BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c104960_g1_i1 len=539 path=[1:0-538]

Length=539
                                                                      Score     E

ref|XP_009618049.1|  PREDICTED: uncharacterized protein LOC104110...    215   5e-64   
ref|XP_009788849.1|  PREDICTED: uncharacterized protein LOC104236593    214   1e-63   
ref|XP_006358420.1|  PREDICTED: uncharacterized protein LOC102598550    213   3e-63   
ref|XP_010326639.1|  PREDICTED: uncharacterized protein LOC101265...    210   8e-63   
ref|XP_010326638.1|  PREDICTED: uncharacterized protein LOC101265...    210   4e-62   
ref|XP_009618051.1|  PREDICTED: uncharacterized protein LOC104110...    200   4e-59   
ref|XP_007050186.1|  Uncharacterized protein isoform 2                  197   3e-57   
ref|XP_007050185.1|  Uncharacterized protein isoform 1                  199   5e-57   
ref|XP_008235767.1|  PREDICTED: uncharacterized protein LOC103334571    187   1e-53   
ref|XP_008372590.1|  PREDICTED: uncharacterized protein LOC103435935    186   4e-53   
ref|XP_009370350.1|  PREDICTED: uncharacterized protein LOC103959710    185   5e-53   
ref|XP_007199478.1|  hypothetical protein PRUPE_ppa027210mg             185   1e-52   
ref|XP_011080106.1|  PREDICTED: uncharacterized protein LOC105163...    182   4e-52   
ref|XP_011080102.1|  PREDICTED: uncharacterized protein LOC105163...    182   1e-51   
ref|XP_002526556.1|  hypothetical protein RCOM_0542810                  181   2e-51   Ricinus communis
ref|XP_002321291.1|  hypothetical protein POPTR_0014s18810g             179   9e-51   Populus trichocarpa [western balsam poplar]
ref|XP_011011167.1|  PREDICTED: uncharacterized protein LOC105115...    178   1e-50   
gb|KDP26480.1|  hypothetical protein JCGZ_17638                         178   1e-50   
emb|CAN69928.1|  hypothetical protein VITISV_018024                     176   2e-50   Vitis vinifera
ref|XP_011011166.1|  PREDICTED: uncharacterized protein LOC105115...    178   2e-50   
ref|XP_011011164.1|  PREDICTED: uncharacterized protein LOC105115...    178   3e-50   
ref|XP_011011163.1|  PREDICTED: uncharacterized protein LOC105115...    178   3e-50   
emb|CDP03786.1|  unnamed protein product                                177   3e-50   
ref|XP_011011161.1|  PREDICTED: uncharacterized protein LOC105115...    178   7e-50   
ref|XP_011011162.1|  PREDICTED: uncharacterized protein LOC105115...    178   7e-50   
ref|XP_002270391.2|  PREDICTED: uncharacterized protein LOC100260103    176   2e-49   Vitis vinifera
emb|CBI37174.3|  unnamed protein product                                176   6e-49   
ref|XP_010091792.1|  hypothetical protein L484_015860                   174   2e-48   
ref|XP_010264905.1|  PREDICTED: uncharacterized protein LOC104602...    170   3e-47   
ref|XP_010264903.1|  PREDICTED: uncharacterized protein LOC104602...    170   3e-47   
ref|XP_010264904.1|  PREDICTED: uncharacterized protein LOC104602...    170   3e-47   
ref|XP_010264902.1|  PREDICTED: uncharacterized protein LOC104602...    171   5e-47   
ref|XP_010264901.1|  PREDICTED: uncharacterized protein LOC104602...    170   2e-46   
ref|XP_010936029.1|  PREDICTED: uncharacterized protein LOC105055758    169   3e-46   
ref|XP_006479460.1|  PREDICTED: uncharacterized protein LOC102618...    166   6e-46   
ref|XP_006857496.1|  hypothetical protein AMTR_s00067p00206040          167   1e-45   
ref|XP_010048076.1|  PREDICTED: uncharacterized protein LOC104436915    167   1e-45   
ref|XP_006443752.1|  hypothetical protein CICLE_v10020041mg             166   2e-45   
ref|XP_006443753.1|  hypothetical protein CICLE_v10020041mg             166   2e-45   
ref|XP_008796370.1|  PREDICTED: uncharacterized protein LOC103711...    164   1e-44   
ref|XP_008796367.1|  PREDICTED: uncharacterized protein LOC103711...    164   1e-44   
ref|XP_008796369.1|  PREDICTED: uncharacterized protein LOC103711...    164   2e-44   
ref|XP_008796366.1|  PREDICTED: uncharacterized protein LOC103711...    164   3e-44   
gb|EYU46407.1|  hypothetical protein MIMGU_mgv1a017685mg                161   1e-43   
ref|XP_010522550.1|  PREDICTED: uncharacterized protein LOC104801132    154   2e-41   
emb|CDY13133.1|  BnaA09g16840D                                          145   4e-38   
ref|XP_010494400.1|  PREDICTED: uncharacterized protein LOC104771558    145   4e-38   
ref|XP_010481787.1|  PREDICTED: uncharacterized protein LOC104760...    145   6e-38   
emb|CDY36965.1|  BnaC09g17810D                                          144   7e-38   
ref|XP_009113957.1|  PREDICTED: uncharacterized protein LOC103839...    143   2e-37   
ref|XP_010441939.1|  PREDICTED: uncharacterized protein LOC104725040    141   1e-36   
gb|KFK31671.1|  hypothetical protein AALP_AA6G143800                    138   3e-35   
ref|XP_009113956.1|  PREDICTED: uncharacterized protein LOC103839...    137   6e-35   
ref|XP_009385583.1|  PREDICTED: uncharacterized protein LOC103972...    131   9e-33   
ref|XP_006648095.1|  PREDICTED: uncharacterized protein LOC102713...    126   6e-31   
ref|NP_001048494.1|  Os02g0814600                                       126   7e-31   Oryza sativa Japonica Group [Japonica rice]
gb|EEC74229.1|  hypothetical protein OsI_09416                          126   3e-30   Oryza sativa Indica Group [Indian rice]
ref|XP_010235955.1|  PREDICTED: uncharacterized protein LOC100826...    120   7e-29   
ref|XP_003570377.1|  PREDICTED: uncharacterized protein LOC100826...    120   9e-29   
dbj|BAD21667.1|  unknown protein                                        119   3e-28   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004954345.1|  PREDICTED: uncharacterized protein LOC101763...    117   1e-27   
ref|XP_004954344.1|  PREDICTED: uncharacterized protein LOC101763...    117   1e-27   
gb|EEE58033.1|  hypothetical protein OsJ_08851                          119   1e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004954343.1|  PREDICTED: uncharacterized protein LOC101763...    117   1e-27   
ref|XP_009385584.1|  PREDICTED: uncharacterized protein LOC103972...    115   4e-27   
ref|XP_002454769.1|  hypothetical protein SORBIDRAFT_04g036960          114   1e-26   Sorghum bicolor [broomcorn]
ref|NP_001143738.1|  uncharacterized protein LOC100276492               112   4e-26   Zea mays [maize]
ref|XP_008676964.1|  PREDICTED: uncharacterized protein LOC100276...    112   4e-26   
ref|XP_008676965.1|  PREDICTED: uncharacterized protein LOC100276...    112   4e-26   
gb|EMT07674.1|  hypothetical protein F775_00616                         107   1e-23   
ref|XP_010481788.1|  PREDICTED: uncharacterized protein LOC104760...    100   6e-22   
ref|XP_011011165.1|  PREDICTED: uncharacterized protein LOC105115...    100   9e-22   
ref|XP_009385585.1|  PREDICTED: uncharacterized protein LOC103972...  93.2    5e-19   
ref|XP_002967378.1|  hypothetical protein SELMODRAFT_408361           90.5    4e-18   
ref|XP_008356245.1|  PREDICTED: uncharacterized protein LOC103419940  85.1    2e-16   
ref|XP_008796368.1|  PREDICTED: uncharacterized protein LOC103711...  85.5    4e-16   
dbj|BAB09061.1|  unnamed protein product                              79.3    2e-14   Arabidopsis thaliana [mouse-ear cress]
ref|NP_199214.2|  uncharacterized protein                             79.3    2e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002863617.1|  hypothetical protein ARALYDRAFT_494595           77.0    1e-13   
ref|XP_006403151.1|  hypothetical protein EUTSA_v10003421mg           75.9    3e-13   
ref|XP_006281685.1|  hypothetical protein CARUB_v10027833mg           74.3    1e-12   
gb|KCW88994.1|  hypothetical protein EUGRSUZ_A013212                  64.7    3e-09   
gb|KCW88995.1|  hypothetical protein EUGRSUZ_A013212                  64.3    4e-09   
gb|KCW88992.1|  hypothetical protein EUGRSUZ_A013212                  64.3    5e-09   
gb|AFW74003.1|  hypothetical protein ZEAMMB73_556482                  56.6    9e-08   
ref|XP_008796372.1|  PREDICTED: uncharacterized protein LOC103711...  53.1    3e-05   



>ref|XP_009618049.1| PREDICTED: uncharacterized protein LOC104110292 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009618050.1| PREDICTED: uncharacterized protein LOC104110292 isoform X1 [Nicotiana 
tomentosiformis]
Length=468

 Score =   215 bits (548),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 104/163 (64%), Positives = 126/163 (77%), Gaps = 0/163 (0%)
 Frame = +1

Query  43   MAGWNYPEISLEDLLKAIKGFIDMLILASGYQSSGRLARWDSGNIKRALQWALFLEDVIG  222
            MAGW+YP++SLEDLLKA+KGFI+M+ LASGYQSSGR+A WDS NI +ALQWALFL+DV+ 
Sbjct  1    MAGWSYPDLSLEDLLKAVKGFIEMVNLASGYQSSGRIAHWDSLNINKALQWALFLQDVMR  60

Query  223  SLNSQDEYRDSLEELDVALCEMISMPYFPKGLEHLSSKTLSNARNLMLEHLTHTLPLRDL  402
             L+S D+YRDSLEELD ALCEM S P FP+GL H+SSK LS A + MLEHL    PLRD 
Sbjct  61   DLSSSDDYRDSLEELDAALCEMASNPSFPQGLAHISSKFLSKATDFMLEHLISAFPLRDG  120

Query  403  HLRALVTATVEMDFHMLPNADSDCLDKHFEELMHSESKKPAFN  531
            HL+AL+ A VEMD+ M   AD   L+ +FE LM + S+ P  N
Sbjct  121  HLKALLIANVEMDYQMHQKADGRSLNGYFETLMCNTSRNPVTN  163



>ref|XP_009788849.1| PREDICTED: uncharacterized protein LOC104236593 [Nicotiana sylvestris]
Length=468

 Score =   214 bits (545),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 103/163 (63%), Positives = 126/163 (77%), Gaps = 0/163 (0%)
 Frame = +1

Query  43   MAGWNYPEISLEDLLKAIKGFIDMLILASGYQSSGRLARWDSGNIKRALQWALFLEDVIG  222
            MAGW+YP++SLEDLLKA+KGFI+M+ LAS YQSSGR+A WDS NI +ALQWALFL+DV+ 
Sbjct  1    MAGWSYPDLSLEDLLKAVKGFIEMVNLASRYQSSGRIAHWDSLNINKALQWALFLQDVMR  60

Query  223  SLNSQDEYRDSLEELDVALCEMISMPYFPKGLEHLSSKTLSNARNLMLEHLTHTLPLRDL  402
             L+S D+YRDSLEELD ALCEM S P FP+G+ H+SSK LS AR+ MLEHL    PLRD 
Sbjct  61   DLSSSDDYRDSLEELDTALCEMASHPSFPQGIAHVSSKVLSKARDFMLEHLISAFPLRDG  120

Query  403  HLRALVTATVEMDFHMLPNADSDCLDKHFEELMHSESKKPAFN  531
            HL+AL+TA VEMD+HM    D   L+ +FE LM + S+    N
Sbjct  121  HLKALLTANVEMDYHMHQKTDGRSLNGYFETLMCNTSRNDFIN  163



>ref|XP_006358420.1| PREDICTED: uncharacterized protein LOC102598550 [Solanum tuberosum]
Length=463

 Score =   213 bits (542),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 105/163 (64%), Positives = 124/163 (76%), Gaps = 0/163 (0%)
 Frame = +1

Query  43   MAGWNYPEISLEDLLKAIKGFIDMLILASGYQSSGRLARWDSGNIKRALQWALFLEDVIG  222
            MA W+YP+ SLEDLLK +KGFIDM+ILASGYQSSGRLA WDS NIK ALQWALFL+DV+ 
Sbjct  1    MANWSYPDASLEDLLKMVKGFIDMVILASGYQSSGRLAHWDSHNIKNALQWALFLQDVMR  60

Query  223  SLNSQDEYRDSLEELDVALCEMISMPYFPKGLEHLSSKTLSNARNLMLEHLTHTLPLRDL  402
             L+S ++Y+DSLEELD ALCE+ S PYFP+GL H+SSK LS A   MLEHL    PLRD 
Sbjct  61   DLSSSEDYKDSLEELDAALCEINSNPYFPQGLAHISSKVLSKASEFMLEHLISVFPLRDE  120

Query  403  HLRALVTATVEMDFHMLPNADSDCLDKHFEELMHSESKKPAFN  531
            HL+AL+ A+VEMD+HM    DS  L+  FE LM + SK    N
Sbjct  121  HLKALLNASVEMDYHMHQKTDSRSLNDIFETLMCNTSKNAIPN  163



>ref|XP_010326639.1| PREDICTED: uncharacterized protein LOC101265770 isoform X2 [Solanum 
lycopersicum]
Length=399

 Score =   210 bits (535),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 103/163 (63%), Positives = 124/163 (76%), Gaps = 0/163 (0%)
 Frame = +1

Query  43   MAGWNYPEISLEDLLKAIKGFIDMLILASGYQSSGRLARWDSGNIKRALQWALFLEDVIG  222
            MAGW+YP+ SLEDL+K +KGFIDM IL+SGYQSSGRLA WDS NIK ALQWALFL++V+ 
Sbjct  1    MAGWSYPDASLEDLVKMVKGFIDMAILSSGYQSSGRLAHWDSHNIKNALQWALFLQNVMR  60

Query  223  SLNSQDEYRDSLEELDVALCEMISMPYFPKGLEHLSSKTLSNARNLMLEHLTHTLPLRDL  402
             L+S D+Y++SLEELD ALCE+ S PY P+GL H+SSK LS A   MLEHL    PLRD 
Sbjct  61   DLSSSDDYKNSLEELDAALCEINSNPYLPQGLAHISSKELSKASEFMLEHLISVFPLRDE  120

Query  403  HLRALVTATVEMDFHMLPNADSDCLDKHFEELMHSESKKPAFN  531
            HL+AL+ A+VEMD+HM   ADS  ++  FE LM S SK    N
Sbjct  121  HLKALLNASVEMDYHMHQKADSRSINDIFENLMCSTSKNAIPN  163



>ref|XP_010326638.1| PREDICTED: uncharacterized protein LOC101265770 isoform X1 [Solanum 
lycopersicum]
Length=459

 Score =   210 bits (534),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 103/163 (63%), Positives = 124/163 (76%), Gaps = 0/163 (0%)
 Frame = +1

Query  43   MAGWNYPEISLEDLLKAIKGFIDMLILASGYQSSGRLARWDSGNIKRALQWALFLEDVIG  222
            MAGW+YP+ SLEDL+K +KGFIDM IL+SGYQSSGRLA WDS NIK ALQWALFL++V+ 
Sbjct  1    MAGWSYPDASLEDLVKMVKGFIDMAILSSGYQSSGRLAHWDSHNIKNALQWALFLQNVMR  60

Query  223  SLNSQDEYRDSLEELDVALCEMISMPYFPKGLEHLSSKTLSNARNLMLEHLTHTLPLRDL  402
             L+S D+Y++SLEELD ALCE+ S PY P+GL H+SSK LS A   MLEHL    PLRD 
Sbjct  61   DLSSSDDYKNSLEELDAALCEINSNPYLPQGLAHISSKELSKASEFMLEHLISVFPLRDE  120

Query  403  HLRALVTATVEMDFHMLPNADSDCLDKHFEELMHSESKKPAFN  531
            HL+AL+ A+VEMD+HM   ADS  ++  FE LM S SK    N
Sbjct  121  HLKALLNASVEMDYHMHQKADSRSINDIFENLMCSTSKNAIPN  163



>ref|XP_009618051.1| PREDICTED: uncharacterized protein LOC104110292 isoform X2 [Nicotiana 
tomentosiformis]
Length=396

 Score =   200 bits (509),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 116/143 (81%), Gaps = 0/143 (0%)
 Frame = +1

Query  43   MAGWNYPEISLEDLLKAIKGFIDMLILASGYQSSGRLARWDSGNIKRALQWALFLEDVIG  222
            MAGW+YP++SLEDLLKA+KGFI+M+ LASGYQSSGR+A WDS NI +ALQWALFL+DV+ 
Sbjct  1    MAGWSYPDLSLEDLLKAVKGFIEMVNLASGYQSSGRIAHWDSLNINKALQWALFLQDVMR  60

Query  223  SLNSQDEYRDSLEELDVALCEMISMPYFPKGLEHLSSKTLSNARNLMLEHLTHTLPLRDL  402
             L+S D+YRDSLEELD ALCEM S P FP+GL H+SSK LS A + MLEHL    PLRD 
Sbjct  61   DLSSSDDYRDSLEELDAALCEMASNPSFPQGLAHISSKFLSKATDFMLEHLISAFPLRDG  120

Query  403  HLRALVTATVEMDFHMLPNADSD  471
            HL+AL+ A VEMD+ M   AD++
Sbjct  121  HLKALLIANVEMDYQMHQKADAE  143



>ref|XP_007050186.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOX94343.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=463

 Score =   197 bits (502),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 113/150 (75%), Gaps = 0/150 (0%)
 Frame = +1

Query  49   GWNYPEISLEDLLKAIKGFIDMLILASGYQSSGRLARWDSGNIKRALQWALFLEDVIGSL  228
            GWNYP+ISLE+++K IKGF+D+LILASGYQSSG LA WDS NIKRA  WALF E+V   L
Sbjct  2    GWNYPDISLEEMMKLIKGFVDILILASGYQSSGLLAHWDSDNIKRAFHWALFFENVFRRL  61

Query  229  NSQDEYRDSLEELDVALCEMISMPYFPKGLEHLSSKTLSNARNLMLEHLTHTLPLRDLHL  408
             S D YR+SLEELD AL EM S P FP+GL HLSS TL  AR  MLEHL H LPLRD HL
Sbjct  62   RSLDVYRESLEELDAALFEMASRPSFPQGLAHLSSATLRRARGYMLEHLLHNLPLRDSHL  121

Query  409  RALVTATVEMDFHMLPNADSDCLDKHFEEL  498
            +A++T+T+EMD   L   + DCL+ +  +L
Sbjct  122  KAILTSTIEMDLSALSETEHDCLNAYLNKL  151



>ref|XP_007050185.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOX94342.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=557

 Score =   199 bits (505),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 113/150 (75%), Gaps = 0/150 (0%)
 Frame = +1

Query  49   GWNYPEISLEDLLKAIKGFIDMLILASGYQSSGRLARWDSGNIKRALQWALFLEDVIGSL  228
            GWNYP+ISLE+++K IKGF+D+LILASGYQSSG LA WDS NIKRA  WALF E+V   L
Sbjct  2    GWNYPDISLEEMMKLIKGFVDILILASGYQSSGLLAHWDSDNIKRAFHWALFFENVFRRL  61

Query  229  NSQDEYRDSLEELDVALCEMISMPYFPKGLEHLSSKTLSNARNLMLEHLTHTLPLRDLHL  408
             S D YR+SLEELD AL EM S P FP+GL HLSS TL  AR  MLEHL H LPLRD HL
Sbjct  62   RSLDVYRESLEELDAALFEMASRPSFPQGLAHLSSATLRRARGYMLEHLLHNLPLRDSHL  121

Query  409  RALVTATVEMDFHMLPNADSDCLDKHFEEL  498
            +A++T+T+EMD   L   + DCL+ +  +L
Sbjct  122  KAILTSTIEMDLSALSETEHDCLNAYLNKL  151



>ref|XP_008235767.1| PREDICTED: uncharacterized protein LOC103334571 [Prunus mume]
Length=423

 Score =   187 bits (475),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 91/150 (61%), Positives = 108/150 (72%), Gaps = 0/150 (0%)
 Frame = +1

Query  49   GWNYPEISLEDLLKAIKGFIDMLILASGYQSSGRLARWDSGNIKRALQWALFLEDVIGSL  228
            GWN+P ISLE LL  IKGF+D+L+L SGYQSSGRLA WDS NIK+A QW LF E V+GS 
Sbjct  2    GWNHPHISLEQLLNLIKGFVDILLLLSGYQSSGRLAHWDSHNIKKAFQWGLFFEKVLGSF  61

Query  229  NSQDEYRDSLEELDVALCEMISMPYFPKGLEHLSSKTLSNARNLMLEHLTHTLPLRDLHL  408
               D+Y  S+EELD AL EM S    PKGL HLSS  L+ AR+ +L+HL HTLPLRD HL
Sbjct  62   GCSDDYGGSMEELDAALSEMTSAASLPKGLAHLSSANLTTARHFVLDHLIHTLPLRDAHL  121

Query  409  RALVTATVEMDFHMLPNADSDCLDKHFEEL  498
            RAL+ ATVEMD   L   + D L+ +F +L
Sbjct  122  RALLMATVEMDLEELSETEHDFLNAYFNKL  151



>ref|XP_008372590.1| PREDICTED: uncharacterized protein LOC103435935 [Malus domestica]
Length=449

 Score =   186 bits (473),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 109/150 (73%), Gaps = 0/150 (0%)
 Frame = +1

Query  49   GWNYPEISLEDLLKAIKGFIDMLILASGYQSSGRLARWDSGNIKRALQWALFLEDVIGSL  228
            GW +P+IS+E+++  IKGF+D+LIL SGY SSGR+A WDS N+K+A QW LF E V GS 
Sbjct  2    GWRHPQISMEEVVNLIKGFVDILILLSGYXSSGRIAHWDSXNVKKAFQWGLFFEQVFGSF  61

Query  229  NSQDEYRDSLEELDVALCEMISMPYFPKGLEHLSSKTLSNARNLMLEHLTHTLPLRDLHL  408
            +  D+Y  S+EELD  L EM S   FPKGL HLSS TL+ AR  +LEHL HTLPLRD+HL
Sbjct  62   SCSDDYASSVEELDAXLSEMTSAASFPKGLAHLSSXTLAKARRFVLEHLIHTLPLRDVHL  121

Query  409  RALVTATVEMDFHMLPNADSDCLDKHFEEL  498
            RAL+TATVE D   L   + D L+ +F +L
Sbjct  122  RALLTATVEXDLEELSETEHDFLNAYFNKL  151



>ref|XP_009370350.1| PREDICTED: uncharacterized protein LOC103959710 [Pyrus x bretschneideri]
Length=423

 Score =   185 bits (470),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 113/150 (75%), Gaps = 1/150 (1%)
 Frame = +1

Query  49   GWNYPEISLEDLLKAIKGFIDMLILASGYQSSGRLARWDSGNIKRALQWALFLEDVIGSL  228
            GW +P+IS+E+++  IKGF+D+LIL SGYQSSG++A WDS N+K+A QW LF E V GS 
Sbjct  2    GWRHPQISMEEVVNLIKGFVDILILLSGYQSSGQIAHWDSHNVKKAFQWGLFFEQVFGSF  61

Query  229  NSQDEYRDSLEELDVALCEMISMPYFPKGLEHLSSKTLSNARNLMLEHLTHTLPLRDLHL  408
            +S D+Y +S+EELD AL EM S   FP+GL HLSS  L+ AR  +LEHL HTLPLRD+HL
Sbjct  62   SS-DDYANSVEELDAALSEMTSAASFPQGLAHLSSANLAKARRFVLEHLIHTLPLRDVHL  120

Query  409  RALVTATVEMDFHMLPNADSDCLDKHFEEL  498
            RAL+TATVEMD   L   + D L+ +F +L
Sbjct  121  RALLTATVEMDLEELSETEHDFLNAYFNKL  150



>ref|XP_007199478.1| hypothetical protein PRUPE_ppa027210mg [Prunus persica]
 gb|EMJ00677.1| hypothetical protein PRUPE_ppa027210mg [Prunus persica]
Length=458

 Score =   185 bits (469),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 90/150 (60%), Positives = 108/150 (72%), Gaps = 0/150 (0%)
 Frame = +1

Query  49   GWNYPEISLEDLLKAIKGFIDMLILASGYQSSGRLARWDSGNIKRALQWALFLEDVIGSL  228
            GWN+P ISLE LL  IKGF+D+L+L SGYQSSGRLA+WDS NIK+A QW LF E V+GS 
Sbjct  2    GWNHPHISLEQLLNLIKGFVDILLLLSGYQSSGRLAQWDSNNIKKAFQWGLFFEKVLGSF  61

Query  229  NSQDEYRDSLEELDVALCEMISMPYFPKGLEHLSSKTLSNARNLMLEHLTHTLPLRDLHL  408
               D+Y  S+EELD AL EM S    PKGL  LSS  L+ AR+ +L+HL HTLPLRD HL
Sbjct  62   GCSDDYGGSMEELDAALSEMTSAASLPKGLALLSSANLTTARHFVLDHLIHTLPLRDAHL  121

Query  409  RALVTATVEMDFHMLPNADSDCLDKHFEEL  498
            RAL+ ATVEMD   L   + D L+ +F +L
Sbjct  122  RALLMATVEMDLEELSETEHDFLNAYFNKL  151



>ref|XP_011080106.1| PREDICTED: uncharacterized protein LOC105163454 isoform X2 [Sesamum 
indicum]
Length=409

 Score =   182 bits (463),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 117/156 (75%), Gaps = 0/156 (0%)
 Frame = +1

Query  49   GWNYPEISLEDLLKAIKGFIDMLILASGYQSSGRLARWDSGNIKRALQWALFLEDVIGSL  228
            GW+YPEISL+DL+K I+ F++M+ILASGYQ +GRLA WDS NIK++ +WA FLE++   L
Sbjct  2    GWSYPEISLQDLMKLIQNFVNMVILASGYQLTGRLAHWDSHNIKKSFRWANFLENLARGL  61

Query  229  NSQDEYRDSLEELDVALCEMISMPYFPKGLEHLSSKTLSNARNLMLEHLTHTLPLRDLHL  408
             S  +Y+DS++ELD AL  + S P+FP+GL HLS  TL  AR  +LEHL HTLPLR+ HL
Sbjct  62   TSSGDYQDSVKELDAALIGLTSNPHFPQGLAHLSCTTLCRAREFLLEHLIHTLPLRESHL  121

Query  409  RALVTATVEMDFHMLPNADSDCLDKHFEELMHSESK  516
            +A++TA+VEMDF  L   D+D +D + E+L    SK
Sbjct  122  KAIMTASVEMDFSNLQRIDNDYVDVYSEQLRRIPSK  157



>ref|XP_011080102.1| PREDICTED: uncharacterized protein LOC105163454 isoform X1 [Sesamum 
indicum]
 ref|XP_011080103.1| PREDICTED: uncharacterized protein LOC105163454 isoform X1 [Sesamum 
indicum]
 ref|XP_011080104.1| PREDICTED: uncharacterized protein LOC105163454 isoform X1 [Sesamum 
indicum]
 ref|XP_011080105.1| PREDICTED: uncharacterized protein LOC105163454 isoform X1 [Sesamum 
indicum]
Length=466

 Score =   182 bits (463),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 117/156 (75%), Gaps = 0/156 (0%)
 Frame = +1

Query  49   GWNYPEISLEDLLKAIKGFIDMLILASGYQSSGRLARWDSGNIKRALQWALFLEDVIGSL  228
            GW+YPEISL+DL+K I+ F++M+ILASGYQ +GRLA WDS NIK++ +WA FLE++   L
Sbjct  2    GWSYPEISLQDLMKLIQNFVNMVILASGYQLTGRLAHWDSHNIKKSFRWANFLENLARGL  61

Query  229  NSQDEYRDSLEELDVALCEMISMPYFPKGLEHLSSKTLSNARNLMLEHLTHTLPLRDLHL  408
             S  +Y+DS++ELD AL  + S P+FP+GL HLS  TL  AR  +LEHL HTLPLR+ HL
Sbjct  62   TSSGDYQDSVKELDAALIGLTSNPHFPQGLAHLSCTTLCRAREFLLEHLIHTLPLRESHL  121

Query  409  RALVTATVEMDFHMLPNADSDCLDKHFEELMHSESK  516
            +A++TA+VEMDF  L   D+D +D + E+L    SK
Sbjct  122  KAIMTASVEMDFSNLQRIDNDYVDVYSEQLRRIPSK  157



>ref|XP_002526556.1| hypothetical protein RCOM_0542810 [Ricinus communis]
 gb|EEF35834.1| hypothetical protein RCOM_0542810 [Ricinus communis]
Length=406

 Score =   181 bits (459),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 114/150 (76%), Gaps = 0/150 (0%)
 Frame = +1

Query  52   WNYPEISLEDLLKAIKGFIDMLILASGYQSSGRLARWDSGNIKRALQWALFLEDVIGSLN  231
            WNYPEISL++L+K IKGF+D++ILASGYQSSG LA WD  NIK+A QWA F E V+G ++
Sbjct  3    WNYPEISLQELMKLIKGFVDIIILASGYQSSGLLAHWDPHNIKKAFQWASFFEHVLGQMS  62

Query  232  SQDEYRDSLEELDVALCEMISMPYFPKGLEHLSSKTLSNARNLMLEHLTHTLPLRDLHLR  411
            S D Y+DS++ELDVAL +M S P FP+GL  +S +TL+ AR+ +L H+ HTLPLRD HLR
Sbjct  63   SSDVYQDSVKELDVALGKMTSSPSFPQGLADISFRTLNRARSFVLAHMFHTLPLRDSHLR  122

Query  412  ALVTATVEMDFHMLPNADSDCLDKHFEELM  501
            A +TA +EMD   +  ++ D L ++  +L+
Sbjct  123  AFLTAIIEMDLENVSRSEHDSLSEYLNKLI  152



>ref|XP_002321291.1| hypothetical protein POPTR_0014s18810g [Populus trichocarpa]
 gb|EEE99606.1| hypothetical protein POPTR_0014s18810g [Populus trichocarpa]
Length=433

 Score =   179 bits (455),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 80/150 (53%), Positives = 112/150 (75%), Gaps = 0/150 (0%)
 Frame = +1

Query  49   GWNYPEISLEDLLKAIKGFIDMLILASGYQSSGRLARWDSGNIKRALQWALFLEDVIGSL  228
            GWNYP ISLE+++K +KGF+D++ILASGYQSS  LA WD+ NIK+A+ W  F ++V+  +
Sbjct  2    GWNYPYISLEEMVKHLKGFVDIMILASGYQSSALLAHWDAQNIKKAIHWGSFFQNVLKHM  61

Query  229  NSQDEYRDSLEELDVALCEMISMPYFPKGLEHLSSKTLSNARNLMLEHLTHTLPLRDLHL  408
            +S D Y+DS++ELD ALC+M S PYFP+GL +LS  TLS AR+ +L HL  TLPLRD HL
Sbjct  62   SSSDVYQDSIKELDAALCQMKSNPYFPQGLANLSCDTLSRARSFVLAHLFQTLPLRDSHL  121

Query  409  RALVTATVEMDFHMLPNADSDCLDKHFEEL  498
            +A +TA +EM+   +  ++ DCL  +  +L
Sbjct  122  KAFLTAVIEMELERVSESEHDCLSVYLNKL  151



>ref|XP_011011167.1| PREDICTED: uncharacterized protein LOC105115829 isoform X7 [Populus 
euphratica]
Length=384

 Score =   178 bits (452),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 79/150 (53%), Positives = 112/150 (75%), Gaps = 0/150 (0%)
 Frame = +1

Query  49   GWNYPEISLEDLLKAIKGFIDMLILASGYQSSGRLARWDSGNIKRALQWALFLEDVIGSL  228
            GWNYP ISLE+++K +KGF+D++ILASGYQSS  LA WD+ NIK+A+ W  F ++V+  +
Sbjct  2    GWNYPYISLEEMVKLLKGFVDIMILASGYQSSALLAHWDAQNIKKAIHWGSFFQNVLEHM  61

Query  229  NSQDEYRDSLEELDVALCEMISMPYFPKGLEHLSSKTLSNARNLMLEHLTHTLPLRDLHL  408
            ++ D Y+DS++ELD ALC+M S PYFP+GL +LS  TLS AR+ +L HL  TLPLRD HL
Sbjct  62   STSDVYQDSIKELDAALCQMKSNPYFPQGLANLSCDTLSRARSFVLAHLFQTLPLRDSHL  121

Query  409  RALVTATVEMDFHMLPNADSDCLDKHFEEL  498
            +A +TA +EM+   +  ++ DCL  +  +L
Sbjct  122  KAFLTAVIEMELERVSESEHDCLSVYLNKL  151



>gb|KDP26480.1| hypothetical protein JCGZ_17638 [Jatropha curcas]
Length=403

 Score =   178 bits (452),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 110/153 (72%), Gaps = 0/153 (0%)
 Frame = +1

Query  43   MAGWNYPEISLEDLLKAIKGFIDMLILASGYQSSGRLARWDSGNIKRALQWALFLEDVIG  222
            M  WNYP+ISLE+++K IKGF+D++ILASGYQSSG LA+WD+ NIK+A QWA F E+V+G
Sbjct  1    MMDWNYPDISLEEMMKLIKGFVDIMILASGYQSSGLLAQWDAHNIKKAFQWASFFENVLG  60

Query  223  SLNSQDEYRDSLEELDVALCEMISMPYFPKGLEHLSSKTLSNARNLMLEHLTHTLPLRDL  402
             +NS D Y++SL +LD  + EM S P FP+GL +LS  TL+  R+ +L HL HTLPLRD 
Sbjct  61   KMNSSDFYQESLNKLDAVIHEMKSNPSFPQGLANLSCDTLNRGRSFVLAHLLHTLPLRDS  120

Query  403  HLRALVTATVEMDFHMLPNADSDCLDKHFEELM  501
            HLRA + A +EMD      +  DCL  +   LM
Sbjct  121  HLRAFLIAIIEMDLDKHSGSGHDCLGVYLNNLM  153



>emb|CAN69928.1| hypothetical protein VITISV_018024 [Vitis vinifera]
Length=335

 Score =   176 bits (447),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 109/151 (72%), Gaps = 0/151 (0%)
 Frame = +1

Query  49   GWNYPEISLEDLLKAIKGFIDMLILASGYQSSGRLARWDSGNIKRALQWALFLEDVIGSL  228
            GW++P++SL+D++K IKGF+D+LILASGYQSSG  A WD  NIKRA QW LF E+VI  L
Sbjct  2    GWSHPDVSLDDMVKLIKGFVDILILASGYQSSGHFALWDPQNIKRAFQWGLFFENVIRHL  61

Query  229  NSQDEYRDSLEELDVALCEMISMPYFPKGLEHLSSKTLSNARNLMLEHLTHTLPLRDLHL  408
            +S D+Y+DSL+ELD  L E+ S P FP+GL  LSS TLS A++ +LEHL  TL LRD HL
Sbjct  62   SSSDDYQDSLKELDSVLLEIKSNPSFPQGLAQLSSVTLSRAKSFVLEHLIQTLTLRDAHL  121

Query  409  RALVTATVEMDFHMLPNADSDCLDKHFEELM  501
             A +TA++ MD   L   + DCL  +   LM
Sbjct  122  XAFLTASIGMDLDELSGTEQDCLSLYMNRLM  152



>ref|XP_011011166.1| PREDICTED: uncharacterized protein LOC105115829 isoform X6 [Populus 
euphratica]
Length=402

 Score =   178 bits (451),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 79/150 (53%), Positives = 112/150 (75%), Gaps = 0/150 (0%)
 Frame = +1

Query  49   GWNYPEISLEDLLKAIKGFIDMLILASGYQSSGRLARWDSGNIKRALQWALFLEDVIGSL  228
            GWNYP ISLE+++K +KGF+D++ILASGYQSS  LA WD+ NIK+A+ W  F ++V+  +
Sbjct  2    GWNYPYISLEEMVKLLKGFVDIMILASGYQSSALLAHWDAQNIKKAIHWGSFFQNVLEHM  61

Query  229  NSQDEYRDSLEELDVALCEMISMPYFPKGLEHLSSKTLSNARNLMLEHLTHTLPLRDLHL  408
            ++ D Y+DS++ELD ALC+M S PYFP+GL +LS  TLS AR+ +L HL  TLPLRD HL
Sbjct  62   STSDVYQDSIKELDAALCQMKSNPYFPQGLANLSCDTLSRARSFVLAHLFQTLPLRDSHL  121

Query  409  RALVTATVEMDFHMLPNADSDCLDKHFEEL  498
            +A +TA +EM+   +  ++ DCL  +  +L
Sbjct  122  KAFLTAVIEMELERVSESEHDCLSVYLNKL  151



>ref|XP_011011164.1| PREDICTED: uncharacterized protein LOC105115829 isoform X4 [Populus 
euphratica]
Length=432

 Score =   178 bits (452),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 79/150 (53%), Positives = 112/150 (75%), Gaps = 0/150 (0%)
 Frame = +1

Query  49   GWNYPEISLEDLLKAIKGFIDMLILASGYQSSGRLARWDSGNIKRALQWALFLEDVIGSL  228
            GWNYP ISLE+++K +KGF+D++ILASGYQSS  LA WD+ NIK+A+ W  F ++V+  +
Sbjct  2    GWNYPYISLEEMVKLLKGFVDIMILASGYQSSALLAHWDAQNIKKAIHWGSFFQNVLEHM  61

Query  229  NSQDEYRDSLEELDVALCEMISMPYFPKGLEHLSSKTLSNARNLMLEHLTHTLPLRDLHL  408
            ++ D Y+DS++ELD ALC+M S PYFP+GL +LS  TLS AR+ +L HL  TLPLRD HL
Sbjct  62   STSDVYQDSIKELDAALCQMKSNPYFPQGLANLSCDTLSRARSFVLAHLFQTLPLRDSHL  121

Query  409  RALVTATVEMDFHMLPNADSDCLDKHFEEL  498
            +A +TA +EM+   +  ++ DCL  +  +L
Sbjct  122  KAFLTAVIEMELERVSESEHDCLSVYLNKL  151



>ref|XP_011011163.1| PREDICTED: uncharacterized protein LOC105115829 isoform X3 [Populus 
euphratica]
Length=433

 Score =   178 bits (452),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 79/150 (53%), Positives = 112/150 (75%), Gaps = 0/150 (0%)
 Frame = +1

Query  49   GWNYPEISLEDLLKAIKGFIDMLILASGYQSSGRLARWDSGNIKRALQWALFLEDVIGSL  228
            GWNYP ISLE+++K +KGF+D++ILASGYQSS  LA WD+ NIK+A+ W  F ++V+  +
Sbjct  2    GWNYPYISLEEMVKLLKGFVDIMILASGYQSSALLAHWDAQNIKKAIHWGSFFQNVLEHM  61

Query  229  NSQDEYRDSLEELDVALCEMISMPYFPKGLEHLSSKTLSNARNLMLEHLTHTLPLRDLHL  408
            ++ D Y+DS++ELD ALC+M S PYFP+GL +LS  TLS AR+ +L HL  TLPLRD HL
Sbjct  62   STSDVYQDSIKELDAALCQMKSNPYFPQGLANLSCDTLSRARSFVLAHLFQTLPLRDSHL  121

Query  409  RALVTATVEMDFHMLPNADSDCLDKHFEEL  498
            +A +TA +EM+   +  ++ DCL  +  +L
Sbjct  122  KAFLTAVIEMELERVSESEHDCLSVYLNKL  151



>emb|CDP03786.1| unnamed protein product [Coffea canephora]
Length=406

 Score =   177 bits (450),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 112/151 (74%), Gaps = 0/151 (0%)
 Frame = +1

Query  49   GWNYPEISLEDLLKAIKGFIDMLILASGYQSSGRLARWDSGNIKRALQWALFLEDVIGSL  228
            GW+YP+ISLEDL++ IKGF+DML+LASGYQSSGRL+ WDS NI++A QWA FLE V+ SL
Sbjct  2    GWSYPDISLEDLMRVIKGFVDMLVLASGYQSSGRLSHWDSHNIEKAFQWATFLEIVLRSL  61

Query  229  NSQDEYRDSLEELDVALCEMISMPYFPKGLEHLSSKTLSNARNLMLEHLTHTLPLRDLHL  408
             S D+ +DS+ ELD AL ++ S P FP+GL  LS  TLS+AR+LM++HL  ++PL D HL
Sbjct  62   RSSDDNQDSVAELDAALSQLTSNPCFPEGLRQLSCTTLSHARDLMVKHLVRSVPLTDAHL  121

Query  409  RALVTATVEMDFHMLPNADSDCLDKHFEELM  501
            RA V A + +D H   +  +D L  + E LM
Sbjct  122  RASVAAVIGIDSHQFQSIGTDELHLYLERLM  152



>ref|XP_011011161.1| PREDICTED: uncharacterized protein LOC105115829 isoform X1 [Populus 
euphratica]
Length=472

 Score =   178 bits (452),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 79/150 (53%), Positives = 112/150 (75%), Gaps = 0/150 (0%)
 Frame = +1

Query  49   GWNYPEISLEDLLKAIKGFIDMLILASGYQSSGRLARWDSGNIKRALQWALFLEDVIGSL  228
            GWNYP ISLE+++K +KGF+D++ILASGYQSS  LA WD+ NIK+A+ W  F ++V+  +
Sbjct  2    GWNYPYISLEEMVKLLKGFVDIMILASGYQSSALLAHWDAQNIKKAIHWGSFFQNVLEHM  61

Query  229  NSQDEYRDSLEELDVALCEMISMPYFPKGLEHLSSKTLSNARNLMLEHLTHTLPLRDLHL  408
            ++ D Y+DS++ELD ALC+M S PYFP+GL +LS  TLS AR+ +L HL  TLPLRD HL
Sbjct  62   STSDVYQDSIKELDAALCQMKSNPYFPQGLANLSCDTLSRARSFVLAHLFQTLPLRDSHL  121

Query  409  RALVTATVEMDFHMLPNADSDCLDKHFEEL  498
            +A +TA +EM+   +  ++ DCL  +  +L
Sbjct  122  KAFLTAVIEMELERVSESEHDCLSVYLNKL  151



>ref|XP_011011162.1| PREDICTED: uncharacterized protein LOC105115829 isoform X2 [Populus 
euphratica]
Length=471

 Score =   178 bits (452),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 79/150 (53%), Positives = 112/150 (75%), Gaps = 0/150 (0%)
 Frame = +1

Query  49   GWNYPEISLEDLLKAIKGFIDMLILASGYQSSGRLARWDSGNIKRALQWALFLEDVIGSL  228
            GWNYP ISLE+++K +KGF+D++ILASGYQSS  LA WD+ NIK+A+ W  F ++V+  +
Sbjct  2    GWNYPYISLEEMVKLLKGFVDIMILASGYQSSALLAHWDAQNIKKAIHWGSFFQNVLEHM  61

Query  229  NSQDEYRDSLEELDVALCEMISMPYFPKGLEHLSSKTLSNARNLMLEHLTHTLPLRDLHL  408
            ++ D Y+DS++ELD ALC+M S PYFP+GL +LS  TLS AR+ +L HL  TLPLRD HL
Sbjct  62   STSDVYQDSIKELDAALCQMKSNPYFPQGLANLSCDTLSRARSFVLAHLFQTLPLRDSHL  121

Query  409  RALVTATVEMDFHMLPNADSDCLDKHFEEL  498
            +A +TA +EM+   +  ++ DCL  +  +L
Sbjct  122  KAFLTAVIEMELERVSESEHDCLSVYLNKL  151



>ref|XP_002270391.2| PREDICTED: uncharacterized protein LOC100260103 [Vitis vinifera]
Length=446

 Score =   176 bits (447),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 109/151 (72%), Gaps = 0/151 (0%)
 Frame = +1

Query  49   GWNYPEISLEDLLKAIKGFIDMLILASGYQSSGRLARWDSGNIKRALQWALFLEDVIGSL  228
            GW++P++SL+D++K IKGF+D+LILASGYQSSG  A WD  NIKRA QW LF E+VI  L
Sbjct  2    GWSHPDVSLDDMVKLIKGFVDILILASGYQSSGHFALWDPQNIKRAFQWGLFFENVIRHL  61

Query  229  NSQDEYRDSLEELDVALCEMISMPYFPKGLEHLSSKTLSNARNLMLEHLTHTLPLRDLHL  408
            +S D+Y+DSL+ELD  L E+ S P FP+GL  LSS TLS A++ +LEHL  TL LRD HL
Sbjct  62   SSSDDYQDSLKELDSVLLEIKSNPSFPQGLAQLSSVTLSRAKSFVLEHLIQTLTLRDAHL  121

Query  409  RALVTATVEMDFHMLPNADSDCLDKHFEELM  501
             A +TA++ MD   L   + DCL  +   LM
Sbjct  122  EAFLTASIGMDLDELSGTEQDCLSLYMNRLM  152



>emb|CBI37174.3| unnamed protein product [Vitis vinifera]
Length=527

 Score =   176 bits (447),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 109/151 (72%), Gaps = 0/151 (0%)
 Frame = +1

Query  49   GWNYPEISLEDLLKAIKGFIDMLILASGYQSSGRLARWDSGNIKRALQWALFLEDVIGSL  228
            GW++P++SL+D++K IKGF+D+LILASGYQSSG  A WD  NIKRA QW LF E+VI  L
Sbjct  110  GWSHPDVSLDDMVKLIKGFVDILILASGYQSSGHFALWDPQNIKRAFQWGLFFENVIRHL  169

Query  229  NSQDEYRDSLEELDVALCEMISMPYFPKGLEHLSSKTLSNARNLMLEHLTHTLPLRDLHL  408
            +S D+Y+DSL+ELD  L E+ S P FP+GL  LSS TLS A++ +LEHL  TL LRD HL
Sbjct  170  SSSDDYQDSLKELDSVLLEIKSNPSFPQGLAQLSSVTLSRAKSFVLEHLIQTLTLRDAHL  229

Query  409  RALVTATVEMDFHMLPNADSDCLDKHFEELM  501
             A +TA++ MD   L   + DCL  +   LM
Sbjct  230  EAFLTASIGMDLDELSGTEQDCLSLYMNRLM  260



>ref|XP_010091792.1| hypothetical protein L484_015860 [Morus notabilis]
 gb|EXB46000.1| hypothetical protein L484_015860 [Morus notabilis]
Length=439

 Score =   174 bits (440),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/150 (54%), Positives = 109/150 (73%), Gaps = 0/150 (0%)
 Frame = +1

Query  49   GWNYPEISLEDLLKAIKGFIDMLILASGYQSSGRLARWDSGNIKRALQWALFLEDVIGSL  228
            GW +P+ISL+DL+K IKGF+D+LIL SGYQSSGR A WD  NI +A QWALF E+V+ +L
Sbjct  2    GWGHPQISLDDLMKLIKGFVDILILTSGYQSSGRPAHWDPTNISKAFQWALFFENVLSTL  61

Query  229  NSQDEYRDSLEELDVALCEMISMPYFPKGLEHLSSKTLSNARNLMLEHLTHTLPLRDLHL  408
            +S + Y+DSL ELD+AL ++ S   FP+GL HLSS+TL+ AR  +++H  HTLPLRD HL
Sbjct  62   SSLEVYQDSLNELDMALSKITSAASFPQGLAHLSSETLTRARGFLMDHFIHTLPLRDSHL  121

Query  409  RALVTATVEMDFHMLPNADSDCLDKHFEEL  498
            R  + AT++MD   L   + D L  +  +L
Sbjct  122  RDFLMATIQMDLDELSGTEHDRLSAYLSKL  151



>ref|XP_010264905.1| PREDICTED: uncharacterized protein LOC104602787 isoform X5 [Nelumbo 
nucifera]
 ref|XP_010264906.1| PREDICTED: uncharacterized protein LOC104602787 isoform X5 [Nelumbo 
nucifera]
Length=433

 Score =   170 bits (431),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/151 (54%), Positives = 108/151 (72%), Gaps = 0/151 (0%)
 Frame = +1

Query  49   GWNYPEISLEDLLKAIKGFIDMLILASGYQSSGRLARWDSGNIKRALQWALFLEDVIGSL  228
            GW++P+ISLEDLL+ IKGF+D+LILASGYQSSG  A WD+ N+K+ + W +F E+V   L
Sbjct  2    GWSHPDISLEDLLRLIKGFVDILILASGYQSSGLPAIWDAQNVKKVVSWGIFFENVFRRL  61

Query  229  NSQDEYRDSLEELDVALCEMISMPYFPKGLEHLSSKTLSNARNLMLEHLTHTLPLRDLHL  408
               D Y DS++E+D AL EM S PYFP+GL+ LSS TLS AR  +  HL +TLPL D HL
Sbjct  62   RGLDGYEDSVKEVDAALLEMTSNPYFPQGLKRLSSATLSRARYFVFHHLLNTLPLSDAHL  121

Query  409  RALVTATVEMDFHMLPNADSDCLDKHFEELM  501
             A++ A VEMD   L   + DCL+ + ++L+
Sbjct  122  SAVLRAAVEMDLDDLRGGEYDCLNVYLDKLL  152



>ref|XP_010264903.1| PREDICTED: uncharacterized protein LOC104602787 isoform X3 [Nelumbo 
nucifera]
Length=435

 Score =   170 bits (431),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/151 (54%), Positives = 108/151 (72%), Gaps = 0/151 (0%)
 Frame = +1

Query  49   GWNYPEISLEDLLKAIKGFIDMLILASGYQSSGRLARWDSGNIKRALQWALFLEDVIGSL  228
            GW++P+ISLEDLL+ IKGF+D+LILASGYQSSG  A WD+ N+K+ + W +F E+V   L
Sbjct  2    GWSHPDISLEDLLRLIKGFVDILILASGYQSSGLPAIWDAQNVKKVVSWGIFFENVFRRL  61

Query  229  NSQDEYRDSLEELDVALCEMISMPYFPKGLEHLSSKTLSNARNLMLEHLTHTLPLRDLHL  408
               D Y DS++E+D AL EM S PYFP+GL+ LSS TLS AR  +  HL +TLPL D HL
Sbjct  62   RGLDGYEDSVKEVDAALLEMTSNPYFPQGLKRLSSATLSRARYFVFHHLLNTLPLSDAHL  121

Query  409  RALVTATVEMDFHMLPNADSDCLDKHFEELM  501
             A++ A VEMD   L   + DCL+ + ++L+
Sbjct  122  SAVLRAAVEMDLDDLRGGEYDCLNVYLDKLL  152



>ref|XP_010264904.1| PREDICTED: uncharacterized protein LOC104602787 isoform X4 [Nelumbo 
nucifera]
Length=435

 Score =   170 bits (431),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/151 (54%), Positives = 108/151 (72%), Gaps = 0/151 (0%)
 Frame = +1

Query  49   GWNYPEISLEDLLKAIKGFIDMLILASGYQSSGRLARWDSGNIKRALQWALFLEDVIGSL  228
            GW++P+ISLEDLL+ IKGF+D+LILASGYQSSG  A WD+ N+K+ + W +F E+V   L
Sbjct  2    GWSHPDISLEDLLRLIKGFVDILILASGYQSSGLPAIWDAQNVKKVVSWGIFFENVFRRL  61

Query  229  NSQDEYRDSLEELDVALCEMISMPYFPKGLEHLSSKTLSNARNLMLEHLTHTLPLRDLHL  408
               D Y DS++E+D AL EM S PYFP+GL+ LSS TLS AR  +  HL +TLPL D HL
Sbjct  62   RGLDGYEDSVKEVDAALLEMTSNPYFPQGLKRLSSATLSRARYFVFHHLLNTLPLSDAHL  121

Query  409  RALVTATVEMDFHMLPNADSDCLDKHFEELM  501
             A++ A VEMD   L   + DCL+ + ++L+
Sbjct  122  SAVLRAAVEMDLDDLRGGEYDCLNVYLDKLL  152



>ref|XP_010264902.1| PREDICTED: uncharacterized protein LOC104602787 isoform X2 [Nelumbo 
nucifera]
Length=474

 Score =   171 bits (432),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 81/151 (54%), Positives = 108/151 (72%), Gaps = 0/151 (0%)
 Frame = +1

Query  49   GWNYPEISLEDLLKAIKGFIDMLILASGYQSSGRLARWDSGNIKRALQWALFLEDVIGSL  228
            GW++P+ISLEDLL+ IKGF+D+LILASGYQSSG  A WD+ N+K+ + W +F E+V   L
Sbjct  2    GWSHPDISLEDLLRLIKGFVDILILASGYQSSGLPAIWDAQNVKKVVSWGIFFENVFRRL  61

Query  229  NSQDEYRDSLEELDVALCEMISMPYFPKGLEHLSSKTLSNARNLMLEHLTHTLPLRDLHL  408
               D Y DS++E+D AL EM S PYFP+GL+ LSS TLS AR  +  HL +TLPL D HL
Sbjct  62   RGLDGYEDSVKEVDAALLEMTSNPYFPQGLKRLSSATLSRARYFVFHHLLNTLPLSDAHL  121

Query  409  RALVTATVEMDFHMLPNADSDCLDKHFEELM  501
             A++ A VEMD   L   + DCL+ + ++L+
Sbjct  122  SAVLRAAVEMDLDDLRGGEYDCLNVYLDKLL  152



>ref|XP_010264901.1| PREDICTED: uncharacterized protein LOC104602787 isoform X1 [Nelumbo 
nucifera]
Length=507

 Score =   170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 81/151 (54%), Positives = 108/151 (72%), Gaps = 0/151 (0%)
 Frame = +1

Query  49   GWNYPEISLEDLLKAIKGFIDMLILASGYQSSGRLARWDSGNIKRALQWALFLEDVIGSL  228
            GW++P+ISLEDLL+ IKGF+D+LILASGYQSSG  A WD+ N+K+ + W +F E+V   L
Sbjct  2    GWSHPDISLEDLLRLIKGFVDILILASGYQSSGLPAIWDAQNVKKVVSWGIFFENVFRRL  61

Query  229  NSQDEYRDSLEELDVALCEMISMPYFPKGLEHLSSKTLSNARNLMLEHLTHTLPLRDLHL  408
               D Y DS++E+D AL EM S PYFP+GL+ LSS TLS AR  +  HL +TLPL D HL
Sbjct  62   RGLDGYEDSVKEVDAALLEMTSNPYFPQGLKRLSSATLSRARYFVFHHLLNTLPLSDAHL  121

Query  409  RALVTATVEMDFHMLPNADSDCLDKHFEELM  501
             A++ A VEMD   L   + DCL+ + ++L+
Sbjct  122  SAVLRAAVEMDLDDLRGGEYDCLNVYLDKLL  152



>ref|XP_010936029.1| PREDICTED: uncharacterized protein LOC105055758 [Elaeis guineensis]
 ref|XP_010936030.1| PREDICTED: uncharacterized protein LOC105055758 [Elaeis guineensis]
 ref|XP_010936031.1| PREDICTED: uncharacterized protein LOC105055758 [Elaeis guineensis]
Length=486

 Score =   169 bits (427),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 112/156 (72%), Gaps = 1/156 (1%)
 Frame = +1

Query  49   GWNYPEISLEDLLKAIKGFIDMLILASGYQSSGRLARWDSGNIKRALQWALFLEDVIGSL  228
            GW++P+ISL+DLL  IKGF+D+LILASGYQSSG  A WD  NIK+A++W +F EDV+  L
Sbjct  2    GWSHPDISLDDLLVLIKGFVDILILASGYQSSGLPASWDVENIKKAVRWGIFFEDVLRRL  61

Query  229  NSQDEYRDSLEELDVALCEMISMPYFPKGLEHLSSKTLSNARNLMLEHLTHTLPLRDLHL  408
                +Y DS++ELD AL  + S P FP+GL H+SS TLS  R+L+LEHL  T PL   H+
Sbjct  62   QDSVDYEDSMKELDAALLHLTSSPNFPQGLVHISSATLSKGRDLILEHLLQTHPLEAAHI  121

Query  409  RALVTATVEMDFHMLPNADSDCLDKHFEELM-HSES  513
             +L+TATVE+D   L N D+D L+ + + LM H ES
Sbjct  122  TSLLTATVELDIDNLTNTDNDGLNMYMDRLMLHLES  157



>ref|XP_006479460.1| PREDICTED: uncharacterized protein LOC102618051 isoform X3 [Citrus 
sinensis]
Length=402

 Score =   166 bits (421),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 79/150 (53%), Positives = 104/150 (69%), Gaps = 0/150 (0%)
 Frame = +1

Query  49   GWNYPEISLEDLLKAIKGFIDMLILASGYQSSGRLARWDSGNIKRALQWALFLEDVIGSL  228
            GWNYPEISLE+++K IKGF+D+LILASG QSSG  A WD+ NIK+ALQW +F E+V+  L
Sbjct  2    GWNYPEISLEEMMKLIKGFVDILILASGCQSSGLPAHWDAQNIKKALQWGIFFENVVSHL  61

Query  229  NSQDEYRDSLEELDVALCEMISMPYFPKGLEHLSSKTLSNARNLMLEHLTHTLPLRDLHL  408
             S + Y DSL+ELD ++ E+ S   FP+GL HLS+  LS  R  + EH   TLPL D HL
Sbjct  62   CSSEVYLDSLKELDTSVTEITSNRSFPQGLSHLSTAVLSKGRAFVCEHFICTLPLSDAHL  121

Query  409  RALVTATVEMDFHMLPNADSDCLDKHFEEL  498
             A + A +EMD + L   + DCL+ +  +L
Sbjct  122  EAFLRAAIEMDLNELMEKEHDCLNIYLSKL  151



>ref|XP_006857496.1| hypothetical protein AMTR_s00067p00206040 [Amborella trichopoda]
 gb|ERN18963.1| hypothetical protein AMTR_s00067p00206040 [Amborella trichopoda]
Length=508

 Score =   167 bits (424),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 85/158 (54%), Positives = 111/158 (70%), Gaps = 1/158 (1%)
 Frame = +1

Query  49   GWNYPEISLEDLLKAIKGFIDMLILASGYQSSGRLARWDSGNIKRALQWALFLEDVIGSL  228
            GW +PEISLE+L+  +KGFID++ILASGYQSSG  A WD+ NIK+ALQW LF E+V+  +
Sbjct  2    GWTHPEISLEELMNLVKGFIDIVILASGYQSSGLHAHWDAENIKKALQWGLFFENVLKKI  61

Query  229  NSQDEYRDSLEELDVALCEMISMPYFPKGLEHLSSKTLSNARNLMLEHLTHTLPLRDLHL  408
                +Y +S++ELD+AL E+ S P+FP+ L HLSS  L  AR L+L HL HTLPLRD  L
Sbjct  62   PDSGDYTESMKELDLALSELTSNPFFPQALMHLSSSALLRARELVLRHLLHTLPLRDEQL  121

Query  409  RALVTATVEMDFH-MLPNADSDCLDKHFEELMHSESKK  519
             AL+ ATVEMD   +    + D L+   + LM S+S K
Sbjct  122  TALLIATVEMDLEDIKTKTEGDPLNAFIDLLMVSKSSK  159



>ref|XP_010048076.1| PREDICTED: uncharacterized protein LOC104436915 [Eucalyptus grandis]
 ref|XP_010048084.1| PREDICTED: uncharacterized protein LOC104436915 [Eucalyptus grandis]
 ref|XP_010048086.1| PREDICTED: uncharacterized protein LOC104436915 [Eucalyptus grandis]
Length=468

 Score =   167 bits (422),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/150 (52%), Positives = 110/150 (73%), Gaps = 0/150 (0%)
 Frame = +1

Query  49   GWNYPEISLEDLLKAIKGFIDMLILASGYQSSGRLARWDSGNIKRALQWALFLEDVIGSL  228
            GW YP++SLE+++K +KGF D+LILASGYQSSG LA WD  N+ +ALQW LF E V  S 
Sbjct  2    GWKYPDVSLEEMVKLVKGFADILILASGYQSSGLLAHWDQQNVTKALQWGLFFEQVFKSF  61

Query  229  NSQDEYRDSLEELDVALCEMISMPYFPKGLEHLSSKTLSNARNLMLEHLTHTLPLRDLHL  408
            +  ++Y +SL+ELD AL  +++   FP+GL  LSS TLS AR+L+LE L H+LPLRD +L
Sbjct  62   SCSEDYDESLQELDKALSVIVADTSFPQGLAKLSSATLSRARDLVLEQLVHSLPLRDSNL  121

Query  409  RALVTATVEMDFHMLPNADSDCLDKHFEEL  498
            R+L+ +T+ MD ++L   D D L ++ ++L
Sbjct  122  RSLLCSTIRMDLNVLSREDPDRLSRYLDKL  151



>ref|XP_006443752.1| hypothetical protein CICLE_v10020041mg [Citrus clementina]
 gb|ESR56992.1| hypothetical protein CICLE_v10020041mg [Citrus clementina]
Length=453

 Score =   166 bits (420),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/150 (53%), Positives = 104/150 (69%), Gaps = 0/150 (0%)
 Frame = +1

Query  49   GWNYPEISLEDLLKAIKGFIDMLILASGYQSSGRLARWDSGNIKRALQWALFLEDVIGSL  228
            GWNYPEISLE+++K IKGF+D+LILASG QSSG  A WD+ NIK+ALQW +F E+V+  L
Sbjct  2    GWNYPEISLEEMMKLIKGFVDILILASGCQSSGLPAHWDAQNIKKALQWGIFFENVVSHL  61

Query  229  NSQDEYRDSLEELDVALCEMISMPYFPKGLEHLSSKTLSNARNLMLEHLTHTLPLRDLHL  408
             S + Y DSL+ELD ++ E+ S   FP+GL HLS+  LS  R  + EH   TLPL D HL
Sbjct  62   CSSEVYLDSLKELDTSVTEITSNRSFPQGLSHLSTAVLSKGRAFVCEHFICTLPLSDAHL  121

Query  409  RALVTATVEMDFHMLPNADSDCLDKHFEEL  498
             A + A +EMD + L   + DCL+ +  +L
Sbjct  122  EAFLRAAIEMDLNELMEKEHDCLNIYLSKL  151



>ref|XP_006443753.1| hypothetical protein CICLE_v10020041mg [Citrus clementina]
 ref|XP_006479458.1| PREDICTED: uncharacterized protein LOC102618051 isoform X1 [Citrus 
sinensis]
 ref|XP_006479459.1| PREDICTED: uncharacterized protein LOC102618051 isoform X2 [Citrus 
sinensis]
 gb|ESR56993.1| hypothetical protein CICLE_v10020041mg [Citrus clementina]
Length=465

 Score =   166 bits (420),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/150 (53%), Positives = 104/150 (69%), Gaps = 0/150 (0%)
 Frame = +1

Query  49   GWNYPEISLEDLLKAIKGFIDMLILASGYQSSGRLARWDSGNIKRALQWALFLEDVIGSL  228
            GWNYPEISLE+++K IKGF+D+LILASG QSSG  A WD+ NIK+ALQW +F E+V+  L
Sbjct  2    GWNYPEISLEEMMKLIKGFVDILILASGCQSSGLPAHWDAQNIKKALQWGIFFENVVSHL  61

Query  229  NSQDEYRDSLEELDVALCEMISMPYFPKGLEHLSSKTLSNARNLMLEHLTHTLPLRDLHL  408
             S + Y DSL+ELD ++ E+ S   FP+GL HLS+  LS  R  + EH   TLPL D HL
Sbjct  62   CSSEVYLDSLKELDTSVTEITSNRSFPQGLSHLSTAVLSKGRAFVCEHFICTLPLSDAHL  121

Query  409  RALVTATVEMDFHMLPNADSDCLDKHFEEL  498
             A + A +EMD + L   + DCL+ +  +L
Sbjct  122  EAFLRAAIEMDLNELMEKEHDCLNIYLSKL  151



>ref|XP_008796370.1| PREDICTED: uncharacterized protein LOC103711847 isoform X5 [Phoenix 
dactylifera]
Length=458

 Score =   164 bits (415),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 83/156 (53%), Positives = 112/156 (72%), Gaps = 1/156 (1%)
 Frame = +1

Query  49   GWNYPEISLEDLLKAIKGFIDMLILASGYQSSGRLARWDSGNIKRALQWALFLEDVIGSL  228
            GW++P+ISL+DLL  IKGF+D+LILASGYQSSG  A WD  NIK+A++W +F EDV+  L
Sbjct  2    GWSHPDISLDDLLVLIKGFVDILILASGYQSSGLSASWDVENIKKAVRWGIFFEDVLRHL  61

Query  229  NSQDEYRDSLEELDVALCEMISMPYFPKGLEHLSSKTLSNARNLMLEHLTHTLPLRDLHL  408
            +   +Y DS++ELD AL  + S P FP+GL H+SS TLS AR+L+LEHL  T PL   H+
Sbjct  62   HDSVDYEDSIKELDAALLHLTSSPNFPQGLAHMSSATLSKARDLILEHLVQTHPLEAAHI  121

Query  409  RALVTATVEMDFHMLPNADSDCLDKHFEELM-HSES  513
             +L+TA VE+D   L + D+D  + + + LM H ES
Sbjct  122  TSLLTAIVELDIDNLTDTDNDGPNMYMDRLMLHLES  157



>ref|XP_008796367.1| PREDICTED: uncharacterized protein LOC103711847 isoform X2 [Phoenix 
dactylifera]
Length=484

 Score =   164 bits (415),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 83/156 (53%), Positives = 112/156 (72%), Gaps = 1/156 (1%)
 Frame = +1

Query  49   GWNYPEISLEDLLKAIKGFIDMLILASGYQSSGRLARWDSGNIKRALQWALFLEDVIGSL  228
            GW++P+ISL+DLL  IKGF+D+LILASGYQSSG  A WD  NIK+A++W +F EDV+  L
Sbjct  2    GWSHPDISLDDLLVLIKGFVDILILASGYQSSGLSASWDVENIKKAVRWGIFFEDVLRHL  61

Query  229  NSQDEYRDSLEELDVALCEMISMPYFPKGLEHLSSKTLSNARNLMLEHLTHTLPLRDLHL  408
            +   +Y DS++ELD AL  + S P FP+GL H+SS TLS AR+L+LEHL  T PL   H+
Sbjct  62   HDSVDYEDSIKELDAALLHLTSSPNFPQGLAHMSSATLSKARDLILEHLVQTHPLEAAHI  121

Query  409  RALVTATVEMDFHMLPNADSDCLDKHFEELM-HSES  513
             +L+TA VE+D   L + D+D  + + + LM H ES
Sbjct  122  TSLLTAIVELDIDNLTDTDNDGPNMYMDRLMLHLES  157



>ref|XP_008796369.1| PREDICTED: uncharacterized protein LOC103711847 isoform X4 [Phoenix 
dactylifera]
Length=465

 Score =   164 bits (414),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 83/156 (53%), Positives = 112/156 (72%), Gaps = 1/156 (1%)
 Frame = +1

Query  49   GWNYPEISLEDLLKAIKGFIDMLILASGYQSSGRLARWDSGNIKRALQWALFLEDVIGSL  228
            GW++P+ISL+DLL  IKGF+D+LILASGYQSSG  A WD  NIK+A++W +F EDV+  L
Sbjct  2    GWSHPDISLDDLLVLIKGFVDILILASGYQSSGLSASWDVENIKKAVRWGIFFEDVLRHL  61

Query  229  NSQDEYRDSLEELDVALCEMISMPYFPKGLEHLSSKTLSNARNLMLEHLTHTLPLRDLHL  408
            +   +Y DS++ELD AL  + S P FP+GL H+SS TLS AR+L+LEHL  T PL   H+
Sbjct  62   HDSVDYEDSIKELDAALLHLTSSPNFPQGLAHMSSATLSKARDLILEHLVQTHPLEAAHI  121

Query  409  RALVTATVEMDFHMLPNADSDCLDKHFEELM-HSES  513
             +L+TA VE+D   L + D+D  + + + LM H ES
Sbjct  122  TSLLTAIVELDIDNLTDTDNDGPNMYMDRLMLHLES  157



>ref|XP_008796366.1| PREDICTED: uncharacterized protein LOC103711847 isoform X1 [Phoenix 
dactylifera]
Length=522

 Score =   164 bits (414),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 83/156 (53%), Positives = 112/156 (72%), Gaps = 1/156 (1%)
 Frame = +1

Query  49   GWNYPEISLEDLLKAIKGFIDMLILASGYQSSGRLARWDSGNIKRALQWALFLEDVIGSL  228
            GW++P+ISL+DLL  IKGF+D+LILASGYQSSG  A WD  NIK+A++W +F EDV+  L
Sbjct  2    GWSHPDISLDDLLVLIKGFVDILILASGYQSSGLSASWDVENIKKAVRWGIFFEDVLRHL  61

Query  229  NSQDEYRDSLEELDVALCEMISMPYFPKGLEHLSSKTLSNARNLMLEHLTHTLPLRDLHL  408
            +   +Y DS++ELD AL  + S P FP+GL H+SS TLS AR+L+LEHL  T PL   H+
Sbjct  62   HDSVDYEDSIKELDAALLHLTSSPNFPQGLAHMSSATLSKARDLILEHLVQTHPLEAAHI  121

Query  409  RALVTATVEMDFHMLPNADSDCLDKHFEELM-HSES  513
             +L+TA VE+D   L + D+D  + + + LM H ES
Sbjct  122  TSLLTAIVELDIDNLTDTDNDGPNMYMDRLMLHLES  157



>gb|EYU46407.1| hypothetical protein MIMGU_mgv1a017685mg, partial [Erythranthe 
guttata]
Length=436

 Score =   161 bits (407),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 89/163 (55%), Positives = 115/163 (71%), Gaps = 2/163 (1%)
 Frame = +1

Query  49   GWNYPEISLEDLLKAIKGFIDMLILASGYQSSGRLARWDSGNIKRALQWALFLEDVIGSL  228
            GW+YPE S+ DL+K I+ FIDMLILASGYQSSGRLA WDS NI +   WALFLE+V   L
Sbjct  2    GWSYPESSMADLIKLIETFIDMLILASGYQSSGRLAHWDSHNIIKCFHWALFLENVSKKL  61

Query  229  NSQDEYRDSLEELDVALCEMISMPYFPKGLEHLSSKTLSNARNLMLEHLTHTLPLRDLHL  408
             S  +Y  S++ELD AL E+   P+FP+GL  LS  TL  +R+L+LEHL  TLPLRD HL
Sbjct  62   TSSIDYEASVKELDAALYELTCNPHFPQGLARLSCSTLGRSRDLLLEHLVLTLPLRDSHL  121

Query  409  RALVTATVEMDFHMLPNADSDCLDKHFEELMHSESKKPAFNVS  537
            +A+++A+VEMDF      D+DC+D + E+LM      P+ + S
Sbjct  122  KAIMSASVEMDFS--KRLDNDCVDVYVEKLMRIPLNAPSLSES  162



>ref|XP_010522550.1| PREDICTED: uncharacterized protein LOC104801132 [Tarenaya hassleriana]
Length=403

 Score =   154 bits (390),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 94/129 (73%), Gaps = 0/129 (0%)
 Frame = +1

Query  52   WNYPEISLEDLLKAIKGFIDMLILASGYQSSGRLARWDSGNIKRALQWALFLEDVIGSLN  231
            WNYPEISLEDL+K +KGF+DMLIL SG+QSSG  A+WD+ N ++ALQW LF E+V+ S+ 
Sbjct  3    WNYPEISLEDLMKLVKGFVDMLILTSGHQSSGFPAQWDAENCRKALQWGLFFENVLKSIT  62

Query  232  SQDEYRDSLEELDVALCEMISMPYFPKGLEHLSSKTLSNARNLMLEHLTHTLPLRDLHLR  411
            S D+Y  S+ ELD A+ EM S P FPKGL  LSS TL   R  +L HL   + LRD HL+
Sbjct  63   SSDKYAKSVIELDEAISEMKSNPLFPKGLGSLSSSTLIKGREFVLGHLVDNVTLRDKHLK  122

Query  412  ALVTATVEM  438
            A++ A VE+
Sbjct  123  AILVAAVEL  131



>emb|CDY13133.1| BnaA09g16840D [Brassica napus]
Length=391

 Score =   145 bits (366),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 93/128 (73%), Gaps = 0/128 (0%)
 Frame = +1

Query  52   WNYPEISLEDLLKAIKGFIDMLILASGYQSSGRLARWDSGNIKRALQWALFLEDVIGSLN  231
            WNYPEIS ED  K +KGF+D+LILASG+QSSG  A WD+ N ++ALQW LF E+++ S+N
Sbjct  3    WNYPEISKEDFTKLLKGFVDLLILASGFQSSGVPAHWDAENCRKALQWGLFFENMLRSIN  62

Query  232  SQDEYRDSLEELDVALCEMISMPYFPKGLEHLSSKTLSNARNLMLEHLTHTLPLRDLHLR  411
            S + + +S  E++ A+ EM S P FPKGLE+LSS TLS  R  +LEHL +   L+D  L+
Sbjct  63   SSETFGESAREVEEAISEMKSNPLFPKGLENLSSDTLSKGREFVLEHLMNNSTLKDTQLQ  122

Query  412  ALVTATVE  435
            A++ A VE
Sbjct  123  AVLVAAVE  130



>ref|XP_010494400.1| PREDICTED: uncharacterized protein LOC104771558 [Camelina sativa]
Length=394

 Score =   145 bits (366),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 93/128 (73%), Gaps = 0/128 (0%)
 Frame = +1

Query  52   WNYPEISLEDLLKAIKGFIDMLILASGYQSSGRLARWDSGNIKRALQWALFLEDVIGSLN  231
            WNYPEIS ED +K +KGF+D+LILASG+QSSG  + WD+ N K+ALQW LF E+V+ S+ 
Sbjct  3    WNYPEISKEDFVKLLKGFVDLLILASGFQSSGVPSHWDAENCKKALQWGLFFENVVRSIT  62

Query  232  SQDEYRDSLEELDVALCEMISMPYFPKGLEHLSSKTLSNARNLMLEHLTHTLPLRDLHLR  411
            S D + +S+ E+D A+ EM + P FPKGLE LSS +L   R L+LEHL +   L+D  L+
Sbjct  63   SSDVFGESMSEVDEAISEMKANPLFPKGLEDLSSDSLLQGRELVLEHLMNNSALKDKQLQ  122

Query  412  ALVTATVE  435
            A++ A VE
Sbjct  123  AILVAAVE  130



>ref|XP_010481787.1| PREDICTED: uncharacterized protein LOC104760547 isoform X1 [Camelina 
sativa]
Length=395

 Score =   145 bits (365),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 94/129 (73%), Gaps = 0/129 (0%)
 Frame = +1

Query  52   WNYPEISLEDLLKAIKGFIDMLILASGYQSSGRLARWDSGNIKRALQWALFLEDVIGSLN  231
            WNYPEIS ED +K +KGF+D+LILASG+QSSG  + WD+ N K+ALQW LF E+V+ S+ 
Sbjct  3    WNYPEISKEDFVKLLKGFVDLLILASGFQSSGVPSHWDAENCKKALQWGLFFENVVRSIT  62

Query  232  SQDEYRDSLEELDVALCEMISMPYFPKGLEHLSSKTLSNARNLMLEHLTHTLPLRDLHLR  411
            S D + +S+ ELD A+ E+ + P FPKGLE LSS +L   R  +LEHL + L L+D  L+
Sbjct  63   SSDVFGESMSELDEAISELKANPLFPKGLEDLSSDSLLQGREFVLEHLMNNLALKDKQLQ  122

Query  412  ALVTATVEM  438
            A++ A +E+
Sbjct  123  AVLVAALEL  131



>emb|CDY36965.1| BnaC09g17810D [Brassica napus]
Length=389

 Score =   144 bits (364),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 93/128 (73%), Gaps = 0/128 (0%)
 Frame = +1

Query  52   WNYPEISLEDLLKAIKGFIDMLILASGYQSSGRLARWDSGNIKRALQWALFLEDVIGSLN  231
            WNYPEIS ED  K +KGF+D+LILASG+QSSG  A WD+ N ++ALQW LF E+++ S+N
Sbjct  3    WNYPEISKEDFTKLLKGFVDLLILASGFQSSGVPAHWDAENCRKALQWGLFFENMLRSIN  62

Query  232  SQDEYRDSLEELDVALCEMISMPYFPKGLEHLSSKTLSNARNLMLEHLTHTLPLRDLHLR  411
            S + + +S  E++ A+ EM S P FPKG+E+LSS TLS  R  +LEHL +   L+D  L+
Sbjct  63   SSETFGESAREVEEAISEMQSNPLFPKGMENLSSDTLSKGREFVLEHLMNNSTLKDTQLQ  122

Query  412  ALVTATVE  435
            A++ A VE
Sbjct  123  AVLVAAVE  130



>ref|XP_009113957.1| PREDICTED: uncharacterized protein LOC103839210 isoform X2 [Brassica 
rapa]
Length=391

 Score =   143 bits (361),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 93/128 (73%), Gaps = 0/128 (0%)
 Frame = +1

Query  52   WNYPEISLEDLLKAIKGFIDMLILASGYQSSGRLARWDSGNIKRALQWALFLEDVIGSLN  231
            WNYPEIS ED  K +KGF+D+LILASG+QSSG  A WD+ N ++ALQW LF E+++ S+N
Sbjct  3    WNYPEISKEDFTKLLKGFVDLLILASGFQSSGVPAHWDAENCRKALQWGLFFENMLRSIN  62

Query  232  SQDEYRDSLEELDVALCEMISMPYFPKGLEHLSSKTLSNARNLMLEHLTHTLPLRDLHLR  411
            S + + +++ E++ A+ EM S P FPKG+E+LSS TLS  R  +LEHL +   L+D  L+
Sbjct  63   SSERFGETVSEVEEAISEMKSNPLFPKGMENLSSDTLSKGREFVLEHLMNNSTLKDTQLQ  122

Query  412  ALVTATVE  435
             ++ A VE
Sbjct  123  VVLVAAVE  130



>ref|XP_010441939.1| PREDICTED: uncharacterized protein LOC104725040 [Camelina sativa]
Length=395

 Score =   141 bits (356),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 92/129 (71%), Gaps = 0/129 (0%)
 Frame = +1

Query  52   WNYPEISLEDLLKAIKGFIDMLILASGYQSSGRLARWDSGNIKRALQWALFLEDVIGSLN  231
            WNYPEIS ED +K +KGF+D+LILASG+QSSG  + WD+ N K+AL W LF E+V+ S+ 
Sbjct  3    WNYPEISKEDFVKLLKGFVDLLILASGFQSSGVPSHWDAENCKKALHWGLFFENVVRSIT  62

Query  232  SQDEYRDSLEELDVALCEMISMPYFPKGLEHLSSKTLSNARNLMLEHLTHTLPLRDLHLR  411
            S D + +S+ ELD A+ EM + P FPKGLE LSS +L   R  +LEHL +   L+D  L+
Sbjct  63   SSDLFGESMSELDEAISEMKANPLFPKGLEDLSSDSLLKGREFVLEHLMNNSGLKDKQLQ  122

Query  412  ALVTATVEM  438
            A++ A VE+
Sbjct  123  AVLVAGVEL  131



>gb|KFK31671.1| hypothetical protein AALP_AA6G143800 [Arabis alpina]
Length=396

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 91/128 (71%), Gaps = 0/128 (0%)
 Frame = +1

Query  52   WNYPEISLEDLLKAIKGFIDMLILASGYQSSGRLARWDSGNIKRALQWALFLEDVIGSLN  231
            WNYPEIS E+ +K +KGF+D+LILASG+QSSG  + WD+ N K+ALQW LF E+VI  + 
Sbjct  3    WNYPEISKEEFVKLLKGFVDLLILASGFQSSGVPSHWDAQNCKKALQWGLFFENVIKGIT  62

Query  232  SQDEYRDSLEELDVALCEMISMPYFPKGLEHLSSKTLSNARNLMLEHLTHTLPLRDLHLR  411
            S D + +S+ E++ A+ +M S P FPKGLE+LS  TL   R  +LEHL +   L+D  L+
Sbjct  63   SSDTFGESVIEIEEAISDMKSNPLFPKGLENLSLVTLLEGREFVLEHLLNNSALKDKQLQ  122

Query  412  ALVTATVE  435
            A++ A VE
Sbjct  123  AILVAAVE  130



>ref|XP_009113956.1| PREDICTED: uncharacterized protein LOC103839210 isoform X1 [Brassica 
rapa]
Length=397

 Score =   137 bits (344),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 66/134 (49%), Positives = 93/134 (69%), Gaps = 6/134 (4%)
 Frame = +1

Query  52   WNYPEISLEDLLKAIKGFIDMLILASGYQSSGRLARWDSGNIKRALQWALFLEDVIGSLN  231
            WNYPEIS ED  K +KGF+D+LILASG+QSSG  A WD+ N ++ALQW LF E+++ S+N
Sbjct  3    WNYPEISKEDFTKLLKGFVDLLILASGFQSSGVPAHWDAENCRKALQWGLFFENMLRSIN  62

Query  232  SQDEYRDSLEELDVALCEMISMPYFPK------GLEHLSSKTLSNARNLMLEHLTHTLPL  393
            S + + +++ E++ A+ EM S P FPK      G+E+LSS TLS  R  +LEHL +   L
Sbjct  63   SSERFGETVSEVEEAISEMKSNPLFPKVGSDLQGMENLSSDTLSKGREFVLEHLMNNSTL  122

Query  394  RDLHLRALVTATVE  435
            +D  L+ ++ A VE
Sbjct  123  KDTQLQVVLVAAVE  136



>ref|XP_009385583.1| PREDICTED: uncharacterized protein LOC103972912 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=468

 Score =   131 bits (330),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 95/132 (72%), Gaps = 0/132 (0%)
 Frame = +1

Query  52   WNYPEISLEDLLKAIKGFIDMLILASGYQSSGRLARWDSGNIKRALQWALFLEDVIGSLN  231
            W +P+I+L DL++ IKGF+D+LILA+GYQSSG  A WD+ +IK A++W LF +DV   +N
Sbjct  3    WCHPDITLGDLMQLIKGFVDILILANGYQSSGLPAVWDAPSIKNAVRWGLFFQDVFKRIN  62

Query  232  SQDEYRDSLEELDVALCEMISMPYFPKGLEHLSSKTLSNARNLMLEHLTHTLPLRDLHLR  411
                + +S++ELD AL  ++S P+ P+GL HL+S +LS AR+L++E L  +  +   HL 
Sbjct  63   DSCHFDNSMKELDAALRNLMSNPFCPQGLVHLTSTSLSRARDLVIECLVQSHIMGAKHLT  122

Query  412  ALVTATVEMDFH  447
            +L+TA +EMD +
Sbjct  123  SLLTAVIEMDVN  134



>ref|XP_006648095.1| PREDICTED: uncharacterized protein LOC102713987 isoform X1 [Oryza 
brachyantha]
Length=451

 Score =   126 bits (317),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 62/152 (41%), Positives = 95/152 (63%), Gaps = 3/152 (2%)
 Frame = +1

Query  49   GWNYPEISLEDLLKAIKGFIDMLILASGYQSSGRLARWDSGNIKRALQWALFLEDVIGSL  228
            GW +  +++E++L  ++ F+D+L+LA G  SSG  A W SG++K+A QWALF E+V  +L
Sbjct  2    GWAHETVAMEEVLALVRSFVDVLVLAGGSTSSGSAAAWRSGDVKKAFQWALFFEEVFKNL  61

Query  229  NSQDEYRDSLEELDVALCEMISMPYFPKGLEHLSSKTLSNARNLMLEHLTHTLPLRDLHL  408
                 Y DS  +LD AL E+ S P FPKG+E L SKTLS AR L+++H   T  + +L  
Sbjct  62   RDIGRYDDSARDLDAALVELTSSPNFPKGIEDLRSKTLSRARELVVKHFLKTTSVDNLG-  120

Query  409  RALVTATVEMDFH-MLPNADSDCLDKHFEELM  501
             A++ A VEMD   + P+ + D   ++   ++
Sbjct  121  -AVLEAVVEMDIDGICPSGERDVCQEYVRSIL  151



>ref|NP_001048494.1| Os02g0814600 [Oryza sativa Japonica Group]
 dbj|BAF10408.1| Os02g0814600 [Oryza sativa Japonica Group]
Length=453

 Score =   126 bits (316),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 62/142 (44%), Positives = 93/142 (65%), Gaps = 3/142 (2%)
 Frame = +1

Query  49   GWNYPEISLEDLLKAIKGFIDMLILASGYQSSGRLARWDSGNIKRALQWALFLEDVIGSL  228
            GW +  +++E+LL  ++GF+D+L+LA G  SSG  A W SG++K+ALQWALF E+V  +L
Sbjct  2    GWAHETVAMEELLGLVRGFVDVLVLAGGRTSSGAAATWRSGDVKKALQWALFFEEVFKNL  61

Query  229  NSQDEYRDSLEELDVALCEMISMPYFPKGLEHLSSKTLSNARNLMLEHLTHTLPLRDLHL  408
                +Y +S  ELD AL ++ S P FPKG+E + SKTL+ AR L+++H   T    +L  
Sbjct  62   RDDGQYDESASELDAALVQLASSPNFPKGIEDIRSKTLAMARELVVKHFLKTTNAENLG-  120

Query  409  RALVTATVEMDFHMLPNADSDC  474
             A++ A VEMD   + +A  +C
Sbjct  121  -AVLQAVVEMDMDGI-SASGEC  140



>gb|EEC74229.1| hypothetical protein OsI_09416 [Oryza sativa Indica Group]
Length=761

 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 62/142 (44%), Positives = 93/142 (65%), Gaps = 3/142 (2%)
 Frame = +1

Query  49   GWNYPEISLEDLLKAIKGFIDMLILASGYQSSGRLARWDSGNIKRALQWALFLEDVIGSL  228
            GW +  +++E+LL  ++GF+D+L+LA G  SSG  A W SG++K+ALQWALF E+V  +L
Sbjct  2    GWAHETVAMEELLGLVRGFVDVLVLAGGRTSSGAAATWRSGDVKKALQWALFFEEVFKNL  61

Query  229  NSQDEYRDSLEELDVALCEMISMPYFPKGLEHLSSKTLSNARNLMLEHLTHTLPLRDLHL  408
                +Y +S  ELD AL ++ S P FPKG+E + SKTL+ AR L+++H   T    +L  
Sbjct  62   RDDGQYDESASELDAALVQLASSPNFPKGIEDIRSKTLAMARELVVKHFLKTTNAENLG-  120

Query  409  RALVTATVEMDFHMLPNADSDC  474
             A++ A VEMD   + +A  +C
Sbjct  121  -AVLQAVVEMDMDGI-SASGEC  140



>ref|XP_010235955.1| PREDICTED: uncharacterized protein LOC100826137 isoform X1 [Brachypodium 
distachyon]
Length=475

 Score =   120 bits (302),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 63/154 (41%), Positives = 92/154 (60%), Gaps = 5/154 (3%)
 Frame = +1

Query  49   GWNYPEISLEDLLKAIKGFIDMLILASGYQSSGRLARWDSGNIKRALQWALFLEDVIGSL  228
            GW    +++E++L  + GF+D+L+LA G  S G  A W SG++++AL+WALF E+V  +L
Sbjct  2    GWELSAVTMEEVLGLVPGFVDILVLAGGRTSYGTAATWRSGDVQKALRWALFFEEVFRNL  61

Query  229  NSQDEYRDSLEELDVALCEMISMPYFPKGLEHLSSKTLSNARNLMLEHLTHTLPLRDLHL  408
                +Y DS  E D AL E+ S P FPKGL  + S TL+ AR L+L+H      +   +L
Sbjct  62   RDTGQYEDSAREFDAALVELTSSPDFPKGLADMRSGTLAMARVLVLKHFLKAKTMSVENL  121

Query  409  RALVTATVEMDFHMLPNADSDCLDKH-FEELMHS  507
            RAL+ A VEMD     +    C   H F+E ++S
Sbjct  122  RALLEAVVEMDV----DGIGGCGGHHAFQEYVNS  151



>ref|XP_003570377.1| PREDICTED: uncharacterized protein LOC100826137 isoform X2 [Brachypodium 
distachyon]
Length=455

 Score =   120 bits (301),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 63/154 (41%), Positives = 92/154 (60%), Gaps = 5/154 (3%)
 Frame = +1

Query  49   GWNYPEISLEDLLKAIKGFIDMLILASGYQSSGRLARWDSGNIKRALQWALFLEDVIGSL  228
            GW    +++E++L  + GF+D+L+LA G  S G  A W SG++++AL+WALF E+V  +L
Sbjct  2    GWELSAVTMEEVLGLVPGFVDILVLAGGRTSYGTAATWRSGDVQKALRWALFFEEVFRNL  61

Query  229  NSQDEYRDSLEELDVALCEMISMPYFPKGLEHLSSKTLSNARNLMLEHLTHTLPLRDLHL  408
                +Y DS  E D AL E+ S P FPKGL  + S TL+ AR L+L+H      +   +L
Sbjct  62   RDTGQYEDSAREFDAALVELTSSPDFPKGLADMRSGTLAMARVLVLKHFLKAKTMSVENL  121

Query  409  RALVTATVEMDFHMLPNADSDCLDKH-FEELMHS  507
            RAL+ A VEMD     +    C   H F+E ++S
Sbjct  122  RALLEAVVEMDV----DGIGGCGGHHAFQEYVNS  151



>dbj|BAD21667.1| unknown protein [Oryza sativa Japonica Group]
Length=444

 Score =   119 bits (297),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 88/134 (66%), Gaps = 3/134 (2%)
 Frame = +1

Query  73   LEDLLKAIKGFIDMLILASGYQSSGRLARWDSGNIKRALQWALFLEDVIGSLNSQDEYRD  252
            +E+LL  ++GF+D+L+LA G  SSG  A W SG++K+ALQWALF E+V  +L    +Y +
Sbjct  1    MEELLGLVRGFVDVLVLAGGRTSSGAAATWRSGDVKKALQWALFFEEVFKNLRDDGQYDE  60

Query  253  SLEELDVALCEMISMPYFPKGLEHLSSKTLSNARNLMLEHLTHTLPLRDLHLRALVTATV  432
            S  ELD AL ++ S P FPKG+E + SKTL+ AR L+++H   T    +L   A++ A V
Sbjct  61   SASELDAALVQLASSPNFPKGIEDIRSKTLAMARELVVKHFLKTTNAENLG--AVLQAVV  118

Query  433  EMDFHMLPNADSDC  474
            EMD   + +A  +C
Sbjct  119  EMDMDGI-SASGEC  131



>ref|XP_004954345.1| PREDICTED: uncharacterized protein LOC101763564 isoform X3 [Setaria 
italica]
Length=397

 Score =   117 bits (292),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/143 (41%), Positives = 83/143 (58%), Gaps = 5/143 (3%)
 Frame = +1

Query  49   GWNYPEISLEDLLKAIKGFIDMLILASGYQSSGRLARWDSGNIKRALQWALFLEDVIGSL  228
            GW +  +++E++L  ++GF+D+L+LA G  SSG  A W S  +K+A +WA F E+V   L
Sbjct  2    GWAHAAVAMEEVLGLVRGFVDVLVLAGGRTSSGAAATWSSDEVKKAFRWAFFFEEVFKDL  61

Query  229  NSQDEYRDSLEELDVALCEMISMPYFPKGLEHLSSKTLSNARNLMLEHLTHTLPLRDLHL  408
                 Y DS  ELD AL ++ S P FPKGL  + S+TLS AR L++ H      +   + 
Sbjct  62   RESGHYEDSAGELDAALVQLTSSPEFPKGLAGMRSETLSKARVLVIRHFLKAKAMSVQNF  121

Query  409  RALVTATVEMDF-----HMLPNA  462
             AL+ A VEMD        +PNA
Sbjct  122  GALLEAVVEMDIDGICASGVPNA  144



>ref|XP_004954344.1| PREDICTED: uncharacterized protein LOC101763564 isoform X2 [Setaria 
italica]
Length=431

 Score =   117 bits (292),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/143 (41%), Positives = 83/143 (58%), Gaps = 5/143 (3%)
 Frame = +1

Query  49   GWNYPEISLEDLLKAIKGFIDMLILASGYQSSGRLARWDSGNIKRALQWALFLEDVIGSL  228
            GW +  +++E++L  ++GF+D+L+LA G  SSG  A W S  +K+A +WA F E+V   L
Sbjct  2    GWAHAAVAMEEVLGLVRGFVDVLVLAGGRTSSGAAATWSSDEVKKAFRWAFFFEEVFKDL  61

Query  229  NSQDEYRDSLEELDVALCEMISMPYFPKGLEHLSSKTLSNARNLMLEHLTHTLPLRDLHL  408
                 Y DS  ELD AL ++ S P FPKGL  + S+TLS AR L++ H      +   + 
Sbjct  62   RESGHYEDSAGELDAALVQLTSSPEFPKGLAGMRSETLSKARVLVIRHFLKAKAMSVQNF  121

Query  409  RALVTATVEMDF-----HMLPNA  462
             AL+ A VEMD        +PNA
Sbjct  122  GALLEAVVEMDIDGICASGVPNA  144



>gb|EEE58033.1| hypothetical protein OsJ_08851 [Oryza sativa Japonica Group]
Length=752

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 88/134 (66%), Gaps = 3/134 (2%)
 Frame = +1

Query  73   LEDLLKAIKGFIDMLILASGYQSSGRLARWDSGNIKRALQWALFLEDVIGSLNSQDEYRD  252
            +E+LL  ++GF+D+L+LA G  SSG  A W SG++K+ALQWALF E+V  +L    +Y +
Sbjct  1    MEELLGLVRGFVDVLVLAGGRTSSGAAATWRSGDVKKALQWALFFEEVFKNLRDDGQYDE  60

Query  253  SLEELDVALCEMISMPYFPKGLEHLSSKTLSNARNLMLEHLTHTLPLRDLHLRALVTATV  432
            S  ELD AL ++ S P FPKG+E + SKTL+ AR L+++H   T    +L   A++ A V
Sbjct  61   SASELDAALVQLASSPNFPKGIEDIRSKTLAMARELVVKHFLKTTNAENLG--AVLQAVV  118

Query  433  EMDFHMLPNADSDC  474
            EMD   + +A  +C
Sbjct  119  EMDMDGI-SASGEC  131



>ref|XP_004954343.1| PREDICTED: uncharacterized protein LOC101763564 isoform X1 [Setaria 
italica]
Length=452

 Score =   117 bits (292),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/143 (41%), Positives = 83/143 (58%), Gaps = 5/143 (3%)
 Frame = +1

Query  49   GWNYPEISLEDLLKAIKGFIDMLILASGYQSSGRLARWDSGNIKRALQWALFLEDVIGSL  228
            GW +  +++E++L  ++GF+D+L+LA G  SSG  A W S  +K+A +WA F E+V   L
Sbjct  2    GWAHAAVAMEEVLGLVRGFVDVLVLAGGRTSSGAAATWSSDEVKKAFRWAFFFEEVFKDL  61

Query  229  NSQDEYRDSLEELDVALCEMISMPYFPKGLEHLSSKTLSNARNLMLEHLTHTLPLRDLHL  408
                 Y DS  ELD AL ++ S P FPKGL  + S+TLS AR L++ H      +   + 
Sbjct  62   RESGHYEDSAGELDAALVQLTSSPEFPKGLAGMRSETLSKARVLVIRHFLKAKAMSVQNF  121

Query  409  RALVTATVEMDFHML-----PNA  462
             AL+ A VEMD   +     PNA
Sbjct  122  GALLEAVVEMDIDGICASGVPNA  144



>ref|XP_009385584.1| PREDICTED: uncharacterized protein LOC103972912 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=452

 Score =   115 bits (288),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 59/132 (45%), Positives = 87/132 (66%), Gaps = 16/132 (12%)
 Frame = +1

Query  52   WNYPEISLEDLLKAIKGFIDMLILASGYQSSGRLARWDSGNIKRALQWALFLEDVIGSLN  231
            W +P+I+L DL++ IKGF+D+LILA+GYQSSG  A WD+ +IK A++W LF +D      
Sbjct  3    WCHPDITLGDLMQLIKGFVDILILANGYQSSGLPAVWDAPSIKNAVRWGLFFQD------  56

Query  232  SQDEYRDSLEELDVALCEMISMPYFPKGLEHLSSKTLSNARNLMLEHLTHTLPLRDLHLR  411
                      ELD AL  ++S P+ P+GL HL+S +LS AR+L++E L  +  +   HL 
Sbjct  57   ----------ELDAALRNLMSNPFCPQGLVHLTSTSLSRARDLVIECLVQSHIMGAKHLT  106

Query  412  ALVTATVEMDFH  447
            +L+TA +EMD +
Sbjct  107  SLLTAVIEMDVN  118



>ref|XP_002454769.1| hypothetical protein SORBIDRAFT_04g036960 [Sorghum bicolor]
 gb|EES07745.1| hypothetical protein SORBIDRAFT_04g036960 [Sorghum bicolor]
Length=407

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/153 (37%), Positives = 90/153 (59%), Gaps = 2/153 (1%)
 Frame = +1

Query  49   GWNYPEISLEDLLKAIKGFIDMLILASGYQSSGRLARWDSGNIKRALQWALFLEDVIGSL  228
            GW +P +++E++L+ ++GF+D+L+LA G  SSG  A W +  +K+AL+WALF E++   L
Sbjct  2    GWAHPAVAMEEVLRLVRGFVDVLVLAGGRTSSGAAATWSAEEVKKALRWALFFEEIFKDL  61

Query  229  NSQDEYRDSLEELDVALCEMISMPYFPKGLEHLSSKTLSNARNLMLEHLTHTLPLRDLHL  408
                +Y DS  ELD AL E+ S P FPKGL  + S+ LS AR L++ H        +  +
Sbjct  62   RDSGQYEDSARELDAALLELTSSPGFPKGLAVVRSEMLSMARVLVVRHFLKAKTTMNARV  121

Query  409  RALVTATVEMDFHMLPNADSDCLDKHFEELMHS  507
              L T++ E+  H      S  + K F++ + S
Sbjct  122  GGLPTSSDEL--HAESTGHSRIIVKEFQKTLDS  152



>ref|NP_001143738.1| uncharacterized protein LOC100276492 [Zea mays]
 gb|ACG34849.1| hypothetical protein [Zea mays]
Length=456

 Score =   112 bits (281),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 55/132 (42%), Positives = 80/132 (61%), Gaps = 0/132 (0%)
 Frame = +1

Query  49   GWNYPEISLEDLLKAIKGFIDMLILASGYQSSGRLARWDSGNIKRALQWALFLEDVIGSL  228
            GW +P +++E++L+ ++GF+D+L+LA G  SSG  A W +  IK+AL+WALF E++   L
Sbjct  2    GWAHPAVTMEEVLRLVRGFVDVLVLAGGRTSSGAAATWSADEIKKALRWALFFEEIFKDL  61

Query  229  NSQDEYRDSLEELDVALCEMISMPYFPKGLEHLSSKTLSNARNLMLEHLTHTLPLRDLHL  408
                +Y DS  ELD AL E+ S P FPKGL  + S  LS AR L++ H      +   + 
Sbjct  62   LDSGQYEDSARELDAALLELTSSPEFPKGLAAVRSDLLSMARVLVMRHFLKPNTMSVENF  121

Query  409  RALVTATVEMDF  444
             AL+ A   MD 
Sbjct  122  CALLEAVAGMDI  133



>ref|XP_008676964.1| PREDICTED: uncharacterized protein LOC100276492 isoform X1 [Zea 
mays]
 gb|AFW64025.1| (csu525(rpL17)), mRNA [Zea mays]
Length=457

 Score =   112 bits (281),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 55/132 (42%), Positives = 80/132 (61%), Gaps = 0/132 (0%)
 Frame = +1

Query  49   GWNYPEISLEDLLKAIKGFIDMLILASGYQSSGRLARWDSGNIKRALQWALFLEDVIGSL  228
            GW +P +++E++L+ ++GF+D+L+LA G  SSG  A W +  IK+AL+WALF E++   L
Sbjct  2    GWAHPAVTMEEVLRLVRGFVDVLVLAGGRTSSGAAATWSADEIKKALRWALFFEEIFKDL  61

Query  229  NSQDEYRDSLEELDVALCEMISMPYFPKGLEHLSSKTLSNARNLMLEHLTHTLPLRDLHL  408
                +Y DS  ELD AL E+ S P FPKGL  + S  LS AR L++ H      +   + 
Sbjct  62   LDSGQYEDSARELDAALLELTSSPEFPKGLAAVRSDLLSMARVLVMRHFLKPNTMSVENF  121

Query  409  RALVTATVEMDF  444
             AL+ A   MD 
Sbjct  122  CALLEAVAGMDI  133



>ref|XP_008676965.1| PREDICTED: uncharacterized protein LOC100276492 isoform X2 [Zea 
mays]
Length=447

 Score =   112 bits (281),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 55/132 (42%), Positives = 80/132 (61%), Gaps = 0/132 (0%)
 Frame = +1

Query  49   GWNYPEISLEDLLKAIKGFIDMLILASGYQSSGRLARWDSGNIKRALQWALFLEDVIGSL  228
            GW +P +++E++L+ ++GF+D+L+LA G  SSG  A W +  IK+AL+WALF E++   L
Sbjct  2    GWAHPAVTMEEVLRLVRGFVDVLVLAGGRTSSGAAATWSADEIKKALRWALFFEEIFKDL  61

Query  229  NSQDEYRDSLEELDVALCEMISMPYFPKGLEHLSSKTLSNARNLMLEHLTHTLPLRDLHL  408
                +Y DS  ELD AL E+ S P FPKGL  + S  LS AR L++ H      +   + 
Sbjct  62   LDSGQYEDSARELDAALLELTSSPEFPKGLAAVRSDLLSMARVLVMRHFLKPNTMSVENF  121

Query  409  RALVTATVEMDF  444
             AL+ A   MD 
Sbjct  122  CALLEAVAGMDI  133



>gb|EMT07674.1| hypothetical protein F775_00616 [Aegilops tauschii]
Length=700

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/125 (40%), Positives = 78/125 (62%), Gaps = 0/125 (0%)
 Frame = +1

Query  70   SLEDLLKAIKGFIDMLILASGYQSSGRLARWDSGNIKRALQWALFLEDVIGSLNSQDEYR  249
            ++E++L  + GF+D+L+LA G  S G  A W  G++++AL+WALF E++  +L    +Y 
Sbjct  3    AMEEVLALVPGFVDILVLAGGRTSPGAAAAWRPGDVQKALRWALFFEEIFRNLRDSGQYE  62

Query  250  DSLEELDVALCEMISMPYFPKGLEHLSSKTLSNARNLMLEHLTHTLPLRDLHLRALVTAT  429
            DS+ E D AL E+ S P FPKGL  + S+TLS A  L+++H          ++RA++ A 
Sbjct  63   DSVREFDAALVELASSPGFPKGLADMRSETLSAATELVIKHFLKAETTSVENIRAVLEAV  122

Query  430  VEMDF  444
            V MD 
Sbjct  123  VGMDI  127



>ref|XP_010481788.1| PREDICTED: uncharacterized protein LOC104760547 isoform X2 [Camelina 
sativa]
Length=362

 Score =   100 bits (249),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 72/129 (56%), Gaps = 33/129 (26%)
 Frame = +1

Query  52   WNYPEISLEDLLKAIKGFIDMLILASGYQSSGRLARWDSGNIKRALQWALFLEDVIGSLN  231
            WNYPEIS ED +K +KGF+D+LILASG+QSSG  + WD+ N K+ALQW LF E+      
Sbjct  3    WNYPEISKEDFVKLLKGFVDLLILASGFQSSGVPSHWDAENCKKALQWGLFFEN------  56

Query  232  SQDEYRDSLEELDVALCEMISMPYFPKGLEHLSSKTLSNARNLMLEHLTHTLPLRDLHLR  411
                                       GLE LSS +L   R  +LEHL + L L+D  L+
Sbjct  57   ---------------------------GLEDLSSDSLLQGREFVLEHLMNNLALKDKQLQ  89

Query  412  ALVTATVEM  438
            A++ A +E+
Sbjct  90   AVLVAALEL  98



>ref|XP_011011165.1| PREDICTED: uncharacterized protein LOC105115829 isoform X5 [Populus 
euphratica]
Length=412

 Score =   100 bits (248),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 65/91 (71%), Gaps = 0/91 (0%)
 Frame = +1

Query  226  LNSQDEYRDSLEELDVALCEMISMPYFPKGLEHLSSKTLSNARNLMLEHLTHTLPLRDLH  405
            +++ D Y+DS++ELD ALC+M S PYFP+GL +LS  TLS AR+ +L HL  TLPLRD H
Sbjct  1    MSTSDVYQDSIKELDAALCQMKSNPYFPQGLANLSCDTLSRARSFVLAHLFQTLPLRDSH  60

Query  406  LRALVTATVEMDFHMLPNADSDCLDKHFEEL  498
            L+A +TA +EM+   +  ++ DCL  +  +L
Sbjct  61   LKAFLTAVIEMELERVSESEHDCLSVYLNKL  91



>ref|XP_009385585.1| PREDICTED: uncharacterized protein LOC103972912 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=435

 Score = 93.2 bits (230),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 51/132 (39%), Positives = 75/132 (57%), Gaps = 33/132 (25%)
 Frame = +1

Query  52   WNYPEISLEDLLKAIKGFIDMLILASGYQSSGRLARWDSGNIKRALQWALFLEDVIGSLN  231
            W +P+I+L DL++ IKGF+D+LILA+GYQSSG  A WD+ +IK A++W LF +D      
Sbjct  3    WCHPDITLGDLMQLIKGFVDILILANGYQSSGLPAVWDAPSIKNAVRWGLFFQD------  56

Query  232  SQDEYRDSLEELDVALCEMISMPYFPKGLEHLSSKTLSNARNLMLEHLTHTLPLRDLHLR  411
                                       GL HL+S +LS AR+L++E L  +  +   HL 
Sbjct  57   ---------------------------GLVHLTSTSLSRARDLVIECLVQSHIMGAKHLT  89

Query  412  ALVTATVEMDFH  447
            +L+TA +EMD +
Sbjct  90   SLLTAVIEMDVN  101



>ref|XP_002967378.1| hypothetical protein SELMODRAFT_408361 [Selaginella moellendorffii]
 gb|EFJ31977.1| hypothetical protein SELMODRAFT_408361 [Selaginella moellendorffii]
Length=449

 Score = 90.5 bits (223),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 46/118 (39%), Positives = 69/118 (58%), Gaps = 0/118 (0%)
 Frame = +1

Query  49   GWNYPEISLEDLLKAIKGFIDMLILASGYQSSGRLARWDSGNIKRALQWALFLEDVIGSL  228
             W +  +SLE+L++    F+D+L+LASGYQSSG    W    + RA++WA  LE  +   
Sbjct  2    AWAHEAMSLEELIQVASAFLDILVLASGYQSSGAPVFWHPRGVARAMRWAALLERAMRGF  61

Query  229  NSQDEYRDSLEELDVALCEMISMPYFPKGLEHLSSKTLSNARNLMLEHLTHTLPLRDL  402
             + D+ R S+E LD+AL +++     P GL  L+ + LS ARN++L  L    P  DL
Sbjct  62   PATDQGRSSMEILDMALLDLMDATPHPPGLPQLTCRLLSTARNVLLVSLVVAAPDTDL  119



>ref|XP_008356245.1| PREDICTED: uncharacterized protein LOC103419940 [Malus domestica]
Length=369

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 50/71 (70%), Gaps = 0/71 (0%)
 Frame = +1

Query  286  MISMPYFPKGLEHLSSKTLSNARNLMLEHLTHTLPLRDLHLRALVTATVEMDFHMLPNAD  465
            M S   FPKGL HLSS TL+ AR  +LEHL HTLPLRD+HLRAL+TATVE D   L   +
Sbjct  1    MTSAASFPKGLAHLSSXTLAKARRFVLEHLIHTLPLRDVHLRALLTATVEXDLEELSETE  60

Query  466  SDCLDKHFEEL  498
             D L+ +F +L
Sbjct  61   HDFLNAYFNKL  71



>ref|XP_008796368.1| PREDICTED: uncharacterized protein LOC103711847 isoform X3 [Phoenix 
dactylifera]
Length=473

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 66/101 (65%), Gaps = 1/101 (1%)
 Frame = +1

Query  214  VIGSLNSQDEYRDSLEELDVALCEMISMPYFPKGLEHLSSKTLSNARNLMLEHLTHTLPL  393
            V+  L+   +Y DS++ELD AL  + S P FP+GL H+SS TLS AR+L+LEHL  T PL
Sbjct  8    VLRHLHDSVDYEDSIKELDAALLHLTSSPNFPQGLAHMSSATLSKARDLILEHLVQTHPL  67

Query  394  RDLHLRALVTATVEMDFHMLPNADSDCLDKHFEELM-HSES  513
               H+ +L+TA VE+D   L + D+D  + + + LM H ES
Sbjct  68   EAAHITSLLTAIVELDIDNLTDTDNDGPNMYMDRLMLHLES  108



>dbj|BAB09061.1| unnamed protein product [Arabidopsis thaliana]
Length=360

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 62/128 (48%), Gaps = 40/128 (31%)
 Frame = +1

Query  52   WNYPEISLEDLLKAIKGFIDMLILASGYQSSGRLARWDSGNIKRALQWALFLEDVIGSLN  231
            WNYPEIS ED +K +KG                                        S+N
Sbjct  3    WNYPEISKEDFIKLLKG----------------------------------------SIN  22

Query  232  SQDEYRDSLEELDVALCEMISMPYFPKGLEHLSSKTLSNARNLMLEHLTHTLPLRDLHLR  411
            S D + +S+ ELD A+ EM S P FPKGLE+LSS  LS  R  +LEHL +   L+D  L+
Sbjct  23   SSDTFGESMRELDEAISEMKSNPLFPKGLENLSSDNLSKGREFVLEHLMNNSTLKDKQLQ  82

Query  412  ALVTATVE  435
            A++ A VE
Sbjct  83   AILVAAVE  90



>ref|NP_199214.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AED95048.1| uncharacterized protein AT5G44010 [Arabidopsis thaliana]
Length=357

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 62/128 (48%), Gaps = 40/128 (31%)
 Frame = +1

Query  52   WNYPEISLEDLLKAIKGFIDMLILASGYQSSGRLARWDSGNIKRALQWALFLEDVIGSLN  231
            WNYPEIS ED +K +KG                                        S+N
Sbjct  3    WNYPEISKEDFIKLLKG----------------------------------------SIN  22

Query  232  SQDEYRDSLEELDVALCEMISMPYFPKGLEHLSSKTLSNARNLMLEHLTHTLPLRDLHLR  411
            S D + +S+ ELD A+ EM S P FPKGLE+LSS  LS  R  +LEHL +   L+D  L+
Sbjct  23   SSDTFGESMRELDEAISEMKSNPLFPKGLENLSSDNLSKGREFVLEHLMNNSTLKDKQLQ  82

Query  412  ALVTATVE  435
            A++ A VE
Sbjct  83   AILVAAVE  90



>ref|XP_002863617.1| hypothetical protein ARALYDRAFT_494595 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39876.1| hypothetical protein ARALYDRAFT_494595 [Arabidopsis lyrata subsp. 
lyrata]
Length=357

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/128 (36%), Positives = 63/128 (49%), Gaps = 40/128 (31%)
 Frame = +1

Query  52   WNYPEISLEDLLKAIKGFIDMLILASGYQSSGRLARWDSGNIKRALQWALFLEDVIGSLN  231
            WNYPEIS ED +K +KG                                        S+N
Sbjct  3    WNYPEISKEDFIKLLKG----------------------------------------SIN  22

Query  232  SQDEYRDSLEELDVALCEMISMPYFPKGLEHLSSKTLSNARNLMLEHLTHTLPLRDLHLR  411
              D + +S+ ELD A+ ++ + P FPKGLE+LSS TLSN R  +LEHL +   L+D  L+
Sbjct  23   GSDTFGESVRELDEAISDIKTNPLFPKGLENLSSDTLSNGREYVLEHLMNNSTLKDKQLQ  82

Query  412  ALVTATVE  435
            A++ A VE
Sbjct  83   AILVAAVE  90



>ref|XP_006403151.1| hypothetical protein EUTSA_v10003421mg [Eutrema salsugineum]
 gb|ESQ44604.1| hypothetical protein EUTSA_v10003421mg [Eutrema salsugineum]
Length=356

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 47/128 (37%), Positives = 60/128 (47%), Gaps = 40/128 (31%)
 Frame = +1

Query  52   WNYPEISLEDLLKAIKGFIDMLILASGYQSSGRLARWDSGNIKRALQWALFLEDVIGSLN  231
            WNYPEIS ED +K +KG                                        SL 
Sbjct  3    WNYPEISKEDFMKLLKG----------------------------------------SLT  22

Query  232  SQDEYRDSLEELDVALCEMISMPYFPKGLEHLSSKTLSNARNLMLEHLTHTLPLRDLHLR  411
              D + +S+ ELD A+ EM S P FPKGLE+LS  TLS  R  +LEHL +   L+D  L+
Sbjct  23   GSDTFGESVRELDEAISEMKSNPLFPKGLENLSLNTLSKGREFVLEHLVNNSTLKDKQLQ  82

Query  412  ALVTATVE  435
            A++ A VE
Sbjct  83   AVLVAAVE  90



>ref|XP_006281685.1| hypothetical protein CARUB_v10027833mg [Capsella rubella]
 gb|EOA14583.1| hypothetical protein CARUB_v10027833mg [Capsella rubella]
Length=357

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 47/128 (37%), Positives = 60/128 (47%), Gaps = 40/128 (31%)
 Frame = +1

Query  52   WNYPEISLEDLLKAIKGFIDMLILASGYQSSGRLARWDSGNIKRALQWALFLEDVIGSLN  231
            WNYPEIS ED +K +KG I                                        N
Sbjct  3    WNYPEISKEDFMKLLKGGI----------------------------------------N  22

Query  232  SQDEYRDSLEELDVALCEMISMPYFPKGLEHLSSKTLSNARNLMLEHLTHTLPLRDLHLR  411
            S D + +S+ ELD A+ EM + P FPKGLE LSS TL   R  +LEHL +   L+D  L+
Sbjct  23   SSDMFGESMRELDEAILEMKANPLFPKGLEGLSSDTLLKGREFVLEHLMNVSTLKDKQLQ  82

Query  412  ALVTATVE  435
            A++ A VE
Sbjct  83   AILVAAVE  90



>gb|KCW88994.1| hypothetical protein EUGRSUZ_A013212 [Eucalyptus grandis]
 gb|KCW88996.1| hypothetical protein EUGRSUZ_A013212, partial [Eucalyptus grandis]
Length=370

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = +1

Query  310  KGLEHLSSKTLSNARNLMLEHLTHTLPLRDLHLRALVTATVEMDFHMLPNADSDCLDKHF  489
            +GL  LSS TLS AR+L+LE L H+LPLRD +LR+L+ +T+ MD ++L   D D L ++ 
Sbjct  18   QGLAKLSSATLSRARDLVLEQLVHSLPLRDSNLRSLLCSTIRMDLNVLSREDPDRLSRYL  77

Query  490  EEL  498
            ++L
Sbjct  78   DKL  80



>gb|KCW88995.1| hypothetical protein EUGRSUZ_A013212 [Eucalyptus grandis]
Length=385

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = +1

Query  310  KGLEHLSSKTLSNARNLMLEHLTHTLPLRDLHLRALVTATVEMDFHMLPNADSDCLDKHF  489
            +GL  LSS TLS AR+L+LE L H+LPLRD +LR+L+ +T+ MD ++L   D D L ++ 
Sbjct  18   QGLAKLSSATLSRARDLVLEQLVHSLPLRDSNLRSLLCSTIRMDLNVLSREDPDRLSRYL  77

Query  490  EEL  498
            ++L
Sbjct  78   DKL  80



>gb|KCW88992.1| hypothetical protein EUGRSUZ_A013212 [Eucalyptus grandis]
 gb|KCW88993.1| hypothetical protein EUGRSUZ_A013212 [Eucalyptus grandis]
Length=397

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = +1

Query  310  KGLEHLSSKTLSNARNLMLEHLTHTLPLRDLHLRALVTATVEMDFHMLPNADSDCLDKHF  489
            +GL  LSS TLS AR+L+LE L H+LPLRD +LR+L+ +T+ MD ++L   D D L ++ 
Sbjct  18   QGLAKLSSATLSRARDLVLEQLVHSLPLRDSNLRSLLCSTIRMDLNVLSREDPDRLSRYL  77

Query  490  EEL  498
            ++L
Sbjct  78   DKL  80



>gb|AFW74003.1| hypothetical protein ZEAMMB73_556482 [Zea mays]
Length=83

 Score = 56.6 bits (135),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 39/60 (65%), Gaps = 1/60 (2%)
 Frame = +1

Query  49   GWNYPEI-SLEDLLKAIKGFIDMLILASGYQSSGRLARWDSGNIKRALQWALFLEDVIGS  225
            GW +P + ++E+  + ++GF+D+L+LA G  SSG  A W S  I +AL+W LF E+  G 
Sbjct  2    GWAHPPVVAMEEERRLVRGFVDVLVLAGGRTSSGAAATWISEYINKALRWTLFFEEASGG  61



>ref|XP_008796372.1| PREDICTED: uncharacterized protein LOC103711847 isoform X6 [Phoenix 
dactylifera]
 ref|XP_008796373.1| PREDICTED: uncharacterized protein LOC103711847 isoform X6 [Phoenix 
dactylifera]
Length=429

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 42/64 (66%), Gaps = 1/64 (2%)
 Frame = +1

Query  325  LSSKTLSNARNLMLEHLTHTLPLRDLHLRALVTATVEMDFHMLPNADSDCLDKHFEELM-  501
            +SS TLS AR+L+LEHL  T PL   H+ +L+TA VE+D   L + D+D  + + + LM 
Sbjct  1    MSSATLSKARDLILEHLVQTHPLEAAHITSLLTAIVELDIDNLTDTDNDGPNMYMDRLML  60

Query  502  HSES  513
            H ES
Sbjct  61   HLES  64



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 507948461360