNDLEHLEHQLETSLKHIRSTRTQVMLDQLSDLQTKEKMMVDANKALERKLEEIYAANH  180

Query  835   LQQPW-GPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvna  1011
             LQQ W G G+ S AY+     Q+ GFFQPLEC+STL IGFN    SSQ+TA T+AQN++ 
Sbjct  181   LQQSWGGGGDHSNAYNDHQHAQSQGFFQPLECNSTLQIGFNDPVASSQMTAPTDAQNMHG  240

Query  1012  vLPGWML  1032
             ++PGWML
Sbjct  241   LVPGWML  247



>emb|CAL36576.1| deficiens H49 homologue [Misopates orontium]
Length=247

 Score =   335 bits (859),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 187/247 (76%), Positives = 214/247 (87%), Gaps = 1/247 (0%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             SNMLKT+ERYQK SYG+LEVN   KD E SSYKEYLKLK KYESLQ YQRHLLG+DLGPL
Sbjct  61    SNMLKTIERYQKSSYGSLEVNHQAKDIEASSYKEYLKLKSKYESLQGYQRHLLGDDLGPL  120

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             N++++EHLEHQL+TSLKHIRSTRTQ++LDQLSDLQTKEK+ ++ANK LE KLEE Y  N+
Sbjct  121   NMNDLEHLEHQLETSLKHIRSTRTQVMLDQLSDLQTKEKMMVDANKALERKLEEIYAANH  180

Query  835   LQQPW-GPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvna  1011
             +QQ W G G+ S AY+     Q+ GFFQPLEC+STL IGFN    SSQ+TA T+AQN++ 
Sbjct  181   IQQSWGGGGDHSNAYNDHQHAQSQGFFQPLECNSTLQIGFNDPVASSQMTAPTDAQNMHG  240

Query  1012  vLPGWML  1032
             ++PGWML
Sbjct  241   LVPGWML  247



>dbj|BAK09619.1| MADS-box transcription factor [Cyclamen persicum]
Length=245

 Score =   332 bits (850),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 178/246 (72%), Positives = 204/246 (83%), Gaps = 1/246 (0%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRI+NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEFSST
Sbjct  1     MGRGRVELKRIDNKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFSST  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             +NMLKTLERYQKCSYGT+E N   ++ EQ SY+EY+KLKGK+E LQRYQR LLGEDLGPL
Sbjct  61    NNMLKTLERYQKCSYGTMECNNAGREMEQISYREYMKLKGKHEELQRYQRQLLGEDLGPL  120

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             N+ E+EHLEHQLD+SLK IRST+TQ +LDQL DLQ KEK+W+E+NK LE KL E Y DN+
Sbjct  121   NMKELEHLEHQLDSSLKLIRSTKTQAMLDQLYDLQAKEKMWIESNKALEGKLSEIYRDNH  180

Query  835   LQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvnav  1014
             +Q  WG GEQ  +Y  QHA Q+ GFFQP  CDSTL IG+NP  ++    A    QN N +
Sbjct  181   VQSSWGGGEQCSSYPHQHA-QSQGFFQPFHCDSTLQIGYNPDVSNPIRAAPQQDQNGNGL  239

Query  1015  LPGWML  1032
             +PGWML
Sbjct  240   IPGWML  245



>ref|XP_009589591.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X2 
[Nicotiana tomentosiformis]
Length=231

 Score =   330 bits (847),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 188/247 (76%), Positives = 211/247 (85%), Gaps = 17/247 (7%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELK+IENKINRQVTFAKRRNGLLKKAYELSVLC+AEVALI+FS RGKLYEFSST
Sbjct  1     MGRGRVELKKIENKINRQVTFAKRRNGLLKKAYELSVLCEAEVALIIFSTRGKLYEFSST  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKD-NEQssykeylklkgkyeslQRYQRHLLGEDLGP  651
             SN LKTLERYQKCSYGTLEV +  +D NE+  Y+EYLKLK KYESLQRYQRHLLG++LGP
Sbjct  61    SNTLKTLERYQKCSYGTLEVKQSGRDSNEEKFYREYLKLKAKYESLQRYQRHLLGDELGP  120

Query  652   LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDN  831
             LNIDE+EHLE QLDTSLKHI+STRTQ++LDQL+DLQT              KLEE Y +N
Sbjct  121   LNIDELEHLELQLDTSLKHIKSTRTQLMLDQLTDLQT--------------KLEEIYAEN  166

Query  832   NLQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvna  1011
             NLQQ WG GEQSGAYSQQH  QT GFFQPLEC+STL IG++P A+SSQITA T+ QN+N 
Sbjct  167   NLQQSWGGGEQSGAYSQQHP-QTQGFFQPLECNSTLQIGYDP-ASSSQITAVTSGQNING  224

Query  1012  vLPGWML  1032
             ++PGWML
Sbjct  225   IVPGWML  231



>ref|XP_009589597.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X3 
[Nicotiana tomentosiformis]
Length=231

 Score =   328 bits (842),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 188/247 (76%), Positives = 209/247 (85%), Gaps = 17/247 (7%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELK+IENKINRQVTFAKRRNGLLKKAYELSVLC+AEVALI+FS RGKLYEFSST
Sbjct  1     MGRGRVELKKIENKINRQVTFAKRRNGLLKKAYELSVLCEAEVALIIFSTRGKLYEFSST  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKD-NEQssykeylklkgkyeslQRYQRHLLGEDLGP  651
             SN LKTLERYQKCSYGTLEV +  +D NE+  Y+EYLKLK KYESLQRYQRHLLG++LGP
Sbjct  61    SNTLKTLERYQKCSYGTLEVKQSGRDSNEEKFYREYLKLKAKYESLQRYQRHLLGDELGP  120

Query  652   LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDN  831
             LNIDE+EHLE QLDTSLKHI+STR              EKLW+EANK LE KLEE Y +N
Sbjct  121   LNIDELEHLELQLDTSLKHIKSTR--------------EKLWIEANKGLERKLEEIYAEN  166

Query  832   NLQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvna  1011
             NLQQ WG GEQSGAYSQQH  QT GFFQPLEC+STL IG++P A+SSQITA T+ QN+N 
Sbjct  167   NLQQSWGGGEQSGAYSQQHP-QTQGFFQPLECNSTLQIGYDP-ASSSQITAVTSGQNING  224

Query  1012  vLPGWML  1032
             ++PGWML
Sbjct  225   IVPGWML  231



>gb|AHW58036.1| SEP1/2 [Coffea arabica]
Length=247

 Score =   329 bits (843),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 189/248 (76%), Positives = 216/248 (87%), Gaps = 3/248 (1%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             SNML+TLERYQ+CSYG +EV+   K+ EQSSYKEYLKLKGKYESLQRYQRHLLG+DLGPL
Sbjct  61    SNMLRTLERYQRCSYGAVEVSHSAKEIEQSSYKEYLKLKGKYESLQRYQRHLLGDDLGPL  120

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEF-YVDN  831
             NI+++EHLEHQL++SLK +RSTRT+++LDQLSDLQTKEKLWLEANK LE KL  + Y +N
Sbjct  121   NINDLEHLEHQLESSLKLVRSTRTKVMLDQLSDLQTKEKLWLEANKALERKLGRYIYAEN  180

Query  832   NLQQPWGP-GEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvn  1008
             +    WG  GEQS  YSQQH+  + GFFQPL C S L IG+NP A+SS ITA TNAQNV+
Sbjct  181   SPSSSWGDGGEQSITYSQQHSQYSQGFFQPLGCSSGLQIGYNP-ASSSHITAVTNAQNVS  239

Query  1009  avLPGWML  1032
              ++PGWML
Sbjct  240   GLVPGWML  247



>ref|XP_009757346.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X2 
[Nicotiana sylvestris]
Length=231

 Score =   328 bits (840),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 187/247 (76%), Positives = 208/247 (84%), Gaps = 17/247 (7%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELK+IENKINRQVTFAKRRNGLLKKAYELSVLC+AEVALI+FS RGKLYEFSST
Sbjct  1     MGRGRVELKKIENKINRQVTFAKRRNGLLKKAYELSVLCEAEVALIIFSTRGKLYEFSST  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKD-NEQssykeylklkgkyeslQRYQRHLLGEDLGP  651
             SN LKTLERYQKCSYGTLEV +  +D NE+  Y+EYLKLK KYESLQRYQRHLLG++LGP
Sbjct  61    SNTLKTLERYQKCSYGTLEVKQSGRDSNEEKFYREYLKLKAKYESLQRYQRHLLGDELGP  120

Query  652   LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDN  831
             LNIDE+EHLE QLDTSLKHI+STR              EKLW+EANK LE KLEE Y +N
Sbjct  121   LNIDELEHLELQLDTSLKHIKSTR--------------EKLWIEANKGLERKLEEIYAEN  166

Query  832   NLQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvna  1011
             NLQQ WG GEQSGAYSQQH  QT GFFQPLEC+STL IG++P A+SSQIT  T+ QN+N 
Sbjct  167   NLQQSWGGGEQSGAYSQQHP-QTQGFFQPLECNSTLQIGYDP-ASSSQITGVTSGQNING  224

Query  1012  vLPGWML  1032
             ++PGWML
Sbjct  225   IVPGWML  231



>dbj|BAO74162.1| MADS-box transcription factor SEP1.2 [Torenia fournieri]
Length=252

 Score =   319 bits (818),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 184/252 (73%), Positives = 214/252 (85%), Gaps = 6/252 (2%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             SNM+KTLERYQKCSYG++EVN P+KD EQSSY+EYLKLK KYESLQRYQR LLG++LG L
Sbjct  61    SNMMKTLERYQKCSYGSVEVNNPSKDIEQSSYREYLKLKSKYESLQRYQRQLLGDELGNL  120

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYV--D  828
             NI++IEHLEHQLDTSLK IRSTRTQ++LDQLSDLQ KEK+ ++ANK LE KL+E Y   +
Sbjct  121   NINDIEHLEHQLDTSLKLIRSTRTQVMLDQLSDLQAKEKMMMDANKALEGKLQEIYATTN  180

Query  829   NNLQQPWGPGEQ----SGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatna  996
             +N+QQ W  GEQ    S  + QQ    + GFFQPL+C+STL IG+N   +S QITAA++ 
Sbjct  181   HNIQQYWIAGEQHHNNSYGHHQQQHAHSQGFFQPLDCNSTLQIGYNDPVSSGQITAASDV  240

Query  997   qnvnavLPGWML  1032
              NVN ++PGWML
Sbjct  241   NNVNGLVPGWML  252



>ref|NP_001268109.1| MADS-box protein 2 [Vitis vinifera]
 gb|AAM21342.1|AF373601_1 MADS-box protein 2 [Vitis vinifera]
Length=244

 Score =   315 bits (808),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 179/246 (73%), Positives = 208/246 (85%), Gaps = 2/246 (1%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FS RGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             S+MLKTLERYQKCSYG +EV+RP+K+ EQSSY+EYLKLK K+E+LQR QR+LLGEDLGPL
Sbjct  61    SSMLKTLERYQKCSYGAVEVSRPSKELEQSSYREYLKLKSKFEALQRTQRNLLGEDLGPL  120

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             N  E+E LE QL+TSLK +RST+TQ +LDQLSDLQ KE++ +E+NK L  KL+E  V N+
Sbjct  121   NTKELEQLERQLETSLKQVRSTKTQFMLDQLSDLQNKEQVLVESNKALTRKLDEISVKNH  180

Query  835   LQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvnav  1014
             LQ  W  GEQS  Y  Q A Q+ GFFQPLEC+ TL IG+NP A SSQ++A +NAQNVN  
Sbjct  181   LQLSWESGEQSMPYGHQQA-QSQGFFQPLECNPTLQIGYNP-AGSSQLSAPSNAQNVNGF  238

Query  1015  LPGWML  1032
             +PGWML
Sbjct  239   IPGWML  244



>gb|KDP24297.1| hypothetical protein JCGZ_25593 [Jatropha curcas]
Length=243

 Score =   309 bits (791),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 179/246 (73%), Positives = 205/246 (83%), Gaps = 3/246 (1%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEFSS 
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFSSI  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             SNMLKTLERYQKCSYG +EVN+P K+ E SSY+EYLKLKG++ESLQR QR+LLGEDLGPL
Sbjct  61    SNMLKTLERYQKCSYGAVEVNKPAKELE-SSYREYLKLKGRFESLQRTQRNLLGEDLGPL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             N  E+E LE QL++SLK +RSTRTQ +LDQLSDLQ KE+L LEAN+ L  KL+E    N+
Sbjct  120   NTKELEQLERQLESSLKQVRSTRTQYMLDQLSDLQNKEQLLLEANRALTIKLDEISARNS  179

Query  835   LQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvnav  1014
             L+  W  GEQS +Y QQH  Q+   FQPLEC+ TL IG+NPV  S Q+TA T+AQ V+  
Sbjct  180   LRSSWEGGEQSMSYGQQHP-QSQELFQPLECNPTLQIGYNPVG-SDQMTATTHAQQVSGF  237

Query  1015  LPGWML  1032
             +PGWML
Sbjct  238   IPGWML  243



>ref|XP_010660492.1| PREDICTED: MADS-box protein 2 isoform X1 [Vitis vinifera]
 emb|CBI16936.3| unnamed protein product [Vitis vinifera]
Length=243

 Score =   309 bits (791),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 179/246 (73%), Positives = 207/246 (84%), Gaps = 3/246 (1%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FS RGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             S+MLKTLERYQKCSYG +EV+RP+K+ E SSY+EYLKLK K+ESLQR QR+LLGEDLGPL
Sbjct  61    SSMLKTLERYQKCSYGAVEVSRPSKELE-SSYREYLKLKSKFESLQRTQRNLLGEDLGPL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             N  E+E LE QL+TSLK +RST+TQ +LDQLSDLQ KE++ +E+NK L  KL+E  V N+
Sbjct  120   NTKELEQLERQLETSLKQVRSTKTQFMLDQLSDLQNKEQVLVESNKALTRKLDEISVKNH  179

Query  835   LQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvnav  1014
             LQ  W  GEQS  Y  Q A Q+ GFFQPLEC+ TL IG+NP A SSQ++A +NAQNVN  
Sbjct  180   LQLSWESGEQSMPYGHQQA-QSQGFFQPLECNPTLQIGYNP-AGSSQLSAPSNAQNVNGF  237

Query  1015  LPGWML  1032
             +PGWML
Sbjct  238   IPGWML  243



>ref|XP_006602962.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X2 
[Glycine max]
 gb|KHN37943.1| Developmental protein SEPALLATA 2 [Glycine soja]
Length=255

 Score =   308 bits (789),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 177/256 (69%), Positives = 207/256 (81%), Gaps = 11/256 (4%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             S+MLKTLERYQKCSYG +EV++P K+ EQSSY+EYLKLK ++ESLQR QR+LLGEDLGPL
Sbjct  61    SSMLKTLERYQKCSYGAVEVSKPAKELEQSSYREYLKLKARFESLQRTQRNLLGEDLGPL  120

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             NI E+EHLE QLD+SLK +RST+TQ +LDQLSDLQTKE++ +EAN++L  KLEE    N+
Sbjct  121   NIKELEHLERQLDSSLKQVRSTKTQFMLDQLSDLQTKEQMLVEANRSLTVKLEEINSRNH  180

Query  835   LQQPWGPGEQSGAYSQQHADQTH------GFFQPLECDSTLHIG----FNPVATSSQIta  984
              +Q W  G+QS  Y     + +H      GFFQPLEC+ TLHIG    +N VA S QITA
Sbjct  181   YRQSWEAGDQSMPYGGGGPENSHSHSHSQGFFQPLECNPTLHIGPDYRYNAVA-SDQITA  239

Query  985   atnaqnvnavLPGWML  1032
              T  Q V+  +PGWML
Sbjct  240   TTQPQQVSGFIPGWML  255



>ref|XP_007032865.1| K-box region and MADS-box transcription factor family protein 
[Theobroma cacao]
 gb|EOY03791.1| K-box region and MADS-box transcription factor family protein 
[Theobroma cacao]
Length=243

 Score =   305 bits (782),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 174/246 (71%), Positives = 202/246 (82%), Gaps = 3/246 (1%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             ++MLKTLERYQKCSYG +EV++P K+ E SSY+EYLKLK +YE+LQR QR+LLGEDLGPL
Sbjct  61    ASMLKTLERYQKCSYGAVEVSKPAKELE-SSYREYLKLKARYEALQRTQRNLLGEDLGPL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             N  E+E LE QL+TSLKH+RST+TQ +LDQLSDLQ KE++ +EAN+ L  KL+E    N 
Sbjct  120   NSKELEQLERQLETSLKHVRSTKTQYLLDQLSDLQNKEQMLMEANRALSIKLDEISARNQ  179

Query  835   LQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvnav  1014
              +  W  GEQS  Y  Q A Q+ G FQPLEC+ TL IG+NPVA S QI A T+AQ VN  
Sbjct  180   FRASWEGGEQSVPYGNQQA-QSQGLFQPLECNPTLQIGYNPVA-SDQIAATTHAQQVNGF  237

Query  1015  LPGWML  1032
             +PGWML
Sbjct  238   IPGWML  243



>ref|XP_010260833.1| PREDICTED: MADS-box protein CMB1 [Nelumbo nucifera]
Length=243

 Score =   304 bits (778),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 174/246 (71%), Positives = 202/246 (82%), Gaps = 3/246 (1%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             S+MLKTL+RYQKCSYG LE ++P K+  QSSY+EYLKLK + E LQR QR+LLGEDLGPL
Sbjct  61    SSMLKTLDRYQKCSYGALETSQPAKET-QSSYQEYLKLKARVEVLQRSQRNLLGEDLGPL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
                E+E LEHQL+ SLK IRST+TQ++LDQLSDLQ KE++  EAN+TL+ KLEE   +N 
Sbjct  120   TTKELEQLEHQLEMSLKQIRSTKTQLMLDQLSDLQRKEQMLQEANRTLKRKLEESSCENP  179

Query  835   LQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvnav  1014
             L+  W  G Q+ +YS+Q A Q+ GFFQPLEC+STL IG+NPV    QIT  T  QNVN  
Sbjct  180   LRLTWEAGGQNISYSRQAA-QSEGFFQPLECNSTLQIGYNPVG-PDQITVTTPTQNVNGF  237

Query  1015  LPGWML  1032
             +PGWML
Sbjct  238   IPGWML  243



>ref|XP_006593703.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X2 
[Glycine max]
 gb|KHN08352.1| Developmental protein SEPALLATA 2 [Glycine soja]
Length=249

 Score =   304 bits (778),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 171/250 (68%), Positives = 202/250 (81%), Gaps = 5/250 (2%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FS RGKLYEF ST
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLYEFCST  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             ++MLKTLERYQKCSYG +EV++P K+ EQSSY+EYLKLK ++ESLQR QR+LLGEDLGPL
Sbjct  61    NSMLKTLERYQKCSYGAVEVSKPGKELEQSSYREYLKLKARFESLQRTQRNLLGEDLGPL  120

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             N  ++E LE QLD+SLK +RST+TQ +LDQL+DLQ KE + +EAN++L  KLEE    N 
Sbjct  121   NTKDLEQLERQLDSSLKQVRSTKTQFMLDQLADLQNKEHMLVEANRSLTMKLEEINSRNQ  180

Query  835   LQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIG----FNPVATSSQItaatnaqn  1002
              +Q W  GEQS +Y  Q+A  + GFFQPLEC+ TL IG    +NP A+  Q+ A T AQ 
Sbjct  181   YRQTWEAGEQSMSYGTQNA-HSQGFFQPLECNPTLQIGSDYRYNPEASEQQLAATTQAQQ  239

Query  1003  vnavLPGWML  1032
             VN  +PGWML
Sbjct  240   VNGFIPGWML  249



>gb|ADU15478.1| SEP1 [Actinidia chinensis]
Length=238

 Score =   303 bits (776),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 176/247 (71%), Positives = 205/247 (83%), Gaps = 10/247 (4%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF ST
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCST  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             S       +YQKCSY TLEVN  +K+ E+SSY+EY KLKGK+ESLQRYQR LLGEDLGPL
Sbjct  61    S-------KYQKCSYDTLEVNHTDKELEESSYREYYKLKGKHESLQRYQRQLLGEDLGPL  113

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             NI+E+EHLEHQL+TSL+ IRST+TQ +LDQL DLQ KEKLWL+AN  LE KL E Y +N+
Sbjct  114   NINELEHLEHQLETSLQQIRSTKTQSMLDQLYDLQAKEKLWLDANIALEGKLNEIYRENH  173

Query  835   LQQPWGP-GEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvna  1011
             +Q  W   GEQ  +Y+QQ+A Q+ GF QPL+C+STL IG+NP   S+Q+ AAT+ QNV  
Sbjct  174   IQSSWACGGEQCTSYAQQNA-QSQGFLQPLDCNSTLQIGYNP-EVSNQMNAATHDQNVTG  231

Query  1012  vLPGWML  1032
             ++PGWML
Sbjct  232   LIPGWML  238



>ref|XP_003531877.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X1 
[Glycine max]
 gb|KHN30313.1| Developmental protein SEPALLATA 2 [Glycine soja]
Length=251

 Score =   303 bits (775),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 175/252 (69%), Positives = 204/252 (81%), Gaps = 7/252 (3%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             S+MLKTLERYQKCSYG +EV +P K+ EQSSY+EYLKLK ++ESLQR QR+LLGEDLGPL
Sbjct  61    SSMLKTLERYQKCSYGAVEVTKPAKELEQSSYREYLKLKARFESLQRTQRNLLGEDLGPL  120

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             N  E+EHLE QLD+SLK +RST+TQ +LDQLSDLQTKE++ +EAN++L  KLEE    N+
Sbjct  121   NTKELEHLERQLDSSLKQVRSTKTQFMLDQLSDLQTKEQMLVEANRSLTVKLEEINSRNH  180

Query  835   LQQPWGPGEQSGAY--SQQHADQTHGFFQPLECDSTLHIG----FNPVATSSQItaatna  996
              +Q W  G+QS  Y    Q++    GFFQPLEC+ TL IG    +N VA S QITA T  
Sbjct  181   YRQSWEAGDQSMPYGGGPQNSHSHQGFFQPLECNPTLQIGPDYRYNDVA-SDQITATTQP  239

Query  997   qnvnavLPGWML  1032
             Q V+  +PGWML
Sbjct  240   QQVSGFIPGWML  251



>ref|XP_003552609.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X1 
[Glycine max]
Length=254

 Score =   301 bits (771),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 176/256 (69%), Positives = 206/256 (80%), Gaps = 12/256 (5%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             S+MLKTLERYQKCSYG +EV++P K+ E SSY+EYLKLK ++ESLQR QR+LLGEDLGPL
Sbjct  61    SSMLKTLERYQKCSYGAVEVSKPAKELE-SSYREYLKLKARFESLQRTQRNLLGEDLGPL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             NI E+EHLE QLD+SLK +RST+TQ +LDQLSDLQTKE++ +EAN++L  KLEE    N+
Sbjct  120   NIKELEHLERQLDSSLKQVRSTKTQFMLDQLSDLQTKEQMLVEANRSLTVKLEEINSRNH  179

Query  835   LQQPWGPGEQSGAYSQQHADQTH------GFFQPLECDSTLHIG----FNPVATSSQIta  984
              +Q W  G+QS  Y     + +H      GFFQPLEC+ TLHIG    +N VA S QITA
Sbjct  180   YRQSWEAGDQSMPYGGGGPENSHSHSHSQGFFQPLECNPTLHIGPDYRYNAVA-SDQITA  238

Query  985   atnaqnvnavLPGWML  1032
              T  Q V+  +PGWML
Sbjct  239   TTQPQQVSGFIPGWML  254



>gb|AHH28266.1| MADS-box transcription factor, partial [Rhizanthes lowii]
Length=244

 Score =   301 bits (770),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 173/246 (70%), Positives = 200/246 (81%), Gaps = 2/246 (1%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             SNMLKTLERYQKCSYG +EVN+P K+ E SSY+EY+KLK ++ESLQR QR+LLGEDLGPL
Sbjct  61    SNMLKTLERYQKCSYGAIEVNKPAKELE-SSYREYMKLKSRFESLQRTQRNLLGEDLGPL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             N  E+E LE QL++SLK +RST+TQ +LDQLSDLQ KE+L LEAN+ L  KL+E    NN
Sbjct  120   NTKELEQLERQLESSLKQVRSTKTQYMLDQLSDLQNKEQLLLEANRALTIKLDEMGARNN  179

Query  835   LQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvnav  1014
             L+  W   EQ+ AY+  H  Q    FQPLEC+ TL IG+NPV  S  +TA T+AQ VN  
Sbjct  180   LRPSWEGPEQNMAYAHHHHPQNQELFQPLECNPTLQIGYNPVC-SDHMTATTHAQQVNGF  238

Query  1015  LPGWML  1032
             +PGWML
Sbjct  239   IPGWML  244



>ref|XP_006482430.1| PREDICTED: developmental protein SEPALLATA 1-like [Citrus sinensis]
 dbj|BAF95941.1| SEPALLATA1 homolog [Citrus unshiu]
Length=243

 Score =   300 bits (767),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 171/246 (70%), Positives = 202/246 (82%), Gaps = 3/246 (1%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             S+MLKTLERYQKCSYG +EVN+P K+ E SSY+EYLKLK ++ESLQR QR+LLGEDLGPL
Sbjct  61    SSMLKTLERYQKCSYGAVEVNKPAKELE-SSYREYLKLKTRFESLQRTQRNLLGEDLGPL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             N  E+E LE QL++SLKH+RST+TQ +LDQLSDLQ KE+L L+ N+ L  KL+E      
Sbjct  120   NSKELEQLERQLESSLKHVRSTKTQYMLDQLSDLQNKEQLLLDTNRALTIKLDEINAKTQ  179

Query  835   LQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvnav  1014
             L+  W  GEQ   Y+ QHA QT G FQP+EC+ TL IG+NP + S Q+TA ++AQ V+  
Sbjct  180   LRPSWEGGEQQLGYNPQHA-QTQGLFQPIECNPTLQIGYNP-SCSDQMTATSHAQQVSGF  237

Query  1015  LPGWML  1032
             +PGWML
Sbjct  238   IPGWML  243



>gb|AAP83376.1| SEPALLATA1-like MADS-box [Solanum lycopersicum]
Length=214

 Score =   298 bits (763),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 167/214 (78%), Positives = 189/214 (88%), Gaps = 0/214 (0%)
 Frame = +1

Query  391   YELSVLCDAEVALIVFSNRGKLYEFSSTSNMLKTLERYQKCSYGTLEVNRPNKDNEQssy  570
             +E+S LCDAEVAL+VFSNRGKLYEF ST+NMLKTL+RYQKCSYGTLEVNR  KDNEQSSY
Sbjct  1     HEMSXLCDAEVALLVFSNRGKLYEFCSTNNMLKTLDRYQKCSYGTLEVNRSIKDNEQSSY  60

Query  571   keylklkgkyeslQRYQRHLLGEDLGPLNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLS  750
             +EYLKLK KYESLQRYQRHLLG++LGPL ID++EHLE QLDTSLKHIRSTRTQM+LDQLS
Sbjct  61    REYLKLKAKYESLQRYQRHLLGDELGPLTIDDLEHLEVQLDTSLKHIRSTRTQMMLDQLS  120

Query  751   DLQTKEKLWLEANKTLESKLEEFYVDNNLQQPWGPGEQSGAYSQQHADQTHGFFQPLECD  930
             DLQTKEKLW EANK LE K+EE Y +NN+QQ WG GEQS  Y QQ   Q+ GFFQPLEC+
Sbjct  121   DLQTKEKLWNEANKVLERKMEEIYAENNMQQAWGGGEQSLNYGQQQHPQSQGFFQPLECN  180

Query  931   STLHIGFNPVATSSQItaatnaqnvnavLPGWML  1032
             S+L IG++P+ TSSQITA TNAQNVN ++PGWML
Sbjct  181   SSLQIGYDPITTSSQITAVTNAQNVNGMIPGWML  214



>ref|XP_006603756.1| PREDICTED: MADS-box protein isoform X1 [Glycine max]
Length=249

 Score =   299 bits (766),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 170/250 (68%), Positives = 200/250 (80%), Gaps = 5/250 (2%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FS RGKLYEF ST
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLYEFCST  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             ++MLKTLERYQKCSYG +EV++P K+ EQSSY+EYLKLK ++ESLQR QR+LLGEDLGPL
Sbjct  61    NSMLKTLERYQKCSYGAVEVSKPGKELEQSSYREYLKLKARFESLQRTQRNLLGEDLGPL  120

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             N  ++E LE QLD+SLK +RST+TQ +LDQL+DLQ KE + +EAN++L  KLEE    N 
Sbjct  121   NTKDLEQLERQLDSSLKQVRSTKTQFMLDQLADLQNKEHMLVEANRSLTMKLEEINSRNQ  180

Query  835   LQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIG----FNPVATSSQItaatnaqn  1002
              +Q W  GEQS  Y  Q+A  + GFFQPLEC+ TL IG    + P A+  Q+ A T AQ 
Sbjct  181   YRQTWEAGEQSMPYGTQNA-HSQGFFQPLECNPTLQIGSDYRYIPEASEQQLAATTQAQQ  239

Query  1003  vnavLPGWML  1032
             VN  +PGWML
Sbjct  240   VNGFIPGWML  249



>gb|KHG17252.1| Developmental SEPALLATA 2 -like protein [Gossypium arboreum]
Length=244

 Score =   298 bits (764),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 171/247 (69%), Positives = 203/247 (82%), Gaps = 4/247 (2%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             S+MLKTL+RYQKCSYG +EV++P K+ E SSY+EYLKLK +YE LQR QR+LLGEDLGPL
Sbjct  61    SSMLKTLDRYQKCSYGAVEVSKPAKELE-SSYREYLKLKARYEELQRTQRNLLGEDLGPL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             N  E+E LEHQL++SLKH+RST+TQ +LDQL++LQ KE++ +E N+ L  KLEE    N 
Sbjct  120   NSKELEQLEHQLESSLKHVRSTKTQYMLDQLTELQNKEQMLMETNRALSIKLEEISARNQ  179

Query  835   LQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGF-NPVATSSQItaatnaqnvna  1011
              +  W  GEQS A++ Q A Q+ G FQPLEC+ TL IG+ NPVA S Q+ A T+AQ VN 
Sbjct  180   FRASWEGGEQSVAFTNQQA-QSMGLFQPLECNPTLQIGYCNPVA-SDQMAATTHAQQVNG  237

Query  1012  vLPGWML  1032
              +PGWML
Sbjct  238   FIPGWML  244



>ref|XP_004154725.1| PREDICTED: developmental protein SEPALLATA 2-like [Cucumis sativus]
Length=246

 Score =   299 bits (765),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 172/249 (69%), Positives = 200/249 (80%), Gaps = 6/249 (2%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF ST
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCST  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             SNMLKTLERYQKCSYG +EV +P K+ E SSY+EYLKLK ++ESLQR QR+LLGEDLGPL
Sbjct  61    SNMLKTLERYQKCSYGAVEVTKPAKELE-SSYREYLKLKSRFESLQRTQRNLLGEDLGPL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             N  E+E LE QL++SLK +RST+TQ +LDQLSDLQ KE++ +E N+ L+ KLEE    NN
Sbjct  120   NSKELEQLERQLESSLKQVRSTKTQYMLDQLSDLQNKEQMLIETNRALQIKLEEISSRNN  179

Query  835   LQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvnav  1014
             ++  W  G+QS +Y  Q+A QT GFFQPLEC+ TL IG+   A S QIT+ T   +   V
Sbjct  180   IRLTWDGGDQSMSYGPQNA-QTQGFFQPLECNPTLQIGYTS-AVSDQITSTTTPTHAQQV  237

Query  1015  ---LPGWML  1032
                LPGWML
Sbjct  238   NGFLPGWML  246



>gb|AEJ76841.1| MADS17 [Gossypium hirsutum]
Length=244

 Score =   298 bits (764),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 172/247 (70%), Positives = 203/247 (82%), Gaps = 4/247 (2%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             S+MLKTL+RYQKCSYG +EV++P K+ E SSY+EYLKLK +YE LQR QR+LLGEDLGPL
Sbjct  61    SSMLKTLDRYQKCSYGAVEVSKPAKELE-SSYREYLKLKARYEELQRTQRNLLGEDLGPL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             N  E+E LEHQL++SLKH+RST+TQ +LDQLS+LQ KE++ +E N+ L  KLEE    N 
Sbjct  120   NSKELEQLEHQLESSLKHVRSTKTQYMLDQLSELQNKEQMLMETNRALSIKLEEVSARNQ  179

Query  835   LQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGF-NPVATSSQItaatnaqnvna  1011
              +  W  GEQS A++ Q A Q+ G FQPLEC+ TL IG+ NPVA S Q+ A T+AQ VN 
Sbjct  180   FRVSWEGGEQSVAFTNQQA-QSMGLFQPLECNPTLQIGYCNPVA-SDQMAATTHAQQVNG  237

Query  1012  vLPGWML  1032
              +PGWML
Sbjct  238   FIPGWML  244



>ref|XP_008464576.1| PREDICTED: developmental protein SEPALLATA 1-like [Cucumis melo]
Length=246

 Score =   298 bits (764),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 170/249 (68%), Positives = 200/249 (80%), Gaps = 6/249 (2%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRG VELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF ST
Sbjct  1     MGRGIVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCST  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             SNMLKTLERYQKCSYG +EV +P K+ E SSY+EY+KLK ++ESLQR QR+LLGEDLGPL
Sbjct  61    SNMLKTLERYQKCSYGAVEVTKPAKELE-SSYREYVKLKSRFESLQRTQRNLLGEDLGPL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             N  E+E LE QL++SLK +RST+TQ +LDQLSDLQ KE++ +E N+ L+ KLEE    NN
Sbjct  120   NSKELEQLERQLESSLKQVRSTKTQYMLDQLSDLQNKEQMLIETNRALQMKLEEISSRNN  179

Query  835   LQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvnav  1014
             ++ PW  G+QS +Y  Q+A QT GFFQPL+C+ TL IG+   A S QIT+ T   +   V
Sbjct  180   IRHPWDGGDQSMSYGTQNA-QTQGFFQPLDCNPTLQIGYTS-AVSDQITSTTTPTHAQQV  237

Query  1015  ---LPGWML  1032
                LPGWML
Sbjct  238   NGFLPGWML  246



>gb|EPS70807.1| hypothetical protein M569_03954 [Genlisea aurea]
Length=256

 Score =   299 bits (765),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 179/256 (70%), Positives = 208/256 (81%), Gaps = 10/256 (4%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             SNMLKTLERYQKCSYG+LEVN P K+ EQSSYKEYLKLK KYE+LQ+YQR LLG+DLG L
Sbjct  61    SNMLKTLERYQKCSYGSLEVNNPGKEIEQSSYKEYLKLKSKYETLQQYQRQLLGDDLGAL  120

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             N++++E +EHQLD+SLK IRSTRTQ++LDQLSDLQTKEKL ++ANK+LE KLEE Y   +
Sbjct  121   NLNDLESIEHQLDSSLKLIRSTRTQIMLDQLSDLQTKEKLMVDANKSLERKLEEIYAATH  180

Query  835   ---LQQPW---GPGEQSGAY--SQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaat  990
                 QQ W     G+QS ++    Q+    HGFFQPL+C+STL IG+N   +S QITAA 
Sbjct  181   HQLQQQSWLGGVGGQQSNSFGGHHQNNHHHHGFFQPLDCNSTLQIGYNDQVSSEQITAAA  240

Query  991   naqnvnav--LPGWML  1032
              A + N    +P WML
Sbjct  241   AADSQNVNGLVPIWML  256



>emb|CAN59955.1| hypothetical protein VITISV_006723 [Vitis vinifera]
Length=244

 Score =   298 bits (763),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 163/226 (72%), Positives = 187/226 (83%), Gaps = 1/226 (0%)
 Frame = +1

Query  295  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FS RGKLYEF S+
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLYEFCSS  60

Query  475  SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
            S+MLKTLERYQKCSYG +EV+RP+K+ EQSSY+EYLKLK K+E LQR QR+LLGEDLGPL
Sbjct  61   SSMLKTLERYQKCSYGAVEVSRPSKELEQSSYREYLKLKSKFEXLQRTQRNLLGEDLGPL  120

Query  655  NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
            N  E+E LE QL+TSLK +RST+TQ +LDQLSDLQ KE++ +E+NK L  KL+E  V N+
Sbjct  121  NTKELEQLERQLETSLKQVRSTKTQFMLDQLSDLQNKEQVLVESNKALTRKLDEISVKNH  180

Query  835  LQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSS  972
            LQ  W  GEQS  Y  Q A Q+ GFFQPLEC+ TL IG    A +S
Sbjct  181  LQLSWESGEQSMPYGHQQA-QSQGFFQPLECNPTLQIGIILQAQAS  225



>ref|XP_008230291.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X3 
[Prunus mume]
Length=245

 Score =   297 bits (761),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 170/247 (69%), Positives = 206/247 (83%), Gaps = 3/247 (1%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             S++LKTLERYQKCSYG +EVN+P K+ EQSSY+EYLKLKG++ESLQR QR+LLGE+LGPL
Sbjct  61    SSILKTLERYQKCSYGQVEVNKPAKELEQSSYREYLKLKGRFESLQRTQRNLLGEELGPL  120

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             N  E+E LE QL++SLK +RST+TQ +LDQLSDLQ KE++ +EAN+ L  KL++    N 
Sbjct  121   NTKELEQLERQLESSLKQVRSTKTQYMLDQLSDLQNKEQMLIEANRDLSLKLDDISSRNQ  180

Query  835   LQQPWGPGEQSG-AYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvna  1011
             ++Q W  G Q G AY  QHA Q+ GFFQPL+C+ TL IG++ V  S Q++A T+AQ VN 
Sbjct  181   IRQSWEGGNQGGMAYGTQHA-QSQGFFQPLDCNPTLQIGYSNVG-SEQMSATTHAQQVNG  238

Query  1012  vLPGWML  1032
              +PGWML
Sbjct  239   FIPGWML  245



>ref|XP_003544012.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X1 
[Glycine max]
Length=248

 Score =   297 bits (761),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 170/250 (68%), Positives = 201/250 (80%), Gaps = 6/250 (2%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FS RGKLYEF ST
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLYEFCST  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             ++MLKTLERYQKCSYG +EV++P K+ E SSY+EYLKLK ++ESLQR QR+LLGEDLGPL
Sbjct  61    NSMLKTLERYQKCSYGAVEVSKPGKELE-SSYREYLKLKARFESLQRTQRNLLGEDLGPL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             N  ++E LE QLD+SLK +RST+TQ +LDQL+DLQ KE + +EAN++L  KLEE    N 
Sbjct  120   NTKDLEQLERQLDSSLKQVRSTKTQFMLDQLADLQNKEHMLVEANRSLTMKLEEINSRNQ  179

Query  835   LQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIG----FNPVATSSQItaatnaqn  1002
              +Q W  GEQS +Y  Q+A  + GFFQPLEC+ TL IG    +NP A+  Q+ A T AQ 
Sbjct  180   YRQTWEAGEQSMSYGTQNA-HSQGFFQPLECNPTLQIGSDYRYNPEASEQQLAATTQAQQ  238

Query  1003  vnavLPGWML  1032
             VN  +PGWML
Sbjct  239   VNGFIPGWML  248



>ref|NP_001267667.1| developmental protein SEPALLATA 2-like [Cucumis sativus]
 gb|AAF23363.1|AF135962_1 CAGL2 [Cucumis sativus]
Length=246

 Score =   297 bits (761),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 172/249 (69%), Positives = 199/249 (80%), Gaps = 6/249 (2%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF ST
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCST  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             SNMLKTLERYQKCSYG +EV +P K+ E SSY+EYLKLK ++ESLQR QR+LLGEDLGPL
Sbjct  61    SNMLKTLERYQKCSYGAVEVTKPAKELE-SSYREYLKLKSRFESLQRTQRNLLGEDLGPL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             N  E+E LE QL +SLK +RST+TQ +LDQLSDLQ KE++ +E N+ L+ KLEE    NN
Sbjct  120   NSKELEQLERQLVSSLKQVRSTKTQYMLDQLSDLQNKEQMLIETNRALQIKLEEISSRNN  179

Query  835   LQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvnav  1014
             ++  W  G+QS +Y  Q+A QT GFFQPLEC+ TL IG+   A S QIT+ T   +   V
Sbjct  180   IRLTWDGGDQSMSYGPQNA-QTQGFFQPLECNPTLQIGYTS-AVSDQITSTTTPTHAQQV  237

Query  1015  ---LPGWML  1032
                LPGWML
Sbjct  238   NGFLPGWML  246



>ref|XP_010257958.1| PREDICTED: developmental protein SEPALLATA 1 [Nelumbo nucifera]
Length=243

 Score =   296 bits (759),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 172/246 (70%), Positives = 203/246 (83%), Gaps = 3/246 (1%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             S+MLKTLERYQKCSYG LE ++P K+  QSSY+EYLKLK + E LQR QR+LLGEDLGPL
Sbjct  61    SSMLKTLERYQKCSYGALEASQPAKET-QSSYQEYLKLKARVEVLQRSQRNLLGEDLGPL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             +  E+E LEHQL+ SLK IRST+TQ++LDQLSDLQ KE++  EAN+ L+ KL+E   +N 
Sbjct  120   STKELEQLEHQLEMSLKQIRSTKTQLMLDQLSDLQRKEQMLQEANRALKRKLDESSSENP  179

Query  835   LQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvnav  1014
             L+  W  G Q+ +YS+Q + Q+ GFFQPLE +STL IG+NPV    QIT A +AQNVN  
Sbjct  180   LRLTWEAGGQNISYSRQPS-QSEGFFQPLEGNSTLQIGYNPVGP-DQITVAASAQNVNGY  237

Query  1015  LPGWML  1032
             +PGWML
Sbjct  238   IPGWML  243



>gb|AAY30858.1| MADS-box transcription factor [Prunus dulcis]
Length=246

 Score =   296 bits (759),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 172/248 (69%), Positives = 207/248 (83%), Gaps = 4/248 (2%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEF-SS  471
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALI+FSNRGKLYEF SS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  60

Query  472   TSNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGP  651
             +S++LKTLERYQKCSYG +EVN+P K+ EQSSY+EYLKLKG++ESLQR QR+LLGEDLGP
Sbjct  61    SSSILKTLERYQKCSYGQVEVNKPAKELEQSSYREYLKLKGRFESLQRTQRNLLGEDLGP  120

Query  652   LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDN  831
             LN  E+E LE QL++SLK +RST+TQ +LDQLSDLQ KE++ +EAN+ L  KL++    N
Sbjct  121   LNTKELEQLERQLESSLKQVRSTKTQYMLDQLSDLQNKEQMLIEANRDLSLKLDDISSRN  180

Query  832   NLQQPWGPGEQSG-AYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvn  1008
              ++Q W  G Q G AY  QHA Q+ GFFQPL+C+ TL IG++ V  S Q++A T+AQ VN
Sbjct  181   QIRQSWEGGNQGGMAYGSQHA-QSQGFFQPLDCNPTLQIGYSNVG-SEQMSATTHAQQVN  238

Query  1009  avLPGWML  1032
               +PGWML
Sbjct  239   GFIPGWML  246



>ref|XP_004507289.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X3 
[Cicer arietinum]
Length=247

 Score =   296 bits (759),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 170/249 (68%), Positives = 202/249 (81%), Gaps = 5/249 (2%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
              +MLKTLERYQKCSYG +EVN+P K+ EQSSY+EYLKLK ++ESLQR QR+LLGEDLGPL
Sbjct  61    PSMLKTLERYQKCSYGAVEVNKPAKELEQSSYREYLKLKARFESLQRTQRNLLGEDLGPL  120

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
                ++E LEHQLD+SLK +RST+TQ +LDQL+DLQ KE + ++AN++L  KLEE    N 
Sbjct  121   GTKDLEQLEHQLDSSLKQVRSTKTQFMLDQLADLQNKEHMLVDANRSLNMKLEEINSRNQ  180

Query  835   LQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIG---FNPVATSSQItaatnaqnv  1005
              +Q W  G+QS AY  Q+   +  FFQPL+C+ TL IG   ++PVA S Q+TA T AQ V
Sbjct  181   YRQTWEAGDQSMAYGTQNP-HSQSFFQPLDCNPTLQIGDYRYSPVA-SDQLTATTQAQQV  238

Query  1006  navLPGWML  1032
             N  +PGWML
Sbjct  239   NGFIPGWML  247



>ref|NP_001238296.1| MADS-box protein [Glycine max]
 gb|AAZ86071.1| MADS-box protein [Glycine max]
Length=248

 Score =   296 bits (759),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 170/250 (68%), Positives = 200/250 (80%), Gaps = 6/250 (2%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FS RGKLYEF ST
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLYEFCST  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             ++MLKTLERYQKCSYG +EV++P K+ E SSY+EYLKLK ++ESLQR QR+LLGEDLGPL
Sbjct  61    NSMLKTLERYQKCSYGAVEVSKPGKELE-SSYREYLKLKARFESLQRTQRNLLGEDLGPL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             N  ++E LE QLD+SLK +RST+TQ +LDQL+DLQ KE + +EAN++L  KLEE    N 
Sbjct  120   NTKDLEQLERQLDSSLKQVRSTKTQFMLDQLADLQNKEHMLVEANRSLTMKLEEINSRNQ  179

Query  835   LQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIG----FNPVATSSQItaatnaqn  1002
              +Q W  GEQS  Y  Q+A  + GFFQPLEC+ TL IG    +NP A+  Q+ A T AQ 
Sbjct  180   YRQTWEAGEQSMPYGTQNA-HSQGFFQPLECNPTLQIGSDYRYNPEASEQQLAATTQAQQ  238

Query  1003  vnavLPGWML  1032
             VN  +PGWML
Sbjct  239   VNGFIPGWML  248



>ref|XP_006585806.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X2 
[Glycine max]
Length=250

 Score =   296 bits (759),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 174/252 (69%), Positives = 203/252 (81%), Gaps = 8/252 (3%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             S+MLKTLERYQKCSYG +EV +P K+ E SSY+EYLKLK ++ESLQR QR+LLGEDLGPL
Sbjct  61    SSMLKTLERYQKCSYGAVEVTKPAKELE-SSYREYLKLKARFESLQRTQRNLLGEDLGPL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             N  E+EHLE QLD+SLK +RST+TQ +LDQLSDLQTKE++ +EAN++L  KLEE    N+
Sbjct  120   NTKELEHLERQLDSSLKQVRSTKTQFMLDQLSDLQTKEQMLVEANRSLTVKLEEINSRNH  179

Query  835   LQQPWGPGEQSGAY--SQQHADQTHGFFQPLECDSTLHIG----FNPVATSSQItaatna  996
              +Q W  G+QS  Y    Q++    GFFQPLEC+ TL IG    +N VA S QITA T  
Sbjct  180   YRQSWEAGDQSMPYGGGPQNSHSHQGFFQPLECNPTLQIGPDYRYNDVA-SDQITATTQP  238

Query  997   qnvnavLPGWML  1032
             Q V+  +PGWML
Sbjct  239   QQVSGFIPGWML  250



>gb|ACD39982.1| MADS1 [Carica papaya]
Length=245

 Score =   296 bits (758),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 168/247 (68%), Positives = 201/247 (81%), Gaps = 3/247 (1%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             S+MLKTL+RYQKCSYG +EV++P K+ E SSY+EYLKLK ++E+LQR QR+LLGEDLGPL
Sbjct  61    SSMLKTLDRYQKCSYGAVEVSKPAKELE-SSYREYLKLKTRFEALQRTQRNLLGEDLGPL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             N  E+E LE QL++SLKH+RST+TQ +LDQL+DLQ KE + LEAN+ L  KL+E    N+
Sbjct  120   NTKELEQLERQLESSLKHVRSTKTQYMLDQLTDLQNKEHMLLEANRALTIKLDEISARNH  179

Query  835   LQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatna-qnvna  1011
             L+  W   EQ+ +Y  QHA Q+ G FQPLEC+ TL IG+NPV +     AAT+  Q VN 
Sbjct  180   LRVAWEGSEQNVSYGHQHA-QSQGLFQPLECNPTLQIGYNPVGSDQMTAAATSQGQQVNG  238

Query  1012  vLPGWML  1032
              +PGWML
Sbjct  239   FIPGWML  245



>ref|XP_004507287.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X1 
[Cicer arietinum]
Length=248

 Score =   296 bits (758),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 170/250 (68%), Positives = 202/250 (81%), Gaps = 6/250 (2%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
              +MLKTLERYQKCSYG +EVN+P K+ EQSSY+EYLKLK ++ESLQR QR+LLGEDLGPL
Sbjct  61    PSMLKTLERYQKCSYGAVEVNKPAKELEQSSYREYLKLKARFESLQRTQRNLLGEDLGPL  120

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
                ++E LEHQLD+SLK +RST+TQ +LDQL+DLQ KE + ++AN++L  KLEE    N 
Sbjct  121   GTKDLEQLEHQLDSSLKQVRSTKTQFMLDQLADLQNKEHMLVDANRSLNMKLEEINSRNQ  180

Query  835   LQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIG----FNPVATSSQItaatnaqn  1002
              +Q W  G+QS AY  Q+   +  FFQPL+C+ TL IG    ++PVA S Q+TA T AQ 
Sbjct  181   YRQTWEAGDQSMAYGTQNP-HSQSFFQPLDCNPTLQIGSDYRYSPVA-SDQLTATTQAQQ  238

Query  1003  vnavLPGWML  1032
             VN  +PGWML
Sbjct  239   VNGFIPGWML  248



>ref|XP_010694125.1| PREDICTED: developmental protein SEPALLATA 1 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=251

 Score =   296 bits (758),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 169/247 (68%), Positives = 201/247 (81%), Gaps = 4/247 (2%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S 
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSG  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
              +MLKTLERYQKCSYG +EVN+P+K+ EQSSY+EYLKLK ++ESLQR QR+LLGEDLGPL
Sbjct  61    PSMLKTLERYQKCSYGGVEVNKPSKELEQSSYREYLKLKARHESLQRTQRNLLGEDLGPL  120

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             N+ E++ LE QL++SLK IRST+TQ +LDQL+DLQ KE   +EANKTL+++L+   V + 
Sbjct  121   NVKELDQLERQLESSLKQIRSTKTQSMLDQLTDLQNKEHALMEANKTLKTELDRIMVKDT  180

Query  835   LQ--QPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvn  1008
              Q  Q W   EQ+  Y QQHA Q+ G FQPL+C+ TL IG+NP  +S Q+T AT+   V 
Sbjct  181   QQFRQTWDGSEQNVHYGQQHA-QSQGLFQPLDCNPTLQIGYNP-ESSEQMTVATSHTQVP  238

Query  1009  avLPGWM  1029
               LPGWM
Sbjct  239   GFLPGWM  245



>ref|XP_006430949.1| hypothetical protein CICLE_v10012593mg [Citrus clementina]
 gb|ESR44189.1| hypothetical protein CICLE_v10012593mg [Citrus clementina]
Length=243

 Score =   295 bits (756),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 169/246 (69%), Positives = 200/246 (81%), Gaps = 3/246 (1%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             S+MLKTLERYQKCSYG +EVN+P K+ E SSY+EYLKLK ++ESLQR QR+LLGEDLGPL
Sbjct  61    SSMLKTLERYQKCSYGAVEVNKPAKELE-SSYREYLKLKTRFESLQRTQRNLLGEDLGPL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             N  E+E LE QL++SLKH+RST+TQ +LDQLSDLQ KE+L L+ N+ L  KL+E      
Sbjct  120   NSKELEQLERQLESSLKHVRSTKTQYMLDQLSDLQNKEQLLLDTNRALTIKLDEINAKTQ  179

Query  835   LQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvnav  1014
             L+  W   EQ   Y+ QH  QT G FQP+EC+ TL IG+NP + S Q+TA ++AQ V+  
Sbjct  180   LRPSWEGSEQQLGYNPQHT-QTQGLFQPIECNPTLQIGYNP-SCSDQMTATSHAQQVSGF  237

Query  1015  LPGWML  1032
             +PGWML
Sbjct  238   IPGWML  243



>gb|AGW23364.1| MADS box protein MADS62 [Gossypium hirsutum]
Length=244

 Score =   295 bits (755),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 170/247 (69%), Positives = 200/247 (81%), Gaps = 4/247 (2%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             S MLKTL+RYQKCSYG +EV++P K+ E SSY+EYLKLK +YE LQR QR+ LGEDLGPL
Sbjct  61    SGMLKTLDRYQKCSYGAVEVSKPAKELE-SSYREYLKLKARYEELQRTQRNFLGEDLGPL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             N  E+E LEHQL++SLKH+RST+TQ +LDQLS+LQ KE++ +E N+ L  KLEE    N 
Sbjct  120   NSKELEQLEHQLESSLKHVRSTKTQYMLDQLSELQNKERMLMETNRALSIKLEEVSARNQ  179

Query  835   LQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGF-NPVATSSQItaatnaqnvna  1011
              +  W  GEQ  A++ Q A Q+ G FQPLEC+ TL IG+ NPVA S Q+ A T+AQ VN 
Sbjct  180   FRVSWEGGEQGVAFTNQQA-QSMGLFQPLECNPTLQIGYCNPVA-SDQMAATTHAQQVNG  237

Query  1012  vLPGWML  1032
              +PGWML
Sbjct  238   FIPGWML  244



>gb|AFO68772.1| agamous-like protein 2, partial [Styrax japonicus]
Length=229

 Score =   295 bits (754),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 171/230 (74%), Positives = 199/230 (87%), Gaps = 1/230 (0%)
 Frame = +1

Query  343   RQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSSTSNMLKTLERYQKCSYG  522
             RQVT++KRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEF STSNM+KTLERYQKCSY 
Sbjct  1     RQVTYSKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFCSTSNMVKTLERYQKCSYA  60

Query  523   TLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPLNIDEIEHLEHQLDTSL  702
             TLEV+R  K+ EQSSY+EYLKLKGKYE+LQ YQRHLLGEDLGPLN+ E+EHLE+QL+TSL
Sbjct  61    TLEVDRSAKEMEQSSYREYLKLKGKYEALQHYQRHLLGEDLGPLNMKELEHLEYQLETSL  120

Query  703   KHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNNLQQPWGPGEQSGAYSQ  882
             K IRST+TQ +LDQL DLQTKEKLWLEANK+LE KL+E Y +++  + W  GEQ  +Y+ 
Sbjct  121   KVIRSTKTQSMLDQLYDLQTKEKLWLEANKSLEGKLDEIYREHHDLRSWPGGEQCSSYNH  180

Query  883   QHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvnavLPGWML  1032
             QHA Q+ GFFQPLEC+STL IG+N     +QITAAT+ QNVN ++PGWML
Sbjct  181   QHA-QSQGFFQPLECNSTLQIGYNTPEIPNQITAATHDQNVNGLVPGWML  229



>emb|CAH04878.1| MADS domain protein [Gerbera hybrid cultivar]
Length=247

 Score =   295 bits (755),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 170/248 (69%), Positives = 203/248 (82%), Gaps = 3/248 (1%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKL+EF ST
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLFEFCST  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             SNMLK LERYQ C+YG++EV+R   + EQSSYKEY+KLK KYESLQ+YQR L GEDLGPL
Sbjct  61    SNMLKMLERYQNCTYGSMEVDRSTPNAEQSSYKEYMKLKAKYESLQQYQRQLFGEDLGPL  120

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             ++ E+E LE QLD++L+ IRS RTQ +LD+LS+LQ KE++W+EANK L++KLEE Y +N 
Sbjct  121   SLKELEQLERQLDSTLRQIRSIRTQSMLDRLSELQVKERMWVEANKALQNKLEEVYAENQ  180

Query  835   LQQPWGPGEQSGAYS--QQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvn  1008
                 W  GE   +Y    QH  Q+ GFFQPL+C+S L IG+N V  SS ITA+TN QN+N
Sbjct  181   AGPSWAAGEHHSSYGQEHQHQHQSQGFFQPLDCNSNLQIGYNTV-DSSHITASTNGQNLN  239

Query  1009  avLPGWML  1032
              ++PGWML
Sbjct  240   GLIPGWML  247



>ref|XP_009373782.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X1 
[Pyrus x bretschneideri]
 ref|XP_009333661.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X1 
[Pyrus x bretschneideri]
Length=247

 Score =   295 bits (755),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 171/248 (69%), Positives = 204/248 (82%), Gaps = 3/248 (1%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLE-VNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGP  651
             S++LKTL+RYQKCSYG ++ VNRP K+ EQSSY+EY+KLKG+YESLQR QR+LLGEDLGP
Sbjct  61    SSILKTLDRYQKCSYGAVDQVNRPAKELEQSSYREYMKLKGRYESLQRTQRNLLGEDLGP  120

Query  652   LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDN  831
             LN  E+E LE QL+ SLK +RST+TQ +LDQLSDLQ KE+L +EAN+ L  KL+E    N
Sbjct  121   LNTKELEQLERQLEGSLKQVRSTKTQYMLDQLSDLQNKEQLLIEANRDLTMKLDEISSRN  180

Query  832   NLQQPWGPGEQSGAYS-QQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvn  1008
              L+Q W  G+Q  AY+ Q H  Q+ GFFQPL+C+ TL +G++  A S Q++A TN Q VN
Sbjct  181   QLRQSWEGGDQGMAYATQHHHAQSQGFFQPLDCNPTLQMGYS-AAGSEQMSATTNGQQVN  239

Query  1009  avLPGWML  1032
               +PGWML
Sbjct  240   CFIPGWML  247



>ref|XP_008230289.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X1 
[Prunus mume]
Length=246

 Score =   295 bits (754),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 171/248 (69%), Positives = 207/248 (83%), Gaps = 4/248 (2%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEF-SS  471
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALI+FSNRGKLYEF SS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  60

Query  472   TSNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGP  651
             +S++LKTLERYQKCSYG +EVN+P K+ EQSSY+EYLKLKG++ESLQR QR+LLGE+LGP
Sbjct  61    SSSILKTLERYQKCSYGQVEVNKPAKELEQSSYREYLKLKGRFESLQRTQRNLLGEELGP  120

Query  652   LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDN  831
             LN  E+E LE QL++SLK +RST+TQ +LDQLSDLQ KE++ +EAN+ L  KL++    N
Sbjct  121   LNTKELEQLERQLESSLKQVRSTKTQYMLDQLSDLQNKEQMLIEANRDLSLKLDDISSRN  180

Query  832   NLQQPWGPGEQSG-AYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvn  1008
              ++Q W  G Q G AY  QHA Q+ GFFQPL+C+ TL IG++ V  S Q++A T+AQ VN
Sbjct  181   QIRQSWEGGNQGGMAYGTQHA-QSQGFFQPLDCNPTLQIGYSNVG-SEQMSATTHAQQVN  238

Query  1009  avLPGWML  1032
               +PGWML
Sbjct  239   GFIPGWML  246



>gb|AHH28272.1| MADS-box transcription factor, partial [Rafflesia tuan-mudae]
Length=242

 Score =   294 bits (753),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 172/245 (70%), Positives = 198/245 (81%), Gaps = 3/245 (1%)
 Frame = +1

Query  298   GRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSSTS  477
             GRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+S
Sbjct  1     GRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSS  60

Query  478   NMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPLN  657
             NMLKTLERYQKCSYG +EVN+P K+ E SSY+EY+KLK ++ESLQR QR+LLGEDLGPLN
Sbjct  61    NMLKTLERYQKCSYGAIEVNKPAKELE-SSYREYMKLKSRFESLQRTQRNLLGEDLGPLN  119

Query  658   IDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNNL  837
               E+E LE QL++SLK +RST+TQ +LDQLSDLQ KE+L LEAN+ L  KL+E    NNL
Sbjct  120   TKELEQLERQLESSLKQVRSTKTQYMLDQLSDLQNKEQLLLEANRALTIKLDEMGARNNL  179

Query  838   QQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvnavL  1017
             +  W   EQ+  Y+  H  Q    FQPLEC+ TL IG+NPV  S  ITA T+AQ VN  +
Sbjct  180   RPSWEGPEQNMPYAHHHP-QNQELFQPLECNPTLQIGYNPVC-SDHITATTHAQQVNGFI  237

Query  1018  PGWML  1032
             PGWML
Sbjct  238   PGWML  242



>ref|XP_011021072.1| PREDICTED: developmental protein SEPALLATA 2-like [Populus euphratica]
 ref|XP_011021073.1| PREDICTED: developmental protein SEPALLATA 2-like [Populus euphratica]
Length=244

 Score =   294 bits (753),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 173/247 (70%), Positives = 198/247 (80%), Gaps = 4/247 (2%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF ST
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCST  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             SNMLKTLERYQKCSYG  EVN+P K+ E SSY+EYLK+K K+E+LQR QR+LLGEDLGPL
Sbjct  61    SNMLKTLERYQKCSYGADEVNKPAKELE-SSYREYLKVKAKFETLQRTQRNLLGEDLGPL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             N  E+E LE  L++SLK +RST+TQ +LDQL DLQ KE + LEAN+ L  KL+E    NN
Sbjct  120   NTKELEQLERHLESSLKQVRSTKTQYMLDQLGDLQNKEHMLLEANRALTMKLDEISARNN  179

Query  835   LQQPW-GPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvna  1011
             L+  W G  +QS +Y  QHA Q+ G FQ LEC+ TL IG+N V  S QITAA  AQ V+ 
Sbjct  180   LRPSWEGDDQQSMSYGHQHA-QSQGLFQHLECNPTLQIGYNSVG-SDQITAAHAAQQVHG  237

Query  1012  vLPGWML  1032
              +PGWML
Sbjct  238   FIPGWML  244



>ref|XP_002306051.2| hypothetical protein POPTR_0004s11440g [Populus trichocarpa]
 ref|XP_006384290.1| hypothetical protein POPTR_0004s11440g [Populus trichocarpa]
 ref|XP_011008140.1| PREDICTED: developmental protein SEPALLATA 2-like [Populus euphratica]
 ref|XP_011008141.1| PREDICTED: developmental protein SEPALLATA 2-like [Populus euphratica]
 gb|EEE86562.2| hypothetical protein POPTR_0004s11440g [Populus trichocarpa]
 gb|ERP62087.1| hypothetical protein POPTR_0004s11440g [Populus trichocarpa]
Length=245

 Score =   294 bits (752),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 165/247 (67%), Positives = 194/247 (79%), Gaps = 3/247 (1%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF ST
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCST  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             SNMLKTLERYQKCSYG  EVN+P K+ E SSY+EYLK+K ++E+LQR QR+LLGEDLGPL
Sbjct  61    SNMLKTLERYQKCSYGAEEVNKPAKELE-SSYREYLKVKARFEALQRTQRNLLGEDLGPL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             N  E+E LE QL++SL  +RST+TQ +LDQL+DLQ KE L LEAN+ L  KL+E    N+
Sbjct  120   NTKELEQLERQLESSLNQVRSTKTQYMLDQLADLQNKEHLLLEANRGLTIKLDEISARNS  179

Query  835   LQQPW-GPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvna  1011
             L+  W G  +Q+ +Y  QHA Q+ G FQ LEC+ TL IG+NPV +          Q V+ 
Sbjct  180   LRPSWEGDDQQNMSYGHQHA-QSQGLFQALECNPTLQIGYNPVGSDQMTATTHATQQVHG  238

Query  1012  vLPGWML  1032
              +PGWML
Sbjct  239   FIPGWML  245



>ref|XP_008341807.1| PREDICTED: developmental protein SEPALLATA 1 isoform X1 [Malus 
domestica]
Length=247

 Score =   294 bits (752),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 171/248 (69%), Positives = 204/248 (82%), Gaps = 3/248 (1%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTF KRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFXKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLE-VNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGP  651
             S++LKTL+RYQKCSYG ++ VNRP K+ EQSSY+EY+KLKG+YESLQR QR+LLGEDLGP
Sbjct  61    SSILKTLDRYQKCSYGAVDQVNRPAKELEQSSYREYMKLKGRYESLQRTQRNLLGEDLGP  120

Query  652   LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDN  831
             LN  E+E LE QL+ SLK +RST+TQ +LDQLSDLQ KE+L +EAN+ L  KL+E    N
Sbjct  121   LNTKELEQLERQLEGSLKQVRSTKTQYMLDQLSDLQNKEQLLIEANRDLTMKLDEISSRN  180

Query  832   NLQQPWGPGEQSGAYS-QQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvn  1008
              L+Q W  G+Q  AY+ Q H  Q+ GFFQPL+C+ TL +G++ V  S Q++A TNAQ VN
Sbjct  181   QLRQSWEGGDQGMAYATQHHHAQSQGFFQPLDCNPTLQMGYSAVG-SEQMSATTNAQQVN  239

Query  1009  avLPGWML  1032
               +PGWML
Sbjct  240   CFIPGWML  247



>ref|XP_007215876.1| hypothetical protein PRUPE_ppa010548mg [Prunus persica]
 gb|EMJ17075.1| hypothetical protein PRUPE_ppa010548mg [Prunus persica]
Length=244

 Score =   293 bits (751),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 170/247 (69%), Positives = 205/247 (83%), Gaps = 4/247 (2%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             S++LKTLERYQKCSYG +EVN+P K+ E SSY+EYLKLKG++ESLQR QR+LLGEDLGPL
Sbjct  61    SSILKTLERYQKCSYGQVEVNKPAKELE-SSYREYLKLKGRFESLQRTQRNLLGEDLGPL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             N  E+E LE QL++SLK +RST+TQ +LDQLSDLQ KE++ +EAN+ L  KL++    N 
Sbjct  120   NTKELEQLERQLESSLKQVRSTKTQYMLDQLSDLQNKEQMLIEANRDLSLKLDDISSRNQ  179

Query  835   LQQPWGPGEQSG-AYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvna  1011
             ++Q W  G Q G AY  QHA Q+ GFFQPL+C+ TL IG++ V  S Q++A T+AQ VN 
Sbjct  180   IRQSWEGGNQGGMAYGSQHA-QSQGFFQPLDCNPTLQIGYSNVG-SEQMSATTHAQQVNG  237

Query  1012  vLPGWML  1032
              +PGWML
Sbjct  238   FIPGWML  244



>gb|AAP83397.1| SEPALLATA1-like MADS-box [Petunia x hybrida]
Length=215

 Score =   292 bits (747),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 168/217 (77%), Positives = 192/217 (88%), Gaps = 4/217 (2%)
 Frame = +1

Query  388   AYELSVLCDAEVALIVFSNRGKLYEFSSTSNMLKTLERYQKCSYGTLEVN-RPNKDN-EQ  561
             A+E SVLCDAEVALI+FSNRGKLYEFSSTSNM+KTL+RYQKCSYGTLEVN R  KDN E+
Sbjct  1     AHEXSVLCDAEVALIIFSNRGKLYEFSSTSNMVKTLDRYQKCSYGTLEVNHRSVKDNNEE  60

Query  562   ssykeylklkgkyeslQRYQRHLLGEDLGPLNIDEIEHLEHQLDTSLKHIRSTRTQMVLD  741
               Y+EYLKLK KYESLQRYQR LLG++LGPLNIDE+EHLE QLD+SLK I+STRTQ++LD
Sbjct  61    RIYREYLKLKAKYESLQRYQRQLLGDELGPLNIDELEHLELQLDSSLKLIKSTRTQLMLD  120

Query  742   QLSDLQTKEKLWLEANKTLESKLEEFYVDNNLQQPWGPGEQSGAYSQQHADQTHGFFQPL  921
             QLSDLQTKEKLW+EANK LE KLE+ Y +NN+QQ WG G+QSGAYSQQHA QT GFFQPL
Sbjct  121   QLSDLQTKEKLWVEANKVLERKLEQIYAENNIQQSWGGGQQSGAYSQQHA-QTQGFFQPL  179

Query  922   ECDSTLHIGFNPVATSSQItaatnaqnvnavLPGWML  1032
             EC+STL IG++P  TSSQITA T+ QNVN ++PGWML
Sbjct  180   ECNSTLQIGYDPT-TSSQITAVTSGQNVNGIIPGWML  215



>ref|XP_011014957.1| PREDICTED: developmental protein SEPALLATA 2-like [Populus euphratica]
 ref|XP_011014958.1| PREDICTED: developmental protein SEPALLATA 2-like [Populus euphratica]
 ref|XP_011014959.1| PREDICTED: developmental protein SEPALLATA 2-like [Populus euphratica]
Length=244

 Score =   293 bits (749),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 172/247 (70%), Positives = 198/247 (80%), Gaps = 4/247 (2%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKL+EF ST
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLFEFCST  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             SNMLKTLERYQKCSYG  EVN+P K+ E SSY+EYLK+K K+E+LQR QR+LLGEDLGPL
Sbjct  61    SNMLKTLERYQKCSYGADEVNKPAKELE-SSYREYLKVKAKFETLQRTQRNLLGEDLGPL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             N  E+E LE  L++SLK +RST+TQ +LDQL DLQ KE + LEAN+ L  KL+E    NN
Sbjct  120   NTKELEQLERHLESSLKQVRSTKTQYMLDQLGDLQNKEHMLLEANRALTMKLDEISARNN  179

Query  835   LQQPW-GPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvna  1011
             L+  W G  +QS +Y  QHA Q+ G FQ LEC+ TL IG+N V  S QITAA  AQ V+ 
Sbjct  180   LRPSWEGDDQQSMSYGHQHA-QSQGLFQHLECNPTLQIGYNSVG-SDQITAAHAAQQVHG  237

Query  1012  vLPGWML  1032
              +PGWML
Sbjct  238   FIPGWML  244



>gb|ABF50239.1| SEPALLATA, partial [Nicotiana langsdorffii x Nicotiana sanderae]
Length=216

 Score =   291 bits (746),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 172/232 (74%), Positives = 192/232 (83%), Gaps = 18/232 (8%)
 Frame = +1

Query  343   RQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSSTSNMLKTLERYQKCSYG  522
             RQVTFAKRRNGLLKKAYELSVLC+AEVALI+FS RGKLYEFSSTSN LKTLERYQKCSYG
Sbjct  1     RQVTFAKRRNGLLKKAYELSVLCEAEVALIIFSTRGKLYEFSSTSNTLKTLERYQKCSYG  60

Query  523   TLEVNRPNKD-NEQssykeylklkgkyeslQRYQRHLLGEDLGPLNIDEIEHLEHQLDTS  699
             TLEV +  +D NE+  Y+EYLKLK KYESLQRYQRHLLG++LGPLNIDE+EHLE QLDTS
Sbjct  61    TLEVKQSGRDTNEEKFYREYLKLKSKYESLQRYQRHLLGDELGPLNIDELEHLELQLDTS  120

Query  700   LKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNNLQQPW-GPGEQSGAY  876
             LKHI+STR              EKLW+EANK LE KLEE Y +NNLQQ W G GEQSGAY
Sbjct  121   LKHIKSTR--------------EKLWIEANKGLERKLEEIYAENNLQQSWGGGGEQSGAY  166

Query  877   SQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvnavLPGWML  1032
             SQQH  QT GFFQPLEC+STL IG++P A+SSQIT  T+ QN+N ++PGWML
Sbjct  167   SQQHP-QTQGFFQPLECNSTLQIGYDP-ASSSQITGVTSGQNINGIVPGWML  216



>ref|XP_007139420.1| hypothetical protein PHAVU_008G027900g [Phaseolus vulgaris]
 gb|ESW11414.1| hypothetical protein PHAVU_008G027900g [Phaseolus vulgaris]
Length=248

 Score =   292 bits (748),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 169/250 (68%), Positives = 201/250 (80%), Gaps = 6/250 (2%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             ++MLKTLERYQKCSYG +EV++P K+ E SSY+EYLKLK ++ESLQR QR+LLGEDLGPL
Sbjct  61    TSMLKTLERYQKCSYGAVEVSKPAKELE-SSYREYLKLKARFESLQRTQRNLLGEDLGPL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             N  E+E LE QLD+SLK +RST+TQ +LDQL+DLQ KE++ +EAN++L  KL+E    N+
Sbjct  120   NTKELEQLERQLDSSLKQVRSTKTQFMLDQLADLQNKEQMLVEANRSLTMKLDEINSRNH  179

Query  835   LQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIG----FNPVATSSQItaatnaqn  1002
              +Q W  G+QS  Y       + GFFQPLEC+ TL IG    +N VA S QITA T AQ 
Sbjct  180   YRQSWEAGDQSMQYGGPQNSHSQGFFQPLECNPTLQIGPDYRYNVVA-SDQITATTPAQQ  238

Query  1003  vnavLPGWML  1032
             V+  +PGWML
Sbjct  239   VSGFIPGWML  248



>gb|ABG78619.1| MADS4 [Populus tomentosa]
Length=245

 Score =   291 bits (746),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 163/247 (66%), Positives = 193/247 (78%), Gaps = 3/247 (1%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF ST
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCST  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             SNMLKTLERYQKCSYG  EVN+P K+ E  SY+EYLK+K ++E+LQR QR+LLGEDLGPL
Sbjct  61    SNMLKTLERYQKCSYGAEEVNKPAKELEN-SYREYLKVKARFEALQRTQRNLLGEDLGPL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             N  ++E LE QL++SL  +RST+TQ +LDQL+DLQ KE L LEAN+ L  KL+E    N+
Sbjct  120   NTKDLEQLERQLESSLNQVRSTKTQYMLDQLADLQNKEHLLLEANRGLTMKLDEISARNS  179

Query  835   LQQPW-GPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvna  1011
             L+  W G  +Q+ +Y  QHA Q+ G FQ LEC+ TL IG+NPV +          Q V+ 
Sbjct  180   LRPSWEGDDQQNMSYGHQHA-QSQGLFQALECNPTLQIGYNPVGSDQMSCTTHATQQVHG  238

Query  1012  vLPGWML  1032
              +PGWML
Sbjct  239   FIPGWML  245



>gb|AAC25922.1| MADS-box protein 1 [Malus domestica]
Length=246

 Score =   291 bits (746),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 172/248 (69%), Positives = 204/248 (82%), Gaps = 4/248 (2%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLE-VNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGP  651
             S+MLKTL+RYQKCSYG ++ VNRP K+ E SSY+EY+KLKG+YESLQR QR+LLGEDLGP
Sbjct  61    SSMLKTLDRYQKCSYGAVDQVNRPAKELE-SSYREYMKLKGRYESLQRTQRNLLGEDLGP  119

Query  652   LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDN  831
             LN  E+E LE QL+ SLK +RST+TQ +LDQLSDLQ KE+L +EAN+ L  KL+E    N
Sbjct  120   LNTKELEQLERQLEGSLKQVRSTKTQYMLDQLSDLQNKEQLLIEANRDLTMKLDEISSRN  179

Query  832   NLQQPWGPGEQSGAYS-QQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvn  1008
              L+Q W  G+Q  AY+ Q H  Q+ GFFQPL+C+ TL +G++ V  S Q++A TNAQ VN
Sbjct  180   QLRQSWEGGDQGMAYATQHHHAQSQGFFQPLDCNPTLQMGYSAVG-SEQMSATTNAQQVN  238

Query  1009  avLPGWML  1032
               +PGWML
Sbjct  239   CFIPGWML  246



>ref|XP_010694117.1| PREDICTED: developmental protein SEPALLATA 1 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=252

 Score =   291 bits (746),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 169/248 (68%), Positives = 201/248 (81%), Gaps = 5/248 (2%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S 
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSG  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
              +MLKTLERYQKCSYG +EVN+P+K+ EQSSY+EYLKLK ++ESLQR QR+LLGEDLGPL
Sbjct  61    PSMLKTLERYQKCSYGGVEVNKPSKELEQSSYREYLKLKARHESLQRTQRNLLGEDLGPL  120

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLES-KLEEFYVDN  831
             N+ E++ LE QL++SLK IRST+TQ +LDQL+DLQ KE   +EANKTL++ +L+   V +
Sbjct  121   NVKELDQLERQLESSLKQIRSTKTQSMLDQLTDLQNKEHALMEANKTLKTEQLDRIMVKD  180

Query  832   NLQ--QPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnv  1005
               Q  Q W   EQ+  Y QQHA Q+ G FQPL+C+ TL IG+NP  +S Q+T AT+   V
Sbjct  181   TQQFRQTWDGSEQNVHYGQQHA-QSQGLFQPLDCNPTLQIGYNP-ESSEQMTVATSHTQV  238

Query  1006  navLPGWM  1029
                LPGWM
Sbjct  239   PGFLPGWM  246



>ref|XP_008230292.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X4 
[Prunus mume]
Length=244

 Score =   291 bits (745),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 169/247 (68%), Positives = 205/247 (83%), Gaps = 4/247 (2%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             S++LKTLERYQKCSYG +EVN+P K+ E SSY+EYLKLKG++ESLQR QR+LLGE+LGPL
Sbjct  61    SSILKTLERYQKCSYGQVEVNKPAKELE-SSYREYLKLKGRFESLQRTQRNLLGEELGPL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             N  E+E LE QL++SLK +RST+TQ +LDQLSDLQ KE++ +EAN+ L  KL++    N 
Sbjct  120   NTKELEQLERQLESSLKQVRSTKTQYMLDQLSDLQNKEQMLIEANRDLSLKLDDISSRNQ  179

Query  835   LQQPWGPGEQSG-AYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvna  1011
             ++Q W  G Q G AY  QHA Q+ GFFQPL+C+ TL IG++ V  S Q++A T+AQ VN 
Sbjct  180   IRQSWEGGNQGGMAYGTQHA-QSQGFFQPLDCNPTLQIGYSNVG-SEQMSATTHAQQVNG  237

Query  1012  vLPGWML  1032
              +PGWML
Sbjct  238   FIPGWML  244



>gb|KHN29767.1| Developmental protein SEPALLATA 2 [Glycine soja]
Length=248

 Score =   291 bits (745),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 168/250 (67%), Positives = 199/250 (80%), Gaps = 6/250 (2%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRR+GLLKKAYELSVLCDAEVALI+FS RGKLYEF ST
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRDGLLKKAYELSVLCDAEVALIIFSTRGKLYEFCST  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             ++MLKTLERYQKCSYG +EV++P K+ E SSY+EYLKLK ++ESLQR QR+LLGEDLGPL
Sbjct  61    NSMLKTLERYQKCSYGAVEVSKPGKELE-SSYREYLKLKARFESLQRTQRNLLGEDLGPL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             N  ++E LE QLD+SLK +RST+TQ +LDQL+DLQ KE + +EAN++L  KLEE    N 
Sbjct  120   NTKDLEQLERQLDSSLKQVRSTKTQFMLDQLADLQNKEHMLVEANRSLTMKLEEINSRNQ  179

Query  835   LQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIG----FNPVATSSQItaatnaqn  1002
              +Q W  GEQS  Y  Q+A  + GFFQPLEC+ TL IG    + P A+  Q+ A T AQ 
Sbjct  180   YRQTWEAGEQSMPYGTQNA-HSQGFFQPLECNPTLQIGSDYRYIPEASEQQLAATTQAQQ  238

Query  1003  vnavLPGWML  1032
             VN  +PGWML
Sbjct  239   VNGFIPGWML  248



>ref|XP_007215877.1| hypothetical protein PRUPE_ppa010548mg [Prunus persica]
 gb|ABO27622.1| transcription factor MADS7 [Prunus persica]
 gb|EMJ17076.1| hypothetical protein PRUPE_ppa010548mg [Prunus persica]
Length=245

 Score =   290 bits (743),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 171/248 (69%), Positives = 206/248 (83%), Gaps = 5/248 (2%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEF-SS  471
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALI+FSNRGKLYEF SS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  60

Query  472   TSNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGP  651
             +S++LKTLERYQKCSYG +EVN+P K+ E SSY+EYLKLKG++ESLQR QR+LLGEDLGP
Sbjct  61    SSSILKTLERYQKCSYGQVEVNKPAKELE-SSYREYLKLKGRFESLQRTQRNLLGEDLGP  119

Query  652   LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDN  831
             LN  E+E LE QL++SLK +RST+TQ +LDQLSDLQ KE++ +EAN+ L  KL++    N
Sbjct  120   LNTKELEQLERQLESSLKQVRSTKTQYMLDQLSDLQNKEQMLIEANRDLSLKLDDISSRN  179

Query  832   NLQQPWGPGEQSG-AYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvn  1008
              ++Q W  G Q G AY  QHA Q+ GFFQPL+C+ TL IG++ V  S Q++A T+AQ VN
Sbjct  180   QIRQSWEGGNQGGMAYGSQHA-QSQGFFQPLDCNPTLQIGYSNVG-SEQMSATTHAQQVN  237

Query  1009  avLPGWML  1032
               +PGWML
Sbjct  238   GFIPGWML  245



>gb|AFM30904.1| transcription factor MADS4 [Prunus avium]
Length=244

 Score =   290 bits (741),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 169/247 (68%), Positives = 204/247 (83%), Gaps = 4/247 (2%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             S++LKTLERYQKCSYG +EVN+P K+ E SSY+EYLKLKG++ESLQR QR+LLGEDLGPL
Sbjct  61    SSILKTLERYQKCSYGQVEVNKPAKELE-SSYREYLKLKGRFESLQRTQRNLLGEDLGPL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             N  E+E LE QL++SLK +RST+TQ +LDQLSDLQ KE++ +EAN+ L  KL++    N 
Sbjct  120   NTKELEQLERQLESSLKQVRSTKTQYMLDQLSDLQNKEQMLIEANRDLTLKLDDISSRNQ  179

Query  835   LQQPWGPGEQSG-AYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvna  1011
             ++Q W  G Q G AY  QHA Q+ GFFQPL+C+  L IG++ V  S Q++A T+AQ VN 
Sbjct  180   IRQSWEGGNQGGMAYGTQHA-QSQGFFQPLDCNPPLQIGYSNVG-SEQMSATTHAQQVNG  237

Query  1012  vLPGWML  1032
              +PGWML
Sbjct  238   FIPGWML  244



>ref|XP_004507288.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X2 
[Cicer arietinum]
Length=247

 Score =   290 bits (742),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 169/250 (68%), Positives = 201/250 (80%), Gaps = 7/250 (3%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
              +MLKTLERYQKCSYG +EVN+P K+ E SSY+EYLKLK ++ESLQR QR+LLGEDLGPL
Sbjct  61    PSMLKTLERYQKCSYGAVEVNKPAKELE-SSYREYLKLKARFESLQRTQRNLLGEDLGPL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
                ++E LEHQLD+SLK +RST+TQ +LDQL+DLQ KE + ++AN++L  KLEE    N 
Sbjct  120   GTKDLEQLEHQLDSSLKQVRSTKTQFMLDQLADLQNKEHMLVDANRSLNMKLEEINSRNQ  179

Query  835   LQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIG----FNPVATSSQItaatnaqn  1002
              +Q W  G+QS AY  Q+   +  FFQPL+C+ TL IG    ++PVA S Q+TA T AQ 
Sbjct  180   YRQTWEAGDQSMAYGTQNP-HSQSFFQPLDCNPTLQIGSDYRYSPVA-SDQLTATTQAQQ  237

Query  1003  vnavLPGWML  1032
             VN  +PGWML
Sbjct  238   VNGFIPGWML  247



>ref|XP_010694134.1| PREDICTED: developmental protein SEPALLATA 1 isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=250

 Score =   290 bits (742),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 168/247 (68%), Positives = 200/247 (81%), Gaps = 5/247 (2%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S 
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSG  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
              +MLKTLERYQKCSYG +EVN+P+K+ E SSY+EYLKLK ++ESLQR QR+LLGEDLGPL
Sbjct  61    PSMLKTLERYQKCSYGGVEVNKPSKELE-SSYREYLKLKARHESLQRTQRNLLGEDLGPL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             N+ E++ LE QL++SLK IRST+TQ +LDQL+DLQ KE   +EANKTL+++L+   V + 
Sbjct  120   NVKELDQLERQLESSLKQIRSTKTQSMLDQLTDLQNKEHALMEANKTLKTELDRIMVKDT  179

Query  835   LQ--QPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvn  1008
              Q  Q W   EQ+  Y QQHA Q+ G FQPL+C+ TL IG+NP  +S Q+T AT+   V 
Sbjct  180   QQFRQTWDGSEQNVHYGQQHA-QSQGLFQPLDCNPTLQIGYNP-ESSEQMTVATSHTQVP  237

Query  1009  avLPGWM  1029
               LPGWM
Sbjct  238   GFLPGWM  244



>ref|NP_001280893.1| developmental protein SEPALLATA 1 [Malus domestica]
 emb|CAA04919.1| MdMADS8 [Malus domestica]
Length=246

 Score =   290 bits (741),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 171/248 (69%), Positives = 204/248 (82%), Gaps = 4/248 (2%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLE-VNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGP  651
             S++LKTL+RYQKCSYG ++ VNRP K+ E SSY+EY+KLKG+YESLQR QR+LLGEDLGP
Sbjct  61    SSILKTLDRYQKCSYGAVDQVNRPAKELE-SSYREYMKLKGRYESLQRTQRNLLGEDLGP  119

Query  652   LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDN  831
             LN  E+E LE QL+ SLK +RST+TQ +LDQLSDLQ KE+L +EAN+ L  KL+E    N
Sbjct  120   LNTKELEQLERQLEGSLKQVRSTKTQYMLDQLSDLQNKEQLLIEANRDLTMKLDEISSRN  179

Query  832   NLQQPWGPGEQSGAYS-QQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvn  1008
              L+Q W  G+Q  AY+ Q H  Q+ GFFQPL+C+ TL +G++ V  S Q++A TNAQ VN
Sbjct  180   QLRQSWEGGDQGMAYATQHHHAQSQGFFQPLDCNPTLQMGYSAVG-SEQMSATTNAQQVN  238

Query  1009  avLPGWML  1032
               +PGWML
Sbjct  239   CFIPGWML  246



>gb|KEH25149.1| MADS-box transcription factor [Medicago truncatula]
Length=250

 Score =   289 bits (740),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 168/252 (67%), Positives = 201/252 (80%), Gaps = 8/252 (3%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
              +MLKTL+RYQKCSYG +EVN+P K+ E SSY+EYLKLK ++ESLQR QR+LLGEDLGPL
Sbjct  61    PSMLKTLDRYQKCSYGAVEVNKPAKELE-SSYREYLKLKARFESLQRTQRNLLGEDLGPL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVD--  828
                ++E LE QLD+SLK +RST+TQ +LDQL+DLQ KE + +EAN++L  KLEE  ++  
Sbjct  120   GTKDLEQLERQLDSSLKQVRSTKTQFMLDQLADLQNKEHMLVEANRSLSMKLEEININSR  179

Query  829   NNLQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIG----FNPVATSSQItaatna  996
             N  +Q W  G+QS AY  Q+A  +  FFQPLEC+ TL IG    ++P   S Q+TA T A
Sbjct  180   NQYRQTWEAGDQSMAYGNQNA-HSQSFFQPLECNPTLQIGTDYRYSPPVASDQLTATTQA  238

Query  997   qnvnavLPGWML  1032
             Q VN  +PGWML
Sbjct  239   QQVNGFIPGWML  250



>ref|XP_003621519.1| MADS-box protein [Medicago truncatula]
Length=245

 Score =   289 bits (739),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 160/246 (65%), Positives = 193/246 (78%), Gaps = 1/246 (0%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FS RGKLYEF ST
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLYEFCST  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             SNMLKTL+RYQKCSYG +EV++P K+ E SSY+EYLKLK ++E+LQR QR+LLGEDLGPL
Sbjct  61    SNMLKTLDRYQKCSYGAVEVSKPAKELE-SSYREYLKLKQRFENLQRAQRNLLGEDLGPL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             +  ++E LE QLD+SLK +RST+TQ +LDQL+DLQ KE + +EAN++L  KLEE    N+
Sbjct  120   SSKDLEQLERQLDSSLKQVRSTKTQFMLDQLADLQNKEHMLVEANRSLSIKLEEINSRNH  179

Query  835   LQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvnav  1014
              +Q W   +QS  Y  Q    +  FFQ LEC+ TL IG+N VA+    + +   Q VN  
Sbjct  180   YRQSWEASDQSMQYEAQQNAHSQSFFQQLECNPTLQIGYNNVASDQIASTSQAQQQVNGF  239

Query  1015  LPGWML  1032
             +PGWML
Sbjct  240   VPGWML  245



>ref|XP_009373783.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X2 
[Pyrus x bretschneideri]
 ref|XP_009333662.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X2 
[Pyrus x bretschneideri]
 dbj|BAK18787.2| MADS-box protein [Pyrus pyrifolia var. culta]
Length=246

 Score =   288 bits (738),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 170/248 (69%), Positives = 203/248 (82%), Gaps = 4/248 (2%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLE-VNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGP  651
             S++LKTL+RYQKCSYG ++ VNRP K+ E SSY+EY+KLKG+YESLQR QR+LLGEDLGP
Sbjct  61    SSILKTLDRYQKCSYGAVDQVNRPAKELE-SSYREYMKLKGRYESLQRTQRNLLGEDLGP  119

Query  652   LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDN  831
             LN  E+E LE QL+ SLK +RST+TQ +LDQLSDLQ KE+L +EAN+ L  KL+E    N
Sbjct  120   LNTKELEQLERQLEGSLKQVRSTKTQYMLDQLSDLQNKEQLLIEANRDLTMKLDEISSRN  179

Query  832   NLQQPWGPGEQSGAYS-QQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvn  1008
              L+Q W  G+Q  AY+ Q H  Q+ GFFQPL+C+ TL +G++  A S Q++A TN Q VN
Sbjct  180   QLRQSWEGGDQGMAYATQHHHAQSQGFFQPLDCNPTLQMGYS-AAGSEQMSATTNGQQVN  238

Query  1009  avLPGWML  1032
               +PGWML
Sbjct  239   CFIPGWML  246



>ref|XP_008230290.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X2 
[Prunus mume]
Length=245

 Score =   288 bits (737),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 170/248 (69%), Positives = 206/248 (83%), Gaps = 5/248 (2%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEF-SS  471
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALI+FSNRGKLYEF SS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  60

Query  472   TSNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGP  651
             +S++LKTLERYQKCSYG +EVN+P K+ E SSY+EYLKLKG++ESLQR QR+LLGE+LGP
Sbjct  61    SSSILKTLERYQKCSYGQVEVNKPAKELE-SSYREYLKLKGRFESLQRTQRNLLGEELGP  119

Query  652   LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDN  831
             LN  E+E LE QL++SLK +RST+TQ +LDQLSDLQ KE++ +EAN+ L  KL++    N
Sbjct  120   LNTKELEQLERQLESSLKQVRSTKTQYMLDQLSDLQNKEQMLIEANRDLSLKLDDISSRN  179

Query  832   NLQQPWGPGEQSG-AYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvn  1008
              ++Q W  G Q G AY  QHA Q+ GFFQPL+C+ TL IG++ V  S Q++A T+AQ VN
Sbjct  180   QIRQSWEGGNQGGMAYGTQHA-QSQGFFQPLDCNPTLQIGYSNVG-SEQMSATTHAQQVN  237

Query  1009  avLPGWML  1032
               +PGWML
Sbjct  238   GFIPGWML  245



>gb|AFU81295.1| SEPALLATA1 [Medicago polyceratia]
Length=249

 Score =   288 bits (737),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 163/250 (65%), Positives = 195/250 (78%), Gaps = 5/250 (2%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FS RGKLYEF ST
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLYEFCST  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             SNMLKTL+RYQKCSYG +EV++P K+ E SSY+EYLKLK ++E+LQR QR+LLGEDLGPL
Sbjct  61    SNMLKTLDRYQKCSYGAVEVSKPAKELE-SSYREYLKLKQRFENLQRTQRNLLGEDLGPL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             +  ++E LE QLD+SLK +RST+TQ +LDQL+DLQ KE + +EAN++L  KLEE    N+
Sbjct  120   SSKDLEQLERQLDSSLKQVRSTKTQFMLDQLADLQNKEHMLVEANRSLSIKLEEINSRNH  179

Query  835   LQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIG----FNPVATSSQItaatnaqn  1002
              +Q W  GEQS  YS Q    +  FFQ LEC+ TL IG    +N VA+    + +   Q 
Sbjct  180   YRQSWEAGEQSMQYSAQQNAHSQSFFQQLECNPTLQIGSDYRYNNVASDQIASTSQAQQQ  239

Query  1003  vnavLPGWML  1032
             VN  +PGWML
Sbjct  240   VNGFVPGWML  249



>gb|AAP83411.1| SEPALLATA1-like MADS-box [Syringa vulgaris]
Length=207

 Score =   286 bits (733),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 154/201 (77%), Positives = 175/201 (87%), Gaps = 1/201 (0%)
 Frame = +1

Query  310  VELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSSTSNMLK  489
            V+L+R+ENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF STSNMLK
Sbjct  3    VQLRRMENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSTSNMLK  62

Query  490  TLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPLNIDEI  669
            TLERYQKCSYG+LEVN   +D E+SS +EYLKLK KYESLQR+QRHLLG++LGPLNI+++
Sbjct  63   TLERYQKCSYGSLEVNNSTRDLEESSNREYLKLKSKYESLQRHQRHLLGDELGPLNINDL  122

Query  670  EHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNNLQQPW  849
            EHLEHQL+TSLKHIRSTRTQ+++DQLSDLQ KEK+ +E N  LE KLEE Y  N LQQ W
Sbjct  123  EHLEHQLETSLKHIRSTRTQVMVDQLSDLQAKEKMMVETNTALERKLEEIYAANQLQQSW  182

Query  850  GPGEQSGAYSQQHADQTHGFF  912
              GEQS AYSQQH +    FF
Sbjct  183  AGGEQSCAYSQQHLN-LRTFF  202



>ref|XP_007151389.1| hypothetical protein PHAVU_004G042300g [Phaseolus vulgaris]
 gb|ESW23383.1| hypothetical protein PHAVU_004G042300g [Phaseolus vulgaris]
Length=247

 Score =   288 bits (737),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 170/250 (68%), Positives = 200/250 (80%), Gaps = 7/250 (3%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FS RGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             S+MLKTLERYQKCSYG +EV++P K+ E SSY+EYLKLKG++ESLQR QR+LLGEDLGPL
Sbjct  61    SSMLKTLERYQKCSYGAVEVSKPAKELE-SSYREYLKLKGRFESLQRTQRNLLGEDLGPL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             N  E+E LE QLD+SLK +RST+TQ +LDQL+DLQ KE++ +EAN+ L  KL+E    N 
Sbjct  120   NTKELEQLERQLDSSLKQVRSTKTQFMLDQLADLQNKEQMLVEANRALTMKLDEINSRNQ  179

Query  835   LQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIG----FNPVATSSQItaatnaqn  1002
              +Q W  G+QS  Y   +A  + GFFQPLEC+ TL IG    +NP A S Q+T  T AQ 
Sbjct  180   YRQTWEAGDQSMPYGTPNA-HSQGFFQPLECNPTLQIGSDYRYNPEA-SDQLTGTTQAQQ  237

Query  1003  vnavLPGWML  1032
             VN  +PGWML
Sbjct  238   VNGFIPGWML  247



>gb|AAL08423.2|AF185574_1 transcription factor MAGL4 [Populus tremuloides]
Length=245

 Score =   288 bits (736),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 162/247 (66%), Positives = 191/247 (77%), Gaps = 3/247 (1%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF ST
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCST  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             SNMLKTLERYQKCSYG  EVN+P K+ E  SY+EYLK+K ++E LQR QR+LLGEDLGPL
Sbjct  61    SNMLKTLERYQKCSYGAEEVNKPAKELEN-SYREYLKVKARFEGLQRTQRNLLGEDLGPL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             N  ++E LE QL++SL  +RST+TQ +LDQL+DLQ KE L  EAN+ L  KL+E    N+
Sbjct  120   NTKDLEQLERQLESSLNQVRSTKTQYMLDQLADLQNKEHLLQEANRGLTIKLDEISARNS  179

Query  835   LQQPW-GPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvna  1011
             L+  W G  +Q+ +Y  QHA Q+ G FQ LEC+ TL IG+NPV +          Q V+ 
Sbjct  180   LRPSWEGDDQQNMSYGHQHA-QSQGLFQALECNPTLQIGYNPVGSDQVSAITHATQQVHG  238

Query  1012  vLPGWML  1032
              +PGWML
Sbjct  239   FIPGWML  245



>ref|XP_010029406.1| PREDICTED: developmental protein SEPALLATA 1 [Eucalyptus grandis]
 gb|KCW56317.1| hypothetical protein EUGRSUZ_I02058 [Eucalyptus grandis]
Length=247

 Score =   287 bits (735),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 160/249 (64%), Positives = 194/249 (78%), Gaps = 5/249 (2%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FS RGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
              +MLKTL+RYQKCSYG++EVN+P+K+ E  +Y+EYLKLKG++E+LQR QR+L+GEDLGPL
Sbjct  61    PSMLKTLDRYQKCSYGSVEVNKPSKELEN-AYREYLKLKGRFEALQRTQRNLMGEDLGPL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             N  E+E LE QL+ SLKHIRST+TQ +LDQLSDLQ KE+  +EAN+ L  KL+E    NN
Sbjct  120   NSKELEQLERQLEASLKHIRSTKTQCMLDQLSDLQDKEQSLMEANRALTLKLDEVCARNN  179

Query  835   LQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVAT---SSQItaatnaqnv  1005
             L+ PW  G+ S  Y Q H  Q+  FFQPLEC+ TL IG++   +   ++        Q  
Sbjct  180   LRPPWEAGDPSMTYGQPHP-QSQEFFQPLECNPTLQIGYDAGGSDQLNTSAATPNAPQQA  238

Query  1006  navLPGWML  1032
             +  LPGWML
Sbjct  239   SGFLPGWML  247



>gb|ADR83588.1| Sepallata 1-like protein [Platanus x acerifolia]
Length=244

 Score =   286 bits (733),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 170/247 (69%), Positives = 198/247 (80%), Gaps = 4/247 (2%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEF-SS  471
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF SS
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  472   TSNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGP  651
             +S+MLKTL RYQ+CSYGTLE ++P K+  QSSY+EYLKLK + E LQR QR+LLGEDLG 
Sbjct  61    SSSMLKTLGRYQRCSYGTLEASQPPKET-QSSYQEYLKLKARVELLQRSQRNLLGEDLGS  119

Query  652   LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDN  831
             LN  E+E LEHQL+ SLK +RST+TQ++LDQLSDLQ KE +  EAN+ L  KL+E   +N
Sbjct  120   LNTKELEQLEHQLEMSLKQVRSTKTQLMLDQLSDLQEKEHMPQEANRALRRKLDESSTEN  179

Query  832   NLQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvna  1011
              L+  W  G Q+  Y++Q A Q+ GFFQ LEC+STL IG+NPV    QIT    AQNVN 
Sbjct  180   PLRLSWEAGGQNIPYNRQPA-QSEGFFQALECNSTLQIGYNPVG-PDQITVTAPAQNVNG  237

Query  1012  vLPGWML  1032
              +PGWML
Sbjct  238   FIPGWML  244



>gb|AGS42240.1| MADS-box protein [Daucus carota]
Length=251

 Score =   286 bits (732),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 178/253 (70%), Positives = 203/253 (80%), Gaps = 9/253 (4%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF ST
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCST  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             SNMLKTLERYQ CS+GTLEVNR  KD EQ+SY+EYLKLKGKY+SLQ+YQRHLLGEDLGPL
Sbjct  61    SNMLKTLERYQNCSHGTLEVNRTAKDLEQNSYREYLKLKGKYDSLQQYQRHLLGEDLGPL  120

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             NI ++EHLE QLD SL HIRST+TQ +LDQLS+LQ KE++ LE N  LE KL E++ +  
Sbjct  121   NIKDLEHLELQLDESLMHIRSTKTQNMLDQLSELQNKERILLETNTALEEKLREYHSETQ  180

Query  835   LQQPWGPGEQSGAY-------SQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatn  993
             L+Q W  GE S +Y        QQ   Q+ GFFQPL+C+STL IG+N V +       TN
Sbjct  181   LRQLWPGGEVSASYGQQQHHQHQQQQGQSQGFFQPLDCNSTLQIGYNAVGSDQMT--GTN  238

Query  994   aqnvnavLPGWML  1032
              QNVN ++P WML
Sbjct  239   GQNVNGLVPDWML  251



>ref|XP_007151388.1| hypothetical protein PHAVU_004G042300g [Phaseolus vulgaris]
 gb|ESW23382.1| hypothetical protein PHAVU_004G042300g [Phaseolus vulgaris]
Length=217

 Score =   284 bits (727),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 155/218 (71%), Positives = 182/218 (83%), Gaps = 1/218 (0%)
 Frame = +1

Query  295  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FS RGKLYEF S+
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLYEFCSS  60

Query  475  SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
            S+MLKTLERYQKCSYG +EV++P K+ EQSSY+EYLKLKG++ESLQR QR+LLGEDLGPL
Sbjct  61   SSMLKTLERYQKCSYGAVEVSKPAKELEQSSYREYLKLKGRFESLQRTQRNLLGEDLGPL  120

Query  655  NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
            N  E+E LE QLD+SLK +RST+TQ +LDQL+DLQ KE++ +EAN+ L  KL+E    N 
Sbjct  121  NTKELEQLERQLDSSLKQVRSTKTQFMLDQLADLQNKEQMLVEANRALTMKLDEINSRNQ  180

Query  835  LQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIG  948
             +Q W  G+QS  Y   +A  + GFFQPLEC+ TL IG
Sbjct  181  YRQTWEAGDQSMPYGTPNA-HSQGFFQPLECNPTLQIG  217



>gb|AET98846.1| SEPALLATA1 [Passiflora edulis]
Length=242

 Score =   285 bits (729),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 170/246 (69%), Positives = 196/246 (80%), Gaps = 4/246 (2%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFS RGKLYEF ST
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSTRGKLYEFCST  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             SNMLKTLERYQKCSYG  +VN+P K+ E SSY+EYLKLK ++E+LQR QR+LLGEDLGPL
Sbjct  61    SNMLKTLERYQKCSYGVEDVNKPAKELE-SSYREYLKLKARFETLQRTQRNLLGEDLGPL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             N  ++E LE QL+ SLK +RST+TQ +LDQL+DLQ KE L LEAN+TL  KL+E    N 
Sbjct  120   NTKDLEQLERQLEGSLKLVRSTKTQYMLDQLADLQNKEHLLLEANRTLTIKLDEISARNQ  179

Query  835   LQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvnav  1014
             L+Q W  GEQS  Y  Q A  + G F  LEC+ TL IG+N V  S QI A++++Q VN  
Sbjct  180   LRQ-WEDGEQSVPYGHQQA-HSQGLFHALECNPTLQIGYNSVG-SDQIPASSHSQQVNGF  236

Query  1015  LPGWML  1032
             +PGWML
Sbjct  237   IPGWML  242



>gb|AAZ77748.1| AGL2-like MADS box 3 [Castanea mollissima]
Length=243

 Score =   285 bits (729),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 166/246 (67%), Positives = 196/246 (80%), Gaps = 3/246 (1%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVE+KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF ST
Sbjct  1     MGRGRVEVKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCST  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             S+MLKTLERYQKCSYG +EVN+P K+ E  SY+EYLKLK ++ESLQR QR+LLGEDLGPL
Sbjct  61    SSMLKTLERYQKCSYGAVEVNKPGKELE-ISYREYLKLKARFESLQRTQRNLLGEDLGPL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             N +++E LE QLD+SLK     R Q +LDQLSDLQ KE L +EAN+ L  KL+E    NN
Sbjct  120   NTNDLERLERQLDSSLKKSGPLR-QYMLDQLSDLQNKEHLLVEANRALAIKLDEISPRNN  178

Query  835   LQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvnav  1014
             L+Q W  GEQS +Y  Q+A  +  FFQPL+C+ TL IG+N   +  Q++  T+AQ VN  
Sbjct  179   LRQSWEGGEQSMSYGPQNA-HSQSFFQPLDCNPTLQIGYNASGSDQQLSGTTHAQQVNGF  237

Query  1015  LPGWML  1032
             +PGWML
Sbjct  238   IPGWML  243



>gb|AAX69068.1| MADS box protein M6 [Pisum sativum]
Length=249

 Score =   285 bits (729),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 160/250 (64%), Positives = 194/250 (78%), Gaps = 5/250 (2%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FS RGKLYEF ST
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLYEFCST  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             SNMLKTL+RYQKCSYG +EV++P K+ E SSY+EYLKLK ++E+LQR QR+LLGEDLGPL
Sbjct  61    SNMLKTLDRYQKCSYGAVEVSKPAKELE-SSYREYLKLKQRFENLQRTQRNLLGEDLGPL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             +  ++E LE QLD+SLKH+RST+TQ +LDQL+DLQ KE + +EAN++L  KL+E    N 
Sbjct  120   SSKDLEQLERQLDSSLKHVRSTKTQFMLDQLADLQNKEHMLVEANRSLSMKLDEINSRNQ  179

Query  835   LQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIG----FNPVATSSQItaatnaqn  1002
              +Q W  G+QS  Y  Q    +  FFQ L+C+ TL IG    +N VA+    + +   Q 
Sbjct  180   YRQSWEAGDQSMQYGDQQNAHSQSFFQQLDCNPTLQIGSDYRYNNVASDQIASTSQAQQQ  239

Query  1003  vnavLPGWML  1032
             VN  +PGWML
Sbjct  240   VNGFVPGWML  249



>gb|AFK42306.1| unknown [Medicago truncatula]
Length=250

 Score =   285 bits (729),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 166/252 (66%), Positives = 200/252 (79%), Gaps = 8/252 (3%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINR+VTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYE  S+
Sbjct  1     MGRGRVELKRIENKINRRVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYELCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
              +MLKTL+RYQKCSYG +EVN+P K+ E SSY+EYLKLK ++ESLQR QR+LLGEDLGPL
Sbjct  61    PSMLKTLDRYQKCSYGAVEVNKPAKELE-SSYREYLKLKARFESLQRTQRNLLGEDLGPL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVD--  828
                ++E LE QLD+SLK +RST+TQ +LDQL+DLQ KE + +EAN++L  KLEE  ++  
Sbjct  120   GTKDLEQLERQLDSSLKQVRSTKTQFMLDQLADLQNKEHMLVEANRSLSMKLEEININSR  179

Query  829   NNLQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIG----FNPVATSSQItaatna  996
             N  +Q W  G+QS AY  Q+A  +  FFQPLEC+ TL IG    ++P   S Q+TA T A
Sbjct  180   NQYRQTWEAGDQSMAYGNQNA-HSQSFFQPLECNPTLQIGTDYRYSPPVASDQLTATTQA  238

Query  997   qnvnavLPGWML  1032
             Q VN  +PGWML
Sbjct  239   QQVNGFIPGWML  250



>ref|XP_009378252.1| PREDICTED: developmental protein SEPALLATA 1-like [Pyrus x bretschneideri]
Length=246

 Score =   285 bits (728),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 168/248 (68%), Positives = 198/248 (80%), Gaps = 4/248 (2%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLE-VNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGP  651
              ++LKTL+RYQKCSYG ++ VN P K+ E SS +EY+KLKG+ ESLQR QR+LLGEDLGP
Sbjct  61    PSILKTLDRYQKCSYGAVDQVNIPAKELE-SSCREYMKLKGRCESLQRTQRNLLGEDLGP  119

Query  652   LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDN  831
             LN  E+E LE QL+ SLK +RST+TQ +LDQLSDLQ KE+L +EAN+ L  KL+E    N
Sbjct  120   LNTKELEQLERQLEASLKQVRSTKTQYLLDQLSDLQNKEQLLIEANRDLTMKLDEIGSRN  179

Query  832   NLQQPWGPGEQSGAY-SQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvn  1008
              L+Q W  G+Q  AY +Q H  Q+ GFFQPL+C+ TL IG+ P   S Q+ A T+AQ VN
Sbjct  180   QLRQSWEGGDQGMAYGTQHHHAQSQGFFQPLDCNPTLQIGY-PAEGSEQMGATTHAQQVN  238

Query  1009  avLPGWML  1032
               +PGWML
Sbjct  239   CFIPGWML  246



>ref|XP_004491903.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X1 
[Cicer arietinum]
Length=250

 Score =   284 bits (727),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 159/250 (64%), Positives = 193/250 (77%), Gaps = 4/250 (2%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FS RGKLYEF ST
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLYEFCST  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             SNMLKTL+RYQKCSYG +EV++P K+ EQSSY+EYLKLK ++E+LQ+ QR+LLGEDLGPL
Sbjct  61    SNMLKTLDRYQKCSYGAVEVSKPAKELEQSSYREYLKLKQRFENLQKTQRNLLGEDLGPL  120

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             N  ++E LE QLD+SLK +RST+TQ +LDQL+DLQ KE + +EAN++L  KL+E    N+
Sbjct  121   NSKDLEQLERQLDSSLKQVRSTKTQFMLDQLADLQNKEHMLVEANRSLSIKLDEINSRNH  180

Query  835   LQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIG----FNPVATSSQItaatnaqn  1002
              +Q W  G+QS  Y       +  FFQ LEC+ TL IG    +N V +    + +   Q 
Sbjct  181   YRQSWEAGDQSMQYGGPQNAHSQSFFQQLECNPTLQIGPDYRYNNVTSDQIASTSQAQQQ  240

Query  1003  vnavLPGWML  1032
             VN  +PGWML
Sbjct  241   VNGFVPGWML  250



>gb|ABD65406.1| MADS-box protein [Diospyros kaki]
Length=249

 Score =   284 bits (726),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 171/250 (68%), Positives = 197/250 (79%), Gaps = 5/250 (2%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEFSS 
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFSSI  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             +NM KTLERYQKCSYGTLE NR  K+ EQ+SY+EYLKLK KYE LQ +QRHLLGEDLGPL
Sbjct  61    NNMPKTLERYQKCSYGTLEDNRSAKEMEQNSYREYLKLKAKYEELQHFQRHLLGEDLGPL  120

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             N+ ++EHLEHQL+TSLK IRST+TQ +LDQL DLQ KEK+W+EANK LE KL+E Y +N 
Sbjct  121   NLKDLEHLEHQLETSLKQIRSTKTQSMLDQLCDLQNKEKMWIEANKALERKLDEIYRENQ  180

Query  835   LQQPWGPGEQSGAY----SQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqn  1002
             LQ  WG G             H   +  FF P +C+ TL IG+ P  ++   TAAT+ QN
Sbjct  181   LQSSWGGGGGEQGNSSFNHHHHHPHSQAFFHPFDCNPTLQIGY-PEVSNQMGTAATHEQN  239

Query  1003  vnavLPGWML  1032
             +N ++P WML
Sbjct  240   MNGLVPEWML  249



>gb|AES77737.2| MADS-box transcription factor [Medicago truncatula]
Length=249

 Score =   283 bits (723),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 160/250 (64%), Positives = 193/250 (77%), Gaps = 5/250 (2%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FS RGKLYEF ST
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLYEFCST  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             SNMLKTL+RYQKCSYG +EV++P K+ E SSY+EYLKLK ++E+LQR QR+LLGEDLGPL
Sbjct  61    SNMLKTLDRYQKCSYGAVEVSKPAKELE-SSYREYLKLKQRFENLQRAQRNLLGEDLGPL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             +  ++E LE QLD+SLK +RST+TQ +LDQL+DLQ KE + +EAN++L  KLEE    N+
Sbjct  120   SSKDLEQLERQLDSSLKQVRSTKTQFMLDQLADLQNKEHMLVEANRSLSIKLEEINSRNH  179

Query  835   LQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIG----FNPVATSSQItaatnaqn  1002
              +Q W   +QS  Y  Q    +  FFQ LEC+ TL IG    +N VA+    + +   Q 
Sbjct  180   YRQSWEASDQSMQYEAQQNAHSQSFFQQLECNPTLQIGSDYRYNNVASDQIASTSQAQQQ  239

Query  1003  vnavLPGWML  1032
             VN  +PGWML
Sbjct  240   VNGFVPGWML  249



>gb|AEF59025.1| MADS-1 [Fragaria x ananassa]
Length=249

 Score =   282 bits (721),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 163/250 (65%), Positives = 197/250 (79%), Gaps = 5/250 (2%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             S+MLKTLERYQKCSYG +EV +P K+ E+SSY+EYLKLK + ESLQ+ QR+LLGEDLGPL
Sbjct  61    SSMLKTLERYQKCSYGAMEVQKPAKELEESSYREYLKLKTRCESLQQTQRNLLGEDLGPL  120

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             N  E+E LE QL++SLKH+RST+TQ ++D LSDLQ+KE + +EAN+ L++KL+E      
Sbjct  121   NTKELEQLERQLESSLKHVRSTKTQHMIDLLSDLQSKEHMLIEANRDLKTKLDEIDSRTQ  180

Query  835   LQQPW--GPGEQSGAYSQQHADQTHGF-FQPLECDSTLHIGFNPVATSSQ-Itaatnaqn  1002
             L+Q W  G   Q+  Y  QHA QT G  FQPL+C+ TL IG+N V +         +AQ 
Sbjct  181   LRQTWEHGHDHQTMLYGTQHA-QTQGLMFQPLDCNPTLQIGYNAVVSQEMPTATPAHAQP  239

Query  1003  vnavLPGWML  1032
             VN  +PGWML
Sbjct  240   VNGFIPGWML  249



>ref|XP_004304204.1| PREDICTED: developmental protein SEPALLATA 2-like [Fragaria vesca 
subsp. vesca]
 gb|AAO49380.1| MADS-RIN-like protein [Fragaria x ananassa]
Length=249

 Score =   281 bits (720),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 163/250 (65%), Positives = 197/250 (79%), Gaps = 5/250 (2%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             S+MLKTLERYQKCSYG +EV +P K+ E+SSY+EYLKLK + ESLQ+ QR+LLGEDLGPL
Sbjct  61    SSMLKTLERYQKCSYGAMEVQKPAKELEESSYREYLKLKTRCESLQQTQRNLLGEDLGPL  120

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             N  E+E LE QL++SLKH+RST+TQ ++D LSDLQ+KE + +EAN+ L++KL+E      
Sbjct  121   NTKELEQLERQLESSLKHVRSTKTQHMIDLLSDLQSKEHMLIEANRDLKTKLDEIDSRTQ  180

Query  835   LQQPW--GPGEQSGAYSQQHADQTHGF-FQPLECDSTLHIGFNPVATSSQ-Itaatnaqn  1002
             L+Q W  G   Q+  Y  QHA QT G  FQPL+C+ TL IG+N V +         +AQ 
Sbjct  181   LRQTWEHGHDHQTMLYGTQHA-QTQGLMFQPLDCNPTLQIGYNAVVSQEMPAATPAHAQP  239

Query  1003  vnavLPGWML  1032
             VN  +PGWML
Sbjct  240   VNGFIPGWML  249



>gb|ADC79693.1| SEPALLATA1-like protein [Akebia trifoliata]
Length=246

 Score =   280 bits (717),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 164/248 (66%), Positives = 198/248 (80%), Gaps = 4/248 (2%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVEL+RIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FS+RGKLYEF S+
Sbjct  1     MGRGRVELRRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             S+MLKTL+RYQKCSYGTLE + P KD  Q++Y+EYL+LK + E LQ+ QR+LLGEDLGPL
Sbjct  61    SSMLKTLDRYQKCSYGTLEASMPPKDT-QNNYQEYLRLKARVEVLQQTQRNLLGEDLGPL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVD-N  831
             N  E++ LE+QL+TSL+ IRST+TQ + DQLSDLQ KE++  EAN+TL  KL+E   +  
Sbjct  120   NTKELDQLENQLETSLRTIRSTKTQFLFDQLSDLQRKEQMLHEANRTLRRKLDENSTEIP  179

Query  832   NLQQPW-GPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvn  1008
             NLQ  W   G Q+ AY +Q+   + GFFQPLEC+STL IG+NPV         T+AQNVN
Sbjct  180   NLQLSWDASGGQNMAYGRQNLP-SDGFFQPLECNSTLQIGYNPVDQDQINNGQTSAQNVN  238

Query  1009  avLPGWML  1032
               +PGWML
Sbjct  239   CFIPGWML  246



>gb|AEL33631.1| SEPALLATA1 [Gossypium hirsutum]
Length=245

 Score =   279 bits (713),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 158/252 (63%), Positives = 189/252 (75%), Gaps = 13/252 (5%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             S+MLKTL+RYQKCSYG +EV++P K+ E SSY+EYLKLK +YE LQR QR+LLGEDLGPL
Sbjct  61    SSMLKTLDRYQKCSYGAVEVSKPAKELE-SSYREYLKLKARYEELQRTQRNLLGEDLGPL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             N  E+E LEHQL++SLKH+RST+TQ +LDQL++LQ KE++ +E N+ L  KLEE    N 
Sbjct  120   NSKELEQLEHQLESSLKHVRSTKTQYMLDQLTELQNKEQMLMETNRALSIKLEEISARNQ  179

Query  835   LQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTL------HIGFNPVATSSQItaatna  996
              +  W  GEQS A++ Q A Q+ G FQPLEC+ T          F P      +      
Sbjct  180   FRASWEGGEQSVAFTNQQA-QSMGLFQPLECNPTFADRVLQSCCFRPDGLQQLM-----L  233

Query  997   qnvnavLPGWML  1032
             +     +PGWML
Sbjct  234   RKSMGFIPGWML  245



>gb|AIC33051.1| flower development transporter SEP1 [Chrysanthemum lavandulifolium]
Length=242

 Score =   277 bits (709),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 160/247 (65%), Positives = 197/247 (80%), Gaps = 6/247 (2%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDA+VALI+FSNRGKL+EF ST
Sbjct  1     MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDADVALIIFSNRGKLFEFCST  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             SNMLK LERYQ C+YG++E++R   + EQ+SYKEY+KLK KYESLQ+YQR + GEDL PL
Sbjct  61    SNMLKMLERYQNCTYGSMEIDRSTTNAEQNSYKEYIKLKAKYESLQQYQRQVCGEDLEPL  120

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             ++ E+E LE QLD++LK IRS RTQ +LD+LS+LQ KEK+WLEAN+ L+ +LE  Y +N 
Sbjct  121   SLKELEQLERQLDSTLKQIRSMRTQSMLDRLSELQLKEKMWLEANRALQEQLEVVYAENQ  180

Query  835   LQQPWGPGEQSGAYSQQHA-DQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvna  1011
                  GP   +  Y QQH   ++ GFFQPL+ +  L IG+N V  SSQ+T  TN QN+N 
Sbjct  181   A----GPSWANCTYEQQHEHPRSQGFFQPLDGNPNLQIGYNTVG-SSQLTTTTNGQNLNG  235

Query  1012  vLPGWML  1032
             ++PGWML
Sbjct  236   LVPGWML  242



>gb|ADL36751.1| MADS domain class transcription factor [Malus domestica]
Length=246

 Score =   277 bits (709),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 165/248 (67%), Positives = 198/248 (80%), Gaps = 4/248 (2%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLE-VNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGP  651
              ++L+T++RYQKCSYG ++ VN P K+ E SSY+EY+KLKG+ ESLQR QR+LLGE+LGP
Sbjct  61    PSILQTVDRYQKCSYGAVDQVNIPAKELE-SSYREYMKLKGRCESLQRTQRNLLGEELGP  119

Query  652   LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDN  831
             LN  E+E LE QL+ SLK +RST+TQ +LDQLS LQ KE+L +EAN+ L  KL+E    N
Sbjct  120   LNTKELEQLERQLEASLKQVRSTKTQYMLDQLSALQNKEQLLIEANRDLTMKLDEIGSRN  179

Query  832   NLQQPWGPGEQSGAY-SQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvn  1008
              L+Q W  G+Q  AY +Q H  Q+ GFFQPL+C+ TL IG+ P   S Q+ A T+AQ VN
Sbjct  180   QLRQSWEGGDQGMAYGTQHHHAQSQGFFQPLDCNPTLQIGY-PAEGSEQMGATTHAQQVN  238

Query  1009  avLPGWML  1032
               +PGWML
Sbjct  239   CFIPGWML  246



>ref|XP_004491904.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X2 
[Cicer arietinum]
Length=249

 Score =   278 bits (710),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 158/250 (63%), Positives = 192/250 (77%), Gaps = 5/250 (2%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FS RGKLYEF ST
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLYEFCST  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             SNMLKTL+RYQKCSYG +EV++P K+ E SSY+EYLKLK ++E+LQ+ QR+LLGEDLGPL
Sbjct  61    SNMLKTLDRYQKCSYGAVEVSKPAKELE-SSYREYLKLKQRFENLQKTQRNLLGEDLGPL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             N  ++E LE QLD+SLK +RST+TQ +LDQL+DLQ KE + +EAN++L  KL+E    N+
Sbjct  120   NSKDLEQLERQLDSSLKQVRSTKTQFMLDQLADLQNKEHMLVEANRSLSIKLDEINSRNH  179

Query  835   LQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIG----FNPVATSSQItaatnaqn  1002
              +Q W  G+QS  Y       +  FFQ LEC+ TL IG    +N V +    + +   Q 
Sbjct  180   YRQSWEAGDQSMQYGGPQNAHSQSFFQQLECNPTLQIGPDYRYNNVTSDQIASTSQAQQQ  239

Query  1003  vnavLPGWML  1032
             VN  +PGWML
Sbjct  240   VNGFVPGWML  249



>ref|XP_010558530.1| PREDICTED: developmental protein SEPALLATA 1 [Tarenaya hassleriana]
 gb|ABD96896.1| hypothetical protein [Cleome spinosa]
Length=248

 Score =   277 bits (708),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 165/251 (66%), Positives = 189/251 (75%), Gaps = 8/251 (3%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEV-NRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGP  651
             SNMLKTLERYQKCSYG++EV NRP K+ E  SY+EYLKLK +YE L R QR+LLGEDLGP
Sbjct  61    SNMLKTLERYQKCSYGSIEVNNRPAKELEN-SYREYLKLKSRYEGLHRQQRNLLGEDLGP  119

Query  652   LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDN  831
             LN  E+E LE QLD+SLK +RS +TQ +LD+LSDLQ KE++ LEAN+ L  KLEE     
Sbjct  120   LNSKELEQLERQLDSSLKQVRSIKTQSMLDELSDLQNKEQMLLEANRALSMKLEEMVGAR  179

Query  832   NLQ--QPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnv  1005
               Q    W   EQ+ +Y   H  Q+ G FQPLEC+ TL IG+N    S Q+ A T A   
Sbjct  180   THQFGGAWEGSEQNVSYG--HQAQSQGLFQPLECNPTLQIGYNNPVCSEQMAATTQAPVQ  237

Query  1006  nav--LPGWML  1032
                  +PGWML
Sbjct  238   AGNGYIPGWML  248



>gb|AFO68777.1| agamous-like protein 2, partial [Actinidia chinensis]
Length=194

 Score =   275 bits (702),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 151/195 (77%), Positives = 170/195 (87%), Gaps = 1/195 (1%)
 Frame = +1

Query  343  RQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSSTSNMLKTLERYQKCSYG  522
            RQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF STSNMLKTLERYQKCSY 
Sbjct  1    RQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSTSNMLKTLERYQKCSYD  60

Query  523  TLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPLNIDEIEHLEHQLDTSL  702
            TLEVN  +K+ EQSSY+EY KLKGKYE+LQ YQR LLGEDLGPLNI+E+EHLEHQL+TSL
Sbjct  61   TLEVNHSDKELEQSSYREYYKLKGKYETLQCYQRQLLGEDLGPLNINELEHLEHQLETSL  120

Query  703  KHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNNLQQPWGPGEQSGAYSQ  882
            K IRST+TQ +LDQL DLQTKEKLWL+ANK LE KL+E Y +N+L+  W  GEQ  +Y Q
Sbjct  121  KQIRSTKTQSMLDQLYDLQTKEKLWLDANKALEGKLDEIYRENHLRSSWACGEQCSSYPQ  180

Query  883  QHADQTHGFFQPLEC  927
            Q+A Q+  FFQPL+C
Sbjct  181  QNA-QSQVFFQPLDC  194



>ref|XP_002263039.1| PREDICTED: MADS-box protein CMB1 isoform X2 [Vitis vinifera]
 emb|CBI15338.3| unnamed protein product [Vitis vinifera]
Length=246

 Score =   275 bits (704),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 165/246 (67%), Positives = 189/246 (77%), Gaps = 2/246 (1%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFS+RGKLYEF S 
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSSRGKLYEFCSG  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
              +M KTLE+YQKCSYG LE ++P  +  QSSY+EYLKLK + E LQR QRHLLGEDL PL
Sbjct  61    PSMAKTLEKYQKCSYGALEASQPVYELTQSSYQEYLKLKTRVEVLQRSQRHLLGEDLDPL  120

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             N  E+E LEHQL+ SLK IRST+TQ +LDQL+DLQ KE + +EAN  L  KLEE    + 
Sbjct  121   NTKELEQLEHQLEMSLKQIRSTKTQNMLDQLADLQNKEHMLIEANNALRRKLEESNGKHP  180

Query  835   LQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvnav  1014
             LQQ W     S  YS+  A Q+ GFFQPLE +STL +G+N  A S++IT A  +QN N  
Sbjct  181   LQQSWEAAGNSALYSRLPA-QSEGFFQPLERNSTLEMGYN-AAGSNEITLAAPSQNDNGF  238

Query  1015  LPGWML  1032
              PGWML
Sbjct  239   GPGWML  244



>gb|AGV54737.1| developmental protein SEPALLATA 2-like protein [Phaseolus vulgaris]
Length=247

 Score =   275 bits (704),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 166/250 (66%), Positives = 196/250 (78%), Gaps = 7/250 (3%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAK  NGL KKAYELSVL DAEVALI+FS RGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKGGNGLFKKAYELSVLWDAEVALIIFSTRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             S+MLKTLERYQKCSYG +EV++P K+ E SSY+EYLKLKG++ESLQR QR+LLGEDLGPL
Sbjct  61    SSMLKTLERYQKCSYGAVEVSKPAKELE-SSYREYLKLKGRFESLQRTQRNLLGEDLGPL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             N  E+E LE QLD+SLK +RST+TQ +LDQL+DLQ KE++ +EAN+ L  KL+E    N 
Sbjct  120   NTKELEQLERQLDSSLKQVRSTKTQFMLDQLADLQNKEQMLVEANRALTMKLDEINSRNQ  179

Query  835   LQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIG----FNPVATSSQItaatnaqn  1002
              +Q W  G+QS  Y   +A  + GFFQPLEC+ TL IG    +NP A S Q+T  T AQ 
Sbjct  180   YRQTWEAGDQSMPYGTPNA-HSQGFFQPLECNPTLQIGSDYRYNPEA-SDQLTGTTQAQQ  237

Query  1003  vnavLPGWML  1032
             VN  +PGWML
Sbjct  238   VNGFIPGWML  247



>ref|XP_008365428.1| PREDICTED: developmental protein SEPALLATA 1-like [Malus domestica]
Length=246

 Score =   275 bits (703),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 164/248 (66%), Positives = 197/248 (79%), Gaps = 4/248 (2%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLE-VNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGP  651
              ++L+T++RYQKCSYG ++ VN P K+ E SSY+EY+KLKG+ ESLQR QR+LLGE+LGP
Sbjct  61    PSILQTVDRYQKCSYGAVDQVNIPAKELE-SSYREYMKLKGRCESLQRTQRNLLGEELGP  119

Query  652   LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDN  831
             LN  E+E LE QL+ SLK +R T+TQ +LDQLS LQ KE+L +EAN+ L  KL+E    N
Sbjct  120   LNTKELEQLERQLEASLKQVRFTKTQYMLDQLSALQNKEQLLIEANRDLTMKLDEIGSRN  179

Query  832   NLQQPWGPGEQSGAY-SQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvn  1008
              L+Q W  G+Q  AY +Q H  Q+ GFFQPL+C+ TL IG+ P   S Q+ A T+AQ VN
Sbjct  180   QLRQSWEGGDQGMAYGTQHHHAQSQGFFQPLDCNPTLQIGY-PAEGSEQMGATTHAQQVN  238

Query  1009  avLPGWML  1032
               +PGWML
Sbjct  239   CFIPGWML  246



>ref|XP_010099309.1| Developmental protein SEPALLATA 2 [Morus notabilis]
 gb|EXB77655.1| Developmental protein SEPALLATA 2 [Morus notabilis]
Length=248

 Score =   275 bits (702),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 162/250 (65%), Positives = 197/250 (79%), Gaps = 6/250 (2%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
              +M+KTLERYQKCSYG +EV++P K+ E SSY+EYLKLKG++ESLQR QR+LLGE+LGPL
Sbjct  61    PSMVKTLERYQKCSYGAMEVSKPGKELE-SSYREYLKLKGRFESLQRTQRNLLGEELGPL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             N  E+E +E QL+TSLK +RST+TQ +LDQL+DLQ+KE + +E+N+ L  KL+E    NN
Sbjct  120   NTKELEQIERQLETSLKQVRSTKTQYMLDQLTDLQSKEHMLIESNRALTLKLDEISSRNN  179

Query  835   LQ-QPWGPGE---QSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqn  1002
              + Q W  G+   Q+  Y   HA      F PL+C+ TL IG+N  A S QIT+ + AQ 
Sbjct  180   FRSQSWEVGDHDQQAMPYGHNHAHSQGLIFHPLDCNPTLQIGYN-AAVSEQITSTSQAQQ  238

Query  1003  vnavLPGWML  1032
             VN  +PGWML
Sbjct  239   VNGFIPGWML  248



>gb|ADL36750.1| MADS domain class transcription factor [Malus domestica]
Length=246

 Score =   274 bits (701),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 164/248 (66%), Positives = 197/248 (79%), Gaps = 4/248 (2%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQ TFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQDTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLE-VNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGP  651
              ++L+T++RYQKCSYG ++ VN P K+ E SSY+EY+KLKG+ ESLQR QR+LLGE+LGP
Sbjct  61    PSILQTVDRYQKCSYGAVDQVNIPAKELE-SSYREYMKLKGRCESLQRTQRNLLGEELGP  119

Query  652   LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDN  831
             LN  E+E LE QL+ SLK +RST+TQ +LDQLS LQ KE+L +EAN+ L  KL+E    N
Sbjct  120   LNTKELEQLERQLEASLKQVRSTKTQYMLDQLSALQNKEQLLIEANRDLTMKLDEIGSRN  179

Query  832   NLQQPWGPGEQSGAY-SQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvn  1008
              L+Q W  G+Q  AY +Q H  Q+ GFFQPL+C+ TL IG+ P   S Q+ A T+AQ VN
Sbjct  180   QLRQSWEGGDQGMAYGTQHHHAQSQGFFQPLDCNPTLQIGY-PAEGSEQMGATTHAQQVN  238

Query  1009  avLPGWML  1032
               +PGWML
Sbjct  239   CFIPGWML  246



>gb|AFO68778.1| agamous-like protein 2, partial [Gunnera manicata]
Length=227

 Score =   273 bits (699),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 155/229 (68%), Positives = 188/229 (82%), Gaps = 2/229 (1%)
 Frame = +1

Query  343   RQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSSTSNMLKTLERYQKCSYG  522
             RQVTF KRRNGLLKKAYELSVLCDAEVALIVFS RGKLYEF S+ +ML+TLERYQKCSYG
Sbjct  1     RQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGKLYEFCSSPSMLRTLERYQKCSYG  60

Query  523   TLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPLNIDEIEHLEHQLDTSL  702
             T EV+RP K+NEQSSY+EYLKLK ++E+LQR QR+ LGEDLGPLN  E+E LE QL+T+L
Sbjct  61    TTEVSRPAKENEQSSYREYLKLKARFEALQRSQRNFLGEDLGPLNSKELEQLERQLETTL  120

Query  703   KHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNNLQQPWGPGEQSGAYSQ  882
             K IRST+TQ VLDQLSDLQ+KE + +EANK L +KL+EF  +N+ +  W  GEQS  Y  
Sbjct  121   KQIRSTKTQFVLDQLSDLQSKEHMLIEANKALRTKLDEFGTENHFRPTWEGGEQSIPYGH  180

Query  883   QHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvnavLPGWM  1029
             QH  Q+HGF+QP+EC+ TL IG+N V  S +I A+T+ QNVN+ +PGW+
Sbjct  181   QHV-QSHGFYQPIECNPTLQIGYNHVG-SDEINASTHTQNVNSFIPGWL  227



>gb|AGL94767.1| MADS-box protein 1, partial [Chrysanthemum x morifolium]
Length=243

 Score =   273 bits (699),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 160/248 (65%), Positives = 198/248 (80%), Gaps = 7/248 (3%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDA+VALI+FSNRGKL+EF ST
Sbjct  1     MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDADVALIIFSNRGKLFEFCST  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             SN+LK LERYQ C+YG++E++R   + EQ+SYKEY+KLK KYESLQ+YQR + GEDL PL
Sbjct  61    SNLLKMLERYQNCTYGSMEIDRSTTNAEQNSYKEYIKLKAKYESLQQYQRQVCGEDLEPL  120

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTL-ESKLEEFYVDN  831
             ++ E+E LE QLD++LK IRS RTQ +LD+LS+LQ KEK+WLEAN+ L E +LE  Y +N
Sbjct  121   SLKELEQLERQLDSTLKQIRSMRTQSMLDRLSELQLKEKMWLEANRALQEQQLEVVYAEN  180

Query  832   NLQQPWGPGEQSGAYSQQHA-DQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvn  1008
                   GP   + +Y QQH   ++ GFFQPL+ +  L IG+N V  SSQ+T  TN QN+N
Sbjct  181   QA----GPSWANCSYEQQHEHPRSQGFFQPLDGNPNLQIGYNTVG-SSQLTTTTNGQNLN  235

Query  1009  avLPGWML  1032
              ++PGWML
Sbjct  236   GLVPGWML  243



>ref|XP_008357795.1| PREDICTED: LOW QUALITY PROTEIN: developmental protein SEPALLATA 
1-like [Malus domestica]
Length=246

 Score =   273 bits (699),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 163/248 (66%), Positives = 197/248 (79%), Gaps = 4/248 (2%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVF +RGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFXHRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLE-VNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGP  651
              ++L+T++RYQKCSYG ++ VN P K+ E SSY+EY+KLKG+ ESLQR QR+LLGE+LGP
Sbjct  61    PSILQTVDRYQKCSYGAVDQVNIPAKELE-SSYREYMKLKGRCESLQRTQRNLLGEELGP  119

Query  652   LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDN  831
             LN  E+E LE QL+ SLK +RST+TQ +LDQLS LQ KE+L +EAN+ L  KL+E    N
Sbjct  120   LNTKELEQLERQLEASLKQVRSTKTQYMLDQLSALQNKEQLLIEANRDLTMKLDEIGSRN  179

Query  832   NLQQPWGPGEQSGAY-SQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvn  1008
              L+Q W  G+Q  AY +Q H  Q+ GFFQPL+C+ TL IG+ P   S Q+ A T+AQ VN
Sbjct  180   QLRQSWEGGDQGMAYGTQHHHAQSQGFFQPLDCNPTLQIGY-PAEGSEQMGATTHAQQVN  238

Query  1009  avLPGWML  1032
               +PGWML
Sbjct  239   CFIPGWML  246



>ref|XP_009415892.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Musa acuminata 
subsp. malaccensis]
Length=243

 Score =   273 bits (698),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 157/246 (64%), Positives = 192/246 (78%), Gaps = 5/246 (2%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             S+MLKTLERYQKC+YG  E N  +++  Q+S +EYLKLK + E+LQR QR+LLGEDLGPL
Sbjct  61    SSMLKTLERYQKCNYGAPETNIISREI-QTSQQEYLKLKARVEALQRSQRNLLGEDLGPL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             +I E+E LE QLD SL+ IRSTRTQ +LDQL+DLQ +E++  EANK L+ +++E    N 
Sbjct  120   SIKELEQLERQLDASLRQIRSTRTQCMLDQLADLQRREQMLCEANKALKIRMDEGNQANQ  179

Query  835   LQQPWGPGEQSGAYSQ-QHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvna  1011
              QQ W P  Q+ AY + Q   Q  GFFQP+EC+ TL IG++P   +  I AA    +V++
Sbjct  180   -QQLWDPNAQAVAYCRHQPQPQGDGFFQPIECEPTLQIGYHPDQMA--IAAAAPGPSVSS  236

Query  1012  vLPGWM  1029
              +PGW+
Sbjct  237   YVPGWL  242



>gb|AIE44769.1| putative MADS-domain transcription factor AGL2 [Nuphar advena]
Length=245

 Score =   273 bits (698),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 160/247 (65%), Positives = 190/247 (77%), Gaps = 3/247 (1%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTF+KRRNGLLKKAYELSVLCD EVALI+FSNRG+LYEF ST
Sbjct  1     MGRGRVELKRIENKINRQVTFSKRRNGLLKKAYELSVLCDVEVALIIFSNRGRLYEFCST  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             S+MLKTLERYQKC+YG++E + P+++  Q+SY+EYLKLK K E+LQ  QR+LLGEDLGPL
Sbjct  61    SSMLKTLERYQKCNYGSIEASVPSRET-QNSYQEYLKLKSKVEALQHSQRNLLGEDLGPL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             N  E+EHLE QL+ SLKH+RST+TQ +LDQLSDL+ KE++  +AN  L  KLE      N
Sbjct  120   NSKELEHLEQQLEVSLKHVRSTKTQFMLDQLSDLKGKEQILQDANMALVRKLEGAAGSAN  179

Query  835   LQQ-PWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvna  1011
              QQ  W  G Q   Y +    Q  GF+ PLECDSTL IG+NP A   QIT A  A NVN 
Sbjct  180   HQQLSWENGGQHLQYGRHSGPQKDGFYHPLECDSTLQIGYNPTA-QEQITVAAPAHNVNG  238

Query  1012  vLPGWML  1032
              +P W++
Sbjct  239   FIPSWLV  245



>emb|CDY26462.1| BnaC09g42060D [Brassica napus]
Length=254

 Score =   273 bits (699),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 165/255 (65%), Positives = 194/255 (76%), Gaps = 10/255 (4%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEV-NRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGP  651
             SNM+KTLERYQKCSYG++EV N+P K+ E  SY+EYLKLKG+YESLQR QR+LLGEDLGP
Sbjct  61    SNMIKTLERYQKCSYGSIEVNNKPAKELEN-SYREYLKLKGRYESLQRQQRNLLGEDLGP  119

Query  652   LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEF----  819
             LN  E+E LE QLD SLK +RS +TQ +LDQLSDLQ+KE++ LE N+ L  KL++     
Sbjct  120   LNSKELEQLERQLDGSLKQVRSIKTQYMLDQLSDLQSKEQMLLETNRALAIKLDDMIGVR  179

Query  820   --YVDNNLQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatn  993
               ++       W   EQ+ +Y   H  Q  G FQPLEC+ TL IG++    S QITA T 
Sbjct  180   SHHMGGGGGGGWEGNEQNVSYEHHHQAQPQGLFQPLECNPTLQIGYDNPVGSEQITATTQ  239

Query  994   aqnv--navLPGWML  1032
             AQ    N  +PGWML
Sbjct  240   AQAQPGNGYIPGWML  254



>gb|AAA32732.1| transcription factor [Arabidopsis thaliana]
 gb|AAU81987.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AAU81989.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AAU81990.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AAU81991.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AAU81992.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AAU81993.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AAU81994.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AAU81995.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AAU81996.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AAU81997.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AAU81998.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AAU81999.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AAU82000.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AAU82001.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AAU82002.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AAU82004.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AAU82005.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AAU82006.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AAU82007.1| SEPALLATA1 [Arabidopsis thaliana]
Length=248

 Score =   272 bits (696),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 165/250 (66%), Positives = 196/250 (78%), Gaps = 6/250 (2%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEV-NRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGP  651
             SNMLKTL+RYQKCSYG++EV N+P K+ E  SY+EYLKLKG+YE+LQR QR+LLGEDLGP
Sbjct  61    SNMLKTLDRYQKCSYGSIEVNNKPAKELEN-SYREYLKLKGRYENLQRQQRNLLGEDLGP  119

Query  652   LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFY-VD  828
             LN  E+E LE QLD SLK +RS +TQ +LDQLSDLQ KE++ LE N+ L  KL++   V 
Sbjct  120   LNSKELEQLERQLDGSLKQVRSIKTQYMLDQLSDLQNKEQMLLETNRALAMKLDDMIGVR  179

Query  829   NNLQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnv-  1005
             ++    W  GEQ+  Y+  H  Q+ G +QPLEC+ TL +G++    S QITA T AQ   
Sbjct  180   SHHMGGWEGGEQNVTYA-HHQAQSQGLYQPLECNPTLQMGYDNPVCSEQITATTQAQAQP  238

Query  1006  -navLPGWML  1032
              N  +PGWML
Sbjct  239   GNGYIPGWML  248



>gb|AIU94433.1| MADS-box transcription factor 2 isoform 1, partial [Musa balbisiana]
Length=243

 Score =   271 bits (693),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 157/246 (64%), Positives = 191/246 (78%), Gaps = 5/246 (2%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             S+MLKTLERYQKC+YG  E N  +++  Q+S +EYLKLK + E+LQR QR+LLGEDLGPL
Sbjct  61    SSMLKTLERYQKCNYGAPETNIISREI-QTSQQEYLKLKARVEALQRSQRNLLGEDLGPL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             +I E+E LE QLD SL+ IRSTRTQ +LDQL+DLQ +E++  EANK L+ +L+E    N 
Sbjct  120   SIKELEQLERQLDASLRQIRSTRTQCMLDQLADLQRREQMLCEANKALKIRLDEGNQANQ  179

Query  835   LQQPWGPGEQSGAYSQ-QHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvna  1011
              QQ W P   + AY + Q   Q  GFFQP+EC+ TL IG++P   +  I AA    +V++
Sbjct  180   -QQLWDPNAHAVAYCRHQPQPQGDGFFQPIECEPTLQIGYHPDQMA--IAAAAPGPSVSS  236

Query  1012  vLPGWM  1029
              +PGW+
Sbjct  237   YVPGWL  242



>gb|AFX72877.1| MADS-box protein SEP2A [Aquilegia coerulea]
Length=243

 Score =   271 bits (692),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 157/246 (64%), Positives = 192/246 (78%), Gaps = 3/246 (1%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FS RGKLYEF ST
Sbjct  1     MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLYEFCST  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             S+MLKTL++YQK SY  LE +   K+  Q++Y+EYL+LK + E LQ+ QR+LLGE+LG L
Sbjct  61    SSMLKTLDKYQKSSYAALETSTSAKET-QNNYQEYLRLKARVEILQQSQRNLLGEELGSL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             +  E++ LEHQLD SLK IR T+TQ +LDQLSDLQ KE++  EAN +L  KL+E   +N 
Sbjct  120   STKELDQLEHQLDMSLKQIRCTKTQFMLDQLSDLQGKEQVLEEANSSLRRKLDERIAENA  179

Query  835   LQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvnav  1014
             L+ PW  GEQ+  Y +Q A Q+  FFQPL C+STLH+G+N V    QIT A  AQN+N  
Sbjct  180   LRLPWASGEQNIPYCRQPA-QSEEFFQPLGCNSTLHVGYNHVG-PEQITVAAPAQNINGF  237

Query  1015  LPGWML  1032
             +PGWM+
Sbjct  238   IPGWMV  243



>ref|XP_009121545.1| PREDICTED: developmental protein SEPALLATA 1 [Brassica rapa]
Length=252

 Score =   271 bits (692),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 166/253 (66%), Positives = 192/253 (76%), Gaps = 8/253 (3%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEV-NRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGP  651
             SNM+KTLERYQKCSYG++EV N+P K+ E  SY+EYLKLKG+YESLQR QR+LLGEDLGP
Sbjct  61    SNMIKTLERYQKCSYGSIEVNNKPAKELEN-SYREYLKLKGRYESLQRQQRNLLGEDLGP  119

Query  652   LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDN  831
             LN  E+E LE QLD SLK +RS +TQ +LDQLSDLQ+KE++ LE N+ L  KL++     
Sbjct  120   LNSKELEQLERQLDGSLKQVRSIKTQYMLDQLSDLQSKEQMLLETNRALTIKLDDMIGVR  179

Query  832   N----LQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaq  999
             +        W   EQ+  Y   H  Q  G FQPLEC+ TL IG++    S QITA T AQ
Sbjct  180   SHHMGGGGGWEGNEQNVPYEHHHQAQPQGLFQPLECNPTLQIGYDNPVGSEQITATTQAQ  239

Query  1000  nv--navLPGWML  1032
                 N  +PGWML
Sbjct  240   AQPGNGYIPGWML  252



>ref|XP_006408426.1| hypothetical protein EUTSA_v10021390mg [Eutrema salsugineum]
 gb|ESQ49879.1| hypothetical protein EUTSA_v10021390mg [Eutrema salsugineum]
Length=250

 Score =   271 bits (692),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 162/251 (65%), Positives = 189/251 (75%), Gaps = 6/251 (2%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEV+LIVFSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVSLIVFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEV-NRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGP  651
             SNMLKTLERYQKCSYG++EV N+P K+ E  SY+EYLKLKG+YE+LQR QR+LLGEDLGP
Sbjct  61    SNMLKTLERYQKCSYGSIEVNNKPAKELEN-SYREYLKLKGRYENLQRQQRNLLGEDLGP  119

Query  652   LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEF--YV  825
             LN  E+E LE QLD SLK +R  +TQ +LDQL+DLQ KE + LEAN+ L  KLE+     
Sbjct  120   LNSKELEQLERQLDGSLKQVRCIKTQYMLDQLTDLQGKEHILLEANRALSMKLEDMIGVR  179

Query  826   DNNLQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQ--Itaatnaq  999
              +++   W  G+Q       H  Q+ G FQ LECD TL IG+N    S Q  +T    +Q
Sbjct  180   SHHIGGAWEGGDQQNVAYGHHQAQSQGLFQSLECDPTLQIGYNNPVCSEQMAVTTQGQSQ  239

Query  1000  nvnavLPGWML  1032
               N  +PGWML
Sbjct  240   PGNGYIPGWML  250



>gb|ACJ64678.1| MADS-box protein MADS2 [Musa acuminata AAA Group]
 gb|AIU94429.1| MADS-box transcription factor 2 isoform 1 [Musa acuminata]
Length=243

 Score =   270 bits (691),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 156/246 (63%), Positives = 191/246 (78%), Gaps = 5/246 (2%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             S+MLKTLERYQKC+YG  E N  +++  Q+S +EYLKLK + E+LQR QR+LLGEDLGPL
Sbjct  61    SSMLKTLERYQKCNYGAPETNIISREI-QTSQQEYLKLKARVEALQRSQRNLLGEDLGPL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             +I E+E LE QLD SL+ IRSTRTQ +LDQL+DLQ +E++  EANK L+ +++E    N 
Sbjct  120   SIKELEQLERQLDASLRQIRSTRTQCMLDQLADLQRREQMLCEANKALKIRMDEGNQANQ  179

Query  835   LQQPWGPGEQSGAYSQ-QHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvna  1011
              QQ W P   + AY + Q   Q  GFFQP+EC+ TL IG++P   +  I AA    +V++
Sbjct  180   -QQLWDPNAHAVAYCRHQPQPQGDGFFQPIECEPTLQIGYHPDQMA--IAAAAPGPSVSS  236

Query  1012  vLPGWM  1029
              +PGW+
Sbjct  237   YVPGWL  242



>emb|CDY34718.1| BnaA01g33070D [Brassica napus]
Length=252

 Score =   271 bits (692),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 160/253 (63%), Positives = 188/253 (74%), Gaps = 8/253 (3%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEV+LIVFSNRGKLYEF ST
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVSLIVFSNRGKLYEFCST  60

Query  475   SNMLKTLERYQKCSYGTLEV-NRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGP  651
             SNMLKTLERYQKCSYG++EV N+P K+ E  SY+EYLKLKG+YE+LQR QR+LLGEDLGP
Sbjct  61    SNMLKTLERYQKCSYGSVEVNNKPAKELEN-SYREYLKLKGRYENLQRQQRNLLGEDLGP  119

Query  652   LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEF--YV  825
             LN  E+E LE QLD SLK +R  +TQ +LDQL+DLQ KE + L+AN+ L  KLE+     
Sbjct  120   LNSKELEQLERQLDGSLKQVRCIKTQYMLDQLTDLQGKEHILLDANRALSMKLEDMIGVR  179

Query  826   DNNLQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnv  1005
              +++   W  G+Q       H  Q+HG FQ LECD TL +G+N    S Q+      Q+ 
Sbjct  180   SHHIGGTWEGGDQHNVAYGHHQAQSHGLFQSLECDPTLQMGYNHPVCSEQMAVTAQGQSS  239

Query  1006  n----avLPGWML  1032
                    +PGWML
Sbjct  240   QPGNNGYIPGWML  252



>gb|ABD60322.1| SEP2 [Boechera stricta]
Length=251

 Score =   270 bits (691),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 162/252 (64%), Positives = 188/252 (75%), Gaps = 7/252 (3%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEV+LIVFSNRGKLYEF ST
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVSLIVFSNRGKLYEFCST  60

Query  475   SNMLKTLERYQKCSYGTLEV-NRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGP  651
             SNMLKTLERYQKCSYG++EV N+P K+ E  SY+EYLKLKG+YE+LQR QR+LLGEDLGP
Sbjct  61    SNMLKTLERYQKCSYGSIEVNNKPAKELEN-SYREYLKLKGRYENLQRQQRNLLGEDLGP  119

Query  652   LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVD-  828
             LN  E+E LE QLD SLK +R  +TQ +LDQLSDLQ KE + LEAN+ L  KLE+  +  
Sbjct  120   LNSKELEQLERQLDGSLKQVRCIKTQYMLDQLSDLQGKEHILLEANRALSMKLEDMTIGV  179

Query  829   --NNLQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQ--Itaatna  996
               +++   W  G+Q       H  Q+ G +Q LECD TL IG+     S Q  +T     
Sbjct  180   RHHHIVGAWEGGDQQNVAYGHHQAQSQGLYQSLECDPTLQIGYGHPVCSEQMTVTTQVQT  239

Query  997   qnvnavLPGWML  1032
             Q  N  +PGWML
Sbjct  240   QPGNGYIPGWML  251



>gb|KFK25803.1| hypothetical protein AALP_AA8G163200 [Arabis alpina]
Length=251

 Score =   270 bits (690),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 169/253 (67%), Positives = 197/253 (78%), Gaps = 9/253 (4%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEV-NRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGP  651
             SNMLKTLERYQKCSYG++EV N+P K+ E  SY+EYLKLKG+YESLQR QR+LLGEDLGP
Sbjct  61    SNMLKTLERYQKCSYGSIEVNNKPAKELEN-SYREYLKLKGRYESLQRQQRNLLGEDLGP  119

Query  652   LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDN  831
             L+  E+E LE QLD SLK +RS +TQ +LDQLSDLQ+KE++ LE N+ L  KL++     
Sbjct  120   LDSKELEQLERQLDGSLKQVRSIKTQYMLDQLSDLQSKEQMLLETNRALAMKLDDMIGVR  179

Query  832   NLQ----QPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaq  999
             N Q      W  GEQ+  Y+  H  Q+ G +QPLEC+ TL IG++  A S QITA T AQ
Sbjct  180   NHQMGGGGGWDGGEQNVTYA-HHQAQSQGLYQPLECNPTLQIGYDNQACSEQITATTQAQ  238

Query  1000  nv--navLPGWML  1032
                 N  +PGWML
Sbjct  239   AQPGNGYIPGWML  251



>gb|AFO68775.1| agamous-like protein 2, partial [Clethra tomentosa]
Length=231

 Score =   269 bits (688),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 157/233 (67%), Positives = 186/233 (80%), Gaps = 5/233 (2%)
 Frame = +1

Query  343   RQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSSTSNMLKTLERYQKCSYG  522
             RQVT++KRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF STSNM KTLERYQKCSY 
Sbjct  1     RQVTYSKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSTSNMPKTLERYQKCSYE  60

Query  523   TLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPLNIDEIEHLEHQLDTSL  702
             T EVN   ++ EQSSY+E+LKLKGK+E+LQRYQR LLGEDLGPL+I E+E+LEHQL+T+L
Sbjct  61    TPEVNNAAQEMEQSSYREFLKLKGKHEALQRYQRQLLGEDLGPLSIKELENLEHQLETTL  120

Query  703   KHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNNLQQPWGPGEQSGAYSQ  882
             K IRS +TQ +LDQL DLQTKE+LW+EANK LE KL+E Y +N+L + W  GEQ  +Y  
Sbjct  121   KQIRSIKTQSMLDQLYDLQTKEQLWIEANKGLERKLDEIYRENHL-RSWANGEQCSSYGS  179

Query  883   QHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvnav---LPGWML  1032
                 Q+ GFFQPL+C+ST  IG+ P   S+QITAAT       V   +PGWML
Sbjct  180   HQHPQSQGFFQPLQCNSTSQIGYTP-EVSNQITAATTHHQDQNVNGIIPGWML  231



>emb|CBI27678.3| unnamed protein product [Vitis vinifera]
Length=242

 Score =   269 bits (688),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 162/247 (66%), Positives = 185/247 (75%), Gaps = 8/247 (3%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDN-EQssykeylklkgkyeslQRYQRHLLGEDLGP  651
             S+MLKTLERYQKC+YG  E N   ++  E SS +EYLKLK +YE+LQR QR+LLGEDLGP
Sbjct  61    SSMLKTLERYQKCNYGAPETNVSTREALELSSQQEYLKLKARYEALQRSQRNLLGEDLGP  120

Query  652   LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDN  831
             L+  E+E LE QLD SLK IRSTRTQ +LDQL+DLQ KE +  EANKTL+ +L E    N
Sbjct  121   LSTKELESLERQLDVSLKQIRSTRTQYMLDQLTDLQRKEHMLNEANKTLKQRLLEGTQVN  180

Query  832   NLQQPWGPGEQSGAYSQQHAD-QTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvn  1008
              LQ  W P  Q   Y +Q A  Q  GFF PLEC+ TL IG+ P      IT A    +VN
Sbjct  181   QLQ--WNPNAQDVGYGRQQAQPQGDGFFHPLECEPTLQIGYQP----DPITVAAAGPSVN  234

Query  1009  avLPGWM  1029
               +PGW+
Sbjct  235   NYMPGWL  241



>ref|XP_002873742.1| hypothetical protein ARALYDRAFT_909555 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AAU82008.1| SEPALLATA1 [Arabidopsis lyrata subsp. petraea]
 gb|EFH50001.1| hypothetical protein ARALYDRAFT_909555 [Arabidopsis lyrata subsp. 
lyrata]
Length=249

 Score =   269 bits (688),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 163/251 (65%), Positives = 195/251 (78%), Gaps = 7/251 (3%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEV-NRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGP  651
             SNMLKTL+RYQKCSYG++EV N+P K+ E  SY+EYLKLKG+YE+LQR QR+LLGEDLGP
Sbjct  61    SNMLKTLDRYQKCSYGSIEVNNKPAKELEN-SYREYLKLKGRYENLQRQQRNLLGEDLGP  119

Query  652   LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEF--YV  825
             LN  E+E LE QLD SLK +RS +TQ +LDQLSDLQ KE++ LE N+ L  KL++     
Sbjct  120   LNSKELEQLERQLDGSLKQVRSIKTQYMLDQLSDLQNKEQMLLETNRALAMKLDDMIGVR  179

Query  826   DNNLQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnv  1005
              +++   W  GEQ+  Y+  H  Q+ G +QPLEC+ TL +G++    S QITA T AQ  
Sbjct  180   SHHMGGGWEGGEQNVTYA-HHQAQSQGLYQPLECNPTLQMGYDNPVCSEQITATTQAQAQ  238

Query  1006  nav--LPGWML  1032
                  +PGWML
Sbjct  239   QGNGYIPGWML  249



>gb|AGW23594.1| MADS1 [Mangifera indica]
Length=254

 Score =   269 bits (688),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 151/255 (59%), Positives = 190/255 (75%), Gaps = 10/255 (4%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             S+M+KTLERYQ+CSYG L+ NR   ++ Q +Y+EYLKLK   E LQR QR+LLGEDLGPL
Sbjct  61    SSMMKTLERYQRCSYGALDTNRTGNES-QGTYQEYLKLKTTVEVLQRSQRNLLGEDLGPL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             +  E++ LE+QL+TSLKHIR+T+TQ ++DQLS+LQ +E++ +E NK L  K EE      
Sbjct  120   STKELDQLENQLETSLKHIRTTKTQFMVDQLSELQKREQMLVETNKALRKKFEETGAQVP  179

Query  835   LQQPWG-PGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSS--------QItaa  987
              +  W   G Q+ AY+ +    + GFFQPL  +ST+++G+NP+A  +          + A
Sbjct  180   FRLAWDQAGVQNMAYNTRLPGHSEGFFQPLGANSTINMGYNPMAVVASSGAEEVVSFSVA  239

Query  988   tnaqnvnavLPGWML  1032
                Q VN  +PGWML
Sbjct  240   GQTQTVNGYIPGWML  254



>ref|XP_009131500.1| PREDICTED: developmental protein SEPALLATA 1-like [Brassica rapa]
 emb|CAD48303.1| MADS-box protein SEP1-a [Brassica oleracea var. botrytis]
 gb|AGT20510.1| SEP1.a [Brassica oleracea var. viridis]
Length=250

 Score =   269 bits (688),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 161/252 (64%), Positives = 191/252 (76%), Gaps = 8/252 (3%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEV-NRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGP  651
             SNM+KTLERYQKCSYG++EV N+P K+ E  SY+EYLKLKG+YE LQR QR+LLGEDLGP
Sbjct  61    SNMIKTLERYQKCSYGSIEVNNKPAKELEN-SYREYLKLKGRYEGLQRQQRNLLGEDLGP  119

Query  652   LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEF----  819
             LN  E+E +E QLD SLK +RS +TQ +LDQLSDLQTKE++ LE N+ L  KL++     
Sbjct  120   LNSKELEQIERQLDGSLKQVRSIKTQYMLDQLSDLQTKEQMLLETNRALAMKLDDMIGVR  179

Query  820   -YVDNNLQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatna  996
              +        W   E + +Y+  H  Q+ G FQPLEC+ TL +G++    S QITA T A
Sbjct  180   SHHMGGGGGGWEGNEHNVSYA-HHQAQSQGLFQPLECNPTLQMGYDNPVCSEQITATTQA  238

Query  997   qnvnavLPGWML  1032
             Q     +P WML
Sbjct  239   QAQPGYIPDWML  250



>emb|CAA04920.1| MdMADS9 [Malus domestica]
Length=242

 Score =   268 bits (686),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 161/244 (66%), Positives = 194/244 (80%), Gaps = 4/244 (2%)
 Frame = +1

Query  307   RVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSSTSNML  486
             RVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEF S+ ++L
Sbjct  1     RVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFCSSPSIL  60

Query  487   KTLERYQKCSYGTLE-VNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPLNID  663
             +T++RYQKCSYG ++ VN P K+ E SSY+EY+KLKG+ ESLQR QR+LLGE+LGPLN  
Sbjct  61    QTVDRYQKCSYGAVDQVNIPAKELE-SSYREYMKLKGRCESLQRTQRNLLGEELGPLNTK  119

Query  664   EIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNNLQQ  843
             E+E LE QL+ SLK +RST+TQ +LDQLS LQ KE+L +EAN+ L  KL+E    N L+Q
Sbjct  120   ELEQLERQLEASLKQVRSTKTQYMLDQLSALQNKEQLLIEANRDLTMKLDEIGSRNQLRQ  179

Query  844   PWGPGEQSGAY-SQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvnavLP  1020
              W  G+Q  AY +Q H  Q+ GFFQPL+C+ TL IG+ P   S Q+ A T+AQ VN  +P
Sbjct  180   SWEGGDQGMAYGTQHHHAQSQGFFQPLDCNPTLQIGY-PAEGSEQMGATTHAQQVNCFIP  238

Query  1021  GWML  1032
             GWML
Sbjct  239   GWML  242



>gb|AGT20511.1| SEP2.a [Brassica oleracea var. viridis]
Length=252

 Score =   269 bits (687),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 160/253 (63%), Positives = 186/253 (74%), Gaps = 8/253 (3%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEV+LIVFSNRGKLYEF ST
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVSLIVFSNRGKLYEFCST  60

Query  475   SNMLKTLERYQKCSYGTLEV-NRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGP  651
             SNMLKTLERYQKCSYG++EV N+P K+ E  SY+EYLKLKG+YE+LQR QR+LLGEDLGP
Sbjct  61    SNMLKTLERYQKCSYGSVEVNNKPAKELEN-SYREYLKLKGRYENLQRQQRNLLGEDLGP  119

Query  652   LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEF--YV  825
             LN  E+E LE QLD SLK +R  +TQ +LDQL+DLQ KE + LEAN+ L  KLE+     
Sbjct  120   LNSKELEQLERQLDGSLKQVRCIKTQYMLDQLTDLQGKEHILLEANRALSMKLEDMIGVR  179

Query  826   DNNLQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnv  1005
              + +   W  G+Q       H  Q+ G FQ LECD TL +G+N    S Q+      Q+ 
Sbjct  180   SHQIGGAWEGGDQQHVAYGHHQAQSQGLFQSLECDPTLQMGYNHPVCSEQMVVTAQGQSS  239

Query  1006  n----avLPGWML  1032
                    +PGWML
Sbjct  240   QPGNNGYIPGWML  252



>ref|XP_006400104.1| hypothetical protein EUTSA_v10014493mg [Eutrema salsugineum]
 gb|ESQ41557.1| hypothetical protein EUTSA_v10014493mg [Eutrema salsugineum]
Length=250

 Score =   268 bits (686),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 163/252 (65%), Positives = 196/252 (78%), Gaps = 8/252 (3%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEV-NRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGP  651
             SNM+KTL+RYQKCSYG++EV N+P K+ E  SY+EYLKLKG+YE+LQR QR+LLGEDLGP
Sbjct  61    SNMIKTLDRYQKCSYGSIEVNNKPAKELEN-SYREYLKLKGRYENLQRQQRNLLGEDLGP  119

Query  652   LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDN  831
             LN  E+E LE QLD SLK +RS +TQ +LDQLSDLQ+KE++ LE N+ L  KL++     
Sbjct  120   LNSKELEQLERQLDGSLKQVRSIKTQYMLDQLSDLQSKEQMLLETNRALSMKLDDMIGVR  179

Query  832   NLQQ---PWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqn  1002
             +       W   EQ+ +Y+  H  Q+ G +QPLEC++TL IG++    S QITA T AQ 
Sbjct  180   SHHMGGGGWEGNEQNVSYA-HHQAQSQGLYQPLECNATLQIGYDNPVGSEQITATTQAQA  238

Query  1003  v--navLPGWML  1032
                N  +PGWML
Sbjct  239   QHGNGYIPGWML  250



>ref|XP_008801852.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X3 [Phoenix dactylifera]
Length=242

 Score =   268 bits (685),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 155/246 (63%), Positives = 188/246 (76%), Gaps = 6/246 (2%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             S+MLKTLERYQKC+YG  E N  +++  QSS +EYLKLK + E+LQR QR+LLGEDLGPL
Sbjct  61    SSMLKTLERYQKCNYGAPETNIVSRET-QSSQQEYLKLKARVEALQRSQRNLLGEDLGPL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             +  E+E LE QLD SLK IRSTRTQ +LDQL+DLQ +E++  EANK+L+ +LEE      
Sbjct  120   SSKELEQLERQLDASLKQIRSTRTQYMLDQLADLQRREQMLCEANKSLKRRLEESNQATQ  179

Query  835   LQQPWGPGEQSGAYSQQHAD-QTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvna  1011
              QQ W P   +  Y +Q    Q  GF+QP+EC+ TLHIG++P   +    AA    +V+ 
Sbjct  180   -QQVWDPNAHAVGYGRQPPQPQGDGFYQPIECEPTLHIGYHPEQIT---IAAGPGPSVSN  235

Query  1012  vLPGWM  1029
              +PGW+
Sbjct  236   YMPGWL  241



>dbj|BAM34478.1| MADS-box transcription factor [Alstroemeria ligtu subsp. ligtu]
Length=244

 Score =   268 bits (685),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 159/248 (64%), Positives = 190/248 (77%), Gaps = 9/248 (4%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEV LIVFSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVGLIVFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             S+M+KTLERYQKC+YG  E N  +++  QSS +EYLKLK + E+LQRYQR+LLGEDLGPL
Sbjct  61    SSMMKTLERYQKCNYGAPETNVISRET-QSSQQEYLKLKARVEALQRYQRNLLGEDLGPL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             +  E+E LE QLD SLK IRSTRTQ +LDQL+DLQ KE++  EANK+L  +LEE    N 
Sbjct  120   SSKELEQLERQLDASLKQIRSTRTQFMLDQLADLQRKEQMLCEANKSLRRRLEESSHPNQ  179

Query  835   LQQPWGPGEQSGA-YSQQHAD-QTHGFFQPLECDSTLHIGFNPVATSSQItaatna-qnv  1005
              QQ W     S A Y+++ A  Q  GFF PLEC+ TL IG++P     QIT A+    + 
Sbjct  180   -QQVWDHNAHSAAGYAREQAQPQGDGFFHPLECEPTLQIGYHP----DQITIASAPGPSA  234

Query  1006  navLPGWM  1029
             ++ +PGW+
Sbjct  235   SSYMPGWL  242



>gb|AIU94434.1| MADS-box transcription factor 2 isoform 2, partial [Musa balbisiana]
Length=247

 Score =   268 bits (684),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 156/248 (63%), Positives = 193/248 (78%), Gaps = 5/248 (2%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             S+MLKTLERYQKC+YG  E N  +++  Q+S +EYLKLK + E+LQR QR+LLGEDLGPL
Sbjct  61    SSMLKTLERYQKCNYGAPETNIISREI-QTSQQEYLKLKARVEALQRSQRNLLGEDLGPL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             +I E+E LE QLD SL+ IRSTRTQ +LDQL+DLQ +E++  EANK L+ +++E    N 
Sbjct  120   SIKELEQLERQLDASLRQIRSTRTQCMLDQLADLQRREQMLCEANKALKIRMDEGNQANQ  179

Query  835   LQQPWGPGEQSGAYSQ-QHADQTHGFFQPLECDSTLHIGFNP--VATSSQItaatnaqnv  1005
              QQ W P  Q+ AY + Q   Q  GFFQP++C+ TL IG++P  +A ++   AA    +V
Sbjct  180   -QQLWDPNAQAVAYCRHQPQPQGDGFFQPIDCEPTLQIGYHPDQMAIAAAAAAAAAGPSV  238

Query  1006  navLPGWM  1029
             +  +PGW+
Sbjct  239   SNYVPGWL  246



>ref|XP_009117898.1| PREDICTED: developmental protein SEPALLATA 2 [Brassica rapa]
Length=252

 Score =   268 bits (684),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 159/253 (63%), Positives = 187/253 (74%), Gaps = 8/253 (3%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEV+LIVFSNRGKLYEF ST
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVSLIVFSNRGKLYEFCST  60

Query  475   SNMLKTLERYQKCSYGTLEV-NRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGP  651
             SNMLKTLERYQKCSYG++EV N+P K+ E  SY+EYLKLKG+YE+LQR QR+LLGEDLGP
Sbjct  61    SNMLKTLERYQKCSYGSVEVNNKPAKELEN-SYREYLKLKGRYENLQRQQRNLLGEDLGP  119

Query  652   LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEF--YV  825
             LN  E+E LE QLD SLK +R  +TQ +LDQL+DLQ KE + L+AN+ L  KLE+     
Sbjct  120   LNSKELEQLERQLDGSLKQVRCIKTQYMLDQLTDLQGKEHILLDANRALSMKLEDMIGVR  179

Query  826   DNNLQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnv  1005
              +++   W  G+Q       H  Q+ G FQ LECD TL +G+N    S Q+      Q+ 
Sbjct  180   SHHIGGTWEGGDQHNVAYGHHQAQSQGLFQSLECDPTLQMGYNHPVCSEQMAVTAQGQSS  239

Query  1006  n----avLPGWML  1032
                    +PGWML
Sbjct  240   QPGNNGYIPGWML  252



>ref|XP_010463632.1| PREDICTED: developmental protein SEPALLATA 2-like [Camelina sativa]
Length=250

 Score =   268 bits (684),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 162/251 (65%), Positives = 187/251 (75%), Gaps = 6/251 (2%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEV+LIVFSNRGKLYEF ST
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVSLIVFSNRGKLYEFCST  60

Query  475   SNMLKTLERYQKCSYGTLEV-NRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGP  651
             SNMLKTLERYQKCSYG++EV N+P K+ E  SY+EYLKLKG+YESLQR QR+LLGEDLGP
Sbjct  61    SNMLKTLERYQKCSYGSIEVNNKPAKELEN-SYREYLKLKGRYESLQRQQRNLLGEDLGP  119

Query  652   LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEF--YV  825
             LN  E+E LE QLD SLK +R  +TQ +LDQLSDLQ KE + LEAN+ L  KLE+     
Sbjct  120   LNSKELEQLERQLDGSLKQVRCIKTQYMLDQLSDLQGKEHILLEANRALSMKLEDMIGVR  179

Query  826   DNNLQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQ--Itaatnaq  999
              +++   W  G+Q       H   + G +Q LECD TL IG+     S Q  +T    +Q
Sbjct  180   HHHIGGAWEAGDQHNVAYGHHQAHSQGLYQSLECDPTLQIGYGHPVCSEQMAVTTQGQSQ  239

Query  1000  nvnavLPGWML  1032
               N  +PGWML
Sbjct  240   PGNGYIPGWML  250



>ref|XP_010485469.1| PREDICTED: developmental protein SEPALLATA 2 [Camelina sativa]
Length=250

 Score =   267 bits (683),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 162/251 (65%), Positives = 187/251 (75%), Gaps = 6/251 (2%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEV+LIVFSNRGKLYEF ST
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVSLIVFSNRGKLYEFCST  60

Query  475   SNMLKTLERYQKCSYGTLEV-NRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGP  651
             SNMLKTLERYQKCSYG++EV N+P K+ E  SY+EYLKLKG+YESLQR QR+LLGEDLGP
Sbjct  61    SNMLKTLERYQKCSYGSIEVNNKPAKELEN-SYREYLKLKGRYESLQRQQRNLLGEDLGP  119

Query  652   LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEF--YV  825
             LN  E+E LE QLD SLK +R  +TQ +LDQLSDLQ KE + LEAN+ L  KLE+     
Sbjct  120   LNSKELEQLERQLDGSLKQVRCIKTQYMLDQLSDLQGKEHILLEANRALSIKLEDMIGVR  179

Query  826   DNNLQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQ--Itaatnaq  999
              +++   W  G+Q       H   + G +Q LECD TL IG+     S Q  +T    +Q
Sbjct  180   HHHIGGAWEAGDQQNVAYGHHQAHSQGLYQSLECDPTLQIGYGHPVCSEQMAVTTQGQSQ  239

Query  1000  nvnavLPGWML  1032
               N  +PGWML
Sbjct  240   PGNGYIPGWML  250



>ref|XP_006298399.1| hypothetical protein CARUB_v10014470mg [Capsella rubella]
 gb|EOA31297.1| hypothetical protein CARUB_v10014470mg [Capsella rubella]
Length=250

 Score =   267 bits (682),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 160/251 (64%), Positives = 186/251 (74%), Gaps = 6/251 (2%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEV+LIVFSNRGKLYEF ST
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVSLIVFSNRGKLYEFCST  60

Query  475   SNMLKTLERYQKCSYGTLEV-NRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGP  651
             SNMLKTLERYQKCSYG++EV N+P K+ E  SY+EYLKLKG+YE+LQR QR+LLGEDLGP
Sbjct  61    SNMLKTLERYQKCSYGSIEVNNKPAKELEN-SYREYLKLKGRYENLQRQQRNLLGEDLGP  119

Query  652   LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEF--YV  825
             LN  E+E LE QLD SLK +R  +TQ +LDQLSDLQ KE + LEAN+ L  KLE+     
Sbjct  120   LNSKELEQLERQLDGSLKQVRCIKTQYMLDQLSDLQGKEHILLEANRALSVKLEDMIGVR  179

Query  826   DNNLQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQ--Itaatnaq  999
              +++   W  G+Q       H   + G +Q LECD TL IG+     S Q  +    + Q
Sbjct  180   HHHIGGAWEAGDQQNVVYGHHQAHSQGLYQSLECDPTLQIGYGHPVCSEQMAVATQGHNQ  239

Query  1000  nvnavLPGWML  1032
               N  +PGWML
Sbjct  240   PGNGYIPGWML  250



>emb|CDX69499.1| BnaA10g18480D [Brassica napus]
Length=264

 Score =   267 bits (683),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 166/265 (63%), Positives = 191/265 (72%), Gaps = 20/265 (8%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             SNM+KTLERYQKCSYG++EVN       ++SY+EYLKLKG+YESLQR QR+LLGEDLGPL
Sbjct  61    SNMIKTLERYQKCSYGSIEVNNKPAKELENSYREYLKLKGRYESLQRQQRNLLGEDLGPL  120

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             N  E+E LE QLD SLK +RS +TQ +LDQLSDLQ+KE++ LE N+ L  KL++     +
Sbjct  121   NSKELEQLERQLDGSLKQVRSIKTQYMLDQLSDLQSKEQMLLETNRALAIKLDDMIGVRS  180

Query  835   ----LQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGF-------------NPVA  963
                     W   EQ+  Y   H  Q+ G FQPLEC+ TL IGF             NPV 
Sbjct  181   HHMGGGGGWEGNEQNVPYEHHHQAQSQGLFQPLECNPTLQIGFLVLRGPYNLRWYDNPVG  240

Query  964   TSSQItaatnaqnv--navLPGWML  1032
              S QIT  T AQ    N  +PGWML
Sbjct  241   -SEQITTTTQAQAQPGNGYIPGWML  264



>ref|XP_010470619.1| PREDICTED: developmental protein SEPALLATA 2-like [Camelina sativa]
Length=250

 Score =   266 bits (681),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 162/251 (65%), Positives = 186/251 (74%), Gaps = 6/251 (2%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEV+LIVFSNRGKLYEF ST
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVSLIVFSNRGKLYEFCST  60

Query  475   SNMLKTLERYQKCSYGTLEV-NRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGP  651
             SNMLKTLERYQKCSYG++EV N+P K+ E  SY+EYLKLKG+YESLQR QR+LLGEDLGP
Sbjct  61    SNMLKTLERYQKCSYGSIEVNNKPAKELEN-SYREYLKLKGRYESLQRQQRNLLGEDLGP  119

Query  652   LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEF--YV  825
             LN  E+E LE QLD SLK +R  +TQ +LDQLSDL  KE + LEAN+ L  KLE+     
Sbjct  120   LNSKELEQLERQLDGSLKQVRCIKTQYMLDQLSDLLGKEHILLEANRALSMKLEDMIGVR  179

Query  826   DNNLQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQ--Itaatnaq  999
              +N+   W  G+Q       H   + G +Q LECD TL IG+     S Q  +T    +Q
Sbjct  180   HHNIGGAWEAGDQHNVAYGHHQAHSQGLYQSLECDPTLQIGYGHPVCSEQMAVTTQGQSQ  239

Query  1000  nvnavLPGWML  1032
               N  +PGWML
Sbjct  240   PGNGYIPGWML  250



>ref|NP_001268114.1| MADS-box protein 4 [Vitis vinifera]
 gb|AAM21344.1|AF373603_1 MADS-box protein 4 [Vitis vinifera]
Length=242

 Score =   266 bits (680),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 161/247 (65%), Positives = 184/247 (74%), Gaps = 8/247 (3%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDN-EQssykeylklkgkyeslQRYQRHLLGEDLGP  651
             S+MLKTLERYQKC+YG  E N   ++  E SS +EYLKLK +YE+LQ  QR+LLGEDLGP
Sbjct  61    SSMLKTLERYQKCNYGAPETNVSTREALELSSQQEYLKLKARYEALQLSQRNLLGEDLGP  120

Query  652   LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDN  831
             L+  E+E LE QLD SLK IRSTRTQ +LDQL+DLQ KE +  EANKTL+ +L E    N
Sbjct  121   LSTKELESLERQLDVSLKQIRSTRTQYMLDQLTDLQRKEHMLNEANKTLKQRLLEGTQVN  180

Query  832   NLQQPWGPGEQSGAYSQQHAD-QTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvn  1008
              LQ  W P  Q   Y +Q A  Q  GFF PLEC+ TL IG+ P      IT A    +VN
Sbjct  181   QLQ--WNPNAQDVGYGRQQAQPQGDGFFHPLECEPTLQIGYQP----DPITVAAAGPSVN  234

Query  1009  avLPGWM  1029
               +PGW+
Sbjct  235   NYMPGWL  241



>ref|XP_010549963.1| PREDICTED: developmental protein SEPALLATA 1 [Tarenaya hassleriana]
 gb|ABD96852.1| hypothetical protein [Cleome spinosa]
Length=248

 Score =   266 bits (680),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 158/251 (63%), Positives = 189/251 (75%), Gaps = 8/251 (3%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEV-NRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGP  651
              NMLKTLERYQKCSYG++EV N+P K+ E  SY+EYLKLK ++E LQR QR+LLGEDLGP
Sbjct  61    PNMLKTLERYQKCSYGSIEVNNKPAKELEN-SYREYLKLKSRFEGLQRQQRNLLGEDLGP  119

Query  652   LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYV--  825
             LN  E+E +E QLD SLK +RS +TQ ++DQLS+LQ++E++ LEAN+ L  KL+E     
Sbjct  120   LNSKELEQIERQLDGSLKQVRSIKTQYMIDQLSELQSREQMLLEANRALSMKLDEMVGAR  179

Query  826   DNNLQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnv  1005
              +++   W   EQ+  Y   H  Q  G FQPLEC+ TL IG+N      Q+TA T A   
Sbjct  180   THHIGGGWEGSEQNVTYG--HQPQPQGLFQPLECNPTLQIGYNNPECPEQMTATTQAPAQ  237

Query  1006  nav--LPGWML  1032
                  +PGWML
Sbjct  238   AGNGYIPGWML  248



>gb|AAF12701.2| Apetala 1 protein [Populus tremuloides]
Length=237

 Score =   265 bits (678),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 151/236 (64%), Positives = 181/236 (77%), Gaps = 3/236 (1%)
 Frame = +1

Query  328   ENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSSTSNMLKTLERYQ  507
             ENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF STSNMLKTLERYQ
Sbjct  4     ENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSTSNMLKTLERYQ  63

Query  508   KCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPLNIDEIEHLEHQ  687
             KCSYG  EVN+P K+ E  SY+EYLK+K ++E+LQR QR+LLGEDLGPLN  ++E LE Q
Sbjct  64    KCSYGAEEVNKPAKELEN-SYREYLKVKARFEALQRTQRNLLGEDLGPLNTKDLEQLERQ  122

Query  688   LDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNNLQQPW-GPGEQ  864
             L++SL  +RST+TQ +LDQL+DLQ KE L LEAN+ L  KL+E    N+L+  W G  +Q
Sbjct  123   LESSLNQVRSTKTQYMLDQLADLQNKEHLLLEANRGLTIKLDEISARNSLRPSWEGDDQQ  182

Query  865   SGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvnavLPGWML  1032
             + +Y  QHA Q+ G FQ LEC+ TL IG+N V +          Q V+  +PGWML
Sbjct  183   NMSYGHQHA-QSQGLFQALECNPTLQIGYNAVGSDQVSAITHATQQVHGFIPGWML  237



>ref|XP_010913017.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X1 [Elaeis guineensis]
 gb|AAQ03226.1|AF411845_1 MADS box transcription factor [Elaeis guineensis]
Length=242

 Score =   266 bits (679),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 154/246 (63%), Positives = 186/246 (76%), Gaps = 6/246 (2%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             S+MLKTLERYQKC+YG  E N  +++  Q+S +EYLKLK + E+LQR QR+LLG+DLGPL
Sbjct  61    SSMLKTLERYQKCNYGAPETNIVSRET-QTSQQEYLKLKARVEALQRSQRNLLGDDLGPL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             +  E+E LE QLD SLK IRSTRTQ +LDQL+DLQ +E++  EANK+L+ +LEE      
Sbjct  120   SSKELEQLERQLDASLKQIRSTRTQYMLDQLADLQRREQMLCEANKSLKQRLEESNQATQ  179

Query  835   LQQPWGPGEQSGAYSQQHAD-QTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvna  1011
              QQ W P   +  Y +Q    Q  GF+Q +ECD TLHIG+ P   +    AA    +V+ 
Sbjct  180   -QQVWDPNAPAVGYGRQPPQPQGDGFYQQIECDPTLHIGYPPEQIT---IAAAPGPSVSN  235

Query  1012  vLPGWM  1029
              +PGW+
Sbjct  236   YMPGWL  241



>ref|XP_002263410.2| PREDICTED: MADS-box protein CMB1 [Vitis vinifera]
 emb|CBI27319.3| unnamed protein product [Vitis vinifera]
Length=243

 Score =   266 bits (679),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 155/246 (63%), Positives = 187/246 (76%), Gaps = 3/246 (1%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S 
Sbjct  1     MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSG  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             S+M +TLERYQ+CSY  LE ++P K+  Q+SY+EYLKLK K E LQR QR+ LGEDLG L
Sbjct  61    SSMPETLERYQRCSYSALEASQPAKET-QNSYQEYLKLKSKVEVLQRTQRNFLGEDLGHL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
                E+E LEHQLD SLK IRST+TQ +LDQLSDLQ KE++ +EAN  L  KL E   ++ 
Sbjct  120   GTKELEQLEHQLDKSLKQIRSTKTQFMLDQLSDLQRKEQILMEANNALRRKLGESSAESG  179

Query  835   LQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvnav  1014
             L   W     +  Y+++   Q+  FF+PL+CDSTL IG+NPV    ++  A+  QNVN  
Sbjct  180   LGSTWEAAAHNLPYNREPV-QSEDFFEPLQCDSTLQIGYNPV-LRVEMNGASTTQNVNGF  237

Query  1015  LPGWML  1032
             +PGWM+
Sbjct  238   IPGWMV  243



>ref|XP_009147359.1| PREDICTED: developmental protein SEPALLATA 2-like [Brassica rapa]
Length=250

 Score =   265 bits (678),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 161/251 (64%), Positives = 186/251 (74%), Gaps = 6/251 (2%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEV+LIVFSNRGKLYEF ST
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVSLIVFSNRGKLYEFCST  60

Query  475   SNMLKTLERYQKCSYGTLEV-NRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGP  651
             SNMLKTL+RYQKCSYG++EV N+P K+ E  SY+EYLKLKG+YE+LQ  QR+LLGEDLGP
Sbjct  61    SNMLKTLDRYQKCSYGSVEVNNKPAKELEN-SYREYLKLKGRYENLQLQQRNLLGEDLGP  119

Query  652   LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEF--YV  825
             LN  E+E LE QLD SLK +R  +TQ +LDQL+DLQ KE + LEAN+ L  KLE+     
Sbjct  120   LNSKELEQLERQLDGSLKQVRCIKTQYMLDQLTDLQGKEHMLLEANRALSIKLEDMIGMR  179

Query  826   DNNLQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQ--Itaatnaq  999
              +++   W  G+Q       H  Q  G FQ LECD TL IG+N    S Q  +T     Q
Sbjct  180   SHHVGGAWEGGDQQNVAYGHHQTQPQGLFQSLECDPTLQIGYNHPVCSEQMAVTTQGQTQ  239

Query  1000  nvnavLPGWML  1032
               N  +PGWML
Sbjct  240   PGNGYIPGWML  250



>ref|XP_009761698.1| PREDICTED: MADS-box protein CMB1-like [Nicotiana sylvestris]
Length=245

 Score =   265 bits (677),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 152/246 (62%), Positives = 190/246 (77%), Gaps = 1/246 (0%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FS+RGKLYEF ST
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFCST  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             S+M++TLE+YQ+CSY +L+  +   D+ Q++Y EYL+LK + E LQR QR+LLGEDLG L
Sbjct  61    SSMMQTLEKYQQCSYASLDPMQSASDHTQNNYHEYLRLKARVELLQRSQRNLLGEDLGTL  120

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             N  E+EHLEHQLD+SLK IRS +TQ +LDQL+DLQ KE++  EANK L  KLEE      
Sbjct  121   NSRELEHLEHQLDSSLKQIRSRKTQNMLDQLADLQQKEQMLAEANKQLRRKLEESAARVP  180

Query  835   LQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvnav  1014
             L+  W  G Q+  +++Q   QT GFFQPL  +S+   G++P+   +++ AA  A N+N  
Sbjct  181   LRLSWDNGGQTMQHNRQLPPQTEGFFQPLGLNSSPQFGYSPMG-GNEVNAAATANNMNGF  239

Query  1015  LPGWML  1032
             +PGWML
Sbjct  240   IPGWML  245



>ref|XP_007045799.1| MADS-box transcription factor [Theobroma cacao]
 gb|EOY01631.1| MADS-box transcription factor [Theobroma cacao]
Length=240

 Score =   265 bits (677),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 155/246 (63%), Positives = 180/246 (73%), Gaps = 6/246 (2%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALI+FSNRGKLYEF ST
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCST  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             S+M KTLERY +C+YGTLE  +   D  QSSY+EYLKLK K E LQR QRH LGEDLG L
Sbjct  61    SSMAKTLERYHRCTYGTLEPGQTESDT-QSSYQEYLKLKAKVEVLQRSQRHFLGEDLGDL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
                E+E LEHQLD SLK +RST+   +LDQL++LQ KE++ LE N+ L  KLEE    + 
Sbjct  120   GSTELEQLEHQLDFSLKQLRSTKMHSMLDQLAELQRKEEILLETNRNLRRKLEE--STST  177

Query  835   LQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvnav  1014
             L+  W  GEQS  Y+     Q  GFF+PL+C S++ IG+NP A       A  A   N  
Sbjct  178   LRSSWETGEQSNPYNHHPPPQPEGFFEPLQCSSSMQIGYNPTAADQD---AAAASAPNGF  234

Query  1015  LPGWML  1032
             +PGWML
Sbjct  235   IPGWML  240



>gb|AIU94430.1| MADS-box transcription factor 2 isoform 2 [Musa acuminata]
 gb|AIU94431.1| MADS-box transcription factor 2 isoform 2 [Musa acuminata]
Length=244

 Score =   265 bits (676),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 148/221 (67%), Positives = 175/221 (79%), Gaps = 5/221 (2%)
 Frame = +1

Query  295  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKL+EF S+
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLFEFCSS  60

Query  475  SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
            S+MLKTLERYQKC+YG  E N  +++  Q+S +EYLKLK + E+LQR QR+LLGEDLGPL
Sbjct  61   SSMLKTLERYQKCNYGAPETNVMSRET-QNSQQEYLKLKARVEALQRSQRNLLGEDLGPL  119

Query  655  NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
            NI E+E LE QLD SL+ IRSTRTQ +LDQL+DLQ +E++  EANK L+ +LEE    N 
Sbjct  120  NIKELEQLERQLDASLRQIRSTRTQYMLDQLTDLQRREQMLCEANKALKRRLEESNQANQ  179

Query  835  LQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNP  957
             QQ W P        QQ   Q  GFFQP++C+ TL IG++P
Sbjct  180  -QQLWDPNTYG---RQQPQPQGDGFFQPIDCEPTLQIGYHP  216



>gb|AIU94432.1| MADS-box transcription factor 2 isoform 3, partial [Musa acuminata]
Length=243

 Score =   265 bits (676),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 156/247 (63%), Positives = 189/247 (77%), Gaps = 7/247 (3%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKL+EF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLFEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             S+MLKTLERYQKC+YG  E N  +++  QSS +EYLKLK + E+LQR QR+LLGEDLGPL
Sbjct  61    SSMLKTLERYQKCNYGAPETNVISRET-QSSQQEYLKLKARVEALQRSQRNLLGEDLGPL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             NI E+E LE QLD SL+ IRSTRTQ +LDQL+DLQ +E++  EANK L+ +LEE    N 
Sbjct  120   NIKELEQLERQLDASLRQIRSTRTQYMLDQLTDLQRREQMLCEANKALKRRLEESNQANQ  179

Query  835   LQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNP--VATSSQItaatnaqnvn  1008
              QQ W P        QQ   Q  GFFQP++C+ TL IG++P  +A ++   AA    +V+
Sbjct  180   -QQLWDPNTYG---RQQPQPQGDGFFQPIDCEPTLQIGYHPDQMAIAAAAAAAAAGPSVS  235

Query  1009  avLPGWM  1029
               +PGW+
Sbjct  236   NYVPGWL  242



>ref|XP_009419371.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Musa acuminata 
subsp. malaccensis]
Length=245

 Score =   265 bits (676),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 149/221 (67%), Positives = 175/221 (79%), Gaps = 5/221 (2%)
 Frame = +1

Query  295  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKL+EF S+
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLFEFCSS  60

Query  475  SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
            S+MLKTLERYQKC+YG  E N  +++  QSS +EYLKLK + E+LQR QR+LLGEDLGPL
Sbjct  61   SSMLKTLERYQKCNYGAPETNVISRET-QSSQQEYLKLKARVEALQRSQRNLLGEDLGPL  119

Query  655  NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
            NI E+E LE QLD SL+ IRSTRTQ +LDQL+DLQ +E++  EANK L+ +LEE    N 
Sbjct  120  NIKELEQLERQLDASLRQIRSTRTQYMLDQLTDLQRREQMLCEANKALKRRLEESNQANQ  179

Query  835  LQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNP  957
             QQ W P        QQ   Q  GFFQP++C+ TL IG++P
Sbjct  180  -QQLWDPNTYG---RQQPQPQGDGFFQPIDCEPTLQIGYHP  216



>emb|CDY57524.1| BnaA05g33600D [Brassica napus]
Length=250

 Score =   265 bits (676),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 161/251 (64%), Positives = 187/251 (75%), Gaps = 6/251 (2%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEV+LIVFSNRGKLYEF ST
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVSLIVFSNRGKLYEFCST  60

Query  475   SNMLKTLERYQKCSYGTLEV-NRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGP  651
             SNMLKTL+RYQKCSYG++EV N+P K+ E  SY+EYLKLKG+YE+LQ  QR+LLGEDLGP
Sbjct  61    SNMLKTLDRYQKCSYGSVEVNNKPAKELEN-SYREYLKLKGRYENLQLQQRNLLGEDLGP  119

Query  652   LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEF--YV  825
             LN  E+E LE QLD SLK +R  +TQ +LDQL+DLQ KE + LEAN+ L  KLE+     
Sbjct  120   LNSKELEQLERQLDGSLKQVRCIKTQYMLDQLTDLQGKEHMLLEANRALSIKLEDMIGMR  179

Query  826   DNNLQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQ--Itaatnaq  999
              +++   W  G+Q       H  Q  G FQ LECD TL IG+N    S Q  +T    +Q
Sbjct  180   SHHVGGAWEGGDQQNVAYGHHQTQPQGLFQSLECDPTLQIGYNHPVCSEQMAVTTQGPSQ  239

Query  1000  nvnavLPGWML  1032
               N  +PGWML
Sbjct  240   PGNGYIPGWML  250



>ref|XP_010653929.1| PREDICTED: MADS-box protein 4 isoform X1 [Vitis vinifera]
Length=258

 Score =   265 bits (677),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 154/227 (68%), Positives = 176/227 (78%), Gaps = 4/227 (2%)
 Frame = +1

Query  295  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475  SNMLKTLERYQKCSYGTLEVNRPNKDN-EQssykeylklkgkyeslQRYQRHLLGEDLGP  651
            S+MLKTLERYQKC+YG  E N   ++  E SS +EYLKLK +YE+LQR QR+LLGEDLGP
Sbjct  61   SSMLKTLERYQKCNYGAPETNVSTREALELSSQQEYLKLKARYEALQRSQRNLLGEDLGP  120

Query  652  LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDN  831
            L+  E+E LE QLD SLK IRSTRTQ +LDQL+DLQ KE +  EANKTL+ +L E    N
Sbjct  121  LSTKELESLERQLDVSLKQIRSTRTQYMLDQLTDLQRKEHMLNEANKTLKQRLLEGTQVN  180

Query  832  NLQQPWGPGEQSGAYSQQHAD-QTHGFFQPLECDSTLHIGFNPVATS  969
             LQ  W P  Q   Y +Q A  Q  GFF PLEC+ TL IG+  ++ S
Sbjct  181  QLQ--WNPNAQDVGYGRQQAQPQGDGFFHPLECEPTLQIGYIVLSIS  225



>ref|XP_010663486.1| PREDICTED: MADS-box protein CMB1 isoform X1 [Vitis vinifera]
Length=261

 Score =   265 bits (677),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 165/261 (63%), Positives = 189/261 (72%), Gaps = 17/261 (7%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFS+RGKLYEF S 
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSSRGKLYEFCSG  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
              +M KTLE+YQKCSYG LE ++P  +  QSSY+EYLKLK + E LQR QRHLLGEDL PL
Sbjct  61    PSMAKTLEKYQKCSYGALEASQPVYELTQSSYQEYLKLKTRVEVLQRSQRHLLGEDLDPL  120

Query  655   NIDEIEHLEHQLDTSLKHIRSTR---------------TQMVLDQLSDLQTKEKLWLEAN  789
             N  E+E LEHQL+ SLK IRST+               TQ +LDQL+DLQ KE + +EAN
Sbjct  121   NTKELEQLEHQLEMSLKQIRSTKFAVFGDILTVVYGFQTQNMLDQLADLQNKEHMLIEAN  180

Query  790   KTLESKLEEFYVDNNLQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATS  969
               L  KLEE    + LQQ W     S  YS+  A Q+ GFFQPLE +STL +G+N  A S
Sbjct  181   NALRRKLEESNGKHPLQQSWEAAGNSALYSRLPA-QSEGFFQPLERNSTLEMGYN-AAGS  238

Query  970   SQItaatnaqnvnavLPGWML  1032
             ++IT A  +QN N   PGWML
Sbjct  239   NEITLAAPSQNDNGFGPGWML  259



>dbj|BAD10944.1| SEPALLATA1 homologous protein [Silene latifolia]
Length=256

 Score =   265 bits (676),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 159/255 (62%), Positives = 194/255 (76%), Gaps = 11/255 (4%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSS-  471
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S 
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSG  60

Query  472   TSNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGP  651
              S+MLKTLERYQKCSYG +EVN+P+K+ E SSYKEYLKLK +YESLQR  R+LLGEDLGP
Sbjct  61    PSSMLKTLERYQKCSYGAVEVNKPSKELE-SSYKEYLKLKARYESLQRAHRNLLGEDLGP  119

Query  652   LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYV-D  828
             LN+ E++ LE QL++SLK IR  +TQ +LDQL+DLQ+KE   +EANK+L+++LE   V D
Sbjct  120   LNVKELDQLERQLESSLKQIRCIKTQSMLDQLTDLQSKEHALMEANKSLKAELERIMVKD  179

Query  829   NNLQQPW-GPGEQSGAYSQ-------QHADQTHGFFQPLECDSTLHIGFNPVATSSQIta  984
             N ++Q W G  E    + +            + G FQP++C+  LH+G+N   +  Q+TA
Sbjct  180   NQVRQSWEGHHEHQNVHYEHQHAHSQHQHAHSQGLFQPIDCNPNLHLGYNAETSDHQLTA  239

Query  985   atnaqnvnavLPGWM  1029
              T+   V   LPGWM
Sbjct  240   GTSHAQVPGFLPGWM  254



>ref|XP_007043947.1| K-box region and MADS-box transcription factor family protein 
isoform 1 [Theobroma cacao]
 gb|EOX99778.1| K-box region and MADS-box transcription factor family protein 
isoform 1 [Theobroma cacao]
Length=242

 Score =   264 bits (674),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 154/227 (68%), Positives = 177/227 (78%), Gaps = 4/227 (2%)
 Frame = +1

Query  295  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475  SNMLKTLERYQKCSYGTLEVNRPNKDN-EQssykeylklkgkyeslQRYQRHLLGEDLGP  651
            S+M+KTLERYQKC+YG  E N   ++  E SS +EYLKLK +YE+LQR QR+LLGEDLGP
Sbjct  61   SSMIKTLERYQKCNYGAPETNVSTREALELSSQQEYLKLKARYEALQRSQRNLLGEDLGP  120

Query  652  LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDN  831
            L+  E+E LE QLD+SLK IRSTRTQ +LDQL+DLQ KE L  EANKTL+ +L E Y  N
Sbjct  121  LSSKELESLERQLDSSLKQIRSTRTQYMLDQLTDLQRKEHLLNEANKTLKQRLVEGYQVN  180

Query  832  NLQQPWGPGEQSGAYSQQHAD-QTHGFFQPLECDSTLHIGFNPVATS  969
            +LQ    P  +   Y +Q A  Q  GFF PLEC+ TL IG+ P   S
Sbjct  181  SLQ--LNPNAEDVGYGRQPAQPQGDGFFHPLECEPTLQIGYQPDPIS  225



>gb|ACJ64681.1| MADS-box protein MADS4 [Musa acuminata AAA Group]
Length=243

 Score =   263 bits (672),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 148/222 (67%), Positives = 175/222 (79%), Gaps = 3/222 (1%)
 Frame = +1

Query  295  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
            MGRGRVELKRIEN INRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEF S+
Sbjct  1    MGRGRVELKRIENSINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFCSS  60

Query  475  SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
            S+ML+TLERYQKC+YG  E N  +++  QSS +EYLKLK + + LQR QR+LLGEDLGPL
Sbjct  61   SSMLRTLERYQKCNYGAPETNIISRET-QSSQQEYLKLKARVDGLQRSQRNLLGEDLGPL  119

Query  655  NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
            NI E+E LE QLD SL+ IRSTRTQ +LDQL DLQ +E++  EANK L+ +LEE   + +
Sbjct  120  NIKELEQLERQLDASLRQIRSTRTQYMLDQLGDLQRREQMLCEANKALKIRLEE-SSEAD  178

Query  835  LQQPWGPGEQSGAYS-QQHADQTHGFFQPLECDSTLHIGFNP  957
             QQ W P   + AY  QQ   Q  GFFQ ++C+ TL IG++P
Sbjct  179  QQQLWDPNTHAVAYGRQQPQPQGDGFFQSIDCEPTLQIGYHP  220



>gb|AAX15924.1| AGL9.2 [Persea americana]
Length=242

 Score =   263 bits (672),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 157/247 (64%), Positives = 186/247 (75%), Gaps = 8/247 (3%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             S+MLKTLERYQKC+YG  E     ++  QSS++EYLKLK + E+LQR QR+LLGEDLGPL
Sbjct  61    SSMLKTLERYQKCNYGAPETTVSTRET-QSSHQEYLKLKARVEALQRSQRNLLGEDLGPL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
                E++ LE QLD SLK IRSTRTQ +LDQL+DLQ +E++  EANK L+ +LEE    N 
Sbjct  120   TSKELDTLEKQLDASLKQIRSTRTQYMLDQLADLQRREQMLSEANKNLKRRLEEGMQAN-  178

Query  835   LQQPWGPGEQSGAYSQQHA-DQTHGFFQPLE-CDSTLHIGFNPVATSSQItaatnaqnvn  1008
               Q W P      Y +Q A  Q+ GFF PL+ C+ TLHIG+ P   + QIT A    +VN
Sbjct  179   -PQVWDPNGHPVTYGRQQAPPQSDGFFHPLDTCEPTLHIGYQP---ADQITIAAPGPSVN  234

Query  1009  avLPGWM  1029
               +PGW+
Sbjct  235   NYMPGWL  241



>ref|XP_011020782.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Populus 
euphratica]
Length=243

 Score =   263 bits (672),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 158/246 (64%), Positives = 185/246 (75%), Gaps = 5/246 (2%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDN-EQssykeylklkgkyeslQRYQRHLLGEDLGP  651
             S+MLKTLERYQKC+YG  E N   ++  E SS +EYLKLK +YE+LQR QR+LLGEDLGP
Sbjct  61    SSMLKTLERYQKCNYGAPEPNVSAREALELSSQQEYLKLKARYEALQRTQRNLLGEDLGP  120

Query  652   LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDN  831
             L+  E+E LE QLD SLK IRSTRTQ +LDQL+DLQ KE +   ANK+L+ +L E Y  N
Sbjct  121   LSSKELESLERQLDMSLKQIRSTRTQYMLDQLNDLQHKEHMLTAANKSLKERLMEGYEVN  180

Query  832   NLQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvna  1011
             +LQ      E  G   QQ   Q +GFF PLEC+ TL IG+ P    S IT  T+  ++ A
Sbjct  181   SLQLNLS-AEDVGFSRQQAQPQGYGFFHPLECEPTLQIGYQP---DSAITVVTSGPSMTA  236

Query  1012  vLPGWM  1029
              +P W+
Sbjct  237   YMPDWL  242



>gb|AGT20512.1| SEP2.b [Brassica oleracea var. viridis]
 emb|CDY43239.1| BnaC05g48320D [Brassica napus]
Length=250

 Score =   263 bits (672),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 159/251 (63%), Positives = 186/251 (74%), Gaps = 6/251 (2%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEV+LIVFSNRGKLYEF ST
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVSLIVFSNRGKLYEFCST  60

Query  475   SNMLKTLERYQKCSYGTLEV-NRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGP  651
             SNMLKTL+RYQKCSYG++EV N+P K+ E  SY+EYLKLKG+YE+LQ  QR+LLGEDLGP
Sbjct  61    SNMLKTLDRYQKCSYGSVEVNNKPAKELEN-SYREYLKLKGRYENLQLQQRNLLGEDLGP  119

Query  652   LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEF--YV  825
             LN  E+E LE +LD SLK +R  +TQ +LDQL+DLQ KE + LEAN+ L  KLE+     
Sbjct  120   LNSKELEQLERRLDGSLKQVRCIKTQYMLDQLTDLQGKEHMLLEANRALSIKLEDMIGVR  179

Query  826   DNNLQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQ--Itaatnaq  999
              + +   W  G+Q       H  Q+ G FQ LECD TL IG++    S Q  +T     Q
Sbjct  180   SHQIGGAWEGGDQQNVAYGHHQAQSQGLFQSLECDPTLQIGYSHPVCSEQMAVTTQGQNQ  239

Query  1000  nvnavLPGWML  1032
               N  +PGWML
Sbjct  240   PGNGYIPGWML  250



>ref|XP_002884314.1| SEPALLATA2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60573.1| SEPALLATA2 [Arabidopsis lyrata subsp. lyrata]
Length=250

 Score =   263 bits (672),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 163/252 (65%), Positives = 191/252 (76%), Gaps = 8/252 (3%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEV+LIVFSNRGKLYEF ST
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVSLIVFSNRGKLYEFCST  60

Query  475   SNMLKTLERYQKCSYGTLEV-NRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGP  651
             SNMLKTLERYQKCSYG++EV N+P K+ E  SY+EYLKLKG+YE+LQR QR+LLGEDLGP
Sbjct  61    SNMLKTLERYQKCSYGSIEVNNKPAKELEN-SYREYLKLKGRYENLQRQQRNLLGEDLGP  119

Query  652   LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEF--YV  825
             LN  E+E LE QLD SLK +R  +TQ +LDQLSDLQ KE + LEAN+ L  KLE+     
Sbjct  120   LNSKELEQLERQLDGSLKQVRCIKTQYMLDQLSDLQGKEHILLEANRALSMKLEDMIGVR  179

Query  826   DNNLQQPWGPGEQSG-AYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQ--Itaatna  996
              +++   W  G+Q   AY    A  + G +Q LECD TL IG++    S Q  +TA   +
Sbjct  180   HHHIGGAWEGGDQHNVAYGHPQA-HSQGLYQSLECDPTLQIGYSHPVCSEQMAVTAQGQS  238

Query  997   qnvnavLPGWML  1032
             Q  +  +PGWML
Sbjct  239   QPGHGYIPGWML  250



>emb|CDX78653.1| BnaA03g05650D [Brassica napus]
Length=259

 Score =   263 bits (672),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 164/262 (63%), Positives = 192/262 (73%), Gaps = 19/262 (7%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEV-NRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGP  651
             SNM+KTLERYQKCSYG++EV N+P K+ E  SY+EYLKLKG+YE LQR QR+LLGEDLGP
Sbjct  61    SNMIKTLERYQKCSYGSIEVNNKPAKELEN-SYREYLKLKGRYEGLQRQQRNLLGEDLGP  119

Query  652   LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEF----  819
             LN  E+E +E QLD SLK +RS +TQ +LDQLSDLQTKE++ LE N+ L  KL++     
Sbjct  120   LNSKELEQIERQLDGSLKQVRSIKTQYMLDQLSDLQTKEQMLLETNRALAMKLDDMIGVR  179

Query  820   -YVDNNLQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGF----------NPVAT  966
              +        W   E + +Y+  H  Q+ G FQPLEC+ TL +G           NPV  
Sbjct  180   SHHMGGGGGGWEGNEHNVSYA-HHQAQSQGLFQPLECNPTLQMGCFVLRGSSMYDNPVC-  237

Query  967   SSQItaatnaqnvnavLPGWML  1032
             S QITA T AQ     +P WML
Sbjct  238   SEQITATTQAQAQPGYIPDWML  259



>gb|AAX15923.1| AGL9.1 [Persea americana]
Length=237

 Score =   262 bits (670),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 157/245 (64%), Positives = 184/245 (75%), Gaps = 9/245 (4%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFS RGKLYEF ST
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSTRGKLYEFCST  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             ++MLKTLERYQKC+YG  E    +++  QSS++EY+KLK + E+LQR QR+LLGEDLGPL
Sbjct  61    ASMLKTLERYQKCNYGAPETTVSSRE-LQSSHQEYMKLKARVEALQRSQRNLLGEDLGPL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
                E++ LE QLD SLKHIRSTRTQ +LDQL DLQ +E +  EANK+L  +LEE  +  N
Sbjct  120   TGKELDTLEKQLDVSLKHIRSTRTQYMLDQLGDLQRREHMLSEANKSLRRRLEEG-MQEN  178

Query  835   LQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvnav  1014
                 W P   +G   QQ   Q+ GFF P+EC+ TL IG+     SSQIT A    NVN  
Sbjct  179   PNHAWDP---NGYVRQQAPPQSDGFFHPIECEPTLQIGYQ----SSQITIAAPGPNVNNY  231

Query  1015  LPGWM  1029
             +PGW+
Sbjct  232   MPGWL  236



>gb|AAF76381.1|AF068723_1 MADS-box protein MADS4 [Nicotiana tabacum]
Length=245

 Score =   262 bits (670),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 151/246 (61%), Positives = 189/246 (77%), Gaps = 1/246 (0%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FS+RGKL EF ST
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLSEFCST  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             S+M++TLE+YQ+CSY +L+  +   D+ Q++Y EYL+LK + E LQR QR+LLGEDLG L
Sbjct  61    SSMMQTLEKYQQCSYASLDPMQSASDHTQNNYHEYLRLKARVELLQRSQRNLLGEDLGTL  120

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             N  E+EHLEHQLD+SLK IRS +TQ +LDQL+DLQ KE++  EANK L  KLEE      
Sbjct  121   NSGELEHLEHQLDSSLKQIRSRKTQNMLDQLADLQQKEQMLAEANKQLRRKLEESAARVP  180

Query  835   LQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvnav  1014
             L+  W  G Q+  +++Q   QT GFFQPL  +S+   G++P+   +++ AA  A N+N  
Sbjct  181   LRLSWDNGGQTMQHNRQLPPQTEGFFQPLGLNSSPQFGYSPMG-GNEVNAAATANNMNGF  239

Query  1015  LPGWML  1032
             +PGWML
Sbjct  240   IPGWML  245



>dbj|BAC80255.1| MADS-box transcription factor [Houttuynia cordata]
Length=247

 Score =   262 bits (670),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 157/249 (63%), Positives = 189/249 (76%), Gaps = 5/249 (2%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTF+KRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             S+M+ TLERYQ+CSY   E   P ++ E+ SY+EYLKLKGK E LQR QR+LLGEDLGPL
Sbjct  61    SSMMTTLERYQECSYSMPEATGPTRETEK-SYQEYLKLKGKVELLQRTQRNLLGEDLGPL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             +  E+E LE+QL+ SL+ IRST+TQ +LDQLSDL+ KE+  LE+NK L+ KL E   +N 
Sbjct  120   SSKELEQLENQLEHSLRQIRSTKTQALLDQLSDLRRKEQQMLESNKILKKKLAEHGPENL  179

Query  835   LQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVA---TSSQItaatnaqnv  1005
             LQ  W    QS  YS+Q A  +  FFQPL+C+ TL IG++PV     +    A    QNV
Sbjct  180   LQLAWQSCGQSNPYSRQPA-HSEAFFQPLDCNPTLQIGYHPVGQEEITMAAPAIAPPQNV  238

Query  1006  navLPGWML  1032
             N  +PGWM+
Sbjct  239   NGFIPGWMV  247



>gb|AAU82009.1| SEPALLATA2 [Arabidopsis thaliana]
 gb|AAU82011.1| SEPALLATA2 [Arabidopsis thaliana]
 gb|AAU82014.1| SEPALLATA2 [Arabidopsis thaliana]
 gb|AAU82024.1| SEPALLATA2 [Arabidopsis thaliana]
Length=250

 Score =   262 bits (669),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 162/252 (64%), Positives = 190/252 (75%), Gaps = 8/252 (3%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEV+LIVFSNRGKLYEF ST
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVSLIVFSNRGKLYEFCST  60

Query  475   SNMLKTLERYQKCSYGTLEV-NRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGP  651
             SNMLKTLERYQKCSYG++EV N+P K+ E  SY+EYLKLKG+YE+LQR QR+LLGEDLGP
Sbjct  61    SNMLKTLERYQKCSYGSIEVNNKPAKELEN-SYREYLKLKGRYENLQRQQRNLLGEDLGP  119

Query  652   LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYV--  825
             LN  E+E LE QLD SLK +R  +TQ +LDQLSDLQ KE + L+AN+ L  KLE+     
Sbjct  120   LNSKELEQLERQLDGSLKQVRCIKTQYMLDQLSDLQGKEHILLDANRALSMKLEDMIGVR  179

Query  826   DNNLQQPWGPGEQSG-AYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQ--Itaatna  996
              +++   W  G+Q   AY    A  + G +Q LECD TL IG++    S Q  +T    +
Sbjct  180   HHHIGGAWEGGDQQNIAYGHPQA-HSQGLYQSLECDPTLQIGYSHPVCSEQMAVTVQGQS  238

Query  997   qnvnavLPGWML  1032
             Q  N  +PGWML
Sbjct  239   QQGNGYIPGWML  250



>gb|AHW52536.1| SEPALLATA-like MADS-box protein 1 [Phalaenopsis equestris]
Length=244

 Score =   261 bits (668),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 155/248 (63%), Positives = 184/248 (74%), Gaps = 8/248 (3%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLC+AEVALI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCEAEVALIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             S+MLKTLERYQK +YG  E N  +++  QSS +EYLKLK + E+LQR QR+LLGEDLGPL
Sbjct  61    SSMLKTLERYQKNNYGAPETNIISRET-QSSQQEYLKLKSRVEALQRSQRNLLGEDLGPL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             N  E+E LE QLD SLK IRSTRTQ +LDQL+DLQ +E++  EANKTL+ +LEE     N
Sbjct  120   NSKELEQLERQLDNSLKQIRSTRTQFMLDQLADLQRREQMLCEANKTLKRRLEESN-QAN  178

Query  835   LQQPWGPG-EQSGAYSQQHADQTHG--FFQPLECDSTLHIGFNPVATSSQItaatnaqnv  1005
              QQ W P    +  Y Q+   Q HG  F+ PLEC+ TLHIG++   +   I         
Sbjct  179   PQQIWDPSTAHAMGYDQRQPVQPHGEAFYHPLECEPTLHIGYH---SDLSIAPMAAPNVN  235

Query  1006  navLPGWM  1029
             N + PGW+
Sbjct  236   NYMPPGWL  243



>ref|NP_186880.1| developmental protein SEPALLATA 2 [Arabidopsis thaliana]
 sp|P29384.1|SEP2_ARATH RecName: Full=Developmental protein SEPALLATA 2; AltName: Full=Agamous-like 
MADS-box protein AGL4 [Arabidopsis thaliana]
 gb|AAF02125.1|AC009755_18 floral homeotic protein AGL4 [Arabidopsis thaliana]
 gb|AAA32734.1| transcription factor [Arabidopsis thaliana]
 gb|AAU82010.1| SEPALLATA2 [Arabidopsis thaliana]
 gb|AAU82012.1| SEPALLATA2 [Arabidopsis thaliana]
 gb|AAU82013.1| SEPALLATA2 [Arabidopsis thaliana]
 gb|AAU82015.1| SEPALLATA2 [Arabidopsis thaliana]
 gb|AAU82016.1| SEPALLATA2 [Arabidopsis thaliana]
 gb|AAU82017.1| SEPALLATA2 [Arabidopsis thaliana]
 gb|AAU82018.1| SEPALLATA2 [Arabidopsis thaliana]
 gb|AAU82019.1| SEPALLATA2 [Arabidopsis thaliana]
 gb|AAU82020.1| SEPALLATA2 [Arabidopsis thaliana]
 gb|AAU82021.1| SEPALLATA2 [Arabidopsis thaliana]
 gb|AAU82022.1| SEPALLATA2 [Arabidopsis thaliana]
 gb|AAU82023.1| SEPALLATA2 [Arabidopsis thaliana]
 gb|AAU82025.1| SEPALLATA2 [Arabidopsis thaliana]
 gb|AAU82026.1| SEPALLATA2 [Arabidopsis thaliana]
 gb|AAU82027.1| SEPALLATA2 [Arabidopsis thaliana]
 gb|AAU82028.1| SEPALLATA2 [Arabidopsis thaliana]
 gb|AAU82029.1| SEPALLATA2 [Arabidopsis thaliana]
 gb|AAU82030.1| SEPALLATA2 [Arabidopsis thaliana]
 gb|AAW38979.1| At3g02310 [Arabidopsis thaliana]
 gb|AEE73791.1| developmental protein SEPALLATA 2 [Arabidopsis thaliana]
Length=250

 Score =   261 bits (668),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 162/252 (64%), Positives = 190/252 (75%), Gaps = 8/252 (3%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEV+LIVFSNRGKLYEF ST
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVSLIVFSNRGKLYEFCST  60

Query  475   SNMLKTLERYQKCSYGTLEV-NRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGP  651
             SNMLKTLERYQKCSYG++EV N+P K+ E  SY+EYLKLKG+YE+LQR QR+LLGEDLGP
Sbjct  61    SNMLKTLERYQKCSYGSIEVNNKPAKELEN-SYREYLKLKGRYENLQRQQRNLLGEDLGP  119

Query  652   LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYV--  825
             LN  E+E LE QLD SLK +R  +TQ +LDQLSDLQ KE + L+AN+ L  KLE+     
Sbjct  120   LNSKELEQLERQLDGSLKQVRCIKTQYMLDQLSDLQGKEHILLDANRALSMKLEDMIGVR  179

Query  826   DNNLQQPWGPGEQSG-AYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQ--Itaatna  996
              +++   W  G+Q   AY    A  + G +Q LECD TL IG++    S Q  +T    +
Sbjct  180   HHHIGGGWEGGDQQNIAYGHPQA-HSQGLYQSLECDPTLQIGYSHPVCSEQMAVTVQGQS  238

Query  997   qnvnavLPGWML  1032
             Q  N  +PGWML
Sbjct  239   QQGNGYIPGWML  250



>gb|AAO42085.1| putative floral homeotic protein AGL4 [Arabidopsis thaliana]
Length=250

 Score =   261 bits (667),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 162/252 (64%), Positives = 190/252 (75%), Gaps = 8/252 (3%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEV+LIVFSNRGKLYEF ST
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVSLIVFSNRGKLYEFCST  60

Query  475   SNMLKTLERYQKCSYGTLEV-NRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGP  651
             SNMLKTLERYQKCSYG++EV N+P K+ E  SY+EYLKLKG+YE+LQR QR+LLGEDLGP
Sbjct  61    SNMLKTLERYQKCSYGSIEVNNKPAKELEN-SYREYLKLKGRYENLQRQQRNLLGEDLGP  119

Query  652   LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEF--YV  825
             LN  E+E LE QLD SLK +R  +TQ +LDQLSDLQ KE + L+AN+ L  KLE+     
Sbjct  120   LNSKELEQLERQLDGSLKQVRCIKTQYMLDQLSDLQGKEHILLDANRALSMKLEDMIGVR  179

Query  826   DNNLQQPWGPGEQSG-AYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQ--Itaatna  996
              +++   W  G+Q   AY    A  + G +Q LECD TL IG++    S Q  +T    +
Sbjct  180   HHHVGGGWEGGDQQNIAYGHPQA-HSQGLYQSLECDPTLQIGYSHPVCSEQMAVTVQGQS  238

Query  997   qnvnavLPGWML  1032
             Q  N  +PGWML
Sbjct  239   QQGNGYIPGWML  250



>gb|AHY82573.1| MADS-box protein 6 [Lilium formosanum]
Length=242

 Score =   261 bits (666),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 161/247 (65%), Positives = 190/247 (77%), Gaps = 8/247 (3%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEFSST
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFSST  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             S+M++TLERYQKC+YG  E N  +++  Q+S +EYLKLK K E+LQR QR+LLGEDLGPL
Sbjct  61    SSMMRTLERYQKCNYGAPETNIVSRET-QNSQQEYLKLKAKVEALQRSQRNLLGEDLGPL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             N  E+E LE QLDTSLK IRSTRTQ +LDQLSDLQ +E++  EANK+L  +LEE     N
Sbjct  120   NTKELEQLERQLDTSLKLIRSTRTQFMLDQLSDLQRREQMLCEANKSLRRRLEE-TSHAN  178

Query  835   LQQPWGPG-EQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaat-naqnvn  1008
              QQ W      +G  +QQ   Q +GFF PLEC+ TL IG+ P     QIT A+    + +
Sbjct  179   QQQVWEANVHAAGYAAQQAQPQGNGFFHPLECEPTLQIGYPP----DQITIASGPGPSGS  234

Query  1009  avLPGWM  1029
             + LPGW+
Sbjct  235   SYLPGWL  241



>ref|XP_010681125.1| PREDICTED: MADS-box protein CMB1-like [Beta vulgaris subsp. vulgaris]
Length=243

 Score =   261 bits (666),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 156/249 (63%), Positives = 190/249 (76%), Gaps = 9/249 (4%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             S+M KTLERYQ+CSYG LE ++P+K+ E  SY+EYLKLK K + LQR QR+LLGEDL  L
Sbjct  61    SSMAKTLERYQRCSYGALEASQPSKETEN-SYQEYLKLKAKVDVLQRNQRNLLGEDLSEL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             +  E+E LEHQLD SL+ IRS +TQ +LDQL+DLQ KE++ LE+N+ L+SKLEE     +
Sbjct  120   STKELEQLEHQLDKSLRQIRSIKTQYMLDQLADLQRKEEMLLESNRALKSKLEETCA--S  177

Query  835   LQQPWGPGEQSG--AYSQQHADQTHGFFQPLEC-DSTLHIGFNPVATSSQItaatnaqnv  1005
             L+Q W    Q+    Y +Q A+   GFF+PL C +++LHIG+N V       A T+  N 
Sbjct  178   LRQNWEAEPQNAPPTYVRQPAE---GFFEPLPCNNNSLHIGYNAVTQDHLNNATTSTHNE  234

Query  1006  navLPGWML  1032
             N+  P WML
Sbjct  235   NSFTPTWML  243



>gb|ACB69510.1| SEPALLATA3-like MADS-box protein [Crocus sativus]
Length=239

 Score =   260 bits (665),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 154/253 (61%), Positives = 181/253 (72%), Gaps = 23/253 (9%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNE--QssykeylklkgkyeslQRYQRHLLGEDLG  648
             S++LKTLERYQKCSYG  + N   ++ +  QSS++EYLKLK + E+LQR QR+LLGEDLG
Sbjct  61    SSILKTLERYQKCSYGAPDNNVQIRETQLLQSSHQEYLKLKARVEALQRSQRNLLGEDLG  120

Query  649   PLNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVD  828
             PL+  E+E LE QLD+SLK IRSTRTQ +LDQL DLQ KE +  EAN++L   LEE    
Sbjct  121   PLSSKELEQLERQLDSSLKQIRSTRTQCMLDQLGDLQRKEHMLCEANRSLRKTLEESNQA  180

Query  829   NNLQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGF------NPVATSSQItaat  990
             N+ QQ W     + AY +Q   Q   F+QPL+C  TLHIGF       P  T+       
Sbjct  181   NH-QQVWESNANAIAYDRQANQQREEFYQPLDCQPTLHIGFQGDQMAGPSVTT-------  232

Query  991   naqnvnavLPGWM  1029
                     +PGW+
Sbjct  233   -------YMPGWL  238



>emb|CAN84110.1| hypothetical protein VITISV_036170 [Vitis vinifera]
Length=243

 Score =   260 bits (665),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 153/246 (62%), Positives = 186/246 (76%), Gaps = 3/246 (1%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S 
Sbjct  1     MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSG  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             S+M +TLER+Q+CSY  LE ++P K+  Q+SY+EYLKLK K E LQR QR+ LGEDLG L
Sbjct  61    SSMPETLERHQRCSYSALEASQPAKET-QNSYQEYLKLKSKVEVLQRTQRNFLGEDLGHL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
                E+E LEHQLD SLK IRST+TQ +LDQLSDLQ K ++ +EAN  L  KL E   ++ 
Sbjct  120   GTKELEQLEHQLDKSLKQIRSTKTQFMLDQLSDLQRKVQILMEANNALRRKLGESSAESG  179

Query  835   LQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvnav  1014
             L   W     +  Y+++   Q+  FF+PL+CDSTL IG+NPV    ++  A+  QNVN  
Sbjct  180   LGSTWEAAAHNLPYNREPV-QSEDFFEPLQCDSTLQIGYNPV-LRVEMNGASTTQNVNGF  237

Query  1015  LPGWML  1032
             +PGWM+
Sbjct  238   IPGWMV  243



>gb|ADU56817.1| MADS-box protein AGL2 subfamily [Coffea arabica]
 emb|CDP13360.1| unnamed protein product [Coffea canephora]
Length=241

 Score =   260 bits (664),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 152/230 (66%), Positives = 177/230 (77%), Gaps = 7/230 (3%)
 Frame = +1

Query  295  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475  SNMLKTLERYQKCSYGTLEVNRPNKDN-EQssykeylklkgkyeslQRYQRHLLGEDLGP  651
            S+MLKTLERYQKC+YG  E N   ++  E SS +EYLKLK +YE+LQR QR+LLGEDLGP
Sbjct  61   SSMLKTLERYQKCNYGAPEPNISTREALELSSQQEYLKLKARYEALQRSQRNLLGEDLGP  120

Query  652  LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDN  831
            LN  E+E LE QLD SLK IRSTRTQ++LDQL+DLQ KE    EANKTL+ +L E    N
Sbjct  121  LNSKELESLERQLDMSLKQIRSTRTQVMLDQLTDLQRKEHALNEANKTLKQRLME---GN  177

Query  832  NLQQPWGPGEQSGAYSQQHA-DQTHGFFQPLECDSTLHIGF--NPVATSS  972
             +   W P  Q   Y +Q A  Q  GFF PL+C+ TL IG+  +P+  ++
Sbjct  178  QVNLQWNPNAQDVGYGRQPAHAQGDGFFHPLDCEPTLQIGYQNDPITVAA  227



>ref|XP_009598871.1| PREDICTED: MADS-box protein CMB1-like [Nicotiana tomentosiformis]
Length=245

 Score =   260 bits (665),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 149/246 (61%), Positives = 191/246 (78%), Gaps = 1/246 (0%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FS+RGKLYEF ST
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFCST  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             S+M++TLE+YQ+CSY +L+  +   ++ QS+Y EYL+LK + E LQR QR+LLGEDLG L
Sbjct  61    SSMMQTLEKYQQCSYASLDPMQSATNHTQSNYHEYLRLKARVELLQRSQRNLLGEDLGTL  120

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             N  E++HLEHQL++SLK IRS +TQ +LDQL+DLQ KE++  EANK L+ KLEE      
Sbjct  121   NSKELDHLEHQLESSLKQIRSRKTQNMLDQLADLQQKEQMMAEANKQLKRKLEESAARIP  180

Query  835   LQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvnav  1014
             ++  W  G Q+  +++Q   QT GFFQPL  +S+   G++P+   +++ AA  A N+N  
Sbjct  181   IRLSWDNGGQTMQHNRQLPPQTEGFFQPLGLNSSPQFGYSPMG-GNEVNAAATANNMNGF  239

Query  1015  LPGWML  1032
             +PGWML
Sbjct  240   IPGWML  245



>gb|AAP83390.1| SEPALLATA1-like MADS-box [Pachysandra terminalis]
Length=238

 Score =   259 bits (663),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 150/241 (62%), Positives = 185/241 (77%), Gaps = 3/241 (1%)
 Frame = +1

Query  310   VELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSSTSNMLK  489
             V+L+R+ENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FS RGKLYEF S+S+M  
Sbjct  1     VQLRRMENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSARGKLYEFCSSSSMQN  60

Query  490   TLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPLNIDEI  669
             TLERYQKCSYG LE ++P K+  QSSY EY++LK + E LQR QR+L GE+LGPL+  E+
Sbjct  61    TLERYQKCSYGPLEPSQPAKET-QSSYLEYMRLKARVEGLQRSQRNLFGENLGPLSTKEL  119

Query  670   EHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNNLQQPW  849
             E LEHQL+ SL  IRST+TQ +LDQLSDLQ KE++  EAN++L+ KLEE   +N+L   W
Sbjct  120   EQLEHQLEMSLNQIRSTKTQFMLDQLSDLQRKEQMLQEANRSLKRKLEESNAENSLGPSW  179

Query  850   GPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvnavLPGWM  1029
               G     +  Q A Q+ GFFQPLEC+STL IG+N V  + Q++     QNVN  +PGWM
Sbjct  180   ESGGHGVPFGHQPA-QSEGFFQPLECNSTLQIGYNHVG-ADQMSITVPPQNVNGFVPGWM  237

Query  1030  L  1032
             +
Sbjct  238   V  238



>emb|CDX70651.1| BnaC03g07350D [Brassica napus]
Length=259

 Score =   260 bits (665),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 163/262 (62%), Positives = 191/262 (73%), Gaps = 19/262 (7%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEV-NRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGP  651
              NM+KTLERYQKCSYG++EV N+P K+ E  SY+EYLKLKG+YE LQR QR+LLGEDLGP
Sbjct  61    YNMIKTLERYQKCSYGSIEVNNKPAKELEN-SYREYLKLKGRYEGLQRQQRNLLGEDLGP  119

Query  652   LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEF----  819
             LN  E+E +E QLD SLK +RS +TQ +LDQLSDLQTKE++ LE N+ L  KL++     
Sbjct  120   LNSKELEQIERQLDGSLKQVRSIKTQYMLDQLSDLQTKEQMLLETNRALAMKLDDMIGVR  179

Query  820   -YVDNNLQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGF----------NPVAT  966
              +        W   E + +Y+  H  Q+ G FQPLEC+ TL +G           NPV  
Sbjct  180   SHHMGGGGGGWEGNEHNVSYA-HHQAQSQGLFQPLECNPTLQMGCFVLIGSSMYDNPVC-  237

Query  967   SSQItaatnaqnvnavLPGWML  1032
             S QITA T AQ     +P WML
Sbjct  238   SEQITATTQAQAQPGYIPDWML  259



>emb|CAC81072.1| MADS box transcription factor [Daucus carota subsp. sativus]
Length=246

 Score =   260 bits (664),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 151/249 (61%), Positives = 188/249 (76%), Gaps = 6/249 (2%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF ST
Sbjct  1     MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCST  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             S+M KTL RY +CSYG LE  + ++D  QSSY+EY+KLK K E+LQ+ QRHLLGE+LG L
Sbjct  61    SSMNKTLGRYHRCSYGALETGQTDRDT-QSSYQEYIKLKAKVEALQQSQRHLLGEELGQL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
                E+E LE QLD++L+ +RST+TQ +LDQLSDLQ KE+  +E NK L +KLEE   D  
Sbjct  120   GTKELEELERQLDSTLRQVRSTKTQYMLDQLSDLQQKEQELVEINKALRNKLEEN--DVR  177

Query  835   LQQPWGPGEQSGAYSQQHADQ---THGFFQPLECDSTLHIGFNPVATSSQItaatnaqnv  1005
             +Q  W   E++    + H  +    HG F+ LEC++T+H+G+N      Q+ +AT  QN 
Sbjct  178   IQSQWEAAERNNVAYRSHPAEHPPDHGVFESLECNNTMHMGYNSAMNDHQMASATPTQNA  237

Query  1006  navLPGWML  1032
             + V+PGWML
Sbjct  238   SGVIPGWML  246



>gb|ADC79703.1| SEPALLATA3-like protein [Pachysandra terminalis]
Length=243

 Score =   259 bits (663),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 154/248 (62%), Positives = 185/248 (75%), Gaps = 9/248 (4%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDN-EQssykeylklkgkyeslQRYQRHLLGEDLGP  651
             S+ML+TLERYQKC+YGT E N   ++  EQSS +EYLKLK +++SLQR QR+L+GEDLGP
Sbjct  61    SSMLETLERYQKCNYGTPEPNVSARETLEQSSQQEYLKLKARFDSLQRSQRNLMGEDLGP  120

Query  652   LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDN  831
             L+  E+E LE QLD SLK IRSTRTQ +LDQL+DLQ +E++  E N TL+ +L+E     
Sbjct  121   LSSKELESLERQLDMSLKQIRSTRTQYMLDQLTDLQRREQMLAEVNNTLKRRLDEG-SQV  179

Query  832   NLQQPWGPGEQSGAYSQQHADQTH--GFFQPLECDSTLHIGFNPVATSSQItaatnaqnv  1005
             N  + W P      Y +  A Q H  GFF PL+C+ TL IG+ P     QIT      +V
Sbjct  180   NAHEMWDPNGHGAGYERSQA-QPHGDGFFHPLDCEPTLQIGYRP----EQITVVAPGPSV  234

Query  1006  navLPGWM  1029
             N  +PGW+
Sbjct  235   NNYMPGWL  242



>gb|ABC70706.1| MADS-box transcription factor [Asparagus virgatus]
Length=239

 Score =   259 bits (662),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 150/247 (61%), Positives = 181/247 (73%), Gaps = 11/247 (4%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNE--QssykeylklkgkyeslQRYQRHLLGEDLG  648
             S+MLKTLERYQKCSYG  + +   ++++  QSS++EYL+LK + E+LQR QR+LLGEDLG
Sbjct  61    SSMLKTLERYQKCSYGAPDTSVQIRESQMLQSSHQEYLRLKARVEALQRSQRNLLGEDLG  120

Query  649   PLNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVD  828
             PL+  E+E LE QLD+SLK IRSTRTQ +LDQL+DLQ +E++  EAN++L  +LEE    
Sbjct  121   PLSSKELEQLERQLDSSLKQIRSTRTQYMLDQLADLQRREQMLCEANRSLRKRLEE-SSQ  179

Query  829   NNLQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvn  1008
              N QQ W      G   Q +  Q   FF PLEC  TL IGF P              +V+
Sbjct  180   ANQQQVWEDANAMGYNRQPNQPQGDQFFHPLECQPTLQIGFQPDQMPG--------PSVS  231

Query  1009  avLPGWM  1029
               +PGW+
Sbjct  232   NYMPGWL  238



>ref|XP_006579436.1| PREDICTED: uncharacterized protein LOC100805078 isoform X4 [Glycine 
max]
Length=241

 Score =   259 bits (661),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 152/228 (67%), Positives = 177/228 (78%), Gaps = 7/228 (3%)
 Frame = +1

Query  295  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475  SNMLKTLERYQKCSYGTLEVNRPNKDN-EQssykeylklkgkyeslQRYQRHLLGEDLGP  651
            S+MLKTLERYQKC+YG  E N   ++  E SS +EYLKLK +YE+LQR QR+L+GEDLGP
Sbjct  61   SSMLKTLERYQKCNYGAPEANVSTREALELSSQQEYLKLKARYEALQRSQRNLMGEDLGP  120

Query  652  LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDN  831
            L+  E+E LE QLD+SLK IRSTRTQ +LDQLSDLQ KE L  EAN++L  +LE + + N
Sbjct  121  LSSKELESLERQLDSSLKQIRSTRTQFMLDQLSDLQRKEHLLSEANRSLRQRLEGYQI-N  179

Query  832  NLQQPWGPGEQSGAYSQQHADQTHG--FFQPLECDSTLHIGFNPVATS  969
             LQ    PG +   Y  +H  QTHG   FQ +EC+ TL IG+ P   S
Sbjct  180  PLQ--LNPGVEEMGYG-RHPAQTHGEALFQQMECEPTLQIGYQPDPVS  224



>ref|XP_007037631.1| K-box region and MADS-box transcription factor family protein 
[Theobroma cacao]
 gb|EOY22132.1| K-box region and MADS-box transcription factor family protein 
[Theobroma cacao]
Length=407

 Score =   265 bits (676),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 148/224 (66%), Positives = 179/224 (80%), Gaps = 2/224 (1%)
 Frame = +1

Query  295  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEF S+
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFCSS  60

Query  475  SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
            S+M+KTLE+YQKCSY T++ +R   +  QSSY+EYLKLK + E LQR QR+LLGEDLGPL
Sbjct  61   SSMMKTLEKYQKCSYSTVDTSRSASET-QSSYQEYLKLKARVEVLQRSQRNLLGEDLGPL  119

Query  655  NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
            N  E+E LE+QL+TSLK IRST++Q +LDQL DLQ +E++ +E NK+L  KLEE     +
Sbjct  120  NTKELEQLENQLETSLKQIRSTKSQAMLDQLGDLQNREQMLVETNKSLRRKLEELSAQPH  179

Query  835  LQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVAT  966
            L+  W  G Q+  Y++  A Q+ GFFQ L   S+L IG+NPV +
Sbjct  180  LRLAWETGGQNIPYNRLPA-QSEGFFQLLGGSSSLQIGYNPVVS  222


 Score =   115 bits (289),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 93/160 (58%), Gaps = 21/160 (13%)
 Frame = +1

Query  610   QRYQRHLLGEDLGPLNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEAN  789
             QR QR+LLGEDLGPLN  E+E LE+QL+TSLK IRST++Q +LDQL DLQ +E++ +E N
Sbjct  250   QRSQRNLLGEDLGPLNTKELEQLENQLETSLKQIRSTKSQAMLDQLGDLQNREQMLVETN  309

Query  790   KTLESK-------------------LEEFYVDNNLQQPWGPGEQSGAYSQQHADQTHGFF  912
             K+L  K                   LEE       +  W  G Q+  Y++  A Q+ GFF
Sbjct  310   KSLRRKYSASLLSTVLILVQILFHLLEELSAQPPFRLAWETGGQNIPYNRLPA-QSEGFF  368

Query  913   QPLECDSTLHIGFNPVATSSQItaatnaqnvnavLPGWML  1032
             Q L   S+  IG+NPV  S ++  A   QNV    PGWML
Sbjct  369   QLLGGSSSFRIGYNPV-VSDEMNVAAQNQNVCGYFPGWML  407



>ref|XP_011036099.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Populus 
euphratica]
Length=242

 Score =   258 bits (660),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 155/247 (63%), Positives = 184/247 (74%), Gaps = 8/247 (3%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDN-EQssykeylklkgkyeslQRYQRHLLGEDLGP  651
             S+MLKTLERYQKC+YG  E N   ++  E SS +EYLKLK +YE+LQR QR+LLGE+LGP
Sbjct  61    SSMLKTLERYQKCNYGAPEPNVSAREALELSSQQEYLKLKARYEALQRTQRNLLGEELGP  120

Query  652   LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDN  831
             L+  E+E LE QLD SLK IRSTRTQ +LDQL+DLQ KE +   ANK+L+ +L E Y  N
Sbjct  121   LSSKELESLERQLDMSLKQIRSTRTQYMLDQLNDLQHKEHMLTAANKSLKERLMEGYHLN  180

Query  832   NLQQPWGPGEQSGAYSQQHAD-QTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvn  1008
             +LQ    P  +   Y++Q A  Q  GFF  LEC+ TL IG+ P      IT  T   ++ 
Sbjct  181   SLQ--LNPSAEDVEYARQQAQPQGDGFFHALECEPTLQIGYQP----ENITMVTAGPSMT  234

Query  1009  avLPGWM  1029
               +PGW+
Sbjct  235   TYMPGWL  241



>ref|XP_006579435.1| PREDICTED: uncharacterized protein LOC100805078 isoform X3 [Glycine 
max]
Length=242

 Score =   258 bits (660),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 152/228 (67%), Positives = 175/228 (77%), Gaps = 6/228 (3%)
 Frame = +1

Query  295  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475  SNMLKTLERYQKCSYGTLEVNRPNKDN-EQssykeylklkgkyeslQRYQRHLLGEDLGP  651
            S+MLKTLERYQKC+YG  E N   ++  E SS +EYLKLK +YE+LQR QR+L+GEDLGP
Sbjct  61   SSMLKTLERYQKCNYGAPEANVSTREALELSSQQEYLKLKARYEALQRSQRNLMGEDLGP  120

Query  652  LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDN  831
            L+  E+E LE QLD+SLK IRSTRTQ +LDQLSDLQ KE L  EAN++L  +  E Y  N
Sbjct  121  LSSKELESLERQLDSSLKQIRSTRTQFMLDQLSDLQRKEHLLSEANRSLRQRQLEGYQIN  180

Query  832  NLQQPWGPGEQSGAYSQQHADQTHG--FFQPLECDSTLHIGFNPVATS  969
             LQ    PG +   Y  +H  QTHG   FQ +EC+ TL IG+ P   S
Sbjct  181  PLQ--LNPGVEEMGYG-RHPAQTHGEALFQQMECEPTLQIGYQPDPVS  225



>gb|AAX13298.1| MADS box protein SEP3 [Lotus japonicus]
Length=243

 Score =   258 bits (660),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 151/228 (66%), Positives = 176/228 (77%), Gaps = 6/228 (3%)
 Frame = +1

Query  295  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475  SNMLKTLERYQKCSYGTLEVNRPNKDN-EQssykeylklkgkyeslQRYQRHLLGEDLGP  651
            S+MLKTLERYQKC+YG  E N   ++  E SS +EYLKLK +YE+LQR QR+L+GEDLGP
Sbjct  61   SSMLKTLERYQKCNYGAPEANVSTREALELSSQQEYLKLKARYEALQRSQRNLMGEDLGP  120

Query  652  LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDN  831
            LN  E+E LE QLD+SLK IRSTRTQ +LDQLSDLQ KE +  EAN++L  +  E Y  N
Sbjct  121  LNSKELESLERQLDSSLKQIRSTRTQFMLDQLSDLQRKEHMLSEANRSLRQRQLEGYQLN  180

Query  832  NLQQPWGPGEQSGAYSQQHADQTHG--FFQPLECDSTLHIGFNPVATS  969
            +LQ    PG +   Y  +H  QTHG  F+  +EC+ TL IG+ P   S
Sbjct  181  SLQ--LNPGVEDMGYG-RHPAQTHGDAFYHSIECEPTLQIGYQPDPVS  225



>gb|ADU15479.1| SEP4 [Actinidia chinensis]
Length=245

 Score =   258 bits (660),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 148/248 (60%), Positives = 185/248 (75%), Gaps = 5/248 (2%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRV LKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSN GKLYEF S+
Sbjct  1     MGRGRVVLKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNHGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             S+M+KTLE+YQ+CSYG+L+ ++P  D+E  SY EYL+LK + E LQ+ QR+LLGEDLGPL
Sbjct  61    SSMMKTLEKYQRCSYGSLDASQPVHDSEN-SYHEYLRLKTRVEILQQSQRNLLGEDLGPL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             +  E+E LEHQL+ SLK IRST+TQ +LDQL+DLQ +E++  E+NK L  KLEE   +  
Sbjct  120   STKELEQLEHQLEVSLKQIRSTKTQAMLDQLADLQRREQMLAESNKALRRKLEESTAEIP  179

Query  835   LQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvnav  1014
             L+  W  G Q+  Y+  H      FFQPL  +S+L IG+N     +++ A   AQ+    
Sbjct  180   LRHSWEAGGQTIPYN--HVPAQSEFFQPLRLNSSLQIGYNHAGGPTEMNAVAPAQDDPVN  237

Query  1015  --LPGWML  1032
               +PGWML
Sbjct  238   GFIPGWML  245



>gb|AAQ83834.1| MADS box protein [Asparagus officinalis]
 gb|ABC70709.1| MADS-box transcription factor [Asparagus officinalis]
Length=239

 Score =   258 bits (659),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 153/249 (61%), Positives = 186/249 (75%), Gaps = 15/249 (6%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNE--QssykeylklkgkyeslQRYQRHLLGEDLG  648
             S+MLKTLERYQKCSYG  + +   ++++  QSS++EYL+LK + E+LQR QR+LLGEDLG
Sbjct  61    SSMLKTLERYQKCSYGAPDTSVQIRESQMLQSSHQEYLRLKARVEALQRSQRNLLGEDLG  120

Query  649   PLNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVD  828
             PL+  E+E LE QLD+SLK IRSTRTQ +LDQL+DLQ +E++  EAN++L  +LEE    
Sbjct  121   PLSSKELEQLERQLDSSLKQIRSTRTQYMLDQLADLQRREQMLCEANRSLRKRLEE-SSQ  179

Query  829   NNLQQPWGPGEQSGAYSQQHADQTHG--FFQPLECDSTLHIGFNPVATSSQItaatnaqn  1002
              N QQ W      G Y++Q  +Q HG  FF PLEC  TL IGF P              +
Sbjct  180   ANQQQVWEDANAMG-YNRQ-PNQPHGDQFFHPLECQPTLQIGFQPDQMPG--------PS  229

Query  1003  vnavLPGWM  1029
             V+  +PGW+
Sbjct  230   VSNYMPGWL  238



>gb|AHM92084.1| MADS-box protein 8 [Erycina pusilla]
Length=243

 Score =   258 bits (659),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 154/247 (62%), Positives = 180/247 (73%), Gaps = 7/247 (3%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLC+AEVALI+FSNRGKLYEF ST
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCEAEVALIIFSNRGKLYEFCST  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             ++MLKTLERYQKC+YG  E N  +++  QSS +EYLKLKG+ E+LQR QR+LLGEDLGPL
Sbjct  61    NSMLKTLERYQKCNYGAPETNVISRET-QSSQQEYLKLKGRVENLQRSQRNLLGEDLGPL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             N  E+E LE QLD SLK IRSTRTQ +LDQL+DLQ +E++  EANKTL+ +LEE    N 
Sbjct  120   NSKELEQLERQLDNSLKQIRSTRTQFMLDQLADLQRREQMLCEANKTLKRRLEESNQANP  179

Query  835   LQQPWGPGEQSGAYSQQHADQTHG--FFQPLECDSTLHIGFNPVATSSQItaatnaqnvn  1008
              Q  W P         +   Q HG  F+ PLEC+ TL IG+    T   I         N
Sbjct  180   PQM-WDPSTAHAMGYDRQPPQPHGDAFYHPLECEPTLQIGYQSDLT---IAPMAAPNVHN  235

Query  1009  avLPGWM  1029
              + PGW+
Sbjct  236   YMPPGWL  242



>gb|AAU82031.1| SEPALLATA2 [Arabidopsis lyrata subsp. petraea]
Length=247

 Score =   258 bits (659),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 155/232 (67%), Positives = 180/232 (78%), Gaps = 6/232 (3%)
 Frame = +1

Query  295  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEV+LIVFSNRGKLYEF ST
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVSLIVFSNRGKLYEFCST  60

Query  475  SNMLKTLERYQKCSYGTLEV-NRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGP  651
            SNMLKTLERYQKCSYG++EV N+P K+ E  SY+EYLKLKG+YE+LQR QR+LLGEDLGP
Sbjct  61   SNMLKTLERYQKCSYGSIEVNNKPAKELEN-SYREYLKLKGRYENLQRQQRNLLGEDLGP  119

Query  652  LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYV--  825
            LN  E+E LE QLD SLK +R  +TQ +LDQLSDLQ KE + LEAN+ L  KLE+     
Sbjct  120  LNSKELEQLERQLDGSLKQVRCIKTQYMLDQLSDLQGKEHILLEANRALSMKLEDMIGVR  179

Query  826  DNNLQQPWGPGEQSG-AYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQI  978
             +++   W  G+Q   AY    A  + G +Q LECD TL IG++    S Q+
Sbjct  180  HHHIGGAWEGGDQHNVAYGHPQA-HSQGLYQSLECDPTLQIGYSHPVCSEQM  230



>ref|XP_006579434.1| PREDICTED: uncharacterized protein LOC100805078 isoform X2 [Glycine 
max]
Length=243

 Score =   258 bits (659),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 152/230 (66%), Positives = 177/230 (77%), Gaps = 9/230 (4%)
 Frame = +1

Query  295  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475  SNMLKTLERYQKCSYGTLEVNRPNKDN---EQssykeylklkgkyeslQRYQRHLLGEDL  645
            S+MLKTLERYQKC+YG  E N   ++    E SS +EYLKLK +YE+LQR QR+L+GEDL
Sbjct  61   SSMLKTLERYQKCNYGAPEANVSTREALVMELSSQQEYLKLKARYEALQRSQRNLMGEDL  120

Query  646  GPLNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYV  825
            GPL+  E+E LE QLD+SLK IRSTRTQ +LDQLSDLQ KE L  EAN++L  +LE + +
Sbjct  121  GPLSSKELESLERQLDSSLKQIRSTRTQFMLDQLSDLQRKEHLLSEANRSLRQRLEGYQI  180

Query  826  DNNLQQPWGPGEQSGAYSQQHADQTHG--FFQPLECDSTLHIGFNPVATS  969
             N LQ    PG +   Y  +H  QTHG   FQ +EC+ TL IG+ P   S
Sbjct  181  -NPLQ--LNPGVEEMGYG-RHPAQTHGEALFQQMECEPTLQIGYQPDPVS  226



>ref|NP_568322.1| MADS box transcription factor SEPALLATA 1 [Arabidopsis thaliana]
 sp|P29382.2|SEP1_ARATH RecName: Full=Developmental protein SEPALLATA 1; AltName: Full=Agamous-like 
MADS-box protein AGL2 [Arabidopsis thaliana]
 dbj|BAC43207.1| putative transcription factor AGL2 [Arabidopsis thaliana]
 gb|AAP12873.1| At5g15800 [Arabidopsis thaliana]
 gb|AAU81986.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AAU81988.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AAU82003.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AED92207.1| MADS box transcription factor SEPALLATA 1 [Arabidopsis thaliana]
Length=251

 Score =   258 bits (660),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 163/253 (64%), Positives = 193/253 (76%), Gaps = 9/253 (4%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEV-NRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGP  651
             SNMLKTL+RYQKCSYG++EV N+P K+ E  SY+EYLKLKG+YE+LQR QR+LLGEDLGP
Sbjct  61    SNMLKTLDRYQKCSYGSIEVNNKPAKELEN-SYREYLKLKGRYENLQRQQRNLLGEDLGP  119

Query  652   LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDN  831
             LN  E+E LE QLD SLK +RS +TQ +LDQLSDLQ KE++ LE N+ L  KL++     
Sbjct  120   LNSKELEQLERQLDGSLKQVRSIKTQYMLDQLSDLQNKEQMLLETNRALAMKLDDMIGVR  179

Query  832   N----LQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaq  999
             +        W  GEQ+  Y+  H  Q+ G +QPLEC+ TL +G++    S QITA T AQ
Sbjct  180   SHHMGGGGGWEGGEQNVTYA-HHQAQSQGLYQPLECNPTLQMGYDNPVCSEQITATTQAQ  238

Query  1000  nvnav--LPGWML  1032
                    +PGWML
Sbjct  239   AQQGNGYIPGWML  251



>ref|XP_006288512.1| hypothetical protein CARUB_v10001783mg [Capsella rubella]
 gb|EOA21410.1| hypothetical protein CARUB_v10001783mg [Capsella rubella]
Length=254

 Score =   258 bits (660),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 162/256 (63%), Positives = 191/256 (75%), Gaps = 12/256 (5%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEV-NRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGP  651
              NMLKTL+RYQKCSYG++EV N+P K+ E  SY+EYLKLKG+YE+LQR QR+LLGEDLGP
Sbjct  61    PNMLKTLDRYQKCSYGSIEVNNKPAKELEN-SYREYLKLKGRYENLQRQQRNLLGEDLGP  119

Query  652   LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEF----  819
             LN  E+E LE QLD SLK +RS +TQ +LDQLSDLQ KE++ LE N+ L  KL++     
Sbjct  120   LNSKELEQLERQLDGSLKQVRSIKTQYMLDQLSDLQNKEQMLLETNRALAMKLDDMIGVR  179

Query  820   --YVDNNLQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatn  993
               +        W  GEQ+  Y+  H  Q+ G +QPLEC+ TL IG++    S QITA T 
Sbjct  180   THHHMGGGGGGWDGGEQNVTYA-HHQVQSQGLYQPLECNPTLQIGYDNTVCSEQITATTT  238

Query  994   aqnv---navLPGWML  1032
                    N  +PGWML
Sbjct  239   QAQAQPGNGYIPGWML  254



>ref|XP_007043949.1| K-box region and MADS-box transcription factor family protein 
isoform 3 [Theobroma cacao]
 gb|EOX99780.1| K-box region and MADS-box transcription factor family protein 
isoform 3 [Theobroma cacao]
Length=247

 Score =   258 bits (659),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 154/232 (66%), Positives = 177/232 (76%), Gaps = 9/232 (4%)
 Frame = +1

Query  295  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475  SNMLKTLERYQKCSYGTLEVNRPNKDN-EQssykeylklkgkyeslQRYQRHLLGEDLGP  651
            S+M+KTLERYQKC+YG  E N   ++  E SS +EYLKLK +YE+LQR QR+LLGEDLGP
Sbjct  61   SSMIKTLERYQKCNYGAPETNVSTREALELSSQQEYLKLKARYEALQRSQRNLLGEDLGP  120

Query  652  LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESK-----LEE  816
            L+  E+E LE QLD+SLK IRSTRTQ +LDQL+DLQ KE L  EANKTL+ +     L E
Sbjct  121  LSSKELESLERQLDSSLKQIRSTRTQYMLDQLTDLQRKEHLLNEANKTLKQRAGALQLVE  180

Query  817  FYVDNNLQQPWGPGEQSGAYSQQHAD-QTHGFFQPLECDSTLHIGFNPVATS  969
             Y  N+LQ    P  +   Y +Q A  Q  GFF PLEC+ TL IG+ P   S
Sbjct  181  GYQVNSLQ--LNPNAEDVGYGRQPAQPQGDGFFHPLECEPTLQIGYQPDPIS  230



>gb|AFO68790.1| agamous-like protein 234, partial [Pachysandra terminalis]
Length=228

 Score =   257 bits (657),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 149/230 (65%), Positives = 177/230 (77%), Gaps = 2/230 (1%)
 Frame = +1

Query  343   RQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSSTSNMLKTLERYQKCSYG  522
             RQVTFAKRRNGLLKKAYELSVLCDAEVALI+FS RGKLYEF S+S+M  TLERYQKCSYG
Sbjct  1     RQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSARGKLYEFCSSSSMQNTLERYQKCSYG  60

Query  523   TLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPLNIDEIEHLEHQLDTSL  702
              LE ++P K+  QSSY EY++LK + E LQR QR+L GEDLGPL+  E+E LEHQL+ SL
Sbjct  61    PLEPSQPAKET-QSSYLEYMRLKARVEGLQRSQRNLFGEDLGPLSTKELEQLEHQLEMSL  119

Query  703   KHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNNLQQPWGPGEQSGAYSQ  882
               IRST+TQ +LDQLSDLQ KE++  EAN+ L  KL+E   +N+L+Q W     +  YSQ
Sbjct  120   NQIRSTKTQFMLDQLSDLQRKEQMLQEANRALRRKLDESSAENHLRQSWEAAGHNMQYSQ  179

Query  883   QHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvnavLPGWML  1032
             QHA Q+  FFQPLEC+STL IG+NPV     +T A  AQNVN  +PGWML
Sbjct  180   QHA-QSEDFFQPLECNSTLQIGYNPVGPDDHMTIAAPAQNVNGFVPGWML  228



>gb|KHN34832.1| MADS-box transcription factor 1 [Glycine soja]
Length=241

 Score =   258 bits (658),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 152/228 (67%), Positives = 177/228 (78%), Gaps = 7/228 (3%)
 Frame = +1

Query  295  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475  SNMLKTLERYQKCSYGTLEVNRPNKDN-EQssykeylklkgkyeslQRYQRHLLGEDLGP  651
            S+MLKTLERYQKC+YG  E N   ++  E SS +EYLKLK +YE+LQR QR+L+GEDLGP
Sbjct  61   SSMLKTLERYQKCNYGAPEANVSTREALELSSQQEYLKLKARYEALQRSQRNLMGEDLGP  120

Query  652  LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDN  831
            L+  E+E LE QLD+SLK IRSTRTQ +LDQLSDLQ KE L  EAN++L  +LE + + N
Sbjct  121  LSSKELESLERQLDSSLKQIRSTRTQFMLDQLSDLQRKEHLLSEANRSLRQRLEGYQI-N  179

Query  832  NLQQPWGPGEQSGAYSQQHADQTHG--FFQPLECDSTLHIGFNPVATS  969
             LQ    PG +   Y +  A QTHG   FQ +EC+ TL IG+ P   S
Sbjct  180  PLQ--LNPGVEEMGYGRNPA-QTHGEALFQQMECEPTLQIGYQPDPVS  224



>dbj|BAC80254.1| MADS-box transcription factor [Houttuynia cordata]
Length=246

 Score =   258 bits (658),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 154/249 (62%), Positives = 182/249 (73%), Gaps = 6/249 (2%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEV LI+FSN GKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVTLIIFSNSGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             S+M+KTLERYQKCSY   E   P+++ E+ SY+EYLKLKGK E LQR QR+LLGEDLGPL
Sbjct  61    SSMMKTLERYQKCSYSMPEATGPSRETEK-SYQEYLKLKGKVEHLQRIQRNLLGEDLGPL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             +  E+E LE+QL+ SL+ IRST+TQ +LDQLSDL+ KE+  LE+ K L  KL E   +N 
Sbjct  120   SSKELEQLENQLEQSLRQIRSTKTQSLLDQLSDLRRKEQQLLESKKILNKKLAEHGPENP  179

Query  835   LQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvnav  1014
             LQ  W    QS  YS Q A  +  FFQPL+C+ TL IG+ P     QI AA         
Sbjct  180   LQLSWQSCGQSNPYSSQPA-HSEAFFQPLDCNPTLQIGY-PSVGQEQIMAAPATAAPQNA  237

Query  1015  ---LPGWML  1032
                +PGW++
Sbjct  238   NGFIPGWLV  246



>gb|ADD25190.1| SEP1, partial [Nelumbo nucifera]
Length=230

 Score =   257 bits (656),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 155/233 (67%), Positives = 184/233 (79%), Gaps = 3/233 (1%)
 Frame = +1

Query  334   KINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSSTSNMLKTLERYQKC  513
             KINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+S+MLKTLERYQKC
Sbjct  1     KINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKC  60

Query  514   SYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPLNIDEIEHLEHQLD  693
             SYG LE ++P K+  QSSY+EYLKLK + E LQR QR+LLGEDLGPL+  E+E LEHQL+
Sbjct  61    SYGALEASQPAKET-QSSYQEYLKLKARVEVLQRSQRNLLGEDLGPLSTKELEQLEHQLE  119

Query  694   TSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNNLQQPWGPGEQSGA  873
              SLK IRST+TQ++LDQLSDLQ KE++  EAN+ L+ KL+E   +N L+  W  G     
Sbjct  120   MSLKQIRSTKTQLMLDQLSDLQRKEQMLQEANRDLKRKLDESSSENPLRLTWEAGGAKHL  179

Query  874   YSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvnavLPGWML  1032
             YS+Q + Q+ G F PLE +ST  IG+NPV    QIT A +AQNVN  +PGWML
Sbjct  180   YSRQPS-QSEGVFPPLEGNSTWQIGYNPVGP-DQITVAASAQNVNGYIPGWML  230



>ref|XP_010917558.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Elaeis 
guineensis]
 gb|AAQ03224.1|AF411843_1 MADS box transcription factor [Elaeis guineensis]
Length=242

 Score =   257 bits (657),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 152/246 (62%), Positives = 184/246 (75%), Gaps = 6/246 (2%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             S+M+KTLERYQKC+YG  E N  +++  QSS +EYLKLK + E+LQR QR+LLGEDLGPL
Sbjct  61    SSMMKTLERYQKCNYGAPETNIISRET-QSSQQEYLKLKARAEALQRSQRNLLGEDLGPL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             +  E+E LE QLD SLK IRSTRTQ +LDQL+DLQ KE++  EANK+L  +LEE      
Sbjct  120   SSKELEQLERQLDASLKQIRSTRTQYMLDQLADLQRKEQMLCEANKSLRRRLEESNQAGQ  179

Query  835   LQQPWGPGEQSGAYSQQHAD-QTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvna  1011
              QQ W P   +  Y +Q    Q+ GF+Q ++ + TL IG+ P   +    AA    +VN 
Sbjct  180   -QQVWDPTAHAVGYGRQPPQPQSDGFYQQIDSEPTLQIGYPPEQIT---IAAAPGPSVNT  235

Query  1012  vLPGWM  1029
              +PGW+
Sbjct  236   YMPGWL  241



>ref|XP_006585132.1| PREDICTED: MADS-box transcription factor 1-like isoform X4 [Glycine 
max]
 gb|KHN12377.1| MADS-box transcription factor 1 [Glycine soja]
Length=241

 Score =   257 bits (657),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 153/228 (67%), Positives = 177/228 (78%), Gaps = 7/228 (3%)
 Frame = +1

Query  295  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475  SNMLKTLERYQKCSYGTLEVNRPNKDN-EQssykeylklkgkyeslQRYQRHLLGEDLGP  651
            S+MLKTLERYQKC+YG  E N   ++  E SS +EYLKLK +YESLQR QR+L+GEDLGP
Sbjct  61   SSMLKTLERYQKCNYGAPEANVSTREALELSSQQEYLKLKARYESLQRSQRNLMGEDLGP  120

Query  652  LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDN  831
            L+  E+E LE QLD+SLK IRSTRTQ +LDQLSDLQ KE L  EAN++L  +LE + + N
Sbjct  121  LSSKELESLERQLDSSLKQIRSTRTQFMLDQLSDLQRKEHLLSEANRSLRQRLEGYQI-N  179

Query  832  NLQQPWGPGEQSGAYSQQHADQTHG--FFQPLECDSTLHIGFNPVATS  969
             LQ    PG +   Y +  A QTHG   FQ +EC+ TL IG+ P   S
Sbjct  180  PLQ--LNPGVEEMGYGRNPA-QTHGEALFQQMECEPTLQIGYQPDPVS  224



>ref|XP_006579433.1| PREDICTED: uncharacterized protein LOC100805078 isoform X1 [Glycine 
max]
Length=244

 Score =   257 bits (657),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 152/230 (66%), Positives = 175/230 (76%), Gaps = 8/230 (3%)
 Frame = +1

Query  295  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475  SNMLKTLERYQKCSYGTLEVNRPNKDN---EQssykeylklkgkyeslQRYQRHLLGEDL  645
            S+MLKTLERYQKC+YG  E N   ++    E SS +EYLKLK +YE+LQR QR+L+GEDL
Sbjct  61   SSMLKTLERYQKCNYGAPEANVSTREALVMELSSQQEYLKLKARYEALQRSQRNLMGEDL  120

Query  646  GPLNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYV  825
            GPL+  E+E LE QLD+SLK IRSTRTQ +LDQLSDLQ KE L  EAN++L  +  E Y 
Sbjct  121  GPLSSKELESLERQLDSSLKQIRSTRTQFMLDQLSDLQRKEHLLSEANRSLRQRQLEGYQ  180

Query  826  DNNLQQPWGPGEQSGAYSQQHADQTHG--FFQPLECDSTLHIGFNPVATS  969
             N LQ    PG +   Y  +H  QTHG   FQ +EC+ TL IG+ P   S
Sbjct  181  INPLQ--LNPGVEEMGYG-RHPAQTHGEALFQQMECEPTLQIGYQPDPVS  227



>emb|CAX65570.1| GRCD4 protein [Gerbera hybrid cultivar]
Length=249

 Score =   257 bits (657),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 150/253 (59%), Positives = 186/253 (74%), Gaps = 11/253 (4%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             S+M+KTLE+Y  CSYG+L+ ++P ++  Q +Y EYL+LK + E LQR QR+LLGEDL PL
Sbjct  61    SSMVKTLEKYHSCSYGSLKASQP-ENESQYNYHEYLRLKARVEVLQRSQRNLLGEDLAPL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             N  E+E LEHQL+ SL+ IRST+TQ +LDQL+DLQ KE++  E NK L  KLEE   +  
Sbjct  120   NTKELEQLEHQLEMSLRKIRSTKTQSMLDQLADLQRKEQVLAETNKALRKKLEESAQEYP  179

Query  835   LQQPWGPGEQSGAYS--QQHADQTHGFFQPLECDSTLHIGF-----NPVATSSQItaatn  993
             ++Q W  G Q+  Y+    H+D+   FFQPL  +ST+H  F     NP+ +     A  N
Sbjct  180   VRQMWEGGAQTIPYNPLPTHSDE---FFQPLGLNSTMHNSFNGLRYNPIVSDEMNVAGAN  236

Query  994   aqnvnavLPGWML  1032
               + N + PGWML
Sbjct  237   NNSPNGLFPGWML  249



>gb|AAX15922.1| AGL2 [Acorus americanus]
Length=237

 Score =   257 bits (656),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 150/247 (61%), Positives = 184/247 (74%), Gaps = 13/247 (5%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIEN INRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRG+L+EF S+
Sbjct  1     MGRGRVELKRIENNINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGRLFEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             S+MLKTL+RYQKCS+   E + P+++  QSSY+EYLKLK K E+LQR QR+LLGEDLGPL
Sbjct  61    SSMLKTLDRYQKCSFHAAESSAPSRE-LQSSYQEYLKLKAKVEALQRSQRNLLGEDLGPL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             N  E+E LE QL+ SLK +RST+TQ +LDQL DL+ KE++  EANK+L+ KL+E+  +N 
Sbjct  120   NSKELEQLESQLEMSLKQVRSTKTQYMLDQLCDLKRKEQMLQEANKSLKRKLDEYNSENP  179

Query  835   LQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGF--NPVATSSQItaatnaqnvn  1008
             LQ  W  G  +  Y +Q    +  FFQPL  D +LHIG+  N  AT   +         N
Sbjct  180   LQLSWDNGGSNVPYGRQ-PTHSEDFFQPLSVDPSLHIGYQVNAAATGQNV---------N  229

Query  1009  avLPGWM  1029
               +PGWM
Sbjct  230   GFIPGWM  236



>ref|XP_010453727.1| PREDICTED: developmental protein SEPALLATA 1 [Camelina sativa]
 ref|XP_010492428.1| PREDICTED: developmental protein SEPALLATA 1 [Camelina sativa]
Length=251

 Score =   257 bits (657),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 163/253 (64%), Positives = 191/253 (75%), Gaps = 9/253 (4%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEV-NRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGP  651
              NMLKTL+RYQKCSYG++EV N+P K+ E  SY+EYLKLKG+YESLQR QR+LLGEDLGP
Sbjct  61    PNMLKTLDRYQKCSYGSIEVNNKPAKELEN-SYREYLKLKGRYESLQRQQRNLLGEDLGP  119

Query  652   LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDN  831
             LN  E+E LE QLD SLK +RS +TQ +LDQLSDLQ KE++ LE N+ L  KL++     
Sbjct  120   LNSKELEQLERQLDGSLKQVRSIKTQYMLDQLSDLQNKEQMLLETNRALAMKLDDMIGVR  179

Query  832   N----LQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaq  999
             +        W  GEQ+  Y+  H   + G +QPLEC+ TL IG++    S QITA T AQ
Sbjct  180   SHHMGGGGGWDGGEQNVTYA-HHQAHSQGLYQPLECNPTLQIGYDNPVCSEQITATTQAQ  238

Query  1000  nvnav--LPGWML  1032
                    +PGWML
Sbjct  239   AQQGNGYIPGWML  251



>gb|AEW50208.1| SEP1 [Acca sellowiana]
Length=245

 Score =   257 bits (657),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 154/247 (62%), Positives = 184/247 (74%), Gaps = 3/247 (1%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             S+M KT+E+YQKCSYG+LE N    D  Q+SY+EYLKLK + E LQR QR+LLGEDLGPL
Sbjct  61    SSMTKTIEKYQKCSYGSLEANCSIND-MQNSYQEYLKLKARVEVLQRSQRNLLGEDLGPL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             N  E+E LEHQL+ SLK IRST+TQ +LDQL+ LQ KE++ +EAN+ L  KLEE      
Sbjct  120   NTKELEQLEHQLENSLKQIRSTKTQFMLDQLAHLQHKEQMLVEANRDLRKKLEESNARIP  179

Query  835   LQQPWGPGEQSGAYSQQHADQTHGF-FQPLECDSTLHIGFNPVATSSQItaatnaqnvna  1011
             L+  W   + +     +   Q+ G  FQPL  + TL IG+NP A S++   +   Q+ N 
Sbjct  180   LRLGWEAEDHNSISYSRLPPQSQGLIFQPLGDNPTLQIGYNP-AGSNEANVSAADQHPNG  238

Query  1012  vLPGWML  1032
              +PGWML
Sbjct  239   FIPGWML  245



>ref|XP_006585131.1| PREDICTED: MADS-box transcription factor 1-like isoform X3 [Glycine 
max]
Length=242

 Score =   257 bits (656),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 153/228 (67%), Positives = 175/228 (77%), Gaps = 6/228 (3%)
 Frame = +1

Query  295  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475  SNMLKTLERYQKCSYGTLEVNRPNKDN-EQssykeylklkgkyeslQRYQRHLLGEDLGP  651
            S+MLKTLERYQKC+YG  E N   ++  E SS +EYLKLK +YESLQR QR+L+GEDLGP
Sbjct  61   SSMLKTLERYQKCNYGAPEANVSTREALELSSQQEYLKLKARYESLQRSQRNLMGEDLGP  120

Query  652  LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDN  831
            L+  E+E LE QLD+SLK IRSTRTQ +LDQLSDLQ KE L  EAN++L  +  E Y  N
Sbjct  121  LSSKELESLERQLDSSLKQIRSTRTQFMLDQLSDLQRKEHLLSEANRSLRQRQLEGYQIN  180

Query  832  NLQQPWGPGEQSGAYSQQHADQTHG--FFQPLECDSTLHIGFNPVATS  969
             LQ    PG +   Y +  A QTHG   FQ +EC+ TL IG+ P   S
Sbjct  181  PLQ--LNPGVEEMGYGRNPA-QTHGEALFQQMECEPTLQIGYQPDPVS  225



>ref|XP_006440804.1| hypothetical protein CICLE_v10021357mg [Citrus clementina]
 gb|ESR54044.1| hypothetical protein CICLE_v10021357mg [Citrus clementina]
Length=301

 Score =   259 bits (661),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 152/253 (60%), Positives = 191/253 (75%), Gaps = 8/253 (3%)
 Frame = +1

Query  292   IMGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSS  471
             IMGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S
Sbjct  51    IMGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS  110

Query  472   TSNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGP  651
             + +++KTLERY +CS+G LE NRP  + +QS+Y+EYL+LK   E LQR QR+LLGEDL P
Sbjct  111   SPSIMKTLERYHRCSFGALEANRPPIETQQSTYQEYLRLKTAVELLQRSQRNLLGEDLEP  170

Query  652   LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDN  831
             L+  E+E LEHQL+TSLKH+RST+TQ ++DQLSDLQ +E++ LE NK L  KL+E  + +
Sbjct  171   LSTKELEQLEHQLETSLKHVRSTKTQCMVDQLSDLQKREQVLLELNKGLRKKLDESNIAH  230

Query  832   NL---QQPW--GPGEQSGAYSQQHADQTHGFFQPLECDS-TLHIGFNPVATSSQItaatn  993
              +   +  W      Q+  Y+ ++  Q+ GFFQPL   +  L IG+NP+  S +     +
Sbjct  231   QVPPHRLAWEAASAGQNITYN-RYPVQSEGFFQPLSGGTPILQIGYNPMG-SEEAHIPVH  288

Query  994   aqnvnavLPGWML  1032
             AQNV   +PGWML
Sbjct  289   AQNVTGFIPGWML  301



>gb|ADJ67238.1| MADS box transcription factor 6 [Oncidium hybrid cultivar]
Length=243

 Score =   257 bits (656),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 153/247 (62%), Positives = 181/247 (73%), Gaps = 7/247 (3%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             M RGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLC+AEVALI+FSNRGKLYEF ST
Sbjct  1     MRRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCEAEVALIIFSNRGKLYEFCST  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             ++MLKTLERYQKC+YG  E N  +++  QSS +EYLKLKG+ E+LQR QR+LLGEDLGPL
Sbjct  61    NSMLKTLERYQKCNYGAPETNVISRET-QSSQQEYLKLKGRVETLQRSQRNLLGEDLGPL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             N  E+E LE QLD SLK IRSTRTQ +LDQL+DLQ +E++  EANKTL+ +LEE     N
Sbjct  120   NSKELEQLERQLDNSLKQIRSTRTQFMLDQLADLQRREQMLCEANKTLKRRLEESN-QAN  178

Query  835   LQQPWGPGEQSGAYSQQHADQTHG--FFQPLECDSTLHIGFNPVATSSQItaatnaqnvn  1008
              QQ W P         +   Q HG  F+ PLEC+ TL IG+    T + + A      + 
Sbjct  179   PQQMWDPSTAHAMGYDRQPAQPHGDAFYHPLECEPTLQIGYQSDLTMAPMAAPNVHNYMP  238

Query  1009  avLPGWM  1029
                PGW+
Sbjct  239   ---PGWL  242



>ref|XP_010420253.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X1 
[Camelina sativa]
 ref|XP_010420254.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X2 
[Camelina sativa]
Length=252

 Score =   257 bits (657),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 163/254 (64%), Positives = 191/254 (75%), Gaps = 10/254 (4%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEV-NRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGP  651
              NMLKTL+RYQKCSYG++EV N+P K+ E  SY+EYLKLKG+YESLQR QR+LLGEDLGP
Sbjct  61    PNMLKTLDRYQKCSYGSIEVNNKPAKELEN-SYREYLKLKGRYESLQRQQRNLLGEDLGP  119

Query  652   LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEF----  819
             LN  E+E LE QLD SLK +RS +TQ +LDQLSDLQ KE++ LE N+ L  KL++     
Sbjct  120   LNSKELEQLERQLDGSLKQVRSIKTQYMLDQLSDLQNKEQMLLETNRALAMKLDDMIGVR  179

Query  820   -YVDNNLQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatna  996
              +        W  GEQ+  Y+  H   + G +QPLEC+ TL IG++    S QITA T A
Sbjct  180   SHHMGGGGGGWDGGEQNVTYA-HHQAHSQGLYQPLECNPTLQIGYDNPVCSEQITATTQA  238

Query  997   qnvnav--LPGWML  1032
             Q       +PGWML
Sbjct  239   QAQQGNGYIPGWML  252



>ref|NP_001284431.1| agamous-like MADS-box protein AGL9 homolog [Cucumis melo]
 gb|AGZ03887.1| sepallata 3-like MADS-box protein [Cucumis melo]
Length=242

 Score =   256 bits (655),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 158/247 (64%), Positives = 182/247 (74%), Gaps = 8/247 (3%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDN-EQssykeylklkgkyeslQRYQRHLLGEDLGP  651
             S+MLKTLERYQKC+YG  E N   ++  E SS +EYLKLK +YE+LQR QR+LLGEDLGP
Sbjct  61    SSMLKTLERYQKCNYGAPEPNVSTREALELSSQQEYLKLKARYEALQRSQRNLLGEDLGP  120

Query  652   LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDN  831
             L+  E+E+LE QLD SLK IRSTRTQ +LDQL+DLQ KE L  EANKTL+ +L E Y  N
Sbjct  121   LSSKELENLERQLDMSLKQIRSTRTQYMLDQLTDLQRKEHLLNEANKTLKQRLVEGYQVN  180

Query  832   NLQQPWGPGEQSGAYSQQHADQT-HGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvn  1008
              LQ           Y +Q A      FF PL+C+ TL IG+ P      IT  T   ++N
Sbjct  181   ALQ--LNQSADDMMYGRQQAQPPGDAFFHPLDCEPTLQIGYQP----DPITVVTAGPSMN  234

Query  1009  avLPGWM  1029
               LPGW+
Sbjct  235   NFLPGWL  241



>ref|XP_004140534.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Cucumis 
sativus]
Length=242

 Score =   256 bits (655),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 158/247 (64%), Positives = 181/247 (73%), Gaps = 8/247 (3%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDN-EQssykeylklkgkyeslQRYQRHLLGEDLGP  651
             S+MLKTLERYQKC+YG  E N   ++  E SS +EYLKLK +YE+LQR QR+LLGEDLGP
Sbjct  61    SSMLKTLERYQKCNYGAPEPNVSTREALELSSQQEYLKLKARYEALQRSQRNLLGEDLGP  120

Query  652   LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDN  831
             L+  E+E LE QLD SLK IRSTRTQ +LDQL+DLQ KE L  EANKTL+ +L E Y  N
Sbjct  121   LSSKELESLERQLDMSLKQIRSTRTQYMLDQLTDLQRKEHLLNEANKTLKQRLVEGYQVN  180

Query  832   NLQQPWGPGEQSGAYSQQHADQT-HGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvn  1008
              LQ           Y +Q A      FF PL+C+ TL IG+ P      IT  T   ++N
Sbjct  181   ALQ--LNQSADDMMYGRQQAQPPGDAFFHPLDCEPTLQIGYQP----DPITVVTAGPSMN  234

Query  1009  avLPGWM  1029
               LPGW+
Sbjct  235   NFLPGWL  241



>ref|XP_008240082.1| PREDICTED: MADS-box protein CMB1-like [Prunus mume]
Length=251

 Score =   257 bits (656),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 153/252 (61%), Positives = 185/252 (73%), Gaps = 7/252 (3%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FS+RGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
              +MLKTLE+YQ+CSYG+LE NRP  D  Q+SY+EYLKLK + E LQ+ QR+LLGEDL PL
Sbjct  61    MSMLKTLEKYQRCSYGSLEANRPVNDT-QNSYQEYLKLKARVEVLQQSQRNLLGEDLAPL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             N  E+E LEHQL+ SL  IRST+TQ +LDQL DLQ KE++ +EANK L  KLEE      
Sbjct  120   NTKELEQLEHQLEASLNQIRSTKTQFMLDQLCDLQNKEQMLVEANKALRRKLEETSGQAP  179

Query  835   LQQPW---GPGEQSGAYSQ-QHADQTHGFFQPLECDSTLHIGFNPVATS--SQItaatna  996
                 W   G G  +  +++  H   + GFF PL  +ST  IG+ P+ +    Q+    + 
Sbjct  180   PPLAWEAAGHGNNNDQHTRLPHHPHSQGFFHPLGNNSTSQIGYTPLGSDHHEQMNVGNHG  239

Query  997   qnvnavLPGWML  1032
             Q+VN  +PGWML
Sbjct  240   QHVNGFIPGWML  251



>ref|XP_006585130.1| PREDICTED: MADS-box transcription factor 1-like isoform X2 [Glycine 
max]
Length=243

 Score =   256 bits (655),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 153/230 (67%), Positives = 177/230 (77%), Gaps = 9/230 (4%)
 Frame = +1

Query  295  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475  SNMLKTLERYQKCSYGTLEVNRPNKDN---EQssykeylklkgkyeslQRYQRHLLGEDL  645
            S+MLKTLERYQKC+YG  E N   ++    E SS +EYLKLK +YESLQR QR+L+GEDL
Sbjct  61   SSMLKTLERYQKCNYGAPEANVSTREALVMELSSQQEYLKLKARYESLQRSQRNLMGEDL  120

Query  646  GPLNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYV  825
            GPL+  E+E LE QLD+SLK IRSTRTQ +LDQLSDLQ KE L  EAN++L  +LE + +
Sbjct  121  GPLSSKELESLERQLDSSLKQIRSTRTQFMLDQLSDLQRKEHLLSEANRSLRQRLEGYQI  180

Query  826  DNNLQQPWGPGEQSGAYSQQHADQTHG--FFQPLECDSTLHIGFNPVATS  969
             N LQ    PG +   Y +  A QTHG   FQ +EC+ TL IG+ P   S
Sbjct  181  -NPLQ--LNPGVEEMGYGRNPA-QTHGEALFQQMECEPTLQIGYQPDPVS  226



>gb|ADC79694.1| SEPALLATA1-like protein [Akebia trifoliata]
Length=243

 Score =   256 bits (655),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 148/246 (60%), Positives = 187/246 (76%), Gaps = 3/246 (1%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVA+I+FS+RGKL+EF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVAVIIFSSRGKLFEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             S+M KTLERYQ+C+Y  +E +    + E SSY++YL+LK + E LQ+ QR+LLGE+LG L
Sbjct  61    SSMSKTLERYQQCNYRAVEASTSANETE-SSYQDYLRLKARVEVLQQSQRNLLGEELGSL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
                E+E LEHQL+ SL  +RST+TQ +LDQL+DLQ KE++  EAN+TL  KL+E   +N 
Sbjct  120   GTGELEQLEHQLEMSLNQVRSTKTQFMLDQLTDLQRKEQMLQEANRTLRRKLDERSTENP  179

Query  835   LQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvnav  1014
                 W  G Q+  YS Q A Q+ GFFQPL+C+S L IG+N   +  Q+T A   QN+N  
Sbjct  180   YTLSWEAGGQNIPYSHQPA-QSEGFFQPLQCNSMLQIGYN-TGSPDQLTVAAPTQNINGF  237

Query  1015  LPGWML  1032
             +PGWML
Sbjct  238   IPGWML  243



>ref|XP_008811035.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X3 [Phoenix dactylifera]
Length=246

 Score =   256 bits (655),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 148/247 (60%), Positives = 184/247 (74%), Gaps = 3/247 (1%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTF+KRRNGLLKKAYELSVLCD EVA I+FSNRG+L+EF ST
Sbjct  1     MGRGRVELKRIENKINRQVTFSKRRNGLLKKAYELSVLCDVEVAAIIFSNRGRLFEFCST  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             S+ML+T+ERYQKCSY   +   P K+ +Q+SY EYLKLK + E LQR QR+LLGEDLGPL
Sbjct  61    SSMLETIERYQKCSYNASDAIVPPKETQQNSYHEYLKLKARVEFLQRSQRNLLGEDLGPL  120

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             ++ E+E L++Q++ SLKHIRST+TQ++LDQL D++ KE++  EANK L  KLEE   +N 
Sbjct  121   SVKELEQLDNQIEISLKHIRSTKTQLMLDQLCDVKRKEQMLQEANKALRRKLEE-GTNNP  179

Query  835   LQQPW--GPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvn  1008
             LQ  W  G  +   A   +   Q+ GFFQPL C+ +L IG++PV      T A   QNVN
Sbjct  180   LQLSWQNGANDVGNAPCGREPPQSQGFFQPLGCEPSLQIGYHPVCIDQLNTEAAATQNVN  239

Query  1009  avLPGWM  1029
                P W+
Sbjct  240   GYFPWWI  246



>ref|XP_006585129.1| PREDICTED: MADS-box transcription factor 1-like isoform X1 [Glycine 
max]
Length=244

 Score =   256 bits (654),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 153/230 (67%), Positives = 175/230 (76%), Gaps = 8/230 (3%)
 Frame = +1

Query  295  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475  SNMLKTLERYQKCSYGTLEVNRPNKDN---EQssykeylklkgkyeslQRYQRHLLGEDL  645
            S+MLKTLERYQKC+YG  E N   ++    E SS +EYLKLK +YESLQR QR+L+GEDL
Sbjct  61   SSMLKTLERYQKCNYGAPEANVSTREALVMELSSQQEYLKLKARYESLQRSQRNLMGEDL  120

Query  646  GPLNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYV  825
            GPL+  E+E LE QLD+SLK IRSTRTQ +LDQLSDLQ KE L  EAN++L  +  E Y 
Sbjct  121  GPLSSKELESLERQLDSSLKQIRSTRTQFMLDQLSDLQRKEHLLSEANRSLRQRQLEGYQ  180

Query  826  DNNLQQPWGPGEQSGAYSQQHADQTHG--FFQPLECDSTLHIGFNPVATS  969
             N LQ    PG +   Y +  A QTHG   FQ +EC+ TL IG+ P   S
Sbjct  181  INPLQ--LNPGVEEMGYGRNPA-QTHGEALFQQMECEPTLQIGYQPDPVS  227



>ref|XP_008222191.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Prunus 
mume]
Length=240

 Score =   256 bits (653),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 150/227 (66%), Positives = 176/227 (78%), Gaps = 6/227 (3%)
 Frame = +1

Query  295  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLC+AEVALI+FSNRGKLYEF S+
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCEAEVALIIFSNRGKLYEFCSS  60

Query  475  SNMLKTLERYQKCSYGTLEVNRPNKDN-EQssykeylklkgkyeslQRYQRHLLGEDLGP  651
            S+MLKTLERYQKC+YG  E N   ++  E SS +EYLKLK +YE+LQR QR+LLGEDLGP
Sbjct  61   SSMLKTLERYQKCNYGAPETNVSAREALELSSQQEYLKLKARYEALQRNQRNLLGEDLGP  120

Query  652  LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDN  831
            L+  E+E LE QLD SLK IRSTRTQ +LDQL+DLQ KE +  EANKTL+ +L E Y  N
Sbjct  121  LSSKELESLERQLDMSLKQIRSTRTQCMLDQLTDLQRKEHMLNEANKTLKQRLFEGYHVN  180

Query  832  NLQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGF--NPVAT  966
            +LQ      E     +Q H D   GFF PL+C+ TL IG+  +P++ 
Sbjct  181  SLQMNPNADEYGRQQAQAHGD---GFFHPLDCEPTLQIGYQNDPISV  224



>ref|XP_007223808.1| hypothetical protein PRUPE_ppa010679mg [Prunus persica]
 gb|ABO27621.1| transcription factor MADS5 [Prunus persica]
 gb|EMJ25007.1| hypothetical protein PRUPE_ppa010679mg [Prunus persica]
Length=240

 Score =   256 bits (653),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 150/227 (66%), Positives = 176/227 (78%), Gaps = 6/227 (3%)
 Frame = +1

Query  295  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLC+AEVALI+FSNRGKLYEF S+
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCEAEVALIIFSNRGKLYEFCSS  60

Query  475  SNMLKTLERYQKCSYGTLEVNRPNKDN-EQssykeylklkgkyeslQRYQRHLLGEDLGP  651
            S+MLKTLERYQKC+YG  E N   ++  E SS +EYLKLK +YE+LQR QR+LLGEDLGP
Sbjct  61   SSMLKTLERYQKCNYGAPETNVSAREALELSSQQEYLKLKARYEALQRNQRNLLGEDLGP  120

Query  652  LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDN  831
            L+  E+E LE QLD SLK IRSTRTQ +LDQL+DLQ KE +  EANKTL+ +L E Y  N
Sbjct  121  LSSKELESLERQLDMSLKQIRSTRTQCMLDQLTDLQRKEHMLNEANKTLKQRLFEGYHVN  180

Query  832  NLQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGF--NPVAT  966
            +LQ      E     +Q H D   GFF PL+C+ TL IG+  +P++ 
Sbjct  181  SLQMNPNADEYGRQQTQAHGD---GFFHPLDCEPTLQIGYQNDPISV  224



>gb|AEN75254.1| transcription factor MADS3 [Prunus avium]
 gb|AIU94282.1| agamous-like MADS-box protein [Prunus pseudocerasus]
Length=240

 Score =   256 bits (653),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 150/227 (66%), Positives = 176/227 (78%), Gaps = 6/227 (3%)
 Frame = +1

Query  295  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLC+AEVALI+FSNRGKLYEF S+
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCEAEVALIIFSNRGKLYEFCSS  60

Query  475  SNMLKTLERYQKCSYGTLEVNRPNKDN-EQssykeylklkgkyeslQRYQRHLLGEDLGP  651
            S+MLKTLERYQKC+YG  E N   ++  E SS +EYLKLK +YE+LQR QR+LLGEDLGP
Sbjct  61   SSMLKTLERYQKCNYGAPETNVSAREALELSSQQEYLKLKARYEALQRNQRNLLGEDLGP  120

Query  652  LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDN  831
            L+  E+E LE QLD SLK IRSTRTQ +LDQL+DLQ KE +  EANKTL+ +L E Y  N
Sbjct  121  LSSKELESLERQLDMSLKQIRSTRTQYMLDQLTDLQRKEHMLNEANKTLKQRLFEGYHVN  180

Query  832  NLQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGF--NPVAT  966
            +LQ      E     +Q H D   GFF PL+C+ TL IG+  +P++ 
Sbjct  181  SLQMNPNADEYGRQQAQAHGD---GFFHPLDCEPTLQIGYQNDPISV  224



>gb|ADC79704.1| SEPALLATA3-like protein [Pachysandra terminalis]
Length=244

 Score =   255 bits (652),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 153/249 (61%), Positives = 181/249 (73%), Gaps = 10/249 (4%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEF ST
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFCST  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDN-EQssykeylklkgkyeslQRYQRHLLGEDLGP  651
             S+M KTLERYQKC+YG  E N   ++  E +S +EYLKLK + E+LQR QR+L+GEDLGP
Sbjct  61    SSMFKTLERYQKCNYGAPEPNVSARETLELASQQEYLKLKARVEALQRSQRNLMGEDLGP  120

Query  652   LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDN  831
             L+  ++E LE QLD SLK I+S RTQ +LDQL+DLQ +E++  EANKTL+ +L+E    N
Sbjct  121   LDSKDLESLEMQLDMSLKQIKSIRTQYMLDQLTDLQRREQVLTEANKTLKRRLDEGSQVN  180

Query  832   NLQQPWGPGEQSGAYSQQ---HADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqn  1002
                Q W        Y +Q   H     GFF PLEC+ TL IG+ P     QIT A    +
Sbjct  181   --AQQWDLSAHVADYGRQVAHHQPHGDGFFHPLECEPTLQIGYQP----EQITVAAAGPS  234

Query  1003  vnavLPGWM  1029
             VN  +PGW+
Sbjct  235   VNNFMPGWL  243



>gb|ADC79707.1| SEPALLATA1-like protein [Euptelea pleiosperma]
Length=243

 Score =   255 bits (652),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 164/246 (67%), Positives = 193/246 (78%), Gaps = 3/246 (1%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEV LI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVGLIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             ++MLKTL+RYQKCSYG LE + P KD  QSSY EYLKLK + E LQR QR+LLGEDLG L
Sbjct  61    NSMLKTLDRYQKCSYGALEASMPPKDT-QSSYHEYLKLKARVEVLQRSQRNLLGEDLGSL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             N  E+E LEHQL+ SLK IRST+TQ++LDQLSDLQ +E+   E N+ L  KL+E   +  
Sbjct  120   NTKELEQLEHQLEMSLKQIRSTKTQLLLDQLSDLQRQEQHLQETNRALRRKLDESSGEIP  179

Query  835   LQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvnav  1014
             LQ  W  G Q+ +YS+Q A Q+  FFQPLEC+STL IG++P+    Q+  A  AQNVN  
Sbjct  180   LQLSWETGAQNISYSRQPA-QSERFFQPLECNSTLQIGYHPLGP-DQLNIAAPAQNVNGF  237

Query  1015  LPGWML  1032
             +PGWML
Sbjct  238   IPGWML  243



>gb|ABQ85951.1| MADS-box transcription factor SEP-like 2 [Trochodendron aralioides]
Length=244

 Score =   255 bits (652),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 156/249 (63%), Positives = 179/249 (72%), Gaps = 10/249 (4%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFS RGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSTRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDN-EQssykeylklkgkyeslQRYQRHLLGEDLGP  651
             S+M KTLERYQKC+Y   E +   ++  EQSSY+EYLKLK +YE+LQR QR+LLGEDLGP
Sbjct  61    SSMFKTLERYQKCNYTAPETDISARETLEQSSYQEYLKLKARYEALQRSQRNLLGEDLGP  120

Query  652   LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDN  831
             L+  E+E LE QLD SLK IRS RTQ +LDQL+DLQ  E++  E+NK L  +LEE    N
Sbjct  121   LSGKELESLERQLDVSLKQIRSIRTQCMLDQLTDLQRTEQMLSESNKNLARRLEEGSQAN  180

Query  832   NLQQPWGPGEQSGAYSQQHA---DQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqn  1002
               Q  W P      Y QQ A    Q  GFF PLEC+ TL IG+ P     QI       +
Sbjct  181   AHQ--WDPNAHGMRYGQQPAHAHPQGDGFFHPLECEPTLQIGYQP----DQIAVMAPGPS  234

Query  1003  vnavLPGWM  1029
             VN  +PGW+
Sbjct  235   VNNYMPGWL  243



>gb|KHG25284.1| Agamous-like MADS-box protein AGL9 [Gossypium arboreum]
Length=246

 Score =   255 bits (652),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 151/223 (68%), Positives = 175/223 (78%), Gaps = 4/223 (2%)
 Frame = +1

Query  295  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475  SNMLKTLERYQKCSYGTLEVNRPNKDN--EQssykeylklkgkyeslQRYQRHLLGEDLG  648
            S+M+KTLERYQKC+YG  E N  +++   E SS +EYLKLK +Y++LQR QR+LLGEDLG
Sbjct  61   SSMIKTLERYQKCNYGAPEPNVSSREAALELSSRQEYLKLKARYDALQRSQRNLLGEDLG  120

Query  649  PLNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVD  828
            PL+  E+E LE QLD+SLK IRSTRTQ +LDQL+DLQ KE L  EANKTL+ +L E Y  
Sbjct  121  PLSSKELESLEKQLDSSLKLIRSTRTQYMLDQLNDLQRKEHLLNEANKTLKQRLVEGYQV  180

Query  829  NNLQQPWGPGEQSGAYSQQHADQTHG--FFQPLECDSTLHIGF  951
            N+LQ      E  G   QQ   Q HG  FF PL+C+ TL IG+
Sbjct  181  NSLQLNPNATEDVGYGRQQVHHQPHGDAFFHPLDCEPTLQIGY  223



>ref|XP_009600809.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Nicotiana 
tomentosiformis]
Length=242

 Score =   255 bits (651),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 151/228 (66%), Positives = 174/228 (76%), Gaps = 7/228 (3%)
 Frame = +1

Query  295  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475  SNMLKTLERYQKCSYGTLEVNRPNKDN-EQssykeylklkgkyeslQRYQRHLLGEDLGP  651
            S+MLKTLERYQKC+YG  E N   ++  E SS +EYLKLK +YE+LQR QR+LLGEDLGP
Sbjct  61   SSMLKTLERYQKCNYGAPETNISTREALEISSQQEYLKLKARYEALQRSQRNLLGEDLGP  120

Query  652  LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDN  831
            LN  E+E LE QLD SLK IRSTRTQ++LDQL+DLQ KE    EAN+TL+ +L E    +
Sbjct  121  LNSKELESLERQLDMSLKQIRSTRTQLMLDQLTDLQRKEHALNEANRTLKQRLME---GS  177

Query  832  NLQQPWGPGEQSGAYSQQHAD-QTHGFFQPLECDSTLHIGF--NPVAT  966
             L   W    Q   Y +Q    Q  GFF PLEC+ TL IG+  +P+ T
Sbjct  178  QLNLQWQQNAQDVGYGRQTTQTQGDGFFHPLECEPTLQIGYQNDPIIT  225



>gb|AEJ76840.1| MADS16 [Gossypium hirsutum]
 gb|KHG22181.1| Agamous-like MADS-box protein AGL9 [Gossypium arboreum]
Length=243

 Score =   255 bits (651),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 150/229 (66%), Positives = 176/229 (77%), Gaps = 5/229 (2%)
 Frame = +1

Query  295  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475  SNMLKTLERYQKCSYGTLEVNRPNKDN-EQssykeylklkgkyeslQRYQRHLLGEDLGP  651
            S+M+KTLERYQKCS+G  E N   ++  E SS +EYLKLK +YE+LQR QR+LLGEDLGP
Sbjct  61   SSMMKTLERYQKCSHGAPETNVSTREALELSSQQEYLKLKARYEALQRSQRNLLGEDLGP  120

Query  652  LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDN  831
            L+  E+E LE QLD+SLK IRSTRTQ +LDQL+DLQ KE L  EANK+L+ +L E Y  +
Sbjct  121  LSSKELESLERQLDSSLKLIRSTRTQYMLDQLTDLQRKEHLLNEANKSLKQRLMEGYQVH  180

Query  832  NLQQPWGPGEQSGAYSQQHADQTHG--FFQPLECDSTLHIGFNPVATSS  972
            +LQ    P      Y +Q   Q  G  FF PL+C+ TL IG+ P   S+
Sbjct  181  SLQ--LNPNADDVGYGRQPTHQPQGDVFFHPLDCEPTLQIGYQPDTISA  227



>ref|XP_006856372.1| hypothetical protein AMTR_s00047p00190220 [Amborella trichopoda]
 gb|AAX15917.1| AGL2 [Amborella trichopoda]
 gb|AAY25578.1| AGL2 [Amborella trichopoda]
 gb|ERN17839.1| hypothetical protein AMTR_s00047p00190220 [Amborella trichopoda]
Length=243

 Score =   255 bits (651),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 162/246 (66%), Positives = 189/246 (77%), Gaps = 3/246 (1%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF ST
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCST  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             S+M+KTLERYQKC+YG LE N P ++  QSSY+EYLKLK + ESLQR QR+LLGEDLGPL
Sbjct  61    SSMVKTLERYQKCNYGALETNVPTRET-QSSYQEYLKLKARVESLQRSQRNLLGEDLGPL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             +  E+E LE QL+ SLK IRST+TQ + DQL+DL+ +E    E NK L+ KLE     N 
Sbjct  120   SSKELEQLEQQLEMSLKQIRSTKTQCMFDQLADLRRRELALQETNKALKRKLEGASASNP  179

Query  835   LQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvnav  1014
              Q  W    Q+  Y++Q A  T GFF PLECDSTL IG++P +   Q+  A   QNVNA 
Sbjct  180   PQLAWENNGQNIHYNRQPA-HTEGFFHPLECDSTLQIGYHP-SCPDQMPVAAPVQNVNAF  237

Query  1015  LPGWML  1032
             LPGW++
Sbjct  238   LPGWLV  243



>gb|KHG04329.1| MADS-box CMB1 [Gossypium arboreum]
Length=244

 Score =   255 bits (651),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 147/247 (60%), Positives = 184/247 (74%), Gaps = 4/247 (2%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALI+FSNRGKLYEF ST
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCST  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             S+M KTLE+Y   +YG LE  +   D  QS+Y+EYLKLK K E LQ+ QRH LGE++  L
Sbjct  61    SSMAKTLEKYNSYTYGALEPAQTEID-AQSNYQEYLKLKSKVEVLQQSQRHFLGEEIADL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
                E+E LEHQLD SLK IRST+ Q+++DQLS+LQTKE++ LE N+ L  KL+E     +
Sbjct  120   GTKELEQLEHQLDFSLKKIRSTKMQLMIDQLSELQTKEEVLLETNRNLRMKLDE--SGPS  177

Query  835   LQQPWGPGEQSGAYSQ-QHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvna  1011
             ++  W  GEQS  Y+      Q+ GFF+PL C+++L IG+NP + + + TA  +A   + 
Sbjct  178   MRSSWETGEQSIPYNHPPPPPQSEGFFEPLHCNNSLQIGYNPSSVTVEDTATASALAPSG  237

Query  1012  vLPGWML  1032
              +PGWML
Sbjct  238   FIPGWML  244



>dbj|BAM36705.1| MADS transcriptional factor SEP3 homolog, partial [Rosa hybrid 
cultivar]
Length=244

 Score =   254 bits (650),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 152/222 (68%), Positives = 173/222 (78%), Gaps = 4/222 (2%)
 Frame = +1

Query  295  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475  SNMLKTLERYQKCSYGTLEVNRPNKDN-EQssykeylklkgkyeslQRYQRHLLGEDLGP  651
            S+MLKTLERYQKC+YG  E N   ++  E SS +EYLKLK +YE+LQR QR+LLGEDLGP
Sbjct  61   SSMLKTLERYQKCNYGAPETNVSTREALELSSQQEYLKLKARYEALQRNQRNLLGEDLGP  120

Query  652  LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDN  831
            L+  E+E LE QLD SLK IRSTRTQ +LDQL+DLQ KE +  EAN+TL+ +L E Y  +
Sbjct  121  LSSKELESLERQLDMSLKQIRSTRTQCMLDQLTDLQRKEHMLNEANRTLKQRLFEGYNVH  180

Query  832  NLQQPWGPGEQSGAYSQQ--HADQTHGFFQPLECDSTLHIGF  951
             LQ      E  G   QQ  H  Q  GFFQPLEC+ TL IG+
Sbjct  181  QLQLN-ANAEDVGYGRQQAHHQPQGEGFFQPLECEPTLQIGY  221



>ref|XP_009788435.1| PREDICTED: MADS-box protein CMB1-like [Nicotiana sylvestris]
Length=239

 Score =   254 bits (649),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 153/251 (61%), Positives = 185/251 (74%), Gaps = 17/251 (7%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             S++ KTLERY +CSY  LE  + + D+ Q+SY+EY KLK + E LQ+ QRH+LGEDLG L
Sbjct  61    SSISKTLERYHRCSYSNLEAGQSSTDS-QNSYQEYTKLKARVEVLQQSQRHILGEDLGQL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             NI E+E LE QLD+SL+ IRS RTQ +LDQLSDLQ KE+  LE N++L+ KL+E YV   
Sbjct  120   NIKELEQLERQLDSSLRQIRSRRTQNILDQLSDLQQKEQSLLEINRSLKIKLDENYVA--  177

Query  835   LQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNP-----VATSSQItaatnaq  999
              Q  W  GEQ+  +  + A Q   FFQPL+C+ST+   +N      + +S+Q        
Sbjct  178   YQTHWDTGEQNIQFRHRPA-QPQEFFQPLQCNSTMPNRYNQAPWDNIESSTQ--------  228

Query  1000  nvnavLPGWML  1032
             N   VLPGWML
Sbjct  229   NATGVLPGWML  239



>gb|AEL33633.1| SEPALLATA3 [Gossypium hirsutum]
Length=243

 Score =   254 bits (649),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 150/229 (66%), Positives = 175/229 (76%), Gaps = 5/229 (2%)
 Frame = +1

Query  295  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475  SNMLKTLERYQKCSYGTLEVNRPNKDN-EQssykeylklkgkyeslQRYQRHLLGEDLGP  651
            S+M+KTLERYQKCS+G  E N   ++  E SS +EYLKLK +YE+LQR QR+LLGEDLGP
Sbjct  61   SSMMKTLERYQKCSHGAPETNVSTREALELSSQQEYLKLKARYEALQRSQRNLLGEDLGP  120

Query  652  LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDN  831
            L+  E+E LE QLD+SLK IRSTRTQ +LDQL+DLQ KE L  EANK L+ +L E Y  +
Sbjct  121  LSSKELESLERQLDSSLKLIRSTRTQYMLDQLTDLQRKEHLLNEANKNLKQRLMEGYQVH  180

Query  832  NLQQPWGPGEQSGAYSQQHADQTHG--FFQPLECDSTLHIGFNPVATSS  972
            +LQ    P      Y +Q   Q  G  FF PL+C+ TL IG+ P   S+
Sbjct  181  SLQ--LNPNADDVGYGRQPTHQPQGDVFFHPLDCEPTLQIGYQPDTISA  227



>gb|AHY82574.1| MADS-box protein 7 [Lilium formosanum]
Length=246

 Score =   254 bits (649),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 152/252 (60%), Positives = 182/252 (72%), Gaps = 13/252 (5%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTF+KRRNGLLKKA+ELSVLCDAEVALI+FSN G+L EF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSNHGRLSEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             S+M+KTLERY KCSY   E   P+K+ E SSY EYLKLK + E LQR QR+LLGEDLGPL
Sbjct  61    SSMMKTLERYHKCSYNATEDIIPSKETE-SSYHEYLKLKTRVEYLQRSQRNLLGEDLGPL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             +  E+E LEHQL+ SLKHIRST+TQ++LD+LSDL+ KE +  +AN+ L  KL+E  VDN 
Sbjct  120   STKELEQLEHQLEISLKHIRSTKTQLMLDELSDLKGKEHMLQDANQLLRRKLQEAGVDNA  179

Query  835   LQQPW-------GPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatn  993
             L+Q W       GP   S         +   FFQPL CDS+L IGF+PV    Q+    +
Sbjct  180   LRQSWENCSRDSGPSMPSDC----QPARPERFFQPLACDSSLQIGFHPVGI-DQLNNGVS  234

Query  994   aqnvnavLPGWM  1029
              QN +   P WM
Sbjct  235   PQNGDDYAPAWM  246



>gb|AAO22982.1| MADS-box transcription factor CDM44 [Chrysanthemum x morifolium]
Length=249

 Score =   254 bits (650),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 151/249 (61%), Positives = 182/249 (73%), Gaps = 7/249 (3%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDN-EQssykeylklkgkyeslQRYQRHLLGEDLGP  651
             S+MLKTLERYQKC+YG  E N   ++  E SS +EYLKLK +YE+LQR QR+LLGEDLGP
Sbjct  61    SSMLKTLERYQKCNYGAPETNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEDLGP  120

Query  652   LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDN  831
             LN  E+E LE QLDTSLK IRS RTQ +LD L+DLQ KE    +AN+TL+ +L E +   
Sbjct  121   LNCKELESLERQLDTSLKQIRSARTQFMLDTLTDLQKKEHALNDANRTLKQRLMEGHQVT  180

Query  832   NLQQPWGPG-EQSGAYSQQHADQ---THGFFQPLECDSTLHIGFNPVATSSQItaatnaq  999
             +L   W P  +Q   Y QQH  Q      FF PL+C  TL +G+   + +++  A+    
Sbjct  181   SLH--WNPHVQQEMGYDQQHEPQHQNGEAFFHPLDCGPTLQMGYPSDSLTAEAAASVAGP  238

Query  1000  nvnavLPGW  1026
             + +  +PGW
Sbjct  239   SCSNYMPGW  247



>dbj|BAM71399.1| transcription factor [Pyrus pyrifolia]
Length=249

 Score =   254 bits (649),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 147/250 (59%), Positives = 182/250 (73%), Gaps = 5/250 (2%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FS+RGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
              +M+KTLE+YQ CSYG+LE N P  +  Q+SY++YL LK + E LQ+ QR+LLGEDL PL
Sbjct  61    FSMMKTLEKYQSCSYGSLEANLPANET-QNSYQDYLTLKARVEVLQQSQRNLLGEDLQPL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             N  E+EHLEHQL+TSLK IRS +TQ +LDQLSDLQ +E++ +EANK+L+ KLEE  V   
Sbjct  120   NTKELEHLEHQLETSLKQIRSRKTQFILDQLSDLQNREQMLVEANKSLKRKLEETSVQAP  179

Query  835   LQQPWGPGEQSGAYSQQHA---DQTHGFFQPLEC-DSTLHIGFNPVATSSQItaatnaqn  1002
                 W        Y+ Q       +  FF PLE  +S+  IG+  + + +++      Q 
Sbjct  180   EGMAWEAAGHDHNYNIQQTRLPSHSEAFFHPLEGNNSSSQIGYTHMGSDNEMNVGNPGQY  239

Query  1003  vnavLPGWML  1032
             VN  +PGWML
Sbjct  240   VNGFIPGWML  249



>ref|NP_001289529.1| agamous-like MADS-box protein AGL9 homolog [Nicotiana sylvestris]
 gb|AAD39034.1|AF068722_1 MADS-box protein MADS3 [Nicotiana sylvestris]
 gb|AFY06679.1| sepallata3-like MADS-box [Nicotiana tabacum]
Length=241

 Score =   254 bits (648),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 150/228 (66%), Positives = 173/228 (76%), Gaps = 7/228 (3%)
 Frame = +1

Query  295  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475  SNMLKTLERYQKCSYGTLEVNRPNKDN-EQssykeylklkgkyeslQRYQRHLLGEDLGP  651
            S+MLKTLERYQKC+YG  E N   ++  E SS +EYLKLK +YE+LQR QR+LLGEDLGP
Sbjct  61   SSMLKTLERYQKCNYGAPETNISTREALEISSQQEYLKLKARYEALQRSQRNLLGEDLGP  120

Query  652  LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDN  831
            LN  E+E LE QLD SLK IRSTRTQ++LDQL+DLQ KE    EAN+TL+ +L E    +
Sbjct  121  LNSKELESLERQLDMSLKQIRSTRTQLMLDQLTDLQRKEHALNEANRTLKQRLME---GS  177

Query  832  NLQQPWGPGEQSGAYSQQHAD-QTHGFFQPLECDSTLHIGF--NPVAT  966
             L   W    Q   Y +Q    Q  GFF PLEC+ TL IG+  +P+  
Sbjct  178  QLNLQWQQNAQDMGYGRQTTQTQGDGFFHPLECEPTLQIGYQNDPITV  225



>dbj|BAG55316.1| transcription factor [Petunia integrifolia subsp. inflata]
 dbj|BAG55317.1| transcription factor [Petunia integrifolia subsp. inflata]
Length=240

 Score =   254 bits (648),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 150/228 (66%), Positives = 172/228 (75%), Gaps = 7/228 (3%)
 Frame = +1

Query  295  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475  SNMLKTLERYQKCSYGTLEVNRPNKDN-EQssykeylklkgkyeslQRYQRHLLGEDLGP  651
            S+MLKTLERYQKC+YG  E N   ++  E SS +EYLKLK +YE+LQR QR+LLGEDLGP
Sbjct  61   SSMLKTLERYQKCNYGAPETNISTREALEISSQQEYLKLKARYEALQRSQRNLLGEDLGP  120

Query  652  LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDN  831
            LN  E+E LE QLD SLK IRSTRTQ++LDQL DLQ KE    EAN+TL+ +L E    +
Sbjct  121  LNSKELESLERQLDMSLKQIRSTRTQLMLDQLQDLQRKEHALNEANRTLKQRLME---GS  177

Query  832  NLQQPWGPGEQSGAYSQQHAD-QTHGFFQPLECDSTLHIGF--NPVAT  966
             L   W    Q   Y +Q    Q  GFF PLEC+ TL IG+  +P+  
Sbjct  178  TLNLQWQQNAQDVGYGRQATQTQGDGFFHPLECEPTLQIGYQNDPITV  225



>gb|AHJ80843.1| SEPALLATA3 [Cymbidium goeringii]
Length=243

 Score =   254 bits (648),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 150/247 (61%), Positives = 180/247 (73%), Gaps = 7/247 (3%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S 
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSN  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             ++M+KT+E+YQK +YG  E N  +++  QSS +EYLKLK + E+LQR QR+LLGEDLGPL
Sbjct  61    NSMMKTIEKYQKSNYGAPETNVISRET-QSSQQEYLKLKSRVEALQRSQRNLLGEDLGPL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             +  E+E LE QLD+SLK IRSTRTQ +LDQL+DLQ +E++  EANKTL+ +LEE     N
Sbjct  120   SSKELEQLERQLDSSLKQIRSTRTQFMLDQLADLQRREQMLCEANKTLKRRLEESN-QAN  178

Query  835   LQQPWGPGEQSGAYSQQHADQTHG--FFQPLECDSTLHIGFNPVATSSQItaatnaqnvn  1008
              QQ W P         +   Q HG  F+ PLEC+ TL IG+    T   I     A   N
Sbjct  179   PQQIWDPSTAHAMGYDRQPAQPHGDAFYHPLECEPTLQIGYQSDLT---IAPMAAANVNN  235

Query  1009  avLPGWM  1029
              + PGW+
Sbjct  236   YMPPGWL  242



>ref|XP_006477713.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X3 
[Citrus sinensis]
Length=250

 Score =   254 bits (648),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 150/252 (60%), Positives = 189/252 (75%), Gaps = 8/252 (3%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
              +++KTLERY +CS+G  E NRP  + +QS+Y+EYL+LK   E LQR QR+LLGEDL PL
Sbjct  61    PSIMKTLERYHRCSFGAHEANRPPIETQQSTYQEYLRLKTAVELLQRSQRNLLGEDLDPL  120

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             +  E+E LEHQL+TSLKH+RST+TQ ++DQLSDLQ +E++ LE NK L  KL+E  + + 
Sbjct  121   STKELEQLEHQLETSLKHVRSTKTQCMVDQLSDLQKREQVLLELNKGLRKKLDESNIAHQ  180

Query  835   L---QQPW--GPGEQSGAYSQQHADQTHGFFQPLE-CDSTLHIGFNPVATSSQItaatna  996
             +   +  W      Q+  Y+ ++  Q+ GFFQPL   +  L IG+NP+  S +     +A
Sbjct  181   VPPHRLAWEAASAGQNITYN-RYPVQSEGFFQPLSGGNPILQIGYNPMG-SEEAHIPVHA  238

Query  997   qnvnavLPGWML  1032
             QNV   +PGWML
Sbjct  239   QNVTGFIPGWML  250



>sp|Q03489.2|AGL9_PETHY RecName: Full=Agamous-like MADS-box protein AGL9 homolog; AltName: 
Full=Floral homeotic protein FBP2; AltName: Full=Floral-binding 
protein 2 [Petunia x hybrida]
 gb|AAA86854.1| transcription factor [Petunia x hybrida]
Length=241

 Score =   253 bits (647),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 150/228 (66%), Positives = 172/228 (75%), Gaps = 7/228 (3%)
 Frame = +1

Query  295  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475  SNMLKTLERYQKCSYGTLEVNRPNKDN-EQssykeylklkgkyeslQRYQRHLLGEDLGP  651
            S+MLKTLERYQKC+YG  E N   ++  E SS +EYLKLK +YE+LQR QR+LLGEDLGP
Sbjct  61   SSMLKTLERYQKCNYGAPETNISTREALEISSQQEYLKLKARYEALQRSQRNLLGEDLGP  120

Query  652  LNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDN  831
            LN  E+E LE QLD SLK IRSTRTQ++LDQL DLQ KE    EAN+TL+ +L E    +
Sbjct  121  LNSKELESLERQLDMSLKQIRSTRTQLMLDQLQDLQRKEHALNEANRTLKQRLME---GS  177

Query  832  NLQQPWGPGEQSGAYSQQHAD-QTHGFFQPLECDSTLHIGF--NPVAT  966
             L   W    Q   Y +Q    Q  GFF PLEC+ TL IG+  +P+  
Sbjct  178  TLNLQWQQNAQDVGYGRQATQTQGDGFFHPLECEPTLQIGYQNDPITV  225



>gb|AHH28254.1| MADS-box transcription factor, partial [Sapria himalayana]
Length=221

 Score =   253 bits (646),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 152/224 (68%), Positives = 177/224 (79%), Gaps = 3/224 (1%)
 Frame = +1

Query  361   KRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSSTSNMLKTLERYQKCSYGTLEVNR  540
             KRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+SNMLKTLERYQKCSYG +EVN+
Sbjct  1     KRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSNMLKTLERYQKCSYGAIEVNK  60

Query  541   PNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPLNIDEIEHLEHQLDTSLKHIRST  720
             P K+ E SSY+EY+KLK ++ESLQR QR+LLGEDLGPLN  E+E LE QL++SLK +RST
Sbjct  61    PAKELE-SSYREYMKLKSRFESLQRTQRNLLGEDLGPLNTKELEQLERQLESSLKQVRST  119

Query  721   RTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNNLQQPWGPGEQSGAYSQQHADQT  900
             +TQ +LDQLSDLQ KE+L LEAN+ L  KL+E    NNL+  W   EQS  Y+  H  Q 
Sbjct  120   KTQYMLDQLSDLQNKEQLLLEANRALTIKLDEMGARNNLRPSWEGPEQSMPYAHHHP-QN  178

Query  901   HGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvnavLPGWML  1032
                FQPLEC+ TL IG+NPV  S  ITA T+AQ VN  +PGWML
Sbjct  179   QELFQPLECNPTLQIGYNPVG-SDHITATTHAQQVNGFIPGWML  221



>gb|ACB69509.1| SEPALLATA3-like MADS-box protein [Crocus sativus]
Length=238

 Score =   253 bits (647),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 149/247 (60%), Positives = 178/247 (72%), Gaps = 12/247 (5%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNE--QssykeylklkgkyeslQRYQRHLLGEDLG  648
             S+++KTLERYQKCSYG  +     ++ +  QSS++EYLKLK   E+LQR QR+LLGEDLG
Sbjct  61    SSIMKTLERYQKCSYGAPDNIVQIRETQLLQSSHQEYLKLKAHVEALQRSQRNLLGEDLG  120

Query  649   PLNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVD  828
             PL+  E+E LE QLD+SLK IRSTRTQ +LDQL DLQ KE +  EAN++L  +LEE    
Sbjct  121   PLSSKELEQLERQLDSSLKQIRSTRTQCMLDQLGDLQRKEHMLCEANRSLRKRLEE--SS  178

Query  829   NNLQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaqnvn  1008
                QQ W     + AY++Q   Q   F+QPL+C  TL IGF     +          +V 
Sbjct  179   QAHQQVWESNANAIAYARQANQQEEEFYQPLDCQPTLQIGFQADQMAG--------PSVT  230

Query  1009  avLPGWM  1029
               +PGW+
Sbjct  231   NYMPGWL  237



>gb|AAN15182.1| MADS box protein GHMADS-1 [Gossypium hirsutum]
Length=236

 Score =   253 bits (646),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 149/223 (67%), Positives = 174/223 (78%), Gaps = 4/223 (2%)
 Frame = +1

Query  295  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEF S+
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  475  SNMLKTLERYQKCSYGTLEVNRPNKDN--EQssykeylklkgkyeslQRYQRHLLGEDLG  648
            S+M+K LERYQKC+YG  E N  +++   E SS +EYLKLK +Y++LQR QR+LLGEDLG
Sbjct  61   SSMIKILERYQKCNYGAPEPNVSSREAALELSSRQEYLKLKARYDALQRSQRNLLGEDLG  120

Query  649  PLNIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVD  828
            PL+  E+E LE QLD+SLK IRSTRTQ +LDQL+DLQ KE L  EAN+TL+ +L E Y  
Sbjct  121  PLSSKELESLEKQLDSSLKLIRSTRTQYMLDQLNDLQRKEHLLNEANRTLKQRLVEGYQV  180

Query  829  NNLQQPWGPGEQSGAYSQQHADQTHG--FFQPLECDSTLHIGF  951
            N+LQ      E  G   QQ   Q HG  FF PL+C+ TL IG+
Sbjct  181  NSLQLNPNATEDVGYGRQQVHHQPHGDAFFHPLDCEPTLQIGY  223



>gb|AAZ95252.1| MADS box protein SEP1 [Dendrobium crumenatum]
Length=243

 Score =   253 bits (647),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 150/248 (60%), Positives = 181/248 (73%), Gaps = 7/248 (3%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALI+FSNRGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             S+MLKTLERYQKC+Y   E N  +++  QSS +EYLKLK + E+LQR QR+LLGEDLGPL
Sbjct  61    SSMLKTLERYQKCNYEGPETNIISRET-QSSQQEYLKLKARVEALQRSQRNLLGEDLGPL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             +  E+EHLE QLD SLK IRSTRTQ +LDQL+DLQ +E++  EANK L+ + EE     +
Sbjct  120   SSKELEHLERQLDASLKQIRSTRTQFMLDQLADLQRREQMLCEANKALKRRFEESNQTAH  179

Query  835   LQQPWGPGEQSGAYSQQHADQTHG--FFQPLECDSTLHIGFNPVATSSQItaatnaqnvn  1008
              QQ W P         +   Q HG  F+ PLEC+ TL IG++   T   +   T     N
Sbjct  180   -QQVWDPSTTHAVGYGRQPAQHHGDAFYHPLECEPTLQIGYHSDIT---MAPTTAPNVSN  235

Query  1009  avLPGWML  1032
              + PGW++
Sbjct  236   YMPPGWLV  243



>ref|XP_007209505.1| hypothetical protein PRUPE_ppa010391mg [Prunus persica]
 gb|AAZ16241.1| MADS box protein [Prunus persica]
 gb|EMJ10704.1| hypothetical protein PRUPE_ppa010391mg [Prunus persica]
Length=251

 Score =   253 bits (647),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 153/262 (58%), Positives = 185/262 (71%), Gaps = 27/262 (10%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FS+RGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
              +MLKTLE+YQ+CSYG+LE NRP  +  Q+SY+EYLKLK + E LQ+ QR+LLGEDL PL
Sbjct  61    MSMLKTLEKYQRCSYGSLEANRPVNET-QNSYQEYLKLKARVEVLQQSQRNLLGEDLAPL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEF-----  819
             N  E+E LEHQL+ SL  IRST+TQ +LDQL DLQ KE++ +EANK L  KLEE      
Sbjct  120   NTKELEQLEHQLEASLNQIRSTKTQFMLDQLCDLQNKEQMLVEANKALRRKLEETSGQAP  179

Query  820   ---------YVDNNLQQPWGPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATS-  969
                      + +NN+Q    P          H   + GFF PL  +ST  IG+ P+ +  
Sbjct  180   PLLAWEAAGHGNNNVQHTGLP----------HHPHSQGFFHPLGNNSTSQIGYTPLGSDH  229

Query  970   -SQItaatnaqnvnavLPGWML  1032
               Q+    + Q+VN  +PGWML
Sbjct  230   HEQMNVGNHGQHVNGFIPGWML  251



>ref|XP_009337956.1| PREDICTED: MADS-box protein CMB1-like [Pyrus x bretschneideri]
Length=249

 Score =   253 bits (647),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 148/254 (58%), Positives = 186/254 (73%), Gaps = 13/254 (5%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FS+RGKLYEF S+
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
              +M+KTLE+YQ CSYG+LE N P  +  Q+SY++YL LK + E LQ+ QR+LLGEDL PL
Sbjct  61    FSMMKTLEKYQSCSYGSLEANLPANET-QNSYQDYLTLKARVEVLQQSQRNLLGEDLQPL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             N  E+EHLEHQL+TSLK IRS +TQ +LDQLSDLQ +E++ +EANK+L+ KLEE  V   
Sbjct  120   NTKELEHLEHQLETSLKQIRSRKTQFILDQLSDLQNREQMLVEANKSLKRKLEETSV---  176

Query  835   LQQPWGPGEQSGAYSQQHADQ-------THGFFQPLEC-DSTLHIGFNPVATSSQItaat  990
              Q P G   ++  +   +  Q       +  FF PLE  +S+  IG+  + + +++    
Sbjct  177   -QAPEGMAWEAAGHDHNYNIQLTRLPSHSEAFFHPLEGNNSSSQIGYTHMGSDNEMNVGN  235

Query  991   naqnvnavLPGWML  1032
               Q VN  +PGWML
Sbjct  236   PGQYVNGFIPGWML  249



>gb|AHM92083.1| MADS-box protein 7 [Erycina pusilla]
Length=249

 Score =   253 bits (647),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 148/250 (59%), Positives = 187/250 (75%), Gaps = 6/250 (2%)
 Frame = +1

Query  295   MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFSST  474
             MGRGRVELK IENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRG+L+EF S+
Sbjct  1     MGRGRVELKMIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGRLFEFCSS  60

Query  475   SNMLKTLERYQKCSYGTLEVNRPNKDNEQssykeylklkgkyeslQRYQRHLLGEDLGPL  654
             S++LKT+ERYQKCSY + E + P+K+  Q+SY+EYLKLK + E LQR QR+LLGEDLG L
Sbjct  61    SSILKTIERYQKCSYNSTETSIPSKET-QNSYQEYLKLKARVEYLQRSQRNLLGEDLGQL  119

Query  655   NIDEIEHLEHQLDTSLKHIRSTRTQMVLDQLSDLQTKEKLWLEANKTLESKLEEFYVDNN  834
             +  E+E LEHQL+ SLK IRST++Q++LDQL DL+ KE+L  EAN+ L  KL+E   +  
Sbjct  120   STKELEQLEHQLEMSLKQIRSTKSQLMLDQLCDLKRKEQLLQEANRALRMKLQEEEPEIP  179

Query  835   LQQPW-----GPGEQSGAYSQQHADQTHGFFQPLECDSTLHIGFNPVATSSQItaatnaq  999
             LQ  W     G G Q+G        Q+  FFQPL CD +L IG++P+     +   +++ 
Sbjct  180   LQLSWPGGGGGGGGQNGRVPCDRQPQSDVFFQPLNCDPSLQIGYSPICIEQHLNNGSSSH  239

Query  1000  nvnavLPGWM  1029
             +VN  +PGWM
Sbjct  240   SVNGFVPGWM  249



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3626085783502