BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c106183_g1_i1 len=143 path=[121:0-142]

Length=143
                                                                      Score     E

emb|CAN67076.1|  hypothetical protein VITISV_042382                   44.7    4e-08   Vitis vinifera
emb|CAN65410.1|  hypothetical protein VITISV_040416                   43.5    6e-08   Vitis vinifera
emb|CAN81139.1|  hypothetical protein VITISV_018760                   43.5    6e-08   Vitis vinifera
emb|CAN69688.1|  hypothetical protein VITISV_026774                   43.5    6e-08   Vitis vinifera
emb|CAN62535.1|  hypothetical protein VITISV_041880                   43.5    6e-08   Vitis vinifera
emb|CAN78715.1|  hypothetical protein VITISV_030863                   43.5    6e-08   Vitis vinifera
emb|CAN70689.1|  hypothetical protein VITISV_012155                   43.5    6e-08   Vitis vinifera
emb|CAN80547.1|  hypothetical protein VITISV_010898                   43.5    6e-08   Vitis vinifera
emb|CAN76679.1|  hypothetical protein VITISV_034325                   43.5    6e-08   Vitis vinifera
emb|CAN62614.1|  hypothetical protein VITISV_028123                   43.5    6e-08   Vitis vinifera
emb|CAN71185.1|  hypothetical protein VITISV_014270                   43.5    6e-08   Vitis vinifera
emb|CAN62328.1|  hypothetical protein VITISV_029806                   43.5    6e-08   Vitis vinifera
emb|CAN71246.1|  hypothetical protein VITISV_011986                   43.5    6e-08   Vitis vinifera
emb|CAN78751.1|  hypothetical protein VITISV_028425                   43.5    6e-08   Vitis vinifera
emb|CAN72663.1|  hypothetical protein VITISV_031849                   43.5    6e-08   Vitis vinifera
emb|CAN61207.1|  hypothetical protein VITISV_015446                   43.5    6e-08   Vitis vinifera
emb|CAN81715.1|  hypothetical protein VITISV_032902                   43.5    6e-08   Vitis vinifera
emb|CAN73101.1|  hypothetical protein VITISV_042890                   43.5    6e-08   Vitis vinifera
emb|CAN72132.1|  hypothetical protein VITISV_040707                   43.5    6e-08   Vitis vinifera
emb|CAN76680.1|  hypothetical protein VITISV_034326                   43.5    6e-08   Vitis vinifera
emb|CAN80771.1|  hypothetical protein VITISV_027574                   43.5    6e-08   Vitis vinifera
emb|CAN70825.1|  hypothetical protein VITISV_039828                   43.5    6e-08   Vitis vinifera
emb|CAN60609.1|  hypothetical protein VITISV_036599                   43.5    6e-08   Vitis vinifera
emb|CAN81362.1|  hypothetical protein VITISV_013815                   43.5    6e-08   Vitis vinifera
emb|CAN73073.1|  hypothetical protein VITISV_032385                   43.5    6e-08   Vitis vinifera
emb|CAN67925.1|  hypothetical protein VITISV_021168                   43.5    6e-08   Vitis vinifera
emb|CAN61179.1|  hypothetical protein VITISV_032292                   43.5    7e-08   Vitis vinifera
emb|CAN82064.1|  hypothetical protein VITISV_022772                   43.5    7e-08   Vitis vinifera
emb|CAN65230.1|  hypothetical protein VITISV_034221                   43.1    8e-08   Vitis vinifera
emb|CAN70968.1|  hypothetical protein VITISV_033354                   43.5    8e-08   Vitis vinifera
emb|CAN79136.1|  hypothetical protein VITISV_034813                   43.5    8e-08   Vitis vinifera
emb|CAN75744.1|  hypothetical protein VITISV_040125                   43.5    8e-08   Vitis vinifera
emb|CAN67338.1|  hypothetical protein VITISV_016115                   43.1    8e-08   Vitis vinifera
emb|CAN69178.1|  hypothetical protein VITISV_024410                   43.1    9e-08   Vitis vinifera
emb|CAN77643.1|  hypothetical protein VITISV_007625                   43.1    9e-08   Vitis vinifera
emb|CAN72018.1|  hypothetical protein VITISV_001841                   43.1    9e-08   Vitis vinifera
emb|CAN67493.1|  hypothetical protein VITISV_022776                   43.1    9e-08   Vitis vinifera
emb|CAN73074.1|  hypothetical protein VITISV_032386                   43.1    1e-07   Vitis vinifera
emb|CAN75571.1|  hypothetical protein VITISV_009506                   43.1    1e-07   Vitis vinifera
emb|CAN72440.1|  hypothetical protein VITISV_039162                   42.7    1e-07   Vitis vinifera
emb|CAN74064.1|  hypothetical protein VITISV_028146                   43.5    1e-07   Vitis vinifera
emb|CAN75856.1|  hypothetical protein VITISV_005690                   43.1    1e-07   Vitis vinifera
emb|CAN67317.1|  hypothetical protein VITISV_019719                   43.1    1e-07   Vitis vinifera
emb|CAN63730.1|  hypothetical protein VITISV_030286                   43.1    1e-07   Vitis vinifera
emb|CAN62074.1|  hypothetical protein VITISV_001619                   43.1    1e-07   Vitis vinifera
emb|CAN74310.1|  hypothetical protein VITISV_037517                   43.1    1e-07   Vitis vinifera
emb|CAN77210.1|  hypothetical protein VITISV_000141                   42.4    1e-07   Vitis vinifera
emb|CAN75900.1|  hypothetical protein VITISV_033582                   42.4    1e-07   Vitis vinifera
emb|CAN83455.1|  hypothetical protein VITISV_029958                   43.5    2e-07   Vitis vinifera
emb|CAN70259.1|  hypothetical protein VITISV_002222                   42.4    2e-07   Vitis vinifera
emb|CAN60837.1|  hypothetical protein VITISV_033823                   44.7    2e-07   Vitis vinifera
emb|CAN63530.1|  hypothetical protein VITISV_038849                   42.4    2e-07   Vitis vinifera
emb|CAN81288.1|  hypothetical protein VITISV_036901                   43.1    2e-07   Vitis vinifera
emb|CAN84135.1|  hypothetical protein VITISV_000113                   43.5    2e-07   Vitis vinifera
emb|CAN79672.1|  hypothetical protein VITISV_012210                   43.5    2e-07   Vitis vinifera
emb|CAN80088.1|  hypothetical protein VITISV_021656                   43.1    2e-07   Vitis vinifera
emb|CAN76965.1|  hypothetical protein VITISV_043961                   42.7    2e-07   Vitis vinifera
emb|CAN77222.1|  hypothetical protein VITISV_010482                   43.5    2e-07   Vitis vinifera
emb|CAN75922.1|  hypothetical protein VITISV_030752                   43.5    2e-07   Vitis vinifera
emb|CAN66243.1|  hypothetical protein VITISV_015916                   43.5    2e-07   Vitis vinifera
emb|CAN83335.1|  hypothetical protein VITISV_043861                   43.5    2e-07   Vitis vinifera
emb|CAN73234.1|  hypothetical protein VITISV_033857                   43.9    2e-07   Vitis vinifera
emb|CAN59895.1|  hypothetical protein VITISV_002882                   43.1    3e-07   Vitis vinifera
emb|CAN70756.1|  hypothetical protein VITISV_014702                   41.2    3e-07   Vitis vinifera
emb|CAN77046.1|  hypothetical protein VITISV_035257                   43.5    3e-07   Vitis vinifera
emb|CAN80753.1|  hypothetical protein VITISV_003323                   41.2    3e-07   Vitis vinifera
emb|CAN63874.1|  hypothetical protein VITISV_038274                   43.5    3e-07   Vitis vinifera
emb|CAN81771.1|  hypothetical protein VITISV_012076                   41.2    3e-07   Vitis vinifera
emb|CAN81916.1|  hypothetical protein VITISV_038548                   40.4    4e-07   Vitis vinifera
emb|CAN74964.1|  hypothetical protein VITISV_006810                   41.2    5e-07   Vitis vinifera
emb|CAN66185.1|  hypothetical protein VITISV_025185                   43.5    5e-07   Vitis vinifera
emb|CAN64673.1|  hypothetical protein VITISV_007430                   43.5    5e-07   Vitis vinifera
ref|XP_009780762.1|  PREDICTED: uncharacterized protein LOC104229761  40.4    5e-07   
emb|CAN80924.1|  hypothetical protein VITISV_003442                   43.5    5e-07   Vitis vinifera
emb|CAN63185.1|  hypothetical protein VITISV_000411                   41.2    5e-07   Vitis vinifera
gb|AFN88207.1|  integrase core domain containing protein              43.1    6e-07   
emb|CAN69307.1|  hypothetical protein VITISV_001120                   40.4    6e-07   Vitis vinifera
emb|CAN59884.1|  hypothetical protein VITISV_026166                   43.5    7e-07   Vitis vinifera
emb|CAN80367.1|  hypothetical protein VITISV_014719                   40.0    8e-07   Vitis vinifera
emb|CAN62266.1|  hypothetical protein VITISV_025647                   41.6    8e-07   Vitis vinifera
emb|CAN81716.1|  hypothetical protein VITISV_032903                   39.7    9e-07   Vitis vinifera
gb|ABI34329.1|  Integrase core domain containing protein              40.4    1e-06   Solanum demissum
emb|CBI37123.3|  unnamed protein product                              43.5    1e-06   
emb|CAN77834.1|  hypothetical protein VITISV_024733                   41.6    1e-06   Vitis vinifera
gb|KHN44882.1|  Putative mitochondrial protein                        43.5    1e-06   
emb|CAN60274.1|  hypothetical protein VITISV_024841                   43.5    1e-06   Vitis vinifera
emb|CAN76432.1|  hypothetical protein VITISV_033849                   39.3    1e-06   Vitis vinifera
emb|CAN65160.1|  hypothetical protein VITISV_021747                   41.2    2e-06   Vitis vinifera
emb|CAN67123.1|  hypothetical protein VITISV_040164                   41.6    2e-06   Vitis vinifera
emb|CAN67119.1|  hypothetical protein VITISV_017483                   39.7    2e-06   Vitis vinifera
emb|CAN79805.1|  hypothetical protein VITISV_031503                   40.4    2e-06   Vitis vinifera
emb|CAN63843.1|  hypothetical protein VITISV_036670                   40.0    2e-06   Vitis vinifera
emb|CAN81940.1|  hypothetical protein VITISV_007358                   43.1    3e-06   Vitis vinifera
emb|CAN72710.1|  hypothetical protein VITISV_018096                   39.7    3e-06   Vitis vinifera
ref|XP_004174156.1|  PREDICTED: uncharacterized mitochondrial pro...  42.0    3e-06   
emb|CAN76224.1|  hypothetical protein VITISV_017232                   39.7    3e-06   Vitis vinifera
emb|CAN77373.1|  hypothetical protein VITISV_008342                   43.5    3e-06   Vitis vinifera
emb|CAN61858.1|  hypothetical protein VITISV_016691                   41.6    4e-06   Vitis vinifera
emb|CAN66306.1|  hypothetical protein VITISV_031415                   43.5    4e-06   Vitis vinifera
emb|CAN59880.1|  hypothetical protein VITISV_029938                   43.5    4e-06   Vitis vinifera
emb|CAN70029.1|  hypothetical protein VITISV_010388                   38.9    4e-06   Vitis vinifera
emb|CAN78880.1|  hypothetical protein VITISV_024991                   40.0    4e-06   Vitis vinifera
emb|CAN60498.1|  hypothetical protein VITISV_027869                   38.9    5e-06   Vitis vinifera
gb|KHN22607.1|  Retrovirus-related Pol polyprotein from transposo...  42.4    5e-06   
gb|AAO26690.1|AF478377_1  gag-pol polyprotein                         41.6    5e-06   Vitis vinifera
ref|XP_004292511.1|  PREDICTED: uncharacterized mitochondrial pro...  41.6    5e-06   
emb|CAN69420.1|  hypothetical protein VITISV_025306                   39.3    5e-06   Vitis vinifera
emb|CAN74507.1|  hypothetical protein VITISV_015891                   41.2    6e-06   Vitis vinifera
emb|CAN83125.1|  hypothetical protein VITISV_015109                   42.4    6e-06   Vitis vinifera
emb|CAN71132.1|  hypothetical protein VITISV_007235                   41.6    6e-06   Vitis vinifera
emb|CAN83177.1|  hypothetical protein VITISV_042114                   41.6    7e-06   Vitis vinifera
emb|CAN65647.1|  hypothetical protein VITISV_001300                   38.1    7e-06   Vitis vinifera
emb|CAN63507.1|  hypothetical protein VITISV_029435                   43.5    8e-06   Vitis vinifera
gb|KHN17267.1|  Putative mitochondrial protein                        40.8    8e-06   
emb|CAN63081.1|  hypothetical protein VITISV_016842                   39.3    9e-06   Vitis vinifera
gb|KHN06274.1|  Retrovirus-related Pol polyprotein from transposo...  38.9    1e-05   
gb|AAO26684.1|AF478370_1  gag-pol polyprotein                         41.6    1e-05   Vitis vinifera
emb|CAN80853.1|  hypothetical protein VITISV_040353                   38.9    1e-05   Vitis vinifera
emb|CBI40600.3|  unnamed protein product                              42.4    1e-05   
emb|CAN83275.1|  hypothetical protein VITISV_026335                   42.4    1e-05   Vitis vinifera
gb|AAO26683.1|AF478369_1  gag-pol polyprotein                         41.6    1e-05   Vitis vinifera
gb|ABY49842.1|  hypothetical protein                                  41.6    1e-05   Vitis hybrid cultivar
emb|CAN72222.1|  hypothetical protein VITISV_028929                   40.4    2e-05   Vitis vinifera
gb|AEJ72555.1|  putative retroelement polyprotein                     39.7    2e-05   
gb|KHN45218.1|  Putative mitochondrial protein                        43.1    2e-05   
emb|CAN60149.1|  hypothetical protein VITISV_016363                   39.3    2e-05   Vitis vinifera
ref|XP_009338880.1|  PREDICTED: uncharacterized protein LOC103931184  40.0    2e-05   
ref|XP_010552410.1|  PREDICTED: uncharacterized protein LOC104822761  40.4    2e-05   
emb|CAN76176.1|  hypothetical protein VITISV_022748                   38.9    3e-05   Vitis vinifera
ref|XP_010534024.1|  PREDICTED: uncharacterized protein LOC104809678  41.6    3e-05   
ref|XP_010527127.1|  PREDICTED: uncharacterized protein LOC104804512  41.6    3e-05   
emb|CAN76350.1|  hypothetical protein VITISV_025245                   38.9    3e-05   Vitis vinifera
ref|XP_010112249.1|  Aldehyde dehydrogenase family 6 member B2        39.3    3e-05   
emb|CAN81070.1|  hypothetical protein VITISV_037301                   43.5    3e-05   Vitis vinifera
ref|XP_009129009.1|  PREDICTED: uncharacterized protein LOC103853855  41.2    3e-05   
ref|XP_007153038.1|  hypothetical protein PHAVU_003G0023001g          41.6    3e-05   
ref|XP_010065010.1|  PREDICTED: uncharacterized protein LOC104452197  48.9    3e-05   
emb|CAN74815.1|  hypothetical protein VITISV_015192                   38.9    3e-05   Vitis vinifera
ref|XP_007044444.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...  40.8    3e-05   
ref|XP_008356691.1|  PREDICTED: uncharacterized calcium-binding p...  40.0    4e-05   
emb|CAN74917.1|  hypothetical protein VITISV_032458                   43.5    4e-05   Vitis vinifera
gb|AAM47483.1|  RNAse H-like protein                                  40.0    4e-05   Quercus suber [cork oak]
gb|KHN07818.1|  Retrovirus-related Pol polyprotein from transposo...  37.7    5e-05   
ref|XP_010555983.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  40.0    5e-05   
ref|XP_008460624.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  40.4    5e-05   
emb|CAN64580.1|  hypothetical protein VITISV_002159                   43.1    6e-05   Vitis vinifera
emb|CAN59936.1|  hypothetical protein VITISV_001878                   41.2    6e-05   Vitis vinifera
ref|XP_008358031.1|  PREDICTED: LOW QUALITY PROTEIN: probable L-t...  40.4    6e-05   
ref|XP_007044112.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...  40.8    6e-05   
ref|XP_006481389.1|  PREDICTED: probable LRR receptor-like serine...  38.9    8e-05   
ref|XP_004515021.1|  PREDICTED: uncharacterized mitochondrial pro...  40.0    8e-05   
gb|AAB61111.1|  Strong similarity to Zea mays retrotransposon Hop...  42.0    8e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006584292.1|  PREDICTED: uncharacterized protein LOC102668041  38.9    9e-05   
emb|CAA36616.1|  unnamed protein product                              36.6    9e-05   Solanum tuberosum [potatoes]
ref|XP_004306286.1|  PREDICTED: uncharacterized mitochondrial pro...  39.3    1e-04   
ref|XP_004292800.1|  PREDICTED: uncharacterized mitochondrial pro...  38.9    1e-04   
emb|CAN68682.1|  hypothetical protein VITISV_024814                   39.3    1e-04   Vitis vinifera
emb|CAN73405.1|  hypothetical protein VITISV_010053                   40.8    1e-04   Vitis vinifera
ref|XP_010088511.1|  hypothetical protein L484_009995                 40.4    1e-04   
emb|CAN69359.1|  hypothetical protein VITISV_024911                   37.7    1e-04   Vitis vinifera
emb|CAN71693.1|  hypothetical protein VITISV_012128                   40.4    1e-04   Vitis vinifera
gb|ABA95230.1|  retrotransposon protein, putative, unclassified       42.0    1e-04   Oryza sativa Japonica Group [Japonica rice]
emb|CAN70670.1|  hypothetical protein VITISV_037507                   37.7    1e-04   Vitis vinifera
ref|XP_004310176.1|  PREDICTED: uncharacterized protein LOC101315202  38.1    1e-04   
emb|CAN77522.1|  hypothetical protein VITISV_005922                   41.6    1e-04   Vitis vinifera
emb|CAN76639.1|  hypothetical protein VITISV_027481                   41.6    1e-04   Vitis vinifera
ref|XP_010545866.1|  PREDICTED: uncharacterized protein LOC104818105  40.4    2e-04   
emb|CAN76658.1|  hypothetical protein VITISV_025162                   37.4    2e-04   Vitis vinifera
emb|CAN83464.1|  hypothetical protein VITISV_030945                   38.1    2e-04   Vitis vinifera
emb|CAN65144.1|  hypothetical protein VITISV_026080                   37.0    2e-04   Vitis vinifera
emb|CAN74241.1|  hypothetical protein VITISV_006638                   37.0    2e-04   Vitis vinifera
emb|CAN67120.1|  hypothetical protein VITISV_017484                   43.1    2e-04   Vitis vinifera
ref|XP_008343253.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  41.2    2e-04   
ref|XP_008372142.1|  PREDICTED: uncharacterized protein LOC103435525  38.1    2e-04   
ref|XP_009139303.1|  PREDICTED: uncharacterized protein LOC103863290  35.4    2e-04   
ref|XP_006605045.1|  PREDICTED: uncharacterized mitochondrial pro...  41.2    2e-04   
emb|CAN71812.1|  hypothetical protein VITISV_037409                   38.5    2e-04   Vitis vinifera
ref|XP_004295380.1|  PREDICTED: uncharacterized protein LOC101310880  38.1    2e-04   
ref|XP_007024405.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...  40.0    2e-04   
ref|XP_007027564.1|  Uncharacterized protein TCM_022381               40.0    2e-04   
gb|AAP54332.2|  retrotransposon protein, putative, unclassified       42.0    2e-04   Oryza sativa Japonica Group [Japonica rice]
emb|CAN76494.1|  hypothetical protein VITISV_024984                   40.8    2e-04   Vitis vinifera
ref|XP_008369116.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  40.8    2e-04   
emb|CCI55442.1|  PH01B031C15.25                                       40.4    3e-04   
ref|XP_003630831.1|  50S ribosomal protein L17                        41.6    3e-04   
gb|AAM91874.1|  putative copia-like polyprotein                       42.0    3e-04   Oryza sativa Japonica Group [Japonica rice]
emb|CAN81001.1|  hypothetical protein VITISV_006992                   37.0    3e-04   Vitis vinifera
emb|CAN77135.1|  hypothetical protein VITISV_021719                   40.8    3e-04   Vitis vinifera
ref|XP_007048482.1|  Uncharacterized protein TCM_001554               37.7    3e-04   
emb|CAN74819.1|  hypothetical protein VITISV_034590                   36.2    3e-04   Vitis vinifera
ref|XP_004487728.1|  PREDICTED: uncharacterized protein LOC101496141  41.2    3e-04   
ref|XP_007017134.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...  38.9    3e-04   
emb|CAN65748.1|  hypothetical protein VITISV_042183                   38.1    4e-04   Vitis vinifera
emb|CAN74229.1|  hypothetical protein VITISV_000584                   38.1    4e-04   Vitis vinifera
ref|XP_007050265.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...  36.6    4e-04   
ref|XP_004508230.1|  PREDICTED: uncharacterized mitochondrial pro...  35.0    4e-04   
emb|CAN63917.1|  hypothetical protein VITISV_019573                   40.0    4e-04   Vitis vinifera
gb|ABA93730.1|  retrotransposon protein, putative, unclassified       41.6    4e-04   Oryza sativa Japonica Group [Japonica rice]
emb|CAN63235.1|  hypothetical protein VITISV_040120                   40.8    4e-04   Vitis vinifera
ref|XP_003600634.1|  Mitochondrial protein, putative                  44.3    4e-04   
ref|XP_006605007.1|  PREDICTED: uncharacterized mitochondrial pro...  45.4    4e-04   
emb|CAN71748.1|  hypothetical protein VITISV_019194                   37.0    4e-04   Vitis vinifera
ref|XP_010513509.1|  PREDICTED: uncharacterized protein LOC104789522  39.7    5e-04   
emb|CAE04751.3|  OSJNBb0060E08.14                                     39.3    5e-04   Oryza sativa [red rice]
emb|CAN60648.1|  hypothetical protein VITISV_033947                   34.7    5e-04   Vitis vinifera
emb|CAB10225.1|  retrovirus-related like polyprotein                  35.8    5e-04   Arabidopsis thaliana [mouse-ear cress]
gb|KHN07234.1|  Retrovirus-related Pol polyprotein from transposo...  35.0    5e-04   
emb|CAN80469.1|  hypothetical protein VITISV_008623                   38.5    5e-04   Vitis vinifera
ref|XP_007045431.1|  Cysteine-rich RLK 8, putative                    38.1    5e-04   
emb|CAN74290.1|  hypothetical protein VITISV_036414                   35.8    5e-04   Vitis vinifera
emb|CAN61724.1|  hypothetical protein VITISV_035360                   37.0    6e-04   Vitis vinifera
ref|XP_010313166.1|  PREDICTED: uncharacterized protein LOC104644711  36.6    6e-04   
emb|CAN73189.1|  hypothetical protein VITISV_042346                   37.4    6e-04   Vitis vinifera
ref|XP_008374297.1|  PREDICTED: uncharacterized protein LOC103437591  45.8    6e-04   
emb|CAN76546.1|  hypothetical protein VITISV_010420                   36.6    6e-04   Vitis vinifera
ref|XP_006605036.1|  PREDICTED: uncharacterized mitochondrial pro...  35.8    7e-04   
emb|CAN68477.1|  hypothetical protein VITISV_029627                   40.4    7e-04   Vitis vinifera
ref|XP_006586529.1|  PREDICTED: uncharacterized mitochondrial pro...  37.4    8e-04   
emb|CAN83990.1|  hypothetical protein VITISV_018454                   36.6    8e-04   Vitis vinifera
ref|XP_006340058.1|  PREDICTED: F-box/LRR-repeat protein At5g0291...  35.4    8e-04   
ref|XP_010098067.1|  Copia protein                                    35.8    9e-04   
gb|AAC33963.1|  contains similarity to reverse transcriptases (Pf...  35.0    9e-04   Arabidopsis thaliana [mouse-ear cress]
emb|CAN77072.1|  hypothetical protein VITISV_006213                   40.8    0.001   Vitis vinifera
emb|CAN79782.1|  hypothetical protein VITISV_002631                   35.4    0.001   Vitis vinifera



>emb|CAN67076.1| hypothetical protein VITISV_042382 [Vitis vinifera]
Length=1236

 Score = 44.7 bits (104),  Expect(2) = 4e-08, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2     DRKSTFGYCIFLGDNLISWKSR  67
             DR+ST GYC+F+G NLISWKS+
Sbjct  1092  DRRSTLGYCVFIGGNLISWKSK  1113


 Score = 38.9 bits (89),  Expect(2) = 4e-08, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  58    EK*NVVTRSSA*TEDRSMALETCELVWL  141
             +K +VVTRS+A  E R MAL TCEL+WL
Sbjct  1113  KKQDVVTRSNAEVEYRVMALATCELIWL  1140



>emb|CAN65410.1| hypothetical protein VITISV_040416 [Vitis vinifera]
Length=2253

 Score = 43.5 bits (101),  Expect(2) = 6e-08, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2     DRKSTFGYCIFLGDNLISWKSR  67
             DR+ST GYC+F+G NLISWKS+
Sbjct  1756  DRRSTSGYCVFIGGNLISWKSK  1777


 Score = 39.3 bits (90),  Expect(2) = 6e-08, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  58    EK*NVVTRSSA*TEDRSMALETCELVWL  141
             +K +VV RSSA  E R+MAL TCEL+WL
Sbjct  1777  KKQDVVARSSAEAEYRAMALATCELIWL  1804



>emb|CAN81139.1| hypothetical protein VITISV_018760 [Vitis vinifera]
Length=1403

 Score = 43.5 bits (101),  Expect(2) = 6e-08, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2     DRKSTFGYCIFLGDNLISWKSR  67
             DR+ST GYC+F+G NLISWKS+
Sbjct  1320  DRRSTSGYCVFIGGNLISWKSK  1341


 Score = 39.3 bits (90),  Expect(2) = 6e-08, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  58    EK*NVVTRSSA*TEDRSMALETCELVWL  141
             +K +VV RSSA  E R+MAL TCEL+WL
Sbjct  1341  KKQDVVARSSAEAEYRAMALATCELIWL  1368



>emb|CAN69688.1| hypothetical protein VITISV_026774 [Vitis vinifera]
Length=1382

 Score = 43.5 bits (101),  Expect(2) = 6e-08, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2     DRKSTFGYCIFLGDNLISWKSR  67
             DR+ST GYC+F+G NLISWKS+
Sbjct  1330  DRRSTSGYCVFIGGNLISWKSK  1351


 Score = 39.3 bits (90),  Expect(2) = 6e-08, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  58    EK*NVVTRSSA*TEDRSMALETCELVWL  141
             +K +VV RSSA  E R+MAL TCEL+WL
Sbjct  1351  KKQDVVARSSAEAEYRAMALATCELIWL  1378



>emb|CAN62535.1| hypothetical protein VITISV_041880 [Vitis vinifera]
Length=1314

 Score = 43.5 bits (101),  Expect(2) = 6e-08, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2     DRKSTFGYCIFLGDNLISWKSR  67
             DR+ST GYC+F+G NLISWKS+
Sbjct  1202  DRRSTSGYCVFIGGNLISWKSK  1223


 Score = 39.3 bits (90),  Expect(2) = 6e-08, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  58    EK*NVVTRSSA*TEDRSMALETCELVWL  141
             +K +VV RSSA  E R+MAL TCEL+WL
Sbjct  1223  KKQDVVARSSAEAEYRAMALATCELIWL  1250



>emb|CAN78715.1| hypothetical protein VITISV_030863 [Vitis vinifera]
Length=1228

 Score = 43.5 bits (101),  Expect(2) = 6e-08, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2     DRKSTFGYCIFLGDNLISWKSR  67
             DR+ST GYC+F+G NLISWKS+
Sbjct  1084  DRRSTSGYCVFIGGNLISWKSK  1105


 Score = 39.3 bits (90),  Expect(2) = 6e-08, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  58    EK*NVVTRSSA*TEDRSMALETCELVWL  141
             +K +VV RSSA  E R+MAL TCEL+WL
Sbjct  1105  KKQDVVARSSAEAEYRAMALATCELIWL  1132



>emb|CAN70689.1| hypothetical protein VITISV_012155 [Vitis vinifera]
Length=1199

 Score = 43.5 bits (101),  Expect(2) = 6e-08, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST GYC+F+G NLISWKS+
Sbjct  673  DRRSTSGYCVFIGGNLISWKSK  694


 Score = 39.3 bits (90),  Expect(2) = 6e-08, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K +VV RSSA  E R+MAL TCEL+WL
Sbjct  694  KKQDVVARSSAEAEYRAMALATCELIWL  721



>emb|CAN80547.1| hypothetical protein VITISV_010898 [Vitis vinifera]
Length=1181

 Score = 43.5 bits (101),  Expect(2) = 6e-08, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2     DRKSTFGYCIFLGDNLISWKSR  67
             DR+ST GYC+F+G NLISWKS+
Sbjct  1044  DRRSTSGYCVFIGGNLISWKSK  1065


 Score = 39.3 bits (90),  Expect(2) = 6e-08, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  58    EK*NVVTRSSA*TEDRSMALETCELVWL  141
             +K +VV RSSA  E R+MAL TCEL+WL
Sbjct  1065  KKQDVVARSSAEAEYRAMALATCELIWL  1092



>emb|CAN76679.1| hypothetical protein VITISV_034325 [Vitis vinifera]
Length=1117

 Score = 43.5 bits (101),  Expect(2) = 6e-08, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2     DRKSTFGYCIFLGDNLISWKSR  67
             DR+ST GYC+F+G NLISWKS+
Sbjct  1057  DRRSTSGYCVFIGGNLISWKSK  1078


 Score = 39.3 bits (90),  Expect(2) = 6e-08, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  58    EK*NVVTRSSA*TEDRSMALETCELVWL  141
             +K +VV RSSA  E R+MAL TCEL+WL
Sbjct  1078  KKQDVVARSSAEAEYRAMALATCELIWL  1105



>emb|CAN62614.1| hypothetical protein VITISV_028123 [Vitis vinifera]
Length=1102

 Score = 43.5 bits (101),  Expect(2) = 6e-08, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST GYC+F+G NLISWKS+
Sbjct  958  DRRSTSGYCVFIGGNLISWKSK  979


 Score = 39.3 bits (90),  Expect(2) = 6e-08, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  58    EK*NVVTRSSA*TEDRSMALETCELVWL  141
             +K +VV RSSA  E R+MAL TCEL+WL
Sbjct  979   KKQDVVARSSAEAEYRAMALATCELIWL  1006



>emb|CAN71185.1| hypothetical protein VITISV_014270 [Vitis vinifera]
Length=1024

 Score = 43.5 bits (101),  Expect(2) = 6e-08, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST GYC+F+G NLISWKS+
Sbjct  880  DRRSTSGYCVFIGGNLISWKSK  901


 Score = 39.3 bits (90),  Expect(2) = 6e-08, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K +VV RSSA  E R+MAL TCEL+WL
Sbjct  901  KKQDVVARSSAEAEYRAMALATCELIWL  928



>emb|CAN62328.1| hypothetical protein VITISV_029806 [Vitis vinifera]
Length=996

 Score = 43.5 bits (101),  Expect(2) = 6e-08, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST GYC+F+G NLISWKS+
Sbjct  852  DRRSTSGYCVFIGGNLISWKSK  873


 Score = 39.3 bits (90),  Expect(2) = 6e-08, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K +VV RSSA  E R+MAL TCEL+WL
Sbjct  873  KKQDVVARSSAEAEYRAMALATCELIWL  900



>emb|CAN71246.1| hypothetical protein VITISV_011986 [Vitis vinifera]
Length=937

 Score = 43.5 bits (101),  Expect(2) = 6e-08, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST GYC+F+G NLISWKS+
Sbjct  793  DRRSTSGYCVFIGGNLISWKSK  814


 Score = 39.3 bits (90),  Expect(2) = 6e-08, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K +VV RSSA  E R+MAL TCEL+WL
Sbjct  814  KKQDVVARSSAEAEYRAMALATCELIWL  841



>emb|CAN78751.1| hypothetical protein VITISV_028425 [Vitis vinifera]
Length=926

 Score = 43.5 bits (101),  Expect(2) = 6e-08, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST GYC+F+G NLISWKS+
Sbjct  782  DRRSTSGYCVFIGGNLISWKSK  803


 Score = 39.3 bits (90),  Expect(2) = 6e-08, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K +VV RSSA  E R+MAL TCEL+WL
Sbjct  803  KKQDVVARSSAEAEYRAMALATCELIWL  830



>emb|CAN72663.1| hypothetical protein VITISV_031849 [Vitis vinifera]
Length=912

 Score = 43.5 bits (101),  Expect(2) = 6e-08, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST GYC+F+G NLISWKS+
Sbjct  768  DRRSTSGYCVFIGGNLISWKSK  789


 Score = 39.3 bits (90),  Expect(2) = 6e-08, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K +VV RSSA  E R+MAL TCEL+WL
Sbjct  789  KKQDVVARSSAEAEYRAMALATCELIWL  816



>emb|CAN61207.1| hypothetical protein VITISV_015446 [Vitis vinifera]
Length=900

 Score = 43.5 bits (101),  Expect(2) = 6e-08, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST GYC+F+G NLISWKS+
Sbjct  756  DRRSTSGYCVFIGGNLISWKSK  777


 Score = 39.3 bits (90),  Expect(2) = 6e-08, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K +VV RSSA  E R+MAL TCEL+WL
Sbjct  777  KKQDVVARSSAEAEYRAMALATCELIWL  804



>emb|CAN81715.1| hypothetical protein VITISV_032902 [Vitis vinifera]
Length=848

 Score = 43.5 bits (101),  Expect(2) = 6e-08, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST GYC+F+G NLISWKS+
Sbjct  704  DRRSTSGYCVFIGGNLISWKSK  725


 Score = 39.3 bits (90),  Expect(2) = 6e-08, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K +VV RSSA  E R+MAL TCEL+WL
Sbjct  725  KKQDVVARSSAEAEYRAMALATCELIWL  752



>emb|CAN73101.1| hypothetical protein VITISV_042890 [Vitis vinifera]
Length=772

 Score = 43.5 bits (101),  Expect(2) = 6e-08, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST GYC+F+G NLISWKS+
Sbjct  628  DRRSTSGYCVFIGGNLISWKSK  649


 Score = 39.3 bits (90),  Expect(2) = 6e-08, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K +VV RSSA  E R+MAL TCEL+WL
Sbjct  649  KKQDVVARSSAEAEYRAMALATCELIWL  676



>emb|CAN72132.1| hypothetical protein VITISV_040707 [Vitis vinifera]
Length=744

 Score = 43.5 bits (101),  Expect(2) = 6e-08, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST GYC+F+G NLISWKS+
Sbjct  600  DRRSTSGYCVFIGGNLISWKSK  621


 Score = 39.3 bits (90),  Expect(2) = 6e-08, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K +VV RSSA  E R+MAL TCEL+WL
Sbjct  621  KKQDVVARSSAEAEYRAMALATCELIWL  648



>emb|CAN76680.1| hypothetical protein VITISV_034326 [Vitis vinifera]
Length=716

 Score = 43.5 bits (101),  Expect(2) = 6e-08, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST GYC+F+G NLISWKS+
Sbjct  572  DRRSTSGYCVFIGGNLISWKSK  593


 Score = 39.3 bits (90),  Expect(2) = 6e-08, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K +VV RSSA  E R+MAL TCEL+WL
Sbjct  593  KKQDVVARSSAEAEYRAMALATCELIWL  620



>emb|CAN80771.1| hypothetical protein VITISV_027574 [Vitis vinifera]
Length=1193

 Score = 43.5 bits (101),  Expect(2) = 6e-08, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2     DRKSTFGYCIFLGDNLISWKSR  67
             DR+ST GYC+F+G NLISWKS+
Sbjct  1049  DRRSTSGYCVFIGGNLISWKSK  1070


 Score = 39.3 bits (90),  Expect(2) = 6e-08, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  58    EK*NVVTRSSA*TEDRSMALETCELVWL  141
             +K +VV RSSA  E R+MAL TCEL+WL
Sbjct  1070  KKQDVVARSSAEAEYRAMALATCELIWL  1097



>emb|CAN70825.1| hypothetical protein VITISV_039828 [Vitis vinifera]
Length=288

 Score = 43.5 bits (101),  Expect(2) = 6e-08, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST GYC+F+G NLISWKS+
Sbjct  199  DRRSTSGYCVFIGGNLISWKSK  220


 Score = 39.3 bits (90),  Expect(2) = 6e-08, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K +VV RSSA  E R+MAL TCEL+WL
Sbjct  220  KKQDVVARSSAEAEYRAMALATCELIWL  247



>emb|CAN60609.1| hypothetical protein VITISV_036599 [Vitis vinifera]
Length=1455

 Score = 43.5 bits (101),  Expect(2) = 6e-08, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2     DRKSTFGYCIFLGDNLISWKSR  67
             DR+ST GYC+F+G NLISWKS+
Sbjct  1332  DRRSTSGYCVFIGGNLISWKSK  1353


 Score = 39.3 bits (90),  Expect(2) = 6e-08, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  58    EK*NVVTRSSA*TEDRSMALETCELVWL  141
             +K +VV RSSA  E R+MAL TCEL+WL
Sbjct  1353  KKQDVVARSSAEAEYRAMALATCELIWL  1380



>emb|CAN81362.1| hypothetical protein VITISV_013815 [Vitis vinifera]
Length=1535

 Score = 43.5 bits (101),  Expect(2) = 6e-08, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST GYC+F+G NLISWKS+
Sbjct  377  DRRSTSGYCVFIGGNLISWKSK  398


 Score = 39.3 bits (90),  Expect(2) = 6e-08, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K +VV RSSA  E R+MAL TCEL+WL
Sbjct  398  KKQDVVARSSAEAEYRAMALATCELIWL  425



>emb|CAN73073.1| hypothetical protein VITISV_032385 [Vitis vinifera]
Length=285

 Score = 43.5 bits (101),  Expect(2) = 6e-08, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST GYC+F+G NLISWKS+
Sbjct  199  DRRSTSGYCVFIGGNLISWKSK  220


 Score = 39.3 bits (90),  Expect(2) = 6e-08, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K +VV RSSA  E R+MAL TCEL+WL
Sbjct  220  KKQDVVARSSAEAEYRAMALATCELIWL  247



>emb|CAN67925.1| hypothetical protein VITISV_021168 [Vitis vinifera]
Length=1354

 Score = 43.5 bits (101),  Expect(2) = 6e-08, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2     DRKSTFGYCIFLGDNLISWKSR  67
             DR+ST GYC+F+G NLISWKS+
Sbjct  1190  DRRSTSGYCVFIGGNLISWKSK  1211


 Score = 39.3 bits (90),  Expect(2) = 6e-08, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  58    EK*NVVTRSSA*TEDRSMALETCELVWL  141
             +K +VV RSSA  E R+MAL TCEL+WL
Sbjct  1211  KKQDVVXRSSAEAEYRAMALATCELIWL  1238



>emb|CAN61179.1| hypothetical protein VITISV_032292 [Vitis vinifera]
Length=1237

 Score = 43.5 bits (101),  Expect(2) = 7e-08, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2     DRKSTFGYCIFLGDNLISWKSR  67
             DR+ST GYC+F+G NLISWKS+
Sbjct  1093  DRRSTSGYCVFIGGNLISWKSK  1114


 Score = 38.9 bits (89),  Expect(2) = 7e-08, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  58    EK*NVVTRSSA*TEDRSMALETCELVWL  141
             +K +VV RSSA  E R+MAL TCEL+WL
Sbjct  1114  KKQDVVARSSAEAEYRAMALATCELIWL  1141



>emb|CAN82064.1| hypothetical protein VITISV_022772 [Vitis vinifera]
Length=1224

 Score = 43.5 bits (101),  Expect(2) = 7e-08, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2     DRKSTFGYCIFLGDNLISWKSR  67
             DR+ST GYC+F+G NLISWKS+
Sbjct  1080  DRRSTSGYCVFIGGNLISWKSK  1101


 Score = 38.9 bits (89),  Expect(2) = 7e-08, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  58    EK*NVVTRSSA*TEDRSMALETCELVWL  141
             +K +VV RSSA  E R+MAL TCEL+WL
Sbjct  1101  KKQDVVARSSAEAEYRAMALATCELIWL  1128



>emb|CAN65230.1| hypothetical protein VITISV_034221 [Vitis vinifera]
Length=482

 Score = 43.1 bits (100),  Expect(2) = 8e-08, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST GYC+F+G NLISWKS+
Sbjct  338  DRRSTSGYCVFIGGNLISWKSK  359


 Score = 39.3 bits (90),  Expect(2) = 8e-08, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K +VV RSSA  E R+MAL TCEL+WL
Sbjct  359  KKQDVVARSSAEAEYRAMALATCELIWL  386



>emb|CAN70968.1| hypothetical protein VITISV_033354 [Vitis vinifera]
Length=295

 Score = 43.5 bits (101),  Expect(2) = 8e-08, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST GYC+F+G NLISWKS+
Sbjct  199  DRRSTSGYCVFIGGNLISWKSK  220


 Score = 39.3 bits (90),  Expect(2) = 8e-08, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K +VV RSSA  E R+MAL TCEL+WL
Sbjct  220  KKQDVVARSSAEAEYRAMALATCELIWL  247



>emb|CAN79136.1| hypothetical protein VITISV_034813 [Vitis vinifera]
Length=278

 Score = 43.5 bits (101),  Expect(2) = 8e-08, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST GYC+F+G NLISWKS+
Sbjct  199  DRRSTSGYCVFIGGNLISWKSK  220


 Score = 38.9 bits (89),  Expect(2) = 8e-08, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K +VV RSSA  E R+MAL TCEL+WL
Sbjct  220  KKQDVVARSSAEAEYRAMALATCELIWL  247



>emb|CAN75744.1| hypothetical protein VITISV_040125 [Vitis vinifera]
Length=1257

 Score = 43.5 bits (101),  Expect(2) = 8e-08, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2     DRKSTFGYCIFLGDNLISWKSR  67
             DR+ST GYC+F+G NLISWKS+
Sbjct  1113  DRRSTSGYCVFIGGNLISWKSK  1134


 Score = 38.9 bits (89),  Expect(2) = 8e-08, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  58    EK*NVVTRSSA*TEDRSMALETCELVWL  141
             +K +VV RSSA  E R+MAL TCEL+WL
Sbjct  1134  KKQDVVARSSAEAEYRAMALATCELIWL  1161



>emb|CAN67338.1| hypothetical protein VITISV_016115 [Vitis vinifera]
Length=949

 Score = 43.1 bits (100),  Expect(2) = 8e-08, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST GYC+F+G NLISWKS+
Sbjct  805  DRRSTSGYCVFIGGNLISWKSK  826


 Score = 39.3 bits (90),  Expect(2) = 8e-08, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K +VV RSSA  E R+MAL TCEL+WL
Sbjct  826  KKQDVVARSSAEVEYRAMALATCELIWL  853



>emb|CAN69178.1| hypothetical protein VITISV_024410 [Vitis vinifera]
Length=259

 Score = 43.1 bits (100),  Expect(2) = 9e-08, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST GYC+F+G NLISWKS+
Sbjct  199  DRRSTSGYCVFIGGNLISWKSK  220


 Score = 39.3 bits (90),  Expect(2) = 9e-08, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K +VV RSSA  E R+MAL TCEL+WL
Sbjct  220  KKQDVVARSSAEAEYRAMALATCELIWL  247



>emb|CAN77643.1| hypothetical protein VITISV_007625 [Vitis vinifera]
Length=383

 Score = 43.1 bits (100),  Expect(2) = 9e-08, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST GYC+F+G NLISWKS+
Sbjct  239  DRRSTSGYCVFIGGNLISWKSK  260


 Score = 39.3 bits (90),  Expect(2) = 9e-08, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K +VV RSSA  E R+MAL TCEL+WL
Sbjct  260  KKQDVVARSSAEAEYRAMALATCELIWL  287



>emb|CAN72018.1| hypothetical protein VITISV_001841 [Vitis vinifera]
Length=1225

 Score = 43.1 bits (100),  Expect(2) = 9e-08, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2     DRKSTFGYCIFLGDNLISWKSR  67
             DR+ST GYC+F+G NLISWKS+
Sbjct  1081  DRRSTSGYCVFIGGNLISWKSK  1102


 Score = 38.9 bits (89),  Expect(2) = 9e-08, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  58    EK*NVVTRSSA*TEDRSMALETCELVWL  141
             +K +VV RSSA  E R+MAL TCEL+WL
Sbjct  1102  KKQDVVARSSAEAEYRAMALATCELIWL  1129



>emb|CAN67493.1| hypothetical protein VITISV_022776 [Vitis vinifera]
Length=274

 Score = 43.1 bits (100),  Expect(2) = 9e-08, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST GYC+F+G NLISWKS+
Sbjct  199  DRRSTSGYCVFIGGNLISWKSK  220


 Score = 39.3 bits (90),  Expect(2) = 9e-08, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K +VV RSSA  E R+MAL TCEL+WL
Sbjct  220  KKQDVVARSSAEAEYRAMALATCELIWL  247



>emb|CAN73074.1| hypothetical protein VITISV_032386 [Vitis vinifera]
Length=1195

 Score = 43.1 bits (100),  Expect(2) = 1e-07, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2     DRKSTFGYCIFLGDNLISWKSR  67
             DR+ST GYC+F+G NLISWKS+
Sbjct  1051  DRRSTSGYCVFIGGNLISWKSK  1072


 Score = 38.9 bits (89),  Expect(2) = 1e-07, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  58    EK*NVVTRSSA*TEDRSMALETCELVWL  141
             +K +VV RSSA  E R+MAL TCEL+WL
Sbjct  1072  KKQDVVARSSAEAEYRAMALATCELIWL  1099



>emb|CAN75571.1| hypothetical protein VITISV_009506 [Vitis vinifera]
Length=308

 Score = 43.1 bits (100),  Expect(2) = 1e-07, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST GYC+F+G NLISWKS+
Sbjct  199  DRRSTSGYCVFIGGNLISWKSK  220


 Score = 38.9 bits (89),  Expect(2) = 1e-07, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K +VV RSSA  E R+MAL TCEL+WL
Sbjct  220  KKQDVVARSSAEAEYRAMALATCELIWL  247



>emb|CAN72440.1| hypothetical protein VITISV_039162 [Vitis vinifera]
Length=1253

 Score = 42.7 bits (99),  Expect(2) = 1e-07, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2     DRKSTFGYCIFLGDNLISWKSR  67
             DR+ST GYC+F+G NLISWKS+
Sbjct  1109  DRRSTSGYCVFIGGNLISWKSK  1130


 Score = 39.3 bits (90),  Expect(2) = 1e-07, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  58    EK*NVVTRSSA*TEDRSMALETCELVWL  141
             +K +VV RSSA  E R+MAL TCEL+WL
Sbjct  1130  KKQDVVARSSAEAEYRAMALATCELIWL  1157



>emb|CAN74064.1| hypothetical protein VITISV_028146 [Vitis vinifera]
Length=1203

 Score = 43.5 bits (101),  Expect(2) = 1e-07, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2     DRKSTFGYCIFLGDNLISWKSR  67
             DR+ST GYC+F+G NLISWKS+
Sbjct  1059  DRRSTSGYCVFIGGNLISWKSK  1080


 Score = 38.9 bits (89),  Expect(2) = 1e-07, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +1

Query  58    EK*NVVTRSSA*TEDRSMALETCELVWL  141
             +K +VV RSSA  E R MAL TCEL+WL
Sbjct  1080  KKQDVVARSSAEAEYRXMALATCELIWL  1107



>emb|CAN75856.1| hypothetical protein VITISV_005690 [Vitis vinifera]
Length=268

 Score = 43.1 bits (100),  Expect(2) = 1e-07, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST GYC+F+G NLISWKS+
Sbjct  199  DRRSTSGYCVFIGGNLISWKSK  220


 Score = 39.3 bits (90),  Expect(2) = 1e-07, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K +VV RSSA  E R+MAL TCEL+WL
Sbjct  220  KKQDVVARSSAEAEYRAMALATCELIWL  247



>emb|CAN67317.1| hypothetical protein VITISV_019719 [Vitis vinifera]
Length=1240

 Score = 43.1 bits (100),  Expect(2) = 1e-07, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2     DRKSTFGYCIFLGDNLISWKSR  67
             DR+ST GYC+F+G NLISWKS+
Sbjct  1096  DRRSTSGYCVFIGGNLISWKSK  1117


 Score = 38.9 bits (89),  Expect(2) = 1e-07, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  58    EK*NVVTRSSA*TEDRSMALETCELVWL  141
             +K +VV RSSA  E R+MAL TCEL+WL
Sbjct  1117  KKQDVVARSSAEAEYRAMALATCELIWL  1144



>emb|CAN63730.1| hypothetical protein VITISV_030286 [Vitis vinifera]
Length=1205

 Score = 43.1 bits (100),  Expect(2) = 1e-07, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2     DRKSTFGYCIFLGDNLISWKSR  67
             DR+ST GYC+F+G NLISWKS+
Sbjct  1061  DRRSTSGYCVFIGGNLISWKSK  1082


 Score = 38.5 bits (88),  Expect(2) = 1e-07, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  58    EK*NVVTRSSA*TEDRSMALETCELVWL  141
             +K +VV RSSA  E R+MAL TCEL+WL
Sbjct  1082  KKQDVVARSSAEAEYRAMALATCELIWL  1109



>emb|CAN62074.1| hypothetical protein VITISV_001619 [Vitis vinifera]
Length=1237

 Score = 43.1 bits (100),  Expect(2) = 1e-07, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2     DRKSTFGYCIFLGDNLISWKSR  67
             DR+ST GYC+F+G NLISWKS+
Sbjct  1093  DRRSTSGYCVFIGGNLISWKSK  1114


 Score = 38.9 bits (89),  Expect(2) = 1e-07, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  58    EK*NVVTRSSA*TEDRSMALETCELVWL  141
             +K +VV RSSA  E R+MAL TCEL+WL
Sbjct  1114  KKQDVVARSSAEAEYRAMALATCELIWL  1141



>emb|CAN74310.1| hypothetical protein VITISV_037517 [Vitis vinifera]
Length=1266

 Score = 43.1 bits (100),  Expect(2) = 1e-07, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2     DRKSTFGYCIFLGDNLISWKSR  67
             DR+ST GYC+F+G NLISWKS+
Sbjct  1122  DRRSTSGYCVFIGGNLISWKSK  1143


 Score = 38.9 bits (89),  Expect(2) = 1e-07, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  58    EK*NVVTRSSA*TEDRSMALETCELVWL  141
             +K +VV RSSA  E R+MAL TCEL+WL
Sbjct  1143  KKQDVVARSSAEAEYRAMALATCELIWL  1170



>emb|CAN77210.1| hypothetical protein VITISV_000141 [Vitis vinifera]
Length=1236

 Score = 42.4 bits (98),  Expect(2) = 1e-07, Method: Composition-based stats.
 Identities = 15/22 (68%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2     DRKSTFGYCIFLGDNLISWKSR  67
             D++ST GYC+F+G NLISWKS+
Sbjct  1092  DKRSTSGYCVFIGGNLISWKSK  1113


 Score = 39.3 bits (90),  Expect(2) = 1e-07, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  58    EK*NVVTRSSA*TEDRSMALETCELVWL  141
             +K +VV RSSA  E R+MAL TCEL+WL
Sbjct  1113  KKQDVVARSSAKAEYRAMALATCELIWL  1140



>emb|CAN75900.1| hypothetical protein VITISV_033582 [Vitis vinifera]
Length=1041

 Score = 42.4 bits (98),  Expect(2) = 1e-07, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR ST GYC+F+G NLISWKS+
Sbjct  897  DRXSTSGYCVFIGGNLISWKSK  918


 Score = 39.3 bits (90),  Expect(2) = 1e-07, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K +VV RSSA  E R+MAL TCEL+WL
Sbjct  918  KKQDVVARSSAEXEYRAMALATCELIWL  945



>emb|CAN83455.1| hypothetical protein VITISV_029958 [Vitis vinifera]
Length=459

 Score = 43.5 bits (101),  Expect(2) = 2e-07, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST GYC+F+G NLISWKS+
Sbjct  315  DRRSTSGYCVFIGGNLISWKSK  336


 Score = 38.1 bits (87),  Expect(2) = 2e-07, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K +VV RSSA  E R+MAL TCEL+WL
Sbjct  336  KKQDVVARSSAEAEYRAMALATCELIWL  363



>emb|CAN70259.1| hypothetical protein VITISV_002222 [Vitis vinifera]
Length=274

 Score = 42.4 bits (98),  Expect(2) = 2e-07, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST GYC+F+G NLISWKS+
Sbjct  199  DRRSTSGYCVFIGGNLISWKSK  220


 Score = 39.3 bits (90),  Expect(2) = 2e-07, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K +VV RSSA  E R+MAL TCEL+WL
Sbjct  220  KKQDVVARSSAEAEYRAMALATCELIWL  247



>emb|CAN60837.1| hypothetical protein VITISV_033823 [Vitis vinifera]
Length=1155

 Score = 44.7 bits (104),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = +2

Query  2     DRKSTFGYCIFLGDNLISWKSR  67
             DR+ST GYC+F+GDNLISWKS+
Sbjct  1018  DRRSTSGYCVFIGDNLISWKSK  1039


 Score = 37.0 bits (84),  Expect(2) = 2e-07, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +1

Query  58    EK*NVVTRSSA*TEDRSMALETCELVWL  141
             +K +VV RSS  TE R+MAL TCEL WL
Sbjct  1039  KKQHVVARSSTETEYRAMALATCELKWL  1066



>emb|CAN63530.1| hypothetical protein VITISV_038849 [Vitis vinifera]
Length=938

 Score = 42.4 bits (98),  Expect(2) = 2e-07, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR ST GYC+F+G NLISWKS+
Sbjct  794  DRHSTSGYCVFIGGNLISWKSK  815


 Score = 38.9 bits (89),  Expect(2) = 2e-07, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K +VV RSSA  E R+MAL TCEL+WL
Sbjct  815  KKQDVVARSSAEVEYRAMALATCELIWL  842



>emb|CAN81288.1| hypothetical protein VITISV_036901 [Vitis vinifera]
Length=520

 Score = 43.1 bits (100),  Expect(2) = 2e-07, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST GYC+F+G NLISWKS+
Sbjct  460  DRRSTSGYCVFIGGNLISWKSK  481


 Score = 38.5 bits (88),  Expect(2) = 2e-07, Method: Composition-based stats.
 Identities = 19/28 (68%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K +VV RSSA TE R+MAL TCEL+WL
Sbjct  481  KKQDVVARSSAETEYRAMALATCELIWL  508



>emb|CAN84135.1| hypothetical protein VITISV_000113 [Vitis vinifera]
Length=1323

 Score = 43.5 bits (101),  Expect(2) = 2e-07, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2     DRKSTFGYCIFLGDNLISWKSR  67
             DR+ST GYC+F+G NLISWKS+
Sbjct  1179  DRRSTSGYCVFIGGNLISWKSK  1200


 Score = 37.7 bits (86),  Expect(2) = 2e-07, Method: Composition-based stats.
 Identities = 17/28 (61%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +1

Query  58    EK*NVVTRSSA*TEDRSMALETCELVWL  141
             +K +VV RSS   E R+MAL TCEL+WL
Sbjct  1200  KKQDVVVRSSVEAEYRAMALATCELIWL  1227



>emb|CAN79672.1| hypothetical protein VITISV_012210 [Vitis vinifera]
Length=1211

 Score = 43.5 bits (101),  Expect(2) = 2e-07, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2     DRKSTFGYCIFLGDNLISWKSR  67
             DR+ST GYC+F+G NLISWKS+
Sbjct  1067  DRRSTSGYCVFIGGNLISWKSK  1088


 Score = 37.7 bits (86),  Expect(2) = 2e-07, Method: Composition-based stats.
 Identities = 17/28 (61%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  58    EK*NVVTRSSA*TEDRSMALETCELVWL  141
             +K +VV RSSA  + R+MAL TCEL+WL
Sbjct  1088  KKQDVVARSSAEAKYRAMALTTCELIWL  1115



>emb|CAN80088.1| hypothetical protein VITISV_021656 [Vitis vinifera]
Length=1099

 Score = 43.1 bits (100),  Expect(2) = 2e-07, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2     DRKSTFGYCIFLGDNLISWKSR  67
             DR+ST GYC+F+G NLISWKS+
Sbjct  980   DRRSTSGYCVFIGGNLISWKSK  1001


 Score = 38.1 bits (87),  Expect(2) = 2e-07, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +1

Query  58    EK*NVVTRSSA*TEDRSMALETCELVWL  141
             +K +VV RSSA  E R MAL TCEL+WL
Sbjct  1001  KKQDVVVRSSAEAEYRVMALATCELIWL  1028



>emb|CAN76965.1| hypothetical protein VITISV_043961 [Vitis vinifera]
Length=1136

 Score = 42.7 bits (99),  Expect(2) = 2e-07, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2     DRKSTFGYCIFLGDNLISWKSR  67
             DR+ST GYC+F+G NLISWKS+
Sbjct  992   DRRSTSGYCVFIGGNLISWKSK  1013


 Score = 38.5 bits (88),  Expect(2) = 2e-07, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  58    EK*NVVTRSSA*TEDRSMALETCELVWL  141
             +K +VV RSSA  E R+MAL TCEL+WL
Sbjct  1013  KKQDVVARSSAEAEYRAMALATCELIWL  1040



>emb|CAN77222.1| hypothetical protein VITISV_010482 [Vitis vinifera]
Length=343

 Score = 43.5 bits (101),  Expect(2) = 2e-07, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST GYC+F+G NLISWKS+
Sbjct  199  DRRSTSGYCVFIGGNLISWKSK  220


 Score = 37.7 bits (86),  Expect(2) = 2e-07, Method: Composition-based stats.
 Identities = 17/28 (61%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K +VV RSS   E R+MAL TCEL+WL
Sbjct  220  KKQDVVARSSVEAEYRAMALATCELIWL  247



>emb|CAN75922.1| hypothetical protein VITISV_030752 [Vitis vinifera]
Length=1214

 Score = 43.5 bits (101),  Expect(2) = 2e-07, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2     DRKSTFGYCIFLGDNLISWKSR  67
             DR+ST GYC+F+G NLISWKS+
Sbjct  1083  DRRSTSGYCVFIGGNLISWKSK  1104


 Score = 37.4 bits (85),  Expect(2) = 2e-07, Method: Composition-based stats.
 Identities = 17/28 (61%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +1

Query  58    EK*NVVTRSSA*TEDRSMALETCELVWL  141
             +K +VV RSSA  E R+M L TCEL+WL
Sbjct  1104  KKQDVVARSSAEAEYRAMTLATCELIWL  1131



>emb|CAN66243.1| hypothetical protein VITISV_015916 [Vitis vinifera]
Length=1258

 Score = 43.5 bits (101),  Expect(2) = 2e-07, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2     DRKSTFGYCIFLGDNLISWKSR  67
             DR+ST GYC+F+G NLISWKS+
Sbjct  1114  DRRSTSGYCVFIGGNLISWKSK  1135


 Score = 37.4 bits (85),  Expect(2) = 2e-07, Method: Composition-based stats.
 Identities = 17/28 (61%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +1

Query  58    EK*NVVTRSSA*TEDRSMALETCELVWL  141
             +K +VV RSSA  E R+M L TCEL+WL
Sbjct  1135  KKQDVVARSSAEAEYRAMTLATCELIWL  1162



>emb|CAN83335.1| hypothetical protein VITISV_043861 [Vitis vinifera]
Length=603

 Score = 43.5 bits (101),  Expect(2) = 2e-07, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST GYC+F+G NLISWKS+
Sbjct  459  DRRSTSGYCVFIGGNLISWKSK  480


 Score = 37.4 bits (85),  Expect(2) = 2e-07, Method: Composition-based stats.
 Identities = 17/28 (61%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K +VV RSSA  E R+M L TCEL+WL
Sbjct  480  KKQDVVARSSAEAEYRAMXLATCELIWL  507



>emb|CAN73234.1| hypothetical protein VITISV_033857 [Vitis vinifera]
Length=1402

 Score = 43.9 bits (102),  Expect(2) = 2e-07, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2     DRKSTFGYCIFLGDNLISWKSR  67
             DR+ST GYC+F+G NLISWKS+
Sbjct  1258  DRRSTXGYCVFIGGNLISWKSK  1279


 Score = 36.6 bits (83),  Expect(2) = 2e-07, Method: Composition-based stats.
 Identities = 17/28 (61%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +1

Query  58    EK*NVVTRSSA*TEDRSMALETCELVWL  141
             +K +VV RSSA    R+MAL TCEL+WL
Sbjct  1279  KKQDVVARSSAEXXYRAMALATCELIWL  1306



>emb|CAN59895.1| hypothetical protein VITISV_002882 [Vitis vinifera]
Length=267

 Score = 43.1 bits (100),  Expect(2) = 3e-07, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST GYC+F+G NLISWKS+
Sbjct  199  DRRSTSGYCVFIGGNLISWKSK  220


 Score = 37.7 bits (86),  Expect(2) = 3e-07, Method: Composition-based stats.
 Identities = 17/28 (61%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K +VV RSSA  E R+M L TCEL+WL
Sbjct  220  KKQDVVARSSAEAEYRAMTLATCELIWL  247



>emb|CAN70756.1| hypothetical protein VITISV_014702 [Vitis vinifera]
Length=1212

 Score = 41.2 bits (95),  Expect(2) = 3e-07, Method: Composition-based stats.
 Identities = 15/21 (71%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = +2

Query  5     RKSTFGYCIFLGDNLISWKSR  67
             R+ST GYC+F+G NLISWKS+
Sbjct  1069  RRSTSGYCVFIGGNLISWKSK  1089


 Score = 39.3 bits (90),  Expect(2) = 3e-07, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  58    EK*NVVTRSSA*TEDRSMALETCELVWL  141
             +K +VV RSSA  E R+MAL TCEL+WL
Sbjct  1089  KKQDVVARSSAEAEYRAMALATCELIWL  1116



>emb|CAN77046.1| hypothetical protein VITISV_035257 [Vitis vinifera]
Length=1478

 Score = 43.5 bits (101),  Expect(2) = 3e-07, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2     DRKSTFGYCIFLGDNLISWKSR  67
             DR+ST GYC+F+G NLISWKS+
Sbjct  1334  DRRSTSGYCVFIGGNLISWKSK  1355


 Score = 37.0 bits (84),  Expect(2) = 3e-07, Method: Composition-based stats.
 Identities = 17/28 (61%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +1

Query  58    EK*NVVTRSSA*TEDRSMALETCELVWL  141
             +K +VV RSSA  E R+MAL TC L+WL
Sbjct  1355  KKQDVVARSSAEAEYRAMALATCXLIWL  1382



>emb|CAN80753.1| hypothetical protein VITISV_003323 [Vitis vinifera]
Length=1304

 Score = 41.2 bits (95),  Expect(2) = 3e-07, Method: Composition-based stats.
 Identities = 15/22 (68%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +2

Query  2     DRKSTFGYCIFLGDNLISWKSR  67
             DR+ T GYC+F+G NLISWKS+
Sbjct  1176  DRRFTSGYCVFIGGNLISWKSK  1197


 Score = 39.3 bits (90),  Expect(2) = 3e-07, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  58    EK*NVVTRSSA*TEDRSMALETCELVWL  141
             +K +VV RSSA  E R+MAL TCEL+WL
Sbjct  1197  KKQDVVARSSAEAEYRAMALATCELIWL  1224



>emb|CAN63874.1| hypothetical protein VITISV_038274 [Vitis vinifera]
Length=583

 Score = 43.5 bits (101),  Expect(2) = 3e-07, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST GYC+F+G NLISWKS+
Sbjct  439  DRRSTSGYCVFIGGNLISWKSK  460


 Score = 36.6 bits (83),  Expect(2) = 3e-07, Method: Composition-based stats.
 Identities = 17/28 (61%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K +VV RS A  E R+MAL TCEL+WL
Sbjct  460  KKQDVVARSIAEAEYRAMALATCELIWL  487



>emb|CAN81771.1| hypothetical protein VITISV_012076 [Vitis vinifera]
Length=276

 Score = 41.2 bits (95),  Expect(2) = 3e-07, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR ST GYC+F+G NLISWKS+
Sbjct  199  DRCSTSGYCVFIGGNLISWKSK  220


 Score = 39.3 bits (90),  Expect(2) = 3e-07, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K +VV RSSA  E R+MAL TCEL+WL
Sbjct  220  KKQDVVARSSAEAEYRAMALATCELIWL  247



>emb|CAN81916.1| hypothetical protein VITISV_038548 [Vitis vinifera]
Length=1202

 Score = 40.4 bits (93),  Expect(2) = 4e-07, Method: Composition-based stats.
 Identities = 15/22 (68%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +2

Query  2     DRKSTFGYCIFLGDNLISWKSR  67
             DR+ T GYC+F+G NLISWKS+
Sbjct  1058  DRRFTSGYCVFIGGNLISWKSK  1079


 Score = 39.3 bits (90),  Expect(2) = 4e-07, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  58    EK*NVVTRSSA*TEDRSMALETCELVWL  141
             +K +VVTRSSA  E R+M L TCEL+WL
Sbjct  1079  KKQDVVTRSSAEAEYRAMCLATCELIWL  1106



>emb|CAN74964.1| hypothetical protein VITISV_006810 [Vitis vinifera]
Length=1248

 Score = 41.2 bits (95),  Expect(2) = 5e-07, Method: Composition-based stats.
 Identities = 14/22 (64%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2     DRKSTFGYCIFLGDNLISWKSR  67
             DR+ST G+C+F+G NL+SWKS+
Sbjct  1104  DRRSTTGFCVFVGGNLVSWKSK  1125


 Score = 38.5 bits (88),  Expect(2) = 5e-07, Method: Composition-based stats.
 Identities = 17/28 (61%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +1

Query  58    EK*NVVTRSSA*TEDRSMALETCELVWL  141
             +K NVV+RSSA +E+R+MA  TCE++WL
Sbjct  1125  KKQNVVSRSSAESENRAMAQATCEIMWL  1152



>emb|CAN66185.1| hypothetical protein VITISV_025185 [Vitis vinifera]
Length=676

 Score = 43.5 bits (101),  Expect(2) = 5e-07, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST GYC+F+G NLISWKS+
Sbjct  532  DRRSTSGYCVFIGGNLISWKSK  553


 Score = 36.2 bits (82),  Expect(2) = 5e-07, Method: Composition-based stats.
 Identities = 17/28 (61%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K +VV RSSA  E R+M L TCEL+WL
Sbjct  553  KKQDVVARSSAEAEYRAMTLATCELIWL  580



>emb|CAN64673.1| hypothetical protein VITISV_007430 [Vitis vinifera]
Length=1079

 Score = 43.5 bits (101),  Expect(2) = 5e-07, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST GYC+F+G NLISWKS+
Sbjct  935  DRRSTSGYCVFIGGNLISWKSK  956


 Score = 36.2 bits (82),  Expect(2) = 5e-07, Method: Composition-based stats.
 Identities = 17/28 (61%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K +VV RSSA  E  +MAL TCEL+WL
Sbjct  956  KKQDVVARSSAEAEYLAMALATCELIWL  983



>ref|XP_009780762.1| PREDICTED: uncharacterized protein LOC104229761 [Nicotiana sylvestris]
Length=535

 Score = 40.4 bits (93),  Expect(2) = 5e-07, Method: Composition-based stats.
 Identities = 14/22 (64%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST GYC+ +G NL+SWKS+
Sbjct  442  DRRSTSGYCVLVGGNLVSWKSK  463


 Score = 39.3 bits (90),  Expect(2) = 5e-07, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K NVV RSSA  E R+MA+ TCELVW+
Sbjct  463  KKQNVVARSSAEAEYRAMAMATCELVWV  490



>emb|CAN80924.1| hypothetical protein VITISV_003442 [Vitis vinifera]
Length=266

 Score = 43.5 bits (101),  Expect(2) = 5e-07, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST GYC+F+G NLISWKS+
Sbjct  122  DRRSTSGYCVFIGGNLISWKSK  143


 Score = 36.2 bits (82),  Expect(2) = 5e-07, Method: Composition-based stats.
 Identities = 17/28 (61%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K +VV RSSA  E R M L TCEL+WL
Sbjct  143  KKQDVVARSSAEAEYRVMTLATCELIWL  170



>emb|CAN63185.1| hypothetical protein VITISV_000411 [Vitis vinifera]
Length=577

 Score = 41.2 bits (95),  Expect(2) = 5e-07, Method: Composition-based stats.
 Identities = 15/22 (68%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            +R+ST GYC+F+G NLISWKS+
Sbjct  427  NRRSTSGYCVFIGGNLISWKSK  448


 Score = 38.5 bits (88),  Expect(2) = 5e-07, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K +VV RSSA  E R+MAL TCEL+WL
Sbjct  448  KKQDVVVRSSAEAEYRAMALATCELIWL  475



>gb|AFN88207.1| integrase core domain containing protein [Phaseolus vulgaris]
Length=1387

 Score = 43.1 bits (100),  Expect(2) = 6e-07, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2     DRKSTFGYCIFLGDNLISWKSR  67
             DR+ST GYC+ +GDNLISWKS+
Sbjct  1243  DRRSTSGYCVSIGDNLISWKSK  1264


 Score = 36.6 bits (83),  Expect(2) = 6e-07, Method: Composition-based stats.
 Identities = 17/28 (61%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +1

Query  58    EK*NVVTRSSA*TEDRSMALETCELVWL  141
             +K +VV RSSA  E R+MA  TCEL+WL
Sbjct  1264  KKQSVVARSSAEAEYRAMASATCELIWL  1291



>emb|CAN69307.1| hypothetical protein VITISV_001120 [Vitis vinifera]
Length=1215

 Score = 40.4 bits (93),  Expect(2) = 6e-07, Method: Composition-based stats.
 Identities = 15/22 (68%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +2

Query  2     DRKSTFGYCIFLGDNLISWKSR  67
             DR+ST G C+F+G NLISWKS+
Sbjct  1071  DRRSTSGXCVFIGGNLISWKSK  1092


 Score = 38.9 bits (89),  Expect(2) = 6e-07, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  58    EK*NVVTRSSA*TEDRSMALETCELVWL  141
             +K +VV RSSA  E R+MAL TCEL+WL
Sbjct  1092  KKQDVVXRSSAEAEYRAMALATCELIWL  1119



>emb|CAN59884.1| hypothetical protein VITISV_026166 [Vitis vinifera]
Length=6311

 Score = 43.5 bits (101),  Expect(2) = 7e-07, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2     DRKSTFGYCIFLGDNLISWKSR  67
             DR+ST GYC+F+G NLISWKS+
Sbjct  1858  DRRSTSGYCVFIGGNLISWKSK  1879


 Score = 35.8 bits (81),  Expect(2) = 7e-07, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +1

Query  61    K*NVVTRSSA*TEDRSMALETCELVWL  141
             K +VV RS+A  E R+MAL TCEL+WL
Sbjct  1880  KQDVVARSNAEAEYRAMALATCELIWL  1906



>emb|CAN80367.1| hypothetical protein VITISV_014719 [Vitis vinifera]
Length=1573

 Score = 40.0 bits (92),  Expect(2) = 8e-07, Method: Composition-based stats.
 Identities = 19/28 (68%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  58    EK*NVVTRSSA*TEDRSMALETCELVWL  141
             +K +VV RSSA  E R MALETCEL+WL
Sbjct  1151  KKQDVVVRSSAEAEYRVMALETCELIWL  1178


 Score = 38.9 bits (89),  Expect(2) = 8e-07, Method: Composition-based stats.
 Identities = 14/20 (70%), Positives = 18/20 (90%), Gaps = 0/20 (0%)
 Frame = +2

Query  8     KSTFGYCIFLGDNLISWKSR  67
             +ST GYC+F+G NLISWKS+
Sbjct  1132  RSTSGYCVFIGGNLISWKSK  1151



>emb|CAN62266.1| hypothetical protein VITISV_025647 [Vitis vinifera]
Length=1254

 Score = 41.6 bits (96),  Expect(2) = 8e-07, Method: Composition-based stats.
 Identities = 15/22 (68%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2     DRKSTFGYCIFLGDNLISWKSR  67
             D++ST GYC+F+G NLISWKS+
Sbjct  1147  DKRSTSGYCVFIGGNLISWKSK  1168


 Score = 37.4 bits (85),  Expect(2) = 8e-07, Method: Composition-based stats.
 Identities = 17/27 (63%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +1

Query  58    EK*NVVTRSSA*TEDRSMALETCELVW  138
             +K +VV RSSA  E R+MAL TCEL+W
Sbjct  1168  KKQDVVARSSAEAEYRAMALATCELIW  1194



>emb|CAN81716.1| hypothetical protein VITISV_032903 [Vitis vinifera]
Length=1170

 Score = 39.7 bits (91),  Expect(2) = 9e-07, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = +2

Query  2     DRKSTFGYCIFLGDNLISWKSR  67
             DR ST  YCIF+G NLISWKS+
Sbjct  1026  DRHSTSRYCIFIGGNLISWKSK  1047


 Score = 39.3 bits (90),  Expect(2) = 9e-07, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  58    EK*NVVTRSSA*TEDRSMALETCELVWL  141
             +K +VV RSSA  E R+MAL TCEL+WL
Sbjct  1047  KKQDVVARSSAEAEYRAMALATCELIWL  1074



>gb|ABI34329.1| Integrase core domain containing protein [Solanum demissum]
Length=1775

 Score = 40.4 bits (93),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 14/22 (64%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +2

Query  2     DRKSTFGYCIFLGDNLISWKSR  67
             DR+ST GYC+ +G NL+SWKS+
Sbjct  1242  DRRSTSGYCVLVGGNLVSWKSK  1263


 Score = 38.1 bits (87),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  58    EK*NVVTRSSA*TEDRSMALETCELVWL  141
             +K NVV RSSA +E R+MA  TCELVW+
Sbjct  1263  KKQNVVARSSAESEYRAMATATCELVWI  1290



>emb|CBI37123.3| unnamed protein product [Vitis vinifera]
Length=2295

 Score = 43.5 bits (101),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2     DRKSTFGYCIFLGDNLISWKSR  67
             DR+ST GYC+F+G NLISWKS+
Sbjct  1466  DRRSTSGYCVFIGGNLISWKSK  1487


 Score = 35.0 bits (79),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  58    EK*NVVTRSSA*TEDRSMALETCELVWL  141
             +K +VV RSSA  E R+MAL TCEL+WL
Sbjct  1487  KKQDVVARSSAEAEYRAMALATCELIWL  1514



>emb|CAN77834.1| hypothetical protein VITISV_024733 [Vitis vinifera]
Length=1300

 Score = 41.6 bits (96),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 16/21 (76%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = +2

Query  2     DRKSTFGYCIFLGDNLISWKS  64
             DR+ST GYC+F+G NLISWKS
Sbjct  1156  DRRSTSGYCVFIGGNLISWKS  1176


 Score = 37.0 bits (84),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 18/27 (67%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = +1

Query  61    K*NVVTRSSA*TEDRSMALETCELVWL  141
             K +VVTRSSA  E R M L TCEL+WL
Sbjct  1178  KQDVVTRSSAEAEYRVMTLATCELIWL  1204



>gb|KHN44882.1| Putative mitochondrial protein, partial [Glycine soja]
Length=283

 Score = 43.5 bits (101),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST GYC+F+G NLISWKS+
Sbjct  182  DRRSTSGYCVFIGGNLISWKSK  203


 Score = 35.0 bits (79),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 17/28 (61%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K  VV RSSA  E RSMA+ TCEL+W+
Sbjct  203  KKQTVVARSSAEAEYRSMAMVTCELMWI  230



>emb|CAN60274.1| hypothetical protein VITISV_024841 [Vitis vinifera]
Length=1573

 Score = 43.5 bits (101),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST GYC+F+G NLISWKS+
Sbjct  960  DRRSTSGYCVFIGGNLISWKSK  981


 Score = 34.7 bits (78),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +1

Query  58    EK*NVVTRSSA*TEDRSMALETCELVWL  141
             +K  VV RSSA  E ++MAL TCEL+WL
Sbjct  981   KKQYVVARSSAEAEYQAMALATCELIWL  1008



>emb|CAN76432.1| hypothetical protein VITISV_033849 [Vitis vinifera]
Length=1126

 Score = 39.3 bits (90),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  58    EK*NVVTRSSA*TEDRSMALETCELVWL  141
             +K +VV RSSA  E R+MAL TCEL+WL
Sbjct  1014  KKQDVVARSSAEAEYRAMALATCELIWL  1041


 Score = 38.9 bits (89),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 14/22 (64%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +2

Query  2     DRKSTFGYCIFLGDNLISWKSR  67
             +R+ST GYC+F+GDN ISW S+
Sbjct  993   NRRSTSGYCVFIGDNQISWMSK  1014



>emb|CAN65160.1| hypothetical protein VITISV_021747 [Vitis vinifera]
Length=2411

 Score = 41.2 bits (95),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 15/22 (68%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = +2

Query  2     DRKSTFGYCIFLGDNLISWKSR  67
             DR ST GYC+F+G N ISWKS+
Sbjct  2350  DRCSTSGYCVFIGGNJISWKSK  2371


 Score = 37.0 bits (84),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 17/28 (61%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +1

Query  58    EK*NVVTRSSA*TEDRSMALETCELVWL  141
             +K +VV RSSA  E R+MAL TCE +WL
Sbjct  2371  KKQDVVARSSAEVEYRAMALATCEFIWL  2398



>emb|CAN67123.1| hypothetical protein VITISV_040164 [Vitis vinifera]
Length=982

 Score = 41.6 bits (96),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 15/22 (68%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST GYC+F+G NLISWK++
Sbjct  876  DRRSTSGYCVFIGGNLISWKNK  897


 Score = 36.6 bits (83),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 16/28 (57%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K ++V RSSA  E ++MAL TCEL+WL
Sbjct  897  KKQDIVARSSAEVEYQAMALATCELIWL  924



>emb|CAN67119.1| hypothetical protein VITISV_017483 [Vitis vinifera]
Length=1970

 Score = 39.7 bits (91),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 15/22 (68%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +2

Query  2     DRKSTFGYCIFLGDNLISWKSR  67
             DR+ST GYC+F+  NLISWKS+
Sbjct  1129  DRRSTSGYCVFIRGNLISWKSK  1150


 Score = 38.5 bits (88),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  58    EK*NVVTRSSA*TEDRSMALETCELVWL  141
             +K +VV RSSA  E R+MAL TCEL+WL
Sbjct  1150  KKQDVVARSSAEAEYRAMALATCELIWL  1177



>emb|CAN79805.1| hypothetical protein VITISV_031503 [Vitis vinifera]
Length=325

 Score = 40.4 bits (93),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 15/22 (68%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST  YC+F+G NLISWKS+
Sbjct  181  DRRSTSRYCVFIGGNLISWKSK  202


 Score = 37.7 bits (86),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 17/28 (61%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K +VV RSS   E R+MAL TCEL+WL
Sbjct  202  KKQDVVVRSSVEAEYRAMALATCELIWL  229



>emb|CAN63843.1| hypothetical protein VITISV_036670 [Vitis vinifera]
Length=753

 Score = 40.0 bits (92),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 14/22 (64%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            +++ST GYC+F+G NLISWKS+
Sbjct  639  NKRSTSGYCVFIGGNLISWKSK  660


 Score = 37.7 bits (86),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 17/28 (61%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K +VV RSSA  E R+M L TCEL+WL
Sbjct  660  KKQDVVARSSAKAEYRAMTLATCELIWL  687



>emb|CAN81940.1| hypothetical protein VITISV_007358 [Vitis vinifera]
Length=772

 Score = 43.1 bits (100),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST GYC+F+G NLISWKS+
Sbjct  628  DRRSTSGYCVFIGGNLISWKSK  649


 Score = 34.3 bits (77),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/28 (57%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K +VV R SA  E R+M L TCEL+WL
Sbjct  649  KKQDVVVRYSAEAEYRAMTLATCELIWL  676



>emb|CAN72710.1| hypothetical protein VITISV_018096 [Vitis vinifera]
Length=1110

 Score = 39.7 bits (91),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 15/22 (68%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +2

Query  2     DRKSTFGYCIFLGDNLISWKSR  67
             DR+ST  YC+F+G NLISWKS+
Sbjct  980   DRRSTSVYCVFIGGNLISWKSK  1001


 Score = 37.7 bits (86),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 17/28 (61%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +1

Query  58    EK*NVVTRSSA*TEDRSMALETCELVWL  141
             +K +VV RSS   E R+MAL TCEL+WL
Sbjct  1001  KKQDVVARSSVEAEYRAMALATCELIWL  1028



>ref|XP_004174156.1| PREDICTED: uncharacterized mitochondrial protein AtMg00810-like 
[Cucumis sativus]
Length=163

 Score = 42.0 bits (97),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 15/22 (68%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST GYC+F+G NL+SWKS+
Sbjct  98   DRRSTSGYCVFVGGNLVSWKSK  119


 Score = 35.0 bits (79),  Expect(2) = 3e-06, Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K NVV+RSSA +E R+MA   CE+VW+
Sbjct  119  KKQNVVSRSSAKSEYRAMAQSVCEIVWI  146



>emb|CAN76224.1| hypothetical protein VITISV_017232 [Vitis vinifera]
Length=674

 Score = 39.7 bits (91),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 15/22 (68%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST  YC+F+G NLISWKS+
Sbjct  602  DRRSTSRYCVFIGGNLISWKSK  623


 Score = 37.4 bits (85),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K +VV RSSA  E R+MAL TCEL+WL
Sbjct  623  KKQDVVVRSSAEAEYRAMALATCELIWL  650



>emb|CAN77373.1| hypothetical protein VITISV_008342 [Vitis vinifera]
Length=250

 Score = 43.5 bits (101),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST GYC+F+G NLISWKS+
Sbjct  199  DRRSTSGYCVFIGGNLISWKSK  220


 Score = 33.5 bits (75),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/26 (62%), Positives = 20/26 (77%), Gaps = 0/26 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELV  135
            +K +VV RSSA  E R+MAL TCEL+
Sbjct  220  KKQDVVARSSAEAEYRAMALATCELI  245



>emb|CAN61858.1| hypothetical protein VITISV_016691 [Vitis vinifera]
Length=763

 Score = 41.6 bits (96),  Expect(2) = 4e-06, Method: Composition-based stats.
 Identities = 14/22 (64%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST GYC+F G NL++WKS+
Sbjct  619  DRRSTTGYCVFFGGNLVAWKSK  640


 Score = 35.4 bits (80),  Expect(2) = 4e-06, Method: Composition-based stats.
 Identities = 15/28 (54%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K +VV+RSSA +E R+MA  TCE++W+
Sbjct  640  KKQSVVSRSSAESEYRAMAQATCEIIWI  667



>emb|CAN66306.1| hypothetical protein VITISV_031415 [Vitis vinifera]
Length=250

 Score = 43.5 bits (101),  Expect(2) = 4e-06, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST GYC+F+G NLISWKS+
Sbjct  199  DRRSTSGYCVFIGGNLISWKSK  220


 Score = 33.5 bits (75),  Expect(2) = 4e-06, Method: Composition-based stats.
 Identities = 16/26 (62%), Positives = 20/26 (77%), Gaps = 0/26 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELV  135
            +K +VV RSSA  E R+MAL TCEL+
Sbjct  220  KKQDVVARSSAEAEYRAMALATCELI  245



>emb|CAN59880.1| hypothetical protein VITISV_029938 [Vitis vinifera]
Length=250

 Score = 43.5 bits (101),  Expect(2) = 4e-06, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST GYC+F+G NLISWKS+
Sbjct  199  DRRSTSGYCVFIGGNLISWKSK  220


 Score = 33.1 bits (74),  Expect(2) = 4e-06, Method: Composition-based stats.
 Identities = 16/26 (62%), Positives = 20/26 (77%), Gaps = 0/26 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELV  135
            +K +VV RSSA  E R+MAL TCEL+
Sbjct  220  KKQDVVXRSSAEAEYRAMALATCELI  245



>emb|CAN70029.1| hypothetical protein VITISV_010388 [Vitis vinifera]
Length=1222

 Score = 38.9 bits (89),  Expect(2) = 4e-06, Method: Composition-based stats.
 Identities = 15/22 (68%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +2

Query  2     DRKSTFGYCIFLGDNLISWKSR  67
             DR+ST GY +F+G NLISWKS+
Sbjct  1078  DRRSTSGYGVFIGGNLISWKSK  1099


 Score = 37.7 bits (86),  Expect(2) = 4e-06, Method: Composition-based stats.
 Identities = 17/28 (61%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +1

Query  58    EK*NVVTRSSA*TEDRSMALETCELVWL  141
             +K +VV RSS   E R+MAL TCEL+WL
Sbjct  1099  KKQDVVARSSVEAEYRAMALATCELIWL  1126



>emb|CAN78880.1| hypothetical protein VITISV_024991 [Vitis vinifera]
Length=2264

 Score = 40.0 bits (92),  Expect(2) = 4e-06, Method: Composition-based stats.
 Identities = 15/22 (68%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST  YC+F+G NLISWKS+
Sbjct  844  DRRSTSXYCVFIGGNLISWKSK  865


 Score = 36.6 bits (83),  Expect(2) = 4e-06, Method: Composition-based stats.
 Identities = 17/28 (61%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K +V  RSSA  E R+MAL TCEL+WL
Sbjct  865  KKQDVXARSSAEVEYRTMALATCELIWL  892



>emb|CAN60498.1| hypothetical protein VITISV_027869 [Vitis vinifera]
Length=2077

 Score = 38.9 bits (89),  Expect(2) = 5e-06, Method: Composition-based stats.
 Identities = 14/22 (64%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = +2

Query  2     DRKSTFGYCIFLGDNLISWKSR  67
             DR+   GYC+F+G NLISWKS+
Sbjct  1336  DRRFISGYCVFIGGNLISWKSK  1357


 Score = 37.7 bits (86),  Expect(2) = 5e-06, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +1

Query  58    EK*NVVTRSSA*TEDRSMALETCELVWL  141
             +K +VV RSSA  E R MAL TCEL+WL
Sbjct  1357  KKQDVVARSSAEAEYRVMALATCELIWL  1384



>gb|KHN22607.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, 
partial [Glycine soja]
Length=172

 Score = 42.4 bits (98),  Expect(2) = 5e-06, Method: Composition-based stats.
 Identities = 15/22 (68%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2   DRKSTFGYCIFLGDNLISWKSR  67
           DR+ST GYC+F+G NL+SWKS+
Sbjct  68  DRRSTSGYCVFIGGNLVSWKSK  89


 Score = 34.3 bits (77),  Expect(2) = 5e-06, Method: Composition-based stats.
 Identities = 17/28 (61%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K  VV RSSA  E RSMA+ TCEL+W+
Sbjct  89   KKQTVVARSSAEAEYRSMAMVTCELMWI  116



>gb|AAO26690.1|AF478377_1 gag-pol polyprotein [Vitis vinifera]
Length=326

 Score = 41.6 bits (96),  Expect(2) = 5e-06, Method: Composition-based stats.
 Identities = 14/22 (64%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST GYC+F G NL++WKS+
Sbjct  182  DRRSTTGYCVFFGGNLVAWKSK  203


 Score = 35.0 bits (79),  Expect(2) = 5e-06, Method: Composition-based stats.
 Identities = 15/28 (54%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K +VV+RSSA +E R+MA  TCE++W+
Sbjct  203  KKQSVVSRSSAESEYRAMAQATCEIIWI  230



>ref|XP_004292511.1| PREDICTED: uncharacterized mitochondrial protein AtMg00810-like 
[Fragaria vesca subsp. vesca]
Length=291

 Score = 41.6 bits (96),  Expect(2) = 5e-06, Method: Composition-based stats.
 Identities = 15/22 (68%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DRKST GYC F+G NL++WKS+
Sbjct  162  DRKSTAGYCTFIGGNLVTWKSK  183


 Score = 34.7 bits (78),  Expect(2) = 5e-06, Method: Composition-based stats.
 Identities = 17/28 (61%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K  VV RSSA  E R+MA  TCEL+WL
Sbjct  183  KKQTVVARSSAEAEYRAMASTTCELIWL  210



>emb|CAN69420.1| hypothetical protein VITISV_025306 [Vitis vinifera]
Length=163

 Score = 39.3 bits (90),  Expect(2) = 5e-06, Method: Composition-based stats.
 Identities = 15/22 (68%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST  YC+F+G NLISWKS+
Sbjct  109  DRRSTSRYCVFIGGNLISWKSK  130


 Score = 37.0 bits (84),  Expect(2) = 5e-06, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K +VV RSSA  E R+MAL TCEL+WL
Sbjct  130  KKQDVVARSSAEAEYRAMALTTCELIWL  157



>emb|CAN74507.1| hypothetical protein VITISV_015891 [Vitis vinifera]
Length=253

 Score = 41.2 bits (95),  Expect(2) = 6e-06, Method: Composition-based stats.
 Identities = 15/22 (68%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            D+ ST GYC+F+G NLISWKS+
Sbjct  109  DKHSTSGYCVFIGGNLISWKSK  130


 Score = 35.0 bits (79),  Expect(2) = 6e-06, Method: Composition-based stats.
 Identities = 16/28 (57%), Positives = 19/28 (68%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K NVV RSS   E R+M L  CEL+WL
Sbjct  130  KKQNVVVRSSVDAEYRAMTLAICELIWL  157



>emb|CAN83125.1| hypothetical protein VITISV_015109 [Vitis vinifera]
Length=1355

 Score = 42.4 bits (98),  Expect(2) = 6e-06, Method: Composition-based stats.
 Identities = 15/22 (68%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2     DRKSTFGYCIFLGDNLISWKSR  67
             DR+ST GYC+F+G NL+SWKS+
Sbjct  1211  DRRSTTGYCMFVGGNLVSWKSK  1232


 Score = 33.9 bits (76),  Expect(2) = 6e-06, Method: Composition-based stats.
 Identities = 15/24 (63%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = +1

Query  70    VVTRSSA*TEDRSMALETCELVWL  141
             VV RSSA  E R+MA  +CE+VWL
Sbjct  1236  VVARSSAEAEYRAMAAASCEMVWL  1259



>emb|CAN71132.1| hypothetical protein VITISV_007235 [Vitis vinifera]
Length=1259

 Score = 41.6 bits (96),  Expect(2) = 6e-06, Method: Composition-based stats.
 Identities = 14/22 (64%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +2

Query  2     DRKSTFGYCIFLGDNLISWKSR  67
             DR+ST GYC+F G NL++WKS+
Sbjct  1115  DRRSTTGYCVFFGGNLVAWKSK  1136


 Score = 34.7 bits (78),  Expect(2) = 6e-06, Method: Composition-based stats.
 Identities = 15/28 (54%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +1

Query  58    EK*NVVTRSSA*TEDRSMALETCELVWL  141
             +K +VV+RSSA +E R+MA  TCE++W+
Sbjct  1136  KKQSVVSRSSAESEYRAMAQATCEIIWI  1163



>emb|CAN83177.1| hypothetical protein VITISV_042114 [Vitis vinifera]
Length=1085

 Score = 41.6 bits (96),  Expect(2) = 7e-06, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+STFGYC+F+G NLIS KS+
Sbjct  940  DRRSTFGYCVFIGGNLISCKSK  961


 Score = 34.3 bits (77),  Expect(2) = 7e-06, Method: Composition-based stats.
 Identities = 16/28 (57%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K +VV  SSA  E R+M L TCEL+WL
Sbjct  961  KKQDVVAGSSAEAEYRAMTLATCELIWL  988



>emb|CAN65647.1| hypothetical protein VITISV_001300 [Vitis vinifera]
Length=1094

 Score = 38.1 bits (87),  Expect(2) = 7e-06, Method: Composition-based stats.
 Identities = 14/22 (64%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            +R+STF YC+F+  NLISWKS+
Sbjct  950  NRRSTFVYCVFIRGNLISWKSK  971


 Score = 37.7 bits (86),  Expect(2) = 7e-06, Method: Composition-based stats.
 Identities = 17/28 (61%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K +VV RSS   E R+MAL TCEL+WL
Sbjct  971  KKQDVVVRSSVEAEYRAMALATCELIWL  998



>emb|CAN63507.1| hypothetical protein VITISV_029435 [Vitis vinifera]
Length=1211

 Score = 43.5 bits (101),  Expect(2) = 8e-06, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2     DRKSTFGYCIFLGDNLISWKSR  67
             DR+ST GYC+F+G NLISWKS+
Sbjct  1067  DRRSTSGYCVFIGGNLISWKSK  1088


 Score = 32.0 bits (71),  Expect(2) = 8e-06, Method: Composition-based stats.
 Identities = 15/28 (54%), Positives = 19/28 (68%), Gaps = 0/28 (0%)
 Frame = +1

Query  58    EK*NVVTRSSA*TEDRSMALETCELVWL  141
             +K +VV   S   E R+MAL TCEL+WL
Sbjct  1088  KKQDVVAGYSVEAEYRAMALATCELIWL  1115



>gb|KHN17267.1| Putative mitochondrial protein, partial [Glycine soja]
Length=283

 Score = 40.8 bits (94),  Expect(2) = 8e-06, Method: Composition-based stats.
 Identities = 15/22 (68%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST  YC+F+G NLISWKS+
Sbjct  182  DRRSTSDYCVFIGGNLISWKSK  203


 Score = 35.0 bits (79),  Expect(2) = 8e-06, Method: Composition-based stats.
 Identities = 17/28 (61%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K  VV RSSA  E RSMA+ TCEL+W+
Sbjct  203  KKQTVVARSSAEAEYRSMAMVTCELMWI  230



>emb|CAN63081.1| hypothetical protein VITISV_016842 [Vitis vinifera]
Length=1179

 Score = 39.3 bits (90),  Expect(2) = 9e-06, Method: Composition-based stats.
 Identities = 14/22 (64%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +2

Query  2     DRKSTFGYCIFLGDNLISWKSR  67
             +R+S  GYC+F+G NLISWKS+
Sbjct  1121  NRRSISGYCVFIGGNLISWKSK  1142


 Score = 36.2 bits (82),  Expect(2) = 9e-06, Method: Composition-based stats.
 Identities = 16/28 (57%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +1

Query  58    EK*NVVTRSSA*TEDRSMALETCELVWL  141
             +K +VV +SS   E R+MAL TCEL+WL
Sbjct  1142  KKQDVVAKSSVEAEYRAMALATCELIWL  1169



>gb|KHN06274.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, 
partial [Glycine soja]
Length=1353

 Score = 38.9 bits (89),  Expect(2) = 1e-05, Method: Composition-based stats.
 Identities = 14/22 (64%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +2

Query  2     DRKSTFGYCIFLGDNLISWKSR  67
             DR+ST GYC+ +G N+ISWKS+
Sbjct  1216  DRRSTSGYCVSIGGNVISWKSK  1237


 Score = 36.6 bits (83),  Expect(2) = 1e-05, Method: Composition-based stats.
 Identities = 17/28 (61%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +1

Query  58    EK*NVVTRSSA*TEDRSMALETCELVWL  141
             +K  VV RSSA  E RSMA+ TCEL+W+
Sbjct  1237  KKQTVVARSSAEAEYRSMAITTCELMWV  1264



>gb|AAO26684.1|AF478370_1 gag-pol polyprotein [Vitis vinifera]
Length=326

 Score = 41.6 bits (96),  Expect(2) = 1e-05, Method: Composition-based stats.
 Identities = 14/22 (64%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST GYC+F G NL++WKS+
Sbjct  182  DRRSTTGYCVFFGGNLVAWKSK  203


 Score = 33.9 bits (76),  Expect(2) = 1e-05, Method: Composition-based stats.
 Identities = 14/28 (50%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K +VV+RSSA +E R+M+  TCE++W+
Sbjct  203  KKQSVVSRSSAESEYRAMSQATCEIIWI  230



>emb|CAN80853.1| hypothetical protein VITISV_040353 [Vitis vinifera]
Length=735

 Score = 38.9 bits (89),  Expect(2) = 1e-05, Method: Composition-based stats.
 Identities = 15/22 (68%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST GY +F+G NLISWKS+
Sbjct  591  DRRSTSGYYVFIGGNLISWKSK  612


 Score = 36.2 bits (82),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K +VV RSSA  E R+MAL TC+L+WL
Sbjct  612  KKQDVVARSSAEAEYRAMALATCKLIWL  639



>emb|CBI40600.3| unnamed protein product [Vitis vinifera]
Length=952

 Score = 42.4 bits (98),  Expect(2) = 1e-05, Method: Composition-based stats.
 Identities = 15/22 (68%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST GYC+F+G NL+SWKS+
Sbjct  808  DRRSTTGYCMFVGGNLVSWKSK  829


 Score = 32.7 bits (73),  Expect(2) = 1e-05, Method: Composition-based stats.
 Identities = 15/24 (63%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = +1

Query  70   VVTRSSA*TEDRSMALETCELVWL  141
            VV RSSA  E R+MA  +CE+VWL
Sbjct  833  VVARSSAEAEYRAMAAASCEMVWL  856



>emb|CAN83275.1| hypothetical protein VITISV_026335 [Vitis vinifera]
Length=195

 Score = 42.4 bits (98),  Expect(2) = 1e-05, Method: Composition-based stats.
 Identities = 15/22 (68%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2   DRKSTFGYCIFLGDNLISWKSR  67
           DR+ST GYC+F+G NL+SWKS+
Sbjct  51  DRRSTTGYCMFVGGNLVSWKSK  72


 Score = 32.7 bits (73),  Expect(2) = 1e-05, Method: Composition-based stats.
 Identities = 15/24 (63%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = +1

Query  70   VVTRSSA*TEDRSMALETCELVWL  141
            VV RSSA  E R+MA  +CE+VWL
Sbjct  76   VVARSSAEAEYRAMAAASCEMVWL  99



>gb|AAO26683.1|AF478369_1 gag-pol polyprotein [Vitis vinifera]
Length=326

 Score = 41.6 bits (96),  Expect(2) = 1e-05, Method: Composition-based stats.
 Identities = 14/22 (64%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST GYC+F G NL++WKS+
Sbjct  182  DRRSTTGYCVFFGGNLVAWKSK  203


 Score = 33.5 bits (75),  Expect(2) = 1e-05, Method: Composition-based stats.
 Identities = 14/28 (50%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K +VV+RSSA +E R+M+  TCE++W+
Sbjct  203  KKQSVVSRSSAESEYRAMSRATCEIIWI  230



>gb|ABY49842.1| hypothetical protein [Vitis hybrid cultivar]
Length=1382

 Score = 41.6 bits (96),  Expect(2) = 1e-05, Method: Composition-based stats.
 Identities = 14/22 (64%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +2

Query  2     DRKSTFGYCIFLGDNLISWKSR  67
             DR+ST GYC+F G NL++WKS+
Sbjct  1238  DRRSTTGYCVFFGGNLVAWKSK  1259


 Score = 33.1 bits (74),  Expect(2) = 1e-05, Method: Composition-based stats.
 Identities = 14/28 (50%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +1

Query  58    EK*NVVTRSSA*TEDRSMALETCELVWL  141
             +K +VV+RSSA +E R+M+  TCE++W+
Sbjct  1259  KKQSVVSRSSAESEYRAMSQATCEIIWI  1286



>emb|CAN72222.1| hypothetical protein VITISV_028929 [Vitis vinifera]
Length=651

 Score = 40.4 bits (93),  Expect(2) = 2e-05, Method: Composition-based stats.
 Identities = 14/22 (64%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST GYC FLG NL++W+S+
Sbjct  560  DRRSTTGYCTFLGGNLVTWRSK  581


 Score = 33.9 bits (76),  Expect(2) = 2e-05, Method: Composition-based stats.
 Identities = 16/28 (57%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K NVV RSSA +E R++A   CEL+WL
Sbjct  581  KKQNVVVRSSAESEFRAIAQRLCELLWL  608



>gb|AEJ72555.1| putative retroelement polyprotein [Malus domestica]
Length=1249

 Score = 39.7 bits (91),  Expect(2) = 2e-05, Method: Composition-based stats.
 Identities = 14/22 (64%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +2

Query  2     DRKSTFGYCIFLGDNLISWKSR  67
             DR+ST GYC F+G NL++WKS+
Sbjct  1105  DRRSTTGYCTFVGGNLVTWKSK  1126


 Score = 34.7 bits (78),  Expect(2) = 2e-05, Method: Composition-based stats.
 Identities = 17/28 (61%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +1

Query  58    EK*NVVTRSSA*TEDRSMALETCELVWL  141
             +K +VV RSSA  E R+MA  TCEL+WL
Sbjct  1126  KKQSVVARSSAEAEYRAMASTTCELIWL  1153



>gb|KHN45218.1| Putative mitochondrial protein, partial [Glycine soja]
Length=283

 Score = 43.1 bits (100),  Expect(2) = 2e-05, Method: Composition-based stats.
 Identities = 15/22 (68%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST GYC+F+G NL+SWKS+
Sbjct  182  DRRSTSGYCVFIGGNLVSWKSK  203


 Score = 31.2 bits (69),  Expect(2) = 2e-05, Method: Composition-based stats.
 Identities = 16/28 (57%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K  VV RSSA  E RSMA+ T EL+W+
Sbjct  203  KKQTVVARSSAEAEYRSMAMVTSELMWI  230



>emb|CAN60149.1| hypothetical protein VITISV_016363 [Vitis vinifera]
Length=1092

 Score = 39.3 bits (90),  Expect(2) = 2e-05, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  58    EK*NVVTRSSA*TEDRSMALETCELVWL  141
             +K +VV RSSA  E R+MAL TCEL+WL
Sbjct  1035  KKQDVVARSSAEAEYRAMALPTCELIWL  1062


 Score = 35.0 bits (79),  Expect(2) = 2e-05, Method: Composition-based stats.
 Identities = 13/22 (59%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = +2

Query  2     DRKSTFGYCIFLGDNLISWKSR  67
             +R+S  GY +F+G NLISWKS+
Sbjct  1014  NRRSISGYYVFIGGNLISWKSK  1035



>ref|XP_009338880.1| PREDICTED: uncharacterized protein LOC103931184 [Pyrus x bretschneideri]
Length=1143

 Score = 40.0 bits (92),  Expect(2) = 2e-05, Method: Composition-based stats.
 Identities = 15/21 (71%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = +2

Query  5     RKSTFGYCIFLGDNLISWKSR  67
             R+S  GYCIFLG++LISWKS+
Sbjct  1000  RRSVTGYCIFLGNSLISWKSK  1020


 Score = 33.9 bits (76),  Expect(2) = 2e-05, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = +1

Query  73    VTRSSA*TEDRSMALETCELVWL  141
             V RSSA  E RSMA  TCEL WL
Sbjct  1025  VARSSAEAEYRSMAAATCELTWL  1047



>ref|XP_010552410.1| PREDICTED: uncharacterized protein LOC104822761 [Tarenaya hassleriana]
Length=766

 Score = 40.4 bits (93),  Expect(2) = 2e-05, Method: Composition-based stats.
 Identities = 14/22 (64%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DRKST GYC F+G N+++WKS+
Sbjct  446  DRKSTTGYCTFVGGNIVTWKSK  467


 Score = 33.5 bits (75),  Expect(2) = 2e-05, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = +1

Query  70   VVTRSSA*TEDRSMALETCELVWL  141
            VV+RSSA  E R+MA  TCEL+WL
Sbjct  471  VVSRSSAEAEYRAMANTTCELLWL  494



>emb|CAN76176.1| hypothetical protein VITISV_022748 [Vitis vinifera]
Length=1025

 Score = 38.9 bits (89),  Expect(2) = 3e-05, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR STFGYC+F+G NLIS KS+
Sbjct  880  DRCSTFGYCVFIGGNLISCKSK  901


 Score = 35.0 bits (79),  Expect(2) = 3e-05, Method: Composition-based stats.
 Identities = 16/28 (57%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K +VV RSS   E R+M L TCEL+WL
Sbjct  901  KKQDVVARSSTEAEYRAMTLATCELIWL  928



>ref|XP_010534024.1| PREDICTED: uncharacterized protein LOC104809678 [Tarenaya hassleriana]
Length=2364

 Score = 41.6 bits (96),  Expect(2) = 3e-05, Method: Composition-based stats.
 Identities = 15/22 (68%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +2

Query  2     DRKSTFGYCIFLGDNLISWKSR  67
             DRKST GYC F+G NL++WKS+
Sbjct  2029  DRKSTSGYCTFIGGNLVTWKSK  2050


 Score = 32.3 bits (72),  Expect(2) = 3e-05, Method: Composition-based stats.
 Identities = 17/28 (61%), Positives = 19/28 (68%), Gaps = 0/28 (0%)
 Frame = +1

Query  58    EK*NVVTRSSA*TEDRSMALETCELVWL  141
             +K NVV RSSA  E R+MA    ELVWL
Sbjct  2050  KKQNVVARSSAEAEYRAMATAASELVWL  2077



>ref|XP_010527127.1| PREDICTED: uncharacterized protein LOC104804512 [Tarenaya hassleriana]
Length=1215

 Score = 41.6 bits (96),  Expect(2) = 3e-05, Method: Composition-based stats.
 Identities = 15/22 (68%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +2

Query  2     DRKSTFGYCIFLGDNLISWKSR  67
             DRKST GYC F+G NL++WKS+
Sbjct  1028  DRKSTTGYCTFIGGNLVTWKSK  1049


 Score = 32.0 bits (71),  Expect(2) = 3e-05, Method: Composition-based stats.
 Identities = 16/28 (57%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = +1

Query  58    EK*NVVTRSSA*TEDRSMALETCELVWL  141
             +K NVV RSSA  E R+MA  T E++WL
Sbjct  1049  KKQNVVARSSAEAEYRAMANTTSEVIWL  1076



>emb|CAN76350.1| hypothetical protein VITISV_025245 [Vitis vinifera]
Length=702

 Score = 38.9 bits (89),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 16/22 (73%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR ST GYC+F+G NLISWKS+
Sbjct  558  DRCSTSGYCVFIGGNLISWKSK  579


 Score = 34.7 bits (78),  Expect(2) = 3e-05, Method: Composition-based stats.
 Identities = 16/28 (57%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K +VV R+ A  E R+MAL TCEL+WL
Sbjct  579  KKQDVVARACAEAEYRAMALATCELIWL  606



>ref|XP_010112249.1| Aldehyde dehydrogenase family 6 member B2 [Morus notabilis]
 gb|EXC33005.1| Aldehyde dehydrogenase family 6 member B2 [Morus notabilis]
Length=961

 Score = 39.3 bits (90),  Expect(2) = 3e-05, Method: Composition-based stats.
 Identities = 13/22 (59%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST GYC F+G NL++W+S+
Sbjct  103  DRRSTSGYCTFVGGNLVTWRSK  124


 Score = 34.3 bits (77),  Expect(2) = 3e-05, Method: Composition-based stats.
 Identities = 16/28 (57%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K NVV RSS  +E RS+A+  CEL+WL
Sbjct  124  KKQNVVARSSEESEFRSLAVGICELLWL  151



>emb|CAN81070.1| hypothetical protein VITISV_037301 [Vitis vinifera]
Length=253

 Score = 43.5 bits (101),  Expect(2) = 3e-05, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST GYC+F+G NLISWKS+
Sbjct  199  DRRSTSGYCVFIGGNLISWKSK  220


 Score = 30.0 bits (66),  Expect(2) = 3e-05, Method: Composition-based stats.
 Identities = 14/27 (52%), Positives = 19/27 (70%), Gaps = 0/27 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVW  138
            +K +VV RSSA  E R+MAL TC + +
Sbjct  220  KKQDVVARSSAEAEYRAMALATCRITY  246



>ref|XP_009129009.1| PREDICTED: uncharacterized protein LOC103853855 [Brassica rapa]
Length=875

 Score = 41.2 bits (95),  Expect(2) = 3e-05, Method: Composition-based stats.
 Identities = 14/21 (67%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  5    RKSTFGYCIFLGDNLISWKSR  67
            R+ST GYC+FLGD+LISW+++
Sbjct  732  RRSTTGYCVFLGDSLISWRAK  752


 Score = 32.7 bits (73),  Expect(2) = 3e-05, Method: Composition-based stats.
 Identities = 15/28 (54%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K   V+RSS+  E RSMA  TCEL+W+
Sbjct  752  KKQQTVSRSSSEAEYRSMADTTCELIWI  779



>ref|XP_007153038.1| hypothetical protein PHAVU_003G0023001g, partial [Phaseolus vulgaris]
 gb|ESW25032.1| hypothetical protein PHAVU_003G0023001g, partial [Phaseolus vulgaris]
Length=1800

 Score = 41.6 bits (96),  Expect(2) = 3e-05, Method: Composition-based stats.
 Identities = 14/22 (64%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2   DRKSTFGYCIFLGDNLISWKSR  67
           DR+ST GYC+FLG NL++W+S+
Sbjct  64  DRRSTTGYCMFLGGNLVTWRSK  85


 Score = 32.0 bits (71),  Expect(2) = 3e-05, Method: Composition-based stats.
 Identities = 16/28 (57%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K NVV RSSA  E R+MA   CEL+W+
Sbjct  85   KKQNVVARSSAEAEFRAMAQGVCELLWM  112



>ref|XP_010065010.1| PREDICTED: uncharacterized protein LOC104452197 [Eucalyptus grandis]
Length=340

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 30/47 (64%), Gaps = 2/47 (4%)
 Frame = +2

Query  5    RKSTFGYCIFLGDNLISWKSRMLLLDQVHKLK--IDPWLSRHVNLCG  139
            RKS  G+CI LGD+L+SWK R       H+L+  I+PW   HV LCG
Sbjct  283  RKSITGFCIKLGDSLLSWKPRSKQQFLYHQLRQSIEPWQKPHVKLCG  329



>emb|CAN74815.1| hypothetical protein VITISV_015192 [Vitis vinifera]
Length=920

 Score = 38.9 bits (89),  Expect(2) = 3e-05, Method: Composition-based stats.
 Identities = 14/22 (64%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+STFGY  F+G NL++WKS+
Sbjct  804  DRQSTFGYFTFVGGNLVTWKSK  825


 Score = 34.7 bits (78),  Expect(2) = 3e-05, Method: Composition-based stats.
 Identities = 17/28 (61%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K NVVTRSSA  E R M L  CE++WL
Sbjct  825  KKQNVVTRSSAKAEFRGMTLGLCEVLWL  852



>ref|XP_007044444.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 8, putative 
[Theobroma cacao]
 gb|EOY00276.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 8, putative 
[Theobroma cacao]
Length=469

 Score = 40.8 bits (94),  Expect(2) = 3e-05, Method: Composition-based stats.
 Identities = 15/21 (71%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = +2

Query  5    RKSTFGYCIFLGDNLISWKSR  67
            RKS  GYCIF+GD+L+SWKS+
Sbjct  326  RKSITGYCIFIGDSLVSWKSK  346


 Score = 33.1 bits (74),  Expect(2) = 3e-05, Method: Composition-based stats.
 Identities = 15/28 (54%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K +VV RSSA  E R+MA   CE++WL
Sbjct  346  KKQSVVARSSAEAEYRAMATTCCEIIWL  373



>ref|XP_008356691.1| PREDICTED: uncharacterized calcium-binding protein At1g02270-like 
[Malus domestica]
Length=531

 Score = 40.0 bits (92),  Expect(2) = 4e-05, Method: Composition-based stats.
 Identities = 15/22 (68%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DRKST G+C F+G NL+SWKS+
Sbjct  387  DRKSTTGFCTFVGGNLVSWKSK  408


 Score = 33.1 bits (74),  Expect(2) = 4e-05, Method: Composition-based stats.
 Identities = 16/28 (57%), Positives = 19/28 (68%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K  VV RSSA  E R+MA   CEL+WL
Sbjct  408  KKQTVVARSSAEAEYRAMASTACELIWL  435



>emb|CAN74917.1| hypothetical protein VITISV_032458 [Vitis vinifera]
Length=925

 Score = 43.5 bits (101),  Expect(2) = 4e-05, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST GYC+F+G NLISWKS+
Sbjct  879  DRRSTSGYCVFIGGNLISWKSK  900


 Score = 29.6 bits (65),  Expect(2) = 4e-05, Method: Composition-based stats.
 Identities = 14/26 (54%), Positives = 19/26 (73%), Gaps = 0/26 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELV  135
            +K +VV +SS   E R+MAL TCEL+
Sbjct  900  KKQDVVIKSSVEAEYRAMALATCELI  925



>gb|AAM47483.1| RNAse H-like protein [Quercus suber]
Length=82

 Score = 40.0 bits (92),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 14/21 (67%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  5   RKSTFGYCIFLGDNLISWKSR  67
           R+ST GYC+F+GD+L+SWKS+
Sbjct  30  RRSTTGYCVFIGDSLVSWKSK  50


 Score = 33.5 bits (75),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 15/28 (54%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K + V+RSSA +E R+MA+  CE+VWL
Sbjct  50   KKQHTVSRSSAESEYRAMAVAVCEIVWL  77



>gb|KHN07818.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, 
partial [Glycine soja]
Length=270

 Score = 37.7 bits (86),  Expect(2) = 5e-05, Method: Composition-based stats.
 Identities = 14/22 (64%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST GYC+ +G N ISWKS+
Sbjct  169  DRRSTSGYCVSIGGNAISWKSK  190


 Score = 35.0 bits (79),  Expect(2) = 5e-05, Method: Composition-based stats.
 Identities = 17/28 (61%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K  VV RSSA  E RSMA+ TCEL+W+
Sbjct  190  KKQTVVARSSAEAEYRSMAMATCELMWI  217



>ref|XP_010555983.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104825359 
[Tarenaya hassleriana]
Length=1643

 Score = 40.0 bits (92),  Expect(2) = 5e-05, Method: Composition-based stats.
 Identities = 14/22 (64%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +2

Query  2     DRKSTFGYCIFLGDNLISWKSR  67
             DRKST GYC F+G N+++WKS+
Sbjct  1457  DRKSTTGYCTFVGGNVVTWKSK  1478


 Score = 32.7 bits (73),  Expect(2) = 5e-05, Method: Composition-based stats.
 Identities = 17/28 (61%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +1

Query  58    EK*NVVTRSSA*TEDRSMALETCELVWL  141
             +K NVV+RSSA  E R+MA  T E+VWL
Sbjct  1478  KKQNVVSRSSAEAEYRAMANTTSEIVWL  1505



>ref|XP_008460624.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103499401 
[Cucumis melo]
Length=789

 Score = 40.4 bits (93),  Expect(2) = 5e-05, Method: Composition-based stats.
 Identities = 14/22 (64%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+S  GYC+F+G NL+SWKS+
Sbjct  645  DRRSISGYCVFVGGNLVSWKSK  666


 Score = 32.3 bits (72),  Expect(2) = 5e-05, Method: Composition-based stats.
 Identities = 15/28 (54%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K NVV+ SSA +E R+MA   CE+VW+
Sbjct  666  KKQNVVSCSSAKSEYRAMAQSVCEIVWI  693



>emb|CAN64580.1| hypothetical protein VITISV_002159 [Vitis vinifera]
Length=1453

 Score = 43.1 bits (100),  Expect(2) = 6e-05, Method: Composition-based stats.
 Identities = 15/22 (68%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2     DRKSTFGYCIFLGDNLISWKSR  67
             DR+ST GYCIFLG NL++W+S+
Sbjct  1309  DRRSTXGYCIFLGGNLVTWRSK  1330


 Score = 29.6 bits (65),  Expect(2) = 6e-05, Method: Composition-based stats.
 Identities = 15/28 (54%), Positives = 19/28 (68%), Gaps = 0/28 (0%)
 Frame = +1

Query  58    EK*NVVTRSSA*TEDRSMALETCELVWL  141
             +K  VV RSSA  E ++MA   CEL+WL
Sbjct  1330  KKQXVVARSSAEAEFQAMAQGVCELLWL  1357



>emb|CAN59936.1| hypothetical protein VITISV_001878 [Vitis vinifera]
Length=1031

 Score = 41.2 bits (95),  Expect(2) = 6e-05, Method: Composition-based stats.
 Identities = 16/21 (76%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = +2

Query  5    RKSTFGYCIFLGDNLISWKSR  67
            RKS  G+CIFLGD+LISWKS+
Sbjct  869  RKSVTGFCIFLGDSLISWKSK  889


 Score = 31.6 bits (70),  Expect(2) = 6e-05, Method: Composition-based stats.
 Identities = 15/28 (54%), Positives = 18/28 (64%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K   V+RSSA  E R+MA  TCEL W 
Sbjct  889  KKQRTVSRSSAEAEYRAMAHVTCELTWF  916



>ref|XP_008358031.1| PREDICTED: LOW QUALITY PROTEIN: probable L-type lectin-domain 
containing receptor kinase S.5 [Malus domestica]
Length=524

 Score = 40.4 bits (93),  Expect(2) = 6e-05, Method: Composition-based stats.
 Identities = 14/22 (64%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +2

Query  2   DRKSTFGYCIFLGDNLISWKSR  67
           DRKST G+C F+G NL++WKS+
Sbjct  23  DRKSTIGFCTFVGGNLVTWKSK  44


 Score = 32.3 bits (72),  Expect(2) = 6e-05, Method: Compositional matrix adjust.
 Identities = 15/28 (54%), Positives = 19/28 (68%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K  V+ RSSA  E R+MA   CEL+WL
Sbjct  44   KKQTVIARSSAEAEYRAMATTACELIWL  71



>ref|XP_007044112.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 8 [Theobroma 
cacao]
 gb|EOX99943.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 8 [Theobroma 
cacao]
Length=597

 Score = 40.8 bits (94),  Expect(2) = 6e-05, Method: Composition-based stats.
 Identities = 14/22 (64%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            D++ST GYC+F+G NL+SWKS+
Sbjct  486  DKRSTTGYCVFIGVNLVSWKSK  507


 Score = 31.6 bits (70),  Expect(2) = 6e-05, Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K NV++RSS  +E R+MA   CE+VW+
Sbjct  507  KKQNVLSRSSVESEYRAMAQTVCEVVWM  534



>ref|XP_006481389.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570-like [Citrus sinensis]
Length=956

 Score = 38.9 bits (89),  Expect(2) = 8e-05, Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+S  GYCIFLG NL+SW S+
Sbjct  186  DRRSVGGYCIFLGSNLVSWSSK  207


 Score = 33.1 bits (74),  Expect(2) = 8e-05, Method: Composition-based stats.
 Identities = 15/28 (54%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K NVV+RSSA +E R++AL T E++W+
Sbjct  207  KKQNVVSRSSAESEYRALALTTSEVLWI  234



>ref|XP_004515021.1| PREDICTED: uncharacterized mitochondrial protein AtMg00810-like 
[Cicer arietinum]
Length=194

 Score = 40.0 bits (92),  Expect(2) = 8e-05, Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+STFGYC+ +G NLISWK++
Sbjct  109  DRRSTFGYCVLIGCNLISWKNK  130


 Score = 32.3 bits (72),  Expect(2) = 8e-05, Method: Composition-based stats.
 Identities = 15/28 (54%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K  VV +SS   E+R+MAL T EL+WL
Sbjct  130  KKQKVVAKSSVEAENRAMALTTQELIWL  157



>gb|AAB61111.1| Strong similarity to Zea mays retrotransposon Hopscotch polyprotein 
(gb|U12626) [Arabidopsis thaliana]
Length=1315

 Score = 42.0 bits (97),  Expect(2) = 8e-05, Method: Composition-based stats.
 Identities = 16/21 (76%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = +2

Query  5     RKSTFGYCIFLGDNLISWKSR  67
             R+ST GYC+FLGD+LI WKSR
Sbjct  1172  RRSTSGYCMFLGDSLICWKSR  1192


 Score = 30.4 bits (67),  Expect(2) = 8e-05, Method: Composition-based stats.
 Identities = 15/27 (56%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +1

Query  61    K*NVVTRSSA*TEDRSMALETCELVWL  141
             K +VV++SSA  E RS+++ T ELVWL
Sbjct  1193  KQDVVSKSSAEAEYRSLSVATDELVWL  1219



>ref|XP_006584292.1| PREDICTED: uncharacterized protein LOC102668041 [Glycine max]
Length=1176

 Score = 38.9 bits (89),  Expect(2) = 9e-05, Method: Composition-based stats.
 Identities = 15/22 (68%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +2

Query  2     DRKSTFGYCIFLGDNLISWKSR  67
             DR+ST GY +F+G NLISWKS+
Sbjct  1032  DRRSTSGYYVFIGGNLISWKSK  1053


 Score = 33.1 bits (74),  Expect(2) = 9e-05, Method: Composition-based stats.
 Identities = 16/28 (57%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = +1

Query  58    EK*NVVTRSSA*TEDRSMALETCELVWL  141
             +K  VV  SSA  E RSMA+ TCEL+W+
Sbjct  1053  KKQTVVAWSSAEAEYRSMAMVTCELMWI  1080



>emb|CAA36616.1| unnamed protein product [Solanum tuberosum]
Length=390

 Score = 36.6 bits (83),  Expect(2) = 9e-05, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K NVV RSSA  E RSMAL  CE++WL
Sbjct  277  KKQNVVARSSAEAEYRSMALGICEILWL  304


 Score = 35.4 bits (80),  Expect(2) = 9e-05, Method: Composition-based stats.
 Identities = 12/22 (55%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST GYC F+  NL++W+S+
Sbjct  256  DRRSTSGYCTFVWGNLVTWRSK  277



>ref|XP_004306286.1| PREDICTED: uncharacterized mitochondrial protein AtMg00810-like 
[Fragaria vesca subsp. vesca]
Length=227

 Score = 39.3 bits (90),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 14/22 (64%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DRKST G+C F+G NL++WKS+
Sbjct  132  DRKSTTGFCTFVGGNLVTWKSK  153


 Score = 32.7 bits (73),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 16/28 (57%), Positives = 19/28 (68%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K  VV RSSA  E R+MA   CEL+WL
Sbjct  153  KKQTVVARSSAEAEYRAMAATACELIWL  180



>ref|XP_004292800.1| PREDICTED: uncharacterized mitochondrial protein AtMg00810-like 
[Fragaria vesca subsp. vesca]
Length=245

 Score = 38.9 bits (89),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 14/22 (64%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DRKST G+C F+G NL+SW+S+
Sbjct  132  DRKSTTGFCTFVGGNLVSWRSK  153


 Score = 32.7 bits (73),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 16/28 (57%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K  VV+RSSA  E R+MA   CEL+WL
Sbjct  153  KKQTVVSRSSAEAEYRAMASTACELIWL  180



>emb|CAN68682.1| hypothetical protein VITISV_024814 [Vitis vinifera]
Length=1248

 Score = 39.3 bits (90),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 14/22 (64%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = +2

Query  2     DRKSTFGYCIFLGDNLISWKSR  67
             DR+ST GYC FLG NL++W S+
Sbjct  1104  DRRSTSGYCTFLGGNLVTWMSK  1125


 Score = 32.7 bits (73),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 16/28 (57%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = +1

Query  58    EK*NVVTRSSA*TEDRSMALETCELVWL  141
             +K NVV RSSA  E ++MA   CEL+WL
Sbjct  1125  KKQNVVARSSAEAEFQAMAQGVCELLWL  1152



>emb|CAN73405.1| hypothetical protein VITISV_010053 [Vitis vinifera]
Length=768

 Score = 40.8 bits (94),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 14/22 (64%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST GYC FLG NL++W+S+
Sbjct  624  DRRSTTGYCTFLGGNLVTWRSK  645


 Score = 30.8 bits (68),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 15/28 (54%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K NVV RS A +E R++A   CEL+WL
Sbjct  645  KKQNVVARSFAKSEFRAIAQGLCELLWL  672



>ref|XP_010088511.1| hypothetical protein L484_009995 [Morus notabilis]
 gb|EXB36428.1| hypothetical protein L484_009995 [Morus notabilis]
Length=744

 Score = 40.4 bits (93),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 15/22 (68%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST GYC FLG NLI+W+S+
Sbjct  626  DRRSTTGYCTFLGGNLITWRSK  647


 Score = 31.2 bits (69),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 16/28 (57%), Positives = 19/28 (68%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K NVV RSSA  E R +A   CEL+WL
Sbjct  647  KKQNVVARSSAEAEFRGVAQGMCELLWL  674



>emb|CAN69359.1| hypothetical protein VITISV_024911 [Vitis vinifera]
Length=696

 Score = 37.7 bits (86),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 14/22 (64%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DRKST GYC F+  NL++WKS+
Sbjct  552  DRKSTSGYCTFVXGNLVTWKSK  573


 Score = 33.9 bits (76),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 16/28 (57%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K  VV++SSA  E R+MA  TCEL+WL
Sbjct  573  KKQTVVSKSSAEAEYRAMAHTTCELIWL  600



>emb|CAN71693.1| hypothetical protein VITISV_012128 [Vitis vinifera]
Length=477

 Score = 40.4 bits (93),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 14/22 (64%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST GYC FLG NL++W+S+
Sbjct  333  DRRSTSGYCTFLGGNLVTWRSK  354


 Score = 31.2 bits (69),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 15/28 (54%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K NVV RSSA ++ R +A   CEL+WL
Sbjct  354  KKQNVVARSSAESDFRVIAQGLCELLWL  381



>gb|ABA95230.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=936

 Score = 42.0 bits (97),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 14/22 (64%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST GYC+F+G NL+SW+S+
Sbjct  792  DRRSTSGYCVFIGGNLVSWRSK  813


 Score = 29.3 bits (64),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 14/28 (50%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K +VV+RS+A  E RSM++   EL+WL
Sbjct  813  KKQSVVSRSTAEAEYRSMSMSLSELLWL  840



>emb|CAN70670.1| hypothetical protein VITISV_037507 [Vitis vinifera]
Length=722

 Score = 37.7 bits (86),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 15/22 (68%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST  YC FLG NLI WKS+
Sbjct  578  DRRSTSDYCTFLGGNLIMWKSK  599


 Score = 33.9 bits (76),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 14/24 (58%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = +1

Query  70   VVTRSSA*TEDRSMALETCELVWL  141
            +V RSSA TE +++AL  CEL+WL
Sbjct  603  IVARSSAETEFKALALRICELIWL  626



>ref|XP_004310176.1| PREDICTED: uncharacterized protein LOC101315202 [Fragaria vesca 
subsp. vesca]
Length=1149

 Score = 38.1 bits (87),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 14/21 (67%), Positives = 18/21 (86%), Gaps = 0/21 (0%)
 Frame = +2

Query  5    RKSTFGYCIFLGDNLISWKSR  67
            R+S  GYCIFLG +L+SWKS+
Sbjct  735  RRSITGYCIFLGKSLVSWKSK  755


 Score = 33.1 bits (74),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 16/28 (57%), Positives = 18/28 (64%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K   V+RSS   E RSMA  TCEL WL
Sbjct  755  KKQTTVSRSSVEAEYRSMAAATCELSWL  782



>emb|CAN77522.1| hypothetical protein VITISV_005922 [Vitis vinifera]
Length=326

 Score = 41.6 bits (96),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 15/22 (68%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DRKST GYC FLG NL++W+S+
Sbjct  224  DRKSTTGYCTFLGGNLVTWRSK  245


 Score = 29.6 bits (65),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 15/28 (54%), Positives = 19/28 (68%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K NVV RS A +E R +A   CEL+WL
Sbjct  245  KKQNVVARSFAESEFRVIAQGLCELLWL  272



>emb|CAN76639.1| hypothetical protein VITISV_027481 [Vitis vinifera]
Length=579

 Score = 41.6 bits (96),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 15/22 (68%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST GYC FLG NL++WKS+
Sbjct  475  DRRSTTGYCTFLGGNLVTWKSK  496


 Score = 29.6 bits (65),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 15/28 (54%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K NVV RSSA +E + +A   CEL+WL
Sbjct  496  KKQNVVARSSAESEFKVIAQGLCELLWL  523



>ref|XP_010545866.1| PREDICTED: uncharacterized protein LOC104818105 [Tarenaya hassleriana]
Length=784

 Score = 40.4 bits (93),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 14/21 (67%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  5    RKSTFGYCIFLGDNLISWKSR  67
            R+ST G+C+FLGD+LISWK++
Sbjct  639  RRSTSGFCVFLGDSLISWKAK  659


 Score = 30.8 bits (68),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 15/28 (54%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K + ++RSS   E RS+A  TCELVWL
Sbjct  659  KKQSTISRSSTEAEYRSLANVTCELVWL  686



>emb|CAN76658.1| hypothetical protein VITISV_025162 [Vitis vinifera]
Length=645

 Score = 37.4 bits (85),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 13/21 (62%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = +2

Query  5    RKSTFGYCIFLGDNLISWKSR  67
            R+S  G+CIFLG++L+SWKS+
Sbjct  551  RRSISGFCIFLGNSLVSWKSK  571


 Score = 33.9 bits (76),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 17/28 (61%), Positives = 19/28 (68%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K N V RSSA  E R+M   TCELVWL
Sbjct  571  KKQNTVPRSSAEVEYRAMXNVTCELVWL  598



>emb|CAN83464.1| hypothetical protein VITISV_030945 [Vitis vinifera]
Length=274

 Score = 38.1 bits (87),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 14/22 (64%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            D +ST  YC+F+G NLISWKS+
Sbjct  186  DXRSTSXYCVFIGGNLISWKSK  207


 Score = 33.5 bits (75),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 15/28 (54%), Positives = 19/28 (68%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K +   RSS   E R+MAL TCEL+WL
Sbjct  207  KKQDXXARSSXEAEYRAMALATCELIWL  234



>emb|CAN65144.1| hypothetical protein VITISV_026080 [Vitis vinifera]
Length=1220

 Score = 37.0 bits (84),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 12/20 (60%), Positives = 17/20 (85%), Gaps = 0/20 (0%)
 Frame = +2

Query  8     KSTFGYCIFLGDNLISWKSR  67
             +ST GYC+F G NL++WKS+
Sbjct  1078  RSTTGYCVFFGGNLVAWKSK  1097


 Score = 34.3 bits (77),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 15/28 (54%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +1

Query  58    EK*NVVTRSSA*TEDRSMALETCELVWL  141
             +K +VV+RSSA +E R+MA  TCE++W+
Sbjct  1097  KKQSVVSRSSAESEYRAMAQATCEIIWI  1124



>emb|CAN74241.1| hypothetical protein VITISV_006638 [Vitis vinifera]
Length=1280

 Score = 37.0 bits (84),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 12/20 (60%), Positives = 17/20 (85%), Gaps = 0/20 (0%)
 Frame = +2

Query  8     KSTFGYCIFLGDNLISWKSR  67
             +ST GYC+F G NL++WKS+
Sbjct  1138  RSTTGYCVFFGGNLVAWKSK  1157


 Score = 34.3 bits (77),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 15/28 (54%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +1

Query  58    EK*NVVTRSSA*TEDRSMALETCELVWL  141
             +K +VV+RSSA +E R+MA  TCE++W+
Sbjct  1157  KKQSVVSRSSAESEYRAMAQATCEIIWI  1184



>emb|CAN67120.1| hypothetical protein VITISV_017484 [Vitis vinifera]
Length=1179

 Score = 43.1 bits (100),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2     DRKSTFGYCIFLGDNLISWKSR  67
             DR+ST GYC+F+G NLISWKS+
Sbjct  1053  DRRSTSGYCVFVGGNLISWKSK  1074


 Score = 27.7 bits (60),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 14/24 (58%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = +1

Query  58    EK*NVVTRSSA*TEDRSMALETCE  129
             +K +VV R SA  E R+MAL TCE
Sbjct  1074  KKQDVVARLSAEVEYRAMALATCE  1097



>ref|XP_008343253.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103406004 
[Malus domestica]
Length=921

 Score = 41.2 bits (95),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 15/21 (71%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  5    RKSTFGYCIFLGDNLISWKSR  67
            R+ST GYC+FLG++LISWKS+
Sbjct  778  RRSTTGYCVFLGNSLISWKSK  798


 Score = 29.6 bits (65),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 14/23 (61%), Positives = 15/23 (65%), Gaps = 0/23 (0%)
 Frame = +1

Query  73   VTRSSA*TEDRSMALETCELVWL  141
            V+ SSA  E RSMA   CEL WL
Sbjct  803  VSLSSAEAEYRSMAAACCELAWL  825



>ref|XP_008372142.1| PREDICTED: uncharacterized protein LOC103435525 [Malus domestica]
Length=1565

 Score = 38.1 bits (87),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 13/22 (59%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +2

Query  2     DRKSTFGYCIFLGDNLISWKSR  67
             DRKST  +C+F+G NL++WKS+
Sbjct  1506  DRKSTTSFCMFVGGNLVTWKSK  1527


 Score = 32.7 bits (73),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = +1

Query  58    EK*NVVTRSSA*TEDRSMALETCELVWL  141
             +K +VV RSSA  E R+MA   CEL+WL
Sbjct  1527  KKQSVVARSSAEAEYRAMASTACELIWL  1554



>ref|XP_009139303.1| PREDICTED: uncharacterized protein LOC103863290 [Brassica rapa]
Length=1266

 Score = 35.4 bits (80),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 12/21 (57%), Positives = 18/21 (86%), Gaps = 0/21 (0%)
 Frame = +2

Query  5     RKSTFGYCIFLGDNLISWKSR  67
             R+S  G+C++LG +LISWKS+
Sbjct  1116  RRSITGFCVYLGTSLISWKSK  1136


 Score = 35.4 bits (80),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 16/28 (57%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  58    EK*NVVTRSSA*TEDRSMALETCELVWL  141
             +K +VV+RSS   E RS+AL TCE++WL
Sbjct  1136  KKQSVVSRSSTEAEYRSLALTTCEIIWL  1163



>ref|XP_006605045.1| PREDICTED: uncharacterized mitochondrial protein AtMg00810-like 
[Glycine max]
Length=265

 Score = 41.2 bits (95),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 15/22 (68%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST GYC FLG NL++WKS+
Sbjct  211  DRRSTTGYCTFLGGNLVTWKSK  232


 Score = 29.6 bits (65),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 15/28 (54%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K +VV RSSA  + R+MA   CEL+WL
Sbjct  232  KKQSVVARSSAKAKFRAMAQGICELLWL  259



>emb|CAN71812.1| hypothetical protein VITISV_037409 [Vitis vinifera]
Length=621

 Score = 38.5 bits (88),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 13/22 (59%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST  YC FLG+NL++W+S+
Sbjct  477  DRRSTSEYCTFLGENLVTWRSK  498


 Score = 32.3 bits (72),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 16/28 (57%), Positives = 19/28 (68%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K NVV RSSA  E R+MA   C L+WL
Sbjct  498  KKQNVVARSSAEAEFRAMAQGVCXLLWL  525



>ref|XP_004295380.1| PREDICTED: uncharacterized protein LOC101310880 [Fragaria vesca 
subsp. vesca]
Length=3881

 Score = 38.1 bits (87),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 14/21 (67%), Positives = 18/21 (86%), Gaps = 0/21 (0%)
 Frame = +2

Query  5     RKSTFGYCIFLGDNLISWKSR  67
             R+S  GYCIFLG +L+SWKS+
Sbjct  2918  RRSVTGYCIFLGQSLVSWKSK  2938


 Score = 32.7 bits (73),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 15/23 (65%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = +1

Query  73    VTRSSA*TEDRSMALETCELVWL  141
             V+RSSA  E RSMA+  CEL WL
Sbjct  2943  VSRSSAEAEYRSMAVAACELTWL  2965



>ref|XP_007024405.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 8, putative 
[Theobroma cacao]
 gb|EOY27027.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 8, putative 
[Theobroma cacao]
Length=148

 Score = 40.0 bits (92),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 14/21 (67%), Positives = 18/21 (86%), Gaps = 0/21 (0%)
 Frame = +2

Query  5   RKSTFGYCIFLGDNLISWKSR  67
           RKS  GYC+F+GD L+SWKS+
Sbjct  5   RKSITGYCVFIGDTLVSWKSK  25


 Score = 30.8 bits (68),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = +1

Query  70   VVTRSSA*TEDRSMALETCELVWL  141
            VV RSSA  E RSMA   CEL+WL
Sbjct  29   VVARSSAEAEYRSMASTCCELMWL  52



>ref|XP_007027564.1| Uncharacterized protein TCM_022381 [Theobroma cacao]
 gb|EOY08066.1| Uncharacterized protein TCM_022381 [Theobroma cacao]
Length=331

 Score = 40.0 bits (92),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 15/21 (71%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = +2

Query  5    RKSTFGYCIFLGDNLISWKSR  67
            RKS  GYCIF+GD+L+SWKS+
Sbjct  188  RKSVTGYCIFVGDSLVSWKSK  208


 Score = 30.8 bits (68),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 14/28 (50%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K +V+ R+SA  E RSMA   CE++WL
Sbjct  208  KKQSVMARNSAKAECRSMAATCCEIIWL  235



>gb|AAP54332.2| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=822

 Score = 42.0 bits (97),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 14/22 (64%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST GYC+F+G NL+SW+S+
Sbjct  678  DRRSTSGYCVFIGGNLVSWRSK  699


 Score = 28.5 bits (62),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K +VV+RS+A  E RSM++   EL+WL
Sbjct  699  KKESVVSRSTAEAEYRSMSMSLSELLWL  726



>emb|CAN76494.1| hypothetical protein VITISV_024984 [Vitis vinifera]
Length=988

 Score = 40.8 bits (94),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 14/22 (64%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+STFGYC F+G NL+ W+S+
Sbjct  856  DRRSTFGYCSFVGGNLVMWRSK  877


 Score = 29.6 bits (65),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 14/28 (50%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K NVV RSSA  E R++A   CE++W+
Sbjct  877  KKQNVVARSSAKAEFRAVAHGICEIMWI  904



>ref|XP_008369116.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103432693 
[Malus domestica]
Length=1051

 Score = 40.8 bits (94),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 15/20 (75%), Positives = 19/20 (95%), Gaps = 0/20 (0%)
 Frame = +2

Query  8    KSTFGYCIFLGDNLISWKSR  67
            +ST GYC+FLGD+LISWKS+
Sbjct  909  RSTTGYCVFLGDSLISWKSK  928


 Score = 29.6 bits (65),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 15/28 (54%), Positives = 17/28 (61%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K   V+ SSA  E RSMA   CEL WL
Sbjct  928  KKQKTVSLSSAEAEYRSMAATCCELTWL  955



>emb|CCI55442.1| PH01B031C15.25 [Phyllostachys edulis]
Length=1126

 Score = 40.4 bits (93),  Expect(2) = 3e-04, Method: Composition-based stats.
 Identities = 15/22 (68%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +2

Query  2     DRKSTFGYCIFLGDNLISWKSR  67
             DR+S  GYCIFLG +LI+WKS+
Sbjct  1047  DRRSVSGYCIFLGSSLITWKSK  1068


 Score = 30.0 bits (66),  Expect(2) = 3e-04, Method: Composition-based stats.
 Identities = 15/28 (54%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = +1

Query  58    EK*NVVTRSSA*TEDRSMALETCELVWL  141
             +K  VV+RSSA  E R++A  T E+VWL
Sbjct  1068  KKQTVVSRSSAEAELRALATTTSEIVWL  1095



>ref|XP_003630831.1| 50S ribosomal protein L17 [Medicago truncatula]
Length=438

 Score = 41.6 bits (96),  Expect(2) = 3e-04, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST  YCIF+G NLISWKS+
Sbjct  228  DRRSTSSYCIFVGGNLISWKSK  249


 Score = 28.9 bits (63),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 18/28 (64%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K  VV RSS   E R+MA  T ELVWL
Sbjct  249  KKQTVVARSSTEAEYRAMAHATSELVWL  276



>gb|AAM91874.1| putative copia-like polyprotein [Oryza sativa Japonica Group]
Length=894

 Score = 42.0 bits (97),  Expect(2) = 3e-04, Method: Composition-based stats.
 Identities = 14/22 (64%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST GYC+F+G NL+SW+S+
Sbjct  750  DRRSTSGYCVFIGGNLVSWRSK  771


 Score = 28.5 bits (62),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K +VV+RS+A  E RSM++   EL+WL
Sbjct  771  KKESVVSRSTAEAEYRSMSMSLSELLWL  798



>emb|CAN81001.1| hypothetical protein VITISV_006992 [Vitis vinifera]
Length=1131

 Score = 37.0 bits (84),  Expect(2) = 3e-04, Method: Composition-based stats.
 Identities = 14/21 (67%), Positives = 17/21 (81%), Gaps = 0/21 (0%)
 Frame = +2

Query  5     RKSTFGYCIFLGDNLISWKSR  67
             R+S  GYCIFLG  LISWK++
Sbjct  988   RRSVTGYCIFLGGALISWKTK  1008


 Score = 33.5 bits (75),  Expect(2) = 3e-04, Method: Composition-based stats.
 Identities = 16/28 (57%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = +1

Query  58    EK*NVVTRSSA*TEDRSMALETCELVWL  141
             +K   V+RSSA +E R+MA  TCEL WL
Sbjct  1008  KKQTTVSRSSAESEYRAMASITCELTWL  1035



>emb|CAN77135.1| hypothetical protein VITISV_021719 [Vitis vinifera]
Length=1087

 Score = 40.8 bits (94),  Expect(2) = 3e-04, Method: Composition-based stats.
 Identities = 14/22 (64%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST GYC FLG NL++W+S+
Sbjct  974  DRRSTAGYCTFLGGNLVTWRSK  995


 Score = 29.6 bits (65),  Expect(2) = 3e-04, Method: Composition-based stats.
 Identities = 14/28 (50%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = +1

Query  58    EK*NVVTRSSA*TEDRSMALETCELVWL  141
             +K N++ RSSA +E R +A   CEL+WL
Sbjct  995   KKQNMIARSSAESEFRGIAQGLCELLWL  1022



>ref|XP_007048482.1| Uncharacterized protein TCM_001554 [Theobroma cacao]
 gb|EOX92639.1| Uncharacterized protein TCM_001554 [Theobroma cacao]
Length=694

 Score = 37.7 bits (86),  Expect(2) = 3e-04, Method: Composition-based stats.
 Identities = 14/22 (64%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DRKST  YC+F+  NL+SWKS+
Sbjct  558  DRKSTTRYCMFVAGNLVSWKSK  579


 Score = 32.7 bits (73),  Expect(2) = 3e-04, Method: Composition-based stats.
 Identities = 15/28 (54%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K NV  RSSA +E R+MA  TC+L+W+
Sbjct  579  KKQNVAARSSAESEYRAMAQTTCKLMWI  606



>emb|CAN74819.1| hypothetical protein VITISV_034590 [Vitis vinifera]
Length=970

 Score = 36.2 bits (82),  Expect(2) = 3e-04, Method: Composition-based stats.
 Identities = 11/21 (52%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = +2

Query  5    RKSTFGYCIFLGDNLISWKSR  67
            ++S  G+C+F+GD+L+SWKS+
Sbjct  845  KRSISGFCVFIGDSLVSWKSK  865


 Score = 33.9 bits (76),  Expect(2) = 3e-04, Method: Composition-based stats.
 Identities = 16/28 (57%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K + V+RSSA  E RSMA  TCEL+W+
Sbjct  865  KKQHTVSRSSAEAEYRSMANATCELMWM  892



>ref|XP_004487728.1| PREDICTED: uncharacterized protein LOC101496141 [Cicer arietinum]
Length=562

 Score = 41.2 bits (95),  Expect(2) = 3e-04, Method: Composition-based stats.
 Identities = 16/21 (76%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = +2

Query  5    RKSTFGYCIFLGDNLISWKSR  67
            RKS  G+CIFLGD+LISWKS+
Sbjct  427  RKSITGFCIFLGDSLISWKSK  447


 Score = 28.9 bits (63),  Expect(2) = 3e-04, Method: Composition-based stats.
 Identities = 13/23 (57%), Positives = 15/23 (65%), Gaps = 0/23 (0%)
 Frame = +1

Query  73   VTRSSA*TEDRSMALETCELVWL  141
            V+RSS   E R+MA   CEL WL
Sbjct  452  VSRSSTEAEYRAMASTVCELQWL  474



>ref|XP_007017134.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 8, putative 
[Theobroma cacao]
 gb|EOY14359.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 8, putative 
[Theobroma cacao]
Length=442

 Score = 38.9 bits (89),  Expect(2) = 3e-04, Method: Composition-based stats.
 Identities = 14/21 (67%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = +2

Query  5    RKSTFGYCIFLGDNLISWKSR  67
            R+S  G+C+FLGD+LISWKS+
Sbjct  329  RRSVTGFCVFLGDSLISWKSK  349


 Score = 31.2 bits (69),  Expect(2) = 3e-04, Method: Composition-based stats.
 Identities = 13/24 (54%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = +1

Query  70   VVTRSSA*TEDRSMALETCELVWL  141
            VV RSS   + R+MA  TCE++WL
Sbjct  353  VVARSSTEAKYRAMAATTCEVIWL  376



>emb|CAN65748.1| hypothetical protein VITISV_042183 [Vitis vinifera]
Length=322

 Score = 38.1 bits (87),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 14/22 (64%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST  YC FLG NL++WKS+
Sbjct  178  DRRSTIKYCTFLGSNLVTWKSK  199


 Score = 32.0 bits (71),  Expect(2) = 4e-04, Method: Composition-based stats.
 Identities = 16/28 (57%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K NVV RSSA +E R +A   CEL+WL
Sbjct  199  KKQNVVVRSSAESEFRVIAQGLCELLWL  226



>emb|CAN74229.1| hypothetical protein VITISV_000584 [Vitis vinifera]
Length=1039

 Score = 38.1 bits (87),  Expect(2) = 4e-04, Method: Composition-based stats.
 Identities = 14/21 (67%), Positives = 18/21 (86%), Gaps = 0/21 (0%)
 Frame = +2

Query  5    RKSTFGYCIFLGDNLISWKSR  67
            R+S  GYCIFLG+ LISWK++
Sbjct  896  RRSVTGYCIFLGEALISWKTK  916


 Score = 32.0 bits (71),  Expect(2) = 4e-04, Method: Composition-based stats.
 Identities = 15/28 (54%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K   V+RSSA +E ++MA  TCEL WL
Sbjct  916  KKQTTVSRSSAESEYQAMASITCELTWL  943



>ref|XP_007050265.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 8 [Theobroma 
cacao]
 gb|EOX94422.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 8 [Theobroma 
cacao]
Length=276

 Score = 36.6 bits (83),  Expect(2) = 4e-04, Method: Composition-based stats.
 Identities = 14/22 (64%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DRKST GYC+ +  NL+SWKS+
Sbjct  209  DRKSTTGYCLLMAGNLVSWKSK  230


 Score = 33.1 bits (74),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K NVV RSSA  E  +MAL TCEL+W+
Sbjct  230  KKQNVVARSSAEFEYCTMALTTCELMWI  257



>ref|XP_004508230.1| PREDICTED: uncharacterized mitochondrial protein AtMg00810-like 
[Cicer arietinum]
Length=266

 Score = 35.0 bits (79),  Expect(2) = 4e-04, Method: Composition-based stats.
 Identities = 13/22 (59%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST GY + +G NLISW+S+
Sbjct  217  DRRSTSGYGVLVGGNLISWQSK  238


 Score = 35.0 bits (79),  Expect(2) = 4e-04, Method: Composition-based stats.
 Identities = 16/28 (57%), Positives = 19/28 (68%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K N+V RSSA  E R+MA   CEL WL
Sbjct  238  KKQNIVARSSAEAEYRAMAAMACELTWL  265



>emb|CAN63917.1| hypothetical protein VITISV_019573 [Vitis vinifera]
Length=569

 Score = 40.0 bits (92),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+STFGYC+F+  NLISWK+ 
Sbjct  530  DRRSTFGYCVFIRGNLISWKTE  551


 Score = 30.0 bits (66),  Expect(2) = 4e-04, Method: Composition-based stats.
 Identities = 11/16 (69%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = +1

Query  94   TEDRSMALETCELVWL  141
            TE R+M L TCEL+WL
Sbjct  550  TEYRAMTLATCELIWL  565



>gb|ABA93730.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=656

 Score = 41.6 bits (96),  Expect(2) = 4e-04, Method: Composition-based stats.
 Identities = 14/22 (64%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST GYC+F+G NL+SW+S+
Sbjct  512  DRRSTSGYCVFVGGNLVSWRSK  533


 Score = 28.1 bits (61),  Expect(2) = 4e-04, Method: Composition-based stats.
 Identities = 12/24 (50%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = +1

Query  70   VVTRSSA*TEDRSMALETCELVWL  141
            VV RS+A  E R+MAL   E++W+
Sbjct  537  VVARSTAEAEYRAMALSLSEMLWM  560



>emb|CAN63235.1| hypothetical protein VITISV_040120 [Vitis vinifera]
Length=317

 Score = 40.8 bits (94),  Expect(2) = 4e-04, Method: Composition-based stats.
 Identities = 14/22 (64%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST GYC+F G NL++WKS+
Sbjct  173  DRRSTTGYCVFFGGNLVAWKSK  194


 Score = 28.9 bits (63),  Expect(2) = 4e-04, Method: Composition-based stats.
 Identities = 13/28 (46%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K +VV+  SA +E R+MA  TCE++W+
Sbjct  194  KKQSVVSXLSAESEYRAMAQATCEIIWI  221



>ref|XP_003600634.1| Mitochondrial protein, putative [Medicago truncatula]
Length=171

 Score = 44.3 bits (103),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 17/22 (77%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  5   RKSTFGYCIFLGDNLISWKSRM  70
           R+ST GYC+FLGDNLISW S+M
Sbjct  52  RRSTSGYCVFLGDNLISWFSKM  73



>ref|XP_006605007.1| PREDICTED: uncharacterized mitochondrial protein AtMg00810-like 
[Glycine max]
Length=298

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 16/21 (76%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  5    RKSTFGYCIFLGDNLISWKSR  67
            R+STFGYC+FLGDNLISW ++
Sbjct  148  RRSTFGYCVFLGDNLISWSAK  168



>emb|CAN71748.1| hypothetical protein VITISV_019194 [Vitis vinifera]
Length=1306

 Score = 37.0 bits (84),  Expect(2) = 4e-04, Method: Composition-based stats.
 Identities = 12/20 (60%), Positives = 17/20 (85%), Gaps = 0/20 (0%)
 Frame = +2

Query  8     KSTFGYCIFLGDNLISWKSR  67
             +ST GYC+F G NL++WKS+
Sbjct  1164  RSTTGYCVFFGGNLVAWKSK  1183


 Score = 32.7 bits (73),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +1

Query  58    EK*NVVTRSSA*TEDRSMALETCELVWL  141
             +K +VV+RSSA +E R+M+  TCE++W+
Sbjct  1183  KKQSVVSRSSAESEYRAMSQATCEIIWI  1210



>ref|XP_010513509.1| PREDICTED: uncharacterized protein LOC104789522 [Camelina sativa]
Length=1391

 Score = 39.7 bits (91),  Expect(2) = 5e-04, Method: Composition-based stats.
 Identities = 14/22 (64%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DRKST GYC F+G NL++W+S+
Sbjct  938  DRKSTGGYCTFVGGNLVTWRSK  959


 Score = 29.6 bits (65),  Expect(2) = 5e-04, Method: Composition-based stats.
 Identities = 17/28 (61%), Positives = 19/28 (68%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K  VV RSSA  E RSMA  T EL+WL
Sbjct  959  KKQKVVPRSSAEAEYRSMADTTDELIWL  986



>emb|CAE04751.3| OSJNBb0060E08.14 [Oryza sativa Japonica Group]
Length=917

 Score = 39.3 bits (90),  Expect(2) = 5e-04, Method: Composition-based stats.
 Identities = 13/22 (59%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            D +ST GYC+F+G NL+SW+S+
Sbjct  439  DMRSTSGYCVFIGGNLVSWRSK  460


 Score = 30.4 bits (67),  Expect(2) = 5e-04, Method: Composition-based stats.
 Identities = 14/28 (50%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K +VV+RS+A  E RSM++   EL+WL
Sbjct  460  KKQSVVSRSTAEAEYRSMSMSLSELLWL  487



>emb|CAN60648.1| hypothetical protein VITISV_033947 [Vitis vinifera]
Length=1257

 Score = 34.7 bits (78),  Expect(2) = 5e-04, Method: Composition-based stats.
 Identities = 11/20 (55%), Positives = 16/20 (80%), Gaps = 0/20 (0%)
 Frame = +2

Query  8     KSTFGYCIFLGDNLISWKSR  67
             +ST GYC+F   NL++WKS+
Sbjct  1116  RSTIGYCVFFDGNLVAWKSK  1135


 Score = 34.7 bits (78),  Expect(2) = 5e-04, Method: Composition-based stats.
 Identities = 15/28 (54%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +1

Query  58    EK*NVVTRSSA*TEDRSMALETCELVWL  141
             +K +VV+RSSA +E R+MA  TCE++W+
Sbjct  1135  KKQSVVSRSSAESEYRAMAQATCEIIWI  1162



>emb|CAB10225.1| retrovirus-related like polyprotein [Arabidopsis thaliana]
 emb|CAB78488.1| retrovirus-related like polyprotein [Arabidopsis thaliana]
Length=1489

 Score = 35.8 bits (81),  Expect(2) = 5e-04, Method: Composition-based stats.
 Identities = 13/21 (62%), Positives = 18/21 (86%), Gaps = 0/21 (0%)
 Frame = +2

Query  5     RKSTFGYCIFLGDNLISWKSR  67
             R+S  G+CI+LG +LISWKS+
Sbjct  1341  RRSISGFCIYLGTSLISWKSK  1361


 Score = 33.9 bits (76),  Expect(2) = 5e-04, Method: Composition-based stats.
 Identities = 14/24 (58%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = +1

Query  70    VVTRSSA*TEDRSMALETCELVWL  141
             V +RSS  +E RSMA  TCE++WL
Sbjct  1365  VASRSSTESEYRSMAQATCEIIWL  1388



>gb|KHN07234.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, 
partial [Glycine soja]
Length=172

 Score = 35.0 bits (79),  Expect(2) = 5e-04, Method: Composition-based stats.
 Identities = 14/22 (64%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = +2

Query  2   DRKSTFGYCIFLGDNLISWKSR  67
           DR+ST GYCIF+G N+I  KS+
Sbjct  68  DRRSTSGYCIFIGGNVIYRKSK  89


 Score = 34.7 bits (78),  Expect(2) = 5e-04, Method: Composition-based stats.
 Identities = 17/28 (61%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K  VV RSSA  E RSMA+ TCEL+W+
Sbjct  89   KKQTVVARSSAEAEYRSMAMVTCELMWI  116



>emb|CAN80469.1| hypothetical protein VITISV_008623 [Vitis vinifera]
Length=1041

 Score = 38.5 bits (88),  Expect(2) = 5e-04, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K +VV RSSA  E R+MAL TCEL+WL
Sbjct  918  KKQDVVARSSAEAEYRAMALATCELIWL  945


 Score = 31.2 bits (69),  Expect(2) = 5e-04, Method: Composition-based stats.
 Identities = 11/22 (50%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            +++S   YC+F+  NLISWKS+
Sbjct  897  EQRSYSXYCVFIXGNLISWKSK  918



>ref|XP_007045431.1| Cysteine-rich RLK 8, putative [Theobroma cacao]
 gb|EOY01263.1| Cysteine-rich RLK 8, putative [Theobroma cacao]
Length=355

 Score = 38.1 bits (87),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 14/21 (67%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = +2

Query  5    RKSTFGYCIFLGDNLISWKSR  67
            RKS  G+CIF+GD+L+SWKS+
Sbjct  202  RKSVTGFCIFIGDSLVSWKSK  222


 Score = 31.6 bits (70),  Expect(2) = 5e-04, Method: Composition-based stats.
 Identities = 15/28 (54%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K +VV RSSA  E RSMA   CE++W+
Sbjct  222  KKQSVVARSSAEAEYRSMASVCCEMIWI  249



>emb|CAN74290.1| hypothetical protein VITISV_036414 [Vitis vinifera]
Length=584

 Score = 35.8 bits (81),  Expect(2) = 5e-04, Method: Composition-based stats.
 Identities = 13/22 (59%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST GY  F+G NL++WKS+
Sbjct  440  DRRSTSGYFTFVGGNLVTWKSK  461


 Score = 33.9 bits (76),  Expect(2) = 5e-04, Method: Composition-based stats.
 Identities = 17/28 (61%), Positives = 19/28 (68%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K NVV RSSA  E R MAL  CE +WL
Sbjct  461  KKQNVVARSSAEAEFRGMALGLCEALWL  488



>emb|CAN61724.1| hypothetical protein VITISV_035360 [Vitis vinifera]
Length=169

 Score = 37.0 bits (84),  Expect(2) = 6e-04, Method: Composition-based stats.
 Identities = 17/28 (61%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K +VV RSS   E R+MAL TCEL+WL
Sbjct  46   KKQDVVARSSXEAEYRAMALATCELIWL  73


 Score = 32.7 bits (73),  Expect(2) = 6e-04, Method: Composition-based stats.
 Identities = 12/18 (67%), Positives = 15/18 (83%), Gaps = 0/18 (0%)
 Frame = +2

Query  14  TFGYCIFLGDNLISWKSR  67
           T  YC+F+G NLISWKS+
Sbjct  29  TSXYCVFIGGNLISWKSK  46



>ref|XP_010313166.1| PREDICTED: uncharacterized protein LOC104644711 [Solanum lycopersicum]
Length=202

 Score = 36.6 bits (83),  Expect(2) = 6e-04, Method: Composition-based stats.
 Identities = 14/22 (64%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST GYC+ +  NLISWKS+
Sbjct  153  DRRSTSGYCVLIRGNLISWKSK  174


 Score = 32.7 bits (73),  Expect(2) = 6e-04, Method: Compositional matrix adjust.
 Identities = 14/24 (58%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = +1

Query  70   VVTRSSA*TEDRSMALETCELVWL  141
            V+ RSSA  E R+M L TCE++WL
Sbjct  178  VIARSSAEAESRAMELTTCEIIWL  201



>emb|CAN73189.1| hypothetical protein VITISV_042346 [Vitis vinifera]
Length=1137

 Score = 37.4 bits (85),  Expect(2) = 6e-04, Method: Composition-based stats.
 Identities = 12/22 (55%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = +2

Query  2     DRKSTFGYCIFLGDNLISWKSR  67
             D++ST GYC+F   NL++WKS+
Sbjct  993   DKRSTTGYCVFFDGNLVAWKSK  1014


 Score = 32.0 bits (71),  Expect(2) = 6e-04, Method: Composition-based stats.
 Identities = 14/28 (50%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  58    EK*NVVTRSSA*TEDRSMALETCELVWL  141
             +K +VV+ SSA +E R+MA  TCE++W+
Sbjct  1014  KKQSVVSHSSAESEYRAMAQATCEIIWI  1041



>ref|XP_008374297.1| PREDICTED: uncharacterized protein LOC103437591 [Malus domestica]
Length=1210

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 18/22 (82%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2     DRKSTFGYCIFLGDNLISWKSR  67
             DR+ST GYCIFLGDNLISW S+
Sbjct  1039  DRRSTGGYCIFLGDNLISWSSK  1060



>emb|CAN76546.1| hypothetical protein VITISV_010420 [Vitis vinifera]
Length=1288

 Score = 36.6 bits (83),  Expect(2) = 6e-04, Method: Composition-based stats.
 Identities = 12/21 (57%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = +2

Query  5     RKSTFGYCIFLGDNLISWKSR  67
             R+S  G+C+FLG++L+SWKS+
Sbjct  1145  RRSVTGFCVFLGNSLVSWKSK  1165


 Score = 32.3 bits (72),  Expect(2) = 6e-04, Method: Composition-based stats.
 Identities = 14/28 (50%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +1

Query  58    EK*NVVTRSSA*TEDRSMALETCELVWL  141
             +K ++V+RSSA  E R+MA  +CE+ WL
Sbjct  1165  KKQHIVSRSSAEAEYRAMANTSCEITWL  1192



>ref|XP_006605036.1| PREDICTED: uncharacterized mitochondrial protein AtMg00810-like 
[Glycine max]
Length=169

 Score = 35.8 bits (81),  Expect(2) = 7e-04, Method: Compositional matrix adjust.
 Identities = 14/21 (67%), Positives = 18/21 (86%), Gaps = 0/21 (0%)
 Frame = +2

Query  5    RKSTFGYCIFLGDNLISWKSR  67
            RKST GYC+F+  N+ISWKS+
Sbjct  89   RKSTTGYCVFIRGNIISWKSK  109


 Score = 33.5 bits (75),  Expect(2) = 7e-04, Method: Composition-based stats.
 Identities = 14/28 (50%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K ++V +S+A  E R+MA+ TCELVW+
Sbjct  109  KKQDIVAQSNAFAEYRAMAITTCELVWI  136



>emb|CAN68477.1| hypothetical protein VITISV_029627 [Vitis vinifera]
Length=659

 Score = 40.4 bits (93),  Expect(2) = 7e-04, Method: Composition-based stats.
 Identities = 14/22 (64%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST GYC FLG NL++W+S+
Sbjct  515  DRRSTTGYCTFLGGNLVTWRSK  536


 Score = 28.5 bits (62),  Expect(2) = 7e-04, Method: Composition-based stats.
 Identities = 14/28 (50%), Positives = 19/28 (68%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K NVV RSS  ++ R +A   CEL+WL
Sbjct  536  KKQNVVARSSTESKFRVIAQGLCELLWL  563



>ref|XP_006586529.1| PREDICTED: uncharacterized mitochondrial protein AtMg00810-like 
[Glycine max]
Length=168

 Score = 37.4 bits (85),  Expect(2) = 8e-04, Method: Composition-based stats.
 Identities = 14/22 (64%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+S   YC+F+G NLISWKS+
Sbjct  99   DRRSASSYCVFIGGNLISWKSK  120


 Score = 31.6 bits (70),  Expect(2) = 8e-04, Method: Composition-based stats.
 Identities = 14/24 (58%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = +1

Query  70   VVTRSSA*TEDRSMALETCELVWL  141
            VV +S+A  E RSMA+ TCEL+W+
Sbjct  124  VVAQSNAEVEYRSMAMVTCELIWI  147



>emb|CAN83990.1| hypothetical protein VITISV_018454 [Vitis vinifera]
Length=1243

 Score = 36.6 bits (83),  Expect(2) = 8e-04, Method: Composition-based stats.
 Identities = 12/21 (57%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = +2

Query  5     RKSTFGYCIFLGDNLISWKSR  67
             R+S  G+C+FLG++L+SWKS+
Sbjct  1120  RRSVTGFCVFLGNSLVSWKSK  1140


 Score = 32.3 bits (72),  Expect(2) = 8e-04, Method: Composition-based stats.
 Identities = 14/28 (50%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +1

Query  58    EK*NVVTRSSA*TEDRSMALETCELVWL  141
             +K ++V+RSSA  E R+MA  +CE+ WL
Sbjct  1140  KKQHIVSRSSAEAEYRAMANTSCEITWL  1167



>ref|XP_006340058.1| PREDICTED: F-box/LRR-repeat protein At5g02910-like [Solanum tuberosum]
Length=751

 Score = 35.4 bits (80),  Expect(2) = 8e-04, Method: Compositional matrix adjust.
 Identities = 12/22 (55%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST GYC F+ +NL++W+S+
Sbjct  134  DRRSTSGYCTFIWENLVTWRSK  155


 Score = 33.5 bits (75),  Expect(2) = 8e-04, Method: Composition-based stats.
 Identities = 17/28 (61%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K NVV RSSA  E RSMA   CE++WL
Sbjct  155  KKQNVVARSSAEAEYRSMAHGICEMIWL  182



>ref|XP_010098067.1| Copia protein [Morus notabilis]
 gb|EXB74504.1| Copia protein [Morus notabilis]
Length=1671

 Score = 35.8 bits (81),  Expect(2) = 9e-04, Method: Composition-based stats.
 Identities = 12/22 (55%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST GYC F+  NL++W+S+
Sbjct  593  DRRSTSGYCTFVWGNLVTWRSK  614


 Score = 32.7 bits (73),  Expect(2) = 9e-04, Method: Compositional matrix adjust.
 Identities = 15/28 (54%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K NVV+RSSA  E R+MA   CE++W+
Sbjct  614  KKHNVVSRSSAEAEYRAMAHGVCEILWI  641



>gb|AAC33963.1| contains similarity to reverse transcriptases (Pfam; rvt.hmm, 
score: 11.19) [Arabidopsis thaliana]
Length=1633

 Score = 35.0 bits (79),  Expect(2) = 9e-04, Method: Composition-based stats.
 Identities = 12/21 (57%), Positives = 18/21 (86%), Gaps = 0/21 (0%)
 Frame = +2

Query  5     RKSTFGYCIFLGDNLISWKSR  67
             R+S  G+CI+LG +LI+WKS+
Sbjct  1294  RRSVTGFCIYLGTSLITWKSK  1314


 Score = 33.5 bits (75),  Expect(2) = 9e-04, Method: Composition-based stats.
 Identities = 15/28 (54%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  58    EK*NVVTRSSA*TEDRSMALETCELVWL  141
             +K +VV+RSS  +E RS+A  TCE++WL
Sbjct  1314  KKQSVVSRSSTESEYRSLAQATCEIIWL  1341



>emb|CAN77072.1| hypothetical protein VITISV_006213 [Vitis vinifera]
Length=775

 Score = 40.8 bits (94),  Expect(2) = 0.001, Method: Composition-based stats.
 Identities = 14/22 (64%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST GYC FLG NL++W+S+
Sbjct  631  DRRSTTGYCTFLGGNLVTWRSK  652


 Score = 27.7 bits (60),  Expect(2) = 0.001, Method: Composition-based stats.
 Identities = 14/28 (50%), Positives = 18/28 (64%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K NVV RSS  +E R +    CEL+WL
Sbjct  652  KKQNVVARSSIESEFRVITQGLCELLWL  679



>emb|CAN79782.1| hypothetical protein VITISV_002631 [Vitis vinifera]
Length=971

 Score = 35.4 bits (80),  Expect(2) = 0.001, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = +1

Query  58   EK*NVVTRSSA*TEDRSMALETCELVWL  141
            +K NVVTRSSA  E R MAL  CE +WL
Sbjct  874  KKQNVVTRSSAEAEFRGMALGLCEALWL  901


 Score = 33.1 bits (74),  Expect(2) = 0.001, Method: Composition-based stats.
 Identities = 12/22 (55%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    DRKSTFGYCIFLGDNLISWKSR  67
            DR+ST GY  F+  NL++WKS+
Sbjct  853  DRRSTSGYFTFVSGNLVTWKSK  874



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 507653521284