BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c105389_g1_i1 len=686 path=[664:0-685]

Length=686
                                                                      Score     E

ref|XP_004230820.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    259   9e-79   
ref|NP_001275023.1|  ferredoxin--nitrite reductase, chloroplastic...    257   3e-78   
ref|XP_011088260.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    256   6e-78   
ref|XP_010107937.1|  Ferredoxin--nitrite reductase                      254   3e-77   
emb|CDP17819.1|  unnamed protein product                                254   9e-77   
ref|XP_008373138.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    251   7e-76   
gb|AGQ43559.1|  nitrite reductase                                       251   7e-76   
gb|KDO59703.1|  hypothetical protein CISIN_1g047572mg                   251   9e-76   
ref|XP_006487107.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    251   1e-75   
ref|XP_006423019.1|  hypothetical protein CICLE_v10028067mg             250   2e-75   
gb|AAC17127.1|  nitrite reductase                                       249   3e-75   Capsicum annuum
dbj|BAB55003.1|  nitrite reductase                                      248   4e-75   Prunus persica
gb|KDP42275.1|  hypothetical protein JCGZ_01599                         249   5e-75   
ref|XP_006349625.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    249   5e-75   
ref|XP_010548020.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    249   6e-75   
ref|XP_008456121.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    248   1e-74   
ref|XP_007201180.1|  hypothetical protein PRUPE_ppa003315mg             248   1e-74   
gb|ADN97117.1|  nitrite reductase                                       248   1e-74   
ref|XP_010675576.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    248   1e-74   
ref|XP_004248736.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    247   2e-74   
sp|P05314.1|NIR_SPIOL  RecName: Full=Ferredoxin--nitrite reductas...    247   2e-74   Spinacia oleracea
ref|XP_008236500.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    247   3e-74   
ref|XP_002518763.1|  Ferredoxin--nitrite reductase, chloroplast p...    247   3e-74   Ricinus communis
pdb|2AKJ|A  Chain A, Structure Of Spinach Nitrite Reductase             247   3e-74   
sp|P38500.1|NIR_BETPN  RecName: Full=Ferredoxin--nitrite reductas...    246   4e-74   Betula pendula [white birch]
ref|XP_010028471.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    246   4e-74   
ref|XP_004163915.1|  PREDICTED: LOW QUALITY PROTEIN: ferredoxin--...    246   9e-74   
ref|XP_004140695.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    246   9e-74   
gb|AIR07815.1|  nitrite reductase                                       240   2e-73   
gb|ABK95605.1|  unknown                                                 244   3e-73   Populus trichocarpa [western balsam poplar]
ref|XP_006384408.1|  Ferredoxin--nitrite reductase family protein       244   4e-73   
ref|XP_011005977.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    244   4e-73   
ref|XP_004294803.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    243   5e-73   
gb|ADJ68001.1|  nitrite reductase protein                               243   9e-73   
ref|XP_007156512.1|  hypothetical protein PHAVU_003G292100g             242   2e-72   
ref|NP_001268194.1|  ferredoxin--nitrite reductase, chloroplastic...    243   2e-72   
gb|AAA74456.1|  nitrite reductase                                       242   2e-72   Phaseolus vulgaris [French bean]
dbj|BAD93723.1|  ferredoxin--nitrite reductase                          233   2e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003607969.1|  Ferredoxin-nitrite reductase                       242   2e-72   
emb|CDY69481.1|  BnaCnng63770D                                          239   2e-72   
ref|XP_009628462.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    242   3e-72   
ref|XP_003529397.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    241   3e-72   
ref|XP_010263547.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    241   5e-72   
ref|XP_008778364.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    238   5e-72   
ref|XP_010530781.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    241   7e-72   
gb|KHN37511.1|  Ferredoxin--nitrite reductase, chloroplastic            241   7e-72   
ref|XP_009346246.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    240   9e-72   
emb|CAC06095.1|  ferredoxin-nitrite reductase                           240   1e-71   Lotus japonicus
ref|NP_001274384.1|  nitrate reductase precursor                        241   1e-71   
gb|AAB50233.1|  nitrite reductase                                       240   1e-71   Glycine max [soybeans]
gb|AGO67239.1|  ferredoxin--nitrite reductase                           240   2e-71   
ref|XP_009783559.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    239   2e-71   
gb|EMT07001.1|  putative Ferredoxin--nitrite reductase, chloropla...    236   4e-71   
gb|ACD13218.1|  nitrite reductase                                       238   5e-71   Brassica rapa subsp. chinensis [bok-choy]
dbj|BAK02992.1|  predicted protein                                      238   6e-71   
ref|XP_009123250.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    239   7e-71   
emb|CDY37232.1|  BnaA09g08530D                                          238   8e-71   
gb|AFW64356.1|  hypothetical protein ZEAMMB73_724678                    230   8e-71   
ref|XP_010488973.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    238   8e-71   
dbj|BAD15364.1|  nitrite reductase                                      238   1e-70   Nicotiana tabacum [American tobacco]
pdb|3B0H|A  Chain A, Assimilatory Nitrite Reductase (Nii4) From T...    238   1e-70   
ref|XP_004505220.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    237   1e-70   
gb|ACL13515.1|  ferredoxin-nitrite reductase precursor                  238   1e-70   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006409539.1|  hypothetical protein EUTSA_v10022613mg             237   2e-70   
ref|XP_002454602.1|  hypothetical protein SORBIDRAFT_04g034160          237   2e-70   Sorghum bicolor [broomcorn]
gb|AAN31830.1|  putative ferredoxin--nitrite reductase                  236   2e-70   Arabidopsis thaliana [mouse-ear cress]
ref|NP_179164.1|  Ferredoxin--nitrite reductase                         236   2e-70   Arabidopsis thaliana [mouse-ear cress]
gb|AAN31831.1|  putative ferredoxin--nitrite reductase                  236   3e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002883906.1|  hypothetical protein ARALYDRAFT_899777             236   3e-70   
gb|KFK40026.1|  hypothetical protein AALP_AA3G320500                    236   4e-70   
gb|ACL13516.1|  ferredoxin-nitrite reductase precursor                  236   5e-70   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010517336.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    236   6e-70   
emb|CDY36642.1|  BnaA07g04150D                                          235   1e-69   
ref|XP_006297287.1|  hypothetical protein CARUB_v10013302mg             235   1e-69   
emb|CDX71230.1|  BnaC07g05090D                                          234   1e-69   
ref|XP_009119404.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    234   1e-69   
gb|AAX19269.1|  nitrite reductase                                       222   2e-69   Fragaria x ananassa
prf||1908371B  nitrite reductase                                        231   2e-69
gb|EYU37674.1|  hypothetical protein MIMGU_mgv1a003340mg                234   2e-69   
emb|CAA46942.1|  ferredoxin--nitrite reductase                          231   2e-69   Nicotiana tabacum [American tobacco]
gb|AFW64354.1|  hypothetical protein ZEAMMB73_724678                    231   3e-69   
ref|XP_009628648.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    234   3e-69   
ref|XP_003570568.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    234   3e-69   
ref|XP_010943064.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    233   4e-69   
emb|CBI32406.3|  unnamed protein product                                231   4e-69   
ref|XP_010467309.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    233   5e-69   
ref|XP_004954025.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    232   1e-68   
dbj|BAD15363.1|  nitrite reductase                                      231   2e-68   Nicotiana tabacum [American tobacco]
gb|AAA60450.1|  nitrite reductase                                       231   2e-68   Zea mays [maize]
sp|P17847.1|NIR_MAIZE  RecName: Full=Ferredoxin--nitrite reductas...    231   2e-68   Zea mays [maize]
pdb|3B0G|A  Chain A, Assimilatory Nitrite Reductase (Nii3) From T...    231   3e-68   
emb|CAA46940.1|  ferredoxin--nitrite reductase                          231   3e-68   Nicotiana tabacum [American tobacco]
gb|ACG29734.1|  ferredoxin--nitrite reductase                           231   3e-68   Zea mays [maize]
ref|XP_008679282.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    231   3e-68   
prf||1908371A  nitrite reductase                                        231   3e-68
ref|XP_009790010.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    221   4e-67   
ref|NP_001048222.2|  Os02g0765900                                       223   1e-66   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009417626.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    227   1e-66   
ref|XP_006647964.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    226   4e-66   
gb|EPS71034.1|  hypothetical protein M569_03724                         224   9e-66   
gb|EEE57859.1|  hypothetical protein OsJ_08501                          222   2e-65   Oryza sativa Japonica Group [Japonica rice]
sp|Q42997.1|NIR_ORYSJ  RecName: Full=Ferredoxin--nitrite reductas...    224   2e-65   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001043008.1|  Os01g0357100                                       224   2e-65   Oryza sativa Japonica Group [Japonica rice]
dbj|BAD53072.1|  putative ferredoxin--nitrite reductase, chloropl...    224   3e-65   Oryza sativa Japonica Group [Japonica rice]
gb|EEC70619.1|  hypothetical protein OsI_01871                          223   3e-65   Oryza sativa Indica Group [Indian rice]
pdb|3VLX|A  Chain A, Assimilatory Nitrite Reductase (Nii3) - N226...    221   3e-64   
pdb|3B0M|A  Chain A, M175k Mutant Of Assimilatory Nitrite Reducta...    221   3e-64   
pdb|3B0J|A  Chain A, M175e Mutant Of Assimilatory Nitrite Reducta...    221   3e-64   
pdb|3B0L|A  Chain A, M175g Mutant Of Assimilatory Nitrite Reducta...    220   3e-64   
pdb|3B0N|A  Chain A, Q448k Mutant Of Assimilatory Nitrite Reducta...    219   1e-63   
gb|AFW73584.1|  hypothetical protein ZEAMMB73_832658                    218   3e-63   
gb|EEC74060.1|  hypothetical protein OsI_09059                          219   4e-63   Oryza sativa Indica Group [Indian rice]
gb|ABR13288.1|  putative ferredoxin--nitrite reductase                  204   6e-63   Prunus dulcis [sweet almond]
ref|XP_008646302.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    218   7e-63   
ref|XP_009776470.1|  PREDICTED: LOW QUALITY PROTEIN: ferredoxin--...    216   2e-62   
gb|AFX87997.1|  ferredoxin--nitrite reductase                           202   3e-61   
gb|AFX87987.1|  ferredoxin--nitrite reductase                           202   3e-61   
ref|XP_006826233.1|  hypothetical protein AMTR_s00132p00099120          212   4e-61   
gb|AFX87901.1|  ferredoxin--nitrite reductase                           201   9e-61   
gb|AFX87876.1|  ferredoxin--nitrite reductase                           201   9e-61   
gb|AFX87977.1|  ferredoxin--nitrite reductase                           200   1e-60   
gb|AFX87973.1|  ferredoxin--nitrite reductase                           200   1e-60   
gb|AFX87975.1|  ferredoxin--nitrite reductase                           200   1e-60   
gb|AFX87984.1|  ferredoxin--nitrite reductase                           200   1e-60   
gb|AFX87985.1|  ferredoxin--nitrite reductase                           200   2e-60   
gb|AFX87940.1|  ferredoxin--nitrite reductase                           200   2e-60   
gb|AFX87697.1|  ferredoxin--nitrite reductase                           200   2e-60   
gb|AFX87712.1|  ferredoxin--nitrite reductase                           200   2e-60   
gb|AFX87927.1|  ferredoxin--nitrite reductase                           197   2e-59   
ref|XP_002987413.1|  hypothetical protein SELMODRAFT_183174             204   7e-58   
ref|XP_002979935.1|  hypothetical protein SELMODRAFT_178021             204   8e-58   
ref|XP_007042430.1|  Ferredoxin--nitrite reductase, chloroplastic       192   6e-54   
ref|XP_001777025.1|  predicted protein                                  190   8e-53   
ref|XP_001775824.1|  predicted protein                                  189   1e-52   
ref|WP_015155568.1|  assimilatory nitrite reductase (ferredoxin) ...    182   5e-50   
ref|WP_039714131.1|  ferredoxin--nitrite reductase                      181   6e-50   
gb|ABD49315.1|  assimilatory nitrite reductase                          173   1e-49   Mastigocladus laminosus W17C
gb|ABD49321.1|  assimilatory nitrite reductase                          172   1e-49   Mastigocladus laminosus W25B
ref|WP_011429510.1|  ferredoxin-nitrite reductase                       179   3e-49   
gb|ABW80920.1|  ferredoxin--nitrite reductase                           179   3e-49   uncultured bacterium
ref|WP_011431706.1|  ferredoxin-nitrite reductase                       177   1e-48   
ref|WP_035998667.1|  ferredoxin--nitrite reductase                      179   1e-48   
ref|WP_012361573.1|  MULTISPECIES: ferredoxin-nitrite reductase         177   2e-48   
ref|WP_026787877.1|  ferredoxin--nitrite reductase                      175   9e-48   
ref|WP_027254353.1|  ferredoxin--nitrite reductase                      175   9e-48   
ref|WP_015113079.1|  assimilatory nitrite reductase (ferredoxin) ...    175   9e-48   
ref|WP_026795180.1|  MULTISPECIES: ferredoxin--nitrite reductase        175   1e-47   
ref|WP_015188381.1|  assimilatory nitrite reductase (ferredoxin) ...    174   2e-47   
dbj|GAL93751.1|  ferredoxin--nitrite reductase                          173   4e-47   
ref|WP_006632844.1|  ferredoxin-nitrite reductase                       175   4e-47   
ref|WP_002775642.1|  ferredoxin-nitrite reductase                       173   4e-47   
ref|WP_009455119.1|  ferredoxin-nitrite reductase                       174   4e-47   
ref|WP_016871793.1|  ferredoxin-nitrite reductase                       174   5e-47   
ref|WP_008196112.1|  ferredoxin-nitrite reductase                       173   5e-47   
ref|WP_002749321.1|  ferredoxin--nitrite reductase                      173   7e-47   
ref|WP_011321208.1|  ferredoxin-nitrite reductase                       173   8e-47   
ref|WP_015180235.1|  assimilatory nitrite reductase (ferredoxin) ...    172   9e-47   
ref|WP_002789471.1|  ferredoxin-nitrite reductase                       172   9e-47   
ref|WP_012265139.1|  ferredoxin-nitrite reductase                       172   1e-46   
ref|WP_004268302.1|  ferredoxin-nitrite reductase                       172   1e-46   
ref|WP_002733445.1|  ferredoxin--nitrite reductase                      172   1e-46   
ref|WP_002752582.1|  ferredoxin-nitrite reductase                       172   1e-46   
ref|WP_024969723.1|  ferredoxin--nitrite reductase                      172   1e-46   
ref|WP_010994783.1|  ferredoxin-nitrite reductase                       172   1e-46   
ref|WP_002781418.1|  Ferredoxin--nitrite reductase                      172   1e-46   
ref|WP_023068951.1|  precorrin-3B synthase                              172   2e-46   
ref|WP_009632002.1|  precorrin-3B synthase                              172   2e-46   
ref|WP_017301382.1|  hypothetical protein                               172   2e-46   
ref|WP_016515805.1|  Sulfite reductase [ferredoxin]                     172   2e-46   
ref|WP_016868536.1|  ferredoxin-nitrite reductase                       172   2e-46   
gb|KEI67697.1|  NirA                                                    172   2e-46   
ref|WP_015142945.1|  precorrin-3B synthase                              172   2e-46   
ref|WP_017720834.1|  ferredoxin                                         173   2e-46   
ref|WP_008274143.1|  ferredoxin-nitrite reductase                       171   4e-46   
ref|WP_015140514.1|  sulfite reductase subunit beta (hemoprotein)       171   4e-46   
ref|WP_002760022.1|  ferredoxin-nitrite reductase                       171   5e-46   
ref|WP_002797849.1|  ferredoxin-nitrite reductase                       170   5e-46   
ref|WP_002765435.1|  ferredoxin-nitrite reductase                       170   5e-46   
ref|WP_002792330.1|  ferredoxin-nitrite reductase                       170   6e-46   
ref|WP_015128366.1|  assimilatory nitrite reductase (ferredoxin) ...    171   6e-46   
ref|WP_015152056.1|  assimilatory nitrite reductase (ferredoxin) ...    171   7e-46   
ref|WP_017315401.1|  ferredoxin-nitrite reductase                       170   8e-46   
gb|AEW90647.1|  nitrite reductase                                       168   8e-46   
ref|WP_011242624.1|  ferredoxin-nitrite reductase                       169   1e-45   
ref|WP_026722911.1|  ferredoxin--nitrite reductase                      170   1e-45   
gb|AIE74568.1|  Ferredoxin--nitrite reductase                           169   1e-45   
ref|WP_026732020.1|  ferredoxin--nitrite reductase                      169   1e-45   
ref|WP_036480548.1|  ferredoxin--nitrite reductase                      169   2e-45   
ref|WP_013323579.1|  ferredoxin-nitrite reductase                       168   3e-45   
ref|WP_016861627.1|  ferredoxin-nitrite reductase                       168   4e-45   
ref|WP_024124217.1|  assimilatory ferredoxin-nitrite reductase NirA     168   4e-45   
ref|WP_029633456.1|  ferredoxin--nitrite reductase [                    168   6e-45   
ref|WP_009783247.1|  ferredoxin-nitrite reductase                       167   9e-45   
ref|WP_006196192.1|  ferredoxin-nitrite reductase                       167   1e-44   
ref|WP_012595745.1|  MULTISPECIES: ferredoxin-nitrite reductase         167   1e-44   
ref|WP_009344167.1|  ferredoxin-nitrite reductase                       167   1e-44   
gb|ABN71231.1|  nitrite reductase                                       157   1e-44   Cucumis sativus [cucumbers]
ref|WP_006508771.1|  precorrin-3B synthase                              168   1e-44   
ref|WP_015213651.1|  assimilatory nitrite reductase (ferredoxin) ...    166   1e-44   
ref|WP_026093421.1|  ferredoxin--nitrite reductase                      166   2e-44   
ref|WP_027400663.1|  ferredoxin--nitrite reductase                      166   2e-44   
ref|WP_021829137.1|  Ferredoxin--nitrite reductase                      166   2e-44   
ref|WP_017713849.1|  hypothetical protein                               166   2e-44   
ref|WP_009554639.1|  assimilatory nitrite reductase (ferredoxin) ...    166   3e-44   
ref|WP_015179108.1|  assimilatory nitrite reductase (ferredoxin) ...    167   3e-44   
ref|WP_015192765.1|  precorrin-3B synthase                              166   3e-44   
ref|WP_007310897.1|  ferredoxin-nitrite reductase                       166   3e-44   
ref|WP_038021955.1|  ferredoxin--nitrite reductase                      166   4e-44   
ref|WP_015081559.1|  ferredoxin-nitrite reductase                       166   4e-44   
ref|WP_027844528.1|  ferredoxin--nitrite reductase                      165   4e-44   
ref|WP_028085072.1|  ferredoxin--nitrite reductase                      165   4e-44   
ref|WP_015224664.1|  assimilatory nitrite reductase (ferredoxin) ...    165   4e-44   
ref|WP_015196742.1|  assimilatory nitrite reductase (ferredoxin) ...    165   5e-44   
ref|WP_015166928.1|  sulfite reductase subunit beta (hemoprotein)       165   5e-44   
ref|WP_015180229.1|  precorrin-3B synthase                              165   6e-44   
ref|WP_011057189.1|  ferredoxin-nitrite reductase                       165   7e-44   
ref|WP_039741277.1|  ferredoxin--nitrite reductase                      165   7e-44   
ref|WP_036030858.1|  ferredoxin--nitrite reductase                      164   8e-44   
gb|EKD11740.1|  nitrite and sulphite reductase 4Fe-4S region            164   1e-43   
emb|CCQ65638.1|  Ferredoxin--nitrite reductase                          164   1e-43   
ref|WP_035758555.1|  ferredoxin--nitrite reductase                      164   1e-43   
ref|WP_017292467.1|  ferredoxin-nitrite reductase                       164   1e-43   
ref|WP_039730005.1|  ferredoxin--nitrite reductase                      164   1e-43   
ref|WP_006669900.1|  ferredoxin-nitrite reductase                       164   1e-43   
ref|WP_016948949.1|  ferredoxin-nitrite reductase                       164   1e-43   
ref|WP_017653159.1|  ferredoxin-nitrite reductase                       164   1e-43   
ref|WP_017288935.1|  hypothetical protein                               165   2e-43   
ref|WP_016877347.1|  ferredoxin-nitrite reductase                       164   2e-43   
ref|WP_017304788.1|  ferredoxin-nitrite reductase                       163   2e-43   
ref|WP_012599063.1|  ferredoxin-nitrite reductase                       163   2e-43   
ref|WP_017310284.1|  ferredoxin-nitrite reductase                       164   2e-43   
ref|WP_008049634.1|  ferredoxin-nitrite reductase                       163   2e-43   
ref|WP_006105894.1|  ferredoxin-nitrite reductase                       163   3e-43   
ref|WP_006275773.1|  ferredoxin-nitrite reductase                       163   3e-43   
ref|WP_007305636.1|  ferredoxin-nitrite reductase                       163   3e-43   
ref|WP_019498141.1|  hypothetical protein                               162   4e-43   
ref|WP_007355409.1|  MULTISPECIES: ferredoxin-nitrite reductase         162   4e-43   
ref|WP_014275660.1|  ferredoxin--nitrite reductase                      162   4e-43   
ref|WP_006617804.1|  ferredoxin-nitrite reductase                       162   4e-43   
ref|WP_035155292.1|  ferredoxin--nitrite reductase                      162   5e-43   
ref|WP_009626422.1|  assimilatory nitrite reductase (ferredoxin) ...    162   5e-43   
ref|WP_021834814.1|  Ferredoxin--nitrite reductase                      162   5e-43   
ref|WP_008189055.1|  ferredoxin-nitrite reductase                       162   6e-43   
ref|WP_017321046.1|  ferredoxin-nitrite reductase                       162   6e-43   
gb|AAT99257.1|  nitrite reductase                                       162   1e-42   Pseudochlorella pringsheimii
ref|WP_035994508.1|  ferredoxin--nitrite reductase                      161   1e-42   
ref|WP_015165563.1|  assimilatory nitrite reductase (ferredoxin) ...    161   1e-42   
ref|WP_015204592.1|  assimilatory nitrite reductase (ferredoxin) ...    162   2e-42   
gb|AAP79144.1|  ferredoxin nitrite reductase                            162   2e-42   Bigelowiella natans
ref|XP_005714928.1|  unnamed protein product                            161   2e-42   
ref|WP_038087531.1|  ferredoxin--nitrite reductase                      161   2e-42   
ref|WP_017748019.1|  ferredoxin-nitrite reductase                       161   2e-42   
ref|WP_011610823.1|  ferredoxin-nitrite reductase                       160   3e-42   
ref|WP_022609023.1|  precorrin-3B synthase                              160   4e-42   
ref|WP_028090043.1|  ferredoxin--nitrite reductase                      159   6e-42   
ref|WP_015222811.1|  assimilatory nitrite reductase (ferredoxin) ...    159   6e-42   
ref|WP_015157292.1|  assimilatory nitrite reductase (ferredoxin) ...    159   7e-42   
ref|WP_006457363.1|  ferredoxin-nitrite reductase                       159   1e-41   
ref|WP_015230746.1|  precorrin-3B synthase                              158   2e-41   
gb|AEO22994.1|  nitrite reductase                                       159   2e-41   
ref|WP_011141556.1|  ferredoxin-nitrite reductase                       157   3e-41   
ref|WP_023171581.1|  ferredoxin-nitrite reductase                       157   3e-41   
ref|WP_018399279.1|  ferredoxin-nitrite reductase                       157   3e-41   
ref|WP_039713492.1|  ferredoxin--nitrite reductase                      157   4e-41   
ref|WP_029315006.1|  ferredoxin--nitrite reductase                      157   6e-41   
ref|XP_005704382.1|  ferredoxin-nitrite reductase                       157   6e-41   
ref|WP_019505972.1|  ferredoxin                                         157   7e-41   
ref|WP_010873675.1|  ferredoxin-nitrite reductase                       156   8e-41   
ref|WP_015116722.1|  assimilatory nitrite reductase (ferredoxin) ...    156   9e-41   
ref|WP_036485313.1|  ferredoxin--nitrite reductase                      155   1e-40   
ref|WP_015218171.1|  assimilatory nitrite reductase (ferredoxin) ...    155   1e-40   
ref|WP_012408235.1|  ferredoxin-nitrite reductase                       155   2e-40   
sp|Q51879.1|NIR_PHOLA  RecName: Full=Ferredoxin--nitrite reductase      155   3e-40   Phormidium laminosum
ref|WP_012163413.1|  ferredoxin-nitrite reductase                       155   3e-40   
ref|WP_017660780.1|  hypothetical protein                               154   5e-40   
ref|WP_015123833.1|  assimilatory nitrite reductase (ferredoxin) ...    153   1e-39   
dbj|BAG74298.1|  nitrite reductase                                      153   1e-39   Phormidium laminosum
ref|WP_017324212.1|  ferredoxin-nitrite reductase                       152   2e-39   
ref|WP_015209003.1|  sulfite reductase, beta subunit (hemoprotein)      152   2e-39   
emb|CAA68040.2|  nir                                                    143   4e-39   
gb|AIF75980.1|  nitrite reductase                                       140   1e-38   
ref|WP_015170815.1|  assimilatory nitrite reductase (ferredoxin) ...    149   2e-38   
ref|XP_005646410.1|  hypothetical protein COCSUDRAFT_29833              149   4e-38   
ref|WP_006528554.1|  precorrin-3B synthase                              149   4e-38   
gb|AIF75977.1|  nitrite reductase                                       139   5e-38   
sp|Q43090.1|NIR_PINSY  RecName: Full=Ferredoxin--nitrite reductas...    139   7e-38   
gb|AIF75982.1|  nitrite reductase                                       138   1e-37   
gb|AIF75979.1|  nitrite reductase                                       137   2e-37   
ref|WP_015161463.1|  sulfite reductase, beta subunit (hemoprotein)      146   3e-37   
gb|AIF75976.1|  nitrite reductase                                       137   3e-37   
ref|WP_024546340.1|  ferredoxin--nitrite reductase                      146   4e-37   
ref|XP_005820309.1|  nitrite reductase                                  143   6e-37   
ref|WP_012629926.1|  ferredoxin-nitrite reductase                       145   1e-36   
gb|AET85053.1|  nitrite reductase                                       143   3e-36   
ref|WP_015134937.1|  assimilatory nitrite reductase (ferredoxin) ...    142   8e-36   
ref|XP_002507511.1|  nadh-nitrite reductase                             144   2e-35   
ref|WP_006515230.1|  assimilatory nitrite reductase (ferredoxin) ...    142   2e-35   
ref|XP_001419920.1|  predicted protein                                  140   7e-35   
gb|EJK78098.1|  nitrite reductase                                       140   9e-35   
ref|XP_001696787.1|  nitrite reductase                                  139   2e-34   
ref|XP_003081527.1|  Nii, plastid-targeted nitrite reductase apoe...    141   2e-34   
ref|XP_003057941.1|  nitrite reductase fusion with b5r chloroplas...    140   4e-34   
ref|WP_012307438.1|  ferredoxin-nitrite reductase                       137   4e-34   
ref|WP_023076501.1|  ferredoxin-nitrite reductase                       137   7e-34   
ref|XP_005791045.1|  ferredoxin-nitrite reductase precursor             138   7e-34   
ref|XP_005777302.1|  putative nitrite reductase                         138   8e-34   
ref|XP_002289265.1|  nitrite reductase-ferredoxin dependent             136   1e-33   
ref|WP_035832431.1|  ferredoxin--nitrite reductase                      135   2e-33   
gb|KEF41486.1|  ferredoxin--nitrite reductase                           135   3e-33   
emb|CAA70137.1|  nitrite reductase                                      135   3e-33   
ref|XP_002955216.1|  hypothetical protein VOLCADRAFT_83067              135   3e-33   
ref|WP_030006379.1|  ferredoxin--nitrite reductase                      131   6e-32   
ref|XP_006379199.1|  hypothetical protein POPTR_0009s10440g             129   4e-31   
ref|WP_038542357.1|  ferredoxin--nitrite reductase                      128   9e-31   
gb|AII41911.1|  ferredoxin-nitrite reductase                            127   1e-30   
ref|XP_007514721.1|  nitrite reductase                                  130   1e-30   
ref|WP_006911675.1|  ferredoxin--nitrite reductase                      126   4e-30   
ref|XP_002180496.1|  predicted protein                                  127   6e-30   
ref|WP_036914886.1|  MULTISPECIES: ferredoxin--nitrite reductase        125   9e-30   
ref|WP_010305963.1|  ferredoxin-nitrite reductase                       124   2e-29   
emb|CBJ25514.1|  ferredoxin nitrite reductase                           125   2e-29   
ref|WP_036905949.1|  ferredoxin--nitrite reductase                      124   2e-29   
ref|WP_028953197.1|  ferredoxin--nitrite reductase                      124   2e-29   
ref|NP_001170660.1|  uncharacterized protein LOC100384717               117   5e-29   
ref|WP_011936894.1|  ferredoxin-nitrite reductase                       123   6e-29   
ref|WP_015109994.1|  sulfite reductase subunit beta (hemoprotein)       123   7e-29   
ref|WP_018671324.1|  ferredoxin-nitrite reductase                       122   1e-28   
gb|ABU94108.1|  nitrite reductase                                       114   1e-28   
ref|XP_005844715.1|  hypothetical protein CHLNCDRAFT_26644              122   2e-28   
gb|AII46522.1|  ferredoxin-nitrite reductase                            121   2e-28   
ref|WP_011361018.1|  ferredoxin-nitrite reductase                       120   4e-28   
gb|ABU94075.1|  nitrite reductase                                       112   4e-28   
gb|ABU94078.1|  nitrite reductase                                       112   4e-28   
ref|WP_011824662.1|  ferredoxin-nitrite reductase                       120   5e-28   
gb|ABU94069.1|  nitrite reductase                                       112   8e-28   
ref|WP_003338958.1|  ferredoxin-nitrite reductase                       119   1e-27   
gb|AIG25430.1|  sulfite reductase                                       119   1e-27   
ref|WP_022584102.1|  ferredoxin-nitrite reductase                       119   1e-27   
gb|AAP32016.1|  nitrite reductase apoprotein                            111   1e-27   
gb|EAU71226.1|  ferredoxin--nitrite reductase                           118   2e-27   
ref|WP_037987910.1|  ferredoxin--nitrite reductase                      118   2e-27   
ref|WP_023483130.1|  sulfite reductase subunit beta-like protein        118   3e-27   
ref|WP_011295642.1|  ferredoxin-nitrite reductase                       118   4e-27   
ref|WP_027415625.1|  ferredoxin--nitrite reductase                      117   5e-27   
emb|CAA46941.1|  ferredoxin--nitrite reductase                          116   5e-27   
ref|WP_011131603.1|  ferredoxin-nitrite reductase                       117   6e-27   
ref|WP_011827554.1|  ferredoxin-nitrite reductase                       117   6e-27   
gb|AHF65029.1|  Ferredoxin--nitrite reductase                           117   6e-27   
prf||1908371C  nitrite reductase                                        115   9e-27
ref|WP_009677005.1|  MULTISPECIES: ferredoxin-nitrite reductase         116   1e-26   
ref|WP_031462327.1|  ferredoxin--nitrite reductase                      116   2e-26   
ref|WP_016822965.1|  MULTISPECIES: ferredoxin-nitrite reductase         116   2e-26   
ref|WP_019688753.1|  ferredoxin-nitrite reductase                       116   2e-26   
ref|WP_010278634.1|  ferredoxin-nitrite reductase                       116   2e-26   
ref|WP_029626046.1|  ferredoxin--nitrite reductase                      115   2e-26   
ref|WP_011620785.1|  ferredoxin-nitrite reductase                       115   3e-26   
ref|WP_011365576.1|  ferredoxin-nitrite reductase                       115   3e-26   
ref|WP_024092939.1|  ferredoxin--nitrite reductase NirA                 115   3e-26   
ref|WP_010349610.1|  ferredoxin-nitrite reductase                       115   5e-26   
ref|WP_007432639.1|  ferredoxin-nitrite reductase                       115   5e-26   
ref|WP_007099389.1|  ferredoxin-nitrite reductase                       114   1e-25   
ref|WP_007101180.1|  ferredoxin-nitrite reductase                       113   1e-25   
ref|WP_038552091.1|  ferredoxin--nitrite reductase                      112   3e-25   
ref|WP_025720482.1|  ferredoxin--nitrite reductase                      112   5e-25   
ref|WP_006854249.1|  ferredoxin-nitrite reductase                       111   7e-25   
ref|WP_015593407.1|  ferredoxin-nitrite reductase                       112   8e-25   
gb|AIA16330.1|  Rieske-like [2Fe-2S] domain protein                     109   1e-24   
ref|WP_027091785.1|  ferredoxin--nitrite reductase                      111   1e-24   
ref|XP_005854645.1|  ferredoxin nitrite reductase                       109   1e-24   
ref|WP_011129330.1|  ferredoxin-nitrite reductase                       110   1e-24   
ref|WP_010191872.1|  ferredoxin-nitrite reductase                       111   1e-24   
ref|WP_012875275.1|  ferredoxin--nitrite reductase                      110   2e-24   
ref|WP_025782397.1|  ferredoxin--nitrite reductase                      110   3e-24   
ref|WP_013489924.1|  ferredoxin-nitrite reductase                       110   3e-24   
ref|WP_006173161.1|  ferredoxin--nitrite reductase                      109   3e-24   
ref|WP_006042731.1|  ferredoxin-nitrite reductase                       109   3e-24   
ref|WP_007504791.1|  ferredoxin-nitrite reductase                       110   3e-24   
ref|WP_028533425.1|  ferredoxin--nitrite reductase                      109   5e-24   
ref|WP_011934377.1|  ferredoxin-nitrite reductase                       109   5e-24   
ref|WP_014278373.1|  ferredoxin-nitrite reductase                       109   6e-24   
ref|WP_021257087.1|  sulfite reductase (ferredoxin)                     109   6e-24   
ref|WP_025684170.1|  ferredoxin--nitrite reductase                      109   6e-24   
ref|WP_037500566.1|  hypothetical protein                               108   7e-24   
ref|WP_006648328.1|  nitrite and sulphite reductase 4Fe-4S region       109   8e-24   
ref|WP_019424774.1|  ferredoxin-nitrite reductase                       108   8e-24   
ref|WP_008003256.1|  nitrite/sulfite reductase hemoprotein beta-c...    109   9e-24   
ref|WP_006182961.1|  ferredoxin--nitrite reductase                      108   1e-23   
gb|AAC17122.1|  nitrite reductase                                       108   1e-23   
ref|WP_009793604.1|  MULTISPECIES: ferredoxin-nitrite reductase         108   2e-23   
ref|WP_005544656.1|  ferredoxin-nitrite reductase                       107   2e-23   
gb|AIU34485.1|  nitrite reductase                                       106   3e-23   
ref|WP_019240815.1|  ferredoxin-nitrite reductase                       107   3e-23   
ref|WP_023504227.1|  sulfite reductase, beta subunit (hemoprotein)      107   3e-23   
ref|WP_018131623.1|  hypothetical protein                               107   3e-23   
ref|WP_006432146.1|  nitrite and sulfite reductase 4Fe-4S region        107   3e-23   
ref|WP_008456399.1|  nitrite and sulphite reductase 4Fe-4S region       107   3e-23   
ref|WP_014256448.1|  ferredoxin-nitrite reductase [                     107   3e-23   
ref|WP_013247942.1|  ferredoxin-nitrite reductase                       107   4e-23   
ref|WP_021258827.1|  sulfite reductase (ferredoxin)                     107   4e-23   
ref|WP_004045775.1|  nitrite/sulfite reductase hemoprotein beta-c...    107   4e-23   
ref|WP_014862758.1|  ferredoxin--nitrite reductase                      107   4e-23   
ref|WP_005046506.1|  ferredoxin-nitrite reductase                       107   4e-23   
ref|WP_006184865.1|  nitrite and sulphite reductase 4Fe-4S region       107   5e-23   
ref|WP_019005272.1|  ferredoxin-nitrite reductase                       106   6e-23   
ref|WP_003351046.1|  ferredoxin-nitrite reductase                       106   8e-23   
ref|WP_015910137.1|  ferredoxin--nitrite reductase                      106   1e-22   
ref|WP_007110176.1|  nitrite and sulphite reductase 4Fe-4S region       106   1e-22   
ref|WP_036582016.1|  ferredoxin--nitrite reductase                      105   1e-22   
gb|KDS92119.1|  ferredoxin--nitrite reductase                           105   1e-22   
ref|WP_027289768.1|  ferredoxin--nitrite reductase                      105   1e-22   
ref|WP_011563948.1|  ferredoxin--nitrite reductase                      105   1e-22   
ref|WP_022746468.1|  ferredoxin--nitrite reductase NirA                 105   2e-22   
ref|WP_026676525.1|  ferredoxin--nitrite reductase                      105   2e-22   
ref|WP_037642342.1|  sulfite reductase                                  105   2e-22   
ref|WP_019915121.1|  ferredoxin-nitrite reductase                       104   2e-22   
ref|WP_006674723.1|  ferredoxin-nitrite reductase                       104   3e-22   
ref|WP_021624882.1|  nitrite/sulfite reductase ferredoxin domain ...    104   3e-22   
ref|WP_004967440.1|  ferredoxin--nitrite reductase                      104   3e-22   
ref|WP_024884633.1|  sulfite reductase                                  104   4e-22   
ref|WP_028597943.1|  ferredoxin--nitrite reductase                      103   5e-22   
ref|WP_037411066.1|  hypothetical protein                               103   5e-22   
ref|WP_038684010.1|  ferredoxin--nitrite reductase                      103   5e-22   
ref|WP_007276139.1|  ferredoxin--nitrite reductase                      104   5e-22   
gb|AHY46157.1|  Sulfite reductase beta subunit (hemoprotein)            103   6e-22   
ref|WP_017728242.1|  ferredoxin-nitrite reductase                       103   7e-22   
ref|WP_008421372.1|  nitrite and sulfite reductase 4Fe-4S region        103   7e-22   
ref|WP_028551036.1|  ferredoxin--nitrite reductase                      103   8e-22   
ref|WP_005006448.1|  Ferredoxin-nitrite reductase                       103   9e-22   
ref|WP_020446077.1|  Ferredoxin--nitrite reductase                      103   9e-22   
ref|WP_008418748.1|  ferredoxin--nitrite reductase                      103   1e-21   
ref|WP_037621769.1|  sulfite reductase                                  103   1e-21   
ref|WP_030967754.1|  sulfite reductase                                  103   1e-21   
ref|WP_023504525.1|  sulfite reductase, beta subunit (hemoprotein)      102   1e-21   
ref|WP_034759222.1|  ferredoxin--nitrite reductase                      102   1e-21   
ref|WP_013312216.1|  ferredoxin-nitrite reductase                       102   2e-21   
ref|WP_030861305.1|  sulfite reductase                                  102   2e-21   
ref|WP_031119448.1|  sulfite reductase                                  102   2e-21   
gb|AJE52180.1|  ferredoxin--nitrite reductase                           102   2e-21   
ref|WP_028542111.1|  ferredoxin--nitrite reductase                      102   2e-21   
ref|WP_030828339.1|  sulfite reductase                                  102   2e-21   
ref|WP_013373319.1|  ferredoxin-nitrite reductase                       102   2e-21   
ref|WP_025723427.1|  ferredoxin--nitrite reductase                      102   2e-21   
ref|WP_023990601.1|  ferredoxin-nitrite reductase                       102   2e-21   
ref|WP_037759111.1|  sulfite reductase                                  102   2e-21   
ref|WP_019523375.1|  sulfite reductase                                  102   2e-21   
ref|WP_028961578.1|  sulfite reductase                                  102   2e-21   
ref|WP_009733083.1|  ferredoxin--nitrite reductase                      102   2e-21   
ref|WP_018256642.1|  ferredoxin--nitrite reductase                      102   2e-21   
ref|WP_006136539.1|  MULTISPECIES: nitrite/sulfite reductase            102   2e-21   
ref|WP_031020417.1|  sulfite reductase                                  102   3e-21   
ref|WP_012807962.1|  ferredoxin--nitrite reductase                      102   3e-21   
ref|WP_013878832.1|  ferredoxin--nitrite reductase                      102   3e-21   
ref|WP_033273958.1|  sulfite reductase                                  102   3e-21   
ref|WP_031185172.1|  sulfite reductase                                  102   3e-21   
ref|WP_031085375.1|  sulfite reductase                                  102   3e-21   
ref|WP_028400399.1|  ferredoxin--nitrite reductase                      101   3e-21   
ref|WP_015789502.1|  ferredoxin--nitrite reductase                      102   3e-21   
ref|WP_038083284.1|  ferredoxin--nitrite reductase                      101   3e-21   
ref|WP_024040361.1|  Sulfite reductase Ferredoxin                       101   4e-21   
ref|WP_016482144.1|  Sulfite reductase, beta subunit (hemoprotein)      101   4e-21   
ref|WP_004981821.1|  MULTISPECIES: sulfite reductase                    101   4e-21   
ref|WP_010612081.1|  ferredoxin-nitrite reductase                       101   4e-21   
ref|WP_005044954.1|  ferredoxin--nitrite reductase                      101   4e-21   
ref|WP_007693600.1|  ferredoxin-nitrite reductase                       101   4e-21   
ref|WP_030953064.1|  sulfite reductase                                98.6    5e-21   
ref|WP_012941468.1|  ferredoxin--nitrite reductase                      101   5e-21   
gb|AHF98381.1|  ferredoxin--nitrite reductase                           101   5e-21   
ref|WP_030404157.1|  sulfite reductase                                  101   6e-21   
ref|WP_030179107.1|  sulfite reductase                                  100   6e-21   
ref|WP_003352911.1|  ferredoxin-nitrite reductase                       100   7e-21   
gb|KDE60228.1|  ferredoxin--nitrite reductase                           100   7e-21   
ref|WP_003348082.1|  ferredoxin-nitrite reductase                       100   8e-21   
ref|WP_006823933.1|  ferredoxin-nitrite reductase                       100   8e-21   
ref|WP_031035264.1|  sulfite reductase                                  100   9e-21   
ref|WP_010042580.1|  sulfite reductase                                  100   1e-20   
ref|WP_021041092.1|  sulfite reductase, beta subunit (hemoprotein)      100   1e-20   
ref|WP_037925942.1|  sulfite reductase                                  100   1e-20   
ref|WP_033306734.1|  sulfite reductase                                  100   1e-20   
ref|WP_037691924.1|  sulfite reductase                                  100   1e-20   
ref|WP_006667589.1|  ferredoxin-nitrite reductase                       100   1e-20   
ref|WP_039271414.1|  ferredoxin--nitrite reductase                      100   1e-20   
ref|WP_000119570.1|  ferredoxin-nitrite reductase                       100   1e-20   
ref|WP_011984224.1|  ferredoxin-nitrite reductase                       100   1e-20   
ref|WP_029514533.1|  ferredoxin--nitrite reductase                      100   1e-20   
ref|WP_033527571.1|  sulfite reductase                                  100   1e-20   
ref|WP_007500999.1|  sulfite reductase                                  100   1e-20   
ref|WP_027451802.1|  hypothetical protein                             99.4    2e-20   
ref|WP_007981975.1|  ferredoxin--nitrite reductase                      100   2e-20   
ref|WP_007259378.1|  nitrite and sulfite reductase 4Fe-4S region      99.8    2e-20   
ref|WP_008892978.1|  nitrite and sulfite reductase 4Fe-4S region      99.8    2e-20   
ref|WP_015789077.1|  ferredoxin--nitrite reductase                    99.8    2e-20   
ref|WP_004051943.1|  ferredoxin--nitrite reductase                    99.8    2e-20   
ref|WP_007740592.1|  ferredoxin--nitrite reductase                    99.8    2e-20   
gb|KDS85889.1|  sulfite reductase                                     99.8    2e-20   
ref|WP_003972818.1|  MULTISPECIES: sulfite reductase                  99.8    2e-20   
ref|WP_007109890.1|  nitrite and sulfite reductase 4Fe-4S region      99.8    2e-20   
ref|WP_004923408.1|  sulfite reductase                                99.8    2e-20   
ref|WP_037804944.1|  sulfite reductase                                97.4    2e-20   
ref|WP_030602807.1|  sulfite reductase                                99.4    2e-20   
ref|WP_012999821.1|  sulfite reductase                                99.4    2e-20   



>ref|XP_004230820.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic [Solanum 
lycopersicum]
Length=587

 Score =   259 bits (661),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 131/164 (80%), Positives = 152/164 (93%), Gaps = 0/164 (0%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQNIIIP+I+NS +D+LLKEP+L+K SP+PPILMKGLVACTG+QFCGQAIIETKAR+L
Sbjct  424  TVEQNIIIPNIENSKIDALLKEPILSKFSPDPPILMKGLVACTGNQFCGQAIIETKARSL  483

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
            KITEEV+R+V++ RPVRMHWTGCPNTC QVQVADIGFMGCL R++  K VEGADVFLGG+
Sbjct  484  KITEEVQRQVSLTRPVRMHWTGCPNTCAQVQVADIGFMGCLTRDKDKKTVEGADVFLGGR  543

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            IGSDSHLGEVYKK VPCD+LVPLIV+LL++ FGAV R+REE ED
Sbjct  544  IGSDSHLGEVYKKAVPCDELVPLIVDLLIKNFGAVPREREETED  587



>ref|NP_001275023.1| ferredoxin--nitrite reductase, chloroplastic-like [Solanum tuberosum]
 emb|CBL43265.1| nitrite reductase [Solanum tuberosum]
Length=587

 Score =   257 bits (657),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 131/164 (80%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQNIIIP+I+NS +++LLKEP+L+K SP+PPILMKGLVACTG+QFCGQAIIETKAR+L
Sbjct  424  TVEQNIIIPNIENSKIEALLKEPILSKFSPDPPILMKGLVACTGNQFCGQAIIETKARSL  483

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
            KITEEV+R+V++ RPVRMHWTGCPNTC QVQVADIGFMGCL R++  K VEGADVFLGG+
Sbjct  484  KITEEVQRQVSLTRPVRMHWTGCPNTCAQVQVADIGFMGCLTRDKDKKTVEGADVFLGGR  543

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            IGSDSHLGEVYKK VPCD+LVPLIV+LLV  FGAV R+REE ED
Sbjct  544  IGSDSHLGEVYKKAVPCDELVPLIVDLLVNNFGAVPREREETED  587



>ref|XP_011088260.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic [Sesamum 
indicum]
Length=588

 Score =   256 bits (655),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 154/165 (93%), Gaps = 1/165 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLT-KLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQNIIIP+++NS V++LL+EPLL  + SPEPPILMKGLVACTG+QFCGQAIIETKARA
Sbjct  424  TVEQNIIIPNVENSKVEALLQEPLLKDRFSPEPPILMKGLVACTGNQFCGQAIIETKARA  483

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            LK+TE+V+R V+V +PVRMHWTGCPN+CGQVQVADIGFMGC+ R++AGK VEGADV+LGG
Sbjct  484  LKVTEQVQRLVSVTKPVRMHWTGCPNSCGQVQVADIGFMGCMTRDKAGKVVEGADVYLGG  543

Query  328  KIGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            +IGSDSHLG++YKK VPCD+L+PL+V+LL+E+FGAV R+REE ED
Sbjct  544  RIGSDSHLGDIYKKAVPCDELIPLVVDLLIEKFGAVPREREESED  588



>ref|XP_010107937.1| Ferredoxin--nitrite reductase [Morus notabilis]
 gb|EXC17337.1| Ferredoxin--nitrite reductase [Morus notabilis]
Length=583

 Score =   254 bits (650),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 132/165 (80%), Positives = 151/165 (92%), Gaps = 1/165 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLT-KLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQNIIIP+++NS +++LLKEPLL  + SPEPP+LMKGLVACTG+QFCGQAIIETKARA
Sbjct  419  TVEQNIIIPNVENSKIEALLKEPLLKDRFSPEPPLLMKGLVACTGNQFCGQAIIETKARA  478

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            LK+TEEVER VAV RPVRMHWTGCPNTCGQVQVADIGFMGC+ +NE GK VEGADVFLGG
Sbjct  479  LKVTEEVERLVAVTRPVRMHWTGCPNTCGQVQVADIGFMGCMTKNENGKVVEGADVFLGG  538

Query  328  KIGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            +IGSDSHLG+VYKKGVPC DLVPL+V++LV  FGAV R+REE E+
Sbjct  539  RIGSDSHLGQVYKKGVPCKDLVPLVVDILVNHFGAVPREREEGEE  583



>emb|CDP17819.1| unnamed protein product [Coffea canephora]
Length=590

 Score =   254 bits (648),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 130/165 (79%), Positives = 152/165 (92%), Gaps = 1/165 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLL-TKLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQNIIIP+I+N+ +++LLKEPLL  + SPEPPILM+GLVACTG+QFCGQAIIETKARA
Sbjct  426  TVEQNIIIPNIENAKLEALLKEPLLKNRFSPEPPILMRGLVACTGNQFCGQAIIETKARA  485

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            LKITEEV R+V+V RPVRMHWTGCPN+CGQVQVADIGFMGC+ R++ GK VEGADVFLGG
Sbjct  486  LKITEEVHRQVSVTRPVRMHWTGCPNSCGQVQVADIGFMGCMTRDKNGKPVEGADVFLGG  545

Query  328  KIGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            +IGSDSHLGEVYKKGVPCDDLVPL+V+LL+ +F AVRR+ EE E+
Sbjct  546  RIGSDSHLGEVYKKGVPCDDLVPLVVDLLINQFDAVRRESEEGEE  590



>ref|XP_008373138.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic [Malus 
domestica]
Length=585

 Score =   251 bits (641),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 131/165 (79%), Positives = 149/165 (90%), Gaps = 1/165 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLL-TKLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQNII+P+++NS +++LLKEPLL  K SP+P ILMKGLVACTG+QFCGQAIIETKARA
Sbjct  421  TVEQNIILPNVENSRIEALLKEPLLQNKYSPKPSILMKGLVACTGNQFCGQAIIETKARA  480

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            LK+TEEVER VAV RPVRMHWTGCPNTC QVQVADIGFMGC+AR+E GK  EGADVFLGG
Sbjct  481  LKVTEEVERHVAVTRPVRMHWTGCPNTCAQVQVADIGFMGCMARDENGKPCEGADVFLGG  540

Query  328  KIGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            +IGSDSHLG+VYKK VPC DLVPL+V+LL+  FGAVRR+REE ED
Sbjct  541  RIGSDSHLGDVYKKSVPCKDLVPLVVDLLISHFGAVRREREEGED  585



>gb|AGQ43559.1| nitrite reductase [Morus alba]
Length=587

 Score =   251 bits (641),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 131/165 (79%), Positives = 150/165 (91%), Gaps = 1/165 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLT-KLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQNIIIP+++NS +++LLKE LL  + SPEPP+LMKGLVACTG+QFCGQAIIETKARA
Sbjct  423  TVEQNIIIPNVENSKLEALLKESLLKDRFSPEPPLLMKGLVACTGNQFCGQAIIETKARA  482

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            LK+TEEVER VAV RPVRMHWTGCPNTCGQVQVADIGFMGC+ +NE GK VEGADVFLGG
Sbjct  483  LKVTEEVERLVAVTRPVRMHWTGCPNTCGQVQVADIGFMGCMTKNENGKVVEGADVFLGG  542

Query  328  KIGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            +IGSDSHLG+VYKKGVPC DLVPL+V++LV  FGAV R+REE E+
Sbjct  543  RIGSDSHLGQVYKKGVPCKDLVPLVVDILVNHFGAVPREREEGEE  587



>gb|KDO59703.1| hypothetical protein CISIN_1g047572mg [Citrus sinensis]
Length=595

 Score =   251 bits (641),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 146/164 (89%), Gaps = 0/164 (0%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQNIIIP++ NS +++LLKEPLL K SP+P ILMKGLVACTG+QFCGQAIIETKARAL
Sbjct  432  TVEQNIIIPNVDNSKLEALLKEPLLEKFSPQPSILMKGLVACTGNQFCGQAIIETKARAL  491

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
            K+T+EVER V V +PVRMHWTGCPN+C QVQVADIGFMGC+ R+E GK  EGADVFLGG+
Sbjct  492  KVTKEVERLVDVTKPVRMHWTGCPNSCAQVQVADIGFMGCMTRDEDGKTCEGADVFLGGR  551

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            IGSDSHLG++YKKGVPC DLVPL+ ++LVE FGAV R+REE ED
Sbjct  552  IGSDSHLGDIYKKGVPCKDLVPLVADILVEHFGAVLREREEAED  595



>ref|XP_006487107.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic-like 
[Citrus sinensis]
Length=596

 Score =   251 bits (640),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 146/164 (89%), Gaps = 0/164 (0%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQNIIIP++ NS +++LLKEPLL K SP+P ILMKGLVACTG+QFCGQAIIETKARAL
Sbjct  433  TVEQNIIIPNVDNSKLEALLKEPLLEKFSPQPSILMKGLVACTGNQFCGQAIIETKARAL  492

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
            K+T+EVER V V +PVRMHWTGCPN+C QVQVADIGFMGC+ R+E GK  EGADVFLGG+
Sbjct  493  KVTKEVERLVDVTKPVRMHWTGCPNSCAQVQVADIGFMGCMTRDEDGKTCEGADVFLGGR  552

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            IGSDSHLG++YKKGVPC DLVPL+ ++LVE FGAV R+REE ED
Sbjct  553  IGSDSHLGDIYKKGVPCKDLVPLVADILVEHFGAVLREREEAED  596



>ref|XP_006423019.1| hypothetical protein CICLE_v10028067mg [Citrus clementina]
 gb|ESR36259.1| hypothetical protein CICLE_v10028067mg [Citrus clementina]
Length=595

 Score =   250 bits (639),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 127/164 (77%), Positives = 146/164 (89%), Gaps = 0/164 (0%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQNIIIP++ NS +++LLKEPLL K SP+P ILMKGLVACTG+QFCGQAIIETKARAL
Sbjct  432  TVEQNIIIPNVDNSKLEALLKEPLLEKFSPQPSILMKGLVACTGNQFCGQAIIETKARAL  491

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
            K+TEEVER V V +PVRMHWTGCPN+C QVQVADIGFMGC+ R+E GK  EGADVFLGG+
Sbjct  492  KVTEEVERLVDVTKPVRMHWTGCPNSCAQVQVADIGFMGCMTRDEDGKTCEGADVFLGGR  551

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            IGSDSHLG++YKKGVPC DLVPL+ ++LVE FGAV R+REE ED
Sbjct  552  IGSDSHLGDIYKKGVPCKDLVPLVADILVEHFGAVVREREEAED  595



>gb|AAC17127.1| nitrite reductase [Capsicum annuum]
Length=588

 Score =   249 bits (637),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 149/164 (91%), Gaps = 1/164 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQNIIIP+I+NS +D+LL EPLL ++SP+PPILM+ LVACTG+QFCGQAIIETKAR++
Sbjct  426  TVEQNIIIPNIENSKIDALLNEPLLKQISPDPPILMRNLVACTGNQFCGQAIIETKARSM  485

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
            KITEEV+R V+V +PVRMHWTGCPN+CGQVQVADIGFMGCL R E GK VEGADVFLGG+
Sbjct  486  KITEEVQRLVSVTQPVRMHWTGCPNSCGQVQVADIGFMGCLTRKE-GKTVEGADVFLGGR  544

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            IG+DSHLG++YKK VPC+DLVP+IV+LLV  FGAV R+REE ED
Sbjct  545  IGTDSHLGDIYKKSVPCEDLVPIIVDLLVNNFGAVPREREEAED  588



>dbj|BAB55003.1| nitrite reductase [Prunus persica]
Length=532

 Score =   248 bits (633),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 130/165 (79%), Positives = 149/165 (90%), Gaps = 1/165 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLL-TKLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQNIIIP+++NS +++LLKEPLL  + SPEP ILM+GLVACTG+QFCGQAIIETKARA
Sbjct  368  TVEQNIIIPNVENSKLEALLKEPLLKNRFSPEPSILMRGLVACTGNQFCGQAIIETKARA  427

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            LK+TEEVER VAV RPVRMHWTGCPNTC QVQVADIGFMGC+AR+E GK  EGADVFLGG
Sbjct  428  LKVTEEVERHVAVTRPVRMHWTGCPNTCAQVQVADIGFMGCMARDENGKPCEGADVFLGG  487

Query  328  KIGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            +IGSDSHLG+VYKK VPC DLVPL+V++LV+ FGAV R+REE ED
Sbjct  488  RIGSDSHLGDVYKKSVPCKDLVPLVVDILVKHFGAVPREREEGED  532



>gb|KDP42275.1| hypothetical protein JCGZ_01599 [Jatropha curcas]
Length=587

 Score =   249 bits (635),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 127/165 (77%), Positives = 147/165 (89%), Gaps = 1/165 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLT-KLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQNI+IP+I+NS +++ LKEPLL  K SPEPPILMKGLVACTG+QFCGQAIIETKARA
Sbjct  423  TVEQNIVIPNIENSKIEAFLKEPLLKDKFSPEPPILMKGLVACTGNQFCGQAIIETKARA  482

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            LK+TEEV+R V+V RP+RMHWTGCPNTCGQVQVADIGFMGC+ R+E GK  EG DV+LGG
Sbjct  483  LKVTEEVQRLVSVTRPIRMHWTGCPNTCGQVQVADIGFMGCMTRDENGKTCEGVDVYLGG  542

Query  328  KIGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            +IGSDSHLG VYKK VPC DLVPL+V++LV+ FGAV R+REE ED
Sbjct  543  RIGSDSHLGNVYKKSVPCKDLVPLVVDILVKNFGAVPREREEVED  587



>ref|XP_006349625.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic-like 
[Solanum tuberosum]
Length=584

 Score =   249 bits (635),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 130/165 (79%), Positives = 148/165 (90%), Gaps = 2/165 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTK-LSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQNIIIP+I+NS +D+LL EPLL K  SP+PPILM+ LVACTG+QFCGQAIIETKAR+
Sbjct  421  TVEQNIIIPNIENSKIDALLNEPLLKKRFSPDPPILMRNLVACTGNQFCGQAIIETKARS  480

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            +KITEEV+R V+V +PVRMHWTGCPNTCGQVQVADIGFMGCL R E GK VEGADVFLGG
Sbjct  481  MKITEEVQRLVSVTQPVRMHWTGCPNTCGQVQVADIGFMGCLTRKE-GKTVEGADVFLGG  539

Query  328  KIGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            +IGSDSHLGEVYKK VPC+DLVP+IV+LLV  FGAV R+REE E+
Sbjct  540  RIGSDSHLGEVYKKSVPCEDLVPIIVDLLVNNFGAVPREREETEE  584



>ref|XP_010548020.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic [Tarenaya 
hassleriana]
Length=588

 Score =   249 bits (635),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 148/165 (90%), Gaps = 1/165 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLL-TKLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQNIIIP+++NS V++LL+E LL  + SPEP ILMKGLVACTGSQFCGQAIIETKARA
Sbjct  422  TVEQNIIIPNVENSKVEALLQEALLKNRFSPEPSILMKGLVACTGSQFCGQAIIETKARA  481

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            LK+TEEVER V+V +PVRMHWTGCPNTCGQVQVADIGFMGC+AR E GK  EGADVF+GG
Sbjct  482  LKVTEEVERLVSVTKPVRMHWTGCPNTCGQVQVADIGFMGCMARGEDGKPCEGADVFVGG  541

Query  328  KIGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            ++GSDSHLGEVYKKGVPC DL PL+ E+LVE+FGAV R RE++ED
Sbjct  542  RVGSDSHLGEVYKKGVPCKDLAPLVAEILVEQFGAVPRDREDNED  586



>ref|XP_008456121.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic [Cucumis 
melo]
Length=583

 Score =   248 bits (633),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 127/155 (82%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQNIIIP+IQNS +++LLKEPLL K SPEPPILMKGLVACTG+QFCGQAIIETKARAL
Sbjct  419  TVEQNIIIPNIQNSKLEALLKEPLLEKFSPEPPILMKGLVACTGNQFCGQAIIETKARAL  478

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
            K+TEEV+RRV V +PVRMHWTGCPNTCGQVQVADIGFMGC+AR+E  K VEG DVFLGG+
Sbjct  479  KVTEEVQRRVTVTQPVRMHWTGCPNTCGQVQVADIGFMGCMARDENKKPVEGVDVFLGGR  538

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAV  221
            IGSDSHLG+VYKK VPC DLVPL+V++LV+ FGAV
Sbjct  539  IGSDSHLGDVYKKAVPCKDLVPLVVDILVQHFGAV  573



>ref|XP_007201180.1| hypothetical protein PRUPE_ppa003315mg [Prunus persica]
 gb|EMJ02379.1| hypothetical protein PRUPE_ppa003315mg [Prunus persica]
 gb|AHM02308.1| nitrite reductase [Prunus persica]
Length=585

 Score =   248 bits (633),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 130/165 (79%), Positives = 149/165 (90%), Gaps = 1/165 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLL-TKLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQNIIIP+++NS +++LLKEPLL  + SPEP ILM+GLVACTG+QFCGQAIIETKARA
Sbjct  421  TVEQNIIIPNVENSKLEALLKEPLLKNRFSPEPSILMRGLVACTGNQFCGQAIIETKARA  480

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            LK+TEEVER VAV RPVRMHWTGCPNTC QVQVADIGFMGC+AR+E GK  EGADVFLGG
Sbjct  481  LKVTEEVERHVAVTRPVRMHWTGCPNTCAQVQVADIGFMGCMARDENGKPCEGADVFLGG  540

Query  328  KIGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            +IGSDSHLG+VYKK VPC DLVPL+V++LV+ FGAV R+REE ED
Sbjct  541  RIGSDSHLGDVYKKSVPCKDLVPLVVDILVKHFGAVPREREEGED  585



>gb|ADN97117.1| nitrite reductase [Beta vulgaris]
 gb|ADR71053.1| nitrite reductase [Beta vulgaris]
Length=599

 Score =   248 bits (634),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 128/164 (78%), Positives = 147/164 (90%), Gaps = 1/164 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLT-KLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQNIIIP+++NS V++LL EPLL  + SPEPPILMKGLVACTGSQFCGQAIIETKARA
Sbjct  436  TVEQNIIIPNVENSKVEALLNEPLLKERFSPEPPILMKGLVACTGSQFCGQAIIETKARA  495

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            LK+TEEV+R V+V RPVRMHWTGCPN+CGQVQVADIGFMGC+ R+E GK  EGADVF+GG
Sbjct  496  LKVTEEVQRLVSVTRPVRMHWTGCPNSCGQVQVADIGFMGCMTRDENGKPCEGADVFVGG  555

Query  328  KIGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDE  197
            +IGSDSHLGEVYKK VPC DLVP++ ELL+ +FGAV R+REE E
Sbjct  556  RIGSDSHLGEVYKKAVPCKDLVPIVAELLINQFGAVPREREEAE  599



>ref|XP_010675576.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic [Beta 
vulgaris subsp. vulgaris]
Length=601

 Score =   248 bits (634),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 128/164 (78%), Positives = 147/164 (90%), Gaps = 1/164 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLT-KLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQNIIIP+++NS V++LL EPLL  + SPEPPILMKGLVACTGSQFCGQAIIETKARA
Sbjct  438  TVEQNIIIPNVENSKVEALLNEPLLKERFSPEPPILMKGLVACTGSQFCGQAIIETKARA  497

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            LK+TEEV+R V+V RPVRMHWTGCPN+CGQVQVADIGFMGC+ R+E GK  EGADVF+GG
Sbjct  498  LKVTEEVQRLVSVTRPVRMHWTGCPNSCGQVQVADIGFMGCMTRDENGKPCEGADVFVGG  557

Query  328  KIGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDE  197
            +IGSDSHLGEVYKK VPC DLVP++ ELL+ +FGAV R+REE E
Sbjct  558  RIGSDSHLGEVYKKAVPCKDLVPIVAELLINQFGAVPREREEAE  601



>ref|XP_004248736.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic [Solanum 
lycopersicum]
Length=584

 Score =   247 bits (631),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 128/165 (78%), Positives = 148/165 (90%), Gaps = 2/165 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLL-TKLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQNIIIP+I+NS +D+LL EPLL  + SP+PPILM+ LVACTG+QFCGQAIIETKAR+
Sbjct  421  TVEQNIIIPNIENSKIDALLNEPLLKNRFSPDPPILMRNLVACTGNQFCGQAIIETKARS  480

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            +KITEEV+R V+V +PVRMHWTGCPNTCGQVQVADIGFMGCL R E GK VEGADVFLGG
Sbjct  481  MKITEEVQRLVSVTQPVRMHWTGCPNTCGQVQVADIGFMGCLTRKE-GKTVEGADVFLGG  539

Query  328  KIGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            +IGSDSHLGEVYKK VPC+DLVP+IV+LL+  FGAV R+REE E+
Sbjct  540  RIGSDSHLGEVYKKSVPCEDLVPIIVDLLINNFGAVPREREETEE  584



>sp|P05314.1|NIR_SPIOL RecName: Full=Ferredoxin--nitrite reductase, chloroplastic; Flags: 
Precursor [Spinacia oleracea]
 emb|CAA34893.1| ferredoxin-nitrite reductase [Spinacia oleracea]
 emb|CAA30453.1| unnamed protein product [Spinacia oleracea]
Length=594

 Score =   247 bits (631),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 147/164 (90%), Gaps = 1/164 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLT-KLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQNIIIP+++NS +DSLL EPLL  + SPEPPILMKGLVACTGSQFCGQAIIETKARA
Sbjct  431  TVEQNIIIPNVENSKIDSLLNEPLLKERYSPEPPILMKGLVACTGSQFCGQAIIETKARA  490

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            LK+TEEV+R V+V RPVRMHWTGCPN+CGQVQVADIGFMGC+ R+E GK  EGADVF+GG
Sbjct  491  LKVTEEVQRLVSVTRPVRMHWTGCPNSCGQVQVADIGFMGCMTRDENGKPCEGADVFVGG  550

Query  328  KIGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDE  197
            +IGSDSHLG++YKK VPC DLVP++ E+L+ +FGAV R+REE E
Sbjct  551  RIGSDSHLGDIYKKAVPCKDLVPVVAEILINQFGAVPREREEAE  594



>ref|XP_008236500.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic [Prunus 
mume]
Length=585

 Score =   247 bits (630),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 149/165 (90%), Gaps = 1/165 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLL-TKLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQNIIIP+++NS +++LLKEPLL  + SPEP ILM+GLVACTG+QFCGQAIIETKARA
Sbjct  421  TVEQNIIIPNVENSKLEALLKEPLLKNRFSPEPSILMRGLVACTGNQFCGQAIIETKARA  480

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            LK+TEEVER VAV RPVRMHWTGCPNTC QVQVADIGFMGC+AR+E GK  EGADV+LGG
Sbjct  481  LKVTEEVERHVAVTRPVRMHWTGCPNTCAQVQVADIGFMGCMARDENGKPCEGADVYLGG  540

Query  328  KIGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            +IGSDSHLG+VYKK VPC DLVPL+V++LV+ FGAV R+REE ED
Sbjct  541  RIGSDSHLGDVYKKSVPCKDLVPLVVDILVKHFGAVPREREEGED  585



>ref|XP_002518763.1| Ferredoxin--nitrite reductase, chloroplast precursor, putative 
[Ricinus communis]
 gb|EEF43688.1| Ferredoxin--nitrite reductase, chloroplast precursor, putative 
[Ricinus communis]
Length=587

 Score =   247 bits (630),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 148/165 (90%), Gaps = 1/165 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLT-KLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQNIIIP+I+NS +++LL+EPLL  K SPEPPILMKGLVACTG++FCGQAIIETKARA
Sbjct  423  TVEQNIIIPNIENSKIEALLQEPLLKHKFSPEPPILMKGLVACTGNEFCGQAIIETKARA  482

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            +K+TEEV+R V+V +PVRMHWTGCPNTCGQVQVADIGFMGC+ R+E GK  EG DVFLGG
Sbjct  483  MKVTEEVQRLVSVTQPVRMHWTGCPNTCGQVQVADIGFMGCMTRDENGKVCEGVDVFLGG  542

Query  328  KIGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            +IGSDSHLG+VYKK VPC +LVPL+V++LV  FGAV R+REE ED
Sbjct  543  RIGSDSHLGDVYKKSVPCKNLVPLVVDILVNNFGAVPREREELED  587



>pdb|2AKJ|A Chain A, Structure Of Spinach Nitrite Reductase
Length=608

 Score =   247 bits (631),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 147/164 (90%), Gaps = 1/164 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLT-KLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQNIIIP+++NS +DSLL EPLL  + SPEPPILMKGLVACTGSQFCGQAIIETKARA
Sbjct  445  TVEQNIIIPNVENSKIDSLLNEPLLKERYSPEPPILMKGLVACTGSQFCGQAIIETKARA  504

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            LK+TEEV+R V+V RPVRMHWTGCPN+CGQVQVADIGFMGC+ R+E GK  EGADVF+GG
Sbjct  505  LKVTEEVQRLVSVTRPVRMHWTGCPNSCGQVQVADIGFMGCMTRDENGKPCEGADVFVGG  564

Query  328  KIGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDE  197
            +IGSDSHLG++YKK VPC DLVP++ E+L+ +FGAV R+REE E
Sbjct  565  RIGSDSHLGDIYKKAVPCKDLVPVVAEILINQFGAVPREREEAE  608



>sp|P38500.1|NIR_BETPN RecName: Full=Ferredoxin--nitrite reductase, chloroplastic; Flags: 
Precursor [Betula pendula]
 emb|CAA42690.1| ferredoxin--nitrite reductase [Betula pendula]
Length=583

 Score =   246 bits (629),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 150/165 (91%), Gaps = 1/165 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLT-KLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQNIIIP+I+NS +++LL EPLL  + SPEPPILMKGLVACTG+QFCGQAIIETKARA
Sbjct  419  TVEQNIIIPNIENSKLEALLGEPLLKDRFSPEPPILMKGLVACTGNQFCGQAIIETKARA  478

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            LK+TEEV+R+VAV RPVRMHWTGCPN+CGQVQVADIGFMGC+AR+E GK  EGA VFLGG
Sbjct  479  LKVTEEVQRQVAVTRPVRMHWTGCPNSCGQVQVADIGFMGCMARDENGKPCEGAAVFLGG  538

Query  328  KIGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            +IGSDSHLG +YKKGVPC +LVPL+V++LV+ FGAV R+REE ED
Sbjct  539  RIGSDSHLGNLYKKGVPCKNLVPLVVDILVKHFGAVPREREESED  583



>ref|XP_010028471.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic [Eucalyptus 
grandis]
 gb|KCW55212.1| hypothetical protein EUGRSUZ_I01148 [Eucalyptus grandis]
Length=589

 Score =   246 bits (629),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 127/165 (77%), Positives = 148/165 (90%), Gaps = 1/165 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLL-TKLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQNI+IP+I+NS + +LL EPLL  + SP PP+LMKGLVACTG+QFCGQAIIETKARA
Sbjct  425  TVEQNIVIPNIENSRIGTLLNEPLLKNRFSPSPPLLMKGLVACTGNQFCGQAIIETKARA  484

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            LK+TEEVER V+V RPVRMHWTGCPNTCGQVQVADIGFMGC+ R+E GK  EG DVFLGG
Sbjct  485  LKVTEEVERLVSVTRPVRMHWTGCPNTCGQVQVADIGFMGCMTRDENGKTCEGVDVFLGG  544

Query  328  KIGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            +IGSDSHLG+VYKKGVPC D+VPL+V++LV++FGAV R+REE ED
Sbjct  545  RIGSDSHLGDVYKKGVPCKDVVPLVVDILVKQFGAVLREREEAED  589



>ref|XP_004163915.1| PREDICTED: LOW QUALITY PROTEIN: ferredoxin--nitrite reductase, 
chloroplastic-like [Cucumis sativus]
Length=583

 Score =   246 bits (627),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 127/155 (82%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQNIIIP+IQNS +++LLKE LL K SPEPPILMKGLVACTG+QFCGQAIIETKARAL
Sbjct  419  TVEQNIIIPNIQNSKLEALLKESLLQKFSPEPPILMKGLVACTGNQFCGQAIIETKARAL  478

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
            K+TEEV+RRV V RPVRMHWTGCPNTCGQVQVADIGFMGC+AR+E  K VEG DVFLGG+
Sbjct  479  KVTEEVQRRVTVTRPVRMHWTGCPNTCGQVQVADIGFMGCMARDENKKPVEGVDVFLGGR  538

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAV  221
            IGSDSHLG+VYKK VPC DLVPL+V++LV+ FGAV
Sbjct  539  IGSDSHLGDVYKKAVPCKDLVPLVVDILVQHFGAV  573



>ref|XP_004140695.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic-like 
[Cucumis sativus]
 gb|KGN57540.1| hypothetical protein Csa_3G207890 [Cucumis sativus]
Length=583

 Score =   246 bits (627),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 127/155 (82%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQNIIIP+IQNS +++LLKE LL K SPEPPILMKGLVACTG+QFCGQAIIETKARAL
Sbjct  419  TVEQNIIIPNIQNSKLEALLKESLLQKFSPEPPILMKGLVACTGNQFCGQAIIETKARAL  478

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
            K+TEEV+RRV V RPVRMHWTGCPNTCGQVQVADIGFMGC+AR+E  K VEG DVFLGG+
Sbjct  479  KVTEEVQRRVTVTRPVRMHWTGCPNTCGQVQVADIGFMGCMARDENKKPVEGVDVFLGGR  538

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAV  221
            IGSDSHLG+VYKK VPC DLVPL+V++LV+ FGAV
Sbjct  539  IGSDSHLGDVYKKAVPCKDLVPLVVDILVQHFGAV  573



>gb|AIR07815.1| nitrite reductase, partial [Vitis labrusca x Vitis vinifera]
Length=413

 Score =   240 bits (613),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 144/165 (87%), Gaps = 1/165 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLT-KLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQNIIIP+++NS +++LLKEPLL  + SPEPPILMKGLVACTG+QFCGQAIIETKARA
Sbjct  248  TVEQNIIIPNVENSRLEALLKEPLLRDRFSPEPPILMKGLVACTGNQFCGQAIIETKARA  307

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            LK+TE+V R V+V +PVRMHWTGCPN+CGQVQVADIGFMGC+ R+E G   EGADVFLGG
Sbjct  308  LKVTEDVGRLVSVTQPVRMHWTGCPNSCGQVQVADIGFMGCMTRDENGNVCEGADVFLGG  367

Query  328  KIGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            +IGSD HLGEVYKK VPC DLVPL+ E+LV  FG V R+REE+ +
Sbjct  368  RIGSDCHLGEVYKKRVPCKDLVPLVAEILVNHFGGVPREREEEAE  412



>gb|ABK95605.1| unknown [Populus trichocarpa]
Length=588

 Score =   244 bits (623),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 151/165 (92%), Gaps = 1/165 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLT-KLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQNIIIP+I++S +++LLKEPLL  + SPEPP+LM+GLVACTG +FCGQAIIETKARA
Sbjct  424  TVEQNIIIPNIEDSKIEALLKEPLLKDRFSPEPPLLMQGLVACTGKEFCGQAIIETKARA  483

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            +K+TEEV+R V+V +PVRMHWTGCPNTCGQVQVADIGFMGC+AR+E GK  EGADV++GG
Sbjct  484  MKVTEEVQRLVSVSKPVRMHWTGCPNTCGQVQVADIGFMGCMARDEKGKICEGADVYVGG  543

Query  328  KIGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            ++GSDSHLGE+YKK VPC DLVPL+V++LV++FGAV R+REE +D
Sbjct  544  RVGSDSHLGELYKKSVPCKDLVPLVVDILVKQFGAVPREREEVDD  588



>ref|XP_006384408.1| Ferredoxin--nitrite reductase family protein [Populus trichocarpa]
 gb|ERP62205.1| Ferredoxin--nitrite reductase family protein [Populus trichocarpa]
Length=588

 Score =   244 bits (623),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 151/165 (92%), Gaps = 1/165 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLT-KLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQNIIIP+I++S +++LLKEPLL  + SPEPP+LM+GLVACTG +FCGQAIIETKARA
Sbjct  424  TVEQNIIIPNIEDSKIEALLKEPLLKDRFSPEPPLLMQGLVACTGKEFCGQAIIETKARA  483

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            +K+TEEV+R V+V +PVRMHWTGCPNTCGQVQVADIGFMGC+AR+E GK  EGADV++GG
Sbjct  484  MKVTEEVQRLVSVSKPVRMHWTGCPNTCGQVQVADIGFMGCMARDENGKICEGADVYVGG  543

Query  328  KIGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            ++GSDSHLGE+YKK VPC DLVPL+V++LV++FGAV R+REE +D
Sbjct  544  RVGSDSHLGELYKKSVPCKDLVPLVVDILVKQFGAVPREREEVDD  588



>ref|XP_011005977.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic [Populus 
euphratica]
Length=588

 Score =   244 bits (622),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 151/165 (92%), Gaps = 1/165 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLT-KLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQNIIIP+I++S +++LLKEPLL  + SPEPP+LM+GLVACTG +FCGQAIIETKARA
Sbjct  424  TVEQNIIIPNIEDSKIEALLKEPLLKDRFSPEPPLLMQGLVACTGKEFCGQAIIETKARA  483

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            +K+TEEV+R V+V +PVRMHWTGCPNTCGQVQVADIGFMGC+AR+E GK  EGADV++GG
Sbjct  484  MKVTEEVQRLVSVSKPVRMHWTGCPNTCGQVQVADIGFMGCMARDENGKICEGADVYVGG  543

Query  328  KIGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            ++GSDSHLGE+YKK VPC DLVPL+V++LV++FGAV R+REE +D
Sbjct  544  RVGSDSHLGELYKKSVPCKDLVPLVVDILVKQFGAVPREREEVDD  588



>ref|XP_004294803.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=582

 Score =   243 bits (621),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 147/165 (89%), Gaps = 1/165 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLT-KLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQNIIIP+++N+ + +LL+EPLL  K SPEP ILMKGLVACTG+QFCGQAIIETK RA
Sbjct  418  TVEQNIIIPNVENTKLQALLQEPLLKEKFSPEPSILMKGLVACTGNQFCGQAIIETKQRA  477

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            LK+TEEVER V+V RPVRMHWTGCPNTCGQVQVADIGFMGC+AR+E GK VEG DVFLGG
Sbjct  478  LKVTEEVERHVSVTRPVRMHWTGCPNTCGQVQVADIGFMGCMARDENGKPVEGVDVFLGG  537

Query  328  KIGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            +IGSDSHLG++YKK VPC DLVPL++++LV  FGAV R+REE E+
Sbjct  538  RIGSDSHLGDIYKKSVPCKDLVPLVIDILVNHFGAVPREREEGEE  582



>gb|ADJ68001.1| nitrite reductase protein [Gossypium hirsutum]
Length=588

 Score =   243 bits (620),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 147/165 (89%), Gaps = 1/165 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLT-KLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQNIIIP+++NS +++L  EPLL  + SP+P ILMKGLVACTG+QFCGQAIIETKARA
Sbjct  424  TVEQNIIIPNVENSKLEALPNEPLLKDRFSPQPSILMKGLVACTGNQFCGQAIIETKARA  483

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            LK+TEEVER V+V RPVRMHW GCPNTCGQVQVADIGFMGC+AR+E GK  EGAD+FLGG
Sbjct  484  LKVTEEVERLVSVSRPVRMHWAGCPNTCGQVQVADIGFMGCMARDENGKPCEGADIFLGG  543

Query  328  KIGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            +IGSDSHLGE+YKKGVPC +LVP++ ++LVE FGAV RQREE ED
Sbjct  544  RIGSDSHLGELYKKGVPCKNLVPVVADILVEHFGAVPRQREEGED  588



>ref|XP_007156512.1| hypothetical protein PHAVU_003G292100g [Phaseolus vulgaris]
 gb|ESW28506.1| hypothetical protein PHAVU_003G292100g [Phaseolus vulgaris]
Length=582

 Score =   242 bits (618),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 148/165 (90%), Gaps = 1/165 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLT-KLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQNIIIP++ NS +++LL+EPLL  K SPEP +LMK LVACTG+QFCGQAIIETKARA
Sbjct  418  TVEQNIIIPNVDNSKLEALLQEPLLKHKFSPEPSLLMKTLVACTGNQFCGQAIIETKARA  477

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            LK+TEEVER+VAV RPVRMHWTGCPNTCGQVQVADIGFMGC+AR+E GKA EG D+FLGG
Sbjct  478  LKVTEEVERQVAVTRPVRMHWTGCPNTCGQVQVADIGFMGCMARDENGKATEGVDIFLGG  537

Query  328  KIGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            +IGSDSHL E+YKKGVPC +LVP++ ++LV+ FGAV+R REE ED
Sbjct  538  RIGSDSHLAELYKKGVPCKNLVPVVADILVKHFGAVQRNREEVED  582



>ref|NP_001268194.1| ferredoxin--nitrite reductase, chloroplastic-like [Vitis vinifera]
 gb|AEO72336.1| nitrite reductase 1 [Vitis vinifera]
Length=594

 Score =   243 bits (619),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 123/163 (75%), Positives = 143/163 (88%), Gaps = 1/163 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLT-KLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQNIIIP+++NS +++LLKEPLL  + SPEPPILMKGLVACTG+QFCGQAIIETKARA
Sbjct  429  TVEQNIIIPNVENSRLEALLKEPLLRDRFSPEPPILMKGLVACTGNQFCGQAIIETKARA  488

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            LK+TE+V R V+V +PVRMHWTGCPN+CGQVQVADIGFMGC+ R+E G   EGADVFLGG
Sbjct  489  LKVTEDVGRLVSVTQPVRMHWTGCPNSCGQVQVADIGFMGCMTRDENGNVCEGADVFLGG  548

Query  328  KIGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREED  200
            +IGSD HLGEVYKK VPC DLVPL+ E+LV  FG V R+REE+
Sbjct  549  RIGSDCHLGEVYKKRVPCKDLVPLVAEILVNHFGGVPREREEE  591



>gb|AAA74456.1| nitrite reductase [Phaseolus vulgaris]
Length=582

 Score =   242 bits (618),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 148/165 (90%), Gaps = 1/165 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLT-KLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQNIIIP++ NS +++LL+EPLL  K SPEP +LMK LVACTG+QFCGQAIIETKARA
Sbjct  418  TVEQNIIIPNVDNSKLEALLQEPLLKHKFSPEPSLLMKTLVACTGNQFCGQAIIETKARA  477

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            LK+TEEVER+VAV RPVRMHWTGCPNTCGQVQVADIGFMGC+AR+E GKA EG D+FLGG
Sbjct  478  LKVTEEVERQVAVTRPVRMHWTGCPNTCGQVQVADIGFMGCMARDENGKATEGVDIFLGG  537

Query  328  KIGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            +IGSDSHL E+YKKGVPC +LVP++ ++LV+ FGAV+R REE ED
Sbjct  538  RIGSDSHLAELYKKGVPCKNLVPVVADILVKHFGAVQRNREEVED  582



>dbj|BAD93723.1| ferredoxin--nitrite reductase [Arabidopsis thaliana]
Length=254

 Score =   233 bits (593),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 143/165 (87%), Gaps = 1/165 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLL-TKLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQNIIIP+++ S  ++LL+EP L  + SPEP ILMKGLVACTGSQFCGQAIIETK RA
Sbjct  90   TVEQNIIIPNVETSKTEALLQEPFLKNRFSPEPSILMKGLVACTGSQFCGQAIIETKLRA  149

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            LK+TEEVER V+V RP+RMHWTGCPNTCGQVQVADIGFMGCL R E GK VEGADV++GG
Sbjct  150  LKVTEEVERLVSVPRPIRMHWTGCPNTCGQVQVADIGFMGCLTRGEEGKPVEGADVYVGG  209

Query  328  KIGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            +IGSDSH+GE+YKKGV   +LV L+ E+L++ FGAV R+REE+ED
Sbjct  210  RIGSDSHIGEIYKKGVRVTELVTLVAEILIKEFGAVPREREENED  254



>ref|XP_003607969.1| Ferredoxin-nitrite reductase [Medicago truncatula]
 gb|AES90166.1| ferredoxin-nitrite reductase [Medicago truncatula]
Length=582

 Score =   242 bits (617),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 125/165 (76%), Positives = 145/165 (88%), Gaps = 1/165 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLT-KLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQNIIIP+++NS +++LL EPLL  K SPEP ILMK LVACTG+QFCGQAIIETK RA
Sbjct  418  TVEQNIIIPNVENSKLEALLNEPLLKDKFSPEPSILMKTLVACTGNQFCGQAIIETKQRA  477

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            LK+TEEVER VAV +PVRMHWTGCPNTCGQVQVADIGFMGC+AR+E GKA EG D+FLGG
Sbjct  478  LKVTEEVERHVAVSKPVRMHWTGCPNTCGQVQVADIGFMGCMARDENGKATEGVDIFLGG  537

Query  328  KIGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            +IGSDSHL EVYKK VPC DLVP++ ++LV+ FGAV+R REE +D
Sbjct  538  RIGSDSHLAEVYKKAVPCKDLVPIVADILVKYFGAVQRNREEGDD  582



>emb|CDY69481.1| BnaCnng63770D, partial [Brassica napus]
Length=460

 Score =   239 bits (609),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 143/165 (87%), Gaps = 1/165 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLL-TKLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQNIIIP+++ S   +LL+EP L  + SPEP ILMKGLVACTGSQFCGQAIIETK RA
Sbjct  296  TVEQNIIIPNVETSKTQALLQEPFLKNRFSPEPSILMKGLVACTGSQFCGQAIIETKLRA  355

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            LK+TEEVER VAV +PVRMHWTGCPNTCGQVQVADIGFMGCL R E GKAVEGADV++GG
Sbjct  356  LKVTEEVERLVAVPKPVRMHWTGCPNTCGQVQVADIGFMGCLTRGENGKAVEGADVYVGG  415

Query  328  KIGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            +IGSDSH+GE+YKKGVP  DL PL+ E+LV+ FGAV R REE+ED
Sbjct  416  RIGSDSHVGEIYKKGVPVTDLAPLVAEILVKEFGAVPRVREENED  460



>ref|XP_009628462.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic-like 
[Nicotiana tomentosiformis]
 dbj|BAD15365.1| nitrite reductase [Nicotiana tabacum]
Length=587

 Score =   242 bits (617),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 146/165 (88%), Gaps = 2/165 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLL-TKLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQNIIIP+++NS ++SLL EPLL  + S  PPILMK LVACTG+QFCGQAIIETKAR+
Sbjct  424  TVEQNIIIPNVENSKIESLLNEPLLKNRFSTNPPILMKNLVACTGNQFCGQAIIETKARS  483

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            +KITEEV+R V+V +PVRMHWTGCPN+CGQVQVADIGFMGCL R E GK VEGADV+LGG
Sbjct  484  MKITEEVQRLVSVTKPVRMHWTGCPNSCGQVQVADIGFMGCLTRKE-GKTVEGADVYLGG  542

Query  328  KIGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            +IGSDSHLG+VYKK VPC+DLVP+IV+LLV  FGAV R+REE ED
Sbjct  543  RIGSDSHLGDVYKKSVPCEDLVPIIVDLLVNNFGAVPREREEAED  587



>ref|XP_003529397.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic-like 
[Glycine max]
 gb|KHN43071.1| Ferredoxin--nitrite reductase, chloroplastic [Glycine soja]
Length=588

 Score =   241 bits (616),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 125/165 (76%), Positives = 147/165 (89%), Gaps = 1/165 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLT-KLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQNIIIP++ ++ +D+LL EPLL  + SPEP +LMK LVACTG+QFCGQAIIETK RA
Sbjct  424  TVEQNIIIPNVDSNKIDALLNEPLLKERFSPEPSLLMKTLVACTGNQFCGQAIIETKERA  483

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            LK+TEEVER+VAV RPVRMHWTGCPNTCGQVQVADIGFMGC+AR+E GKA EG D+FLGG
Sbjct  484  LKVTEEVERQVAVTRPVRMHWTGCPNTCGQVQVADIGFMGCMARDENGKATEGVDIFLGG  543

Query  328  KIGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            +IGSDSHL EVYKKGVPC +LVP++V++LV+ FGAV+R REE ED
Sbjct  544  RIGSDSHLAEVYKKGVPCKNLVPIVVDILVKHFGAVQRNREEGED  588



>ref|XP_010263547.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic [Nelumbo 
nucifera]
Length=592

 Score =   241 bits (615),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 125/163 (77%), Positives = 147/163 (90%), Gaps = 1/163 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLL-TKLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQN++IP+++NS +++LLKEPLL  + SPEP +LMKGLVACTG+QFCGQAIIETKARA
Sbjct  427  TVEQNVVIPNVENSKLEALLKEPLLRNRFSPEPSLLMKGLVACTGNQFCGQAIIETKARA  486

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            LK+TEEVERRVAV RPVRMHWTGCPN+CGQVQVADIGFMGC+ R+E GKA EG DVFLGG
Sbjct  487  LKVTEEVERRVAVTRPVRMHWTGCPNSCGQVQVADIGFMGCMTRDENGKACEGVDVFLGG  546

Query  328  KIGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREED  200
            +IGSDSHLG+VYKK VPC DLVPL+V++L+  FGAV R REE+
Sbjct  547  RIGSDSHLGDVYKKSVPCKDLVPLVVDILINHFGAVPRDREEE  589



>ref|XP_008778364.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic [Phoenix 
dactylifera]
Length=461

 Score =   238 bits (606),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 145/164 (88%), Gaps = 0/164 (0%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQNIIIP++++S V++LL EPLL K SPEP +LM+GLVACTG+QFCGQAIIETKARA+
Sbjct  293  TVEQNIIIPNVEDSRVEALLNEPLLKKFSPEPSLLMQGLVACTGNQFCGQAIIETKARAM  352

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
            K+TEEVE+RV+V R +RMHWTGCPN+CGQVQVADIGFMG L ++  GK  EG DV+LGG+
Sbjct  353  KVTEEVEKRVSVGRTIRMHWTGCPNSCGQVQVADIGFMGRLTKDAEGKVCEGVDVYLGGR  412

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            IGSDSHLG+VYKKGVPC DLVPL+ ++LV+ FGAV R REEDE+
Sbjct  413  IGSDSHLGDVYKKGVPCKDLVPLVADILVKHFGAVPRVREEDEE  456



>ref|XP_010530781.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic-like 
[Tarenaya hassleriana]
Length=590

 Score =   241 bits (614),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 125/165 (76%), Positives = 144/165 (87%), Gaps = 1/165 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLL-TKLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQNIIIP+++N  V++LL+E  L  + SPEP ILMKGLVACTG+QFCGQAIIETKARA
Sbjct  425  TVEQNIIIPNVENLKVEALLQESFLKNRFSPEPSILMKGLVACTGNQFCGQAIIETKARA  484

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            +K+TEEVER V+V +PVRMHWTGCPNTCGQVQVADIGFMGC+ R+E  K  EGADVF+GG
Sbjct  485  MKVTEEVERLVSVTKPVRMHWTGCPNTCGQVQVADIGFMGCMTRDENRKPCEGADVFVGG  544

Query  328  KIGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            +IGSDSHLGEVYKKGVPC DLVPL+ E+LV +FGAV R REED D
Sbjct  545  RIGSDSHLGEVYKKGVPCKDLVPLVAEILVNQFGAVPRDREEDND  589



>gb|KHN37511.1| Ferredoxin--nitrite reductase, chloroplastic [Glycine soja]
Length=591

 Score =   241 bits (614),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 125/165 (76%), Positives = 145/165 (88%), Gaps = 1/165 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLT-KLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQNIIIP++ N+ +D LL EPLL  + SPEP +LMK LVACTG+QFCGQAIIETK RA
Sbjct  427  TVEQNIIIPNVDNNKIDGLLNEPLLKGRFSPEPSLLMKTLVACTGNQFCGQAIIETKERA  486

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            LK+TEEVER+VAV RPVRMHWTGCPNTCGQVQVADIGFMGC+AR++ GKA EG D+FLGG
Sbjct  487  LKVTEEVERQVAVTRPVRMHWTGCPNTCGQVQVADIGFMGCMARDDNGKATEGVDIFLGG  546

Query  328  KIGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            +IGSDSHL +VYKKGVPC DLVP++V++LV+ FGAV R REE ED
Sbjct  547  RIGSDSHLAQVYKKGVPCKDLVPVVVDILVKHFGAVLRNREEGED  591



>ref|XP_009346246.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic [Pyrus 
x bretschneideri]
Length=585

 Score =   240 bits (613),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 146/165 (88%), Gaps = 1/165 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLL-TKLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQNII+P+++ S +++LLKEPLL    SP+P ILM+GLVACTG+QFCGQAIIETKARA
Sbjct  421  TVEQNIILPNVEKSRIEALLKEPLLQNTYSPKPSILMRGLVACTGNQFCGQAIIETKARA  480

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            LK+TEEVER VAV RPVRMHWTGCPNTC QVQVADIGFMGC+AR+E GK  EGADVFLGG
Sbjct  481  LKVTEEVERHVAVTRPVRMHWTGCPNTCAQVQVADIGFMGCMARDENGKPCEGADVFLGG  540

Query  328  KIGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            +IGSDSHLG+VYKK VP  DLVPL+V+LL+  FGAV R+REE+ED
Sbjct  541  RIGSDSHLGDVYKKSVPSKDLVPLVVDLLISHFGAVPREREEEED  585



>emb|CAC06095.1| ferredoxin-nitrite reductase [Lotus japonicus]
Length=582

 Score =   240 bits (613),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 144/165 (87%), Gaps = 1/165 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLT-KLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQNIIIP+++NS + +LL EPLL  K SPEP +LMK LVACTGSQFCGQAIIETKARA
Sbjct  418  TVEQNIIIPNVENSKLSALLNEPLLKEKFSPEPSLLMKTLVACTGSQFCGQAIIETKARA  477

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            LK+TEEVER VAV RPVRMHWTGCPNTCGQVQVADIGFMGC+AR+E GK  EG D+FLGG
Sbjct  478  LKVTEEVERLVAVTRPVRMHWTGCPNTCGQVQVADIGFMGCMARDENGKPGEGVDIFLGG  537

Query  328  KIGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            +IGSDSHL EVYKK VPC DLVP++ ++LV+ FGAV+R REE +D
Sbjct  538  RIGSDSHLAEVYKKAVPCKDLVPIVADILVKHFGAVQRNREEGDD  582



>ref|NP_001274384.1| nitrate reductase precursor [Glycine max]
 gb|AGY36141.1| nitrite and sulphite reductase [Glycine max]
Length=605

 Score =   241 bits (614),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 125/165 (76%), Positives = 145/165 (88%), Gaps = 1/165 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLT-KLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQNIIIP++ N+ +D LL EPLL  + SPEP +LMK LVACTG+QFCGQAIIETK RA
Sbjct  441  TVEQNIIIPNVDNNKIDGLLNEPLLKGRFSPEPSLLMKTLVACTGNQFCGQAIIETKERA  500

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            LK+TEEVER+VAV RPVRMHWTGCPNTCGQVQVADIGFMGC+AR++ GKA EG D+FLGG
Sbjct  501  LKVTEEVERQVAVTRPVRMHWTGCPNTCGQVQVADIGFMGCMARDDNGKATEGVDIFLGG  560

Query  328  KIGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            +IGSDSHL +VYKKGVPC DLVP++V++LV+ FGAV R REE ED
Sbjct  561  RIGSDSHLAQVYKKGVPCKDLVPVVVDILVKHFGAVLRNREEGED  605



>gb|AAB50233.1| nitrite reductase [Glycine max]
Length=596

 Score =   240 bits (613),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 125/165 (76%), Positives = 145/165 (88%), Gaps = 1/165 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLT-KLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQNIIIP++ N+ +D LL EPLL  + SPEP +LMK LVACTG+QFCGQAIIETK RA
Sbjct  432  TVEQNIIIPNLDNNKIDGLLNEPLLKGRFSPEPSLLMKTLVACTGNQFCGQAIIETKERA  491

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            LK+TEEVER+VAV RPVRMHWTGCPNTCGQVQVADIGFMGC+AR++ GKA EG D+FLGG
Sbjct  492  LKVTEEVERQVAVTRPVRMHWTGCPNTCGQVQVADIGFMGCMARDDNGKATEGVDIFLGG  551

Query  328  KIGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            +IGSDSHL +VYKKGVPC DLVP++V++LV+ FGAV R REE ED
Sbjct  552  RIGSDSHLAQVYKKGVPCKDLVPVVVDILVKHFGAVLRNREEGED  596



>gb|AGO67239.1| ferredoxin--nitrite reductase [Silene vulgaris]
Length=592

 Score =   240 bits (612),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 147/164 (90%), Gaps = 1/164 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLT-KLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQNIIIP+++NS V++LLKEPLL  K SPEPPILMKGLVACTG+QFCGQAIIETK RA
Sbjct  428  TVEQNIIIPNVENSKVEALLKEPLLQDKFSPEPPILMKGLVACTGNQFCGQAIIETKLRA  487

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            LK+TEEV+R V+V +P+RMHWTGCPN+CGQ+QVADIGFMGC+AR+E GK  EGADV++GG
Sbjct  488  LKVTEEVQRLVSVTKPIRMHWTGCPNSCGQIQVADIGFMGCMARDENGKPCEGADVYVGG  547

Query  328  KIGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDE  197
            +IGSDSHLG +YKK VPC ++ P++ ++L+E+FGAV R+REE E
Sbjct  548  RIGSDSHLGTLYKKQVPCKNIAPIVAQILIEQFGAVPREREETE  591



>ref|XP_009783559.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic-like 
[Nicotiana sylvestris]
Length=584

 Score =   239 bits (610),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 146/165 (88%), Gaps = 2/165 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLL-TKLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQNIIIP+++NS +++LL EPLL  + S +PPILMK LVACTG+QFCGQAIIETKAR+
Sbjct  421  TVEQNIIIPNVKNSKIEALLNEPLLKNRFSTDPPILMKNLVACTGNQFCGQAIIETKARS  480

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            +KITEEV+  V++ +PVRMHWTGCPN+C QVQVADIGFMGCL R E GK VEGADV+LGG
Sbjct  481  MKITEEVQLLVSITQPVRMHWTGCPNSCAQVQVADIGFMGCLTRKE-GKTVEGADVYLGG  539

Query  328  KIGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            +IGSDSHLG+VYKK VPC+DLVP+IV+LLV+ FGAV R+REE ED
Sbjct  540  RIGSDSHLGDVYKKSVPCEDLVPIIVDLLVDNFGAVPREREEAED  584



>gb|EMT07001.1| putative Ferredoxin--nitrite reductase, chloroplastic [Aegilops 
tauschii]
Length=464

 Score =   236 bits (601),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 141/164 (86%), Gaps = 0/164 (0%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQNI++P+++N  V++LL  PLL K S  P +LMKGLVACTG+QFCGQAIIETKARAL
Sbjct  301  TVEQNIVLPNVKNEKVEALLAGPLLQKFSAHPSLLMKGLVACTGNQFCGQAIIETKARAL  360

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
            ++T +VE RV+V R VRMHWTGCPN+C QVQVADIGFMGCL +N +GK VE AD+F+GG+
Sbjct  361  QVTRDVEARVSVPRAVRMHWTGCPNSCAQVQVADIGFMGCLTKNSSGKIVEAADIFVGGR  420

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            +GSDSHL  VYKK VPC+DLVPL+ +LLVERFGAV R+REEDE+
Sbjct  421  VGSDSHLTGVYKKAVPCEDLVPLVADLLVERFGAVPREREEDEE  464



>gb|ACD13218.1| nitrite reductase [Brassica rapa subsp. chinensis]
Length=593

 Score =   238 bits (608),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 125/165 (76%), Positives = 143/165 (87%), Gaps = 1/165 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLL-TKLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQNIIIP+++ S   +LL+EP L  + SPEP ILMKGLVACTGSQFCGQAIIETK RA
Sbjct  429  TVEQNIIIPNVETSKTQALLQEPFLKNRFSPEPSILMKGLVACTGSQFCGQAIIETKLRA  488

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            LK+TEEVER VAV +PVRMHWTGCPNTCGQVQVADIGFMGCL R E GKAVEGADV++GG
Sbjct  489  LKVTEEVERLVAVPKPVRMHWTGCPNTCGQVQVADIGFMGCLTRGEDGKAVEGADVYVGG  548

Query  328  KIGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            ++GSDSH+GE+YKKGVP  DL PL+ E+LV+ FGAV R REE+ED
Sbjct  549  RVGSDSHIGEIYKKGVPVTDLAPLVAEILVKEFGAVPRVREENED  593



>dbj|BAK02992.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=599

 Score =   238 bits (608),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 142/164 (87%), Gaps = 0/164 (0%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQNI++P+++N  V++LL EPLL K S  P +LMKGLVACTG+QFCGQAIIETKARAL
Sbjct  436  TVEQNIVLPNVKNEKVEALLAEPLLHKFSAHPSLLMKGLVACTGNQFCGQAIIETKARAL  495

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
            ++T +VE RV+V + VRMHWTGCPN+C QVQVADIGFMGCL +N +GK VE AD+F+GG+
Sbjct  496  QVTRDVEARVSVPKAVRMHWTGCPNSCAQVQVADIGFMGCLTKNSSGKIVEAADIFVGGR  555

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            IGSDSHL  VYKK VPC+DLVP++ +LLVERFGAV R+REEDE+
Sbjct  556  IGSDSHLTGVYKKAVPCEDLVPIVADLLVERFGAVPREREEDEE  599



>ref|XP_009123250.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic-like 
[Brassica rapa]
Length=628

 Score =   239 bits (610),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 125/165 (76%), Positives = 143/165 (87%), Gaps = 1/165 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLL-TKLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQNIIIP+++ S   +LL+EP L  + SPEP ILMKGLVACTGSQFCGQAIIETK RA
Sbjct  464  TVEQNIIIPNVETSKTQALLQEPFLKNRFSPEPSILMKGLVACTGSQFCGQAIIETKLRA  523

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            LK+TEEVER VAV +PVRMHWTGCPNTCGQVQVADIGFMGCL R E GKAVEGADV++GG
Sbjct  524  LKVTEEVERLVAVPKPVRMHWTGCPNTCGQVQVADIGFMGCLTRGEDGKAVEGADVYVGG  583

Query  328  KIGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            ++GSDSH+GE+YKKGVP  DL PL+ E+LV+ FGAV R REE+ED
Sbjct  584  RVGSDSHIGEIYKKGVPVTDLAPLVAEILVKEFGAVPRVREENED  628



>emb|CDY37232.1| BnaA09g08530D [Brassica napus]
Length=584

 Score =   238 bits (607),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 143/165 (87%), Gaps = 1/165 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLL-TKLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQNIIIP+++ S   +LL+EP L  + SPEP ILMKGLVACTGSQFCGQAIIETK RA
Sbjct  420  TVEQNIIIPNVETSKTQALLQEPFLKNRFSPEPSILMKGLVACTGSQFCGQAIIETKLRA  479

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            LK+TEEVER VAV +PVRMHWTGCPNTCGQVQVADIGFMGCL R + GKAVEGADV++GG
Sbjct  480  LKVTEEVERLVAVPKPVRMHWTGCPNTCGQVQVADIGFMGCLTRGDDGKAVEGADVYVGG  539

Query  328  KIGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            ++GSDSH+GE+YKKGVP  DL PL+ E+LV+ FGAV R REE+ED
Sbjct  540  RVGSDSHIGEIYKKGVPVTDLAPLVAEILVKEFGAVPRVREENED  584



>gb|AFW64356.1| hypothetical protein ZEAMMB73_724678 [Zea mays]
Length=318

 Score =   230 bits (587),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 144/166 (87%), Gaps = 2/166 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLT--KLSPEPPILMKGLVACTGSQFCGQAIIETKAR  512
            TVEQNI++P++ N  +D+LL EPLL   +LSP P +L++GLVACTG+QFCGQAIIETKAR
Sbjct  153  TVEQNIVLPNVSNERLDALLAEPLLQEQRLSPRPSMLLRGLVACTGNQFCGQAIIETKAR  212

Query  511  ALKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLG  332
            AL++  EVE+RVAV RPVRMHWTGCPN+CGQVQVADIGFMGCL ++  GK VE AD+F+G
Sbjct  213  ALQVAREVEKRVAVPRPVRMHWTGCPNSCGQVQVADIGFMGCLTKDSDGKIVEAADIFVG  272

Query  331  GKIGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            G++GSDSHL +VY+K VPC DLVP++ +LLVERFGAV R+REEDE+
Sbjct  273  GRVGSDSHLADVYRKSVPCKDLVPIVADLLVERFGAVPREREEDEE  318



>ref|XP_010488973.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic [Camelina 
sativa]
Length=584

 Score =   238 bits (606),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 144/165 (87%), Gaps = 1/165 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLL-TKLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQNIIIP++ +S  ++LL+EP L  + SPEP ILMKGLVACTGSQFCGQAIIETK RA
Sbjct  420  TVEQNIIIPNVDSSKTEALLQEPFLKNRFSPEPSILMKGLVACTGSQFCGQAIIETKLRA  479

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            LK+TEEVER V+V RP+RMHWTGCPNTCGQVQVADIGFMGCL R E GK VEGADV++GG
Sbjct  480  LKVTEEVERLVSVPRPIRMHWTGCPNTCGQVQVADIGFMGCLTRGEEGKPVEGADVYVGG  539

Query  328  KIGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            +IGSDSH+GE+YKKGV   DLVPL+ E+L++ FGAV R+REE+ED
Sbjct  540  RIGSDSHIGEIYKKGVRVTDLVPLVAEILIKEFGAVPREREENED  584



>dbj|BAD15364.1| nitrite reductase [Nicotiana tabacum]
Length=584

 Score =   238 bits (606),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 146/165 (88%), Gaps = 2/165 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLL-TKLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQNIIIP+++NS +++LL EPLL  + S +PPILMK LVACTG+QFCG+AIIETKAR+
Sbjct  421  TVEQNIIIPNVKNSKIEALLNEPLLKNRFSTDPPILMKNLVACTGNQFCGKAIIETKARS  480

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            +KITEEV+  V++ +PVRMHWTGCPN+C QVQVADIGFMGCL R E GK VEGADV+LGG
Sbjct  481  MKITEEVQLLVSITQPVRMHWTGCPNSCAQVQVADIGFMGCLTRKE-GKTVEGADVYLGG  539

Query  328  KIGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            +IGSDSHLG+VYKK VPC+DLVP+IV+LLV+ FGAV R+REE ED
Sbjct  540  RIGSDSHLGDVYKKSVPCEDLVPIIVDLLVDNFGAVPREREEAED  584



>pdb|3B0H|A Chain A, Assimilatory Nitrite Reductase (Nii4) From Tobbaco Root
 pdb|3B0H|B Chain B, Assimilatory Nitrite Reductase (Nii4) From Tobbaco Root
Length=588

 Score =   238 bits (606),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 146/165 (88%), Gaps = 2/165 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLL-TKLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQNIIIP+++NS +++LL EPLL  + S +PPILMK LVACTG+QFCG+AIIETKAR+
Sbjct  425  TVEQNIIIPNVKNSKIEALLNEPLLKNRFSTDPPILMKNLVACTGNQFCGKAIIETKARS  484

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            +KITEEV+  V++ +PVRMHWTGCPN+C QVQVADIGFMGCL R E GK VEGADV+LGG
Sbjct  485  MKITEEVQLLVSITQPVRMHWTGCPNSCAQVQVADIGFMGCLTRKE-GKTVEGADVYLGG  543

Query  328  KIGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            +IGSDSHLG+VYKK VPC+DLVP+IV+LLV+ FGAV R+REE ED
Sbjct  544  RIGSDSHLGDVYKKSVPCEDLVPIIVDLLVDNFGAVPREREEAED  588



>ref|XP_004505220.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic-like 
[Cicer arietinum]
Length=582

 Score =   237 bits (605),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 145/165 (88%), Gaps = 1/165 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLT-KLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQNIII +++NS +++LL+EPLL  K SP P ILMK LVACTG+QFCGQAIIETKARA
Sbjct  418  TVEQNIIITNVENSKLNALLQEPLLKDKFSPSPSILMKTLVACTGNQFCGQAIIETKARA  477

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            LK+TEEVER+VAV +PVRMHWTGCPNTCGQVQVADIGFMGC+ R+E GK  EG D+FLGG
Sbjct  478  LKVTEEVERQVAVFKPVRMHWTGCPNTCGQVQVADIGFMGCMTRDENGKITEGVDIFLGG  537

Query  328  KIGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            +IGSDSHL EVYKKGVPC DLVP++ ++LV+ FGAV+R REE +D
Sbjct  538  RIGSDSHLAEVYKKGVPCKDLVPIVADILVKYFGAVQRNREEGDD  582



>gb|ACL13515.1| ferredoxin-nitrite reductase precursor [Triticum aestivum]
Length=597

 Score =   238 bits (606),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 142/164 (87%), Gaps = 0/164 (0%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQNI++P+++N  V++LL EPLL K S  P +LMKGLVACTG+QFCGQAIIETKARAL
Sbjct  434  TVEQNIVLPNVRNDKVEALLAEPLLEKFSAHPSLLMKGLVACTGNQFCGQAIIETKARAL  493

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
            ++T +VE RV+V R VRMHWTGCPN+C QVQVADIGFMGCL +N +GK VE AD+F+GG+
Sbjct  494  QVTRDVEARVSVPRAVRMHWTGCPNSCAQVQVADIGFMGCLTKNSSGKIVEAADIFVGGR  553

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            +GSDSHL  VYKK VPC+DLVP++ +LLVERFGAV R+REEDE+
Sbjct  554  VGSDSHLTGVYKKAVPCEDLVPIVADLLVERFGAVPREREEDEE  597



>ref|XP_006409539.1| hypothetical protein EUTSA_v10022613mg [Eutrema salsugineum]
 gb|ESQ50992.1| hypothetical protein EUTSA_v10022613mg [Eutrema salsugineum]
Length=590

 Score =   237 bits (605),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 144/165 (87%), Gaps = 1/165 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLL-TKLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQNIIIP+++ S  ++LL+EP L  + SPEP ILMKGLVACTG+QFCGQAIIETK RA
Sbjct  425  TVEQNIIIPNVETSKTEALLQEPFLKNRFSPEPSILMKGLVACTGNQFCGQAIIETKQRA  484

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            LK+TEEVER VAV +PVRMHWTGCPNTCGQVQVADIGFMGCL R E GK VEGADV++GG
Sbjct  485  LKVTEEVERLVAVTKPVRMHWTGCPNTCGQVQVADIGFMGCLTRGENGKPVEGADVYVGG  544

Query  328  KIGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            +IGSDSHLGE+YKKGV   DLVPL+ E+LV+ FGAV R+REE+E+
Sbjct  545  RIGSDSHLGEIYKKGVRVTDLVPLVAEILVKEFGAVPREREENEE  589



>ref|XP_002454602.1| hypothetical protein SORBIDRAFT_04g034160 [Sorghum bicolor]
 gb|EES07578.1| hypothetical protein SORBIDRAFT_04g034160 [Sorghum bicolor]
Length=593

 Score =   237 bits (604),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 145/165 (88%), Gaps = 1/165 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLL-TKLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQNI++P++ N  VD+LL EPLL  + SPEP +L+KGLVACTG+QFCGQAIIETKARA
Sbjct  429  TVEQNIVLPNVSNERVDALLAEPLLRQRFSPEPSLLLKGLVACTGNQFCGQAIIETKARA  488

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            L++T EVE+RV+V RPVRMHWTGCPN+CGQVQVADIGFMGCL ++  GK VE AD+F+GG
Sbjct  489  LQVTREVEKRVSVPRPVRMHWTGCPNSCGQVQVADIGFMGCLTKDSDGKIVEAADIFVGG  548

Query  328  KIGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            ++GSDSHL +VYKK VPC DLVP++ +LLVERFGAV R+REEDE+
Sbjct  549  RVGSDSHLADVYKKSVPCKDLVPIVADLLVERFGAVPREREEDEE  593



>gb|AAN31830.1| putative ferredoxin--nitrite reductase [Arabidopsis thaliana]
Length=586

 Score =   236 bits (603),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 144/165 (87%), Gaps = 1/165 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLL-TKLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQNIIIP+++ S  ++LL+EP L  + SPEP ILMKGLVACTGSQFCGQAIIETK RA
Sbjct  422  TVEQNIIIPNVETSKTEALLQEPFLKNRFSPEPSILMKGLVACTGSQFCGQAIIETKLRA  481

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            LK+TEEVER V+V RP+RMHWTGCPNTCGQVQVADIGFMGCL R E GK VEGADV++GG
Sbjct  482  LKVTEEVERLVSVPRPIRMHWTGCPNTCGQVQVADIGFMGCLTRGEEGKPVEGADVYVGG  541

Query  328  KIGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            +IGSDSH+GE+YKKGV   +LVPL+ E+L++ FGAV R+REE+ED
Sbjct  542  RIGSDSHIGEIYKKGVRVTELVPLVAEILIKEFGAVPREREENED  586



>ref|NP_179164.1| Ferredoxin--nitrite reductase [Arabidopsis thaliana]
 sp|Q39161.1|NIR_ARATH RecName: Full=Ferredoxin--nitrite reductase, chloroplastic; Short=NiR; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAK26030.1|AF360320_1 putative ferredoxin-nitrite reductase [Arabidopsis thaliana]
 dbj|BAA03561.1| nitrite reductase [Arabidopsis thaliana]
 dbj|BAA21672.1| nitrite reductase [Arabidopsis thaliana]
 gb|AAD17406.1| ferredoxin--nitrite reductase [Arabidopsis thaliana]
 gb|AAK73966.1| At2g15620/F9O13.17 [Arabidopsis thaliana]
 gb|AAM16256.1| At2g15620/F9O13.17 [Arabidopsis thaliana]
 gb|AAN13223.1| putative ferredoxin-nitrite reductase [Arabidopsis thaliana]
 gb|AEC06424.1| Ferredoxin--nitrite reductase [Arabidopsis thaliana]
Length=586

 Score =   236 bits (603),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 144/165 (87%), Gaps = 1/165 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLL-TKLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQNIIIP+++ S  ++LL+EP L  + SPEP ILMKGLVACTGSQFCGQAIIETK RA
Sbjct  422  TVEQNIIIPNVETSKTEALLQEPFLKNRFSPEPSILMKGLVACTGSQFCGQAIIETKLRA  481

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            LK+TEEVER V+V RP+RMHWTGCPNTCGQVQVADIGFMGCL R E GK VEGADV++GG
Sbjct  482  LKVTEEVERLVSVPRPIRMHWTGCPNTCGQVQVADIGFMGCLTRGEEGKPVEGADVYVGG  541

Query  328  KIGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            +IGSDSH+GE+YKKGV   +LVPL+ E+L++ FGAV R+REE+ED
Sbjct  542  RIGSDSHIGEIYKKGVRVTELVPLVAEILIKEFGAVPREREENED  586



>gb|AAN31831.1| putative ferredoxin--nitrite reductase [Arabidopsis thaliana]
Length=586

 Score =   236 bits (603),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 144/165 (87%), Gaps = 1/165 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLL-TKLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQNIIIP+++ S  ++LL+EP L  + SPEP ILMKGLVACTGSQFCGQAIIETK RA
Sbjct  422  TVEQNIIIPNVETSKTEALLQEPFLKNRFSPEPSILMKGLVACTGSQFCGQAIIETKLRA  481

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            LK+TEEVER V+V RP+RMHWTGCPNTCGQVQVADIGFMGCL R E GK VEGADV++GG
Sbjct  482  LKVTEEVERLVSVPRPIRMHWTGCPNTCGQVQVADIGFMGCLTRGEEGKPVEGADVYVGG  541

Query  328  KIGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            +IGSDSH+GE+YKKGV   +LVPL+ E+L++ FGAV R+REE+ED
Sbjct  542  RIGSDSHIGEIYKKGVRVTELVPLVAEILIKEFGAVPREREENED  586



>ref|XP_002883906.1| hypothetical protein ARALYDRAFT_899777 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60165.1| hypothetical protein ARALYDRAFT_899777 [Arabidopsis lyrata subsp. 
lyrata]
Length=585

 Score =   236 bits (603),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 144/165 (87%), Gaps = 1/165 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLT-KLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQNIIIP+++ S  ++LL+EP L  + SPEP ILMKGLVACTG+QFCGQAIIETK RA
Sbjct  421  TVEQNIIIPNVETSKTEALLQEPFLKIRFSPEPSILMKGLVACTGNQFCGQAIIETKLRA  480

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            LK+TEEVER V+V +P+RMHWTGCPNTCGQVQVADIGFMGCL R E GK VEGADV++GG
Sbjct  481  LKVTEEVERLVSVPKPIRMHWTGCPNTCGQVQVADIGFMGCLTRGENGKPVEGADVYVGG  540

Query  328  KIGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            +IGSDSH+GE+YKKGV   DLVPL+ E+L++ FGAV R+REE+ED
Sbjct  541  RIGSDSHIGEIYKKGVRVTDLVPLVAEILIKEFGAVPREREENED  585



>gb|KFK40026.1| hypothetical protein AALP_AA3G320500 [Arabis alpina]
Length=583

 Score =   236 bits (601),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 145/165 (88%), Gaps = 1/165 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLL-TKLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQNIIIP++ +S  ++LL+EP L  + SPEP ILMKGLVACTG+QFCGQAIIETK RA
Sbjct  419  TVEQNIIIPNVDSSKTEALLQEPFLKNRFSPEPSILMKGLVACTGNQFCGQAIIETKLRA  478

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            LK+TEEVER VAV +PVRMHWTGCPNTCGQVQVADIGFMGCL R ++GK VEGADV++GG
Sbjct  479  LKVTEEVERLVAVPKPVRMHWTGCPNTCGQVQVADIGFMGCLTRGDSGKPVEGADVYVGG  538

Query  328  KIGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            +IGSDSHLG++YKKGV   DLVPL+ E+L++ FGAV R+REE+ED
Sbjct  539  RIGSDSHLGQIYKKGVRVTDLVPLVAEILIKEFGAVPREREENED  583



>gb|ACL13516.1| ferredoxin-nitrite reductase precursor [Triticum aestivum]
Length=597

 Score =   236 bits (602),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 141/164 (86%), Gaps = 0/164 (0%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQNI++P+++N  V +LL EPLL K S  P +LMKGLVACTG+QFCGQAIIETKARAL
Sbjct  434  TVEQNIVLPNVRNDKVGALLAEPLLEKFSAHPSLLMKGLVACTGNQFCGQAIIETKARAL  493

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
            ++T +VE RV+V R VRMHWTGCPN+C QVQVADIGFMGCL +N +GK VE AD+F+GG+
Sbjct  494  QVTRDVEARVSVPRAVRMHWTGCPNSCAQVQVADIGFMGCLTKNSSGKIVEAADIFVGGR  553

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            +GSDSHL  VYKK VPC+DLVP++ +LLVERFGAV R+REEDE+
Sbjct  554  VGSDSHLTGVYKKAVPCEDLVPVVADLLVERFGAVPREREEDEE  597



>ref|XP_010517336.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic-like 
[Camelina sativa]
Length=584

 Score =   236 bits (601),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 144/165 (87%), Gaps = 1/165 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLL-TKLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQNIIIP+++ S  ++LL+EP L  + SPEP ILMKGLVACTG+QFCGQAIIETK RA
Sbjct  420  TVEQNIIIPNVETSKTEALLQEPFLKNRFSPEPSILMKGLVACTGNQFCGQAIIETKLRA  479

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            LK+TEEVER V+V RP+RMHWTGCPNTCGQVQVADIGFMGCL R + GK VEGADV++GG
Sbjct  480  LKVTEEVERLVSVPRPIRMHWTGCPNTCGQVQVADIGFMGCLTRGDEGKPVEGADVYVGG  539

Query  328  KIGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            +IGSDSH+GE+YKKGV   DLVPL+ E+L++ FGAV R+REE+ED
Sbjct  540  RIGSDSHIGEIYKKGVRVTDLVPLVAEILIKEFGAVPREREENED  584



>emb|CDY36642.1| BnaA07g04150D [Brassica napus]
Length=586

 Score =   235 bits (599),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 144/165 (87%), Gaps = 1/165 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLL-TKLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQNIIIP+++ S  ++LL+EP L  + SPEP ILMKGLVACTG+QFCGQAIIETK RA
Sbjct  422  TVEQNIIIPNVETSKTEALLQEPFLKNRFSPEPSILMKGLVACTGNQFCGQAIIETKLRA  481

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            LK+TEEVER VAV +P+RMHWTGCPNTCGQVQVADIGFMGCL R E GK VEGADV++GG
Sbjct  482  LKVTEEVERLVAVPKPIRMHWTGCPNTCGQVQVADIGFMGCLTRGENGKPVEGADVYVGG  541

Query  328  KIGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            +IGSDSHLGE+YKKGV   +LVPL+ E+L++ FGAV R+RE++ED
Sbjct  542  RIGSDSHLGEIYKKGVRVTELVPLVAEILIKEFGAVPREREDNED  586



>ref|XP_006297287.1| hypothetical protein CARUB_v10013302mg [Capsella rubella]
 gb|EOA30185.1| hypothetical protein CARUB_v10013302mg [Capsella rubella]
Length=588

 Score =   235 bits (599),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 144/165 (87%), Gaps = 1/165 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLL-TKLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQNIIIP++ +S  ++LL+EP L  + SPEP ILMKGLVACTG+QFCGQAIIETK RA
Sbjct  424  TVEQNIIIPNVDSSKTEALLQEPFLKNRFSPEPSILMKGLVACTGNQFCGQAIIETKLRA  483

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            LK+TEEVER V+V RP+RMHWTGCPNTCGQVQVADIGFMGCL R E GK VEGADV++GG
Sbjct  484  LKVTEEVERLVSVPRPIRMHWTGCPNTCGQVQVADIGFMGCLTRGEEGKPVEGADVYVGG  543

Query  328  KIGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            +IGSDSH+GE+YKKGV   DLVP++ E+L++ FGAV R+REE+ED
Sbjct  544  RIGSDSHIGEIYKKGVRVTDLVPVVAEILIKEFGAVPREREENED  588



>emb|CDX71230.1| BnaC07g05090D [Brassica napus]
Length=586

 Score =   234 bits (598),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 144/165 (87%), Gaps = 1/165 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLL-TKLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQNIIIP+++ S  ++LL+EP L  + SPEP ILMKGLVACTG+QFCGQAIIETK RA
Sbjct  422  TVEQNIIIPNVETSKTEALLQEPFLKNRFSPEPSILMKGLVACTGNQFCGQAIIETKLRA  481

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            LK+TEEVER VAV +P+RMHWTGCPNTCGQVQVADIGFMGCL R E GK VEGADV++GG
Sbjct  482  LKVTEEVERLVAVPKPIRMHWTGCPNTCGQVQVADIGFMGCLTRGENGKPVEGADVYVGG  541

Query  328  KIGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            +IGSDSHLGE+YKKGV   +LVPL+ E+L++ FGAV R+RE++ED
Sbjct  542  RIGSDSHLGEIYKKGVRVTELVPLVAEILIKEFGAVPREREDNED  586



>ref|XP_009119404.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic [Brassica 
rapa]
Length=589

 Score =   234 bits (598),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 144/165 (87%), Gaps = 1/165 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLL-TKLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQNIIIP+++ S  ++LL+EP L  + SPEP ILMKGLVACTG+QFCGQAIIETK RA
Sbjct  425  TVEQNIIIPNVETSKTEALLQEPFLKNRFSPEPSILMKGLVACTGNQFCGQAIIETKLRA  484

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            LK+TEEVER VAV +P+RMHWTGCPNTCGQVQVADIGFMGCL R E GK VEGADV++GG
Sbjct  485  LKVTEEVERLVAVPKPIRMHWTGCPNTCGQVQVADIGFMGCLTRGENGKPVEGADVYVGG  544

Query  328  KIGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            +IGSDSHLGE+YKKGV   +LVPL+ E+L++ FGAV R+RE++ED
Sbjct  545  RIGSDSHLGEIYKKGVRVTELVPLVAEILIKEFGAVPREREDNED  589



>gb|AAX19269.1| nitrite reductase [Fragaria x ananassa]
Length=165

 Score =   222 bits (565),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 141/165 (85%), Gaps = 2/165 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLT-KLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQ+   P+++N+ + +LL+EPLL  K SPEP ILMKGLVACTG+QF GQAIIETK RA
Sbjct  2    TVEQHYY-PNVENTKLQALLQEPLLKEKFSPEPSILMKGLVACTGNQFWGQAIIETKQRA  60

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            LK+TEEVER V+V RPVRMHWTGCPNTCGQVQVADIGFMGC+AR+E GK VEG DVFLGG
Sbjct  61   LKVTEEVERHVSVTRPVRMHWTGCPNTCGQVQVADIGFMGCMARDENGKPVEGVDVFLGG  120

Query  328  KIGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            +IGSDSHLG++YKK VPC DLVPL++++LV+    V R+REE ED
Sbjct  121  RIGSDSHLGDIYKKNVPCKDLVPLVIDILVKSLWLVPREREEGED  165



>prf||1908371B nitrite reductase
Length=456

 Score =   231 bits (589),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 129/164 (79%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQNIIIP+I+ S +++LLKEP+L+  SP+PPILMKGLVACTG+QFCGQAIIETKAR+L
Sbjct  293  TVEQNIIIPNIETSKIEALLKEPVLSTFSPDPPILMKGLVACTGNQFCGQAIIETKARSL  352

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
            KITEEV+R+V++ +PVRMHWTGCPNTC QVQVADIGFMGCL R++ GK VEGADVFLGG+
Sbjct  353  KITEEVQRQVSLTKPVRMHWTGCPNTCAQVQVADIGFMGCLTRDKNGKTVEGADVFLGGR  412

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            IGSDSHLGEVYKK VPCDDLVPL+V+LLV  FGAV R+REE ED
Sbjct  413  IGSDSHLGEVYKKAVPCDDLVPLVVDLLVNNFGAVPREREETED  456



>gb|EYU37674.1| hypothetical protein MIMGU_mgv1a003340mg [Erythranthe guttata]
Length=591

 Score =   234 bits (597),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 131/165 (79%), Positives = 149/165 (90%), Gaps = 1/165 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLL-TKLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQNIIIP+I NS +++LL EPLL  + SPEPPILMKGLVACTG+QFCGQAIIETKARA
Sbjct  427  TVEQNIIIPNIANSKLEALLNEPLLKNRFSPEPPILMKGLVACTGNQFCGQAIIETKARA  486

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            LK+TEEV R V+V +PVRMHWTGCPNTCGQVQVADIGFMGC+ RN+ GK VEGADVFLGG
Sbjct  487  LKVTEEVGRLVSVVKPVRMHWTGCPNTCGQVQVADIGFMGCMTRNKDGKVVEGADVFLGG  546

Query  328  KIGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            +IGSDSHLGE+YKK VPC+DLVPL+V+LLVE+FG V R+REE ED
Sbjct  547  RIGSDSHLGEIYKKSVPCEDLVPLVVDLLVEKFGGVLREREESED  591



>emb|CAA46942.1| ferredoxin--nitrite reductase [Nicotiana tabacum]
Length=456

 Score =   231 bits (588),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 129/164 (79%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQNIIIP+I+ S +++LLKEP+L+  SP+PPILMKGLVACTG+QFCGQAIIETKAR+L
Sbjct  293  TVEQNIIIPNIETSKIEALLKEPVLSTFSPDPPILMKGLVACTGNQFCGQAIIETKARSL  352

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
            KITEEV+R+V++ +PVRMHWTGCPNTC QVQVADIGFMGCL R++ GK VEGADVFLGG+
Sbjct  353  KITEEVQRQVSLTKPVRMHWTGCPNTCAQVQVADIGFMGCLTRDKNGKTVEGADVFLGGR  412

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            IGSDSHLGEVYKK VPCDDLVPL+V+LLV  FGAV R+REE ED
Sbjct  413  IGSDSHLGEVYKKAVPCDDLVPLVVDLLVNNFGAVPREREETED  456



>gb|AFW64354.1| hypothetical protein ZEAMMB73_724678 [Zea mays]
 gb|AFW64355.1| hypothetical protein ZEAMMB73_724678 [Zea mays]
Length=458

 Score =   231 bits (588),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 144/166 (87%), Gaps = 2/166 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLT--KLSPEPPILMKGLVACTGSQFCGQAIIETKAR  512
            TVEQNI++P++ N  +D+LL EPLL   +LSP P +L++GLVACTG+QFCGQAIIETKAR
Sbjct  293  TVEQNIVLPNVSNERLDALLAEPLLQEQRLSPRPSMLLRGLVACTGNQFCGQAIIETKAR  352

Query  511  ALKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLG  332
            AL++  EVE+RVAV RPVRMHWTGCPN+CGQVQVADIGFMGCL ++  GK VE AD+F+G
Sbjct  353  ALQVAREVEKRVAVPRPVRMHWTGCPNSCGQVQVADIGFMGCLTKDSDGKIVEAADIFVG  412

Query  331  GKIGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            G++GSDSHL +VY+K VPC DLVP++ +LLVERFGAV R+REEDE+
Sbjct  413  GRVGSDSHLADVYRKSVPCKDLVPIVADLLVERFGAVPREREEDEE  458



>ref|XP_009628648.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=587

 Score =   234 bits (596),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 131/164 (80%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQNIIIP+I+NS +++LLKEP+L+  SP+PPILMKGLVACTG+QFCGQAIIETKAR+L
Sbjct  424  TVEQNIIIPNIENSKIEALLKEPVLSTFSPDPPILMKGLVACTGNQFCGQAIIETKARSL  483

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
            KITEEV+R+V++ RPVRMHWTGCPNTC QVQVADIGFMGCL R++ GK VEGADVFLGG+
Sbjct  484  KITEEVQRQVSLTRPVRMHWTGCPNTCAQVQVADIGFMGCLTRDKNGKTVEGADVFLGGR  543

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            IGSDSHLGEVYKK VPCDDLVPL+V+LLV  FGAV R+REE ED
Sbjct  544  IGSDSHLGEVYKKAVPCDDLVPLVVDLLVNNFGAVPREREETED  587



>ref|XP_003570568.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic [Brachypodium 
distachyon]
Length=598

 Score =   234 bits (596),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 142/164 (87%), Gaps = 0/164 (0%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQNI++P++ N  + SLL EPLL K S +P +LMKGLVACTG+QFCGQAIIETKARAL
Sbjct  435  TVEQNIVLPNVPNDKIPSLLAEPLLQKFSAQPSLLMKGLVACTGNQFCGQAIIETKARAL  494

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
            ++T +VERRV+V R VRMHWTGCPN+C QVQVADIGFMGCL +N +GK VE AD+F+GG+
Sbjct  495  RVTRDVERRVSVPRAVRMHWTGCPNSCAQVQVADIGFMGCLTKNGSGKIVEAADIFVGGR  554

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            +GSDSHL  V+KK VPC+DLVP++ +LLVERFGAV R+REEDE+
Sbjct  555  VGSDSHLTGVWKKAVPCEDLVPVVADLLVERFGAVPREREEDEE  598



>ref|XP_010943064.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic [Elaeis 
guineensis]
Length=590

 Score =   233 bits (595),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 141/159 (89%), Gaps = 0/159 (0%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQNIIIP+I++S V++LL EPLL K SPEP +LMKGLVACTG+QFCGQAIIETKARA+
Sbjct  422  TVEQNIIIPNIKDSRVEALLDEPLLKKFSPEPSLLMKGLVACTGNQFCGQAIIETKARAM  481

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
            K+TEEVE+RV+V R +RMHWTGCPN+CGQVQVADIGFMGC+ ++  GK  EG DV+LGG+
Sbjct  482  KVTEEVEKRVSVERTIRMHWTGCPNSCGQVQVADIGFMGCMTKDAEGKVCEGVDVYLGGR  541

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQR  209
            IGSDSHLG++YKKGVPC DLVPL+ ++LV+ FGAV R R
Sbjct  542  IGSDSHLGDLYKKGVPCKDLVPLVADILVKHFGAVPRVR  580



>emb|CBI32406.3| unnamed protein product [Vitis vinifera]
Length=499

 Score =   231 bits (590),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 118/154 (77%), Positives = 136/154 (88%), Gaps = 1/154 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLT-KLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQNIIIP+++NS +++LLKEPLL  + SPEPPILMKGLVACTG+QFCGQAIIETKARA
Sbjct  329  TVEQNIIIPNVENSRLEALLKEPLLRDRFSPEPPILMKGLVACTGNQFCGQAIIETKARA  388

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            LK+TE+V R V+V +PVRMHWTGCPN+CGQVQVADIGFMGC+ R+E G   EGADVFLGG
Sbjct  389  LKVTEDVGRLVSVTQPVRMHWTGCPNSCGQVQVADIGFMGCMTRDENGNVCEGADVFLGG  448

Query  328  KIGSDSHLGEVYKKGVPCDDLVPLIVELLVERFG  227
            +IGSD HLGEVYKK VPC DLVPL+ E+LV  FG
Sbjct  449  RIGSDCHLGEVYKKRVPCKDLVPLVAEILVNHFG  482



>ref|XP_010467309.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic-like 
[Camelina sativa]
Length=584

 Score =   233 bits (594),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 120/165 (73%), Positives = 144/165 (87%), Gaps = 1/165 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLL-TKLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQNIIIP++ +S  ++LL+EP L ++ SPEP ILMKGLVACTG+QFCGQAIIETK RA
Sbjct  420  TVEQNIIIPNVDSSKTEALLQEPFLKSRFSPEPSILMKGLVACTGNQFCGQAIIETKLRA  479

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            LK+TEEVER V+V RP+RMHWTGCPNTCGQVQVADIGFMGCL R + GK VEGADV++GG
Sbjct  480  LKVTEEVERLVSVPRPIRMHWTGCPNTCGQVQVADIGFMGCLTRGDEGKPVEGADVYVGG  539

Query  328  KIGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            +IGSDSH+GE+YKKGV    LVPL+ E+L++ FGAV R+REE+ED
Sbjct  540  RIGSDSHIGEIYKKGVRVTHLVPLVAEILIKEFGAVPREREENED  584



>ref|XP_004954025.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic-like 
[Setaria italica]
Length=593

 Score =   232 bits (592),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 116/165 (70%), Positives = 144/165 (87%), Gaps = 1/165 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLT-KLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQNI++P+++N  +D+LL EPLL  +LSP+P +L+KGLVACTG QFCGQAIIETKARA
Sbjct  429  TVEQNIVLPNVRNERLDALLAEPLLQERLSPQPSLLLKGLVACTGKQFCGQAIIETKARA  488

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            L++T EVE+RV+V RPVRMHWTGCPN+C QVQVADIGFMGCL +   GK  E AD+F+GG
Sbjct  489  LQVTREVEKRVSVPRPVRMHWTGCPNSCAQVQVADIGFMGCLTKGSDGKVCEAADIFVGG  548

Query  328  KIGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            ++GSDSHL +VYKK VPCDDLVP++ ++LVERFGAV R+REEDE+
Sbjct  549  RVGSDSHLADVYKKAVPCDDLVPVVADILVERFGAVPREREEDEE  593



>dbj|BAD15363.1| nitrite reductase [Nicotiana tabacum]
Length=587

 Score =   231 bits (590),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 129/164 (79%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQNIIIP+I+ S +++LLKEP+L+  SP+PPILMKGLVACTG+QFCGQAIIETKAR+L
Sbjct  424  TVEQNIIIPNIETSKIEALLKEPVLSTFSPDPPILMKGLVACTGNQFCGQAIIETKARSL  483

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
            KITEEV+R+V++ +PVRMHWTGCPNTC QVQVADIGFMGCL R++ GK VEGADVFLGG+
Sbjct  484  KITEEVQRQVSLTKPVRMHWTGCPNTCAQVQVADIGFMGCLTRDKNGKTVEGADVFLGGR  543

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            IGSDSHLGEVYKK VPCDDLVPL+V+LLV  FGAV R+REE ED
Sbjct  544  IGSDSHLGEVYKKAVPCDDLVPLVVDLLVNNFGAVPREREETED  587



>gb|AAA60450.1| nitrite reductase, partial [Zea mays]
Length=567

 Score =   231 bits (589),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 144/166 (87%), Gaps = 2/166 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLT--KLSPEPPILMKGLVACTGSQFCGQAIIETKAR  512
            TVEQNI++P++ N  +D+LL EPLL   +LSP P +L++GLVACTG+QFCGQAIIETKAR
Sbjct  402  TVEQNIVLPNVSNERLDALLAEPLLQEQRLSPRPSMLLRGLVACTGNQFCGQAIIETKAR  461

Query  511  ALKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLG  332
            AL++  EVE+RVAV RPVRMHWTGCPN+CGQVQVADIGFMGCL ++  GK VE AD+F+G
Sbjct  462  ALQVAREVEKRVAVPRPVRMHWTGCPNSCGQVQVADIGFMGCLTKDSDGKIVEAADIFVG  521

Query  331  GKIGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            G++GSDSHL +VY+K VPC DLVP++ +LLVERFGAV R+REEDE+
Sbjct  522  GRVGSDSHLADVYRKSVPCKDLVPIVADLLVERFGAVPREREEDEE  567



>sp|P17847.1|NIR_MAIZE RecName: Full=Ferredoxin--nitrite reductase, chloroplastic; Flags: 
Precursor, partial [Zea mays]
Length=569

 Score =   231 bits (589),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 144/166 (87%), Gaps = 2/166 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLT--KLSPEPPILMKGLVACTGSQFCGQAIIETKAR  512
            TVEQNI++P++ N  +D+LL EPLL   +LSP P +L++GLVACTG+QFCGQAIIETKAR
Sbjct  404  TVEQNIVLPNVSNERLDALLAEPLLQEQRLSPRPSMLLRGLVACTGNQFCGQAIIETKAR  463

Query  511  ALKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLG  332
            AL++  EVE+RVAV RPVRMHWTGCPN+CGQVQVADIGFMGCL ++  GK VE AD+F+G
Sbjct  464  ALQVAREVEKRVAVPRPVRMHWTGCPNSCGQVQVADIGFMGCLTKDSDGKIVEAADIFVG  523

Query  331  GKIGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            G++GSDSHL +VY+K VPC DLVP++ +LLVERFGAV R+REEDE+
Sbjct  524  GRVGSDSHLADVYRKSVPCKDLVPIVADLLVERFGAVPREREEDEE  569



>pdb|3B0G|A Chain A, Assimilatory Nitrite Reductase (Nii3) From Tobbaco Leaf
 pdb|3VKP|A Chain A, Assimilatory Nitrite Reductase (nii3) - No2 Complex 
From Tobbaco Leaf Analysed With Low X-ray Dose
 pdb|3VKQ|A Chain A, Assimilatory Nitrite Reductase (nii3) - No2 Complex 
From Tobbaco Leaf Analysed With Middle X-ray Dose
 pdb|3VKR|A Chain A, Assimilatory Nitrite Reductase (nii3) - No2 Complex 
From Tobbaco Leaf Analysed With High X-ray Dose
 pdb|3VKS|A Chain A, Assimilatory Nitrite Reductase (nii3) - No Complex From 
Tobbaco Leaf
 pdb|3VKT|A Chain A, Assimilatory Nitrite Reductase (nii3) - Nh2oh Complex 
From Tobbaco Leaf
Length=591

 Score =   231 bits (590),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 129/164 (79%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQNIIIP+I+ S +++LLKEP+L+  SP+PPILMKGLVACTG+QFCGQAIIETKAR+L
Sbjct  428  TVEQNIIIPNIETSKIEALLKEPVLSTFSPDPPILMKGLVACTGNQFCGQAIIETKARSL  487

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
            KITEEV+R+V++ +PVRMHWTGCPNTC QVQVADIGFMGCL R++ GK VEGADVFLGG+
Sbjct  488  KITEEVQRQVSLTKPVRMHWTGCPNTCAQVQVADIGFMGCLTRDKNGKTVEGADVFLGGR  547

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            IGSDSHLGEVYKK VPCDDLVPL+V+LLV  FGAV R+REE ED
Sbjct  548  IGSDSHLGEVYKKAVPCDDLVPLVVDLLVNNFGAVPREREETED  591



>emb|CAA46940.1| ferredoxin--nitrite reductase [Nicotiana tabacum]
Length=583

 Score =   231 bits (589),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 130/164 (79%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQNIIIP+I+NS +++LLKEP+L+  SP+PPILMKGLVACTG+QFCGQAIIETKAR+L
Sbjct  420  TVEQNIIIPNIENSKIEALLKEPVLSTFSPDPPILMKGLVACTGNQFCGQAIIETKARSL  479

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             ITEEV+R+V++ RPVRMHWTGCPNTC QVQVADIGFMGCL R++ GK VEGADVFLGG+
Sbjct  480  MITEEVQRQVSLTRPVRMHWTGCPNTCAQVQVADIGFMGCLTRDKNGKTVEGADVFLGGR  539

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            IGSDSHLGEVYKK VPCDDLVPL+V+LLV  FGAV R+REE ED
Sbjct  540  IGSDSHLGEVYKKAVPCDDLVPLVVDLLVNNFGAVPREREETED  583



>gb|ACG29734.1| ferredoxin--nitrite reductase [Zea mays]
Length=597

 Score =   231 bits (590),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 144/166 (87%), Gaps = 2/166 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLT--KLSPEPPILMKGLVACTGSQFCGQAIIETKAR  512
            TVEQNI++P++ N  +D+LL EPLL   +LSP P +L++GLVACTG+QFCGQAIIETKAR
Sbjct  432  TVEQNIVLPNVSNERLDALLAEPLLQEQRLSPRPSMLLRGLVACTGNQFCGQAIIETKAR  491

Query  511  ALKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLG  332
            AL++  EVE+RVAV RPVRMHWTGCPN+CGQVQVADIGFMGCL ++  GK VE AD+F+G
Sbjct  492  ALQVAREVEKRVAVPRPVRMHWTGCPNSCGQVQVADIGFMGCLTKDSDGKIVEAADIFVG  551

Query  331  GKIGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            G++GSDSHL +VY+K VPC DLVP++ +LLVERFGAV R+REEDE+
Sbjct  552  GRVGSDSHLADVYRKSVPCKDLVPIVADLLVERFGAVPREREEDEE  597



>ref|XP_008679282.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic [Zea 
mays]
 gb|AFW64352.1| ferredoxin--nitrite reductase, Precursor [Zea mays]
Length=597

 Score =   231 bits (590),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 144/166 (87%), Gaps = 2/166 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLT--KLSPEPPILMKGLVACTGSQFCGQAIIETKAR  512
            TVEQNI++P++ N  +D+LL EPLL   +LSP P +L++GLVACTG+QFCGQAIIETKAR
Sbjct  432  TVEQNIVLPNVSNERLDALLAEPLLQEQRLSPRPSMLLRGLVACTGNQFCGQAIIETKAR  491

Query  511  ALKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLG  332
            AL++  EVE+RVAV RPVRMHWTGCPN+CGQVQVADIGFMGCL ++  GK VE AD+F+G
Sbjct  492  ALQVAREVEKRVAVPRPVRMHWTGCPNSCGQVQVADIGFMGCLTKDSDGKIVEAADIFVG  551

Query  331  GKIGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            G++GSDSHL +VY+K VPC DLVP++ +LLVERFGAV R+REEDE+
Sbjct  552  GRVGSDSHLADVYRKSVPCKDLVPIVADLLVERFGAVPREREEDEE  597



>prf||1908371A nitrite reductase
Length=583

 Score =   231 bits (589),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 130/164 (79%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQNIIIP+I+NS +++LLKEP+L+  SP+PPILMKGLVACTG+QFCGQAIIETKAR+L
Sbjct  420  TVEQNIIIPNIENSKIEALLKEPVLSTFSPDPPILMKGLVACTGNQFCGQAIIETKARSL  479

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             ITEEV+R+V++ RPVRMHWTGCPNTC QVQVADIGFMGCL R++ GK VEGADVFLGG+
Sbjct  480  MITEEVQRQVSLTRPVRMHWTGCPNTCAQVQVADIGFMGCLTRDKNGKTVEGADVFLGGR  539

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            IGSDSHLGEVYKK VPCDDLVPL+V+LLV  FGAV R+REE ED
Sbjct  540  IGSDSHLGEVYKKAVPCDDLVPLVVDLLVNNFGAVPREREETED  583



>ref|XP_009790010.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic-like, 
partial [Nicotiana sylvestris]
Length=329

 Score =   221 bits (564),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 127/165 (77%), Positives = 149/165 (90%), Gaps = 1/165 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAII-ETKARA  509
            TVEQNIIIP+I+NS +++LLKEP+L+  SP+PPILMKGLVACTG+QFCGQAII E+KAR+
Sbjct  165  TVEQNIIIPNIENSKIEALLKEPVLSTFSPDPPILMKGLVACTGNQFCGQAIIIESKARS  224

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            LKITEEV+R+V++  PVRMHWTGCP TC QVQVADIGFMGCL R++ GK VEGA+VFLGG
Sbjct  225  LKITEEVQRQVSLTWPVRMHWTGCPKTCAQVQVADIGFMGCLTRDKNGKTVEGANVFLGG  284

Query  328  KIGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            +IGSDSHLGEVYKK VPCDDLVPL+V+LLV  FGAV R+REE ED
Sbjct  285  RIGSDSHLGEVYKKVVPCDDLVPLVVDLLVNNFGAVPREREETED  329



>ref|NP_001048222.2| Os02g0765900 [Oryza sativa Japonica Group]
 dbj|BAF10136.2| Os02g0765900 [Oryza sativa Japonica Group]
Length=424

 Score =   223 bits (568),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 134/155 (86%), Gaps = 0/155 (0%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQNI+IP++++  V++LL EPLL K SP+P +L+KGLVACTG+QFCGQAIIETK RAL
Sbjct  261  TVEQNIVIPNVKDEKVEALLAEPLLQKFSPQPSLLLKGLVACTGNQFCGQAIIETKQRAL  320

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             +T +VE+ V+V R VRMHWTGCPN+CGQVQVADIGFMGCL ++ AGK VE AD+F+GG+
Sbjct  321  LVTSQVEKLVSVPRAVRMHWTGCPNSCGQVQVADIGFMGCLTKDSAGKIVEAADIFVGGR  380

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAV  221
            +GSDSHL  VYKK VPCD+L P++ ++LVERFGAV
Sbjct  381  VGSDSHLAGVYKKSVPCDELAPIVADILVERFGAV  415



>ref|XP_009417626.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic [Musa 
acuminata subsp. malaccensis]
Length=597

 Score =   227 bits (579),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 112/156 (72%), Positives = 140/156 (90%), Gaps = 1/156 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLT-KLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQN+IIP++ ++ V++LL EPLL  + SPEPP+LMKGLVACTG+QFCGQAIIETKARA
Sbjct  426  TVEQNVIIPNVDDARVEALLDEPLLKERFSPEPPLLMKGLVACTGNQFCGQAIIETKARA  485

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            +++TEEVE+RV++ R VRMHWTGCPNTCGQVQVADIGFMGC+ R+  GK  EGAD++LGG
Sbjct  486  MQVTEEVEKRVSLGRAVRMHWTGCPNTCGQVQVADIGFMGCMTRDAEGKVCEGADIYLGG  545

Query  328  KIGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAV  221
            +IGSDSHLG+++KK VPC DLVP++V++LVE FGAV
Sbjct  546  RIGSDSHLGDLHKKAVPCKDLVPVVVDILVEHFGAV  581



>ref|XP_006647964.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic-like 
[Oryza brachyantha]
Length=597

 Score =   226 bits (575),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 134/155 (86%), Gaps = 0/155 (0%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
             VEQNI+IP+++N  V++LL EPLL KLSP+P +L+KGLVACTGSQFCGQAIIETK RAL
Sbjct  434  AVEQNIVIPNVKNGKVEALLAEPLLQKLSPQPSLLLKGLVACTGSQFCGQAIIETKQRAL  493

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             +T +VE+ V+V R VRMHWTGCPN+C QVQVADIGFMGCL +N AGK VE AD+F+GG+
Sbjct  494  LVTSQVEKLVSVPRAVRMHWTGCPNSCAQVQVADIGFMGCLTKNSAGKVVEAADIFVGGR  553

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAV  221
            +GSDSHL +VYKK VPCD++ P++ ++LVERFGAV
Sbjct  554  VGSDSHLADVYKKSVPCDEVAPIVADILVERFGAV  588



>gb|EPS71034.1| hypothetical protein M569_03724 [Genlisea aurea]
Length=591

 Score =   224 bits (572),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 115/156 (74%), Positives = 139/156 (89%), Gaps = 1/156 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLT-KLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQN++IP+I+NS VD+LL EPLL  + SP P +L  GLVACTG+QFCGQAIIETKARA
Sbjct  429  TVEQNVVIPNIENSKVDALLDEPLLRDRFSPGPSLLTGGLVACTGNQFCGQAIIETKARA  488

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            LK+TEEV+R V+VR+PVRMHWTGCPN+CGQVQVADIGFMGC+ RN  GK VEGADV++GG
Sbjct  489  LKVTEEVQRLVSVRQPVRMHWTGCPNSCGQVQVADIGFMGCMTRNGEGKVVEGADVYVGG  548

Query  328  KIGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAV  221
            +IG DSHLG++Y+KGVPCD+L PLI +LLV++FGAV
Sbjct  549  RIGCDSHLGDLYRKGVPCDELAPLIAQLLVQKFGAV  584



>gb|EEE57859.1| hypothetical protein OsJ_08501 [Oryza sativa Japonica Group]
Length=501

 Score =   222 bits (565),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 134/155 (86%), Gaps = 0/155 (0%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQNI+IP++++  V++LL EPLL K SP+P +L+KGLVACTG+QFCGQAIIETK RAL
Sbjct  338  TVEQNIVIPNVKDEKVEALLAEPLLQKFSPQPSLLLKGLVACTGNQFCGQAIIETKQRAL  397

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             +T +VE+ V+V R VRMHWTGCPN+CGQVQVADIGFMGCL ++ AGK VE AD+F+GG+
Sbjct  398  LVTSQVEKLVSVPRAVRMHWTGCPNSCGQVQVADIGFMGCLTKDSAGKIVEAADIFVGGR  457

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAV  221
            +GSDSHL  VYKK VPCD+L P++ ++LVERFGAV
Sbjct  458  VGSDSHLAGVYKKSVPCDELAPIVADILVERFGAV  492



>sp|Q42997.1|NIR_ORYSJ RecName: Full=Ferredoxin--nitrite reductase, chloroplastic; Flags: 
Precursor [Oryza sativa Japonica Group]
 dbj|BAA09122.1| ferredoxin-nitrite reductase [Oryza sativa (japonica cultivar-group)]
 dbj|BAC10721.1| putative ferredoxin--nitrite reductase, chloroplast precursor 
[Oryza sativa Japonica Group]
 gb|EEE54549.1| hypothetical protein OsJ_01727 [Oryza sativa Japonica Group]
Length=596

 Score =   224 bits (570),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 133/155 (86%), Gaps = 0/155 (0%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQNI+IP+++N  V++LL EPLL K SP+P +L+KGLVACTG+QFCGQAIIETK RAL
Sbjct  433  TVEQNIVIPNVKNEKVEALLSEPLLQKFSPQPSLLLKGLVACTGNQFCGQAIIETKQRAL  492

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             +T +VE+ V+V R VRMHWTGCPN+CGQVQVADIGFMGCL ++ AGK VE AD+F+GG+
Sbjct  493  LVTSQVEKLVSVPRAVRMHWTGCPNSCGQVQVADIGFMGCLTKDSAGKIVEAADIFVGGR  552

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAV  221
            +GSDSHL   YKK VPCD+L P++ ++LVERFGAV
Sbjct  553  VGSDSHLAGAYKKSVPCDELAPIVADILVERFGAV  587



>ref|NP_001043008.1| Os01g0357100 [Oryza sativa Japonica Group]
 dbj|BAF04922.1| Os01g0357100 [Oryza sativa Japonica Group]
Length=594

 Score =   224 bits (570),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 133/155 (86%), Gaps = 0/155 (0%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQNI+IP+++N  V++LL EPLL K SP+P +L+KGLVACTG+QFCGQAIIETK RAL
Sbjct  431  TVEQNIVIPNVKNEKVEALLSEPLLQKFSPQPSLLLKGLVACTGNQFCGQAIIETKQRAL  490

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             +T +VE+ V+V R VRMHWTGCPN+CGQVQVADIGFMGCL ++ AGK VE AD+F+GG+
Sbjct  491  LVTSQVEKLVSVPRAVRMHWTGCPNSCGQVQVADIGFMGCLTKDSAGKIVEAADIFVGGR  550

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAV  221
            +GSDSHL   YKK VPCD+L P++ ++LVERFGAV
Sbjct  551  VGSDSHLAGAYKKSVPCDELAPIVADILVERFGAV  585



>dbj|BAD53072.1| putative ferredoxin--nitrite reductase, chloroplast precursor 
[Oryza sativa Japonica Group]
Length=627

 Score =   224 bits (571),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 133/155 (86%), Gaps = 0/155 (0%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQNI+IP+++N  V++LL EPLL K SP+P +L+KGLVACTG+QFCGQAIIETK RAL
Sbjct  464  TVEQNIVIPNVKNEKVEALLSEPLLQKFSPQPSLLLKGLVACTGNQFCGQAIIETKQRAL  523

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             +T +VE+ V+V R VRMHWTGCPN+CGQVQVADIGFMGCL ++ AGK VE AD+F+GG+
Sbjct  524  LVTSQVEKLVSVPRAVRMHWTGCPNSCGQVQVADIGFMGCLTKDSAGKIVEAADIFVGGR  583

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAV  221
            +GSDSHL   YKK VPCD+L P++ ++LVERFGAV
Sbjct  584  VGSDSHLAGAYKKSVPCDELAPIVADILVERFGAV  618



>gb|EEC70619.1| hypothetical protein OsI_01871 [Oryza sativa Indica Group]
Length=596

 Score =   223 bits (569),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 133/155 (86%), Gaps = 0/155 (0%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQNI+IP+++N  V++LL EPLL K SP+P +L+KGLVACTG+QFCGQAIIETK RAL
Sbjct  433  TVEQNIVIPNVKNEKVEALLAEPLLQKFSPQPSLLLKGLVACTGNQFCGQAIIETKQRAL  492

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             +T +VE+ V+V R VRMHWTGCPN+CGQVQVADIGFMGCL ++ AGK VE AD+F+GG+
Sbjct  493  LVTSQVEKLVSVPRAVRMHWTGCPNSCGQVQVADIGFMGCLTKDSAGKIVEAADIFVGGR  552

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAV  221
            +GSDSHL   YKK VPCD+L P++ ++LVERFGAV
Sbjct  553  VGSDSHLAGAYKKSVPCDELAPIVADILVERFGAV  587



>pdb|3VLX|A Chain A, Assimilatory Nitrite Reductase (Nii3) - N226k Mutant 
- Ligand Free Form From Tobacco Leaf
 pdb|3VLY|A Chain A, Assimilatory Nitrite Reductase (Nii3) - N226k Mutant 
- So3 Partial Complex From Tobacco Leaf
 pdb|3VLZ|A Chain A, Assimilatory Nitrite Reductase (Nii3) - N226k Mutant 
- So3 Full Complex From Tobacco Leaf
 pdb|3VM0|A Chain A, Assimilatory Nitrite Reductase (Nii3) - N226k Mutant 
- No2 Complex From Tobacco Leaf
 pdb|3VM1|A Chain A, Assimilatory Nitrite Reductase (Nii3) - N226k Mutant 
- Hco3 Complex From Tobacco Leaf
Length=584

 Score =   221 bits (562),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 124/157 (79%), Positives = 144/157 (92%), Gaps = 0/157 (0%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQNIIIP+I+ S +++LLKEP+L+  SP+PPILMKGLVACTG+QFCGQAIIETKAR+L
Sbjct  428  TVEQNIIIPNIETSKIEALLKEPVLSTFSPDPPILMKGLVACTGNQFCGQAIIETKARSL  487

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
            KITEEV+R+V++ +PVRMHWTGCPNTC QVQVADIGFMGCL R++ GK VEGADVFLGG+
Sbjct  488  KITEEVQRQVSLTKPVRMHWTGCPNTCAQVQVADIGFMGCLTRDKNGKTVEGADVFLGGR  547

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRR  215
            IGSDSHLGEVYKK VPCDDLVPL+V+LLV  FGAV R
Sbjct  548  IGSDSHLGEVYKKAVPCDDLVPLVVDLLVNNFGAVPR  584



>pdb|3B0M|A Chain A, M175k Mutant Of Assimilatory Nitrite Reductase (Nii3) 
From Tobbaco Leaf
Length=584

 Score =   221 bits (562),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 124/157 (79%), Positives = 144/157 (92%), Gaps = 0/157 (0%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQNIIIP+I+ S +++LLKEP+L+  SP+PPILMKGLVACTG+QFCGQAIIETKAR+L
Sbjct  428  TVEQNIIIPNIETSKIEALLKEPVLSTFSPDPPILMKGLVACTGNQFCGQAIIETKARSL  487

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
            KITEEV+R+V++ +PVRMHWTGCPNTC QVQVADIGFMGCL R++ GK VEGADVFLGG+
Sbjct  488  KITEEVQRQVSLTKPVRMHWTGCPNTCAQVQVADIGFMGCLTRDKNGKTVEGADVFLGGR  547

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRR  215
            IGSDSHLGEVYKK VPCDDLVPL+V+LLV  FGAV R
Sbjct  548  IGSDSHLGEVYKKAVPCDDLVPLVVDLLVNNFGAVPR  584



>pdb|3B0J|A Chain A, M175e Mutant Of Assimilatory Nitrite Reductase (Nii3) 
From Tobbaco Leaf
Length=584

 Score =   221 bits (562),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 124/157 (79%), Positives = 144/157 (92%), Gaps = 0/157 (0%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQNIIIP+I+ S +++LLKEP+L+  SP+PPILMKGLVACTG+QFCGQAIIETKAR+L
Sbjct  428  TVEQNIIIPNIETSKIEALLKEPVLSTFSPDPPILMKGLVACTGNQFCGQAIIETKARSL  487

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
            KITEEV+R+V++ +PVRMHWTGCPNTC QVQVADIGFMGCL R++ GK VEGADVFLGG+
Sbjct  488  KITEEVQRQVSLTKPVRMHWTGCPNTCAQVQVADIGFMGCLTRDKNGKTVEGADVFLGGR  547

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRR  215
            IGSDSHLGEVYKK VPCDDLVPL+V+LLV  FGAV R
Sbjct  548  IGSDSHLGEVYKKAVPCDDLVPLVVDLLVNNFGAVPR  584



>pdb|3B0L|A Chain A, M175g Mutant Of Assimilatory Nitrite Reductase (Nii3) 
From Tobbaco Leaf
Length=584

 Score =   220 bits (561),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 124/157 (79%), Positives = 144/157 (92%), Gaps = 0/157 (0%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQNIIIP+I+ S +++LLKEP+L+  SP+PPILMKGLVACTG+QFCGQAIIETKAR+L
Sbjct  428  TVEQNIIIPNIETSKIEALLKEPVLSTFSPDPPILMKGLVACTGNQFCGQAIIETKARSL  487

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
            KITEEV+R+V++ +PVRMHWTGCPNTC QVQVADIGFMGCL R++ GK VEGADVFLGG+
Sbjct  488  KITEEVQRQVSLTKPVRMHWTGCPNTCAQVQVADIGFMGCLTRDKNGKTVEGADVFLGGR  547

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRR  215
            IGSDSHLGEVYKK VPCDDLVPL+V+LLV  FGAV R
Sbjct  548  IGSDSHLGEVYKKAVPCDDLVPLVVDLLVNNFGAVPR  584



>pdb|3B0N|A Chain A, Q448k Mutant Of Assimilatory Nitrite Reductase (Nii3) 
From Tobbaco Leaf
Length=584

 Score =   219 bits (558),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 123/157 (78%), Positives = 144/157 (92%), Gaps = 0/157 (0%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQNIIIP+I+ S +++LLKEP+L+  SP+PPILMKGLVACTG+QFCG+AIIETKAR+L
Sbjct  428  TVEQNIIIPNIETSKIEALLKEPVLSTFSPDPPILMKGLVACTGNQFCGKAIIETKARSL  487

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
            KITEEV+R+V++ +PVRMHWTGCPNTC QVQVADIGFMGCL R++ GK VEGADVFLGG+
Sbjct  488  KITEEVQRQVSLTKPVRMHWTGCPNTCAQVQVADIGFMGCLTRDKNGKTVEGADVFLGGR  547

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRR  215
            IGSDSHLGEVYKK VPCDDLVPL+V+LLV  FGAV R
Sbjct  548  IGSDSHLGEVYKKAVPCDDLVPLVVDLLVNNFGAVPR  584



>gb|AFW73584.1| hypothetical protein ZEAMMB73_832658 [Zea mays]
Length=593

 Score =   218 bits (555),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 108/157 (69%), Positives = 136/157 (87%), Gaps = 2/157 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTK--LSPEPPILMKGLVACTGSQFCGQAIIETKAR  512
            TVEQN+++P++ N  +D+LL EPLL +  LSP+P +L++GLVACTG+QFCGQAIIETKAR
Sbjct  427  TVEQNVVLPNVSNRRLDALLAEPLLQRQRLSPQPSLLLRGLVACTGNQFCGQAIIETKAR  486

Query  511  ALKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLG  332
            AL++  EVE+RVAV RPVRMHWTGCPN+C QVQVADIGFMGCL ++  GK VE AD+F+G
Sbjct  487  ALQVAREVEKRVAVPRPVRMHWTGCPNSCAQVQVADIGFMGCLTKDRDGKVVEAADIFVG  546

Query  331  GKIGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAV  221
            G++GSDSHL +VY+K VPC DLVP++ +LLVERFGAV
Sbjct  547  GRVGSDSHLADVYRKSVPCKDLVPIVADLLVERFGAV  583



>gb|EEC74060.1| hypothetical protein OsI_09059 [Oryza sativa Indica Group]
Length=640

 Score =   219 bits (557),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 106/155 (68%), Positives = 133/155 (86%), Gaps = 0/155 (0%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQNI+IP++++  V++LL EPLL K SP+P +L+KGLVACTG+QFCGQAIIETK RAL
Sbjct  477  TVEQNIVIPNVKDEKVEALLAEPLLQKFSPQPSLLLKGLVACTGNQFCGQAIIETKQRAL  536

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             +T +VE+ V+V R VRMHWTGCPN+CGQVQVAD GFMGCL ++ AGK VE AD+F+GG+
Sbjct  537  LVTSQVEKLVSVPRAVRMHWTGCPNSCGQVQVADNGFMGCLTKDSAGKIVEAADIFVGGR  596

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAV  221
            +GSDSHL  VYKK VPCD+L P++ ++LVERFGAV
Sbjct  597  VGSDSHLAGVYKKSVPCDELAPIVADILVERFGAV  631



>gb|ABR13288.1| putative ferredoxin--nitrite reductase [Prunus dulcis]
Length=133

 Score =   204 bits (519),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 109/133 (82%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = -2

Query  592  PPILMKGLVACTGSQFCGQAIIETKARALKITeeverrvavrrpvRMHWTGCPNTCGQVQ  413
            P ILM+GLVACTG+QFCGQAIIETKARALK+TEEVER VAV RPVRMHWTGCPNTC QVQ
Sbjct  1    PSILMRGLVACTGNQFCGQAIIETKARALKVTEEVERHVAVTRPVRMHWTGCPNTCAQVQ  60

Query  412  VADIGFMGCLARNEAGKAVEGADVFLGGKIGSDSHLGEVYKKGVPCDDLVPLIVELLVER  233
            VADIGFMGC+AR+E GK  EGADVFLGG+IGSDSHLG+VYKK VPC DLVPL+V++LV+ 
Sbjct  61   VADIGFMGCMARDENGKPCEGADVFLGGRIGSDSHLGDVYKKSVPCKDLVPLVVDILVKH  120

Query  232  FGAVRRQREEDED  194
            FGAV R+REE ED
Sbjct  121  FGAVPREREEGED  133



>ref|XP_008646302.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic-like 
[Zea mays]
Length=666

 Score =   218 bits (556),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 108/157 (69%), Positives = 136/157 (87%), Gaps = 2/157 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTK--LSPEPPILMKGLVACTGSQFCGQAIIETKAR  512
            TVEQN+++P++ N  +D+LL EPLL +  LSP+P +L++GLVACTG+QFCGQAIIETKAR
Sbjct  500  TVEQNVVLPNVSNRRLDALLAEPLLQRQRLSPQPSLLLRGLVACTGNQFCGQAIIETKAR  559

Query  511  ALKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLG  332
            AL++  EVE+RVAV RPVRMHWTGCPN+C QVQVADIGFMGCL ++  GK VE AD+F+G
Sbjct  560  ALQVAREVEKRVAVPRPVRMHWTGCPNSCAQVQVADIGFMGCLTKDRDGKVVEAADIFVG  619

Query  331  GKIGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAV  221
            G++GSDSHL +VY+K VPC DLVP++ +LLVERFGAV
Sbjct  620  GRVGSDSHLADVYRKSVPCKDLVPIVADLLVERFGAV  656



>ref|XP_009776470.1| PREDICTED: LOW QUALITY PROTEIN: ferredoxin--nitrite reductase, 
chloroplastic-like [Nicotiana sylvestris]
Length=578

 Score =   216 bits (549),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 118/165 (72%), Positives = 137/165 (83%), Gaps = 11/165 (7%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAII-ETKARA  509
            TVEQNIIIP+I+ S +++LLKEP+L+  SP+PPILMKGLVACTG+QFCGQAII E+KAR+
Sbjct  424  TVEQNIIIPNIETSKIEALLKEPVLSTFSPDPPILMKGLVACTGNQFCGQAIIIESKARS  483

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
              +T+ V           MHWTGCPNTC QVQVADIGFMGCL R++ GK VEGADVFLGG
Sbjct  484  XSLTKPVR----------MHWTGCPNTCAQVQVADIGFMGCLTRDKNGKTVEGADVFLGG  533

Query  328  KIGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED  194
            +IGSDSHLGEVYKK VPCDDLVPL+V+LLV  FGAV R+REE ED
Sbjct  534  RIGSDSHLGEVYKKAVPCDDLVPLVVDLLVNNFGAVPREREETED  578



>gb|AFX87997.1| ferredoxin--nitrite reductase, partial [Arabidopsis thaliana]
Length=205

 Score =   202 bits (514),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 106/136 (78%), Positives = 121/136 (89%), Gaps = 1/136 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLL-TKLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQNIIIP+++ S  ++LL+EP L  + SPEP ILMKGLVACTGSQFCGQAIIETK RA
Sbjct  68   TVEQNIIIPNVETSKTEALLQEPFLKNRFSPEPSILMKGLVACTGSQFCGQAIIETKLRA  127

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            LK+TEEVER V+V RP+RMHWTGCPNTCGQVQVADIGFMGCL R E GK VEGADV++GG
Sbjct  128  LKVTEEVERLVSVPRPIRMHWTGCPNTCGQVQVADIGFMGCLTRGEEGKPVEGADVYVGG  187

Query  328  KIGSDSHLGEVYKKGV  281
            +IGSDSH+GE+YKKGV
Sbjct  188  RIGSDSHIGEIYKKGV  203



>gb|AFX87987.1| ferredoxin--nitrite reductase, partial [Arabidopsis thaliana]
 gb|AFX87988.1| ferredoxin--nitrite reductase, partial [Arabidopsis thaliana]
 gb|AFX87989.1| ferredoxin--nitrite reductase, partial [Arabidopsis thaliana]
 gb|AFX87990.1| ferredoxin--nitrite reductase, partial [Arabidopsis thaliana]
 gb|AFX87991.1| ferredoxin--nitrite reductase, partial [Arabidopsis thaliana]
 gb|AFX87992.1| ferredoxin--nitrite reductase, partial [Arabidopsis thaliana]
 gb|AFX87993.1| ferredoxin--nitrite reductase, partial [Arabidopsis thaliana]
 gb|AFX87994.1| ferredoxin--nitrite reductase, partial [Arabidopsis thaliana]
 gb|AFX87995.1| ferredoxin--nitrite reductase, partial [Arabidopsis thaliana]
 gb|AFX87996.1| ferredoxin--nitrite reductase, partial [Arabidopsis thaliana]
 gb|AFX87998.1| ferredoxin--nitrite reductase, partial [Arabidopsis thaliana]
 gb|AFX87999.1| ferredoxin--nitrite reductase, partial [Arabidopsis thaliana]
 gb|AFX88000.1| ferredoxin--nitrite reductase, partial [Arabidopsis thaliana]
 gb|AFX88001.1| ferredoxin--nitrite reductase, partial [Arabidopsis thaliana]
 gb|AFX88002.1| ferredoxin--nitrite reductase, partial [Arabidopsis thaliana]
 gb|AFX88003.1| ferredoxin--nitrite reductase, partial [Arabidopsis thaliana]
 gb|AFX88004.1| ferredoxin--nitrite reductase, partial [Arabidopsis thaliana]
 gb|AFX88005.1| ferredoxin--nitrite reductase, partial [Arabidopsis thaliana]
 gb|AFX88006.1| ferredoxin--nitrite reductase, partial [Arabidopsis thaliana]
Length=205

 Score =   202 bits (514),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 106/136 (78%), Positives = 121/136 (89%), Gaps = 1/136 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLL-TKLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQNIIIP+++ S  ++LL+EP L  + SPEP ILMKGLVACTGSQFCGQAIIETK RA
Sbjct  68   TVEQNIIIPNVETSKTEALLQEPFLKNRFSPEPSILMKGLVACTGSQFCGQAIIETKLRA  127

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            LK+TEEVER V+V RP+RMHWTGCPNTCGQVQVADIGFMGCL R E GK VEGADV++GG
Sbjct  128  LKVTEEVERLVSVPRPIRMHWTGCPNTCGQVQVADIGFMGCLTRGEEGKPVEGADVYVGG  187

Query  328  KIGSDSHLGEVYKKGV  281
            +IGSDSH+GE+YKKGV
Sbjct  188  RIGSDSHIGEIYKKGV  203



>ref|XP_006826233.1| hypothetical protein AMTR_s00132p00099120 [Amborella trichopoda]
 gb|ERM93470.1| hypothetical protein AMTR_s00132p00099120 [Amborella trichopoda]
Length=580

 Score =   212 bits (540),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 107/159 (67%), Positives = 136/159 (86%), Gaps = 1/159 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLL-TKLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQNIIIP++ +S +D+LL E L+ TKLSP P  L  GLVACTGSQFCGQAIIETKARA
Sbjct  420  TVEQNIIIPNVPDSKLDALLNELLVQTKLSPSPGRLTAGLVACTGSQFCGQAIIETKARA  479

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            L+IT+E+ER V V +P+RMHWTGCPN+CGQVQVADIGFMGC+ R+E  K VEG D++LGG
Sbjct  480  LQITKELERHVEVDQPIRMHWTGCPNSCGQVQVADIGFMGCMTRDENKKMVEGVDIYLGG  539

Query  328  KIGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQ  212
            ++G+DSHLG++ +KGVPC DLVP++ E+L++ FGA +R+
Sbjct  540  RVGADSHLGDLIRKGVPCKDLVPIVEEILIQHFGAKKRE  578



>gb|AFX87901.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87902.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87919.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87922.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87925.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87930.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87932.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87936.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
Length=205

 Score =   201 bits (511),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 105/136 (77%), Positives = 122/136 (90%), Gaps = 1/136 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLL-TKLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQNIIIP+++ S  ++LL+EP L  + SPEP ILMKGLVACTG+QFCGQAIIETK RA
Sbjct  68   TVEQNIIIPNVETSKTEALLQEPFLKNRFSPEPSILMKGLVACTGNQFCGQAIIETKLRA  127

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            LK+TEEVER V+V RP+RMHWTGCPNTCGQVQVADIGFMGCL R+E GK VEGADV++GG
Sbjct  128  LKVTEEVERLVSVPRPIRMHWTGCPNTCGQVQVADIGFMGCLTRSENGKPVEGADVYVGG  187

Query  328  KIGSDSHLGEVYKKGV  281
            +IGSDSH+GE+YKKGV
Sbjct  188  RIGSDSHIGEIYKKGV  203



>gb|AFX87876.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87924.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87926.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
Length=205

 Score =   201 bits (511),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 104/136 (76%), Positives = 121/136 (89%), Gaps = 1/136 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLL-TKLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQNIIIP+++ S  ++LL+EP L  + SPEP ILMKGLVACTG+QFCGQAIIETK RA
Sbjct  68   TVEQNIIIPNVETSKTEALLQEPFLKNRFSPEPSILMKGLVACTGNQFCGQAIIETKLRA  127

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            LK+TEEVER V+V +P+RMHWTGCPNTCGQVQVADIGFMGCL R E GK VEGADV++GG
Sbjct  128  LKVTEEVERLVSVAKPIRMHWTGCPNTCGQVQVADIGFMGCLTRGENGKPVEGADVYVGG  187

Query  328  KIGSDSHLGEVYKKGV  281
            +IGSDSH+GE+YKKGV
Sbjct  188  RIGSDSHIGEIYKKGV  203



>gb|AFX87977.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87978.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
Length=190

 Score =   200 bits (509),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 105/136 (77%), Positives = 121/136 (89%), Gaps = 1/136 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLL-TKLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQNIIIP+++ S  ++LL+EP L  + SPEP ILMKGLVACTG+QFCGQAIIETK RA
Sbjct  53   TVEQNIIIPNVETSKTEALLQEPFLKNRFSPEPSILMKGLVACTGNQFCGQAIIETKLRA  112

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            LK+TEEVER V+V RP+RMHWTGCPNTCGQVQVADIGFMGCL R E GK VEGADV++GG
Sbjct  113  LKVTEEVERLVSVPRPIRMHWTGCPNTCGQVQVADIGFMGCLTRGENGKPVEGADVYVGG  172

Query  328  KIGSDSHLGEVYKKGV  281
            +IGSDSH+GE+YKKGV
Sbjct  173  RIGSDSHIGEIYKKGV  188



>gb|AFX87973.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87974.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87981.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87982.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
Length=195

 Score =   200 bits (509),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 105/136 (77%), Positives = 121/136 (89%), Gaps = 1/136 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLL-TKLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQNIIIP+++ S  ++LL+EP L  + SPEP ILMKGLVACTG+QFCGQAIIETK RA
Sbjct  58   TVEQNIIIPNVETSKTEALLQEPFLKNRFSPEPSILMKGLVACTGNQFCGQAIIETKLRA  117

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            LK+TEEVER V+V RP+RMHWTGCPNTCGQVQVADIGFMGCL R E GK VEGADV++GG
Sbjct  118  LKVTEEVERLVSVPRPIRMHWTGCPNTCGQVQVADIGFMGCLTRGENGKPVEGADVYVGG  177

Query  328  KIGSDSHLGEVYKKGV  281
            +IGSDSH+GE+YKKGV
Sbjct  178  RIGSDSHIGEIYKKGV  193



>gb|AFX87975.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87976.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87979.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87980.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87983.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
Length=191

 Score =   200 bits (508),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 105/136 (77%), Positives = 121/136 (89%), Gaps = 1/136 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLL-TKLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQNIIIP+++ S  ++LL+EP L  + SPEP ILMKGLVACTG+QFCGQAIIETK RA
Sbjct  54   TVEQNIIIPNVETSKTEALLQEPFLKNRFSPEPSILMKGLVACTGNQFCGQAIIETKLRA  113

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            LK+TEEVER V+V RP+RMHWTGCPNTCGQVQVADIGFMGCL R E GK VEGADV++GG
Sbjct  114  LKVTEEVERLVSVPRPIRMHWTGCPNTCGQVQVADIGFMGCLTRGENGKPVEGADVYVGG  173

Query  328  KIGSDSHLGEVYKKGV  281
            +IGSDSH+GE+YKKGV
Sbjct  174  RIGSDSHIGEIYKKGV  189



>gb|AFX87984.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
Length=191

 Score =   200 bits (508),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 104/136 (76%), Positives = 121/136 (89%), Gaps = 1/136 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLL-TKLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQNIIIP+++ S  ++LL+EP L  + SPEP ILMKGLVACTG+QFCGQAIIETK RA
Sbjct  54   TVEQNIIIPNVETSKTEALLQEPFLKNRFSPEPSILMKGLVACTGNQFCGQAIIETKLRA  113

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            LK+TEEVER V+V +P+RMHWTGCPNTCGQVQVADIGFMGCL R E GK VEGADV++GG
Sbjct  114  LKVTEEVERLVSVPKPIRMHWTGCPNTCGQVQVADIGFMGCLTRGENGKPVEGADVYVGG  173

Query  328  KIGSDSHLGEVYKKGV  281
            +IGSDSH+GE+YKKGV
Sbjct  174  RIGSDSHIGEIYKKGV  189



>gb|AFX87985.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87986.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
Length=196

 Score =   200 bits (508),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 104/136 (76%), Positives = 121/136 (89%), Gaps = 1/136 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLL-TKLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQNIIIP+++ S  ++LL+EP L  + SPEP ILMKGLVACTG+QFCGQAIIETK RA
Sbjct  59   TVEQNIIIPNVETSKTEALLQEPFLKNRFSPEPSILMKGLVACTGNQFCGQAIIETKLRA  118

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            LK+TEEVER V+V +P+RMHWTGCPNTCGQVQVADIGFMGCL R E GK VEGADV++GG
Sbjct  119  LKVTEEVERLVSVPKPIRMHWTGCPNTCGQVQVADIGFMGCLTRGENGKPVEGADVYVGG  178

Query  328  KIGSDSHLGEVYKKGV  281
            +IGSDSH+GE+YKKGV
Sbjct  179  RIGSDSHIGEIYKKGV  194



>gb|AFX87940.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
Length=205

 Score =   200 bits (509),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 105/136 (77%), Positives = 121/136 (89%), Gaps = 1/136 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLL-TKLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQNIIIP+++ S  ++LL+EP L  + SPEP ILMKGLVACTG+QFCGQAIIETK RA
Sbjct  68   TVEQNIIIPNVETSKTEALLQEPFLKNRFSPEPSILMKGLVACTGNQFCGQAIIETKLRA  127

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            LK+TEEVER V+V RP+RMHWTGCPNTCGQVQVADIGFMGCL R E GK VEGADV++GG
Sbjct  128  LKVTEEVERLVSVPRPIRMHWTGCPNTCGQVQVADIGFMGCLTRGENGKPVEGADVYVGG  187

Query  328  KIGSDSHLGEVYKKGV  281
            +IGSDSH+GE+YKKGV
Sbjct  188  RIGSDSHIGEIYKKGV  203



>gb|AFX87697.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87698.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87699.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87700.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87701.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87702.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87703.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87704.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87705.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87706.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87707.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87708.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87709.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87710.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87711.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87713.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87714.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87715.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87716.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87717.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87718.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87719.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87720.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87721.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87722.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87723.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87724.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87725.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87726.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87729.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87730.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87731.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87732.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87733.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87734.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87735.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87736.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87737.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87738.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87739.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87740.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87741.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87742.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87743.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87744.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87745.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87746.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87747.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87748.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87749.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87750.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87751.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87752.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87753.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87754.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87755.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87756.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87757.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87758.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87759.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87760.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87767.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87789.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87793.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87794.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87795.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87796.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87797.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87799.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87800.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87801.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87802.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87803.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87804.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87805.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87806.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87807.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87808.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87809.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87810.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87811.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87812.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87813.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87814.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87815.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87816.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87817.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87818.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87819.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87820.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87821.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87822.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87823.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87824.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87825.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87826.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87827.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87828.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87829.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87830.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87831.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87832.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87833.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87834.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87835.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87836.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87837.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87838.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87839.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87840.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87841.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87842.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87843.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87844.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87845.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87846.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87847.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87848.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87849.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87850.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87851.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87852.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87853.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87854.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87855.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87856.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87857.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87858.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87859.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87860.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87861.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87862.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87863.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87864.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87865.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87866.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87867.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87868.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87869.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87870.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87871.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87872.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87873.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87874.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87875.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87877.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87878.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87879.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87880.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87881.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87882.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87883.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87884.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87885.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87886.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87887.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87888.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87889.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87890.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87891.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87892.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87893.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87894.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87895.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87896.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87897.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87898.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87899.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87900.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87903.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87904.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87905.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87906.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87907.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87908.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87909.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87910.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87911.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87912.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87913.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87914.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87915.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87916.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87917.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87918.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87920.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87921.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87923.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87928.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87929.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87931.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87933.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87934.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87935.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87937.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87938.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87942.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87943.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87944.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87950.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87952.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87953.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87954.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87959.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87960.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87961.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87964.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87968.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87969.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87970.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87971.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
Length=205

 Score =   200 bits (508),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 105/136 (77%), Positives = 121/136 (89%), Gaps = 1/136 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLL-TKLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQNIIIP+++ S  ++LL+EP L  + SPEP ILMKGLVACTG+QFCGQAIIETK RA
Sbjct  68   TVEQNIIIPNVETSKTEALLQEPFLKNRFSPEPSILMKGLVACTGNQFCGQAIIETKLRA  127

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            LK+TEEVER V+V RP+RMHWTGCPNTCGQVQVADIGFMGCL R E GK VEGADV++GG
Sbjct  128  LKVTEEVERLVSVPRPIRMHWTGCPNTCGQVQVADIGFMGCLTRGENGKPVEGADVYVGG  187

Query  328  KIGSDSHLGEVYKKGV  281
            +IGSDSH+GE+YKKGV
Sbjct  188  RIGSDSHIGEIYKKGV  203



>gb|AFX87712.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87727.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87728.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87761.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87762.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87763.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87764.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87765.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87766.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87768.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87769.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87770.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87771.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87772.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87773.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87774.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87775.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87776.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87777.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87778.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87779.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87780.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87781.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87782.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87783.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87784.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87785.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87786.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87787.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87788.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87790.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87791.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87792.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87798.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87939.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87941.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87945.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87946.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87947.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87948.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87949.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87951.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87955.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87956.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87957.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87958.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87962.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87963.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87965.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87966.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87967.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
 gb|AFX87972.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
Length=205

 Score =   200 bits (508),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 104/136 (76%), Positives = 121/136 (89%), Gaps = 1/136 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLL-TKLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQNIIIP+++ S  ++LL+EP L  + SPEP ILMKGLVACTG+QFCGQAIIETK RA
Sbjct  68   TVEQNIIIPNVETSKTEALLQEPFLKNRFSPEPSILMKGLVACTGNQFCGQAIIETKLRA  127

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            LK+TEEVER V+V +P+RMHWTGCPNTCGQVQVADIGFMGCL R E GK VEGADV++GG
Sbjct  128  LKVTEEVERLVSVPKPIRMHWTGCPNTCGQVQVADIGFMGCLTRGENGKPVEGADVYVGG  187

Query  328  KIGSDSHLGEVYKKGV  281
            +IGSDSH+GE+YKKGV
Sbjct  188  RIGSDSHIGEIYKKGV  203



>gb|AFX87927.1| ferredoxin--nitrite reductase, partial [Arabidopsis lyrata subsp. 
petraea]
Length=205

 Score =   197 bits (501),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 103/136 (76%), Positives = 120/136 (88%), Gaps = 1/136 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLL-TKLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQNIIIP+++    ++LL+EP L  + SPEP ILMKGLVACTG+QFCGQAIIETK RA
Sbjct  68   TVEQNIIIPNVETLKTEALLQEPFLKNRFSPEPSILMKGLVACTGNQFCGQAIIETKLRA  127

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            LK+TEEVER V+V +P+RMHWTGCPNTCGQVQVADIGFMGCL R E GK VEGADV++GG
Sbjct  128  LKVTEEVERLVSVPKPIRMHWTGCPNTCGQVQVADIGFMGCLTRGENGKPVEGADVYVGG  187

Query  328  KIGSDSHLGEVYKKGV  281
            +IGSDSH+GE+YKKGV
Sbjct  188  RIGSDSHIGEIYKKGV  203



>ref|XP_002987413.1| hypothetical protein SELMODRAFT_183174 [Selaginella moellendorffii]
 gb|EFJ11500.1| hypothetical protein SELMODRAFT_183174 [Selaginella moellendorffii]
Length=604

 Score =   204 bits (518),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 102/157 (65%), Positives = 129/157 (82%), Gaps = 0/157 (0%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQNIIIP++ +S VDS L+EPLL + SP P IL   LVACTGSQFCGQAIIETKARA 
Sbjct  448  TVEQNIIIPNVPSSKVDSFLREPLLARFSPTPGILQANLVACTGSQFCGQAIIETKARAQ  507

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
            K+TEE+ER + V RPVRMHWTGCPN+CGQ+QVADIGFMGC+ R+   K VEG  +++GG+
Sbjct  508  KLTEELERTMEVPRPVRMHWTGCPNSCGQIQVADIGFMGCMTRDANKKVVEGVHIYVGGR  567

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRR  215
            +G+DSHLG++    VPCD L+P++ +LL+ERFGA ++
Sbjct  568  VGADSHLGDLVVADVPCDGLLPVVQDLLIERFGARKK  604



>ref|XP_002979935.1| hypothetical protein SELMODRAFT_178021 [Selaginella moellendorffii]
 gb|EFJ18805.1| hypothetical protein SELMODRAFT_178021 [Selaginella moellendorffii]
Length=604

 Score =   204 bits (518),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 102/157 (65%), Positives = 129/157 (82%), Gaps = 0/157 (0%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQNIIIP++ +S VDS L+EPLL + SP P IL   LVACTGSQFCGQAIIETKARA 
Sbjct  448  TVEQNIIIPNVPSSKVDSFLREPLLARFSPTPGILQANLVACTGSQFCGQAIIETKARAQ  507

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
            K+TEE+ER + V RPVRMHWTGCPN+CGQ+QVADIGFMGC+ R+   K VEG  +++GG+
Sbjct  508  KLTEELERTMEVPRPVRMHWTGCPNSCGQIQVADIGFMGCMTRDANKKVVEGVHIYVGGR  567

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRR  215
            +G+DSHLG++    VPCD L+P++ +LL+ERFGA ++
Sbjct  568  VGADSHLGDLVVADVPCDGLLPVVQDLLIERFGARKK  604



>ref|XP_007042430.1| Ferredoxin--nitrite reductase, chloroplastic [Theobroma cacao]
 gb|EOX98261.1| Ferredoxin--nitrite reductase, chloroplastic [Theobroma cacao]
Length=553

 Score =   192 bits (489),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 102/130 (78%), Positives = 117/130 (90%), Gaps = 1/130 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLT-KLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQNIIIP+++N  +++LL EPLL  + SPEP ILMKGLVACTG+QFCGQAIIETKARA
Sbjct  420  TVEQNIIIPNVENWKLEALLNEPLLKDRFSPEPSILMKGLVACTGNQFCGQAIIETKARA  479

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            LK+TEEVER V+V +PVRMHWTGCPN+CGQVQVADIGFMGC+AR+E GK  EGADVFLGG
Sbjct  480  LKVTEEVERLVSVAQPVRMHWTGCPNSCGQVQVADIGFMGCMARDENGKPCEGADVFLGG  539

Query  328  KIGSDSHLGE  299
            +IGSDSHL E
Sbjct  540  RIGSDSHLEE  549



>ref|XP_001777025.1| predicted protein [Physcomitrella patens]
 dbj|BAE06055.1| ferredoxin-nitrite reductase [Physcomitrella patens]
 dbj|BAF43438.1| nitrite reductase [Physcomitrella patens]
 gb|EDQ58139.1| predicted protein [Physcomitrella patens]
Length=602

 Score =   190 bits (483),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 92/157 (59%), Positives = 124/157 (79%), Gaps = 0/157 (0%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            +VEQN+I+P++    ++ LLKEPLL K SP P  L+  LVACTGSQFCGQAI ETKAR+L
Sbjct  445  SVEQNLILPNVPTEKIEKLLKEPLLEKYSPNPTPLLANLVACTGSQFCGQAIAETKARSL  504

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
            ++T+E+E  +   RP+R+H+TGCPNTC Q+QVADIGFMG +AR+E  K VEG D++LGG+
Sbjct  505  QLTQELEATMETTRPIRLHFTGCPNTCAQIQVADIGFMGTMARDENRKPVEGFDIYLGGR  564

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRR  215
            IGSDSHLGE+   GVP   L+P++ +L+++ FGA R+
Sbjct  565  IGSDSHLGELVVPGVPATKLLPVVQDLMIQHFGAKRK  601



>ref|XP_001775824.1| predicted protein [Physcomitrella patens]
 dbj|BAB92078.1| ferredoxin-nitrite reductase [Physcomitrella patens]
 dbj|BAF43437.1| nitrite reductase [Physcomitrella patens]
 gb|EDQ59363.1| predicted protein [Physcomitrella patens]
Length=602

 Score =   189 bits (481),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 92/157 (59%), Positives = 123/157 (78%), Gaps = 0/157 (0%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN+I+P+I    +D L++EPLL K SP P  L+  LVACTGSQFCGQAI ETKA +L
Sbjct  445  TVEQNLILPNIPTEKIDKLMQEPLLQKYSPNPTPLLANLVACTGSQFCGQAIAETKALSL  504

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
            ++T+++E  +   RP+R+H+TGCPNTC Q+QVADIGFMG +AR+E  K VEG D++LGG+
Sbjct  505  QLTQQLEDTMETTRPIRLHFTGCPNTCAQIQVADIGFMGTMARDENRKPVEGFDIYLGGR  564

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRR  215
            IGSDSHLGE+   GVP   L+P++ EL+++ FGA R+
Sbjct  565  IGSDSHLGELVVPGVPATKLLPVVQELMIQHFGAKRK  601



>ref|WP_015155568.1| assimilatory nitrite reductase (ferredoxin) precursor [Chroococcidiopsis 
thermalis]
 ref|YP_007092892.1| assimilatory nitrite reductase (ferredoxin) precursor [Chroococcidiopsis 
thermalis PCC 7203]
 gb|AFY89023.1| assimilatory nitrite reductase (ferredoxin) precursor [Chroococcidiopsis 
thermalis PCC 7203]
Length=538

 Score =   182 bits (461),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 92/158 (58%), Positives = 116/158 (73%), Gaps = 1/158 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQNIIIP+I +S + + L EPLL + S EP  L +GLV+CTG+QFC  A+IETK RAL
Sbjct  374  TVEQNIIIPNIPDSRLGTFLAEPLLQRFSIEPETLTRGLVSCTGAQFCNFALIETKNRAL  433

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
               + +E  +   +PVR+HWTGCPN+CGQ QVADIG MG   R + GKAVEG D+++GGK
Sbjct  434  ATIKALEAELRFTQPVRIHWTGCPNSCGQPQVADIGLMGTKVRKD-GKAVEGVDIYMGGK  492

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQ  212
            +G D+HLG    KG+PCDDL P++  LLVE FGA  RQ
Sbjct  493  VGKDAHLGSCITKGIPCDDLQPVLRNLLVEHFGARPRQ  530



>ref|WP_039714131.1| ferredoxin--nitrite reductase [Scytonema millei]
 gb|KIF21842.1| ferredoxin--nitrite reductase [Scytonema millei VB511283]
Length=530

 Score =   181 bits (460),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 91/158 (58%), Positives = 116/158 (73%), Gaps = 1/158 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQNIIIP+I +S + + L EPLL + S EP  L +GLV+CTG+QFC  A+IETK RAL
Sbjct  366  TVEQNIIIPNIPDSRLRTFLAEPLLQRFSIEPETLTRGLVSCTGAQFCNFALIETKNRAL  425

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
               + +E  +   +PVR+HWTGCPN+CGQ QVADIG MG  AR + GK VEG D+++GGK
Sbjct  426  ATIKALEAELTFTQPVRIHWTGCPNSCGQPQVADIGLMGTKARKD-GKPVEGVDIYMGGK  484

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQ  212
            +G D+HLG    KG+PCDDL P++  LL+E FGA  RQ
Sbjct  485  VGKDAHLGSCITKGIPCDDLQPVLRNLLIEHFGARPRQ  522



>gb|ABD49315.1| assimilatory nitrite reductase [Mastigocladus laminosus W17C]
 gb|ABD49317.1| assimilatory nitrite reductase [Mastigocladus laminosus W7C]
 gb|ABD49319.1| assimilatory nitrite reductase [Mastigocladus laminosus W16C]
 gb|ABD49329.1| assimilatory nitrite reductase [Mastigocladus laminosus W17B]
 gb|ABD49335.1| assimilatory nitrite reductase [Mastigocladus laminosus B15A]
 gb|ABD49337.1| assimilatory nitrite reductase [Mastigocladus laminosus B2B]
 gb|ABD49339.1| assimilatory nitrite reductase [Mastigocladus laminosus B13B]
 gb|ABD49341.1| assimilatory nitrite reductase [Mastigocladus laminosus B2D]
 gb|ABD49343.1| assimilatory nitrite reductase [Mastigocladus laminosus B6A]
 gb|ABD49345.1| assimilatory nitrite reductase [Mastigocladus laminosus B3A]
 gb|ABD49347.1| assimilatory nitrite reductase [Mastigocladus laminosus B2C]
 gb|ABD49349.1| assimilatory nitrite reductase [Mastigocladus laminosus B4B]
 gb|ABD49351.1| assimilatory nitrite reductase [Mastigocladus laminosus B3D]
 gb|ABD49353.1| assimilatory nitrite reductase [Mastigocladus laminosus B12A]
 gb|ACM48813.1| assimilatory nitrite reductase [Mastigocladus laminosus W527]
 gb|ACM48814.1| assimilatory nitrite reductase [Mastigocladus laminosus W529]
 gb|ACM48815.1| assimilatory nitrite reductase [Mastigocladus laminosus W532]
 gb|ACM48816.1| assimilatory nitrite reductase [Mastigocladus laminosus W511]
 gb|ACM48817.1| assimilatory nitrite reductase [Mastigocladus laminosus W558]
 gb|ACM48818.1| assimilatory nitrite reductase [Mastigocladus laminosus W213]
 gb|ACM48819.1| assimilatory nitrite reductase [Mastigocladus laminosus W341]
 gb|ACM48820.1| assimilatory nitrite reductase [Mastigocladus laminosus W352]
 gb|ACM48821.1| assimilatory nitrite reductase [Mastigocladus laminosus W447]
 gb|ACM48822.1| assimilatory nitrite reductase [Mastigocladus laminosus W451]
 gb|ACM48823.1| assimilatory nitrite reductase [Mastigocladus laminosus W455]
 gb|ACM48824.1| assimilatory nitrite reductase [Mastigocladus laminosus W515]
 gb|ACM48831.1| assimilatory nitrite reductase [Mastigocladus laminosus W135]
 gb|ACM48832.1| assimilatory nitrite reductase [Mastigocladus laminosus W517]
Length=218

 Score =   173 bits (438),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 118/158 (75%), Gaps = 1/158 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN+IIP+I +S +   L EPLL K S +P  L + LV+CTG+QFC  A+IETK RAL
Sbjct  56   TVEQNVIIPNIPDSRLVLFLAEPLLEKFSIDPQPLRRSLVSCTGAQFCNFALIETKNRAL  115

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             I + +E  + + RPVR+HWTGCPN+CGQ QVADIG MG  AR   GKAVEG D+++GGK
Sbjct  116  NIIKALEEDLELTRPVRIHWTGCPNSCGQPQVADIGLMGTKARKN-GKAVEGVDIYMGGK  174

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQ  212
            +G ++HLG   +KG+PC+DL P++ +LL++ FGA  RQ
Sbjct  175  VGKEAHLGTCVQKGIPCEDLQPVLRDLLIQHFGAKPRQ  212



>gb|ABD49321.1| assimilatory nitrite reductase [Mastigocladus laminosus W25B]
 gb|ABD49323.1| assimilatory nitrite reductase [Mastigocladus laminosus W15C]
 gb|ABD49325.1| assimilatory nitrite reductase [Mastigocladus laminosus W23B]
 gb|ABD49327.1| assimilatory nitrite reductase [Mastigocladus laminosus W1C]
 gb|ABD49331.1| assimilatory nitrite reductase [Mastigocladus laminosus W13D]
 gb|ABD49333.1| assimilatory nitrite reductase [Mastigocladus laminosus W11D]
 gb|ACM48825.1| assimilatory nitrite reductase [Mastigocladus laminosus W114]
 gb|ACM48826.1| assimilatory nitrite reductase [Mastigocladus laminosus W157]
 gb|ACM48827.1| assimilatory nitrite reductase [Mastigocladus laminosus W241]
 gb|ACM48828.1| assimilatory nitrite reductase [Mastigocladus laminosus W245]
 gb|ACM48829.1| assimilatory nitrite reductase [Mastigocladus laminosus W247]
 gb|ACM48830.1| assimilatory nitrite reductase [Mastigocladus laminosus W556]
Length=218

 Score =   172 bits (437),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 118/158 (75%), Gaps = 1/158 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN+IIP+I +S +   L EPLL K S +P  L + LV+CTG+QFC  A+IETK RAL
Sbjct  56   TVEQNVIIPNIPDSRLVLFLAEPLLEKFSIDPQPLRRSLVSCTGAQFCNFALIETKNRAL  115

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             I + +E  + + RPVR+HWTGCPN+CGQ QVADIG MG  AR   GKAVEG D+++GGK
Sbjct  116  NIIKALEEDLELTRPVRIHWTGCPNSCGQPQVADIGLMGTKARKN-GKAVEGVDIYMGGK  174

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQ  212
            +G ++HLG   +KG+PC+DL P++ +LL++ FGA  RQ
Sbjct  175  VGKEAHLGTCVQKGIPCEDLQPVLRDLLIQHFGAKPRQ  212



>ref|WP_011429510.1| ferredoxin-nitrite reductase [Synechococcus sp. JA-3-3Ab]
 ref|YP_474090.1| ferredoxin-nitrite reductase [Synechococcus sp. JA-3-3Ab]
 gb|ABC98827.1| ferredoxin-nitrite reductase [Synechococcus sp. JA-3-3Ab]
Length=515

 Score =   179 bits (454),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 90/158 (57%), Positives = 121/158 (77%), Gaps = 1/158 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN++IP++ +S V  LLKEPLL K SP P  L +GLV+CTG+QFC  A+IETK RA+
Sbjct  346  TVEQNVLIPNVPDSRVAPLLKEPLLKKFSPNPGPLQRGLVSCTGNQFCNFALIETKNRAV  405

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             + EE+E  + + + VR+HWTGCPN+CGQ QVADIG MG  AR + G+ VE  D+++GG+
Sbjct  406  ALMEELEAELEIPQTVRIHWTGCPNSCGQPQVADIGLMGTTARKD-GRVVEAVDIYMGGE  464

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQ  212
            +G D+ LGE  +KG+PC+DL P++VELL+E FGA  RQ
Sbjct  465  VGKDAKLGECVRKGIPCEDLKPVLVELLIEHFGAKPRQ  502



>gb|ABW80920.1| ferredoxin--nitrite reductase [uncultured bacterium]
Length=515

 Score =   179 bits (454),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 90/158 (57%), Positives = 121/158 (77%), Gaps = 1/158 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN++IP++ +S V  LLKEPLL K SP P  L +GLV+CTG+QFC  A+IETK RA+
Sbjct  346  TVEQNVLIPNVPDSRVAPLLKEPLLKKFSPNPGPLQRGLVSCTGNQFCNFALIETKNRAV  405

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             + EE+E  + + + VR+HWTGCPN+CGQ QVADIG MG  AR + G+ VE  D+++GG+
Sbjct  406  ALMEELEAELEIPQTVRIHWTGCPNSCGQPQVADIGLMGTTARKD-GRVVEAVDIYMGGE  464

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQ  212
            +G D+ LGE  +KG+PC+DL P++VELL+E FGA  RQ
Sbjct  465  VGKDAKLGECVRKGIPCEDLKPVLVELLIEHFGAKPRQ  502



>ref|WP_011431706.1| ferredoxin-nitrite reductase [Synechococcus sp. JA-2-3B'a(2-13)]
 ref|YP_476298.1| ferredoxin-nitrite reductase [Synechococcus sp. JA-2-3B'a(2-13)]
 gb|ABD01035.1| ferredoxin-nitrite reductase [Synechococcus sp. JA-2-3B'a(2-13)]
Length=515

 Score =   177 bits (450),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 90/158 (57%), Positives = 120/158 (76%), Gaps = 1/158 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN++IP++ +S V  LLKEPLL K SP P  L +GLV+CTG+QFC  A+IETK RA+
Sbjct  346  TVEQNVLIPNVPDSRVAPLLKEPLLKKFSPNPGPLQRGLVSCTGNQFCNFALIETKNRAV  405

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             + EE+E  + + + VR+HWTGCPN+CGQ QVADIG MG  AR + G+ VE  D+++GG+
Sbjct  406  ALMEELEAELEIPQTVRIHWTGCPNSCGQPQVADIGLMGTTARKD-GRVVEAVDIYMGGE  464

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQ  212
            +G D+ LGE  +KG+PC+DL P++VELL E FGA  RQ
Sbjct  465  VGKDAKLGECVRKGIPCEDLKPVLVELLREHFGARPRQ  502



>ref|WP_035998667.1| ferredoxin--nitrite reductase [Leptolyngbya sp. JSC-1]
Length=674

 Score =   179 bits (454),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 120/154 (78%), Gaps = 1/154 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN+IIP++ +S +D+LL+E LL K S EP  L++ LV+CTG+QFC  AIIETK RAL
Sbjct  413  TVEQNLIIPNVPDSRLDALLQEALLQKFSIEPTPLVRSLVSCTGAQFCNFAIIETKNRAL  472

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
            +I   ++  V + RPVR+HWTGCPN+CGQ QVADIG MG  AR   GKAV+G D+++GGK
Sbjct  473  EIARALDEMVELTRPVRIHWTGCPNSCGQPQVADIGLMGTKARKN-GKAVDGVDMYMGGK  531

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGA  224
            +G D+HLG   +KG+ CDDL P++ +LL+E+FGA
Sbjct  532  VGKDAHLGTCVQKGIACDDLKPMLRDLLIEQFGA  565



>ref|WP_012361573.1| MULTISPECIES: ferredoxin-nitrite reductase [Cyanothece]
 ref|YP_001802639.1| ferredoxin-nitrite reductase [Cyanothece sp. ATCC 51142]
 gb|ACB50573.1| ferredoxin-nitrite reductase [Cyanothece sp. ATCC 51142]
Length=514

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/157 (54%), Positives = 118/157 (75%), Gaps = 1/157 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN+IIP+I + N+++ L+EP+L K S  P  L + LV+CTG+QFC  A++ETK RAL
Sbjct  359  TVEQNVIIPNIPDDNLETFLEEPILEKFSISPKPLQRALVSCTGAQFCNFALVETKNRAL  418

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             + +E++  + + + VR+HWTGCPN+CGQ QVADIG MG   R + GK VEG D+++GGK
Sbjct  419  TLAKELDEALELPQTVRIHWTGCPNSCGQPQVADIGLMGTKVRKD-GKTVEGVDLYMGGK  477

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRR  215
            +G D+HLG   +KG+ CDDL P++ +LL+E FGA RR
Sbjct  478  VGKDAHLGTCVQKGIACDDLFPVLTDLLIENFGAKRR  514



>ref|WP_026787877.1| ferredoxin--nitrite reductase [Planktothrix rubescens]
Length=511

 Score =   175 bits (444),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 119/154 (77%), Gaps = 1/154 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN+IIP+I +S +++ L EP+L K S  P  L +GLV+CTGSQFC  A++ETK RA+
Sbjct  355  TVEQNVIIPNISDSRLEAFLTEPILEKFSVNPSALSRGLVSCTGSQFCNFALVETKNRAV  414

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
            ++ +E+E  + V + VR+HWTGCPN+CGQ QVADIG MG  AR E GK VEG ++++GGK
Sbjct  415  ELVKELEAELTVEKTVRIHWTGCPNSCGQPQVADIGLMGTKARKE-GKTVEGVNLYMGGK  473

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGA  224
            +G D+ LGE  +K +PC+DL P++ ++LVE+FGA
Sbjct  474  VGKDAQLGECVQKSIPCEDLKPVLRQILVEQFGA  507



>ref|WP_027254353.1| ferredoxin--nitrite reductase [Planktothrix agardhii]
Length=511

 Score =   175 bits (444),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 119/154 (77%), Gaps = 1/154 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN+IIP+I +S +++ L EP+L K S  P  L +GLV+CTGSQFC  A++ETK RA+
Sbjct  355  TVEQNVIIPNISDSRLEAFLTEPILEKFSVNPSALSRGLVSCTGSQFCNFALVETKNRAV  414

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
            ++ +E+E  + V + VR+HWTGCPN+CGQ QVADIG MG  AR E GK VEG ++++GGK
Sbjct  415  ELVKELEAELTVEKTVRIHWTGCPNSCGQPQVADIGLMGTKARKE-GKTVEGVNLYMGGK  473

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGA  224
            +G D+ LGE  +K +PC+DL P++ ++LVE+FGA
Sbjct  474  VGKDAQLGECVQKSIPCEDLKPVLRQILVEQFGA  507



>ref|WP_015113079.1| assimilatory nitrite reductase (ferredoxin) precursor [Nostoc 
sp. PCC 7107]
 ref|YP_007050014.1| assimilatory nitrite reductase (ferredoxin) precursor [Nostoc 
sp. PCC 7107]
 gb|AFY42864.1| assimilatory nitrite reductase (ferredoxin) precursor [Nostoc 
sp. PCC 7107]
Length=524

 Score =   175 bits (444),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 88/158 (56%), Positives = 118/158 (75%), Gaps = 1/158 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQNIIIP+I +S++ + L EPLL + S  P +L + LV+CTG+QFC  A+IETK RAL
Sbjct  362  TVEQNIIIPNISDSSLATFLAEPLLERFSINPGVLERSLVSCTGAQFCNFALIETKNRAL  421

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
               + +E  +   +PVR+HWTGCPN+CGQ QVADIG MG  AR + GKAVEG D+++GGK
Sbjct  422  ATIQALEADLTFTQPVRIHWTGCPNSCGQPQVADIGLMGTKARKD-GKAVEGVDIYMGGK  480

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQ  212
            +G D+HLG    KG+PC+DL P++ ELL++ FGA  +Q
Sbjct  481  VGKDAHLGTCAIKGIPCEDLQPVLQELLIKHFGAHIKQ  518



>ref|WP_026795180.1| MULTISPECIES: ferredoxin--nitrite reductase [Planktothrix]
Length=511

 Score =   175 bits (443),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 119/154 (77%), Gaps = 1/154 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN+IIP+I +S +++ L EP+L K S  P  L +GLV+CTGSQFC  A++ETK RA+
Sbjct  355  TVEQNVIIPNISDSRLEAFLTEPILEKFSVNPSALSRGLVSCTGSQFCNFALVETKNRAV  414

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
            ++ +E+E  + V + VR+HWTGCPN+CGQ QVADIG MG  AR E GK VEG ++++GGK
Sbjct  415  ELVKELEAELTVEKTVRIHWTGCPNSCGQPQVADIGLMGTKARKE-GKTVEGVNLYMGGK  473

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGA  224
            +G D+ LGE  +K +PC+DL P++ ++LVE+FGA
Sbjct  474  VGKDAQLGECVQKSIPCEDLKPVLRQILVEQFGA  507



>ref|WP_015188381.1| assimilatory nitrite reductase (ferredoxin) precursor [Gloeocapsa 
sp. PCC 7428]
 ref|YP_007127667.1| assimilatory nitrite reductase (ferredoxin) precursor [Gloeocapsa 
sp. PCC 7428]
 gb|AFZ30507.1| assimilatory nitrite reductase (ferredoxin) precursor [Gloeocapsa 
sp. PCC 7428]
Length=516

 Score =   174 bits (442),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 87/158 (55%), Positives = 116/158 (73%), Gaps = 1/158 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN+IIP+I +S +D+ L EPLL + S  P  L +GLV+CTG+QFC  A+IETK RAL
Sbjct  354  TVEQNLIIPNIPDSRLDAFLAEPLLQRFSTRPDTLTRGLVSCTGAQFCNFALIETKNRAL  413

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             + + +E  + + RPVR+HWTGCPN+CGQ QVADIG MG   R   GK VEG D+++GGK
Sbjct  414  GMIKALEAELYLTRPVRIHWTGCPNSCGQPQVADIGLMGTKVRKN-GKTVEGVDIYMGGK  472

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQ  212
            +G D+HLG    KG+PC+DL P++ +LL+E F A  +Q
Sbjct  473  VGKDAHLGTCVTKGIPCEDLQPVLRDLLIEHFDAKPKQ  510



>dbj|GAL93751.1| ferredoxin--nitrite reductase [Microcystis aeruginosa NIES-44]
Length=513

 Score =   173 bits (439),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 115/155 (74%), Gaps = 1/155 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN+IIP+I   N+ +LL EPLL K +P P  L + LV+CTG+QFC  A+IETK +A+
Sbjct  357  TVEQNVIIPNIAAENMPTLLTEPLLAKFTPNPTPLQRALVSCTGAQFCNFALIETKNKAV  416

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             +  +++  + + + VRMHWTGCPN+CGQ QVADIG MG  AR + GK VEG D+++GGK
Sbjct  417  DLIRQLDAELNIPQGVRMHWTGCPNSCGQPQVADIGLMGTKARKD-GKTVEGVDLYMGGK  475

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAV  221
            +G D+HLG   +KG+PC+DL  L+  +L+E+FGA 
Sbjct  476  VGKDAHLGSCVQKGIPCEDLKSLLTSILIEQFGAT  510



>ref|WP_006632844.1| ferredoxin-nitrite reductase [Microcoleus vaginatus]
 gb|EGK88063.1| precorrin-3B synthase [Microcoleus vaginatus FGP-2]
Length=644

 Score =   175 bits (443),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 85/158 (54%), Positives = 125/158 (79%), Gaps = 1/158 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVE+N+IIP++ +S ++SL+KEPLL + S EP  LM+ LV+CTG++FC  A+IETK+RA+
Sbjct  373  TVEENVIIPNVPDSRIESLVKEPLLQRFSIEPAPLMRALVSCTGAKFCNFALIETKSRAV  432

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             + EE++  +++ +PVR+HWTGCPN+CGQ QVADIG MG   R   GK +EG D+++GG 
Sbjct  433  AMIEELDVELSLPKPVRIHWTGCPNSCGQPQVADIGLMGTKVRKN-GKTLEGVDIYMGGT  491

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQ  212
            +G ++HLG   +KG+PC+DL PL+ +LLVE+FGAV ++
Sbjct  492  VGKEAHLGACVQKGIPCEDLKPLLHQLLVEQFGAVPKE  529



>ref|WP_002775642.1| ferredoxin-nitrite reductase [Microcystis aeruginosa]
 emb|CCI06091.1| Ferredoxin--nitrite reductase [Microcystis aeruginosa PCC 7941]
Length=513

 Score =   173 bits (439),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 84/155 (54%), Positives = 115/155 (74%), Gaps = 1/155 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN+IIP+I   NV +LL EPLL K +P P  L + LV+CTG+QFC  A+IETK +A+
Sbjct  357  TVEQNVIIPNIAAENVATLLTEPLLVKFTPNPAPLQRALVSCTGAQFCNFALIETKNKAV  416

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             +  +++  + + R VRMHWTGCPN+CGQ QVADIG MG  AR + GK VEG D+++GGK
Sbjct  417  DLIRQLDAELNIPRGVRMHWTGCPNSCGQPQVADIGLMGTKARKD-GKTVEGVDLYMGGK  475

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAV  221
            +G D+HLG   +KG+PC+DL  ++  +L+E+FGA 
Sbjct  476  VGKDAHLGSCVQKGIPCEDLKSVLTSILIEQFGAT  510



>ref|WP_009455119.1| ferredoxin-nitrite reductase [Fischerella sp. JSC-11]
 gb|EHC18905.1| Ferredoxin--nitrite reductase [Fischerella sp. JSC-11]
Length=541

 Score =   174 bits (440),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 118/158 (75%), Gaps = 1/158 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN+IIP+I +S +   L EPLL K S +P  L + LV+CTG+QFC  A+IETK RAL
Sbjct  379  TVEQNVIIPNIPDSRLVLFLAEPLLEKFSIDPQPLRRSLVSCTGAQFCNFALIETKNRAL  438

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             I + +E  + + RPVR+HWTGCPN+CGQ QVADIG MG  AR   GKAVEG D+++GGK
Sbjct  439  NIIKALEEDLELTRPVRIHWTGCPNSCGQPQVADIGLMGTKARKN-GKAVEGVDIYMGGK  497

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQ  212
            +G ++HLG   +KG+PC+DL P++ +LL++ FGA  RQ
Sbjct  498  VGKEAHLGTCVQKGIPCEDLQPVLRDLLIQHFGAKPRQ  535



>ref|WP_016871793.1| ferredoxin-nitrite reductase [Fischerella thermalis]
Length=541

 Score =   174 bits (440),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 118/158 (75%), Gaps = 1/158 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN+IIP+I +S +   L EPLL K S +P  L + LV+CTG+QFC  A+IETK RAL
Sbjct  379  TVEQNVIIPNIPDSRLVLFLAEPLLEKFSIDPQPLRRSLVSCTGAQFCNFALIETKNRAL  438

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             I + +E  + + RPVR+HWTGCPN+CGQ QVADIG MG  AR   GKAVEG D+++GGK
Sbjct  439  NIIKALEEDLELTRPVRIHWTGCPNSCGQPQVADIGLMGTKARKN-GKAVEGVDIYMGGK  497

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQ  212
            +G ++HLG   +KG+PC+DL P++ +LL++ FGA  RQ
Sbjct  498  VGKEAHLGTCVQKGIPCEDLQPVLRDLLIQHFGAKPRQ  535



>ref|WP_008196112.1| ferredoxin-nitrite reductase [Microcystis sp. T1-4]
 emb|CCI30334.1| Ferredoxin--nitrite reductase [Microcystis sp. T1-4]
Length=513

 Score =   173 bits (439),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 115/155 (74%), Gaps = 1/155 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN+IIP+I   N+ +LL EPLL K +P P  L + LV+CTG+QFC  A+IETK RA+
Sbjct  357  TVEQNVIIPNIAAENMPTLLTEPLLAKFTPNPTPLQRALVSCTGAQFCNFALIETKNRAV  416

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             +  +++  + + + VR+HWTGCPN+CGQ QVADIG MG  AR + GK VEG D+++GGK
Sbjct  417  DLISQLDAELNIPQGVRIHWTGCPNSCGQPQVADIGLMGTKARKD-GKTVEGVDLYMGGK  475

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAV  221
            +G D+HLG   +KG+PC+DL  L+  +L+E+FGA 
Sbjct  476  VGKDAHLGSCVQKGIPCEDLKSLLTSILIEQFGAT  510



>ref|WP_002749321.1| ferredoxin--nitrite reductase [Microcystis aeruginosa]
 emb|CAO88688.1| nirA [Microcystis aeruginosa PCC 7806]
 gb|ELS44877.1| ferredoxin--nitrite reductase [Microcystis aeruginosa DIANCHI905]
Length=513

 Score =   173 bits (438),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 84/155 (54%), Positives = 115/155 (74%), Gaps = 1/155 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN+IIP+I   NV +LL EPLL K +P P  L + LV+CTG+QFC  A+IETK +A+
Sbjct  357  TVEQNVIIPNIAAENVATLLTEPLLVKFTPNPAPLQRSLVSCTGAQFCNFALIETKNKAV  416

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             +  +++  + + R VR+HWTGCPN+CGQ QVADIG MG  AR + GK VEG D+++GGK
Sbjct  417  DLISQLDAELNIPRGVRIHWTGCPNSCGQPQVADIGLMGTKARKD-GKTVEGVDLYMGGK  475

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAV  221
            +G D+HLG   +KG+PC+DL  L+  +L+E+FGA 
Sbjct  476  VGKDAHLGSCVQKGIPCEDLKSLLTSILIEQFGAT  510



>ref|WP_011321208.1| ferredoxin-nitrite reductase [Anabaena variabilis]
 ref|YP_325032.1| ferredoxin-nitrite reductase [Anabaena variabilis ATCC 29413]
 gb|ABA24137.1| assimilatory nitrite reductase (ferredoxin) precursor [Anabaena 
variabilis ATCC 29413]
Length=536

 Score =   173 bits (438),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 88/158 (56%), Positives = 118/158 (75%), Gaps = 1/158 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQNIIIP+I +S + +LL +PLL + S +P  L + LV+CTG+QFC  A+IETK RAL
Sbjct  373  TVEQNIIIPNITDSRLKTLLTDPLLERFSLDPGALTRSLVSCTGAQFCNFALIETKNRAL  432

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
            ++ + +E  +   RPVR+HWTGCPN+CGQ QVADIG MG  AR   GKAVEG D+++GGK
Sbjct  433  EMIKGLEAELTFTRPVRIHWTGCPNSCGQPQVADIGLMGTKARKN-GKAVEGVDIYMGGK  491

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQ  212
            +G D+HLG   +KG+PC+DL  ++ +LL+  FGA  RQ
Sbjct  492  VGKDAHLGSCVQKGIPCEDLHLVLRDLLITNFGAKPRQ  529



>ref|WP_015180235.1| assimilatory nitrite reductase (ferredoxin) precursor [Microcoleus 
sp. PCC 7113]
 ref|YP_007119477.1| assimilatory nitrite reductase (ferredoxin) precursor [Microcoleus 
sp. PCC 7113]
 gb|AFZ16071.1| assimilatory nitrite reductase (ferredoxin) precursor [Microcoleus 
sp. PCC 7113]
Length=517

 Score =   172 bits (437),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 87/158 (55%), Positives = 120/158 (76%), Gaps = 1/158 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN+IIP++ +S +D+ L EPLL + S  P  L + LV+CTG+QFC  A+IETK RAL
Sbjct  355  TVEQNVIIPNVPDSRLDAFLVEPLLERFSINPDPLTRALVSCTGAQFCNFALIETKNRAL  414

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             + +++E  + + RPVR+HWTGCPN+CGQ QVADIG MG   R + GKAVEG D+++GGK
Sbjct  415  TLIKQLEAELDLPRPVRVHWTGCPNSCGQPQVADIGLMGTKVRKD-GKAVEGVDLYMGGK  473

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQ  212
            +G D+HLG   +KG+ C+DL P++ +LL+E+FGA  RQ
Sbjct  474  VGKDAHLGTCVQKGIACEDLKPVLHQLLIEQFGARPRQ  511



>ref|WP_002789471.1| ferredoxin-nitrite reductase [Microcystis aeruginosa]
 emb|CCI19458.1| Ferredoxin--nitrite reductase [Microcystis aeruginosa PCC 9807]
Length=513

 Score =   172 bits (437),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 115/155 (74%), Gaps = 1/155 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN+IIP+I   N+ +LL EPLL K +P P  L + LV+CTG+QFC  A+IETK +A+
Sbjct  357  TVEQNVIIPNIAAENMATLLTEPLLAKFTPNPTPLQRALVSCTGAQFCNFALIETKNKAV  416

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             +  +++  + + R VRMHWTGCPN+CGQ QVADIG MG  AR + GK VEG D+++GGK
Sbjct  417  DLIRQLDAELNIPRGVRMHWTGCPNSCGQPQVADIGLMGTKARKD-GKTVEGVDLYMGGK  475

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAV  221
            +G D+HLG   +KG+PC+DL  ++  +L+E+FGA 
Sbjct  476  VGKDAHLGSCVQKGIPCEDLKSVLTSILIEQFGAT  510



>ref|WP_012265139.1| ferredoxin-nitrite reductase [Microcystis aeruginosa]
 ref|YP_001656855.1| ferredoxin-nitrite reductase [Microcystis aeruginosa NIES-843]
 dbj|BAG01663.1| ferredoxin--nitrite reductase [Microcystis aeruginosa NIES-843]
Length=513

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 115/155 (74%), Gaps = 1/155 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN+IIP+I   N+ +LL EPLL K +P P  L + LV+CTG+QFC  A+IETK RA+
Sbjct  357  TVEQNVIIPNIAAENMPTLLSEPLLAKFTPNPTPLQRALVSCTGAQFCNFALIETKNRAV  416

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             +  +++  + + R VR+HWTGCPN+CGQ QVADIG MG  AR + GK VEG D+++GGK
Sbjct  417  DLISQLDAELNIPRGVRIHWTGCPNSCGQPQVADIGLMGTKARKD-GKTVEGVDLYMGGK  475

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAV  221
            +G D+HLG   +KG+PC+DL  ++  +L+E+FGA 
Sbjct  476  VGKDAHLGSCVQKGIPCEDLKSVLTSILIEQFGAT  510



>ref|WP_004268302.1| ferredoxin-nitrite reductase [Microcystis aeruginosa]
 emb|CCI36406.1| Ferredoxin--nitrite reductase [Microcystis aeruginosa PCC 9701]
Length=513

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 115/155 (74%), Gaps = 1/155 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN+IIP+I   N+ +LL EPLL K +P P  L + LV+CTG+QFC  A+IETK +A+
Sbjct  357  TVEQNVIIPNIAAENMPTLLTEPLLAKFTPNPTPLQRALVSCTGAQFCNFALIETKNKAV  416

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             +  +++  + + R VRMHWTGCPN+CGQ QVADIG MG  AR + GK VEG D+++GGK
Sbjct  417  DLIRQLDAELNIPRGVRMHWTGCPNSCGQPQVADIGLMGTKARKD-GKTVEGVDLYMGGK  475

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAV  221
            +G D+HLG   +KG+PC+DL  ++  +L+E+FGA 
Sbjct  476  VGKDAHLGSCVQKGIPCEDLKSVLTSILIEQFGAT  510



>ref|WP_002733445.1| ferredoxin--nitrite reductase [Microcystis aeruginosa]
 gb|ELP56496.1| ferredoxin--nitrite reductase [Microcystis aeruginosa TAIHU98]
Length=513

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 115/155 (74%), Gaps = 1/155 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN+IIP+I   N+ +LL EPLL K +P P  L + LV+CTG+QFC  A+IETK +A+
Sbjct  357  TVEQNVIIPNIAAENMPTLLTEPLLAKFTPNPTPLQRALVSCTGAQFCNFALIETKNKAV  416

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             +  +++  + + R VRMHWTGCPN+CGQ QVADIG MG  AR + GK VEG D+++GGK
Sbjct  417  DLIRQLDAELNIPRGVRMHWTGCPNSCGQPQVADIGLMGTKARKD-GKTVEGVDLYMGGK  475

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAV  221
            +G D+HLG   +KG+PC+DL  ++  +L+E+FGA 
Sbjct  476  VGKDAHLGSCVQKGIPCEDLKSVLTSILIEQFGAT  510



>ref|WP_002752582.1| ferredoxin-nitrite reductase [Microcystis aeruginosa]
 emb|CCH91382.1| Ferredoxin--nitrite reductase [Microcystis aeruginosa PCC 9432]
Length=513

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 115/155 (74%), Gaps = 1/155 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN+IIP+I   N+ +LL EPLL K +P P  L + LV+CTG+QFC  A+IETK +A+
Sbjct  357  TVEQNVIIPNIAAENMPTLLTEPLLAKFTPNPTPLQRALVSCTGAQFCNFALIETKNKAV  416

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             +  +++  + + R VRMHWTGCPN+CGQ QVADIG MG  AR + GK VEG D+++GGK
Sbjct  417  DLIRQLDAELNIPRGVRMHWTGCPNSCGQPQVADIGLMGTKARKD-GKTVEGVDLYMGGK  475

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAV  221
            +G D+HLG   +KG+PC+DL  ++  +L+E+FGA 
Sbjct  476  VGKDAHLGSCVQKGIPCEDLKSVLTSILIEQFGAT  510



>ref|WP_024969723.1| ferredoxin--nitrite reductase [Microcystis aeruginosa]
Length=513

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 115/155 (74%), Gaps = 1/155 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN+IIP+I   N+ +LL EPLL K +P P  L + LV+CTG+QFC  A+IETK +A+
Sbjct  357  TVEQNVIIPNIAAENMPTLLTEPLLAKFTPNPTPLQRALVSCTGAQFCNFALIETKNKAV  416

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             +  +++  + + R VRMHWTGCPN+CGQ QVADIG MG  AR + GK VEG D+++GGK
Sbjct  417  DLIRQLDAELNIPRGVRMHWTGCPNSCGQPQVADIGLMGTKARKD-GKTVEGVDLYMGGK  475

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAV  221
            +G D+HLG   +KG+PC+DL  ++  +L+E+FGA 
Sbjct  476  VGKDAHLGSCVQKGIPCEDLKSVLTSILIEQFGAT  510



>ref|WP_010994783.1| ferredoxin-nitrite reductase [Nostoc sp. PCC 7120]
 ref|NP_484651.1| ferredoxin-nitrite reductase [Nostoc sp. PCC 7120]
 gb|AAC46074.1|AAC46074 nitrite reductase [Nostoc sp. PCC 7120]
 dbj|BAB72565.1| nitrite reductase [Nostoc sp. PCC 7120]
Length=536

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 88/158 (56%), Positives = 118/158 (75%), Gaps = 1/158 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQNIIIP+I +S + +LL +PLL + S +P  L + LV+CTG+QFC  A+IETK RAL
Sbjct  373  TVEQNIIIPNITDSRLRTLLTDPLLERFSLDPGALTRSLVSCTGAQFCNFALIETKNRAL  432

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
            ++ + +E  +   RPVR+HWTGCPN+CGQ QVADIG MG  AR   GKAVEG D+++GGK
Sbjct  433  EMIKGLEAELTFTRPVRIHWTGCPNSCGQPQVADIGLMGTKARKN-GKAVEGVDIYMGGK  491

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQ  212
            +G D+HLG   +KG+PC+DL  ++ +LL+  FGA  RQ
Sbjct  492  VGKDAHLGSCVQKGIPCEDLHLVLRDLLITNFGAKPRQ  529



>ref|WP_002781418.1| Ferredoxin--nitrite reductase [Microcystis aeruginosa]
 emb|CCI15840.1| Ferredoxin--nitrite reductase [Microcystis aeruginosa PCC 9806]
Length=513

 Score =   172 bits (435),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 115/155 (74%), Gaps = 1/155 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN+IIP+I   N+ +LL EPLL K +P P  L + LV+CTG+QFC  A+IETK RA+
Sbjct  357  TVEQNVIIPNIAAENMPTLLTEPLLAKFTPNPTPLQRALVSCTGAQFCNFALIETKNRAV  416

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             +  +++  + + + VR+HWTGCPN+CGQ QVADIG MG  AR + GK VEG D+++GGK
Sbjct  417  DLISQLDAELNIPQGVRIHWTGCPNSCGQPQVADIGLMGTKARKD-GKTVEGVDLYMGGK  475

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAV  221
            +G D+HLG   +KG+PC+DL  ++  +L+E+FGA 
Sbjct  476  VGKDAHLGSCVQKGIPCEDLKSVLTSILIEQFGAT  510



>ref|WP_023068951.1| precorrin-3B synthase [Lyngbya aestuarii]
 gb|ERT04799.1| precorrin-3B synthase [Lyngbya aestuarii BL J]
Length=514

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 116/154 (75%), Gaps = 1/154 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN+IIP++ +S +D+ L EPLL K S  P  L + LV+CTG+QFC  A+IETK RAL
Sbjct  359  TVEQNLIIPNVSDSRLDAFLTEPLLEKFSINPAPLTRALVSCTGAQFCNFALIETKNRAL  418

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             + +E+E  +   +PVR+HWTGCPN+CGQ QVADIG MG  AR + GK VEG D+++GGK
Sbjct  419  ALVKELEAELTFTKPVRIHWTGCPNSCGQPQVADIGLMGTKARKD-GKMVEGVDLYMGGK  477

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGA  224
            +G D+ LG   +KG+PC+DL PL+ +LL+++F A
Sbjct  478  VGKDAELGTRVQKGIPCEDLKPLLRDLLIDKFDA  511



>ref|WP_009632002.1| precorrin-3B synthase [Synechocystis sp. PCC 7509]
Length=517

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 116/159 (73%), Gaps = 1/159 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            +VEQN+IIP+I +S +++ L EP+L K S  P  L +GLV+CTG+QFC  A+IETK RAL
Sbjct  355  SVEQNVIIPNISDSRLETFLAEPVLAKFSVNPEPLTRGLVSCTGAQFCNFALIETKNRAL  414

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
            K    + + V + RPVR+HWTGCPN+CGQ QVADIG MG  AR   GK VEG D+++GG 
Sbjct  415  KEIASLAQEVQLTRPVRIHWTGCPNSCGQPQVADIGLMGTKARKN-GKPVEGVDIYMGGT  473

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQR  209
            +G D+HLG    KG+PC+DL P++ +LL+E F A  R++
Sbjct  474  VGKDAHLGTCVTKGIPCEDLQPVLRDLLIEHFQAKPREK  512



>ref|WP_017301382.1| hypothetical protein [Nodosilinea nodulosa]
Length=532

 Score =   172 bits (436),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 83/161 (52%), Positives = 119/161 (74%), Gaps = 1/161 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN+IIP++ +S ++ LL+EPLL + S  P  L + LV+CTG+QFC  A++ETK RAL
Sbjct  361  TVEQNVIIPNVPDSRLEVLLQEPLLERFSIAPSALTRSLVSCTGAQFCNFALVETKQRAL  420

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             +   ++  + + +PVR+HWTGCPN+CGQ QVADIG MG   R + GK VEG D+F+GGK
Sbjct  421  ALARALDGELTLAQPVRIHWTGCPNSCGQPQVADIGLMGTKVRKD-GKTVEGVDIFMGGK  479

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREE  203
            +G ++HLGE  ++G+PCD+L  ++  LL++ FGA+ R  EE
Sbjct  480  VGKEAHLGEKVQQGIPCDELHGVLRSLLIDHFGAIPRSLEE  520



>ref|WP_016515805.1| Sulfite reductase [ferredoxin] [Microcystis aeruginosa]
 gb|EPF21619.1| Sulfite reductase [ferredoxin] [Microcystis aeruginosa SPC777]
Length=513

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 115/155 (74%), Gaps = 1/155 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN+IIP+I   N+ +LL EPLL K +P P  L + LV+CTG+QFC  A+IETK +A+
Sbjct  357  TVEQNLIIPNIAAENMPTLLTEPLLAKFTPNPTPLQRALVSCTGAQFCNFALIETKNKAV  416

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             +  +++  + + R VRMHWTGCPN+CGQ QVADIG MG  AR + GK VEG D+++GGK
Sbjct  417  DLIRQLDAELNIPRGVRMHWTGCPNSCGQPQVADIGLMGTKARKD-GKTVEGVDLYMGGK  475

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAV  221
            +G D+HLG   +KG+PC+DL  ++  +L+E+FGA 
Sbjct  476  VGKDAHLGSCVQKGIPCEDLKSVLTSILIEQFGAT  510



>ref|WP_016868536.1| ferredoxin-nitrite reductase [Fischerella muscicola]
Length=541

 Score =   172 bits (436),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 88/158 (56%), Positives = 118/158 (75%), Gaps = 1/158 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN+IIP+I +S +   L EPLL K S +P  L + LV+CTG+QFC  A+IETK RAL
Sbjct  379  TVEQNVIIPNIPDSRLVLFLAEPLLEKFSIDPQPLTRSLVSCTGAQFCNFALIETKNRAL  438

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             + + +E  + + RPVR+HWTGCPN+CGQ QVADIG MG  AR   GKAVEG D+++GGK
Sbjct  439  GVIKALEEDLELTRPVRIHWTGCPNSCGQPQVADIGLMGTKARKN-GKAVEGVDIYMGGK  497

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQ  212
            +G ++HLG   +KG+PC+DL P++ +LL++ FGA  RQ
Sbjct  498  VGKEAHLGTCVQKGIPCEDLQPVLRDLLIQHFGAKPRQ  535



>gb|KEI67697.1| NirA [Planktothrix agardhii NIVA-CYA 126/8]
Length=528

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 83/154 (54%), Positives = 118/154 (77%), Gaps = 1/154 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN+IIP+I +S ++  L EP+L K S  P  L +GLV+CTG+QFC  A++ETK RA+
Sbjct  372  TVEQNVIIPNISDSRLEPFLTEPILEKFSVNPSALSRGLVSCTGAQFCNFALVETKHRAV  431

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
            ++ +E+E  + V + VR+HWTGCPN+CGQ QVADIG MG  AR E GK +EG ++++GGK
Sbjct  432  ELVKELEAELTVEKTVRIHWTGCPNSCGQPQVADIGLMGTKARKE-GKTLEGVNLYMGGK  490

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGA  224
            +G D+ LGE  +K +PC+DL P++ ++LVE+FGA
Sbjct  491  VGKDAQLGECVQKSIPCEDLKPVLRQILVEQFGA  524



>ref|WP_015142945.1| precorrin-3B synthase [Pleurocapsa minor]
 ref|YP_007080194.1| precorrin-3B synthase [Pleurocapsa sp. PCC 7327]
 gb|AFY76637.1| precorrin-3B synthase [Pleurocapsa sp. PCC 7327]
Length=515

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 116/159 (73%), Gaps = 1/159 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN+IIP+I N N+D+ L EPLL K +  P  L + LV+CTG+QFC  A++ETK RAL
Sbjct  358  TVEQNVIIPNIPNENLDAFLVEPLLQKFTISPKPLERALVSCTGAQFCNFALVETKNRAL  417

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             + + ++  + + R VR+HWTGCPN+CGQ QVADIG MG   R + GK VEG D+++GGK
Sbjct  418  ALAKALDEELELSRSVRIHWTGCPNSCGQPQVADIGLMGTKVRKD-GKTVEGVDLYMGGK  476

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQR  209
            +G D+ LG   +KG+ CDDL+P++  +L+E FGA  +Q+
Sbjct  477  VGKDARLGTCVQKGIACDDLLPVLKNILIENFGAKPKQK  515



>ref|WP_017720834.1| ferredoxin [Oscillatoria sp. PCC 10802]
Length=629

 Score =   173 bits (438),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 86/154 (56%), Positives = 117/154 (76%), Gaps = 1/154 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN I+P+I +S +++ LKEPLL + S  P  L + LV+CTG+QFC  A+IETK RAL
Sbjct  354  TVEQNAILPNIPDSRLETFLKEPLLERFSINPDPLTRALVSCTGAQFCNFALIETKNRAL  413

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             + +E+E  +++ +PVR+HWTGCPN+CGQ QVADIG MG   R   GK VEGAD+++GGK
Sbjct  414  AMIKELEAELSLTKPVRIHWTGCPNSCGQPQVADIGLMGTKTRKN-GKTVEGADIYMGGK  472

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGA  224
            +G D+HLG    KG+PC+DL P++  LL+E+FGA
Sbjct  473  VGKDAHLGTCVTKGIPCEDLKPVLRSLLIEQFGA  506



>ref|WP_008274143.1| ferredoxin-nitrite reductase [Cyanothece sp. CCY0110]
 gb|EAZ92575.1| ferredoxin-nitrite reductase [Cyanothece sp. CCY0110]
Length=514

 Score =   171 bits (432),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 81/157 (52%), Positives = 117/157 (75%), Gaps = 1/157 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN+IIP+I + N++  L+EP+L K S  P  L + LV+CTG+QFC  A++ETK RAL
Sbjct  359  TVEQNVIIPNISDDNLEPFLEEPILEKFSISPKPLQRALVSCTGAQFCNFALVETKNRAL  418

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             + +E++  + + + VR+HWTGCPN+CGQ QVADIG MG   R + G  VEG D+++GGK
Sbjct  419  ALAKELDEILELPQTVRIHWTGCPNSCGQPQVADIGLMGTKVRKD-GTTVEGVDLYMGGK  477

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRR  215
            +G D+HLG   +KG+ CDDL+P++ +LL++ FGA R+
Sbjct  478  VGKDAHLGTCVQKGIACDDLLPVLSDLLIKNFGAKRK  514



>ref|WP_015140514.1| sulfite reductase subunit beta (hemoprotein) [Nostoc sp. PCC 
7524]
 ref|YP_007077699.1| sulfite reductase subunit beta (hemoprotein) [Nostoc sp. PCC 
7524]
 gb|AFY50102.1| sulfite reductase, beta subunit (hemoprotein) [Nostoc sp. PCC 
7524]
Length=536

 Score =   171 bits (433),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 84/158 (53%), Positives = 118/158 (75%), Gaps = 1/158 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN+IIP+I +S + + L +PL+ + S +P +L + LV+CTG+QFC  A+IETK RAL
Sbjct  372  TVEQNVIIPNIPDSKLRTFLADPLMERFSIDPGLLTRSLVSCTGAQFCNFALIETKNRAL  431

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             + + +E  +   RPVR+HWTGCPN+CGQ QVADIG MG  AR   GKAVEG D+++GGK
Sbjct  432  SMIKALESELTFTRPVRIHWTGCPNSCGQPQVADIGLMGTKARKN-GKAVEGVDIYMGGK  490

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQ  212
            +G D+ LG   +KG+PC+DL P++ +LL++ FGA  R+
Sbjct  491  VGKDAKLGSCVQKGIPCEDLQPVLRDLLIQNFGAKVRE  528



>ref|WP_002760022.1| ferredoxin-nitrite reductase [Microcystis aeruginosa]
 emb|CCH97466.1| Ferredoxin--nitrite reductase [Microcystis aeruginosa PCC 9717]
Length=513

 Score =   171 bits (432),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 115/155 (74%), Gaps = 1/155 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN+IIP+I   N+ +LL EPLL K +P P  L + LV+CTG+QFC  A+IETK +A+
Sbjct  357  TVEQNVIIPNIAAENMATLLTEPLLAKFTPNPTPLQRALVSCTGAQFCNFALIETKNKAV  416

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             +  +++  + + R VR+HWTGCPN+CGQ QVADIG MG  AR + GK VEG D+++GGK
Sbjct  417  DLIRQLDAELNIPRGVRIHWTGCPNSCGQPQVADIGLMGTKARKD-GKTVEGVDLYMGGK  475

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAV  221
            +G D+HLG   +KG+PC+DL  ++  +L+E+FGA 
Sbjct  476  VGKDAHLGSCVQKGIPCEDLKSVLTSILIEQFGAT  510



>ref|WP_002797849.1| ferredoxin-nitrite reductase [Microcystis aeruginosa]
 emb|CCI26322.1| Ferredoxin--nitrite reductase [Microcystis aeruginosa PCC 9809]
Length=513

 Score =   170 bits (431),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 115/155 (74%), Gaps = 1/155 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN+IIP+I   N+ +LL EPLL K +P P  L + LV+CTG+QFC  A+IETK +A+
Sbjct  357  TVEQNVIIPNIAAENMPTLLTEPLLAKFTPNPTPLQRALVSCTGAQFCNFALIETKNKAV  416

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             +  +++  + + R VR+HWTGCPN+CGQ QVADIG MG  AR + GK VEG D+++GGK
Sbjct  417  DLISQLDAELNIPRGVRIHWTGCPNSCGQPQVADIGLMGTKARKD-GKTVEGVDLYMGGK  475

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAV  221
            +G D+HLG   +KG+PC+DL  ++  +L+E+FGA 
Sbjct  476  VGKDAHLGSCVQKGIPCEDLKSVLTSILIEQFGAT  510



>ref|WP_002765435.1| ferredoxin-nitrite reductase [Microcystis aeruginosa]
 emb|CCI05310.1| Ferredoxin--nitrite reductase [Microcystis aeruginosa PCC 9443]
Length=513

 Score =   170 bits (431),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 116/155 (75%), Gaps = 1/155 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN+IIP+I   N+ +LL EPLL K +P P  L + LV+CTG+QFC  A+IETK +A+
Sbjct  357  TVEQNVIIPNIAAENMATLLTEPLLAKFTPNPTPLQRALVSCTGAQFCNFALIETKNKAV  416

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             +  +++ ++ + R VR+HWTGCPN+CGQ QVADIG MG  AR + GK VEG D+++GGK
Sbjct  417  DLISQLDAQLNIPRGVRIHWTGCPNSCGQPQVADIGLMGTKARKD-GKTVEGVDLYMGGK  475

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAV  221
            +G D+HLG   +KG+PC+DL  ++  +L+E+FGA 
Sbjct  476  VGKDAHLGSCVQKGIPCEDLKSVLTSILIEQFGAT  510



>ref|WP_002792330.1| ferredoxin-nitrite reductase [Microcystis aeruginosa]
 emb|CCI21907.1| Ferredoxin--nitrite reductase [Microcystis aeruginosa PCC 9808]
Length=513

 Score =   170 bits (431),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 115/155 (74%), Gaps = 1/155 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN+IIP+I   N+ +LL EPLL K +P P  L + LV+CTG+QFC  A+IETK +A+
Sbjct  357  TVEQNVIIPNIAAENMPTLLTEPLLAKFTPNPTPLQRALVSCTGAQFCNFALIETKNKAV  416

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             +  +++  + + R VR+HWTGCPN+CGQ QVADIG MG  AR + GK VEG D+++GGK
Sbjct  417  DLIRQLDAELNIPRGVRIHWTGCPNSCGQPQVADIGLMGTKARKD-GKTVEGVDLYMGGK  475

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAV  221
            +G D+HLG   +KG+PC+DL  ++  +L+E+FGA 
Sbjct  476  VGKDAHLGSCVQKGIPCEDLKSVLTSILIEQFGAT  510



>ref|WP_015128366.1| assimilatory nitrite reductase (ferredoxin) precursor [Calothrix 
sp. PCC 7507]
 ref|YP_007065386.1| assimilatory nitrite reductase (ferredoxin) precursor [Calothrix 
sp. PCC 7507]
 gb|AFY32552.1| assimilatory nitrite reductase (ferredoxin) precursor [Calothrix 
sp. PCC 7507]
Length=538

 Score =   171 bits (432),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 83/154 (54%), Positives = 110/154 (71%), Gaps = 1/154 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN+IIP I +S + + L EPLL K +  P +L + LV+CTG+QFC  A+IETK RAL
Sbjct  378  TVEQNLIIPHISDSRLVTFLTEPLLKKFAVNPGLLARSLVSCTGAQFCNFALIETKNRAL  437

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             + + +E  + +   VR+HWTGCPN+CGQ QVADIG MG   R   GK VEG D+++GGK
Sbjct  438  SMIKALEAELIITHTVRIHWTGCPNSCGQPQVADIGLMGTKTRKN-GKTVEGVDIYMGGK  496

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGA  224
            +G D+HLG    KG+PC+DL P++  LL+E FGA
Sbjct  497  VGKDAHLGSCVTKGIPCEDLQPVLRNLLIEHFGA  530



>ref|WP_015152056.1| assimilatory nitrite reductase (ferredoxin) precursor [Oscillatoria 
acuminata]
 ref|YP_007089373.1| assimilatory nitrite reductase (ferredoxin) precursor [Oscillatoria 
acuminata PCC 6304]
 gb|AFY85453.1| assimilatory nitrite reductase (ferredoxin) precursor [Oscillatoria 
acuminata PCC 6304]
Length=626

 Score =   171 bits (434),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 118/154 (77%), Gaps = 1/154 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN+IIP+I +S +++LL+EP+L K S +P  L + LV+CTGSQFC  A+IETK RAL
Sbjct  357  TVEQNVIIPNIPDSRLEALLQEPILEKFSIDPAPLTRSLVSCTGSQFCNFALIETKNRAL  416

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             + +E+E  + + + VR+HWTGCPN+CGQ QVA+IG MG   R   GK VEG D+++GGK
Sbjct  417  ALVQELETELEIPKTVRIHWTGCPNSCGQPQVAEIGLMGTKTRKN-GKTVEGVDLYMGGK  475

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGA  224
            +G D+HLG   +KG+PC+DL P++ +LLVE+F A
Sbjct  476  VGKDAHLGSCVQKGIPCEDLKPVLRQLLVEQFEA  509



>ref|WP_017315401.1| ferredoxin-nitrite reductase [Mastigocladopsis repens]
Length=532

 Score =   170 bits (431),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 85/158 (54%), Positives = 116/158 (73%), Gaps = 1/158 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            +VEQN +IP+I +S + + L +PLL + +  P  L + LV+CTG+QFC  A+IETK RAL
Sbjct  372  SVEQNFLIPNIPDSRLATFLIDPLLNRFTINPAPLTRALVSCTGAQFCNFALIETKNRAL  431

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             I + +E  V +  PVR+HWTGCPN+CGQ QVADIG MG  AR   GKAV+G D+++GGK
Sbjct  432  AIIKALEAEVELTHPVRIHWTGCPNSCGQPQVADIGLMGTKARKN-GKAVDGVDIYMGGK  490

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQ  212
            +G D+HLG    KG+PC+DL+P++ ELL+E FGA  R+
Sbjct  491  VGKDAHLGICVTKGIPCEDLLPVLRELLIEHFGARLRE  528



>gb|AEW90647.1| nitrite reductase [Saponaria officinalis]
Length=426

 Score =   168 bits (426),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 101/114 (89%), Gaps = 1/114 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLL-TKLSPEPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQNIIIP+I NS +DSLL EPLL  K SPEPPILMKGLVACTG+QFCGQAIIETK RA
Sbjct  313  TVEQNIIIPNIDNSKIDSLLNEPLLHEKFSPEPPILMKGLVACTGNQFCGQAIIETKQRA  372

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGA  347
            LK+TE+V+R V+V RPVRMHWTGCPN+CGQVQVADIGFMGC+ R+E GK  EGA
Sbjct  373  LKVTEDVQRLVSVTRPVRMHWTGCPNSCGQVQVADIGFMGCMTRDENGKPCEGA  426



>ref|WP_011242624.1| ferredoxin-nitrite reductase [Synechococcus elongatus]
 ref|YP_171020.1| ferredoxin-nitrite reductase [Synechococcus elongatus PCC 6301]
 ref|YP_400257.1| ferredoxin-nitrite reductase [Synechococcus elongatus PCC 7942]
 sp|P39661.1|NIR_SYNE7 RecName: Full=Ferredoxin--nitrite reductase [Synechococcus elongatus 
PCC 7942]
 dbj|BAA02217.1| ferredoxin-nitrite reductase [Synechococcus elongatus PCC 7942]
 emb|CAA47912.1| ferredoxin--nitrite reductase [Synechococcus elongatus PCC 7942]
 dbj|BAD78500.1| ferredoxin-nitrite reductase [Synechococcus elongatus PCC 6301]
 gb|ABB57270.1| assimilatory nitrite reductase (ferredoxin) precursor [Synechococcus 
elongatus PCC 7942]
 gb|AJD58216.1| ferredoxin--nitrite reductase [Synechococcus sp. UTEX 2973]
 prf||2005377B nitrite reductase
Length=512

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 87/157 (55%), Positives = 116/157 (74%), Gaps = 1/157 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN+I+  I ++ + +LL EPLLT+ SP+P  L +G V+CTGSQ+C  A+IETK RA+
Sbjct  355  TVEQNVILTHIPDAQLPTLLAEPLLTRFSPQPAPLSRGTVSCTGSQYCNFALIETKQRAI  414

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             I + +E  + + RPVR+HWTGCPN+CGQ QVADIG MG   R + G+ VEG D+FLGGK
Sbjct  415  AIAQSLEAELDLPRPVRIHWTGCPNSCGQPQVADIGLMGAKVRKD-GQMVEGVDIFLGGK  473

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRR  215
            +G D+HLGE    GV C+DL  ++ +LL+ERFGA  R
Sbjct  474  VGYDAHLGEKAMTGVACEDLPDVLRQLLIERFGAQAR  510



>ref|WP_026722911.1| ferredoxin--nitrite reductase [Fischerella sp. PCC 9431]
Length=538

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 88/158 (56%), Positives = 118/158 (75%), Gaps = 1/158 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQNIIIP+I +S++   L EPLL K S +P  L + LV+CTG+QFC  A+IETK+RA 
Sbjct  378  TVEQNIIIPNIHDSSLVFFLAEPLLEKFSIDPKPLTRSLVSCTGAQFCNFALIETKSRAQ  437

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             + + +E  + + RPVR+HWTGCPN+CGQ QVADIG MG  AR   GKAVEG D+++GGK
Sbjct  438  AVIKALEADLELTRPVRIHWTGCPNSCGQPQVADIGLMGTKARKN-GKAVEGVDIYMGGK  496

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQ  212
            +G ++ LG   +KGVPC+DL+P++ ELLV+ F A  R+
Sbjct  497  VGKEAQLGTCVQKGVPCEDLLPVLRELLVKNFDARLRE  534



>gb|AIE74568.1| Ferredoxin--nitrite reductase [Synechocystis sp. PCC 6714]
Length=502

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 86/157 (55%), Positives = 117/157 (75%), Gaps = 1/157 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN+I+ ++ +  +D LL EPLLTK    P  L + +V+CTG+QFC  A+IETK RAL
Sbjct  347  TVEQNLILVNVPDDKLDQLLAEPLLTKFRVNPHNLQRSVVSCTGAQFCKFALIETKNRAL  406

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             + + +E+ + V +PVR+HWTGCPN+CGQ QVADIG MG   R + GK V+GADV+LGGK
Sbjct  407  AMVDALEKELTVPQPVRIHWTGCPNSCGQPQVADIGLMGTKVRKD-GKTVDGADVYLGGK  465

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRR  215
            +G D+ LG    K +PCD+L PL+ ++L+E+FGAVRR
Sbjct  466  VGKDARLGTCVHKSIPCDELQPLLAQILIEQFGAVRR  502



>ref|WP_026732020.1| ferredoxin--nitrite reductase [Fischerella sp. PCC 9605]
Length=541

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 115/158 (73%), Gaps = 1/158 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN IIP++ +S +   L E LL K S +P  L + LV+CTG+QFC  A+IETK RAL
Sbjct  379  TVEQNAIIPNVPDSRLTLFLAESLLEKFSVDPKPLTRSLVSCTGAQFCNFALIETKNRAL  438

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
               + +E  V + RPVR+HWTGCPN+CGQ QVADIG MG  AR   GKAVEG D+++GGK
Sbjct  439  TTIKALEEEVELTRPVRIHWTGCPNSCGQPQVADIGLMGTKARKN-GKAVEGVDIYMGGK  497

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQ  212
            +G D+HLG   +KGVPC+DL P++ +LL++ FGA  RQ
Sbjct  498  VGKDAHLGTCVQKGVPCEDLQPVLQDLLIKHFGAKPRQ  535



>ref|WP_036480548.1| ferredoxin--nitrite reductase [Myxosarcina sp. GI1]
Length=517

 Score =   169 bits (427),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/154 (53%), Positives = 117/154 (76%), Gaps = 1/154 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN++IP I + N+D+ L EPLL K + EP  L + LV+CTGS+FC  A++ETK RAL
Sbjct  355  TVEQNLLIPHIPDENLDAFLAEPLLKKFTLEPQSLERSLVSCTGSRFCNFALVETKQRAL  414

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             +  E++R + V   VR+HWTGCPN+CGQ QVADIGFMG   R + GK VEG D+++GGK
Sbjct  415  AMARELDRELEVPDKVRIHWTGCPNSCGQPQVADIGFMGTKVRKD-GKTVEGVDLYMGGK  473

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGA  224
            +G ++ LG++ +KG+ CD+L P++ ++L+E+FGA
Sbjct  474  VGKNAKLGDLVEKGIACDELKPVLKKILIEQFGA  507



>ref|WP_013323579.1| ferredoxin-nitrite reductase [Cyanothece sp. PCC 7822]
 ref|YP_003888785.1| nitrite and sulfite reductase 4Fe-4S region [Cyanothece sp. PCC 
7822]
 gb|ADN15510.1| nitrite and sulphite reductase 4Fe-4S region [Cyanothece sp. 
PCC 7822]
Length=519

 Score =   168 bits (426),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 79/154 (51%), Positives = 114/154 (74%), Gaps = 1/154 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN IIP I+  N+++ L EPLL +    P  LM+ L++CTGS +C  A+IETK R +
Sbjct  360  TVEQNFIIPYIKTENLETFLAEPLLQRFPINPTPLMRSLISCTGSHYCNFALIETKQRGV  419

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
            K+ +E++  + + + VR+HWTGCPN+CGQVQ  DIG MG  AR + GK VEG D+++GGK
Sbjct  420  KLAQELDSELEIPQRVRIHWTGCPNSCGQVQAGDIGLMGTKARKD-GKTVEGVDLYMGGK  478

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGA  224
            +G D+ LG + +KG+PC+DL P++ +LL+E+FGA
Sbjct  479  VGKDAKLGTLIQKGIPCEDLKPMLKKLLIEQFGA  512



>ref|WP_016861627.1| ferredoxin-nitrite reductase [Fischerella muscicola]
Length=534

 Score =   168 bits (426),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 85/158 (54%), Positives = 117/158 (74%), Gaps = 1/158 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            T+EQN++IP+I +S +   L EPLL K S +P  L + LV+CTG+QFC  A+IETK RA 
Sbjct  372  TLEQNVMIPNIPDSRLVLFLAEPLLEKFSIDPKPLTRSLVSCTGAQFCNFALIETKNRAQ  431

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             + + +E  + + RPVR+HWTGCPN+CGQ QVADIG MG  AR   GKAVEG D+++GGK
Sbjct  432  AVIKALEADLELTRPVRIHWTGCPNSCGQPQVADIGLMGTKARKN-GKAVEGVDIYMGGK  490

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQ  212
            +G ++HLG   +KG+PC+DL P++ +LL++ FGA  RQ
Sbjct  491  VGKEAHLGTCIQKGIPCEDLQPILQDLLIQHFGAKPRQ  528



>ref|WP_024124217.1| assimilatory ferredoxin-nitrite reductase NirA [Thermosynechococcus 
sp. NK55a]
 ref|YP_008899317.1| assimilatory ferredoxin-nitrite reductase NirA [Thermosynechococcus 
sp. NK55a]
 gb|AHB87804.1| assimilatory ferredoxin-nitrite reductase NirA [Thermosynechococcus 
sp. NK55a]
Length=519

 Score =   168 bits (425),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 83/157 (53%), Positives = 117/157 (75%), Gaps = 1/157 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN+IIP + ++ + SLL+EPLL K  PEPP L + LV+CTG+QFC  A+IETK RAL
Sbjct  347  TVEQNVIIPHVTDAVLPSLLREPLLGKFRPEPPSLERALVSCTGAQFCNFALIETKNRAL  406

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             +   +++++ + +PVR+HWTGCPN+CGQ QVADIG MG   R   G+ V+  D+++GGK
Sbjct  407  ALARWLDQQLVLAQPVRIHWTGCPNSCGQPQVADIGLMGTKTRRN-GETVDAVDLYMGGK  465

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRR  215
            +G D+ LG   KKG+PCD+L  ++ +LL+E+FGA  R
Sbjct  466  VGKDAKLGTCIKKGIPCDELPEVLRQLLIEQFGAKPR  502



>ref|WP_029633456.1| ferredoxin--nitrite reductase [[Scytonema hofmanni] UTEX B 1581]
Length=542

 Score =   168 bits (425),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 83/161 (52%), Positives = 115/161 (71%), Gaps = 3/161 (2%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN+IIP+I ++ + + L E LL +   EP  LM+ LV+CTG+QFC  A+IETK RAL
Sbjct  380  TVEQNVIIPNIADTRLATFLTERLLERFRIEPGSLMRSLVSCTGAQFCNFALIETKNRAL  439

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             + + +E  +   + VR+HWTGCPN+CGQ QVADIG MG   R + GK +EG D+++GGK
Sbjct  440  AMIKTLESELTFTQTVRIHWTGCPNSCGQPQVADIGLMGTKVR-KNGKTLEGVDIYMGGK  498

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREE  203
            +G D+HLG    K +PC+DL P++ +LL+E FGA  R +EE
Sbjct  499  VGKDAHLGTCVTKSIPCEDLQPVLRQLLIENFGA--RAKEE  537



>ref|WP_009783247.1| ferredoxin-nitrite reductase [Lyngbya sp. PCC 8106]
 gb|EAW38366.1| nitrite reductase [Lyngbya sp. PCC 8106]
Length=510

 Score =   167 bits (422),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 114/153 (75%), Gaps = 1/153 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN+IIP + +S +++LL EPLL K S  P  L + LV+CTG+QFC  A+IETK RAL
Sbjct  355  TVEQNLIIPYVSDSRLEALLTEPLLEKFSINPAPLTRALVSCTGAQFCNFALIETKNRAL  414

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             + +E+E  +   +PVR+HWTGCPN+CGQ QVADIG MG   R + GK VEG D+F+GGK
Sbjct  415  ALVKELEAELTFTKPVRIHWTGCPNSCGQPQVADIGLMGTKTRKD-GKMVEGVDLFMGGK  473

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFG  227
            +G ++ LG   KKG+ C+DL PL+ +LLV++FG
Sbjct  474  VGKEAELGTCVKKGIACEDLKPLLRDLLVDKFG  506



>ref|WP_006196192.1| ferredoxin-nitrite reductase [Nodularia spumigena]
 gb|EAW45499.1| nitrite reductase [Nodularia spumigena CCY9414]
 gb|AHJ28768.1| Ferredoxin--nitrite reductase [Nodularia spumigena CCY9414]
Length=535

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 115/154 (75%), Gaps = 1/154 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQNIIIP+I +S + + L E LL K +  P +L + LV+CTG+QFC  A+IETK +AL
Sbjct  378  TVEQNIIIPNIPDSRLATFLTEALLEKFAINPDMLTRSLVSCTGAQFCNFALIETKNQAL  437

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
            ++ + ++  + + R VR+HWTGCPN+CGQ QVADIG MG  AR + GK VEG D+++GG 
Sbjct  438  EMAQALQAELTLTRAVRIHWTGCPNSCGQPQVADIGLMGTKAR-KNGKPVEGVDIYMGGT  496

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGA  224
            +G D+HLG   +KG+PC+DL P++ +LL++ FGA
Sbjct  497  VGKDAHLGNCVQKGIPCEDLQPVLRDLLIQHFGA  530



>ref|WP_012595745.1| MULTISPECIES: ferredoxin-nitrite reductase [Cyanothece]
 ref|YP_002372634.1| ferredoxin-nitrite reductase [Cyanothece sp. PCC 8801]
 ref|YP_003139289.1| ferredoxin-nitrite reductase [Cyanothece sp. PCC 8802]
 gb|ACK66478.1| Ferredoxin--nitrite reductase [Cyanothece sp. PCC 8801]
 gb|ACV02454.1| Ferredoxin--nitrite reductase [Cyanothece sp. PCC 8802]
Length=513

 Score =   167 bits (422),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/154 (53%), Positives = 116/154 (75%), Gaps = 1/154 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN+IIP+I + N++    EPLL K S  PP L + LV+CTG+QFC  A++ETK RAL
Sbjct  358  TVEQNVIIPNIPDENLNPFFAEPLLQKFSINPPSLERSLVSCTGAQFCNFALVETKNRAL  417

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             ++ E+++ + + +PVR+HWTGCPN+CGQ QVADIG MG   R + GK VEG D++LGGK
Sbjct  418  ALSRELDKVLDIPQPVRIHWTGCPNSCGQPQVADIGLMGTKVR-KNGKTVEGVDLYLGGK  476

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGA  224
            +G D+ LG   +KG+ C+DL+P++ +LL++ FGA
Sbjct  477  VGKDAQLGTCVQKGIACEDLLPVLQQLLIDNFGA  510



>ref|WP_009344167.1| ferredoxin-nitrite reductase [Raphidiopsis brookii]
 gb|EFA72074.1| nirA (Nitrite/sulfite reductase, hemoprotein beta- component, 
ferrodoxin) [Raphidiopsis brookii D9]
Length=522

 Score =   167 bits (422),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/163 (50%), Positives = 123/163 (75%), Gaps = 1/163 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN IIP+I +S +++LL EP+L K S  P +LM+ +V+CTG+QFC  A+IETK RA+
Sbjct  352  TVEQNAIIPNIPDSGLNTLLTEPILKKFSVSPGLLMRSVVSCTGAQFCNFALIETKKRAI  411

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             +T+ +E+ + + +PVR+HWTGCPN+CGQ QVADIG MG   R + G+ +EG D+++GGK
Sbjct  412  VMTQALEQELILSKPVRIHWTGCPNSCGQPQVADIGLMGTKVR-KNGQTLEGVDIYMGGK  470

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDE  197
            +G D+ LG   +KGV C+DL P++ ++L+++FGA  R+   D+
Sbjct  471  VGKDARLGTCIQKGVACEDLQPILKDILLKQFGAKVREHTADQ  513



>gb|ABN71231.1| nitrite reductase [Cucumis sativus]
Length=142

 Score =   157 bits (397),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 86/99 (87%), Positives = 93/99 (94%), Gaps = 0/99 (0%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQNIIIP+IQNS +++LLKE LL K SPEPPILMKGLVACTG+QFCGQAIIETKARAL
Sbjct  43   TVEQNIIIPNIQNSKLEALLKESLLQKFSPEPPILMKGLVACTGNQFCGQAIIETKARAL  102

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMG  389
            K+TEEV+RRV V RPVRMHWTGCPNTCGQVQVADIGFMG
Sbjct  103  KVTEEVQRRVTVTRPVRMHWTGCPNTCGQVQVADIGFMG  141



>ref|WP_006508771.1| precorrin-3B synthase [Xenococcus sp. PCC 7305]
 gb|ELS04107.1| precorrin-3B synthase [Xenococcus sp. PCC 7305]
Length=626

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/154 (53%), Positives = 110/154 (71%), Gaps = 1/154 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN IIP I N N+++ L EPLL + S  P  L + +++CTG+++C  AIIETK RAL
Sbjct  361  TVEQNAIIPHIANENLETFLTEPLLEQFSINPSTLTRSVISCTGAKYCNFAIIETKQRAL  420

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
            K+ +E+++ + +   VR+HWTGCPN+CGQ Q  DIG MG   R + GKAVEGA +F GGK
Sbjct  421  KLAQELDQELDIPDRVRLHWTGCPNSCGQAQAGDIGLMGTKVRKD-GKAVEGAKIFTGGK  479

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGA  224
            +G D+ LG +  KGV CDDL P +  LL+E+FGA
Sbjct  480  VGKDAQLGSLVDKGVACDDLKPTLRNLLIEQFGA  513



>ref|WP_015213651.1| assimilatory nitrite reductase (ferredoxin) precursor [Anabaena 
cylindrica]
 ref|YP_007155911.1| assimilatory nitrite reductase (ferredoxin) precursor [Anabaena 
cylindrica PCC 7122]
 gb|AFZ57001.1| assimilatory nitrite reductase (ferredoxin) precursor [Anabaena 
cylindrica PCC 7122]
Length=516

 Score =   166 bits (421),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 83/158 (53%), Positives = 115/158 (73%), Gaps = 1/158 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN IIP+I +S + + L EPLL K    P +LM+ LV+CTG+QFC  A+IETK RAL
Sbjct  354  TVEQNAIIPNITDSALTAFLTEPLLNKFGVNPGLLMRSLVSCTGAQFCNFALIETKNRAL  413

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             + + +E  + + RPVR+HWTGCPN+CGQ QVADIG MG   R + GK +EG D+++GG 
Sbjct  414  AMIKVLESELILSRPVRIHWTGCPNSCGQPQVADIGLMGTKVR-KNGKTLEGVDIYMGGT  472

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQ  212
            +G D+HLG   +K +PC+DL P++ E+L++ FGA  R+
Sbjct  473  VGKDAHLGTCVQKSIPCEDLEPVLKEILIQNFGAKLRE  510



>ref|WP_026093421.1| ferredoxin--nitrite reductase [Calothrix sp. PCC 7103]
Length=515

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 111/154 (72%), Gaps = 1/154 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQNI+IP+I ++ + S   E LL K    P  L + LV+CTG+QFC  A+IETK RAL
Sbjct  355  TVEQNIVIPNISDARLASFFTESLLGKFKINPEPLTRALVSCTGAQFCNFALIETKNRAL  414

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             + + +E  + + +PVR+HWTGCPN+CGQ QVADIG MG  AR + GK VEG D+++GGK
Sbjct  415  AMIKALESELEMSQPVRIHWTGCPNSCGQPQVADIGLMGTKAR-KNGKPVEGVDIYMGGK  473

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGA  224
            +G D+HLG    KGVPC+DL P++ ELLV  FGA
Sbjct  474  VGKDAHLGTCVTKGVPCEDLQPVLHELLVTHFGA  507



>ref|WP_027400663.1| ferredoxin--nitrite reductase [Aphanizomenon flos-aquae]
Length=515

 Score =   166 bits (420),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 82/154 (53%), Positives = 113/154 (73%), Gaps = 1/154 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQNIIIP+I +S++ +   E +L K S  P +LM+ LV+CTG+QFC  A+IETK RAL
Sbjct  360  TVEQNIIIPNIPDSSLTAFFTESVLEKFSVNPGLLMRSLVSCTGAQFCNFALIETKNRAL  419

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             + + +E  + + RPVR+HWTGCPN+CGQ QVADIG MG   RN  G+ +EG D+++GG 
Sbjct  420  AMIKSLESELTLSRPVRIHWTGCPNSCGQPQVADIGLMGTKVRNN-GQMLEGVDIYMGGT  478

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGA  224
            +G D+HLG   KK +PC DL P++ +LL+ +FGA
Sbjct  479  VGKDAHLGTCVKKSIPCKDLQPILRDLLIHKFGA  512



>ref|WP_021829137.1| Ferredoxin--nitrite reductase [Crocosphaera watsonii]
 emb|CCQ48945.1| Ferredoxin--nitrite reductase [Crocosphaera watsonii WH 8502]
Length=516

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 116/157 (74%), Gaps = 1/157 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN++I  I   N+++ L+EP+L K S  P  L + LV+CTG+QFC  A++ETK RA+
Sbjct  359  TVEQNVLISHIPQENLETFLEEPILEKFSISPKTLQRALVSCTGAQFCSFALVETKNRAV  418

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             + +E++  + + + VR+HWTGCPN+CGQ QVADIG MG   R + G+ VEG ++++GGK
Sbjct  419  ALAKELDEALEIPKTVRIHWTGCPNSCGQPQVADIGLMGTKVRKD-GQTVEGLNLYMGGK  477

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRR  215
            +G D+HLG   +KG+ CDDL+P++ ++L+E FGA R+
Sbjct  478  VGKDAHLGTCMQKGIACDDLIPVLTDILIENFGAKRK  514



>ref|WP_017713849.1| hypothetical protein [Prochlorothrix hollandica]
Length=513

 Score =   166 bits (420),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 111/155 (72%), Gaps = 0/155 (0%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN+IIP + +S +++LL+EPLL   +  P  L++ LV+CTG+QFC  A++ETK RAL
Sbjct  356  TVEQNVIIPHVPDSRLEALLQEPLLATFTTTPSPLVRSLVSCTGAQFCNFAMVETKQRAL  415

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             I +E+E  +   R VRMHWTGCPN+CGQ QVADIG +G  AR   GK  EG D+++GGK
Sbjct  416  DIAQELEAELDFPRSVRMHWTGCPNSCGQPQVADIGMLGTKARGADGKPTEGVDIYMGGK  475

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAV  221
            +G D+ LG    KG+PCD L  ++ +LL++ FGA 
Sbjct  476  VGKDAQLGSRVMKGIPCDTLKSVLQDLLIKEFGAT  510



>ref|WP_009554639.1| assimilatory nitrite reductase (ferredoxin) precursor [Oscillatoriales 
cyanobacterium JSC-12]
 gb|EKQ70221.1| assimilatory nitrite reductase (ferredoxin) precursor [Oscillatoriales 
cyanobacterium JSC-12]
Length=526

 Score =   166 bits (420),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 84/157 (54%), Positives = 118/157 (75%), Gaps = 1/157 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQNIIIP++ +S +  LL EPLL++    P  L++ LV+CTG+QFC  A+IETK RAL
Sbjct  355  TVEQNIIIPNVPDSRLAPLLNEPLLSRFLINPTPLVRSLVSCTGAQFCNFALIETKNRAL  414

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             +  E+++ +   RPVR+HWTGCPN+CGQ QVADIG MG   R + GKAV+G D+++GGK
Sbjct  415  AMARELDQELYCPRPVRIHWTGCPNSCGQPQVADIGLMGTKTRKD-GKAVDGVDLYMGGK  473

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRR  215
            +G ++ LGE  +KG+PC+DL P++ +LL++ FGA  R
Sbjct  474  VGKEAELGECVRKGIPCEDLKPVLRDLLIQNFGAQAR  510



>ref|WP_015179108.1| assimilatory nitrite reductase (ferredoxin) precursor [Oscillatoria 
nigro-viridis]
 ref|YP_007118319.1| assimilatory nitrite reductase (ferredoxin) precursor [Oscillatoria 
nigro-viridis PCC 7112]
 gb|AFZ09903.1| assimilatory nitrite reductase (ferredoxin) precursor [Oscillatoria 
nigro-viridis PCC 7112]
Length=644

 Score =   167 bits (422),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 83/162 (51%), Positives = 122/162 (75%), Gaps = 1/162 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVE+N+IIP++ +S ++SL+KEPLL + S  P  L + LV+CTG++FC  A+IETK+R++
Sbjct  374  TVEENVIIPNVPDSRIESLVKEPLLQRFSINPAPLTRALVSCTGAKFCNFALIETKSRSV  433

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             + EE+E  ++V +PVR+HWTGCPN+CGQ QVADIG MG   R   GK +EG D+++GG 
Sbjct  434  AMIEELELELSVPKPVRIHWTGCPNSCGQPQVADIGLMGTKVRKN-GKTLEGVDIYMGGT  492

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREED  200
            +G D+HLG   +K +PC+DL P++ +LLV+ FGAV    +E+
Sbjct  493  VGKDAHLGTCVQKSIPCEDLKPVLRQLLVDNFGAVPNPSQEN  534



>ref|WP_015192765.1| precorrin-3B synthase [Stanieria cyanosphaera]
 ref|YP_007132060.1| precorrin-3B synthase [Stanieria cyanosphaera PCC 7437]
 gb|AFZ35094.1| precorrin-3B synthase [Stanieria cyanosphaera PCC 7437]
Length=512

 Score =   166 bits (419),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 80/157 (51%), Positives = 114/157 (73%), Gaps = 1/157 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN+IIP+I N N+++ L EP+L K + EP  L + LV+CTG+QFC  A++ETK RAL
Sbjct  355  TVEQNVIIPNIPNENLEAFLAEPILEKFTLEPKPLERTLVSCTGAQFCNFALVETKNRAL  414

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             +  E++  + +   VR+HWTGCPN+CGQ QVADIG MG   R + GK VEG D+++GGK
Sbjct  415  ALARELDAELELPNKVRIHWTGCPNSCGQPQVADIGLMGTKVRKD-GKTVEGVDLYMGGK  473

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRR  215
            +G D+ LG   +KG+ CDDL  ++ ++L+++FGA  R
Sbjct  474  VGKDAELGTCVQKGIACDDLKSVLRDILIDKFGAKSR  510



>ref|WP_007310897.1| ferredoxin-nitrite reductase [Crocosphaera watsonii]
 gb|EHJ12568.1| Ferredoxin--nitrite reductase [Crocosphaera watsonii WH 0003]
 emb|CCQ56529.1| Ferredoxin--nitrite reductase [Crocosphaera watsonii WH 0005]
Length=516

 Score =   166 bits (419),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 116/157 (74%), Gaps = 1/157 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN++I  I   N+++ L+EP+L K S  P  L + LV+CTG+QFC  A++ETK RA+
Sbjct  359  TVEQNVLISHIPQENLETFLEEPILEKFSISPKPLQRALVSCTGAQFCSFALVETKNRAV  418

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             + +E++  + + + VR+HWTGCPN+CGQ QVADIG MG   R + G+ VEG ++++GGK
Sbjct  419  ALAKELDEALEIPQTVRIHWTGCPNSCGQPQVADIGLMGTKVRKD-GQTVEGVNLYMGGK  477

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRR  215
            +G D+HLG   +KG+ CDDL+P++ ++L+E FGA R+
Sbjct  478  VGKDAHLGTCVQKGIACDDLIPVLTDILIENFGAKRK  514



>ref|WP_038021955.1| ferredoxin--nitrite reductase [Synechocystis sp. PCC 7509]
Length=527

 Score =   166 bits (419),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 123/174 (71%), Gaps = 1/174 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN+IIP+I NS +++ L+EPLL + S  P  L + LV+CTGSQFCG A+IETK RAL
Sbjct  355  TVEQNLIIPNIPNSRLETFLQEPLLERFSINPENLSRRLVSCTGSQFCGFALIETKNRAL  414

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             + + +E  + V +PVR+HWTGCPN+CGQ QVADIG MG   R + G+ VE  D+++GGK
Sbjct  415  AMIKALEAEITVEQPVRIHWTGCPNSCGQPQVADIGLMGTKGR-KNGQVVEAVDIWMGGK  473

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREEDED*TKF*ASSSS  164
            +G ++ LG    K +PCDDL P++ +LL+E FGA  ++  E     +F + SS+
Sbjct  474  VGFEAELGSRIMKQIPCDDLKPVLKDLLIEHFGAKLKKSPESFVPQEFLSVSSN  527



>ref|WP_015081559.1| ferredoxin-nitrite reductase [Anabaena sp. 90]
 ref|YP_006998241.1| ferredoxin-nitrite reductase [Anabaena sp. 90]
 gb|AFW96428.1| ferredoxin-nitrite reductase [Anabaena sp. 90]
Length=520

 Score =   166 bits (419),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 81/158 (51%), Positives = 116/158 (73%), Gaps = 1/158 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN+IIP+I +S++ +   E +L K S  P +LM+ LV+CTG+QFC  A+IETK RAL
Sbjct  360  TVEQNVIIPNIPDSSLTTFFTESVLEKFSVNPGLLMRSLVSCTGAQFCNFALIETKNRAL  419

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             + + +E  + + RPVR+HWTGCPN+CGQ QVADIG MG   R + GK +EG D+++GG 
Sbjct  420  AMIKSLESELTLSRPVRIHWTGCPNSCGQPQVADIGLMGTKVR-KNGKMLEGVDIYMGGT  478

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQ  212
            +G D+HLG   +K +PC+DL P++ E+L+ +FGA  R+
Sbjct  479  VGKDAHLGTCVQKSIPCEDLQPILKEILITKFGAKLRE  516



>ref|WP_027844528.1| ferredoxin--nitrite reductase [Mastigocoleus testarum]
Length=515

 Score =   165 bits (418),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 83/158 (53%), Positives = 114/158 (72%), Gaps = 1/158 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN IIP+I   N+D  L EPLL K +  P  L + LV+CTG+QFC  A++ETK+RAL
Sbjct  358  TVEQNAIIPNISQENLDLFLSEPLLQKFTINPKPLERKLVSCTGAQFCKFALVETKSRAL  417

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             I +E++R + +   VR+HWTGCPN+CGQ QVADIG MG   R + GK VEG D+++GGK
Sbjct  418  AIAKELDRELDIPEDVRIHWTGCPNSCGQPQVADIGLMGTKVRKD-GKTVEGVDLYMGGK  476

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQ  212
            +G D+ LG   +KG+PC+DL+P++  +L + FGA  +Q
Sbjct  477  VGKDARLGTCVQKGIPCEDLLPVLRNILTKDFGAQPKQ  514



>ref|WP_028085072.1| ferredoxin--nitrite reductase [Dolichospermum circinale]
Length=520

 Score =   165 bits (418),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 81/158 (51%), Positives = 116/158 (73%), Gaps = 1/158 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQNIIIP+I +S++ +   E +L K +  P +LM  LV+CTG+QFC  A+IETK RAL
Sbjct  360  TVEQNIIIPNIPDSSLTTFFTEGILEKFAVNPGLLMGSLVSCTGAQFCNFALIETKNRAL  419

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
            ++ + +E  + + R VR+HWTGCPN+CGQ QVADIG MG   R + G+ +EG D+++GG 
Sbjct  420  EMIKSLESELTLSRLVRIHWTGCPNSCGQPQVADIGLMGTKVR-KNGQMLEGVDIYMGGT  478

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQ  212
            +G D+HLG   KKG+PC+DL P++ E+L+ +FGA  R+
Sbjct  479  VGKDAHLGTCVKKGIPCEDLQPILREILITQFGAKLRE  516



>ref|WP_015224664.1| assimilatory nitrite reductase (ferredoxin) precursor [Halothece 
sp. PCC 7418]
 ref|YP_007167000.1| assimilatory nitrite reductase (ferredoxin) precursor [Halothece 
sp. PCC 7418]
 gb|AFZ42786.1| assimilatory nitrite reductase (ferredoxin) precursor [Halothece 
sp. PCC 7418]
Length=512

 Score =   165 bits (418),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 115/155 (74%), Gaps = 1/155 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN+I+PD+   ++++ L EPLL K S EP  L + LV+CTG+QFC  A++ETK +AL
Sbjct  357  TVEQNVILPDLAEEHLETFLSEPLLEKFSIEPAPLARSLVSCTGAQFCNFALVETKQQAL  416

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
            +I +++E  + +   VR+HWTGCPN+CGQ QVADIG MG  AR + G+ VE  D+F+GGK
Sbjct  417  EIAQQLEAELNIPNGVRIHWTGCPNSCGQPQVADIGLMGTKAR-KNGEMVEAVDLFMGGK  475

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAV  221
            +G ++ LGE  KKG+PC+DL  ++ E+LV+ FGA 
Sbjct  476  VGKNAKLGERVKKGIPCEDLPQVLREILVDEFGAT  510



>ref|WP_015196742.1| assimilatory nitrite reductase (ferredoxin) precursor [Calothrix 
parietina]
 ref|YP_007136061.1| assimilatory nitrite reductase (ferredoxin) precursor [Calothrix 
sp. PCC 6303]
 gb|AFZ00089.1| assimilatory nitrite reductase (ferredoxin) precursor [Calothrix 
sp. PCC 6303]
Length=515

 Score =   165 bits (417),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 84/155 (54%), Positives = 110/155 (71%), Gaps = 1/155 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN+IIP+I N N+  L  EPLL K    P  LM+ LV+CTG+QFC  A+IETK RAL
Sbjct  359  TVEQNVIIPNISNDNLAILTTEPLLNKFKIVPEPLMRSLVSCTGAQFCNFALIETKNRAL  418

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
            ++ + +E  +    PVR+HWTGCPN+CGQ QVADIG MG   R + GKAVEG D+++GGK
Sbjct  419  ELIKALEAELDFTNPVRIHWTGCPNSCGQPQVADIGLMGTKVR-KNGKAVEGVDIYMGGK  477

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAV  221
            +G ++ LG    KG+ C+DL P++  LL+E FGA 
Sbjct  478  VGKEARLGTCVTKGIACEDLQPVLHNLLIEHFGAT  512



>ref|WP_015166928.1| sulfite reductase subunit beta (hemoprotein) [Synechococcus sp. 
PCC 7502]
 ref|YP_007104404.1| sulfite reductase subunit beta (hemoprotein) [Synechococcus sp. 
PCC 7502]
 gb|AFY72269.1| sulfite reductase, beta subunit (hemoprotein) [Synechococcus 
sp. PCC 7502]
Length=518

 Score =   165 bits (417),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 116/159 (73%), Gaps = 1/159 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQNIIIPD+ +S + +LLKEPLL K S  P  L + LV+CTG QFC  AIIETK R+L
Sbjct  350  TVEQNIIIPDVPDSRIGALLKEPLLQKFSAYPGNLFRALVSCTGIQFCNLAIIETKNRSL  409

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             + E +E  +++ RPVR+HW+GC N+CGQ QV DIGF+GC AR   G  V+  D+++GG+
Sbjct  410  ALVEALESELSLPRPVRIHWSGCANSCGQPQVGDIGFIGCKARKN-GVMVDAVDIYMGGE  468

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQR  209
            +G D+HLGE   + +PC+DL  ++ +LL+E FGAV + R
Sbjct  469  VGKDAHLGECVMEKIPCEDLKDVVQKLLIENFGAVPKSR  507



>ref|WP_015180229.1| precorrin-3B synthase [Microcoleus sp. PCC 7113]
 ref|YP_007119471.1| precorrin-3B synthase [Microcoleus sp. PCC 7113]
 gb|AFZ16065.1| precorrin-3B synthase [Microcoleus sp. PCC 7113]
Length=522

 Score =   165 bits (417),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 117/159 (74%), Gaps = 2/159 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSP-EPPILMKGLVACTGSQFCGQAIIETKARA  509
            TVEQN+IIP+I +S +++ LKEPL+ +  P +P  L + LV+CTG++FCG AIIETK RA
Sbjct  359  TVEQNLIIPNIPDSRLEAFLKEPLVQQRFPIDPKPLQRALVSCTGAEFCGFAIIETKNRA  418

Query  508  LKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGG  329
            L + +E+E  +    PVR+HWTGCPN+CGQ QVADIG MG  AR + G+ VE  D+++GG
Sbjct  419  LAMIQELEAELETPHPVRIHWTGCPNSCGQPQVADIGLMGTKARKD-GQMVEAVDLYMGG  477

Query  328  KIGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQ  212
            K+G D+HLG      +PC+DL P++ +LL+E FGA  RQ
Sbjct  478  KVGKDAHLGSCVMPKIPCEDLKPVLRDLLIEHFGARPRQ  516



>ref|WP_011057189.1| ferredoxin-nitrite reductase [Thermosynechococcus elongatus]
 ref|NP_682139.1| ferredoxin-nitrite reductase [Thermosynechococcus elongatus BP-1]
 dbj|BAC08901.1| ferredoxin--nitrite reductase [Thermosynechococcus elongatus 
BP-1]
Length=519

 Score =   165 bits (417),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 81/161 (50%), Positives = 118/161 (73%), Gaps = 1/161 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN+IIP + ++ + SLL+EPLL+K  PEPP L + LV+CTG++FC  A+IETK RAL
Sbjct  347  TVEQNVIIPHVPDAVLPSLLREPLLSKFRPEPPPLERALVSCTGAEFCNFALIETKNRAL  406

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             +   +++++ + +PVR+HWTGCPN+CGQ QVADIG MG   R   G+ V+  D+++GGK
Sbjct  407  ALARWLDQQLVLPQPVRIHWTGCPNSCGQPQVADIGLMGTKTRRN-GETVDAVDLYMGGK  465

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREE  203
            +G D+ LG   KK +PCD+L  ++ ++L+E+FGA  R  E 
Sbjct  466  VGKDAKLGTCVKKAIPCDELPEVLRQVLIEQFGAQPRGSER  506



>ref|WP_039741277.1| ferredoxin--nitrite reductase [Hassallia byssoidea]
 gb|KIF36286.1| ferredoxin--nitrite reductase [Hassallia byssoidea VB512170]
Length=522

 Score =   165 bits (417),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 112/154 (73%), Gaps = 1/154 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN+IIP+I ++ + + L E LL +   EP  L + LV+CTG+QFC  A+IETK RAL
Sbjct  361  TVEQNVIIPNIADTRLATFLTESLLERFKIEPNTLTRSLVSCTGAQFCNFALIETKNRAL  420

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             + +E+E  +    PVR+HWTGCPN+CGQ QVADIG MG   R + GK +EG D+++GGK
Sbjct  421  AMIKELESELTFTLPVRIHWTGCPNSCGQPQVADIGLMGTKVR-KNGKTLEGVDIYMGGK  479

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGA  224
            +G ++HLG    KG+PC+DL P++ +LL+E FGA
Sbjct  480  VGKEAHLGTCVTKGIPCEDLQPVLRQLLIENFGA  513



>ref|WP_036030858.1| ferredoxin--nitrite reductase [Leptolyngbya sp. PCC 6406]
Length=526

 Score =   164 bits (416),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 84/155 (54%), Positives = 112/155 (72%), Gaps = 1/155 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN+IIP I  S + +LLKEPLL   S EP  L++ LV+CTG+QFC  A++ETK RAL
Sbjct  356  TVEQNVIIPHIPESRMAALLKEPLLETFSIEPSPLVRSLVSCTGAQFCNFALVETKQRAL  415

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             +   +++ + + RPVR+HWTGCPN+CGQ QVADIG MG  AR + GK VEG D+++GGK
Sbjct  416  ALARSLDQTLTLPRPVRIHWTGCPNSCGQPQVADIGLMGTKARKD-GKVVEGVDIYMGGK  474

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAV  221
            +G ++ LG   +K VPCDDL  ++ +LL   FGA 
Sbjct  475  VGKEAQLGTCVQKSVPCDDLFAVLQDLLSTHFGAT  509



>gb|EKD11740.1| nitrite and sulphite reductase 4Fe-4S region [Arthrospira platensis 
C1]
Length=527

 Score =   164 bits (416),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 82/158 (52%), Positives = 112/158 (71%), Gaps = 1/158 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN+IIP I    +++ L EPLL   S  P  L + LV+CTG+ +C  A+IETK RAL
Sbjct  369  TVEQNLIIPYISEDKLEAFLAEPLLEIFSINPAPLTRSLVSCTGNNYCNFALIETKQRAL  428

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
            K+  E++  + +   VR+HWTGCPN+CGQ QVADIGF+G  AR + GK VEG D++ GGK
Sbjct  429  KLARELDEELEISDRVRIHWTGCPNSCGQPQVADIGFIGTKARKD-GKTVEGVDIYTGGK  487

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQ  212
            +G ++ LG   +KGV CDDL P+I +LL+++FGA  +Q
Sbjct  488  VGHEAELGSRLEKGVACDDLKPIIRDLLIQKFGARPKQ  525



>emb|CCQ65638.1| Ferredoxin--nitrite reductase [Crocosphaera watsonii WH 0402]
Length=518

 Score =   164 bits (415),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 115/159 (72%), Gaps = 1/159 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN++I  I   N+++ L+EP+L K S  P  L + LV+CTG+QFC  A++ETK RA+
Sbjct  359  TVEQNVLISHIPQENLETFLEEPILEKFSISPKPLQRALVSCTGAQFCSFALVETKNRAV  418

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             + +E++  + + + VR+HWTGCPN+CGQ QVADIG MG   R + G+ VEG ++++GGK
Sbjct  419  ALAKELDEALEIPQTVRIHWTGCPNSCGQPQVADIGLMGTKVRKD-GQTVEGVNLYMGGK  477

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQR  209
            +G D+HLG   +KG+ CDDL+P++ ++L+E FGA    R
Sbjct  478  VGKDAHLGTCVQKGIACDDLIPVLTDILIENFGANENSR  516



>ref|WP_035758555.1| ferredoxin--nitrite reductase [Arthrospira platensis]
Length=518

 Score =   164 bits (415),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 82/158 (52%), Positives = 112/158 (71%), Gaps = 1/158 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN+IIP I    +++ L EPLL   S  P  L + LV+CTG+ +C  A+IETK RAL
Sbjct  360  TVEQNLIIPYISEDKLEAFLAEPLLEIFSINPAPLTRSLVSCTGNNYCNFALIETKQRAL  419

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
            K+  E++  + +   VR+HWTGCPN+CGQ QVADIGF+G  AR + GK VEG D++ GGK
Sbjct  420  KLARELDEELEISDRVRIHWTGCPNSCGQPQVADIGFIGTKARKD-GKTVEGVDIYTGGK  478

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQ  212
            +G ++ LG   +KGV CDDL P+I +LL+++FGA  +Q
Sbjct  479  VGHEAELGSRLEKGVACDDLKPIIRDLLIQKFGARPKQ  516



>ref|WP_017292467.1| ferredoxin-nitrite reductase [Geminocystis herdmanii]
Length=515

 Score =   164 bits (415),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 78/155 (50%), Positives = 110/155 (71%), Gaps = 1/155 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN IIP + N  V++ L EP+L   S  P  L + L++CTGS++C  A++ETK R L
Sbjct  360  TVEQNFIIPYVPNDKVEAFLAEPILQTYSINPSTLTRSLISCTGSRYCNFALVETKQRGL  419

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
            K+ +E++  + +   VR+HWTGCPN+CGQ Q  DIG MG  A+ + G+ VEG ++FLGGK
Sbjct  420  KLAQELDAELNIPDRVRIHWTGCPNSCGQAQAGDIGIMGTKAKKD-GQVVEGVNLFLGGK  478

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAV  221
            +G D+HLGEV +K +PCDDL  ++ ELL+  FGA+
Sbjct  479  VGKDAHLGEVKQKSIPCDDLKEVLKELLITEFGAI  513



>ref|WP_039730005.1| ferredoxin--nitrite reductase, partial [Lyngbya confervoides]
Length=510

 Score =   164 bits (414),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 83/154 (54%), Positives = 111/154 (72%), Gaps = 1/154 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQNIIIP I ++ +D L+ EPLL K S  P  L++ LV+CTG+QFC  A++ETK RAL
Sbjct  357  TVEQNIIIPYIPDTRLDLLMAEPLLQKFSTSPTPLVRSLVSCTGAQFCNFALVETKQRAL  416

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             I  +++  + + +PVR+HWTGCPN+CGQ QVADIG MG   R + GK  EG D+++GGK
Sbjct  417  AIARQLDATLHLPQPVRIHWTGCPNSCGQPQVADIGLMGTKVRKD-GKPAEGVDIYMGGK  475

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGA  224
            +G D+ LG   +KGVPCD+L  ++  LL E FGA
Sbjct  476  VGKDAQLGTCVQKGVPCDELPAVLTGLLTEHFGA  509



>ref|WP_006669900.1| ferredoxin-nitrite reductase [Arthrospira maxima]
 gb|EDZ93461.1| nitrite and sulphite reductase 4Fe-4S region [Arthrospira maxima 
CS-328]
Length=561

 Score =   164 bits (416),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 82/158 (52%), Positives = 112/158 (71%), Gaps = 1/158 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN+IIP I    +++ L EPLL   S  P  L + LV+CTG+ +C  A+IETK RAL
Sbjct  403  TVEQNLIIPYISEDKLEAFLAEPLLEIFSINPAPLTRSLVSCTGNNYCNFALIETKQRAL  462

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
            K+  E++  + +   VR+HWTGCPN+CGQ QVADIGF+G  AR + GK VEG D++ GGK
Sbjct  463  KLARELDEELEISDRVRIHWTGCPNSCGQPQVADIGFIGTKARKD-GKTVEGVDIYTGGK  521

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQ  212
            +G ++ LG   +KGV CDDL P+I +LL+++FGA  +Q
Sbjct  522  VGHEAELGSRLEKGVACDDLKPIIRDLLIQKFGARPKQ  559



>ref|WP_016948949.1| ferredoxin-nitrite reductase [Anabaena sp. PCC 7108]
Length=520

 Score =   164 bits (415),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 82/158 (52%), Positives = 114/158 (72%), Gaps = 1/158 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQNIIIP+I +S++     E +L K S  P +LM+ LV+CTG+QFC  A+IETK RAL
Sbjct  360  TVEQNIIIPNIPDSSLTPFFTESILEKFSVNPGLLMRSLVSCTGAQFCNFALIETKNRAL  419

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             + + +E  + + RPVR+HWTGCPN+CGQ QVADIG MG   R + GK  EG D+++GG 
Sbjct  420  AMIKSLESELTLSRPVRIHWTGCPNSCGQPQVADIGLMGTKVR-KNGKMSEGVDIYMGGT  478

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQ  212
            +G D+HLG   +K +PC+DL P++ E+L+ +FGA  R+
Sbjct  479  VGKDAHLGTCVQKSIPCEDLQPILREILITQFGAKLRE  516



>ref|WP_017653159.1| ferredoxin-nitrite reductase [Microchaete sp. PCC 7126]
Length=539

 Score =   164 bits (415),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 83/157 (53%), Positives = 113/157 (72%), Gaps = 1/157 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN+IIP + +S + + L EPLL K + +P +L + LV+CTG+QFC  A+IETK RA 
Sbjct  374  TVEQNLIIPHVPDSRLATFLSEPLLEKFAIDPGLLTRSLVSCTGAQFCNFALIETKNRAQ  433

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
            ++ + +E  + +  PVR+HWTGCPN+CGQ QVADIG MG  AR   GKAV+G D+++GGK
Sbjct  434  EMIKALEAELILTHPVRIHWTGCPNSCGQPQVADIGLMGTKARKN-GKAVDGVDIYMGGK  492

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRR  215
            +G D+ LG    KGVPC+DL P++  LL+E F A  R
Sbjct  493  VGKDAQLGTCVTKGVPCEDLQPVLRNLLIEHFQAQPR  529



>ref|WP_017288935.1| hypothetical protein [Leptolyngbya boryana]
 dbj|BAA06530.1| nitrite reductase [Leptolyngbya boryana]
Length=654

 Score =   165 bits (417),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 82/154 (53%), Positives = 117/154 (76%), Gaps = 1/154 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN+IIP++ +S V +LL+EP++ + S EP  L + LV+CTG+QFC  A+IETK RA+
Sbjct  354  TVEQNVIIPNVPDSRVSALLREPIVKRFSIEPQNLSRALVSCTGAQFCNFALIETKNRAV  413

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             + +E+E+ +   RPVR+HWTGCPN+CGQ QVADIG MG   R + GK VEG D+++GGK
Sbjct  414  ALMQELEQDLYCPRPVRIHWTGCPNSCGQPQVADIGLMGTKVRKD-GKTVEGVDLYMGGK  472

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGA  224
            +G  + LG   +K +PC+DL P++ E+L+E+FGA
Sbjct  473  VGKHAELGTCVRKSIPCEDLKPILQEILIEQFGA  506



>ref|WP_016877347.1| ferredoxin-nitrite reductase [Chlorogloeopsis fritschii]
Length=551

 Score =   164 bits (415),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 83/158 (53%), Positives = 113/158 (72%), Gaps = 1/158 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN+IIP+I +S +   L EPLL K S  P  L + LV+CTG+QFC  A+IETK RAL
Sbjct  389  TVEQNVIIPNISDSRLVMFLTEPLLEKFSITPKQLTRSLVSCTGAQFCNFALIETKQRAL  448

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             + +++E  + +  PVR+HWTGCPN+CGQ QVADIG MG   R   GK VEG D+++GGK
Sbjct  449  AMIKDLEAELELTHPVRIHWTGCPNSCGQPQVADIGLMGTKVRKN-GKTVEGVDIYMGGK  507

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQ  212
            +G ++ LG   +KG+PC+DL P++ +LL++ F A  RQ
Sbjct  508  VGKEAQLGTCVQKGIPCEDLQPVLRDLLIQHFAAKPRQ  545



>ref|WP_017304788.1| ferredoxin-nitrite reductase [Spirulina subsalsa]
Length=517

 Score =   163 bits (413),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 116/157 (74%), Gaps = 1/157 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN+I+P +   NV++LL EPLL + +  P  L++ LV+CTG+ +C  A+IETKAR L
Sbjct  360  TVEQNVILPFVAEGNVEALLSEPLLEEFTVSPDPLVRSLVSCTGNHYCNFALIETKARGL  419

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
            K  +++++ + + + VR+HWTGCPN+CGQ QV DIG +G   R + GK VEG D++ GGK
Sbjct  420  KFAQQLDQELNIPQRVRIHWTGCPNSCGQPQVGDIGLLGTKVRKD-GKTVEGVDIYTGGK  478

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRR  215
            +G D+ LG +++KGVPCD+L  ++ E+LV++FGA  +
Sbjct  479  VGKDAKLGNLFRKGVPCDELPEVLREILVDQFGATEK  515



>ref|WP_012599063.1| ferredoxin-nitrite reductase [Cyanothece sp. PCC 7424]
 ref|YP_002376987.1| ferredoxin-nitrite reductase [Cyanothece sp. PCC 7424]
 gb|ACK70119.1| Ferredoxin--nitrite reductase [Cyanothece sp. PCC 7424]
Length=516

 Score =   163 bits (413),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 77/154 (50%), Positives = 117/154 (76%), Gaps = 1/154 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN IIP ++N ++++ L EPLL +    P  L + L++CTG+++C  A+IETK R L
Sbjct  360  TVEQNFIIPFLKNEHLEAFLAEPLLQQFPVNPTPLTRSLISCTGNRYCNFAMIETKHRGL  419

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
            ++ +E++R + + + VR+HWTGCPN+CGQVQ ADIG MG   R + G+AVEG D+++GGK
Sbjct  420  QLAQELDRELEIPQRVRIHWTGCPNSCGQVQAADIGLMGTKTR-KNGEAVEGVDLYMGGK  478

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGA  224
            +G D+ LG++ +KG+PC+DL P++  LL+E+FGA
Sbjct  479  VGKDAKLGDLQQKGIPCEDLKPILRNLLIEQFGA  512



>ref|WP_017310284.1| ferredoxin-nitrite reductase [Fischerella sp. PCC 9339]
Length=572

 Score =   164 bits (415),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 84/158 (53%), Positives = 116/158 (73%), Gaps = 1/158 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            T+EQN+IIP+I +S++   L EPLL K S +P  L + LV+CTG+QFC  A+IETK RA 
Sbjct  410  TLEQNVIIPNIPDSSLVLFLAEPLLEKFSIDPKPLTRSLVSCTGAQFCNFALIETKNRAQ  469

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             + + +E  + + RPVR+HWTGCPN+CGQ QVADIG MG  AR   GKAVEG D+++GGK
Sbjct  470  AVIKALEADLELTRPVRIHWTGCPNSCGQPQVADIGLMGTKARKN-GKAVEGVDIYMGGK  528

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQ  212
            +G  + LG   +KG+PC+DL P++ +LL++ FGA  +Q
Sbjct  529  VGKHAQLGTCIQKGIPCEDLQPVLQDLLIQHFGAKPKQ  566



>ref|WP_008049634.1| ferredoxin-nitrite reductase [Arthrospira sp. PCC 8005]
 emb|CCE15667.1| ferredoxin-nitrite reductase [Arthrospira sp. PCC 8005]
 emb|CDM94270.1| ferredoxin-nitrite reductase [Arthrospira sp. PCC 8005]
Length=517

 Score =   163 bits (413),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 110/154 (71%), Gaps = 1/154 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN+IIP I    +++ L EPLL   S  P  L + LV+CTG+ +C  A+IETK RAL
Sbjct  360  TVEQNLIIPYISEDKLEAFLAEPLLEIFSINPAPLTRSLVSCTGNNYCNFALIETKQRAL  419

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
            K+  E++  + +   VR+HWTGCPN+CGQ QVADIGF+G  AR + GK VEG D++ GGK
Sbjct  420  KLARELDEELEISDRVRIHWTGCPNSCGQPQVADIGFIGTKARKD-GKTVEGVDIYTGGK  478

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGA  224
            +G ++ LG   +KGV CDDL P+I +LL+++FGA
Sbjct  479  VGHEAELGSRLEKGVACDDLKPIIRDLLIQKFGA  512



>ref|WP_006105894.1| ferredoxin-nitrite reductase [Coleofasciculus chthonoplastes]
 gb|EDX71161.1| Nitrite and sulphite reductase 4Fe-4S domain protein [Coleofasciculus 
chthonoplastes PCC 7420]
Length=532

 Score =   163 bits (413),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 80/154 (52%), Positives = 111/154 (72%), Gaps = 1/154 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN+IIP I N  +++ L EPLL +    P  L + LV+CTG+++C  AIIETK RAL
Sbjct  361  TVEQNLIIPYIANDKIEAFLSEPLLQQFPIHPSTLTRSLVSCTGNRYCNFAIIETKQRAL  420

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
            K+ +E+++ + +   VR+HWTGCPN+CGQ QVADIG MG   R + GK VEG +++ GGK
Sbjct  421  KLAQELDQELDIPERVRIHWTGCPNSCGQPQVADIGLMGTKVRKD-GKPVEGVNLYTGGK  479

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGA  224
            +G D+ LG+V +KG+ CDDL P++  LL+E F A
Sbjct  480  VGKDAQLGDVLEKGIACDDLKPILRNLLIENFDA  513



>ref|WP_006275773.1| ferredoxin-nitrite reductase [Cylindrospermopsis raciborskii]
 gb|EFA71193.1| Nitrite/sulfite reductase, hemoprotein beta- component, ferrodoxin 
[Cylindrospermopsis raciborskii CS-505]
Length=545

 Score =   163 bits (412),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 120/159 (75%), Gaps = 1/159 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN IIP+I +S +++LL EP+L K S  P +LM+ +++CTG+QFC  A+IETK RA+
Sbjct  374  TVEQNAIIPNIHDSALNTLLTEPILKKFSVSPGLLMRSVISCTGAQFCNFALIETKKRAI  433

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             +TE +E  + + +PVR+HWTGCPN+CGQ QVADIG MG   R + G+ +EG D+++GGK
Sbjct  434  AMTEALEEELILSKPVRIHWTGCPNSCGQPQVADIGLMGTKVR-KNGQTLEGVDIYMGGK  492

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQR  209
            +G D+ LG   +K V C+DL P++ ++L+++FGA  R++
Sbjct  493  VGKDARLGTCIQKSVACEDLQPILKDILLKQFGAKVREQ  531



>ref|WP_007305636.1| ferredoxin-nitrite reductase [Crocosphaera watsonii]
 gb|EAM50680.1| Nitrite/sulfite reductase, hemoprotein beta-component, ferrodoxin-like:Nitrite 
and sulphite reductase 4Fe-4S region [Crocosphaera 
watsonii WH 8501]
Length=516

 Score =   163 bits (412),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 115/157 (73%), Gaps = 1/157 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN++I  I   N+++ L+EP+L K S  P  L + LV+CTG+QFC  A++ETK RA+
Sbjct  359  TVEQNVLISHIPQENLETFLEEPILEKFSISPKPLQRALVSCTGAQFCSFALVETKNRAV  418

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             + +E++  + + + VR+HWTGCPN+CGQ QVADIG MG   R + G+ VEG ++++GGK
Sbjct  419  ALAKELDEALEIPKTVRIHWTGCPNSCGQPQVADIGLMGTKVRKD-GQTVEGVNLYMGGK  477

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRR  215
            +G D+HLG   +K + CDDL+P++ ++L+E FGA R+
Sbjct  478  VGKDAHLGTCVQKRIACDDLIPVLTDILIENFGAKRK  514



>ref|WP_019498141.1| hypothetical protein [Pseudanabaena sp. PCC 6802]
Length=524

 Score =   162 bits (411),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 83/158 (53%), Positives = 116/158 (73%), Gaps = 1/158 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN+IIP I ++ +D+ L EPLL K S  P  L + LV+CTG+QFC  AIIETK RAL
Sbjct  352  TVEQNLIIPYIPDAKLDAFLSEPLLQKFSVAPTNLRRSLVSCTGNQFCPVAIIETKNRAL  411

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
            ++ E++E  + V + VR+HW+GCPN+CGQ QVADIGF GC  + + GK V+G D+++GGK
Sbjct  412  ELIEQLEADLNVPKSVRIHWSGCPNSCGQPQVADIGFSGCKTKKD-GKVVDGVDIYMGGK  470

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQ  212
            +G  +HLGE   + VPC+DL  ++ +LL++ FGA  +Q
Sbjct  471  VGKGAHLGECVMEKVPCEDLREVVGKLLIDNFGASPKQ  508



>ref|WP_007355409.1| MULTISPECIES: ferredoxin-nitrite reductase [Kamptonema]
 emb|CBN56197.1| ferredoxin-nitrite reductase [ [[Oscillatoria] sp. PCC 6506]
Length=517

 Score =   162 bits (411),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 79/154 (51%), Positives = 115/154 (75%), Gaps = 1/154 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN I+P++ +S +++ L+EPLL + S  P  L + LV+CTG+QFC  A+IETK RAL
Sbjct  355  TVEQNAIVPNVPDSRLETFLQEPLLQRFSVNPDPLTRALVSCTGAQFCNFALIETKNRAL  414

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             + +E+E  ++  +PVR+HWTGCPN+CGQ QVADIG +G   R + GK +EG D+++GG 
Sbjct  415  AMIKELEAELSFPKPVRIHWTGCPNSCGQPQVADIGLLGTKVR-KNGKTLEGVDLYMGGT  473

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGA  224
            +G D+HLG   +KG+PC+DL P++ +LL+E F A
Sbjct  474  VGKDAHLGSCVQKGIPCEDLKPVLRQLLIEHFNA  507



>ref|WP_014275660.1| ferredoxin--nitrite reductase [Arthrospira platensis]
 ref|YP_005069482.1| ferredoxin--nitrite reductase [Arthrospira platensis NIES-39]
 dbj|BAI90944.1| ferredoxin--nitrite reductase [Arthrospira platensis NIES-39]
Length=518

 Score =   162 bits (411),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 81/158 (51%), Positives = 111/158 (70%), Gaps = 1/158 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN+IIP I    +++ L EPLL   S  P  L + LV+CTG+ +C  A+IETK RAL
Sbjct  360  TVEQNLIIPYISEDKLEAFLAEPLLEVFSINPAPLTRSLVSCTGNNYCNFALIETKQRAL  419

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
            K+  E++  + +   VR+HWTGCPN+CGQ QVADIGF+G  AR + GK VE  D++ GGK
Sbjct  420  KLARELDEELEISDRVRIHWTGCPNSCGQPQVADIGFIGTKARKD-GKTVEAVDIYTGGK  478

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQ  212
            +G ++ LG   +KGV CDDL P+I +LL+++FGA  +Q
Sbjct  479  VGHEAELGSRIEKGVACDDLKPIIRDLLIQKFGARPKQ  516



>ref|WP_006617804.1| ferredoxin-nitrite reductase [Arthrospira platensis]
 gb|KDR55989.1| ferredoxin--nitrite reductase [Arthrospira platensis str. Paraca]
Length=518

 Score =   162 bits (411),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 81/158 (51%), Positives = 111/158 (70%), Gaps = 1/158 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN+IIP I    +++ L EPLL   S  P  L + LV+CTG+ +C  A+IETK RAL
Sbjct  360  TVEQNLIIPYISEDKLEAFLAEPLLEVFSINPAPLTRSLVSCTGNNYCNFALIETKQRAL  419

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
            K+  E++  + +   VR+HWTGCPN+CGQ QVADIGF+G  AR + GK VE  D++ GGK
Sbjct  420  KLARELDEELEISDRVRIHWTGCPNSCGQPQVADIGFIGTKARKD-GKTVEAVDIYTGGK  478

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQ  212
            +G ++ LG   +KGV CDDL P+I +LL+++FGA  +Q
Sbjct  479  VGHEAELGSRIEKGVACDDLKPIIRDLLIQKFGARPKQ  516



>ref|WP_035155292.1| ferredoxin--nitrite reductase [Calothrix sp. 336/3]
 gb|KFB84761.1| ferredoxin--nitrite reductase [Calothrix sp. 336/3]
Length=516

 Score =   162 bits (411),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 83/158 (53%), Positives = 112/158 (71%), Gaps = 1/158 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN+IIP+I +S +D  L EPLL K S     L + LV+CTG+QFC  A+IETK RA+
Sbjct  360  TVEQNVIIPNIPDSRLDIFLTEPLLNKFSVNGTGLTRSLVSCTGAQFCNFALIETKNRAI  419

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
               + +E  + +  PVR+HWTGCPN+CGQ QVADIG MG   R + GK VEG D+++GGK
Sbjct  420  ATIQTLEAELDITNPVRIHWTGCPNSCGQPQVADIGLMGTKTRKD-GKVVEGVDIYMGGK  478

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQ  212
            +G ++ LG   KKG+PCDDL  ++ +LL++ FGA  +Q
Sbjct  479  VGKEAKLGTCVKKGIPCDDLPSVLKDLLIQNFGAKPKQ  516



>ref|WP_009626422.1| assimilatory nitrite reductase (ferredoxin) precursor [Pseudanabaena 
biceps]
 gb|ELS33455.1| assimilatory nitrite reductase (ferredoxin) precursor [Pseudanabaena 
biceps PCC 7429]
Length=519

 Score =   162 bits (411),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 112/159 (70%), Gaps = 1/159 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN++I  + +  V  LL+EP+L K   EP  LM+GLV+CTG+QFC  AI+ETK R+L
Sbjct  349  TVEQNLLITHVSDRQVPLLLQEPILQKFPAEPNNLMRGLVSCTGNQFCPVAIVETKNRSL  408

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             +T ++     + + VR+HW+GCPN+C Q QVADIGF GC  R   GK V+G D+++GGK
Sbjct  409  ALTHQLAEDYDLPKVVRIHWSGCPNSCAQPQVADIGFTGCKTRKN-GKVVDGVDIYMGGK  467

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQR  209
            +G D+HLG    + VPC+DL  ++ +LL+E FGA  +Q+
Sbjct  468  VGKDAHLGTCVMEKVPCEDLREVVGKLLMENFGATPKQQ  506



>ref|WP_021834814.1| Ferredoxin--nitrite reductase [Crocosphaera watsonii]
 emb|CCQ60545.1| Ferredoxin--nitrite reductase [Crocosphaera watsonii WH 0401]
Length=516

 Score =   162 bits (410),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 115/157 (73%), Gaps = 1/157 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN++I  I   N+++ L+E +L K S  P  L + LV+CTG+QFC  A++ETK RA+
Sbjct  359  TVEQNVLISHIPQENLETFLEETILEKFSISPKPLQRALVSCTGAQFCSFALVETKNRAV  418

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             + +E++  + + + VR+HWTGCPN+CGQ QVADIG MG   R + G+ VEG ++++GGK
Sbjct  419  ALAKELDEALEIPKTVRIHWTGCPNSCGQPQVADIGLMGTKVRKD-GQTVEGVNLYMGGK  477

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRR  215
            +G D+HLG   +KG+ CDDL+P++ ++L+E FGA R+
Sbjct  478  VGKDAHLGTCVQKGIACDDLIPVLTDILIENFGAKRK  514



>ref|WP_008189055.1| ferredoxin-nitrite reductase [Moorea producens]
 gb|EGJ29689.1| assimilatory nitrite reductase/ferredoxin precursor [Moorea producens 
3L]
Length=533

 Score =   162 bits (410),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 114/154 (74%), Gaps = 1/154 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN+IIP+I ++N+D+ L EPLL K + EP  L + LV+CTG+QFC  A+IETK RAL
Sbjct  378  TVEQNVIIPNIPDANLDAFLAEPLLQKFTLEPKPLERLLVSCTGAQFCNFALIETKNRAL  437

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             I  E+E ++ +  PVR+HWTGCPN+CGQ QVADIG MG   R + GK+VEG ++++GGK
Sbjct  438  GIVRELEEKLDIPNPVRIHWTGCPNSCGQPQVADIGLMGTKVRKD-GKSVEGVNIYMGGK  496

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGA  224
            +G D+ LGE   K V CDDL  ++  +L+E FGA
Sbjct  497  VGKDAKLGECVLKSVACDDLPEVLGNILIENFGA  530



>ref|WP_017321046.1| ferredoxin-nitrite reductase [cyanobacterium PCC 7702]
Length=526

 Score =   162 bits (410),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 82/158 (52%), Positives = 111/158 (70%), Gaps = 1/158 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN+IIP+I +S +   L EPLL K S  P  L + L++CTG+QFC  A+IETK RAL
Sbjct  364  TVEQNVIIPNIPDSRLVLFLTEPLLEKFSISPKPLTRSLISCTGAQFCNFALIETKQRAL  423

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
               + +E  + V + VR+HWTGCPN+CGQ QVADIG MG   R   GK VEG D+++GGK
Sbjct  424  ATIQALETELEVTQKVRIHWTGCPNSCGQPQVADIGLMGTKVRKN-GKTVEGVDIYMGGK  482

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQ  212
            +G D+ LG   +KG+PC+DL P++ +LL++ F A  +Q
Sbjct  483  VGKDARLGTCIQKGIPCEDLQPVLRDLLIQHFQAKPKQ  520



>gb|AAT99257.1| nitrite reductase [Pseudochlorella pringsheimii]
Length=647

 Score =   162 bits (411),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 90/164 (55%), Positives = 115/164 (70%), Gaps = 6/164 (4%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVE NI+ P I  S ++ L KEPL  K S EP  L +GLV+CTG+QFCG AIIETK RA+
Sbjct  465  TVECNILFPFIPESKLEDLKKEPLFQKFSLEPKPLTRGLVSCTGAQFCGVAIIETKQRAM  524

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             I  ++E  + + + VRMHWTGCPN+CGQVQVADIG MG  AR+E GKAVEG  +F GGK
Sbjct  525  AIAAKLENELDIPQTVRMHWTGCPNSCGQVQVADIGLMGGPARHE-GKAVEGVRIFTGGK  583

Query  325  IGSDSHLGEVYKKGVPCDD--LVPLIVELLVERFGAVRRQREED  200
            +G  + LG   +KGV C+D  L+P + E+ + ++G   R REED
Sbjct  584  VGEGASLGAEIEKGVACNDEVLLPKLREIXINQYG---RHREED  624



>ref|WP_035994508.1| ferredoxin--nitrite reductase [Leptolyngbya sp. KIOST-1]
Length=531

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 114/154 (74%), Gaps = 1/154 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN+IIP++ +S +  LL+EPLL + S  P  L + LV+CTG+QFC  A++ETK RAL
Sbjct  361  TVEQNVIIPNVPDSRLAVLLQEPLLERFSIAPSALTRSLVSCTGAQFCNFALVETKQRAL  420

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             +   ++  + + +PVR+HWTGCPN+CGQ QVADIG MG   R + GK VEG D+F+GGK
Sbjct  421  ALAHALDAELTLTQPVRIHWTGCPNSCGQPQVADIGLMGTKVRKD-GKTVEGVDIFMGGK  479

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGA  224
            +G ++HLGE  ++GVPCD+L  ++  LL++ FGA
Sbjct  480  VGKEAHLGEKVQQGVPCDELHGVLRSLLIDNFGA  513



>ref|WP_015165563.1| assimilatory nitrite reductase (ferredoxin) precursor [Pseudanabaena 
sp. PCC 7367]
 ref|YP_007103035.1| assimilatory nitrite reductase (ferredoxin) precursor [Pseudanabaena 
sp. PCC 7367]
 gb|AFY70607.1| assimilatory nitrite reductase (ferredoxin) precursor [Pseudanabaena 
sp. PCC 7367]
Length=515

 Score =   161 bits (407),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 80/154 (52%), Positives = 114/154 (74%), Gaps = 1/154 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN+IIPD+ +S +++LL EPLL + S +P  L + LV+CTGSQFC  A++ETK RAL
Sbjct  358  TVEQNVIIPDVPDSRLEALLTEPLLDQFSIDPTPLTRALVSCTGSQFCNFALVETKQRAL  417

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             I +E+++ + + +P+R+HWTGCPN+CGQ QVADIG MG   R + GK  EG D+++GGK
Sbjct  418  AIAQELDQELELAKPIRIHWTGCPNSCGQPQVADIGLMGTKVRKD-GKITEGVDIYMGGK  476

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGA  224
            +G D+ LGE   KG+ CDDL  ++ +L+ + F A
Sbjct  477  VGKDAVLGERTMKGIACDDLKDVLKDLMKQHFNA  510



>ref|WP_015204592.1| assimilatory nitrite reductase (ferredoxin) precursor [Crinalium 
epipsammum]
 ref|YP_007143999.1| assimilatory nitrite reductase (ferredoxin) precursor [Crinalium 
epipsammum PCC 9333]
 gb|AFZ14489.1| assimilatory nitrite reductase (ferredoxin) precursor [Crinalium 
epipsammum PCC 9333]
Length=658

 Score =   162 bits (409),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 80/161 (50%), Positives = 113/161 (70%), Gaps = 1/161 (1%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN+IIP+I +S + SLLKEPLL +    P  L + L++CTG++FC  A++ETK RAL
Sbjct  361  TVEQNVIIPNIPDSRIASLLKEPLLQRFKVNPETLERSLISCTGAEFCNFALVETKNRAL  420

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
             + +E++  ++V   VR+HWTGCPN+C Q QVADIG MG   R   GK +EG D++LGGK
Sbjct  421  ALIKELDAELSVPSSVRLHWTGCPNSCAQPQVADIGLMGTKVRKN-GKTLEGVDIYLGGK  479

Query  325  IGSDSHLGEVYKKGVPCDDLVPLIVELLVERFGAVRRQREE  203
            +G D+HLG    K +PC+DL  ++ +LL++ FGA  +   E
Sbjct  480  VGKDAHLGTCAIKSIPCEDLKQVLRDLLIKDFGAQLKSEAE  520



>gb|AAP79144.1| ferredoxin nitrite reductase [Bigelowiella natans]
Length=647

 Score =   162 bits (409),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 92/173 (53%), Positives = 121/173 (70%), Gaps = 17/173 (10%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLT-------KLSPEPPILMKGLVACTGSQFCGQAII  527
            TVEQN+I P++ N+ V  LL+EPL         K   + P L +GLV+CTGSQFCG A+I
Sbjct  476  TVEQNVIFPNVNNTKVSELLQEPLFNIGHYFIPKTDKDFP-LSRGLVSCTGSQFCGVALI  534

Query  526  ETKARALKITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEA---GK--  362
            ETK RA+++++ +E  + V  PVR+HWTGCPN+CGQ QVADIG MG  AR E    GK  
Sbjct  535  ETKNRAIELSKRLEEELKVDMPVRIHWTGCPNSCGQAQVADIGLMGGPARVEKEIDGKVK  594

Query  361  --AVEGADVFLGGKIGSDSHLGEVYKKGVPCD--DLVPLIVELLVERFGAVRR  215
              AVEG ++FLGGK+G D  LGEVYKKGVP D   L+P++ ++L E+FGA+ +
Sbjct  595  KVAVEGVNIFLGGKVGEDPFLGEVYKKGVPADYKYLIPIMKDILKEKFGAMEK  647



>ref|XP_005714928.1| unnamed protein product [Chondrus crispus]
 emb|CDF35109.1| unnamed protein product [Chondrus crispus]
Length=587

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 116/161 (72%), Gaps = 4/161 (2%)
 Frame = -2

Query  685  TVEQNIIIPDIQNSNVDSLLKEPLLTKLSPEPPILMKGLVACTGSQFCGQAIIETKARAL  506
            TVEQN++ P+++N  V  LL E ++ K   E   +  GLV+CTG+QFCG AIIETK RA+
Sbjct  428  TVEQNVLFPNVKNEEVAGLLGEEIMGKFKTERKGVSAGLVSCTGAQFCGLAIIETKNRAI  487

Query  505  KITeeverrvavrrpvRMHWTGCPNTCGQVQVADIGFMGCLARNEAGKAVEGADVFLGGK  326
            ++   ++  V + R VRMHWTGCPN+CGQ QVADIG MG  AR + GK VEG  +FLGG+
Sbjct  488  EVARRLDEEVELDREVRMHWTGCPNSCGQAQVADIGLMGGAARKD-GKGVEGVKMFLGGR  546

Query  325  IGSDSHLGEVY-KKGVPC--DDLVPLIVELLVERFGAVRRQ  212
            IG D+HLG++  KK +P   DDLVP++ ++L+++FGA  R+
Sbjct  547  IGEDAHLGDLKDKKAIPADIDDLVPVLKDVLIKQFGAKERK  587



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1042394327856