BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c10473_g1_i1 len=684 path=[1:0-71 73:72-683]

Length=684
                                                                      Score     E

ref|XP_009360131.1|  PREDICTED: kinesin-like protein NACK1              246   1e-71   
ref|XP_008393328.1|  PREDICTED: kinesin-like protein NACK1              244   5e-71   
ref|XP_009347467.1|  PREDICTED: kinesin-like protein NACK1              241   4e-70   
ref|XP_007210400.1|  hypothetical protein PRUPE_ppa000865mg             240   1e-69   
ref|XP_008240232.1|  PREDICTED: kinesin-like protein NACK1              239   4e-69   
ref|XP_008356658.1|  PREDICTED: kinesin-like protein NACK1              238   5e-69   
ref|XP_002524897.1|  conserved hypothetical protein                     209   1e-64   Ricinus communis
ref|XP_009589619.1|  PREDICTED: kinesin-like protein NACK1              225   3e-64   
gb|KDO49802.1|  hypothetical protein CISIN_1g002128mg                   224   5e-64   
ref|XP_006442593.1|  hypothetical protein CICLE_v10018724mg             224   6e-64   
ref|XP_002279228.1|  PREDICTED: kinesin-like protein NACK1              224   7e-64   Vitis vinifera
ref|XP_006477781.1|  PREDICTED: kinesin-like protein NACK1-like         224   7e-64   
emb|CBI15491.3|  unnamed protein product                                223   8e-64   
ref|XP_009804137.1|  PREDICTED: kinesin-like protein NACK1              223   1e-63   
ref|XP_004300503.1|  PREDICTED: uncharacterized protein LOC101315243    223   1e-63   
ref|XP_004512893.1|  PREDICTED: kinesin-II 95 kDa subunit-like is...    222   3e-63   
ref|XP_008460891.1|  PREDICTED: kinesin-like protein NACK1              222   3e-63   
ref|XP_004235748.1|  PREDICTED: kinesin-like protein NACK1              221   5e-63   
ref|XP_010036903.1|  PREDICTED: kinesin-like protein NACK1              221   7e-63   
ref|XP_006341574.1|  PREDICTED: kinesin-like protein NACK1-like i...    220   1e-62   
ref|XP_004166306.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    220   1e-62   
gb|KGN64145.1|  hypothetical protein Csa_1G042550                       220   1e-62   
ref|XP_004137483.1|  PREDICTED: uncharacterized protein LOC101215425    220   2e-62   
ref|XP_010693857.1|  PREDICTED: kinesin-like protein NACK1              218   9e-62   
ref|XP_003620405.1|  Kinesin-like protein KIF3A                         217   1e-61   
gb|AES76623.2|  ATP-binding microtubule motor family protein            217   2e-61   
ref|XP_002318539.1|  hypothetical protein POPTR_0012s05060g             217   2e-61   Populus trichocarpa [western balsam poplar]
ref|XP_011045826.1|  PREDICTED: kinesin-like protein NACK1 isofor...    216   4e-61   
ref|XP_011045825.1|  PREDICTED: kinesin-like protein NACK1 isofor...    216   4e-61   
emb|CDO98410.1|  unnamed protein product                                215   8e-61   
ref|XP_002321490.2|  nodulin-25 precursor family protein                214   2e-60   Populus trichocarpa [western balsam poplar]
gb|KDP35186.1|  hypothetical protein JCGZ_10720                         213   4e-60   
ref|XP_007036598.1|  ATP binding microtubule motor family protein...    212   5e-60   
gb|KHN20772.1|  Kinesin-related protein 4                               213   6e-60   
ref|XP_003528955.1|  PREDICTED: kinesin-like protein NACK1-like i...    213   6e-60   
ref|XP_010540004.1|  PREDICTED: kinesin-like protein NACK1              213   6e-60   
ref|XP_010537459.1|  PREDICTED: kinesin-like protein NACK1 isofor...    212   1e-59   
ref|XP_011008305.1|  PREDICTED: kinesin-like protein NACK1              211   2e-59   
ref|XP_007036597.1|  ATP binding microtubule motor family protein...    210   5e-59   
ref|XP_011072914.1|  PREDICTED: kinesin-like protein NACK1              209   8e-59   
ref|XP_003534160.1|  PREDICTED: kinesin-like protein NACK1-like i...    208   3e-58   
gb|KHN23757.1|  Kinesin-related protein 4                               208   3e-58   
ref|XP_010110084.1|  Kinesin-related protein 4                          206   1e-57   
ref|XP_002893000.1|  hypothetical protein ARALYDRAFT_472057             206   2e-57   
ref|XP_006416611.1|  hypothetical protein EUTSA_v10006702mg             206   2e-57   
ref|XP_009149278.1|  PREDICTED: kinesin-like protein NACK1              205   3e-57   
emb|CDY26167.1|  BnaA06g12500D                                          205   3e-57   
ref|XP_007152726.1|  hypothetical protein PHAVU_004G154300g             204   1e-56   
ref|XP_010279346.1|  PREDICTED: kinesin-like protein NACK1              202   3e-56   
ref|NP_173273.2|  kinesin HINKEL                                        202   6e-56   Arabidopsis thaliana [mouse-ear cress]
gb|AAF25984.1|AC013354_3  F15H18.12                                     202   7e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006303901.1|  hypothetical protein CARUB_v10008207mg             201   1e-55   
gb|EYU21085.1|  hypothetical protein MIMGU_mgv1a000841mg                201   1e-55   
ref|XP_010459448.1|  PREDICTED: kinesin-like protein NACK1              201   2e-55   
ref|XP_010906990.1|  PREDICTED: kinesin-like protein NACK1              199   4e-55   
ref|XP_010477014.1|  PREDICTED: kinesin-like protein NACK1              199   4e-55   
ref|XP_010498223.1|  PREDICTED: kinesin-like protein NACK1              198   1e-54   
ref|XP_009117616.1|  PREDICTED: kinesin-like protein NACK1              197   2e-54   
emb|CDY21709.1|  BnaA09g44600D                                          197   2e-54   
emb|CDX81870.1|  BnaC08g37310D                                          197   3e-54   
gb|KHG01962.1|  Kinesin-related 4                                       196   8e-54   
ref|XP_010250094.1|  PREDICTED: kinesin-like protein NACK1              195   1e-53   
ref|XP_008792831.1|  PREDICTED: LOW QUALITY PROTEIN: kinesin-like...    194   4e-53   
emb|CDY19208.1|  BnaC05g14090D                                          193   1e-52   
ref|XP_010922342.1|  PREDICTED: kinesin-like protein NACK1              192   1e-52   
ref|XP_008775906.1|  PREDICTED: kinesin-like protein NACK1              191   5e-52   
gb|KHG07572.1|  kif4                                                    190   7e-52   
gb|KHG07573.1|  kif4                                                    190   1e-51   
ref|XP_006842375.1|  hypothetical protein AMTR_s00079p00190770          189   3e-51   
ref|XP_008337808.1|  PREDICTED: kinesin-like protein NACK2 isofor...    186   3e-50   
ref|XP_008337807.1|  PREDICTED: kinesin-like protein NACK2 isofor...    186   3e-50   
ref|XP_009359691.1|  PREDICTED: kinesin-like protein NACK2              184   1e-49   
ref|XP_010227940.1|  PREDICTED: kinesin-like protein NACK1              181   2e-48   
ref|XP_009418072.1|  PREDICTED: kinesin-like protein NACK1              181   2e-48   
ref|XP_007203229.1|  hypothetical protein PRUPE_ppa000925mg             180   4e-48   
ref|XP_004287670.1|  PREDICTED: uncharacterized protein LOC101306666    179   5e-48   
ref|XP_008242294.1|  PREDICTED: kinesin-like protein NACK2              179   6e-48   
ref|XP_006644227.1|  PREDICTED: kinesin-like protein NACK1-like         179   1e-47   
ref|NP_001043186.1|  Os01g0513900                                       178   2e-47   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004968822.1|  PREDICTED: kinesin-like protein NACK1-like i...    177   4e-47   
gb|EEC70753.1|  hypothetical protein OsI_02166                          176   6e-47   Oryza sativa Indica Group [Indian rice]
ref|XP_002516209.1|  microtubule motor, putative                        176   9e-47   Ricinus communis
ref|XP_009407329.1|  PREDICTED: kinesin-like protein NACK1              176   1e-46   
ref|XP_003568740.1|  PREDICTED: kinesin-like protein NACK1              173   8e-46   
ref|XP_002437695.1|  hypothetical protein SORBIDRAFT_10g001010          173   8e-46   Sorghum bicolor [broomcorn]
gb|KDP33977.1|  hypothetical protein JCGZ_07548                         172   1e-45   
gb|AFW86156.1|  LOW QUALITY PROTEIN: kinesin heavy chain                172   3e-45   
gb|KHN45051.1|  Kinesin-related protein 4                               172   3e-45   
ref|XP_006474579.1|  PREDICTED: kinesin-like protein NACK2-like         172   3e-45   
emb|CBI27754.3|  unnamed protein product                                172   3e-45   
ref|XP_002275046.2|  PREDICTED: kinesin-like protein NACK2              172   3e-45   Vitis vinifera
ref|XP_008659376.1|  PREDICTED: kinesin-like protein NACK1              172   3e-45   
ref|XP_003541319.1|  PREDICTED: kinesin-like protein NACK2-like i...    171   4e-45   
gb|KHG14242.1|  Kinesin-related 4                                       171   4e-45   
ref|XP_010261715.1|  PREDICTED: kinesin-like protein NACK2              171   6e-45   
ref|XP_010107075.1|  Kinesin-related protein 4                          171   7e-45   
ref|XP_007012545.1|  ATP binding microtubule motor family protein...    171   9e-45   
ref|XP_007012544.1|  ATP binding microtubule motor family protein...    171   9e-45   
ref|XP_006452892.1|  hypothetical protein CICLE_v10007377mg             170   1e-44   
ref|XP_007154542.1|  hypothetical protein PHAVU_003G127400g             170   1e-44   
gb|KGN51423.1|  hypothetical protein Csa_5G537000                       169   3e-44   
gb|AES92142.2|  ATP-binding microtubule motor family protein            169   5e-44   
dbj|BAK03253.1|  predicted protein                                      167   9e-44   
ref|XP_006353764.1|  PREDICTED: kinesin-like protein NACK2-like         167   1e-43   
ref|XP_003609945.1|  Kinesin-like protein                               168   1e-43   
gb|KCW81847.1|  hypothetical protein EUGRSUZ_C03198                     167   1e-43   
ref|XP_010051345.1|  PREDICTED: kinesin-like protein NACK2              167   1e-43   
ref|XP_008367780.1|  PREDICTED: kinesin-like protein NACK1              164   3e-43   
emb|CDP03034.1|  unnamed protein product                                166   3e-43   
ref|XP_010323978.1|  PREDICTED: kinesin-like protein NACK2              166   4e-43   
ref|XP_004508036.1|  PREDICTED: centromere-associated protein E-l...    166   5e-43   
gb|EEC70757.1|  hypothetical protein OsI_02172                          158   7e-43   Oryza sativa Indica Group [Indian rice]
gb|EMS62599.1|  Kinesin-related protein 4                               166   7e-43   
ref|XP_008460563.1|  PREDICTED: kinesin-like protein NACK2 isofor...    164   1e-42   
ref|XP_008460562.1|  PREDICTED: kinesin-like protein NACK2 isofor...    164   1e-42   
ref|XP_011039916.1|  PREDICTED: kinesin-like protein NACK2              163   3e-42   
ref|XP_006381563.1|  TETRASPORE family protein                          163   4e-42   
gb|EPS71432.1|  hypothetical protein M569_03327                         162   8e-42   
ref|XP_008361127.1|  PREDICTED: kinesin-like protein NACK1              162   1e-41   
gb|EYU28300.1|  hypothetical protein MIMGU_mgv1a001029mg                159   1e-40   
ref|XP_011078149.1|  PREDICTED: kinesin-like protein NACK2              157   3e-40   
ref|XP_009365403.1|  PREDICTED: uncharacterized protein LOC103955247    157   8e-40   
ref|XP_009786272.1|  PREDICTED: kinesin-like protein NACK2 isofor...    155   2e-39   
ref|XP_009786271.1|  PREDICTED: kinesin-like protein NACK2 isofor...    155   2e-39   
sp|Q8S949.1|NACK2_TOBAC  RecName: Full=Kinesin-like protein NACK2...    155   2e-39   Nicotiana tabacum [American tobacco]
ref|XP_009786269.1|  PREDICTED: kinesin-like protein NACK2 isofor...    155   2e-39   
ref|XP_009786270.1|  PREDICTED: kinesin-like protein NACK2 isofor...    155   2e-39   
ref|XP_009625447.1|  PREDICTED: kinesin-like protein NACK2              155   2e-39   
ref|XP_010687583.1|  PREDICTED: kinesin-like protein NACK2              155   3e-39   
ref|XP_010535793.1|  PREDICTED: kinesin-like protein NACK2 isofor...    152   3e-38   
ref|XP_010535794.1|  PREDICTED: kinesin-like protein NACK2 isofor...    151   4e-38   
gb|EMT03728.1|  Kinesin-related protein 4                               151   6e-38   
ref|XP_002987833.1|  hypothetical protein SELMODRAFT_126650             150   8e-38   
ref|XP_002992286.1|  hypothetical protein SELMODRAFT_135047             150   8e-38   
ref|XP_006419132.1|  hypothetical protein EUTSA_v10002392mg             150   2e-37   
ref|XP_009150293.1|  PREDICTED: kinesin-like protein NACK2              147   1e-36   
emb|CDY30956.1|  BnaA06g19570D                                          147   1e-36   
ref|XP_010430934.1|  PREDICTED: kinesin-like protein NACK2              145   6e-36   
ref|XP_006290563.1|  hypothetical protein CARUB_v10016650mg             145   7e-36   
emb|CDY44836.1|  BnaCnng11920D                                          144   1e-35   
ref|XP_002875601.1|  hypothetical protein ARALYDRAFT_323079             143   4e-35   
ref|XP_010514712.1|  PREDICTED: kinesin-like protein NACK2              142   5e-35   
emb|CAB89042.1|  kinesin-like protein                                   142   8e-35   Arabidopsis thaliana [mouse-ear cress]
ref|NP_189907.2|  kinesin TETRASPORE                                    142   9e-35   Arabidopsis thaliana [mouse-ear cress]
emb|CAD42234.1|  kinesin-like protein                                   142   9e-35   Arabidopsis thaliana [mouse-ear cress]
emb|CAD42658.1|  kinesin-like protein                                   142   9e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010503028.1|  PREDICTED: kinesin-like protein NACK2              141   2e-34   
ref|XP_002301999.2|  kinesin motor family protein                       136   7e-33   Populus trichocarpa [western balsam poplar]
ref|XP_001779285.1|  predicted protein                                  135   3e-32   
ref|XP_011028954.1|  PREDICTED: kinesin-like protein NACK1 isofor...    134   5e-32   
ref|XP_011028953.1|  PREDICTED: kinesin-like protein NACK1 isofor...    134   5e-32   
gb|EMS53749.1|  Kinesin-related protein 4                               132   2e-31   
ref|XP_011074638.1|  PREDICTED: kinesin-like protein NACK1 isofor...    131   5e-31   
ref|XP_011074636.1|  PREDICTED: kinesin-like protein NACK2 isofor...    131   7e-31   
gb|KHN25430.1|  Centromere-associated protein E                         130   9e-31   
gb|EYU38855.1|  hypothetical protein MIMGU_mgv1a000996mg                129   2e-30   
ref|XP_010436197.1|  PREDICTED: kinesin-like protein NACK1              120   2e-30   
ref|XP_010436196.1|  PREDICTED: kinesin-like protein NACK1              119   3e-30   
ref|XP_002510482.1|  ATP binding protein, putative                      129   3e-30   Ricinus communis
ref|XP_010526582.1|  PREDICTED: kinesin-like protein NACK1 isofor...    128   3e-30   
ref|XP_007017694.1|  ATP binding microtubule motor family protein...    129   4e-30   
ref|XP_010526578.1|  PREDICTED: kinesin-like protein NACK1 isofor...    128   4e-30   
ref|XP_007131750.1|  hypothetical protein PHAVU_011G038800g             128   4e-30   
ref|XP_007131749.1|  hypothetical protein PHAVU_011G038800g             128   4e-30   
gb|KDP46700.1|  hypothetical protein JCGZ_06488                         128   7e-30   
ref|XP_009393646.1|  PREDICTED: kinesin-like protein NACK1              127   9e-30   
ref|XP_009398104.1|  PREDICTED: kinesin-like protein NACK1              127   9e-30   
ref|XP_006659658.1|  PREDICTED: kinesin-like protein NACK2-like         127   1e-29   
gb|EEE69110.1|  hypothetical protein OsJ_28179                          127   1e-29   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001062429.1|  Os08g0547500                                       127   1e-29   Oryza sativa Japonica Group [Japonica rice]
gb|EPS66399.1|  hypothetical protein M569_08373                         124   1e-29   
gb|EEC83991.1|  hypothetical protein OsI_30145                          127   1e-29   Oryza sativa Indica Group [Indian rice]
dbj|BAD09937.1|  putative kinesin heavy chain                           127   1e-29   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009407965.1|  PREDICTED: kinesin-like protein NACK2              127   1e-29   
gb|KHF98979.1|  Kinesin-related 11                                      127   1e-29   
ref|XP_006403945.1|  hypothetical protein EUTSA_v10010086mg             127   2e-29   
ref|XP_009386558.1|  PREDICTED: kinesin-like protein NACK1              127   2e-29   
gb|KHN39844.1|  Centromere-associated protein E                         127   2e-29   
ref|XP_002452842.1|  hypothetical protein SORBIDRAFT_04g033453          118   2e-29   Sorghum bicolor [broomcorn]
ref|XP_002280678.2|  PREDICTED: kinesin-like protein NACK1              127   2e-29   Vitis vinifera
emb|CDY29004.1|  BnaC07g32100D                                          127   2e-29   
emb|CDX90660.1|  BnaA03g41210D                                          126   3e-29   
ref|XP_009136598.1|  PREDICTED: kinesin-like protein NACK1 isofor...    126   3e-29   
ref|XP_002876073.1|  kinesin motor family protein                       126   3e-29   
ref|XP_009386197.1|  PREDICTED: kinesin-like protein NACK1              126   3e-29   
ref|XP_010113382.1|  Kinesin-related protein 4                          125   4e-29   
ref|NP_001190049.1|  ATP binding microtubule motor family protein       125   5e-29   
ref|NP_190684.3|  ATP binding microtubule motor family protein          125   5e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004974129.1|  PREDICTED: kinesin-like protein NACK1-like i...    125   5e-29   
emb|CDY03483.1|  BnaC01g15990D                                          118   5e-29   
ref|XP_004974127.1|  PREDICTED: kinesin-like protein NACK1-like i...    125   5e-29   
ref|XP_004974128.1|  PREDICTED: kinesin-like protein NACK1-like i...    125   5e-29   
ref|XP_010550452.1|  PREDICTED: kinesin-like protein NACK1 isofor...    125   5e-29   
emb|CAB62637.1|  putative protein                                       125   6e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007203241.1|  hypothetical protein PRUPE_ppa001146mg             125   7e-29   
ref|XP_008241798.1|  PREDICTED: kinesin-like protein NACK1              125   8e-29   
ref|XP_009777060.1|  PREDICTED: LOW QUALITY PROTEIN: kinesin-like...    124   9e-29   
ref|XP_008444776.1|  PREDICTED: kinesin-like protein NACK1              124   1e-28   
ref|XP_002531511.1|  conserved hypothetical protein                     124   1e-28   Ricinus communis
gb|EPS66111.1|  hypothetical protein M569_08665                         124   1e-28   
emb|CDX73746.1|  BnaC08g22570D                                          124   1e-28   
ref|XP_011025920.1|  PREDICTED: kinesin-like protein NACK2              124   1e-28   
ref|XP_008382370.1|  PREDICTED: LOW QUALITY PROTEIN: kinesin-like...    124   1e-28   
ref|XP_009115792.1|  PREDICTED: kinesin-like protein NACK1 isofor...    124   1e-28   
ref|XP_009124539.1|  PREDICTED: kinesin-like protein NACK1              115   1e-28   
ref|XP_009378441.1|  PREDICTED: kinesin-like protein NACK1              124   1e-28   
ref|XP_007135918.1|  hypothetical protein PHAVU_009G003000g             124   2e-28   
gb|EYU40392.1|  hypothetical protein MIMGU_mgv1a001117mg                124   2e-28   
emb|CDX77978.1|  BnaA09g31730D                                          124   2e-28   
ref|XP_009345268.1|  PREDICTED: kinesin-like protein NACK1              124   2e-28   
ref|XP_009101918.1|  PREDICTED: kinesin-like protein NACK1              123   2e-28   
ref|XP_006435104.1|  hypothetical protein CICLE_v10000097mg             124   2e-28   
ref|XP_008236841.1|  PREDICTED: kinesin-like protein NACK2              123   2e-28   
gb|EMT22069.1|  Kinesin-related protein 4                               124   2e-28   
gb|KDP27640.1|  hypothetical protein JCGZ_19645                         124   2e-28   
ref|XP_006380794.1|  hypothetical protein POPTR_0007s13860g             123   3e-28   
ref|XP_006279726.1|  hypothetical protein CARUB_v10027496mg             123   3e-28   
ref|XP_010515505.1|  PREDICTED: kinesin-like protein NACK1 isofor...    123   3e-28   
ref|XP_011083601.1|  PREDICTED: kinesin-like protein NACK1              123   4e-28   
ref|XP_010271468.1|  PREDICTED: kinesin-like protein NACK2              123   4e-28   
ref|XP_006473602.1|  PREDICTED: kinesin-like protein NACK1-like i...    123   4e-28   
ref|XP_010649060.1|  PREDICTED: kinesin-like protein NACK1              123   4e-28   
gb|KDO84748.1|  hypothetical protein CISIN_1g001290mg                   123   4e-28   
ref|XP_006473601.1|  PREDICTED: kinesin-like protein NACK1-like i...    123   4e-28   
ref|XP_006473600.1|  PREDICTED: kinesin-like protein NACK1-like i...    123   4e-28   
gb|KDO84747.1|  hypothetical protein CISIN_1g001290mg                   123   4e-28   
ref|XP_002512997.1|  ATP binding protein, putative                      122   4e-28   Ricinus communis
ref|XP_008791672.1|  PREDICTED: kinesin-like protein NACK1 isofor...    122   5e-28   
ref|XP_010426656.1|  PREDICTED: kinesin-like protein NACK1 isofor...    123   5e-28   
ref|XP_008791670.1|  PREDICTED: kinesin-like protein NACK2 isofor...    122   5e-28   
ref|XP_009617690.1|  PREDICTED: kinesin-like protein NACK2              122   6e-28   
gb|AAK50070.1|AF372930_1  AT5g66310/K1L20_9                             119   6e-28   Arabidopsis thaliana [mouse-ear cress]
gb|EPS64209.1|  hypothetical protein M569_10571                         119   7e-28   
ref|XP_009760421.1|  PREDICTED: kinesin-like protein NACK2              122   7e-28   
gb|EMS48622.1|  Kinesin-related protein 4                               122   7e-28   
ref|XP_007201806.1|  hypothetical protein PRUPE_ppa001038mg             122   7e-28   
ref|XP_011047311.1|  PREDICTED: kinesin-like protein NACK2 isofor...    122   7e-28   
ref|XP_003527612.1|  PREDICTED: kinesin-like protein NACK1-like i...    122   7e-28   
ref|XP_011047336.1|  PREDICTED: kinesin-like protein NACK2 isofor...    122   8e-28   
gb|KHN20030.1|  Kinesin-related protein 4                               122   8e-28   
gb|KDO49885.1|  hypothetical protein CISIN_1g002139mg                   121   1e-27   
ref|XP_010465682.1|  PREDICTED: kinesin-like protein NACK1              122   1e-27   
ref|XP_010484662.1|  PREDICTED: kinesin-like protein NACK1 isofor...    122   1e-27   
ref|XP_006854867.1|  hypothetical protein AMTR_s00182p00038530          122   1e-27   
gb|KHN33713.1|  Centromere-associated protein E                         121   1e-27   
ref|XP_010444813.1|  PREDICTED: kinesin-like protein NACK2              122   1e-27   
ref|XP_004167109.1|  PREDICTED: uncharacterized LOC101212680            121   1e-27   
ref|XP_004152764.1|  PREDICTED: uncharacterized protein LOC101212680    121   1e-27   
ref|XP_006423481.1|  hypothetical protein CICLE_v10027758mg             121   1e-27   
ref|XP_006423482.1|  hypothetical protein CICLE_v10027758mg             121   1e-27   
ref|XP_010263900.1|  PREDICTED: kinesin-like protein NACK1 isofor...    121   1e-27   
ref|XP_004232466.1|  PREDICTED: kinesin-like protein NACK2              121   1e-27   
ref|NP_195606.2|  ATP binding microtubule motor family protein          121   1e-27   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF02000.1|  kinesin like protein                                   121   1e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004146557.1|  PREDICTED: uncharacterized protein LOC101218717    121   1e-27   
ref|XP_008452056.1|  PREDICTED: kinesin-like protein NACK1 isofor...    121   1e-27   
ref|XP_007226270.1|  hypothetical protein PRUPE_ppa019074mg             121   1e-27   
gb|KGN53326.1|  hypothetical protein Csa_4G047870                       121   1e-27   
ref|XP_010263901.1|  PREDICTED: kinesin-like protein NACK1 isofor...    121   1e-27   
emb|CAB38815.1|  kinesin like protein                                   121   1e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004160983.1|  PREDICTED: uncharacterized LOC101218717            121   1e-27   
ref|XP_008452051.1|  PREDICTED: kinesin-like protein NACK1 isofor...    121   1e-27   
ref|XP_006413467.1|  hypothetical protein EUTSA_v10026976mg             121   1e-27   
gb|AES73979.2|  ATP-binding microtubule motor family protein            122   1e-27   
ref|XP_003603728.1|  Kinesin-related protein                            122   1e-27   
ref|XP_006342006.1|  PREDICTED: kinesin-like protein NACK2-like i...    121   2e-27   
ref|XP_006342008.1|  PREDICTED: kinesin-like protein NACK2-like i...    121   2e-27   
ref|XP_009389113.1|  PREDICTED: kinesin-like protein NACK1              121   2e-27   
ref|XP_006487385.1|  PREDICTED: kinesin-like protein NACK1-like i...    121   2e-27   
gb|KDP38590.1|  hypothetical protein JCGZ_04515                         121   2e-27   
gb|KDO49879.1|  hypothetical protein CISIN_1g002139mg                   121   2e-27   
ref|XP_002868873.1|  kinesin motor family protein                       120   2e-27   
ref|XP_006487377.1|  PREDICTED: kinesin-like protein NACK1-like i...    121   2e-27   
ref|XP_011088489.1|  PREDICTED: kinesin-like protein NACK1              121   2e-27   
ref|XP_010647602.1|  PREDICTED: kinesin-like protein NACK1              121   2e-27   
ref|XP_006411686.1|  hypothetical protein EUTSA_v10024409mg             120   2e-27   
gb|KHN45902.1|  Kinesin-related protein 11                              121   2e-27   
ref|XP_006340707.1|  PREDICTED: kinesin-like protein NACK1-like         121   2e-27   
ref|XP_008448048.1|  PREDICTED: kinesin-like protein NACK2              120   2e-27   
gb|ABB45845.1|  hypothetical protein                                    121   2e-27   
ref|XP_006425531.1|  hypothetical protein CICLE_v10024791mg             121   2e-27   
emb|CDY03482.1|  BnaC01g16000D                                          120   2e-27   
ref|XP_006466914.1|  PREDICTED: kinesin-like protein NACK1-like i...    121   2e-27   
ref|XP_006599340.1|  PREDICTED: kinesin-like protein NACK1-like i...    120   2e-27   
gb|KHN41676.1|  Kinesin-related protein 4                               120   2e-27   
emb|CDX99601.1|  BnaC04g33580D                                          120   2e-27   
ref|XP_006283113.1|  hypothetical protein CARUB_v10004132mg             120   2e-27   
ref|XP_010446407.1|  PREDICTED: kinesin-like protein NACK1 isofor...    120   3e-27   
ref|XP_007042026.1|  ATP binding microtubule motor family protein...    120   3e-27   
ref|XP_004238322.1|  PREDICTED: kinesin-like protein NACK2              120   3e-27   
ref|XP_010448602.1|  PREDICTED: kinesin-like protein NACK1              120   3e-27   
ref|XP_010433806.1|  PREDICTED: kinesin-like protein NACK1              120   3e-27   
ref|XP_007156119.1|  hypothetical protein PHAVU_003G260200g             120   3e-27   
ref|NP_001047571.1|  Os02g0645100                                       120   3e-27   
ref|XP_009338640.1|  PREDICTED: kinesin-like protein NACK2 isofor...    120   3e-27   
ref|XP_009338641.1|  PREDICTED: kinesin-like protein NACK2 isofor...    120   3e-27   
emb|CDY22404.1|  BnaA06g37260D                                          120   3e-27   
gb|AAB63609.1|  kinesin heavy chain isolog                              120   3e-27   
emb|CBI19799.3|  unnamed protein product                                120   3e-27   
gb|KCW53110.1|  hypothetical protein EUGRSUZ_J02401                     120   4e-27   
emb|CDY34261.1|  BnaA01g13640D                                          120   4e-27   
emb|CDX82016.1|  BnaC08g35850D                                          120   4e-27   
ref|XP_010431843.1|  PREDICTED: kinesin-like protein NACK1              120   4e-27   
gb|KGN43176.1|  hypothetical protein Csa_7G006260                       120   4e-27   
ref|XP_009630368.1|  PREDICTED: kinesin-like protein NACK1 isofor...    120   4e-27   
ref|XP_002865077.1|  kinesin motor family protein                       120   4e-27   
ref|XP_009630370.1|  PREDICTED: kinesin-like protein NACK2 isofor...    120   4e-27   
ref|XP_007136058.1|  hypothetical protein PHAVU_009G014400g             120   4e-27   
ref|XP_009772334.1|  PREDICTED: kinesin-like protein NACK2              120   4e-27   
gb|KDO71124.1|  hypothetical protein CISIN_1g001693mg                   120   4e-27   
ref|XP_009137750.1|  PREDICTED: kinesin-like protein NACK2              120   4e-27   
ref|XP_009117419.1|  PREDICTED: kinesin-like protein NACK1              120   4e-27   
ref|XP_004289095.1|  PREDICTED: uncharacterized protein LOC101300397    120   4e-27   
gb|EYU24075.1|  hypothetical protein MIMGU_mgv1a001308mg                119   4e-27   
ref|XP_010033468.1|  PREDICTED: kinesin-like protein NACK1              120   4e-27   
emb|CDY13822.1|  BnaA09g43240D                                          119   4e-27   
ref|XP_010531480.1|  PREDICTED: kinesin-like protein NACK1              119   4e-27   
ref|NP_567695.1|  ATP binding microtubule motor family protein          120   5e-27   
ref|XP_009378197.1|  PREDICTED: kinesin-like protein NACK1 isofor...    120   5e-27   
ref|XP_009378198.1|  PREDICTED: kinesin-like protein NACK2 isofor...    120   5e-27   
ref|XP_008775732.1|  PREDICTED: kinesin-like protein NACK1 isofor...    119   6e-27   
ref|XP_008221318.1|  PREDICTED: kinesin-like protein NACK1              119   6e-27   
ref|XP_004293191.1|  PREDICTED: uncharacterized protein LOC101301847    119   6e-27   
ref|XP_011037209.1|  PREDICTED: kinesin-like protein NACK1              119   6e-27   
gb|AAD23678.1|  putative kinesin heavy chain                            118   6e-27   
ref|XP_004148539.1|  PREDICTED: kinesin-like protein KIN12B-like        119   6e-27   
emb|CAB51660.1|  putative protein                                       120   7e-27   
ref|XP_009587868.1|  PREDICTED: kinesin-like protein NACK2              119   7e-27   
ref|XP_010535298.1|  PREDICTED: kinesin-like protein NACK1              119   7e-27   
emb|CDY45220.1|  BnaA07g12700D                                          119   7e-27   
ref|XP_010436987.1|  PREDICTED: kinesin-like protein NACK1              119   7e-27   
ref|XP_002305465.1|  kinesin motor family protein                       119   7e-27   
gb|AET03829.2|  ATP-binding microtubule motor family protein            119   7e-27   
ref|XP_007046742.1|  ATP binding microtubule motor family protein...    119   7e-27   
gb|KHF98716.1|  Kinesin-related 11                                      119   7e-27   
ref|XP_009767348.1|  PREDICTED: kinesin-like protein NACK2 isofor...    119   7e-27   
ref|XP_009767346.1|  PREDICTED: kinesin-like protein NACK2 isofor...    119   7e-27   
ref|XP_008775730.1|  PREDICTED: kinesin-like protein NACK1 isofor...    119   8e-27   
ref|XP_010315333.1|  PREDICTED: kinesin-like protein NACK2 isofor...    119   9e-27   
ref|XP_009791027.1|  PREDICTED: kinesin-like protein NACK1              119   9e-27   
gb|KHN09110.1|  Kinesin-related protein 4                               119   9e-27   
ref|XP_010315335.1|  PREDICTED: kinesin-like protein NACK2 isofor...    119   1e-26   
ref|XP_008388154.1|  PREDICTED: kinesin-like protein NACK1              115   1e-26   
emb|CDP01925.1|  unnamed protein product                                119   1e-26   
gb|EYU31140.1|  hypothetical protein MIMGU_mgv1a000697mg                119   1e-26   
ref|XP_008388151.1|  PREDICTED: kinesin-like protein NACK1              119   1e-26   
ref|XP_009140272.1|  PREDICTED: kinesin-like protein NACK1              118   1e-26   
ref|XP_002313758.2|  kinesin motor family protein                       119   1e-26   
emb|CDY15900.1|  BnaA04g12110D                                          118   1e-26   
ref|XP_006285338.1|  hypothetical protein CARUB_v10006728mg             119   1e-26   
ref|XP_006582466.1|  PREDICTED: kinesin-like protein NACK1-like         118   1e-26   
dbj|BAB10710.1|  kinesin heavy chain DNA binding protein-like           118   2e-26   
ref|NP_201432.2|  ATP binding microtubule motor family protein          118   2e-26   
gb|EEC73693.1|  hypothetical protein OsI_08272                          117   2e-26   
ref|NP_179726.2|  ATP binding microtubule motor family protein          117   2e-26   
ref|XP_006404570.1|  hypothetical protein EUTSA_v10000043mg             117   2e-26   
emb|CDY30779.1|  BnaC07g16790D                                          118   2e-26   
ref|XP_010672217.1|  PREDICTED: kinesin-like protein NACK2              118   2e-26   
ref|XP_010429028.1|  PREDICTED: kinesin-like protein NACK1              117   2e-26   
ref|XP_008372766.1|  PREDICTED: kinesin-like protein NACK1              117   2e-26   
ref|XP_010472110.1|  PREDICTED: kinesin-like protein NACK1              117   2e-26   
gb|EEE57470.1|  hypothetical protein OsJ_07710                          117   2e-26   
ref|XP_006296345.1|  hypothetical protein CARUB_v10025517mg             117   2e-26   
ref|XP_003607070.1|  Kinesin-related protein                            117   2e-26   
ref|XP_010240186.1|  PREDICTED: kinesin-like protein NACK1 isofor...    117   2e-26   
ref|XP_006281818.1|  hypothetical protein CARUB_v10028003mg             118   2e-26   
ref|XP_010240185.1|  PREDICTED: kinesin-like protein NACK1 isofor...    117   2e-26   
ref|XP_010690757.1|  PREDICTED: kinesin-like protein NACK1              117   2e-26   
gb|EMT18151.1|  Kinesin-related protein 4                               117   3e-26   
gb|EYU37862.1|  hypothetical protein MIMGU_mgv1a001175mg                117   3e-26   
ref|NP_199064.1|  ATP binding microtubule motor family protein          117   3e-26   
gb|KHG01762.1|  Kinesin-related 11                                      117   3e-26   
ref|XP_011100938.1|  PREDICTED: kinesin-like protein NACK1              117   3e-26   
ref|XP_003569980.1|  PREDICTED: kinesin-like protein NACK2              117   3e-26   
ref|XP_011090438.1|  PREDICTED: kinesin-like protein NACK1              117   3e-26   
ref|XP_006647603.1|  PREDICTED: kinesin-like protein NACK1-like         117   3e-26   
ref|XP_002880373.1|  kinesin motor family protein                       117   3e-26   
ref|XP_006383133.1|  kinesin motor family protein                       117   3e-26   
ref|XP_010416871.1|  PREDICTED: kinesin-like protein NACK1              117   3e-26   
ref|XP_008663418.1|  PREDICTED: kinesin-like protein NACK1 isofor...    117   4e-26   
dbj|BAK06679.1|  predicted protein                                      117   4e-26   
ref|XP_008663419.1|  PREDICTED: kinesin-like protein NACK1 isofor...    117   4e-26   
gb|KHG01464.1|  Kinesin-related 4                                       117   6e-26   
gb|AFW63202.1|  hypothetical protein ZEAMMB73_949881                    116   7e-26   
ref|XP_008668212.1|  PREDICTED: uncharacterized protein LOC100304...    116   9e-26   
ref|XP_008668211.1|  PREDICTED: uncharacterized protein LOC100304...    116   9e-26   
ref|XP_008678882.1|  PREDICTED: kinesin-like protein NACK1 isofor...    116   9e-26   
ref|XP_009123681.1|  PREDICTED: kinesin-like protein NACK1              116   1e-25   
gb|AES95091.2|  ATP-binding microtubule motor family protein            116   1e-25   
ref|XP_003612133.1|  Kinesin-related protein                            116   1e-25   
ref|XP_010235379.1|  PREDICTED: kinesin-like protein NACK2 isofor...    115   2e-25   
ref|XP_010235378.1|  PREDICTED: kinesin-like protein NACK2 isofor...    115   2e-25   
ref|XP_010919401.1|  PREDICTED: kinesin-like protein NACK2 isofor...    115   2e-25   
ref|XP_008388149.1|  PREDICTED: kinesin-like protein NACK2              115   2e-25   
ref|XP_009336756.1|  PREDICTED: kinesin-like protein NACK1              115   2e-25   
ref|XP_010679850.1|  PREDICTED: kinesin-like protein NACK1 isofor...    115   2e-25   
ref|XP_011092849.1|  PREDICTED: kinesin-like protein NACK1 isofor...    114   3e-25   
ref|XP_003519876.1|  PREDICTED: kinesin-like protein NACK1-like         114   3e-25   
ref|XP_010679851.1|  PREDICTED: kinesin-like protein NACK1 isofor...    115   3e-25   
ref|XP_010494185.1|  PREDICTED: kinesin-like protein NACK2              115   3e-25   
ref|XP_004512118.1|  PREDICTED: kinesin-related protein 4-like is...    114   3e-25   
ref|XP_010481985.1|  PREDICTED: kinesin-like protein NACK1              115   3e-25   
ref|XP_009336747.1|  PREDICTED: kinesin-like protein NACK1              114   3e-25   
ref|XP_002448243.1|  hypothetical protein SORBIDRAFT_06g023880          114   4e-25   
ref|XP_002444630.1|  hypothetical protein SORBIDRAFT_07g025040          114   4e-25   
ref|XP_004953277.1|  PREDICTED: kinesin-like protein NACK1-like i...    114   5e-25   
ref|XP_004512117.1|  PREDICTED: kinesin-related protein 4-like is...    114   5e-25   
ref|XP_010091188.1|  Kinesin-related protein 11                         114   6e-25   
dbj|BAJ95863.1|  predicted protein                                      114   6e-25   
ref|XP_004976382.1|  PREDICTED: kinesin-like protein NACK1-like i...    114   7e-25   
ref|XP_008652983.1|  PREDICTED: kinesin-like protein NACK1 isofor...    113   7e-25   
ref|XP_008652981.1|  PREDICTED: kinesin-like protein NACK1 isofor...    113   7e-25   
ref|XP_010933747.1|  PREDICTED: kinesin-like protein NACK1              113   8e-25   
emb|CDO96988.1|  unnamed protein product                                113   9e-25   
ref|XP_010028651.1|  PREDICTED: kinesin-like protein NACK1 isofor...    113   9e-25   
emb|CDP07439.1|  unnamed protein product                                113   1e-24   
ref|XP_003629353.1|  Kinesin heavy chain DNA binding protein-like...    113   1e-24   
tpg|DAA36661.1|  TPA: hypothetical protein ZEAMMB73_386599              113   1e-24   
ref|XP_009597015.1|  PREDICTED: kinesin-like protein NACK1              113   1e-24   
ref|XP_008669081.1|  PREDICTED: kinesin-like protein NACK1 isofor...    113   1e-24   
ref|XP_008669084.1|  PREDICTED: kinesin-like protein NACK1 isofor...    113   1e-24   
ref|XP_006652585.1|  PREDICTED: kinesin-like protein NACK1-like         112   1e-24   
ref|XP_008669085.1|  PREDICTED: kinesin-like protein NACK1 isofor...    112   1e-24   
ref|XP_002863777.1|  kinesin motor family protein                       112   1e-24   
gb|KEH20389.1|  ATP-binding microtubule motor family protein            112   1e-24   
gb|KEH20388.1|  ATP-binding microtubule motor family protein            112   2e-24   
gb|EEC77720.1|  hypothetical protein OsI_16807                          112   2e-24   
gb|KHN36049.1|  Kinesin-related protein 4                               112   2e-24   
ref|XP_004509338.1|  PREDICTED: kinesin-related protein 4-like is...    112   3e-24   
ref|XP_003516550.1|  PREDICTED: kinesin-like protein NACK2-like i...    112   3e-24   
ref|XP_004509341.1|  PREDICTED: kinesin-related protein 4-like is...    111   3e-24   
ref|NP_001053433.1|  Os04g0538800                                       111   3e-24   
ref|XP_004958729.1|  PREDICTED: kinesin-like protein NACK1-like         111   4e-24   
ref|XP_010547441.1|  PREDICTED: kinesin-like protein NACK2 isofor...    111   4e-24   
ref|XP_010547439.1|  PREDICTED: kinesin-like protein NACK2 isofor...    111   4e-24   
ref|XP_010547438.1|  PREDICTED: kinesin-like protein NACK1 isofor...    111   4e-24   
ref|XP_010547436.1|  PREDICTED: kinesin-like protein NACK1 isofor...    111   4e-24   
ref|XP_010547437.1|  PREDICTED: kinesin-like protein NACK1 isofor...    111   4e-24   
ref|XP_010547442.1|  PREDICTED: kinesin-like protein NACK2 isofor...    111   4e-24   
ref|XP_010547440.1|  PREDICTED: kinesin-like protein NACK2 isofor...    111   4e-24   
ref|XP_008796871.1|  PREDICTED: kinesin-like protein NACK1              111   5e-24   
gb|EMS48860.1|  Kinesin-related protein 4                               110   6e-24   
gb|EMT03608.1|  Kinesin-related protein 4                               110   6e-24   
ref|XP_003578490.1|  PREDICTED: kinesin-like protein NACK1              110   7e-24   
ref|XP_003538873.1|  PREDICTED: kinesin-like protein NACK1-like i...    110   9e-24   
emb|CDY42594.1|  BnaC01g00060D                                          110   1e-23   
ref|XP_006403375.1|  hypothetical protein EUTSA_v10003349mg             109   2e-23   
ref|XP_006661465.1|  PREDICTED: kinesin-like protein NACK2-like         107   7e-23   
ref|XP_007157943.1|  hypothetical protein PHAVU_002G111200g             107   8e-23   
ref|XP_010317234.1|  PREDICTED: kinesin-like protein NACK1 isofor...    107   8e-23   
ref|XP_009140424.1|  PREDICTED: kinesin-like protein NACK1              107   8e-23   
emb|CDY41952.1|  BnaA01g05240D                                          107   1e-22   
ref|NP_001063734.2|  Os09g0528000                                       107   1e-22   
gb|EEE70089.1|  hypothetical protein OsJ_30085                          106   1e-22   
gb|EEC84919.1|  hypothetical protein OsI_32119                          106   2e-22   
gb|AAK91822.1|AF272759_1  kinesin heavy chain                           105   3e-22   
ref|XP_010503800.1|  PREDICTED: kinesin-like protein NACK1              105   4e-22   
gb|ADQ43205.1|  kinesin motor family protein                            104   1e-21   
ref|XP_011028784.1|  PREDICTED: kinesin-like protein NACK1            93.2    3e-20   
gb|EYU35751.1|  hypothetical protein MIMGU_mgv1a020956mg              95.5    9e-20   
gb|EYU35741.1|  hypothetical protein MIMGU_mgv1a019603mg              91.7    4e-19   
ref|XP_005840662.1|  hypothetical protein GUITHDRAFT_64226            93.6    5e-19   
gb|EJK46449.1|  hypothetical protein THAOC_34878                      96.3    9e-19   
gb|EPS74248.1|  hypothetical protein M569_00506                       93.6    1e-18   
gb|KCW55401.1|  hypothetical protein EUGRSUZ_I01311                   94.7    2e-18   
ref|XP_010028635.1|  PREDICTED: kinesin-like protein FLA10            94.7    2e-18   
gb|EJK72343.1|  hypothetical protein THAOC_06136                      88.6    2e-18   
ref|XP_010531461.1|  PREDICTED: kinesin-related protein 11 isofor...  94.4    3e-18   
ref|XP_010531462.1|  PREDICTED: kinesin-related protein 11 isofor...  94.4    3e-18   
gb|EYU37843.1|  hypothetical protein MIMGU_mgv1a000704mg              94.0    4e-18   
gb|KHG01461.1|  Kinesin-related 11                                    93.6    4e-18   
gb|EYU19439.1|  hypothetical protein MIMGU_mgv1a021560mg              88.6    7e-18   
ref|XP_011088468.1|  PREDICTED: kinesin-like protein KIF3A isofor...  92.8    8e-18   
ref|XP_011088471.1|  PREDICTED: kinesin-related protein 11-like i...  92.8    8e-18   
ref|XP_011088470.1|  PREDICTED: kinesin-related protein 4-like is...  92.8    9e-18   
gb|KEH30458.1|  kinesin motor catalytic domain protein                91.7    2e-17   
gb|AES89210.2|  kinesin motor catalytic domain protein                91.7    2e-17   
ref|XP_002169489.2|  PREDICTED: kinesin-like protein KIF3A-like       86.3    2e-17   
ref|XP_003607013.1|  Kinesin heavy chain-like protein                 91.7    2e-17   
ref|XP_010526594.1|  PREDICTED: kinesin-related protein 11-like       90.9    4e-17   
ref|XP_002512972.1|  kinesin heavy chain, putative                    90.9    4e-17   
ref|XP_011092838.1|  PREDICTED: kinesin-like protein KIF3A            90.9    4e-17   
ref|XP_009382331.1|  PREDICTED: kinesin-like protein KIF3A isofor...  90.9    4e-17   
gb|KCW53111.1|  hypothetical protein EUGRSUZ_J02403                   90.5    5e-17   
ref|XP_010690796.1|  PREDICTED: kinesin-related protein 11 isofor...  90.5    6e-17   
emb|CBJ28848.1|  kinesin family-like protein                          90.9    6e-17   
ref|XP_010690795.1|  PREDICTED: kinesin-related protein 4 isoform X1  90.1    6e-17   
ref|XP_004975655.1|  PREDICTED: centromere-associated protein E-like  90.1    6e-17   
gb|EMT14173.1|  Kinesin-related protein 11                            90.1    7e-17   
ref|XP_006434234.1|  hypothetical protein CICLE_v10000080mg           90.1    7e-17   
ref|XP_006472805.1|  PREDICTED: centromere-associated protein E-l...  90.1    8e-17   
gb|ADD09606.1|  kinesin-related protein                               89.7    8e-17   
gb|KDO80578.1|  hypothetical protein CISIN_1g001118mg                 90.1    8e-17   
ref|XP_007042062.1|  Kinesin motor family protein isoform 2           89.7    9e-17   
ref|XP_007042061.1|  Kinesin motor family protein isoform 1           89.7    1e-16   
ref|XP_002313019.2|  hypothetical protein POPTR_0009s12510g           89.4    1e-16   
gb|AES74241.2|  kinesin motor catalytic domain protein                89.0    1e-16   
ref|XP_009411493.1|  PREDICTED: centromere-associated protein E-like  89.0    2e-16   
ref|XP_003603990.1|  Kinesin-like protein                             89.0    2e-16   
ref|XP_002306132.1|  kinesin motor family protein                     89.0    2e-16   



>ref|XP_009360131.1| PREDICTED: kinesin-like protein NACK1 [Pyrus x bretschneideri]
Length=974

 Score =   246 bits (627),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 132/146 (90%), Gaps = 1/146 (1%)
 Frame = -1

Query  438  MTIKVPGTPASRIERTPANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAK  259
            MT+K PGTPAS+++RTPA+TPASKI+RTP STPGG R+KE+KI+VTVRLRPLNK+EQ AK
Sbjct  1    MTVKTPGTPASKVDRTPASTPASKIDRTPVSTPGGPRAKEEKIVVTVRLRPLNKREQLAK  60

Query  258  DNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMG  79
            D VAWEC+D+++IVYKP P ERS QP   FTFDKVFGP SLTE VYEEGVK VALS+LMG
Sbjct  61   DQVAWECLDDNTIVYKPPPQERSVQPAP-FTFDKVFGPTSLTEAVYEEGVKNVALSSLMG  119

Query  78   INATIFAYGQTSSGKTYTMRGITEKA  1
            INATIFAYGQTSSGKTYTMRGITEKA
Sbjct  120  INATIFAYGQTSSGKTYTMRGITEKA  145



>ref|XP_008393328.1| PREDICTED: kinesin-like protein NACK1 [Malus domestica]
Length=974

 Score =   244 bits (622),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 131/146 (90%), Gaps = 1/146 (1%)
 Frame = -1

Query  438  MTIKVPGTPASRIERTPANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAK  259
            MT+K PGTPAS+++RTP +TPASKI+RTP STPGG R+KE+KI+VTVRLRPLNK+EQ AK
Sbjct  1    MTVKTPGTPASKVDRTPXSTPASKIDRTPVSTPGGPRAKEEKIVVTVRLRPLNKREQLAK  60

Query  258  DNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMG  79
            D VAWEC+D+++IVYKP P ERS QP   FTFDKVFGP SLTE VYEEGVK VALS+LMG
Sbjct  61   DQVAWECLDDNTIVYKPPPQERSVQPAP-FTFDKVFGPTSLTEAVYEEGVKNVALSSLMG  119

Query  78   INATIFAYGQTSSGKTYTMRGITEKA  1
            INATIFAYGQTSSGKTYTMRGITEKA
Sbjct  120  INATIFAYGQTSSGKTYTMRGITEKA  145



>ref|XP_009347467.1| PREDICTED: kinesin-like protein NACK1 [Pyrus x bretschneideri]
Length=974

 Score =   241 bits (616),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 132/146 (90%), Gaps = 1/146 (1%)
 Frame = -1

Query  438  MTIKVPGTPASRIERTPANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAK  259
            MT+K PGTP S+I+RTPA+TPASKI+RT  STPGG R+KE+KI+VTVRLRPLNK+EQ +K
Sbjct  1    MTVKTPGTPTSKIDRTPASTPASKIDRTVVSTPGGPRAKEEKIVVTVRLRPLNKREQLSK  60

Query  258  DNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMG  79
            D VAWEC+D+++IVYKP P ERS QP   FTFDKVFGP+SLTE+VYEEGVK VALS+LMG
Sbjct  61   DQVAWECLDDNTIVYKPPPQERSAQPVP-FTFDKVFGPSSLTESVYEEGVKNVALSSLMG  119

Query  78   INATIFAYGQTSSGKTYTMRGITEKA  1
            INATIFAYGQTSSGKTYTMRGITEKA
Sbjct  120  INATIFAYGQTSSGKTYTMRGITEKA  145



>ref|XP_007210400.1| hypothetical protein PRUPE_ppa000865mg [Prunus persica]
 gb|EMJ11599.1| hypothetical protein PRUPE_ppa000865mg [Prunus persica]
Length=976

 Score =   240 bits (612),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 130/146 (89%), Gaps = 1/146 (1%)
 Frame = -1

Query  438  MTIKVPGTPASRIERTPANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAK  259
            MT+K PGTPAS+I+RTP +TP SKI+RTP STPGG R+KE+KI+VTVRLRPL+K+EQ AK
Sbjct  1    MTVKTPGTPASKIDRTPVSTPTSKIDRTPVSTPGGPRAKEEKIVVTVRLRPLSKREQLAK  60

Query  258  DNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMG  79
            D VAWECID+ +IVYKP P ERS QP   FTFDKVFGP+ +TETVYEEGVK VALS+LMG
Sbjct  61   DQVAWECIDDTTIVYKPPPQERSAQPAP-FTFDKVFGPSCVTETVYEEGVKNVALSSLMG  119

Query  78   INATIFAYGQTSSGKTYTMRGITEKA  1
            INATIFAYGQTSSGKTYTMRGITEKA
Sbjct  120  INATIFAYGQTSSGKTYTMRGITEKA  145



>ref|XP_008240232.1| PREDICTED: kinesin-like protein NACK1 [Prunus mume]
Length=976

 Score =   239 bits (609),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 130/146 (89%), Gaps = 1/146 (1%)
 Frame = -1

Query  438  MTIKVPGTPASRIERTPANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAK  259
            MT+K PGTPAS+I+RTP +TP SK++RTP STPGG R+KE+KI+VTVRLRPL+K+EQ AK
Sbjct  1    MTVKTPGTPASKIDRTPVSTPTSKMDRTPVSTPGGPRAKEEKIVVTVRLRPLSKREQLAK  60

Query  258  DNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMG  79
            D VAWECID+ +IVYKP P ERS QP   FTFDKVFGP+ +TETVYEEGVK VALS+LMG
Sbjct  61   DQVAWECIDDTTIVYKPPPQERSAQPAP-FTFDKVFGPSCVTETVYEEGVKNVALSSLMG  119

Query  78   INATIFAYGQTSSGKTYTMRGITEKA  1
            INATIFAYGQTSSGKTYTMRGITEKA
Sbjct  120  INATIFAYGQTSSGKTYTMRGITEKA  145



>ref|XP_008356658.1| PREDICTED: kinesin-like protein NACK1 [Malus domestica]
 ref|XP_008356659.1| PREDICTED: kinesin-like protein NACK1 [Malus domestica]
Length=974

 Score =   238 bits (607),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 132/147 (90%), Gaps = 2/147 (1%)
 Frame = -1

Query  438  MTIKVPGTPASRIERTPANTPASKIERTPASTPGGQR-SKEDKIMVTVRLRPLNKKEQSA  262
            MT+K PGTP S+I+RTPA+TPASKI+RT  STPGG R +KE+KI+VTVRLRPLNK+EQ A
Sbjct  1    MTVKTPGTPTSKIDRTPASTPASKIDRTVVSTPGGPRGAKEEKIVVTVRLRPLNKREQLA  60

Query  261  KDNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALM  82
            KD VAWEC+D+++IVYKP P ERS QP  F TFDKVFGP+SLTE+VYEEGVK VALS+LM
Sbjct  61   KDQVAWECLDDNTIVYKPPPQERSAQPVPF-TFDKVFGPSSLTESVYEEGVKNVALSSLM  119

Query  81   GINATIFAYGQTSSGKTYTMRGITEKA  1
            GINATIFAYGQTSSGKTYTMRGITEKA
Sbjct  120  GINATIFAYGQTSSGKTYTMRGITEKA  146



>ref|XP_002524897.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF37521.1| conserved hypothetical protein [Ricinus communis]
Length=162

 Score =   209 bits (533),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 119/146 (82%), Gaps = 14/146 (10%)
 Frame = -1

Query  438  MTIKVPGTPASRIERTPANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAK  259
            MT++ PGTPAS+I+RTPA TP             G +SKE+KI+VTVRLRPLNKKEQ AK
Sbjct  1    MTVRTPGTPASKIDRTPATTP-------------GPKSKEEKIVVTVRLRPLNKKEQLAK  47

Query  258  DNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMG  79
            D VAWEC+D+H+IV+KP   ER+ Q T  FTFDKVFGP SLTE+VYE+GVK VALSALMG
Sbjct  48   DQVAWECVDDHTIVFKPPTQERTAQSTP-FTFDKVFGPTSLTESVYEDGVKNVALSALMG  106

Query  78   INATIFAYGQTSSGKTYTMRGITEKA  1
            INATIFAYGQTSSGKTYTMRGITEKA
Sbjct  107  INATIFAYGQTSSGKTYTMRGITEKA  132



>ref|XP_009589619.1| PREDICTED: kinesin-like protein NACK1 [Nicotiana tomentosiformis]
Length=959

 Score =   225 bits (573),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 103/132 (78%), Positives = 120/132 (91%), Gaps = 1/132 (1%)
 Frame = -1

Query  396  RTPANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIV  217
            RTP  TPASK+ERTPA+TP G R++E+KI+VTVRLRPLNK+E SAKD+ AWECID+H+I+
Sbjct  4    RTPG-TPASKMERTPATTPSGHRAREEKIVVTVRLRPLNKRELSAKDHAAWECIDDHTII  62

Query  216  YKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSG  37
            Y+P+P ER+ QP S FTFDKVFGP+S+TE VYEEGVK VALS+LMGINATIFAYGQTSSG
Sbjct  63   YRPVPQERAAQPASSFTFDKVFGPDSITEAVYEEGVKNVALSSLMGINATIFAYGQTSSG  122

Query  36   KTYTMRGITEKA  1
            KTYTMRGITEKA
Sbjct  123  KTYTMRGITEKA  134



>gb|KDO49802.1| hypothetical protein CISIN_1g002128mg [Citrus sinensis]
Length=962

 Score =   224 bits (571),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 125/146 (86%), Gaps = 8/146 (5%)
 Frame = -1

Query  438  MTIKVPGTPASRIERTPANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAK  259
            MT++ PGTPAS+ ER    TP     +TPASTPGG + +E+KI+VTVRLRPLNK+EQ AK
Sbjct  1    MTVRTPGTPASKSERA---TPT----QTPASTPGGPKPREEKIVVTVRLRPLNKREQLAK  53

Query  258  DNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMG  79
            D VAW+C+D+H+IVYKP PHER  QP+SF +FDKVFGP+ LTETVYEEGVK VALSALMG
Sbjct  54   DQVAWDCVDDHTIVYKPQPHERVAQPSSF-SFDKVFGPSCLTETVYEEGVKNVALSALMG  112

Query  78   INATIFAYGQTSSGKTYTMRGITEKA  1
            INATIFAYGQTSSGKTYTMRGITEKA
Sbjct  113  INATIFAYGQTSSGKTYTMRGITEKA  138



>ref|XP_006442593.1| hypothetical protein CICLE_v10018724mg [Citrus clementina]
 gb|ESR55833.1| hypothetical protein CICLE_v10018724mg [Citrus clementina]
Length=962

 Score =   224 bits (570),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 125/146 (86%), Gaps = 8/146 (5%)
 Frame = -1

Query  438  MTIKVPGTPASRIERTPANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAK  259
            MT++ PGTPAS+ ER    TP     +TPASTPGG + +E+KI+VTVRLRPLNK+EQ AK
Sbjct  1    MTVRTPGTPASKSERA---TPT----QTPASTPGGPKPREEKIVVTVRLRPLNKREQLAK  53

Query  258  DNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMG  79
            D VAW+C+D+H+IVYKP PHER  QP+SF +FDKVFGP+ LTETVYEEGVK VALSALMG
Sbjct  54   DQVAWDCVDDHTIVYKPQPHERVSQPSSF-SFDKVFGPSCLTETVYEEGVKNVALSALMG  112

Query  78   INATIFAYGQTSSGKTYTMRGITEKA  1
            INATIFAYGQTSSGKTYTMRGITEKA
Sbjct  113  INATIFAYGQTSSGKTYTMRGITEKA  138



>ref|XP_002279228.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010663629.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
Length=962

 Score =   224 bits (570),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 110/132 (83%), Positives = 119/132 (90%), Gaps = 2/132 (2%)
 Frame = -1

Query  396  RTPANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIV  217
            RTP+ TPASK +RTP STPGG R KE+KI+VTVRLRPL+KKEQSAKD VAW+CID+H+IV
Sbjct  4    RTPS-TPASKTDRTPVSTPGGSRVKEEKIVVTVRLRPLSKKEQSAKDQVAWDCIDDHTIV  62

Query  216  YKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSG  37
            +KP P ERSPQ  S FTFDKVFGP SLTETVYEEGVK VALSALMGINATIFAYGQTSSG
Sbjct  63   FKPPPQERSPQLAS-FTFDKVFGPASLTETVYEEGVKNVALSALMGINATIFAYGQTSSG  121

Query  36   KTYTMRGITEKA  1
            KTYTMRGITEKA
Sbjct  122  KTYTMRGITEKA  133



>ref|XP_006477781.1| PREDICTED: kinesin-like protein NACK1-like [Citrus sinensis]
Length=962

 Score =   224 bits (570),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 125/146 (86%), Gaps = 8/146 (5%)
 Frame = -1

Query  438  MTIKVPGTPASRIERTPANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAK  259
            MT++ PGTPAS+ ER    TP     +TPASTPGG + +E+KI+VTVRLRPLNK+EQ AK
Sbjct  1    MTVRTPGTPASKSERA---TPT----QTPASTPGGPKPREEKIVVTVRLRPLNKREQLAK  53

Query  258  DNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMG  79
            D VAW+C+D+H+IVYKP PHER  QP+SF +FDKVFGP+ LTETVYEEGVK VALSALMG
Sbjct  54   DQVAWDCVDDHTIVYKPQPHERVAQPSSF-SFDKVFGPSCLTETVYEEGVKNVALSALMG  112

Query  78   INATIFAYGQTSSGKTYTMRGITEKA  1
            INATIFAYGQTSSGKTYTMRGITEKA
Sbjct  113  INATIFAYGQTSSGKTYTMRGITEKA  138



>emb|CBI15491.3| unnamed protein product [Vitis vinifera]
Length=849

 Score =   223 bits (568),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 110/132 (83%), Positives = 119/132 (90%), Gaps = 2/132 (2%)
 Frame = -1

Query  396  RTPANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIV  217
            RTP+ TPASK +RTP STPGG R KE+KI+VTVRLRPL+KKEQSAKD VAW+CID+H+IV
Sbjct  4    RTPS-TPASKTDRTPVSTPGGSRVKEEKIVVTVRLRPLSKKEQSAKDQVAWDCIDDHTIV  62

Query  216  YKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSG  37
            +KP P ERSPQ  S FTFDKVFGP SLTETVYEEGVK VALSALMGINATIFAYGQTSSG
Sbjct  63   FKPPPQERSPQLAS-FTFDKVFGPASLTETVYEEGVKNVALSALMGINATIFAYGQTSSG  121

Query  36   KTYTMRGITEKA  1
            KTYTMRGITEKA
Sbjct  122  KTYTMRGITEKA  133



>ref|XP_009804137.1| PREDICTED: kinesin-like protein NACK1 [Nicotiana sylvestris]
 ref|XP_009804138.1| PREDICTED: kinesin-like protein NACK1 [Nicotiana sylvestris]
 ref|XP_009804139.1| PREDICTED: kinesin-like protein NACK1 [Nicotiana sylvestris]
 sp|Q8S950.1|NACK1_TOBAC RecName: Full=Kinesin-like protein NACK1; AltName: Full=NPK1-activating 
kinesin-1 [Nicotiana tabacum]
 dbj|BAB86283.1| kinesin-like protein NACK1 [Nicotiana tabacum]
Length=959

 Score =   223 bits (568),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 122/146 (84%), Gaps = 12/146 (8%)
 Frame = -1

Query  438  MTIKVPGTPASRIERTPANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAK  259
            MT++ PGTPAS            KI++TPA+TP G R +E+KI+VTVRLRPLNK+E SAK
Sbjct  1    MTVRTPGTPAS------------KIDKTPATTPNGHRGREEKIVVTVRLRPLNKRELSAK  48

Query  258  DNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMG  79
            D+ AWECID+H+I+Y+P+P ER+ QP S FTFDKVFGP+S+TE VYEEGVK VALS+LMG
Sbjct  49   DHAAWECIDDHTIIYRPVPQERAAQPASSFTFDKVFGPDSITEAVYEEGVKNVALSSLMG  108

Query  78   INATIFAYGQTSSGKTYTMRGITEKA  1
            INATIFAYGQTSSGKTYTMRGITEKA
Sbjct  109  INATIFAYGQTSSGKTYTMRGITEKA  134



>ref|XP_004300503.1| PREDICTED: uncharacterized protein LOC101315243 [Fragaria vesca 
subsp. vesca]
Length=978

 Score =   223 bits (568),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 130/147 (88%), Gaps = 4/147 (3%)
 Frame = -1

Query  438  MTIKVPGTPASRIERTPANTPASKIERTPASTPGGQR-SKEDKIMVTVRLRPLNKKEQSA  262
            MT++ PGTP+S+I++TP  TP+S+I+RTP STPGG R +KE+KI+VTVRLRPL+K+EQ A
Sbjct  1    MTVRTPGTPSSKIDKTPVTTPSSRIDRTPVSTPGGPRGAKEEKIVVTVRLRPLSKREQLA  60

Query  261  KDNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALM  82
            KD VAWEC+D+++IV KP   +RS QP SF TFDKVFGP S+T+TVYEEGVK VALS+LM
Sbjct  61   KDQVAWECVDDNTIVSKP--QDRSTQPASF-TFDKVFGPTSITDTVYEEGVKNVALSSLM  117

Query  81   GINATIFAYGQTSSGKTYTMRGITEKA  1
            GINATIFAYGQTSSGKTYTMRGITEKA
Sbjct  118  GINATIFAYGQTSSGKTYTMRGITEKA  144



>ref|XP_004512893.1| PREDICTED: kinesin-II 95 kDa subunit-like isoform X1 [Cicer arietinum]
 ref|XP_004512894.1| PREDICTED: kinesin-II 95 kDa subunit-like isoform X2 [Cicer arietinum]
Length=962

 Score =   222 bits (565),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 108/146 (74%), Positives = 122/146 (84%), Gaps = 13/146 (9%)
 Frame = -1

Query  438  MTIKVPGTPASRIERTPANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAK  259
            MT+K PGTPAS            KI+RTP STPGG RS+E+KI+VTVRLRPLN++EQ AK
Sbjct  1    MTVKTPGTPAS------------KIDRTPVSTPGGPRSREEKIVVTVRLRPLNRREQLAK  48

Query  258  DNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMG  79
            D VAW+CID+++IVYKP PHER+ QP S FTFDKVFGP S+TE VYEEGVK VALSALMG
Sbjct  49   DQVAWDCIDDYTIVYKPPPHERASQPAS-FTFDKVFGPASVTEAVYEEGVKNVALSALMG  107

Query  78   INATIFAYGQTSSGKTYTMRGITEKA  1
            INAT+FAYGQTSSGKTYTMRGITEKA
Sbjct  108  INATVFAYGQTSSGKTYTMRGITEKA  133



>ref|XP_008460891.1| PREDICTED: kinesin-like protein NACK1 [Cucumis melo]
Length=960

 Score =   222 bits (565),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 109/132 (83%), Positives = 119/132 (90%), Gaps = 2/132 (2%)
 Frame = -1

Query  396  RTPANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIV  217
            +TPA TPASKIERTPASTPGG RSKE+KI+VTVRLRPL+KKEQ AKD++AWECID+++IV
Sbjct  4    KTPA-TPASKIERTPASTPGGPRSKEEKIVVTVRLRPLSKKEQQAKDHMAWECIDDNTIV  62

Query  216  YKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSG  37
            YKP P ER  QP S FTFDKVF P SLTE VYEEGVK VALSALMGINATIFAYGQTSSG
Sbjct  63   YKPQPQERQAQPAS-FTFDKVFSPASLTEAVYEEGVKNVALSALMGINATIFAYGQTSSG  121

Query  36   KTYTMRGITEKA  1
            KT+TMRGITEKA
Sbjct  122  KTFTMRGITEKA  133



>ref|XP_004235748.1| PREDICTED: kinesin-like protein NACK1 [Solanum lycopersicum]
 ref|XP_010318630.1| PREDICTED: kinesin-like protein NACK1 [Solanum lycopersicum]
Length=962

 Score =   221 bits (564),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 122/146 (84%), Gaps = 13/146 (9%)
 Frame = -1

Query  438  MTIKVPGTPASRIERTPANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAK  259
            MT++ PGTPAS            KIERTPA+TP G R+KE+KI+VTVRLRPLNK+E SAK
Sbjct  1    MTVRTPGTPAS------------KIERTPATTPSGHRAKEEKIVVTVRLRPLNKRELSAK  48

Query  258  DNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMG  79
            D+ AWECID+H+I+Y+ +P ER+ QP S FTFDKVFGP+S+TE VYEEGVK VALS+LMG
Sbjct  49   DHAAWECIDDHTIIYRSLPQERAAQPAS-FTFDKVFGPDSITEAVYEEGVKNVALSSLMG  107

Query  78   INATIFAYGQTSSGKTYTMRGITEKA  1
            INATIFAYGQTSSGKTYTMRGITEKA
Sbjct  108  INATIFAYGQTSSGKTYTMRGITEKA  133



>ref|XP_010036903.1| PREDICTED: kinesin-like protein NACK1 [Eucalyptus grandis]
 ref|XP_010036904.1| PREDICTED: kinesin-like protein NACK1 [Eucalyptus grandis]
 gb|KCW48561.1| hypothetical protein EUGRSUZ_K02233 [Eucalyptus grandis]
Length=976

 Score =   221 bits (563),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 111/149 (74%), Positives = 125/149 (84%), Gaps = 5/149 (3%)
 Frame = -1

Query  438  MTIKVPGTPASRIERTPAN---TPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQ  268
            MT++ PGTPA R   TPA    TPASK E+TP STPGG RS+E+KI+VTVRLRPL+K+EQ
Sbjct  1    MTVRAPGTPA-RAPGTPARAPGTPASKAEKTPMSTPGGPRSREEKIVVTVRLRPLSKREQ  59

Query  267  SAKDNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSA  88
              KD VAWEC D+H+IV+K  P ER  QP SF TFD+VFGP+SLTE+VYEEGVK VALSA
Sbjct  60   LVKDQVAWECADDHTIVHKLQPQERVAQPASF-TFDRVFGPSSLTESVYEEGVKNVALSA  118

Query  87   LMGINATIFAYGQTSSGKTYTMRGITEKA  1
            LMGINATIFAYGQTSSGKTYTMRGITEKA
Sbjct  119  LMGINATIFAYGQTSSGKTYTMRGITEKA  147



>ref|XP_006341574.1| PREDICTED: kinesin-like protein NACK1-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006341575.1| PREDICTED: kinesin-like protein NACK1-like isoform X2 [Solanum 
tuberosum]
Length=961

 Score =   220 bits (560),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 121/146 (83%), Gaps = 13/146 (9%)
 Frame = -1

Query  438  MTIKVPGTPASRIERTPANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAK  259
            MT++ PGTPAS            KIERTPA+TP G R KE+KI+VTVRLRPLNK+E SAK
Sbjct  1    MTVRTPGTPAS------------KIERTPATTPSGHRPKEEKIVVTVRLRPLNKRELSAK  48

Query  258  DNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMG  79
            D+ AWECID+H+I+Y+ +P ER+ QP S FTFDKVFGP+S+TE VYEEGVK VALS+LMG
Sbjct  49   DHAAWECIDDHTIIYRSLPQERAAQPAS-FTFDKVFGPDSITEAVYEEGVKNVALSSLMG  107

Query  78   INATIFAYGQTSSGKTYTMRGITEKA  1
            INATIFAYGQTSSGKTYTMRGITEKA
Sbjct  108  INATIFAYGQTSSGKTYTMRGITEKA  133



>ref|XP_004166306.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101229623 
[Cucumis sativus]
Length=960

 Score =   220 bits (560),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 109/132 (83%), Positives = 117/132 (89%), Gaps = 2/132 (2%)
 Frame = -1

Query  396  RTPANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIV  217
            RTPA TPASKIERTPASTPGG RSKE+KI+VTVRLRPL+KKEQ AKD +AWECID+++IV
Sbjct  4    RTPA-TPASKIERTPASTPGGPRSKEEKIVVTVRLRPLSKKEQQAKDQMAWECIDDNTIV  62

Query  216  YKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSG  37
            YK  P ER  QP S FTFDKVF P SLTE VYEEGVK VALSALMGINATIFAYGQTSSG
Sbjct  63   YKSQPQERQTQPAS-FTFDKVFSPASLTEAVYEEGVKNVALSALMGINATIFAYGQTSSG  121

Query  36   KTYTMRGITEKA  1
            KT+TMRGITEKA
Sbjct  122  KTFTMRGITEKA  133



>gb|KGN64145.1| hypothetical protein Csa_1G042550 [Cucumis sativus]
Length=960

 Score =   220 bits (560),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 109/132 (83%), Positives = 117/132 (89%), Gaps = 2/132 (2%)
 Frame = -1

Query  396  RTPANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIV  217
            RTPA TPASKIERTPASTPGG RSKE+KI+VTVRLRPL+KKEQ AKD +AWECID+++IV
Sbjct  4    RTPA-TPASKIERTPASTPGGPRSKEEKIVVTVRLRPLSKKEQQAKDQMAWECIDDNTIV  62

Query  216  YKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSG  37
            YK  P ER  QP S FTFDKVF P SLTE VYEEGVK VALSALMGINATIFAYGQTSSG
Sbjct  63   YKSQPQERQTQPAS-FTFDKVFSPASLTEAVYEEGVKNVALSALMGINATIFAYGQTSSG  121

Query  36   KTYTMRGITEKA  1
            KT+TMRGITEKA
Sbjct  122  KTFTMRGITEKA  133



>ref|XP_004137483.1| PREDICTED: uncharacterized protein LOC101215425 [Cucumis sativus]
Length=960

 Score =   220 bits (560),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 109/132 (83%), Positives = 117/132 (89%), Gaps = 2/132 (2%)
 Frame = -1

Query  396  RTPANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIV  217
            RTPA TPASKIERTPASTPGG RSKE+KI+VTVRLRPL+KKEQ AKD +AWECID+++IV
Sbjct  4    RTPA-TPASKIERTPASTPGGPRSKEEKIVVTVRLRPLSKKEQQAKDQMAWECIDDNTIV  62

Query  216  YKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSG  37
            YK  P ER  QP S FTFDKVF P SLTE VYEEGVK VALSALMGINATIFAYGQTSSG
Sbjct  63   YKSQPQERQTQPAS-FTFDKVFSPASLTEAVYEEGVKNVALSALMGINATIFAYGQTSSG  121

Query  36   KTYTMRGITEKA  1
            KT+TMRGITEKA
Sbjct  122  KTFTMRGITEKA  133



>ref|XP_010693857.1| PREDICTED: kinesin-like protein NACK1 [Beta vulgaris subsp. vulgaris]
Length=984

 Score =   218 bits (555),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 130/152 (86%), Gaps = 7/152 (5%)
 Frame = -1

Query  438  MTIKVPGTPASRIER-----TPANTPASKIERTPASTPGG-QRSKEDKIMVTVRLRPLNK  277
            MT+K P TP S+I++     TP +TPAS++ RTPASTPGG + +KEDKI+VTVRLRPL+ 
Sbjct  1    MTVKCPSTPNSKIDKSSAASTPVSTPASRVNRTPASTPGGPKAAKEDKIVVTVRLRPLST  60

Query  276  KEQSAKDNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVA  97
            +EQ+AKD VAWECIDE +IV+K   ++RS QP+SF TFDKVFGP S+TETVYEEGVK VA
Sbjct  61   REQAAKDQVAWECIDEQTIVHKTPVNDRSMQPSSF-TFDKVFGPASVTETVYEEGVKNVA  119

Query  96   LSALMGINATIFAYGQTSSGKTYTMRGITEKA  1
            LS+LMGINATIFAYGQTSSGKT+TMRGITEKA
Sbjct  120  LSSLMGINATIFAYGQTSSGKTFTMRGITEKA  151



>ref|XP_003620405.1| Kinesin-like protein KIF3A [Medicago truncatula]
Length=945

 Score =   217 bits (553),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 122/146 (84%), Gaps = 13/146 (9%)
 Frame = -1

Query  438  MTIKVPGTPASRIERTPANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAK  259
            MT+K PGTPAS            KI+RTP STPGG R++EDKI+VTVRLRPLN++EQ AK
Sbjct  1    MTVKTPGTPAS------------KIDRTPVSTPGGPRAREDKIVVTVRLRPLNRREQLAK  48

Query  258  DNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMG  79
            D VAW+CID+++I+YKP P+ER+ QP S FTFDKVFGP S+T+ VYEEGVK VALSALMG
Sbjct  49   DQVAWDCIDDYTIMYKPPPNERATQPAS-FTFDKVFGPASITDAVYEEGVKNVALSALMG  107

Query  78   INATIFAYGQTSSGKTYTMRGITEKA  1
            INAT+FAYGQTSSGKTYTMRGITEKA
Sbjct  108  INATVFAYGQTSSGKTYTMRGITEKA  133



>gb|AES76623.2| ATP-binding microtubule motor family protein [Medicago truncatula]
Length=964

 Score =   217 bits (552),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 122/146 (84%), Gaps = 13/146 (9%)
 Frame = -1

Query  438  MTIKVPGTPASRIERTPANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAK  259
            MT+K PGTPAS            KI+RTP STPGG R++EDKI+VTVRLRPLN++EQ AK
Sbjct  1    MTVKTPGTPAS------------KIDRTPVSTPGGPRAREDKIVVTVRLRPLNRREQLAK  48

Query  258  DNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMG  79
            D VAW+CID+++I+YKP P+ER+ QP S FTFDKVFGP S+T+ VYEEGVK VALSALMG
Sbjct  49   DQVAWDCIDDYTIMYKPPPNERATQPAS-FTFDKVFGPASITDAVYEEGVKNVALSALMG  107

Query  78   INATIFAYGQTSSGKTYTMRGITEKA  1
            INAT+FAYGQTSSGKTYTMRGITEKA
Sbjct  108  INATVFAYGQTSSGKTYTMRGITEKA  133



>ref|XP_002318539.1| hypothetical protein POPTR_0012s05060g [Populus trichocarpa]
 gb|EEE96759.1| hypothetical protein POPTR_0012s05060g [Populus trichocarpa]
Length=964

 Score =   217 bits (552),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 122/146 (84%), Gaps = 13/146 (9%)
 Frame = -1

Query  438  MTIKVPGTPASRIERTPANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAK  259
            MT++ PGTPAS            KI+RTPA+TPGG ++KE+KI+VTVRLRPLNKKEQ AK
Sbjct  1    MTLRTPGTPAS------------KIDRTPATTPGGPKAKEEKIVVTVRLRPLNKKEQLAK  48

Query  258  DNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMG  79
            D +AW+C+D+H+IV+KP P ER+ QP SF  FDKVFGP+S+TE VYE+GVK VALSALMG
Sbjct  49   DQIAWDCVDDHTIVFKPPPQERAAQPASFI-FDKVFGPSSITEAVYEDGVKNVALSALMG  107

Query  78   INATIFAYGQTSSGKTYTMRGITEKA  1
            INATIFAYGQTSSGKTYTMRGIT+KA
Sbjct  108  INATIFAYGQTSSGKTYTMRGITDKA  133



>ref|XP_011045826.1| PREDICTED: kinesin-like protein NACK1 isoform X2 [Populus euphratica]
Length=925

 Score =   216 bits (549),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 121/146 (83%), Gaps = 13/146 (9%)
 Frame = -1

Query  438  MTIKVPGTPASRIERTPANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAK  259
            MT++ PGTPAS            KI+RTPA+TPGG ++KE+KI+VTVRLRPLNKKEQ A 
Sbjct  1    MTLRTPGTPAS------------KIDRTPATTPGGPKAKEEKIVVTVRLRPLNKKEQLAN  48

Query  258  DNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMG  79
            D +AW+C+D+H+IV+KP P ER+ QP SF  FDKVFGP+S+TE VYEEGVK VALSALMG
Sbjct  49   DQIAWDCVDDHTIVFKPPPQERATQPASFI-FDKVFGPSSITEAVYEEGVKNVALSALMG  107

Query  78   INATIFAYGQTSSGKTYTMRGITEKA  1
            INATIFAYGQTSSGKTYTMRGIT+KA
Sbjct  108  INATIFAYGQTSSGKTYTMRGITDKA  133



>ref|XP_011045825.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Populus euphratica]
Length=964

 Score =   216 bits (550),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 121/146 (83%), Gaps = 13/146 (9%)
 Frame = -1

Query  438  MTIKVPGTPASRIERTPANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAK  259
            MT++ PGTPAS            KI+RTPA+TPGG ++KE+KI+VTVRLRPLNKKEQ A 
Sbjct  1    MTLRTPGTPAS------------KIDRTPATTPGGPKAKEEKIVVTVRLRPLNKKEQLAN  48

Query  258  DNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMG  79
            D +AW+C+D+H+IV+KP P ER+ QP SF  FDKVFGP+S+TE VYEEGVK VALSALMG
Sbjct  49   DQIAWDCVDDHTIVFKPPPQERATQPASFI-FDKVFGPSSITEAVYEEGVKNVALSALMG  107

Query  78   INATIFAYGQTSSGKTYTMRGITEKA  1
            INATIFAYGQTSSGKTYTMRGIT+KA
Sbjct  108  INATIFAYGQTSSGKTYTMRGITDKA  133



>emb|CDO98410.1| unnamed protein product [Coffea canephora]
Length=954

 Score =   215 bits (548),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 119/146 (82%), Gaps = 14/146 (10%)
 Frame = -1

Query  438  MTIKVPGTPASRIERTPANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAK  259
            MT+K PGTPAS            KI+RTPA+TPGG + KE+KI+VTVRLRPLNK+EQSAK
Sbjct  1    MTVKTPGTPAS------------KIDRTPATTPGGHKGKEEKIVVTVRLRPLNKREQSAK  48

Query  258  DNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMG  79
            D+VAW CID+H+IVYKP P ER+ QP S FTFDKVF P   TETVY +GVK VALSALMG
Sbjct  49   DHVAWHCIDDHTIVYKPAPQERAAQPAS-FTFDKVFSPECSTETVY-DGVKDVALSALMG  106

Query  78   INATIFAYGQTSSGKTYTMRGITEKA  1
            INATIFAYGQTSSGKTYTMRGITEKA
Sbjct  107  INATIFAYGQTSSGKTYTMRGITEKA  132



>ref|XP_002321490.2| nodulin-25 precursor family protein [Populus trichocarpa]
 gb|EEF05617.2| nodulin-25 precursor family protein [Populus trichocarpa]
Length=964

 Score =   214 bits (545),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 120/146 (82%), Gaps = 13/146 (9%)
 Frame = -1

Query  438  MTIKVPGTPASRIERTPANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAK  259
            MTI+ PGTPAS            KI+RTPA+TPGG ++KE+KI+VTVRLRPLNKKEQ AK
Sbjct  1    MTIRTPGTPAS------------KIDRTPATTPGGAKAKEEKIVVTVRLRPLNKKEQLAK  48

Query  258  DNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMG  79
            D VAW+C+D+H+IV+KP   ER+ QP S F FDKVF P+S+TE VYE+GVK VALSALMG
Sbjct  49   DQVAWDCVDDHTIVFKPPSQERAAQPAS-FVFDKVFDPSSITEAVYEDGVKNVALSALMG  107

Query  78   INATIFAYGQTSSGKTYTMRGITEKA  1
            INATIFAYGQTSSGKTYTMRGITEKA
Sbjct  108  INATIFAYGQTSSGKTYTMRGITEKA  133



>gb|KDP35186.1| hypothetical protein JCGZ_10720 [Jatropha curcas]
Length=963

 Score =   213 bits (542),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 121/146 (83%), Gaps = 13/146 (9%)
 Frame = -1

Query  438  MTIKVPGTPASRIERTPANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAK  259
            MT++ PGTPAS            K +RTPA+TPGG ++KE+KI+VTVRLRPLNKKEQ AK
Sbjct  1    MTVRTPGTPAS------------KFDRTPATTPGGPKAKEEKIVVTVRLRPLNKKEQLAK  48

Query  258  DNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMG  79
            D VAWEC+D+H+IV+KP   ER+ Q ++ FTFDKVFGP  LTETVYE+GVKTVALSALMG
Sbjct  49   DQVAWECVDDHTIVFKPPTQERTAQ-SNPFTFDKVFGPTCLTETVYEDGVKTVALSALMG  107

Query  78   INATIFAYGQTSSGKTYTMRGITEKA  1
            INATIFAYGQTSSGKTYTMRGITEKA
Sbjct  108  INATIFAYGQTSSGKTYTMRGITEKA  133



>ref|XP_007036598.1| ATP binding microtubule motor family protein isoform 2 [Theobroma 
cacao]
 gb|EOY21099.1| ATP binding microtubule motor family protein isoform 2 [Theobroma 
cacao]
Length=763

 Score =   212 bits (539),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 120/146 (82%), Gaps = 13/146 (9%)
 Frame = -1

Query  438  MTIKVPGTPASRIERTPANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAK  259
            MT++ PGTPAS            K +RTP +TPGG +SKE+KI+VTVRLRPL+K+EQ AK
Sbjct  1    MTVRTPGTPAS------------KTDRTPVTTPGGPKSKEEKIVVTVRLRPLSKREQLAK  48

Query  258  DNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMG  79
            D VAW+C+DEH+IV K    ER+ QPTSF TFDKVFGP+SLTETVYE+GVK VALS+LMG
Sbjct  49   DQVAWDCVDEHTIVSKHPAQERTAQPTSF-TFDKVFGPSSLTETVYEDGVKNVALSSLMG  107

Query  78   INATIFAYGQTSSGKTYTMRGITEKA  1
            INATIFAYGQTSSGKTYTMRGITEKA
Sbjct  108  INATIFAYGQTSSGKTYTMRGITEKA  133



>gb|KHN20772.1| Kinesin-related protein 4 [Glycine soja]
Length=962

 Score =   213 bits (541),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 119/146 (82%), Gaps = 13/146 (9%)
 Frame = -1

Query  438  MTIKVPGTPASRIERTPANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAK  259
            MT+K PGTPAS             I+RTP STPGG R+KE+KI+VTVRLRPLN++EQ AK
Sbjct  1    MTVKTPGTPAS------------NIDRTPVSTPGGARAKEEKIVVTVRLRPLNRREQLAK  48

Query  258  DNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMG  79
            D VAW+CI++++IVYKP  HER+ QP S FTFDKVFGP S+TE VYEEGVK +ALSAL G
Sbjct  49   DQVAWDCINDYTIVYKPPAHERASQPAS-FTFDKVFGPASVTEAVYEEGVKKIALSALTG  107

Query  78   INATIFAYGQTSSGKTYTMRGITEKA  1
            INAT+FAYGQTSSGKTYTMRGITEKA
Sbjct  108  INATVFAYGQTSSGKTYTMRGITEKA  133



>ref|XP_003528955.1| PREDICTED: kinesin-like protein NACK1-like isoform X1 [Glycine 
max]
 ref|XP_006583433.1| PREDICTED: kinesin-like protein NACK1-like isoform X2 [Glycine 
max]
Length=962

 Score =   213 bits (541),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 119/146 (82%), Gaps = 13/146 (9%)
 Frame = -1

Query  438  MTIKVPGTPASRIERTPANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAK  259
            MT+K PGTPAS             I+RTP STPGG R+KE+KI+VTVRLRPLN++EQ AK
Sbjct  1    MTVKTPGTPAS------------NIDRTPVSTPGGARAKEEKIVVTVRLRPLNRREQLAK  48

Query  258  DNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMG  79
            D VAW+CI++++IVYKP  HER+ QP S FTFDKVFGP S+TE VYEEGVK +ALSAL G
Sbjct  49   DQVAWDCINDYTIVYKPPAHERASQPAS-FTFDKVFGPASVTEAVYEEGVKKIALSALTG  107

Query  78   INATIFAYGQTSSGKTYTMRGITEKA  1
            INAT+FAYGQTSSGKTYTMRGITEKA
Sbjct  108  INATVFAYGQTSSGKTYTMRGITEKA  133



>ref|XP_010540004.1| PREDICTED: kinesin-like protein NACK1 [Tarenaya hassleriana]
Length=972

 Score =   213 bits (541),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 120/147 (82%), Gaps = 13/147 (9%)
 Frame = -1

Query  438  MTIKVPGTPASRIERTPANTPASKIERTPASTPGGQ-RSKEDKIMVTVRLRPLNKKEQSA  262
            MT+++PGTP S++ERT             A TPGG  RS+E+KI+VTVRLRPLNKKE SA
Sbjct  1    MTMRIPGTPTSKMERTAT-----------AVTPGGGPRSREEKIVVTVRLRPLNKKELSA  49

Query  261  KDNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALM  82
            KD VAWEC+D+H++VYK    ERSPQ +SF TFDKVFGP+SLTE VYEEGVK VALSALM
Sbjct  50   KDQVAWECVDDHTVVYKSPSQERSPQSSSF-TFDKVFGPDSLTENVYEEGVKNVALSALM  108

Query  81   GINATIFAYGQTSSGKTYTMRGITEKA  1
            GINATIFAYGQTSSGKTYTMRGITEKA
Sbjct  109  GINATIFAYGQTSSGKTYTMRGITEKA  135



>ref|XP_010537459.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Tarenaya hassleriana]
 ref|XP_010537460.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Tarenaya hassleriana]
 ref|XP_010537461.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Tarenaya hassleriana]
Length=975

 Score =   212 bits (539),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 120/147 (82%), Gaps = 13/147 (9%)
 Frame = -1

Query  438  MTIKVPGTPASRIERTPANTPASKIERTPASTP-GGQRSKEDKIMVTVRLRPLNKKEQSA  262
            MT++ PGTP S++ERT           T A TP GG R +E+KI+VTVRLRPLNKKE SA
Sbjct  1    MTMRTPGTPVSKMERT-----------TSAVTPAGGPRPREEKIVVTVRLRPLNKKEVSA  49

Query  261  KDNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALM  82
            KD VAWECID+H+IVYKP   ERSPQ +S FTFDKVFGP +LTE+VYEEGVK VALSALM
Sbjct  50   KDQVAWECIDDHTIVYKPPSQERSPQSSS-FTFDKVFGPETLTESVYEEGVKNVALSALM  108

Query  81   GINATIFAYGQTSSGKTYTMRGITEKA  1
            GINATIFAYGQTSSGKTYTMRGITEKA
Sbjct  109  GINATIFAYGQTSSGKTYTMRGITEKA  135



>ref|XP_011008305.1| PREDICTED: kinesin-like protein NACK1 [Populus euphratica]
Length=964

 Score =   211 bits (537),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 119/146 (82%), Gaps = 13/146 (9%)
 Frame = -1

Query  438  MTIKVPGTPASRIERTPANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAK  259
            MTI+ PGTPAS            KI+RTPA+TPGG ++KE+KI+VTVRLRPLNKKEQ AK
Sbjct  1    MTIRTPGTPAS------------KIDRTPATTPGGAKAKEEKIVVTVRLRPLNKKEQLAK  48

Query  258  DNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMG  79
            D VAW+C+D+H+IV+KP   ER+ QP S F FDKVF P+S+TE VYE+GVK VALSAL G
Sbjct  49   DQVAWDCVDDHTIVFKPPSQERAAQPAS-FVFDKVFDPSSITEAVYEDGVKNVALSALTG  107

Query  78   INATIFAYGQTSSGKTYTMRGITEKA  1
            INATIFAYGQTSSGKTYTMRGITEKA
Sbjct  108  INATIFAYGQTSSGKTYTMRGITEKA  133



>ref|XP_007036597.1| ATP binding microtubule motor family protein isoform 1 [Theobroma 
cacao]
 gb|EOY21098.1| ATP binding microtubule motor family protein isoform 1 [Theobroma 
cacao]
Length=964

 Score =   210 bits (535),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 120/146 (82%), Gaps = 13/146 (9%)
 Frame = -1

Query  438  MTIKVPGTPASRIERTPANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAK  259
            MT++ PGTPAS            K +RTP +TPGG +SKE+KI+VTVRLRPL+K+EQ AK
Sbjct  1    MTVRTPGTPAS------------KTDRTPVTTPGGPKSKEEKIVVTVRLRPLSKREQLAK  48

Query  258  DNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMG  79
            D VAW+C+DEH+IV K    ER+ QPTSF TFDKVFGP+SLTETVYE+GVK VALS+LMG
Sbjct  49   DQVAWDCVDEHTIVSKHPAQERTAQPTSF-TFDKVFGPSSLTETVYEDGVKNVALSSLMG  107

Query  78   INATIFAYGQTSSGKTYTMRGITEKA  1
            INATIFAYGQTSSGKTYTMRGITEKA
Sbjct  108  INATIFAYGQTSSGKTYTMRGITEKA  133



>ref|XP_011072914.1| PREDICTED: kinesin-like protein NACK1 [Sesamum indicum]
 ref|XP_011072915.1| PREDICTED: kinesin-like protein NACK1 [Sesamum indicum]
Length=961

 Score =   209 bits (533),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 100/132 (76%), Positives = 116/132 (88%), Gaps = 2/132 (2%)
 Frame = -1

Query  396  RTPANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIV  217
            RTP+ TPASK++RTP +TPGG R+KE+KI+VTVRLRPLNK+E  +KD +AWEC D+++IV
Sbjct  4    RTPS-TPASKMDRTPVATPGGHRAKEEKIVVTVRLRPLNKREHLSKDQIAWECTDDNTIV  62

Query  216  YKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSG  37
            YKP P ER+  P S FTFDKVFGP+  TE VYE+GVKTVALSALMGINATIFAYGQTSSG
Sbjct  63   YKPNPQERAALPAS-FTFDKVFGPDCSTEIVYEDGVKTVALSALMGINATIFAYGQTSSG  121

Query  36   KTYTMRGITEKA  1
            KTYTMRGITEKA
Sbjct  122  KTYTMRGITEKA  133



>ref|XP_003534160.1| PREDICTED: kinesin-like protein NACK1-like isoform X1 [Glycine 
max]
 ref|XP_006587490.1| PREDICTED: kinesin-like protein NACK1-like isoform X2 [Glycine 
max]
Length=962

 Score =   208 bits (529),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 118/146 (81%), Gaps = 13/146 (9%)
 Frame = -1

Query  438  MTIKVPGTPASRIERTPANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAK  259
            MT+K PGTPAS            KI+RTP ST G  R++E+KI+VTVRLRPLN++EQ AK
Sbjct  1    MTVKTPGTPAS------------KIDRTPVSTLGAARAREEKIVVTVRLRPLNRREQLAK  48

Query  258  DNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMG  79
            D VAW+CI++++IVYKP  HER+ QP S FTFDKVFGP S+TE VYEEGVK VALSAL G
Sbjct  49   DQVAWDCINDYTIVYKPPAHERTSQPAS-FTFDKVFGPASVTEAVYEEGVKKVALSALTG  107

Query  78   INATIFAYGQTSSGKTYTMRGITEKA  1
            INAT+FAYGQTSSGKTYTMRGITEKA
Sbjct  108  INATVFAYGQTSSGKTYTMRGITEKA  133



>gb|KHN23757.1| Kinesin-related protein 4 [Glycine soja]
Length=962

 Score =   208 bits (529),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 118/146 (81%), Gaps = 13/146 (9%)
 Frame = -1

Query  438  MTIKVPGTPASRIERTPANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAK  259
            MT+K PGTPAS            KI+RTP ST G  R++E+KI+VTVRLRPLN++EQ AK
Sbjct  1    MTVKTPGTPAS------------KIDRTPVSTLGAARAREEKIVVTVRLRPLNRREQLAK  48

Query  258  DNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMG  79
            D VAW+CI++++IVYKP  HER+ QP S FTFDKVFGP S+TE VYEEGVK VALSAL G
Sbjct  49   DQVAWDCINDYTIVYKPPAHERTSQPAS-FTFDKVFGPASVTEAVYEEGVKKVALSALTG  107

Query  78   INATIFAYGQTSSGKTYTMRGITEKA  1
            INAT+FAYGQTSSGKTYTMRGITEKA
Sbjct  108  INATVFAYGQTSSGKTYTMRGITEKA  133



>ref|XP_010110084.1| Kinesin-related protein 4 [Morus notabilis]
 gb|EXC25171.1| Kinesin-related protein 4 [Morus notabilis]
Length=963

 Score =   206 bits (524),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 118/146 (81%), Gaps = 14/146 (10%)
 Frame = -1

Query  438  MTIKVPGTPASRIERTPANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAK  259
            MT++ PGTP+S            KI+R+P STPGG R+KE+KI+VTVRLRPL+K+EQ AK
Sbjct  1    MTVRTPGTPSS------------KIDRSPVSTPGGPRAKEEKIVVTVRLRPLSKREQLAK  48

Query  258  DNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMG  79
            D VAWECID+++IVYKP   ER  QP S FTFDKVFGP  LTETVY +GVK VALSALMG
Sbjct  49   DQVAWECIDDNTIVYKPASLERLAQPAS-FTFDKVFGPTCLTETVY-DGVKNVALSALMG  106

Query  78   INATIFAYGQTSSGKTYTMRGITEKA  1
            INATIFAYGQTSSGKTYTMRGITEKA
Sbjct  107  INATIFAYGQTSSGKTYTMRGITEKA  132



>ref|XP_002893000.1| hypothetical protein ARALYDRAFT_472057 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69259.1| hypothetical protein ARALYDRAFT_472057 [Arabidopsis lyrata subsp. 
lyrata]
Length=974

 Score =   206 bits (524),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 114/146 (78%), Gaps = 12/146 (8%)
 Frame = -1

Query  438  MTIKVPGTPASRIERTPANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAK  259
            MTIK PGTP S+++RTPA TP            G  RS+E+KI+VTVRLRPLNKKE  AK
Sbjct  1    MTIKTPGTPVSKMDRTPAVTPG-----------GSSRSREEKIVVTVRLRPLNKKELLAK  49

Query  258  DNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMG  79
            D VAWEC+D+H+IV KP   ER    +SF TFDKVFGP SLTE VYE+GVK VALSALMG
Sbjct  50   DQVAWECVDDHTIVSKPQVQERLHHQSSF-TFDKVFGPESLTENVYEDGVKNVALSALMG  108

Query  78   INATIFAYGQTSSGKTYTMRGITEKA  1
            INATIFAYGQTSSGKTYTMRG+TEKA
Sbjct  109  INATIFAYGQTSSGKTYTMRGVTEKA  134



>ref|XP_006416611.1| hypothetical protein EUTSA_v10006702mg [Eutrema salsugineum]
 gb|ESQ34964.1| hypothetical protein EUTSA_v10006702mg [Eutrema salsugineum]
Length=968

 Score =   206 bits (523),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 101/133 (76%), Positives = 113/133 (85%), Gaps = 3/133 (2%)
 Frame = -1

Query  396  RTPANTPASKIERTPASTPGGQ-RSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSI  220
            RTP  TP SK++RT A TPGG  RS+E+KI+VTVRLRPLNKKEQ AKD VAWEC+D+H+I
Sbjct  2    RTPG-TPVSKMDRTQAVTPGGSSRSREEKIVVTVRLRPLNKKEQLAKDQVAWECVDDHTI  60

Query  219  VYKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSS  40
            V KP P ER    +SF TFDKVFGP S+TE VYE+GVK VALSALMGINATIFAYGQTSS
Sbjct  61   VSKPQPQERLHHQSSF-TFDKVFGPESITENVYEDGVKNVALSALMGINATIFAYGQTSS  119

Query  39   GKTYTMRGITEKA  1
            GKTYTMRG+TEKA
Sbjct  120  GKTYTMRGVTEKA  132



>ref|XP_009149278.1| PREDICTED: kinesin-like protein NACK1 [Brassica rapa]
Length=980

 Score =   205 bits (522),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 113/133 (85%), Gaps = 3/133 (2%)
 Frame = -1

Query  396  RTPANTPASKIERTPASTPGGQ-RSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSI  220
            RTP  TP SK +RTPA TPGG  RS+E+KI+VTVRLRPLNKKEQ AKD VAWEC+D+H+I
Sbjct  2    RTPG-TPLSKTDRTPAVTPGGSSRSREEKIVVTVRLRPLNKKEQLAKDQVAWECVDDHTI  60

Query  219  VYKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSS  40
            V KP   ERS   +SF TFDKVFGP S+TE VYE+GVK VALSALMGINATIFAYGQTSS
Sbjct  61   VSKPQAQERSHHQSSF-TFDKVFGPESVTEDVYEDGVKNVALSALMGINATIFAYGQTSS  119

Query  39   GKTYTMRGITEKA  1
            GKTYTMRG+TEKA
Sbjct  120  GKTYTMRGVTEKA  132



>emb|CDY26167.1| BnaA06g12500D [Brassica napus]
Length=980

 Score =   205 bits (522),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 113/133 (85%), Gaps = 3/133 (2%)
 Frame = -1

Query  396  RTPANTPASKIERTPASTPGGQ-RSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSI  220
            RTP  TP SK +RTPA TPGG  RS+E+KI+VTVRLRPLNKKEQ AKD VAWEC+D+H+I
Sbjct  2    RTPG-TPLSKTDRTPAVTPGGSSRSREEKIVVTVRLRPLNKKEQLAKDQVAWECVDDHTI  60

Query  219  VYKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSS  40
            V KP   ERS   +SF TFDKVFGP S+TE VYE+GVK VALSALMGINATIFAYGQTSS
Sbjct  61   VSKPQAQERSHHQSSF-TFDKVFGPESVTEDVYEDGVKNVALSALMGINATIFAYGQTSS  119

Query  39   GKTYTMRGITEKA  1
            GKTYTMRG+TEKA
Sbjct  120  GKTYTMRGVTEKA  132



>ref|XP_007152726.1| hypothetical protein PHAVU_004G154300g [Phaseolus vulgaris]
 gb|ESW24720.1| hypothetical protein PHAVU_004G154300g [Phaseolus vulgaris]
Length=961

 Score =   204 bits (518),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 117/146 (80%), Gaps = 15/146 (10%)
 Frame = -1

Query  438  MTIKVPGTPASRIERTPANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAK  259
            MT+K PGTPAS            KI+RTP STPGG R KE+KI+VTVRLRPLNK+EQ  K
Sbjct  1    MTLKTPGTPAS------------KIDRTPVSTPGGSRVKEEKIVVTVRLRPLNKREQLVK  48

Query  258  DNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMG  79
            D VAW+CI++++IVYKP PHER+ QP S FTFDKVFGP S TE VY EGVK VALS+L G
Sbjct  49   DQVAWDCINDYTIVYKP-PHERAAQPMS-FTFDKVFGPTSETEAVY-EGVKNVALSSLTG  105

Query  78   INATIFAYGQTSSGKTYTMRGITEKA  1
            INAT+FAYGQTSSGKTYTMRGITE+A
Sbjct  106  INATVFAYGQTSSGKTYTMRGITERA  131



>ref|XP_010279346.1| PREDICTED: kinesin-like protein NACK1 [Nelumbo nucifera]
Length=964

 Score =   202 bits (515),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 103/132 (78%), Positives = 114/132 (86%), Gaps = 3/132 (2%)
 Frame = -1

Query  396  RTPANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIV  217
            ++PA TPASKI+RTP STPGG + KE+KI+VTVRLRPL+K+EQS KD VAWECID+H+IV
Sbjct  4    KSPA-TPASKIDRTPVSTPGGPKVKEEKIVVTVRLRPLSKREQSLKDQVAWECIDDHTIV  62

Query  216  YKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSG  37
            YKP   ERS    S +TFDKVFGP SLTE VY EGVK VALSALMGINATIFAYGQTSSG
Sbjct  63   YKPPSQERSITSAS-YTFDKVFGPVSLTEAVY-EGVKNVALSALMGINATIFAYGQTSSG  120

Query  36   KTYTMRGITEKA  1
            KTYTMRGITEKA
Sbjct  121  KTYTMRGITEKA  132



>ref|NP_173273.2| kinesin HINKEL [Arabidopsis thaliana]
 sp|Q8S905.1|NACK1_ARATH RecName: Full=Kinesin-like protein NACK1; Short=AtNACK1; AltName: 
Full=NPK1-activating kinesin-1; AltName: Full=Protein HINKEL 
[Arabidopsis thaliana]
 dbj|BAB88748.1| AtNACK1 kinesin-like protein [Arabidopsis thaliana]
 gb|AEE29708.1| kinesin HINKEL [Arabidopsis thaliana]
Length=974

 Score =   202 bits (513),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 99/146 (68%), Positives = 114/146 (78%), Gaps = 12/146 (8%)
 Frame = -1

Query  438  MTIKVPGTPASRIERTPANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAK  259
            MTIK PGTP S+++RTPA TP            G  RS+E+KI+VTVRLRP+NK+E  AK
Sbjct  1    MTIKTPGTPVSKMDRTPAVTPG-----------GSSRSREEKIVVTVRLRPMNKRELLAK  49

Query  258  DNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMG  79
            D VAWEC+++H+IV KP   ER    +SF TFDKVFGP SLTE VYE+GVK VALSALMG
Sbjct  50   DQVAWECVNDHTIVSKPQVQERLHHQSSF-TFDKVFGPESLTENVYEDGVKNVALSALMG  108

Query  78   INATIFAYGQTSSGKTYTMRGITEKA  1
            INATIFAYGQTSSGKTYTMRG+TEKA
Sbjct  109  INATIFAYGQTSSGKTYTMRGVTEKA  134



>gb|AAF25984.1|AC013354_3 F15H18.12 [Arabidopsis thaliana]
Length=1003

 Score =   202 bits (513),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 99/146 (68%), Positives = 114/146 (78%), Gaps = 12/146 (8%)
 Frame = -1

Query  438  MTIKVPGTPASRIERTPANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAK  259
            MTIK PGTP S+++RTPA TP            G  RS+E+KI+VTVRLRP+NK+E  AK
Sbjct  1    MTIKTPGTPVSKMDRTPAVTPG-----------GSSRSREEKIVVTVRLRPMNKRELLAK  49

Query  258  DNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMG  79
            D VAWEC+++H+IV KP   ER    +SF TFDKVFGP SLTE VYE+GVK VALSALMG
Sbjct  50   DQVAWECVNDHTIVSKPQVQERLHHQSSF-TFDKVFGPESLTENVYEDGVKNVALSALMG  108

Query  78   INATIFAYGQTSSGKTYTMRGITEKA  1
            INATIFAYGQTSSGKTYTMRG+TEKA
Sbjct  109  INATIFAYGQTSSGKTYTMRGVTEKA  134



>ref|XP_006303901.1| hypothetical protein CARUB_v10008207mg [Capsella rubella]
 gb|EOA36799.1| hypothetical protein CARUB_v10008207mg [Capsella rubella]
Length=978

 Score =   201 bits (511),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 99/146 (68%), Positives = 113/146 (77%), Gaps = 12/146 (8%)
 Frame = -1

Query  438  MTIKVPGTPASRIERTPANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAK  259
            MT++ PGTP S+++RT A TP            G  RS+E+KI+VTVRLRPLNKKE  AK
Sbjct  1    MTMRTPGTPVSKMDRTQAVTPG-----------GSSRSREEKIVVTVRLRPLNKKELFAK  49

Query  258  DNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMG  79
            D VAWEC+D+H+IV KP   ER    +S FTFDKVFGP SLTE VYE+GVK VALSALMG
Sbjct  50   DQVAWECVDDHTIVSKPQAQERLHHQSS-FTFDKVFGPESLTENVYEDGVKNVALSALMG  108

Query  78   INATIFAYGQTSSGKTYTMRGITEKA  1
            INATIFAYGQTSSGKTYTMRG+TEKA
Sbjct  109  INATIFAYGQTSSGKTYTMRGVTEKA  134



>gb|EYU21085.1| hypothetical protein MIMGU_mgv1a000841mg [Erythranthe guttata]
Length=966

 Score =   201 bits (511),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 94/131 (72%), Positives = 113/131 (86%), Gaps = 5/131 (4%)
 Frame = -1

Query  381  TPASKIER----TPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVY  214
            TP+SK+ER    TP +TPGG R++E+KI+VT+RLRPLNK+EQS+K+ +AWEC D+H+IV 
Sbjct  5    TPSSKMERGNTNTPVTTPGGNRAREEKIVVTIRLRPLNKREQSSKEQMAWECTDDHTIVN  64

Query  213  KPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGK  34
            +   H+R+PQPTSF  FDKVFGP+   E VYE+GVKTVALSALMGINATIFAYGQTSSGK
Sbjct  65   RLNTHDRAPQPTSFM-FDKVFGPDCSNEIVYEDGVKTVALSALMGINATIFAYGQTSSGK  123

Query  33   TYTMRGITEKA  1
            TYTMRGITEKA
Sbjct  124  TYTMRGITEKA  134



>ref|XP_010459448.1| PREDICTED: kinesin-like protein NACK1 [Camelina sativa]
Length=981

 Score =   201 bits (510),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 99/146 (68%), Positives = 113/146 (77%), Gaps = 12/146 (8%)
 Frame = -1

Query  438  MTIKVPGTPASRIERTPANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAK  259
            MT++ PGTP S+I+RT A TP            G  RS+E+KI+VTVRLRPLNKKE  A+
Sbjct  1    MTMRTPGTPVSKIDRTQAVTPG-----------GSSRSREEKIVVTVRLRPLNKKELLAR  49

Query  258  DNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMG  79
            D VAWEC+D+H+IV KP   ER    +S FTFDKVFGP SLTE VYE+GVK VALSALMG
Sbjct  50   DQVAWECVDDHTIVSKPQFQERLHHQSS-FTFDKVFGPESLTENVYEDGVKNVALSALMG  108

Query  78   INATIFAYGQTSSGKTYTMRGITEKA  1
            INATIFAYGQTSSGKTYTMRG+TEKA
Sbjct  109  INATIFAYGQTSSGKTYTMRGVTEKA  134



>ref|XP_010906990.1| PREDICTED: kinesin-like protein NACK1 [Elaeis guineensis]
Length=957

 Score =   199 bits (507),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 109/132 (83%), Gaps = 2/132 (2%)
 Frame = -1

Query  396  RTPANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIV  217
            RTP  TPASKIERTP STPGG R K++KI VTVR+RPL+KKEQ+ KD + WECID+H+I+
Sbjct  5    RTPG-TPASKIERTPVSTPGGSRVKDEKIFVTVRMRPLSKKEQALKDEIVWECIDDHTIM  63

Query  216  YKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSG  37
            +K    ERS    S+ TFDKVFGPN LTE VYEEG K VALSAL GINATIFAYGQTSSG
Sbjct  64   FKGSTQERSNLSGSY-TFDKVFGPNCLTEIVYEEGAKNVALSALTGINATIFAYGQTSSG  122

Query  36   KTYTMRGITEKA  1
            KTYTMRGITE+A
Sbjct  123  KTYTMRGITERA  134



>ref|XP_010477014.1| PREDICTED: kinesin-like protein NACK1 [Camelina sativa]
Length=976

 Score =   199 bits (507),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 98/146 (67%), Positives = 112/146 (77%), Gaps = 12/146 (8%)
 Frame = -1

Query  438  MTIKVPGTPASRIERTPANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAK  259
            MT++ PGTP S+I+RT + TP            G  RS+E+KI+VTVRLRPLNKKE  AK
Sbjct  1    MTMRTPGTPVSKIDRTQSVTPG-----------GSSRSREEKIVVTVRLRPLNKKELLAK  49

Query  258  DNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMG  79
            D VAWEC+D+H+IV KP   ER    +S FTFDKVFGP S TE VYE+GVK VALSALMG
Sbjct  50   DQVAWECVDDHTIVSKPQAQERLHNQSS-FTFDKVFGPESFTENVYEDGVKNVALSALMG  108

Query  78   INATIFAYGQTSSGKTYTMRGITEKA  1
            INATIFAYGQTSSGKTYTMRG+TEKA
Sbjct  109  INATIFAYGQTSSGKTYTMRGVTEKA  134



>ref|XP_010498223.1| PREDICTED: kinesin-like protein NACK1 [Camelina sativa]
Length=976

 Score =   198 bits (504),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 97/146 (66%), Positives = 112/146 (77%), Gaps = 12/146 (8%)
 Frame = -1

Query  438  MTIKVPGTPASRIERTPANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAK  259
            MT++ PGTP S+++RT + TP            G  RS+E+KI+VTVRLRPLNKKE  AK
Sbjct  1    MTMRTPGTPVSKMDRTQSVTPG-----------GSSRSREEKIVVTVRLRPLNKKELLAK  49

Query  258  DNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMG  79
            D VAWEC+D+H+IV KP   ER    +S FTFDKVFGP S TE VYE+GVK VALSALMG
Sbjct  50   DQVAWECVDDHTIVSKPQAQERLHHQSS-FTFDKVFGPESFTENVYEDGVKNVALSALMG  108

Query  78   INATIFAYGQTSSGKTYTMRGITEKA  1
            INATIFAYGQTSSGKTYTMRG+TEKA
Sbjct  109  INATIFAYGQTSSGKTYTMRGVTEKA  134



>ref|XP_009117616.1| PREDICTED: kinesin-like protein NACK1 [Brassica rapa]
Length=949

 Score =   197 bits (501),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 111/135 (82%), Gaps = 5/135 (4%)
 Frame = -1

Query  396  RTPANTPASKIERTPASTPGGQ--RSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHS  223
            RTP  TP SK +RT A TPGG   RS+E+KI+VTVRLRPLNKKE  A+D VAW+C+D H+
Sbjct  2    RTPG-TPVSKTDRTQAVTPGGSSSRSREEKIVVTVRLRPLNKKELLARDQVAWQCVDSHT  60

Query  222  IVYKPM-PHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQT  46
            IV KP  PHERS   +SF TFDKVFGP S TE VYE+GVK VALSALMGINATIFAYGQT
Sbjct  61   IVSKPQAPHERSHHQSSF-TFDKVFGPESFTEDVYEDGVKNVALSALMGINATIFAYGQT  119

Query  45   SSGKTYTMRGITEKA  1
            SSGKTYTMRG+TEKA
Sbjct  120  SSGKTYTMRGVTEKA  134



>emb|CDY21709.1| BnaA09g44600D [Brassica napus]
Length=949

 Score =   197 bits (501),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 111/135 (82%), Gaps = 5/135 (4%)
 Frame = -1

Query  396  RTPANTPASKIERTPASTPGGQ--RSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHS  223
            RTP  TP SK +RT A TPGG   RS+E+KI+VTVRLRPLNKKE  A+D VAW+C+D H+
Sbjct  2    RTPG-TPVSKTDRTQAVTPGGSSSRSREEKIVVTVRLRPLNKKELLARDQVAWQCVDSHT  60

Query  222  IVYKPM-PHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQT  46
            IV KP  PHERS   +SF TFDKVFGP S TE VYE+GVK VALSALMGINATIFAYGQT
Sbjct  61   IVSKPQAPHERSHHQSSF-TFDKVFGPESFTEDVYEDGVKNVALSALMGINATIFAYGQT  119

Query  45   SSGKTYTMRGITEKA  1
            SSGKTYTMRG+TEKA
Sbjct  120  SSGKTYTMRGVTEKA  134



>emb|CDX81870.1| BnaC08g37310D [Brassica napus]
Length=953

 Score =   197 bits (500),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 97/134 (72%), Positives = 106/134 (79%), Gaps = 3/134 (2%)
 Frame = -1

Query  396  RTPANTPASKIERTPASTPGGQ--RSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHS  223
            RTP  TP SK +RT A TPGG   RS+E+KI+VTVRLRPLNKKE  AKD VAW+C+D H+
Sbjct  2    RTPG-TPVSKTDRTQAVTPGGSSSRSREEKIVVTVRLRPLNKKELLAKDQVAWQCVDSHT  60

Query  222  IVYKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTS  43
            IV KP  H       S FTFDKVFGP S TE VYE+GVK VALSALMGINATIFAYGQTS
Sbjct  61   IVSKPQAHHERSHHQSSFTFDKVFGPESFTEDVYEDGVKNVALSALMGINATIFAYGQTS  120

Query  42   SGKTYTMRGITEKA  1
            SGKTYTMRG+TEKA
Sbjct  121  SGKTYTMRGVTEKA  134



>gb|KHG01962.1| Kinesin-related 4 [Gossypium arboreum]
Length=963

 Score =   196 bits (497),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 99/146 (68%), Positives = 117/146 (80%), Gaps = 14/146 (10%)
 Frame = -1

Query  438  MTIKVPGTPASRIERTPANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAK  259
            MT+K PGTP++            KI++TP +TPGG +SKE+KI+VTVRLRPL+K+EQ AK
Sbjct  1    MTVKTPGTPSN------------KIDKTPVTTPGGPKSKEEKIVVTVRLRPLSKREQLAK  48

Query  258  DNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMG  79
            D VAW+C+D+H+IV K    ER+ QP+S FTFDKVFGP+ L ETVY EGVK VALSAL G
Sbjct  49   DQVAWDCVDDHTIVSKHPSQERTAQPSS-FTFDKVFGPSCLNETVY-EGVKNVALSALGG  106

Query  78   INATIFAYGQTSSGKTYTMRGITEKA  1
            INATIFAYGQTSSGKTYTMRGITEKA
Sbjct  107  INATIFAYGQTSSGKTYTMRGITEKA  132



>ref|XP_010250094.1| PREDICTED: kinesin-like protein NACK1 [Nelumbo nucifera]
Length=965

 Score =   195 bits (496),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 111/131 (85%), Gaps = 3/131 (2%)
 Frame = -1

Query  393  TPANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVY  214
            TPA TP SKI+RTP STPGG + KE+KI+VTVRLRPL+++EQS KD VAWECID+ +IV+
Sbjct  5    TPA-TPVSKIDRTPVSTPGGTKVKEEKIVVTVRLRPLSRREQSLKDQVAWECIDDQTIVF  63

Query  213  KPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGK  34
            KP P +R   P S +TFD++FGP S TETVY EGVK V LSALMGINATIFAYGQTSSGK
Sbjct  64   KPPPQDRLLTPAS-YTFDRIFGPGSSTETVY-EGVKNVVLSALMGINATIFAYGQTSSGK  121

Query  33   TYTMRGITEKA  1
            TYTMRGITEKA
Sbjct  122  TYTMRGITEKA  132



>ref|XP_008792831.1| PREDICTED: LOW QUALITY PROTEIN: kinesin-like protein NACK1 [Phoenix 
dactylifera]
Length=964

 Score =   194 bits (492),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 106/132 (80%), Gaps = 2/132 (2%)
 Frame = -1

Query  396  RTPANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIV  217
            RTP  TPASK ERTP STPGG R K++KI VTVR+RPL+KKEQ+ KD + W+CID+H+IV
Sbjct  5    RTPG-TPASKTERTPVSTPGGSRVKDEKIFVTVRMRPLSKKEQALKDEIVWDCIDDHTIV  63

Query  216  YKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSG  37
            +K    ERS  P  +  FDKVFGPN LTE VYEEG K VALSAL GINATIFAYGQTSSG
Sbjct  64   FKGSTQERSNLPGPY-AFDKVFGPNCLTEIVYEEGAKNVALSALTGINATIFAYGQTSSG  122

Query  36   KTYTMRGITEKA  1
            KTYTMRGITE A
Sbjct  123  KTYTMRGITENA  134



>emb|CDY19208.1| BnaC05g14090D [Brassica napus]
Length=974

 Score =   193 bits (490),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 107/132 (81%), Gaps = 5/132 (4%)
 Frame = -1

Query  396  RTPANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIV  217
            RTP  TP SK +RTP    G  RS+E+KI+VTVRLRPLNKKEQ AKD VAW C+D+H+IV
Sbjct  2    RTPG-TPLSKTDRTPG---GSSRSREEKIVVTVRLRPLNKKEQLAKDQVAWVCVDDHTIV  57

Query  216  YKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSG  37
             KP   ERS   +SF TFDKVFGP S+TE VYE GVK VALSALMGINATIFAYGQTSSG
Sbjct  58   SKPQAQERSHHQSSF-TFDKVFGPESVTEDVYENGVKNVALSALMGINATIFAYGQTSSG  116

Query  36   KTYTMRGITEKA  1
            KTYTMRG+TEKA
Sbjct  117  KTYTMRGVTEKA  128



>ref|XP_010922342.1| PREDICTED: kinesin-like protein NACK1 [Elaeis guineensis]
Length=959

 Score =   192 bits (488),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 106/132 (80%), Gaps = 2/132 (2%)
 Frame = -1

Query  396  RTPANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIV  217
            RTP  TPASKIERTP STPGG R K++KI VTVR+RPL+KKE + KD + W+CID+H+IV
Sbjct  5    RTPG-TPASKIERTPISTPGGSRVKDEKIFVTVRMRPLSKKELTLKDEIVWDCIDDHTIV  63

Query  216  YKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSG  37
            +K    ERS  P S   FDKVFGP+ LTE VYEEG K VALSAL GINATIFAYGQTSSG
Sbjct  64   FKGSTQERSNLPGSH-AFDKVFGPDCLTEIVYEEGAKNVALSALTGINATIFAYGQTSSG  122

Query  36   KTYTMRGITEKA  1
            KTYTMRGITE A
Sbjct  123  KTYTMRGITESA  134



>ref|XP_008775906.1| PREDICTED: kinesin-like protein NACK1 [Phoenix dactylifera]
Length=964

 Score =   191 bits (484),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 92/132 (70%), Positives = 107/132 (81%), Gaps = 2/132 (2%)
 Frame = -1

Query  396  RTPANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIV  217
            RTP  TPASK+ERTP STPGG R K++KI VTVR+RPL+KKE + KD + W+CID+H+I+
Sbjct  5    RTPG-TPASKMERTPVSTPGGSRVKDEKIFVTVRMRPLSKKELALKDELVWDCIDDHTII  63

Query  216  YKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSG  37
            +K    ERS  P S+  FDKVFGP+ LTE VY+EG K VALSAL GINATIFAYGQTSSG
Sbjct  64   FKGSTQERSNSPGSY-AFDKVFGPDCLTEIVYDEGAKNVALSALTGINATIFAYGQTSSG  122

Query  36   KTYTMRGITEKA  1
            KTYTMRGITE A
Sbjct  123  KTYTMRGITESA  134



>gb|KHG07572.1| kif4 [Gossypium arboreum]
Length=929

 Score =   190 bits (483),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 99/146 (68%), Positives = 114/146 (78%), Gaps = 14/146 (10%)
 Frame = -1

Query  438  MTIKVPGTPASRIERTPANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAK  259
            MT++ PGTPA             KI+RTP +TPGG +SKE+KI+VTVRLRPL+K+EQ AK
Sbjct  1    MTVRTPGTPAR------------KIDRTPVTTPGGPKSKEEKIVVTVRLRPLSKREQLAK  48

Query  258  DNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMG  79
            D VAW+C D+++IV K    ER+ QP   FTFDKVFGP+ L ETVY EGVKTVALSAL G
Sbjct  49   DQVAWDCKDDYTIVSKHPSQERTAQPPP-FTFDKVFGPSCLNETVY-EGVKTVALSALGG  106

Query  78   INATIFAYGQTSSGKTYTMRGITEKA  1
            INATIFAYGQTSSGKTYTMRGITEKA
Sbjct  107  INATIFAYGQTSSGKTYTMRGITEKA  132



>gb|KHG07573.1| kif4 [Gossypium arboreum]
Length=962

 Score =   190 bits (482),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 99/146 (68%), Positives = 114/146 (78%), Gaps = 14/146 (10%)
 Frame = -1

Query  438  MTIKVPGTPASRIERTPANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAK  259
            MT++ PGTPA             KI+RTP +TPGG +SKE+KI+VTVRLRPL+K+EQ AK
Sbjct  1    MTVRTPGTPAR------------KIDRTPVTTPGGPKSKEEKIVVTVRLRPLSKREQLAK  48

Query  258  DNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMG  79
            D VAW+C D+++IV K    ER+ QP   FTFDKVFGP+ L ETVY EGVKTVALSAL G
Sbjct  49   DQVAWDCKDDYTIVSKHPSQERTAQPPP-FTFDKVFGPSCLNETVY-EGVKTVALSALGG  106

Query  78   INATIFAYGQTSSGKTYTMRGITEKA  1
            INATIFAYGQTSSGKTYTMRGITEKA
Sbjct  107  INATIFAYGQTSSGKTYTMRGITEKA  132



>ref|XP_006842375.1| hypothetical protein AMTR_s00079p00190770 [Amborella trichopoda]
 gb|ERN04050.1| hypothetical protein AMTR_s00079p00190770 [Amborella trichopoda]
Length=1007

 Score =   189 bits (480),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 95/157 (61%), Positives = 115/157 (73%), Gaps = 15/157 (10%)
 Frame = -1

Query  429  KVPGTPASRIERTPANTP--------------ASKIERTPASTPGGQRSKEDKIMVTVRL  292
            K+  TPAS+IERTP +TP              ASKIERTP STPGG +++E+KI+VTVR+
Sbjct  33   KIHATPASKIERTPLSTPVFPKAREEKIHATPASKIERTPLSTPGGPKAREEKILVTVRV  92

Query  291  RPLNKKEQSAKDNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEG  112
            RPL+ KE + +D +AWEC D+H+I++K    ERS    S +TFD+VF P  LTE VY EG
Sbjct  93   RPLSSKELAQRDQIAWECADDHTILFKNQSQERSSSQAS-YTFDRVFRPECLTERVYVEG  151

Query  111  VKTVALSALMGINATIFAYGQTSSGKTYTMRGITEKA  1
             K VALSAL GINATIFAYGQTSSGKT+TMRGITE A
Sbjct  152  AKDVALSALTGINATIFAYGQTSSGKTFTMRGITECA  188



>ref|XP_008337808.1| PREDICTED: kinesin-like protein NACK2 isoform X2 [Malus domestica]
Length=942

 Score =   186 bits (471),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 110/142 (77%), Gaps = 12/142 (8%)
 Frame = -1

Query  426  VPGTPASRIERTPANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAKDNVA  247
            +PGTPA         TP+SK+ RTP STPGG +  E+KI+VTVRLRPLN++EQ+  D +A
Sbjct  2    MPGTPA---------TPSSKVRRTPCSTPGGSKVSEEKILVTVRLRPLNRREQALYDLIA  52

Query  246  WECIDEHSIVYKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINAT  67
            W+C+DEH+IV+K   HER   P++ +TFDKVFGP   T+ VYEEG K VALSAL G+NAT
Sbjct  53   WDCLDEHTIVFKNPNHER---PSNPYTFDKVFGPMCSTQKVYEEGAKDVALSALTGMNAT  109

Query  66   IFAYGQTSSGKTYTMRGITEKA  1
            IFAYGQTSSGKT+TMRGITE A
Sbjct  110  IFAYGQTSSGKTFTMRGITENA  131



>ref|XP_008337807.1| PREDICTED: kinesin-like protein NACK2 isoform X1 [Malus domestica]
Length=944

 Score =   186 bits (471),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 110/142 (77%), Gaps = 12/142 (8%)
 Frame = -1

Query  426  VPGTPASRIERTPANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAKDNVA  247
            +PGTPA         TP+SK+ RTP STPGG +  E+KI+VTVRLRPLN++EQ+  D +A
Sbjct  2    MPGTPA---------TPSSKVRRTPCSTPGGSKVSEEKILVTVRLRPLNRREQALYDLIA  52

Query  246  WECIDEHSIVYKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINAT  67
            W+C+DEH+IV+K   HER   P++ +TFDKVFGP   T+ VYEEG K VALSAL G+NAT
Sbjct  53   WDCLDEHTIVFKNPNHER---PSNPYTFDKVFGPMCSTQKVYEEGAKDVALSALTGMNAT  109

Query  66   IFAYGQTSSGKTYTMRGITEKA  1
            IFAYGQTSSGKT+TMRGITE A
Sbjct  110  IFAYGQTSSGKTFTMRGITENA  131



>ref|XP_009359691.1| PREDICTED: kinesin-like protein NACK2 [Pyrus x bretschneideri]
Length=942

 Score =   184 bits (468),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 110/142 (77%), Gaps = 12/142 (8%)
 Frame = -1

Query  426  VPGTPASRIERTPANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAKDNVA  247
            +PGTPA         TP++K+ RTP STPGG +  E+KI+VTVRLRPLN++EQ+  D +A
Sbjct  2    MPGTPA---------TPSTKVRRTPCSTPGGSKVSEEKILVTVRLRPLNRREQALYDLIA  52

Query  246  WECIDEHSIVYKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINAT  67
            W+C+DEH+IV+K   HER   P++ +TFDKVFGP   T+ VYEEG K VALSAL G+NAT
Sbjct  53   WDCLDEHTIVFKNPNHER---PSNPYTFDKVFGPMCSTQKVYEEGAKDVALSALTGMNAT  109

Query  66   IFAYGQTSSGKTYTMRGITEKA  1
            IFAYGQTSSGKT+TMRGITE A
Sbjct  110  IFAYGQTSSGKTFTMRGITENA  131



>ref|XP_010227940.1| PREDICTED: kinesin-like protein NACK1 [Brachypodium distachyon]
Length=970

 Score =   181 bits (458),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 94/157 (60%), Positives = 115/157 (73%), Gaps = 18/157 (11%)
 Frame = -1

Query  423  PGTPASRIERTPA---------------NTPASKIERTPASTPGGQ-RSKEDKIMVTVRL  292
            P TPAS+IERTP+               +TPASKIERTP+ TPGG  R+KE+KI VTVR+
Sbjct  7    PSTPASKIERTPSVTPGSSSRSKEEKISSTPASKIERTPSVTPGGSSRAKEEKIFVTVRV  66

Query  291  RPLNKKEQSAKDNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEG  112
            RPL+KKE +  D VAWEC D  +I+YK  P +R+  P S+ TFDKVFGP   T+ VYE+G
Sbjct  67   RPLSKKELAVNDQVAWECADSQTILYKGPPQDRAA-PNSY-TFDKVFGPGCQTDLVYEDG  124

Query  111  VKTVALSALMGINATIFAYGQTSSGKTYTMRGITEKA  1
             K VA+SA+ GINATIFAYGQTSSGKT+T+RG+TE A
Sbjct  125  AKDVAMSAMTGINATIFAYGQTSSGKTFTIRGVTESA  161



>ref|XP_009418072.1| PREDICTED: kinesin-like protein NACK1 [Musa acuminata subsp. 
malaccensis]
Length=966

 Score =   181 bits (458),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 87/130 (67%), Positives = 102/130 (78%), Gaps = 1/130 (1%)
 Frame = -1

Query  390  PANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYK  211
            P +TP SK+E+    TPGG R KE+KI VTVR+RPL++KE S KD  AWECID++ IV+K
Sbjct  6    PPSTPVSKVEKMSVCTPGGSRVKEEKIFVTVRVRPLSRKELSLKDQEAWECIDDNKIVFK  65

Query  210  PMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKT  31
                +R+  P+S+ TFDKVFGP  LTE VYEEG K VALSAL GINATIFAYGQTSSGKT
Sbjct  66   MSSQDRTNSPSSY-TFDKVFGPTCLTERVYEEGAKNVALSALTGINATIFAYGQTSSGKT  124

Query  30   YTMRGITEKA  1
            +TMRGITE A
Sbjct  125  FTMRGITENA  134



>ref|XP_007203229.1| hypothetical protein PRUPE_ppa000925mg [Prunus persica]
 gb|EMJ04428.1| hypothetical protein PRUPE_ppa000925mg [Prunus persica]
Length=960

 Score =   180 bits (456),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 105/142 (74%), Gaps = 12/142 (8%)
 Frame = -1

Query  426  VPGTPASRIERTPANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAKDNVA  247
            +PGTPA         TP SKI R   STPGG +  E+KI+VTVRLRPLN++EQ+  D +A
Sbjct  2    MPGTPA---------TPLSKIRRNLYSTPGGSKVHEEKILVTVRLRPLNRREQAMYDLIA  52

Query  246  WECIDEHSIVYKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINAT  67
            W+C+DEH+IV+K   HER   P   +TFDKVFGP   T+ VYEEG K VALSAL G+NAT
Sbjct  53   WDCLDEHTIVFKNPNHERPANP---YTFDKVFGPMCSTQKVYEEGAKDVALSALTGMNAT  109

Query  66   IFAYGQTSSGKTYTMRGITEKA  1
            IFAYGQTSSGKT+TMRGITE A
Sbjct  110  IFAYGQTSSGKTFTMRGITEHA  131



>ref|XP_004287670.1| PREDICTED: uncharacterized protein LOC101306666 [Fragaria vesca 
subsp. vesca]
Length=947

 Score =   179 bits (455),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 88/131 (67%), Positives = 104/131 (79%), Gaps = 4/131 (3%)
 Frame = -1

Query  393  TPANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVY  214
            TPA TP SKI RT  STPGG R +E+KI+VTVRLRPLN++EQ+  D +AW+C+DE++IV+
Sbjct  5    TPA-TPNSKIHRTICSTPGGSRVREEKILVTVRLRPLNRREQAMYDLIAWDCLDENTIVF  63

Query  213  KPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGK  34
            K   HER   P   +TFDKVFGP   T+ VYEEG K VALSAL G+NATIFAYGQTSSGK
Sbjct  64   KNPNHERPANP---YTFDKVFGPTCSTQKVYEEGAKDVALSALTGMNATIFAYGQTSSGK  120

Query  33   TYTMRGITEKA  1
            T+TMRGITE A
Sbjct  121  TFTMRGITENA  131



>ref|XP_008242294.1| PREDICTED: kinesin-like protein NACK2 [Prunus mume]
Length=946

 Score =   179 bits (455),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 105/142 (74%), Gaps = 12/142 (8%)
 Frame = -1

Query  426  VPGTPASRIERTPANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAKDNVA  247
            +PGTPA         TP SKI R   STPGG +  E+KI+VTVRLRPLN++EQ+  D +A
Sbjct  2    MPGTPA---------TPLSKIRRNLYSTPGGSKVHEEKILVTVRLRPLNRREQAMYDLIA  52

Query  246  WECIDEHSIVYKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINAT  67
            W+C+DEH+IV+K   HER   P   +TFDKVFGP   T+ VYEEG K VALSAL G+NAT
Sbjct  53   WDCLDEHTIVFKNPNHERPANP---YTFDKVFGPMCSTQKVYEEGAKDVALSALTGMNAT  109

Query  66   IFAYGQTSSGKTYTMRGITEKA  1
            IFAYGQTSSGKT+TMRGITE A
Sbjct  110  IFAYGQTSSGKTFTMRGITEHA  131



>ref|XP_006644227.1| PREDICTED: kinesin-like protein NACK1-like [Oryza brachyantha]
Length=954

 Score =   179 bits (453),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 91/133 (68%), Positives = 106/133 (80%), Gaps = 5/133 (4%)
 Frame = -1

Query  390  PANTPASKIERTPASTP---GGQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSI  220
            P +TPASKIERTP STP   G  R+KE+KI VTVR+RPL+KKE + KD VAWEC D  +I
Sbjct  6    PPSTPASKIERTPMSTPTPGGSSRAKEEKIFVTVRVRPLSKKELALKDQVAWECADNQTI  65

Query  219  VYKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSS  40
            +YK  P +R+  PTS+ TFDKVFGP S T+ VYEEG K VA+SAL GINATIFAYGQTSS
Sbjct  66   LYKGPPQDRAA-PTSY-TFDKVFGPASQTDVVYEEGAKDVAMSALTGINATIFAYGQTSS  123

Query  39   GKTYTMRGITEKA  1
            GKT+TMRG+TE A
Sbjct  124  GKTFTMRGVTESA  136



>ref|NP_001043186.1| Os01g0513900 [Oryza sativa Japonica Group]
 dbj|BAB32972.1| putative KIF3 protein [Oryza sativa Japonica Group]
 dbj|BAF05100.1| Os01g0513900 [Oryza sativa Japonica Group]
 gb|EEE54684.1| hypothetical protein OsJ_01991 [Oryza sativa Japonica Group]
Length=954

 Score =   178 bits (451),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 105/133 (79%), Gaps = 5/133 (4%)
 Frame = -1

Query  390  PANTPASKIERTPASTP---GGQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSI  220
            P +TPASKIERTP STP   G  R KE+KI VTVR+RPL+KKE + KD VAWEC D  +I
Sbjct  6    PPSTPASKIERTPMSTPTPGGSTRVKEEKIFVTVRVRPLSKKELALKDQVAWECDDNQTI  65

Query  219  VYKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSS  40
            +YK  P +R+  PTS+ TFDKVFGP S TE VYEEG K VA+SAL GINATIFAYGQTSS
Sbjct  66   LYKGPPQDRAA-PTSY-TFDKVFGPASQTEVVYEEGAKDVAMSALTGINATIFAYGQTSS  123

Query  39   GKTYTMRGITEKA  1
            GKT+TMRG+TE A
Sbjct  124  GKTFTMRGVTESA  136



>ref|XP_004968822.1| PREDICTED: kinesin-like protein NACK1-like isoform X1 [Setaria 
italica]
 ref|XP_004968823.1| PREDICTED: kinesin-like protein NACK1-like isoform X2 [Setaria 
italica]
 ref|XP_004968824.1| PREDICTED: kinesin-like protein NACK1-like isoform X3 [Setaria 
italica]
Length=951

 Score =   177 bits (449),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 105/131 (80%), Gaps = 3/131 (2%)
 Frame = -1

Query  390  PANTPASKIERTPASTPGGQ-RSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVY  214
            P +TPASK ERTP STPGG  R+KE+KI VTVR+RPL+KKE + KD VAWEC D  +I+Y
Sbjct  6    PPSTPASKGERTPMSTPGGSSRAKEEKIFVTVRVRPLSKKELAVKDEVAWECADSQTILY  65

Query  213  KPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGK  34
            K  P +R+  PTS+ TFDKVFGP   T+ VYEEG K VA+SAL GINATIFAYGQTSSGK
Sbjct  66   KGPPQDRAA-PTSY-TFDKVFGPACQTDVVYEEGAKDVAMSALTGINATIFAYGQTSSGK  123

Query  33   TYTMRGITEKA  1
            T+TMRG+TE A
Sbjct  124  TFTMRGVTESA  134



>gb|EEC70753.1| hypothetical protein OsI_02166 [Oryza sativa Indica Group]
Length=954

 Score =   176 bits (447),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 91/133 (68%), Positives = 105/133 (79%), Gaps = 5/133 (4%)
 Frame = -1

Query  390  PANTPASKIERTPASTP---GGQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSI  220
            P +TPASKIERTP STP   G  R KE+KI VTVR+RPL+KKE + KD VAWEC D  +I
Sbjct  6    PPSTPASKIERTPMSTPTPGGSTRVKEEKIFVTVRVRPLSKKELALKDQVAWECDDNQTI  65

Query  219  VYKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSS  40
            +YK  P +R+  PTS+ TFDKVFGP S T+ VYEEG K VA+SAL GINATIFAYGQTSS
Sbjct  66   LYKGPPQDRAA-PTSY-TFDKVFGPASQTDVVYEEGAKDVAMSALTGINATIFAYGQTSS  123

Query  39   GKTYTMRGITEKA  1
            GKT+TMRG+TE A
Sbjct  124  GKTFTMRGVTESA  136



>ref|XP_002516209.1| microtubule motor, putative [Ricinus communis]
 gb|EEF46211.1| microtubule motor, putative [Ricinus communis]
Length=891

 Score =   176 bits (445),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 86/128 (67%), Positives = 103/128 (80%), Gaps = 4/128 (3%)
 Frame = -1

Query  381  TPASKIERTPASTPGG-QRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPM  205
            TPA KI+RTP++TPGG  R +E+KI+VTVR+RPL++KEQ+  D +AW+C D+HSIVYK  
Sbjct  7    TPACKIQRTPSTTPGGCSRIREEKILVTVRIRPLSRKEQALYDLIAWDCPDDHSIVYKNP  66

Query  204  PHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYT  25
             HER   P   +TFDKVF   S T+ VYEEG K VALSALMG+NATIFAYGQTSSGKT+T
Sbjct  67   NHERPAVP---YTFDKVFDAASSTQKVYEEGAKNVALSALMGMNATIFAYGQTSSGKTFT  123

Query  24   MRGITEKA  1
            MRGITE A
Sbjct  124  MRGITENA  131



>ref|XP_009407329.1| PREDICTED: kinesin-like protein NACK1 [Musa acuminata subsp. 
malaccensis]
Length=962

 Score =   176 bits (446),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 99/130 (76%), Gaps = 1/130 (1%)
 Frame = -1

Query  390  PANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYK  211
            P NTP SKIER P  TPG  R KE+KI VTVR+RPL+KKE S KD  AW C+D++ IV+K
Sbjct  6    PPNTPTSKIERIPIYTPGRSRIKEEKIFVTVRVRPLSKKELSLKDQEAWTCVDDNKIVFK  65

Query  210  PMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKT  31
             MP +     +S +TFDKVFG   LTE VYEEG K VALSAL GINATIFAYGQTSSGKT
Sbjct  66   -MPAQDRSNSSSSYTFDKVFGAACLTERVYEEGAKDVALSALTGINATIFAYGQTSSGKT  124

Query  30   YTMRGITEKA  1
            +TMRGITE A
Sbjct  125  FTMRGITENA  134



>ref|XP_003568740.1| PREDICTED: kinesin-like protein NACK1 [Brachypodium distachyon]
Length=951

 Score =   173 bits (439),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 91/135 (67%), Positives = 106/135 (79%), Gaps = 6/135 (4%)
 Frame = -1

Query  396  RTPANTPASKIERT--PASTPGGQ-RSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEH  226
            RTP  TPASKIERT  P  TPGG  RSKE+KI VTVR+RPL+KKE + KD VAW+C D H
Sbjct  5    RTPG-TPASKIERTQLPTLTPGGSSRSKEEKIFVTVRVRPLSKKELAVKDQVAWDCADSH  63

Query  225  SIVYKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQT  46
            +I+YK  P +R+  PTS+ TFDKVFGP   T+ VY +G K VA+SAL GINATIFAYGQT
Sbjct  64   TILYKAPPQDRAA-PTSY-TFDKVFGPTCQTDLVYADGAKDVAMSALTGINATIFAYGQT  121

Query  45   SSGKTYTMRGITEKA  1
            SSGKT+TMRG+TE A
Sbjct  122  SSGKTFTMRGVTESA  136



>ref|XP_002437695.1| hypothetical protein SORBIDRAFT_10g001010 [Sorghum bicolor]
 gb|EER89062.1| hypothetical protein SORBIDRAFT_10g001010 [Sorghum bicolor]
Length=950

 Score =   173 bits (439),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 105/131 (80%), Gaps = 3/131 (2%)
 Frame = -1

Query  390  PANTPASKIERTPASTPGGQ-RSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVY  214
            P +TPASK E TP STPGG  R+KE+KI VTVR+RPL+KKE + KD+VAWEC D  +I+Y
Sbjct  6    PPSTPASKGEHTPMSTPGGSSRAKEEKIFVTVRVRPLSKKELAVKDDVAWECADSQTILY  65

Query  213  KPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGK  34
            K    +R+  PTS+ TFDKVFGP S T+ VYEEG K VA+SAL GINATIFAYGQTSSGK
Sbjct  66   KGPTQDRAA-PTSY-TFDKVFGPASQTDVVYEEGAKDVAMSALTGINATIFAYGQTSSGK  123

Query  33   TYTMRGITEKA  1
            T+TMRG+TE A
Sbjct  124  TFTMRGVTESA  134



>gb|KDP33977.1| hypothetical protein JCGZ_07548 [Jatropha curcas]
Length=946

 Score =   172 bits (437),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 86/131 (66%), Positives = 104/131 (79%), Gaps = 4/131 (3%)
 Frame = -1

Query  393  TPANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVY  214
            TPA TPASKI RTP+STP G + +E+KI+VTVRLRPL+++EQ+  D +AW+C D+ +IV+
Sbjct  4    TPA-TPASKIHRTPSSTPVGSKVREEKILVTVRLRPLSRREQALYDLIAWDCPDDRTIVF  62

Query  213  KPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGK  34
            K    ER   P + +TFDKVF P   T+ VYEEG K VALSALMGINATIFAYGQTSSGK
Sbjct  63   KNPSLER---PATSYTFDKVFDPACSTQKVYEEGAKNVALSALMGINATIFAYGQTSSGK  119

Query  33   TYTMRGITEKA  1
            T+TMRGITE A
Sbjct  120  TFTMRGITENA  130



>gb|AFW86156.1| LOW QUALITY PROTEIN: kinesin heavy chain, partial [Zea mays]
Length=949

 Score =   172 bits (435),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 88/131 (67%), Positives = 104/131 (79%), Gaps = 3/131 (2%)
 Frame = -1

Query  390  PANTPASKIERTPASTPGGQ-RSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVY  214
            P +TPASK E TP STPGG  R+KE+KI VTVR+RPL+KKE +AKD+VAWEC D  +I+Y
Sbjct  6    PPSTPASKGEHTPMSTPGGSSRAKEEKIFVTVRVRPLSKKELAAKDDVAWECADTQTILY  65

Query  213  KPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGK  34
            K    +R+  P S+ TFDKVFGP   T+ VYEEG K VA+SAL GINATIFAYGQTSSGK
Sbjct  66   KGPAQDRAA-PMSY-TFDKVFGPACQTDVVYEEGAKDVAMSALTGINATIFAYGQTSSGK  123

Query  33   TYTMRGITEKA  1
            T+TMRG+TE A
Sbjct  124  TFTMRGVTESA  134



>gb|KHN45051.1| Kinesin-related protein 4 [Glycine soja]
Length=921

 Score =   172 bits (435),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 103/140 (74%), Gaps = 7/140 (5%)
 Frame = -1

Query  420  GTPASRIERTPANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWE  241
            GTP +      A TP SKI+R  + TPGG + +E+KI VTVR+RPLN KEQ+  D +AW+
Sbjct  3    GTPVA----VAAATPRSKIQRNASGTPGGPKVREEKIRVTVRMRPLNTKEQAMYDLIAWD  58

Query  240  CIDEHSIVYKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIF  61
            C+DEH+IV+K    ER   PT+ +TFDKVF P   T  VYEEG K VALSAL GINATIF
Sbjct  59   CLDEHTIVFKNPNQER---PTTPYTFDKVFAPTCSTHKVYEEGAKDVALSALSGINATIF  115

Query  60   AYGQTSSGKTYTMRGITEKA  1
            AYGQTSSGKT+TMRG+TE A
Sbjct  116  AYGQTSSGKTFTMRGVTESA  135



>ref|XP_006474579.1| PREDICTED: kinesin-like protein NACK2-like [Citrus sinensis]
Length=945

 Score =   172 bits (435),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 85/144 (59%), Positives = 105/144 (73%), Gaps = 12/144 (8%)
 Frame = -1

Query  432  IKVPGTPASRIERTPANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAKDN  253
            +K+ GTPA         TP SKI+RTPASTPGG + +E+KI+VTVR+RPL+++EQ+  D 
Sbjct  1    MKMVGTPA---------TPLSKIQRTPASTPGGPKVREEKILVTVRMRPLSRREQAMYDL  51

Query  252  VAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGIN  73
            +AW+C+D H IV+K   HER   P + +TFDKVF     T+ VYEEG K VALS L GIN
Sbjct  52   LAWDCLDNHMIVFKSPSHER---PINPYTFDKVFDTTCSTQKVYEEGAKNVALSVLTGIN  108

Query  72   ATIFAYGQTSSGKTYTMRGITEKA  1
            ATIFAYGQT SGKT+TMRGI E A
Sbjct  109  ATIFAYGQTGSGKTFTMRGIAENA  132



>emb|CBI27754.3| unnamed protein product [Vitis vinifera]
Length=942

 Score =   172 bits (435),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 87/131 (66%), Positives = 102/131 (78%), Gaps = 4/131 (3%)
 Frame = -1

Query  393  TPANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVY  214
            TPA TP SKI+RTP STPGG +  E+KI VTVR+RPLN+KEQ+  D +AW+C DE++IV+
Sbjct  4    TPA-TPFSKIQRTPLSTPGGPKVCEEKIRVTVRVRPLNRKEQAMYDLIAWDCTDENTIVF  62

Query  213  KPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGK  34
            K   HER   PT+ +TFDKVFGP      VYEEG K VALS L GINATIFAYGQTSSGK
Sbjct  63   KNPNHER---PTAPYTFDKVFGPTCSNLMVYEEGAKDVALSVLTGINATIFAYGQTSSGK  119

Query  33   TYTMRGITEKA  1
            T+TMRGIT+ A
Sbjct  120  TFTMRGITDNA  130



>ref|XP_002275046.2| PREDICTED: kinesin-like protein NACK2 [Vitis vinifera]
Length=945

 Score =   172 bits (435),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 87/131 (66%), Positives = 102/131 (78%), Gaps = 4/131 (3%)
 Frame = -1

Query  393  TPANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVY  214
            TPA TP SKI+RTP STPGG +  E+KI VTVR+RPLN+KEQ+  D +AW+C DE++IV+
Sbjct  7    TPA-TPFSKIQRTPLSTPGGPKVCEEKIRVTVRVRPLNRKEQAMYDLIAWDCTDENTIVF  65

Query  213  KPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGK  34
            K   HER   PT+ +TFDKVFGP      VYEEG K VALS L GINATIFAYGQTSSGK
Sbjct  66   KNPNHER---PTAPYTFDKVFGPTCSNLMVYEEGAKDVALSVLTGINATIFAYGQTSSGK  122

Query  33   TYTMRGITEKA  1
            T+TMRGIT+ A
Sbjct  123  TFTMRGITDNA  133



>ref|XP_008659376.1| PREDICTED: kinesin-like protein NACK1 [Zea mays]
 gb|AFW86157.1| hypothetical protein ZEAMMB73_908447 [Zea mays]
Length=950

 Score =   172 bits (435),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 88/131 (67%), Positives = 104/131 (79%), Gaps = 3/131 (2%)
 Frame = -1

Query  390  PANTPASKIERTPASTPGGQ-RSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVY  214
            P +TPASK E TP STPGG  R+KE+KI VTVR+RPL+KKE +AKD+VAWEC D  +I+Y
Sbjct  6    PPSTPASKGEHTPMSTPGGSSRAKEEKIFVTVRVRPLSKKELAAKDDVAWECADTQTILY  65

Query  213  KPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGK  34
            K    +R+  P S+ TFDKVFGP   T+ VYEEG K VA+SAL GINATIFAYGQTSSGK
Sbjct  66   KGPAQDRAA-PMSY-TFDKVFGPACQTDVVYEEGAKDVAMSALTGINATIFAYGQTSSGK  123

Query  33   TYTMRGITEKA  1
            T+TMRG+TE A
Sbjct  124  TFTMRGVTESA  134



>ref|XP_003541319.1| PREDICTED: kinesin-like protein NACK2-like isoform X1 [Glycine 
max]
 ref|XP_006593967.1| PREDICTED: kinesin-like protein NACK2-like isoform X2 [Glycine 
max]
Length=950

 Score =   171 bits (434),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 103/140 (74%), Gaps = 7/140 (5%)
 Frame = -1

Query  420  GTPASRIERTPANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWE  241
            GTP +      A TP SKI+R  + TPGG + +E+KI VTVR+RPLN KEQ+  D +AW+
Sbjct  3    GTPVA----VAAATPRSKIQRNASGTPGGPKVREEKIRVTVRMRPLNTKEQAMYDLIAWD  58

Query  240  CIDEHSIVYKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIF  61
            C+DEH+IV+K    ER   PT+ +TFDKVF P   T  VYEEG K VALSAL GINATIF
Sbjct  59   CLDEHTIVFKNPNQER---PTTPYTFDKVFAPTCSTHKVYEEGAKDVALSALSGINATIF  115

Query  60   AYGQTSSGKTYTMRGITEKA  1
            AYGQTSSGKT+TMRG+TE A
Sbjct  116  AYGQTSSGKTFTMRGVTESA  135



>gb|KHG14242.1| Kinesin-related 4 [Gossypium arboreum]
Length=947

 Score =   171 bits (434),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 106/132 (80%), Gaps = 5/132 (4%)
 Frame = -1

Query  393  TPANTPASKIERTPASTPGGQ-RSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIV  217
            TPA TP  K++RTPA TPGG  + +E++I+VTVR+RPLN++EQ+  D +AW+C+D+H+IV
Sbjct  4    TPA-TPLCKVQRTPAMTPGGGPKVREERILVTVRMRPLNQREQAMYDLIAWDCVDDHTIV  62

Query  216  YKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSG  37
            +K   HER   P + ++FD+VF P+S T  VYE+G K VALSAL GINATIFAYGQTSSG
Sbjct  63   FKNPNHER---PANQYSFDRVFDPSSSTRKVYEDGAKDVALSALTGINATIFAYGQTSSG  119

Query  36   KTYTMRGITEKA  1
            KT+TMRGITE A
Sbjct  120  KTFTMRGITENA  131



>ref|XP_010261715.1| PREDICTED: kinesin-like protein NACK2 [Nelumbo nucifera]
Length=954

 Score =   171 bits (433),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 101/130 (78%), Gaps = 4/130 (3%)
 Frame = -1

Query  396  RTPANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIV  217
            +TPA TP SKIE+TP+STPGG RS E+K+ VTVR+RPL++KEQ   D ++W+C DEH+I 
Sbjct  4    KTPA-TPLSKIEKTPSSTPGGPRSHEEKLFVTVRVRPLSQKEQEMNDQISWDCTDEHTIS  62

Query  216  YKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSG  37
             K + H   P P+  + FDKVFGP  LT  VYEEG K VALS L GINATIFAYGQTSSG
Sbjct  63   LKNL-HPGRPTPS--YCFDKVFGPTCLTWKVYEEGAKDVALSVLSGINATIFAYGQTSSG  119

Query  36   KTYTMRGITE  7
            KT+TMRGITE
Sbjct  120  KTFTMRGITE  129



>ref|XP_010107075.1| Kinesin-related protein 4 [Morus notabilis]
 gb|EXC13596.1| Kinesin-related protein 4 [Morus notabilis]
Length=956

 Score =   171 bits (432),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 102/131 (78%), Gaps = 4/131 (3%)
 Frame = -1

Query  393  TPANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVY  214
            TPA TP SKI+RT +STPGG R + +KI+VTVR+RPL+++EQ+  D +AWEC+DEHSI +
Sbjct  5    TPA-TPLSKIQRTLSSTPGGLRVRGEKILVTVRVRPLSRREQALYDLIAWECVDEHSIFF  63

Query  213  KPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGK  34
                 ER+P   + +TFDKVFGP+   + VYEEG K VALS L G+NATIFAYGQTSSGK
Sbjct  64   NSPNQERAP---TSYTFDKVFGPSCANQKVYEEGAKDVALSTLRGMNATIFAYGQTSSGK  120

Query  33   TYTMRGITEKA  1
            TYTMRGI E A
Sbjct  121  TYTMRGIAENA  131



>ref|XP_007012545.1| ATP binding microtubule motor family protein isoform 2 [Theobroma 
cacao]
 gb|EOY30164.1| ATP binding microtubule motor family protein isoform 2 [Theobroma 
cacao]
Length=943

 Score =   171 bits (432),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 103/131 (79%), Gaps = 4/131 (3%)
 Frame = -1

Query  393  TPANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVY  214
            TPA TP  KI RTPA+TPGG +++E+KI+VTVR+RPL+++EQ+  D +AW C+D+H+I +
Sbjct  4    TPA-TPLCKIPRTPAATPGGLKTQEEKILVTVRMRPLSRREQAMYDLIAWNCVDDHTIHF  62

Query  213  KPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGK  34
            K   HER   P + ++FD+VF P+  T   YEEG K VALSAL GINATIFAYGQTSSGK
Sbjct  63   KHPNHER---PATHYSFDRVFDPSCSTRKAYEEGAKDVALSALTGINATIFAYGQTSSGK  119

Query  33   TYTMRGITEKA  1
            T+TMRGITE A
Sbjct  120  TFTMRGITENA  130



>ref|XP_007012544.1| ATP binding microtubule motor family protein isoform 1 [Theobroma 
cacao]
 gb|EOY30163.1| ATP binding microtubule motor family protein isoform 1 [Theobroma 
cacao]
Length=946

 Score =   171 bits (432),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 103/131 (79%), Gaps = 4/131 (3%)
 Frame = -1

Query  393  TPANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVY  214
            TPA TP  KI RTPA+TPGG +++E+KI+VTVR+RPL+++EQ+  D +AW C+D+H+I +
Sbjct  4    TPA-TPLCKIPRTPAATPGGLKTQEEKILVTVRMRPLSRREQAMYDLIAWNCVDDHTIHF  62

Query  213  KPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGK  34
            K   HER   P + ++FD+VF P+  T   YEEG K VALSAL GINATIFAYGQTSSGK
Sbjct  63   KHPNHER---PATHYSFDRVFDPSCSTRKAYEEGAKDVALSALTGINATIFAYGQTSSGK  119

Query  33   TYTMRGITEKA  1
            T+TMRGITE A
Sbjct  120  TFTMRGITENA  130



>ref|XP_006452892.1| hypothetical protein CICLE_v10007377mg [Citrus clementina]
 gb|ESR66132.1| hypothetical protein CICLE_v10007377mg [Citrus clementina]
Length=943

 Score =   170 bits (431),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 101/131 (77%), Gaps = 4/131 (3%)
 Frame = -1

Query  393  TPANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVY  214
            TPA TP SKI+RTPASTPGG + +E+KI+VTVR+RPL+++EQ+  D +AW+C+D H IV+
Sbjct  4    TPA-TPLSKIQRTPASTPGGPKVREEKILVTVRMRPLSRREQAMYDLLAWDCLDSHMIVF  62

Query  213  KPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGK  34
            K   HER   P + +TFDKVF     T+ VYEEG K VALS L GINATIFAYGQT SGK
Sbjct  63   KSPSHER---PINPYTFDKVFDTTCSTQKVYEEGAKNVALSVLTGINATIFAYGQTGSGK  119

Query  33   TYTMRGITEKA  1
            T+TMRGI E A
Sbjct  120  TFTMRGIAENA  130



>ref|XP_007154542.1| hypothetical protein PHAVU_003G127400g [Phaseolus vulgaris]
 gb|ESW26536.1| hypothetical protein PHAVU_003G127400g [Phaseolus vulgaris]
Length=941

 Score =   170 bits (430),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 83/140 (59%), Positives = 106/140 (76%), Gaps = 9/140 (6%)
 Frame = -1

Query  420  GTPASRIERTPANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWE  241
            GTPA+        TP SK++R P+ TPGG + +E+KI VTVR+RPL++KEQ+  D +AW+
Sbjct  3    GTPAA------VATPLSKMQRIPSGTPGGPKVREEKIRVTVRMRPLSRKEQAMYDLIAWD  56

Query  240  CIDEHSIVYKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIF  61
            C+DEH++V+K    ER   P + +TFDKVF P   T++VYEEG K VALSAL GINATIF
Sbjct  57   CLDEHTLVFKNPNQER---PATPYTFDKVFAPACSTQSVYEEGAKDVALSALSGINATIF  113

Query  60   AYGQTSSGKTYTMRGITEKA  1
            AYGQTSSGKT+TMRG+TE A
Sbjct  114  AYGQTSSGKTFTMRGVTESA  133



>gb|KGN51423.1| hypothetical protein Csa_5G537000 [Cucumis sativus]
Length=938

 Score =   169 bits (427),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 80/128 (63%), Positives = 102/128 (80%), Gaps = 4/128 (3%)
 Frame = -1

Query  381  TPASKIERTPASTPGGQ-RSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPM  205
            TP SKI+RTP++TPGG  R++E+ I+VTVR+RPLN+KEQ+  D +AW+C+D+H++V+K  
Sbjct  4    TPLSKIQRTPSTTPGGCPRAREENILVTVRMRPLNRKEQAMYDLIAWDCLDQHTLVFKNP  63

Query  204  PHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYT  25
             HER   P   + FDKVF P   T+ VY+EG K VALSAL G+NATIFAYGQTSSGKT+T
Sbjct  64   NHERPLNP---YCFDKVFYPTCSTQRVYDEGAKDVALSALTGMNATIFAYGQTSSGKTFT  120

Query  24   MRGITEKA  1
            MRGITE A
Sbjct  121  MRGITEYA  128



>gb|AES92142.2| ATP-binding microtubule motor family protein [Medicago truncatula]
Length=1037

 Score =   169 bits (427),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 106/138 (77%), Gaps = 4/138 (3%)
 Frame = -1

Query  411  ASRIERTP-ANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECI  235
             SR+ +TP A TP+SKI R  A TPGG + +E+KI VTVR+RPLN+KEQ+  D +AW+C+
Sbjct  110  VSRMVKTPMAATPSSKIRRKLADTPGGSKIREEKIRVTVRMRPLNRKEQAMYDLIAWDCL  169

Query  234  DEHSIVYKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAY  55
            D+ +IV+K    ER   P++ +TFD+VF P   T+ VY+EG K VALSAL GINATIFAY
Sbjct  170  DDKTIVFKNPNQER---PSTSYTFDRVFPPACSTQKVYDEGAKDVALSALSGINATIFAY  226

Query  54   GQTSSGKTYTMRGITEKA  1
            GQTSSGKT+TMRGITE A
Sbjct  227  GQTSSGKTFTMRGITENA  244



>dbj|BAK03253.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=949

 Score =   167 bits (424),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 87/133 (65%), Positives = 107/133 (80%), Gaps = 5/133 (4%)
 Frame = -1

Query  393  TPANTPASKIERTPASTPGGQ-RSKEDKIMVTVRLRPLNKKEQSAKD-NVAWECIDEHSI  220
            TP+ TPAS+I+RTP  TPGG  R++E+KI+VTVR+RPL+KKE + KD  VAWEC D  +I
Sbjct  8    TPS-TPASRIQRTPMVTPGGSSRAQEEKILVTVRVRPLSKKELAMKDPKVAWECTDSQTI  66

Query  219  VYKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSS  40
            +YK  P +R+  PTS+ TFDKVFGP   T+ VYE+G K VA+SAL GINATIFAYGQTSS
Sbjct  67   LYKGPPQDRAA-PTSY-TFDKVFGPACQTDLVYEDGAKDVAMSALTGINATIFAYGQTSS  124

Query  39   GKTYTMRGITEKA  1
            GKT+TMRG+TE A
Sbjct  125  GKTFTMRGVTESA  137



>ref|XP_006353764.1| PREDICTED: kinesin-like protein NACK2-like [Solanum tuberosum]
Length=957

 Score =   167 bits (424),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 108/147 (73%), Gaps = 6/147 (4%)
 Frame = -1

Query  438  MTIKVPGTPASRIERTPANTPASKIERT-PASTPGGQRSKEDKIMVTVRLRPLNKKEQSA  262
            M I VPGTP S+  RTP+  P S+  RT P+STPGG + +E+KI+VT+R+RPL+ KEQ+A
Sbjct  1    MVIGVPGTPLSKTGRTPSRFPGSR--RTIPSSTPGGPKLREEKILVTIRVRPLSPKEQAA  58

Query  261  KDNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALM  82
             D +AW+  DE +IV K + HER   P   ++FD VF P   T  VYE+G + VALSAL 
Sbjct  59   YDLIAWDFPDEQTIVSKNLNHERHTGP---YSFDNVFDPTCSTSKVYEQGARDVALSALN  115

Query  81   GINATIFAYGQTSSGKTYTMRGITEKA  1
            GINATIFAYGQTSSGKT+TMRGITE A
Sbjct  116  GINATIFAYGQTSSGKTFTMRGITESA  142



>ref|XP_003609945.1| Kinesin-like protein [Medicago truncatula]
Length=1228

 Score =   168 bits (426),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 106/138 (77%), Gaps = 4/138 (3%)
 Frame = -1

Query  411  ASRIERTP-ANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECI  235
             SR+ +TP A TP+SKI R  A TPGG + +E+KI VTVR+RPLN+KEQ+  D +AW+C+
Sbjct  306  VSRMVKTPMAATPSSKIRRKLADTPGGSKIREEKIRVTVRMRPLNRKEQAMYDLIAWDCL  365

Query  234  DEHSIVYKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAY  55
            D+ +IV+K    ER   P++ +TFD+VF P   T+ VY+EG K VALSAL GINATIFAY
Sbjct  366  DDKTIVFKNPNQER---PSTSYTFDRVFPPACSTQKVYDEGAKDVALSALSGINATIFAY  422

Query  54   GQTSSGKTYTMRGITEKA  1
            GQTSSGKT+TMRGITE A
Sbjct  423  GQTSSGKTFTMRGITENA  440



>gb|KCW81847.1| hypothetical protein EUGRSUZ_C03198 [Eucalyptus grandis]
Length=943

 Score =   167 bits (423),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 84/134 (63%), Positives = 103/134 (77%), Gaps = 5/134 (4%)
 Frame = -1

Query  402  IERTPANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHS  223
            I+R PA TP+SK+ RTP+STPG    +E+KI VTVRLRPL+++EQ+  D +AWEC D+++
Sbjct  2    IDRAPA-TPSSKVRRTPSSTPGASH-REEKIFVTVRLRPLSRREQALYDLIAWECTDDNT  59

Query  222  IVYKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTS  43
            I+YK    ER     + + FD+VFGP S T  VYEEG K VALSAL GIN+TIFAYGQTS
Sbjct  60   IIYKNPNQERG---AASYVFDRVFGPASSTYMVYEEGAKDVALSALKGINSTIFAYGQTS  116

Query  42   SGKTYTMRGITEKA  1
            SGKTYTMRGITE A
Sbjct  117  SGKTYTMRGITENA  130



>ref|XP_010051345.1| PREDICTED: kinesin-like protein NACK2 [Eucalyptus grandis]
Length=921

 Score =   167 bits (423),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 84/134 (63%), Positives = 103/134 (77%), Gaps = 5/134 (4%)
 Frame = -1

Query  402  IERTPANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHS  223
            I+R PA TP+SK+ RTP+STPG    +E+KI VTVRLRPL+++EQ+  D +AWEC D+++
Sbjct  2    IDRAPA-TPSSKVRRTPSSTPGASH-REEKIFVTVRLRPLSRREQALYDLIAWECTDDNT  59

Query  222  IVYKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTS  43
            I+YK    ER     + + FD+VFGP S T  VYEEG K VALSAL GIN+TIFAYGQTS
Sbjct  60   IIYKNPNQERG---AASYVFDRVFGPASSTYMVYEEGAKDVALSALKGINSTIFAYGQTS  116

Query  42   SGKTYTMRGITEKA  1
            SGKTYTMRGITE A
Sbjct  117  SGKTYTMRGITENA  130



>ref|XP_008367780.1| PREDICTED: kinesin-like protein NACK1, partial [Malus domestica]
Length=567

 Score =   164 bits (414),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 97/115 (84%), Gaps = 2/115 (2%)
 Frame = -1

Query  345  TPGGQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPHERSPQPTSFFT  166
            TPG  R+K++KI+V V LRPL+K+E+ AK+ V+W+C+ +++IVYKP PHERS Q TS FT
Sbjct  5    TPGTPRAKKEKIVVLVCLRPLSKREELAKEQVSWDCLGDNTIVYKPPPHERSAQSTS-FT  63

Query  165  FDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITEKA  1
            FDKVFGP S TE VYEEGV+ VALS+LMGINATIFAYGQ+ SGKTYTMR I EKA
Sbjct  64   FDKVFGPGS-TEAVYEEGVRNVALSSLMGINATIFAYGQSGSGKTYTMRRIMEKA  117



>emb|CDP03034.1| unnamed protein product [Coffea canephora]
Length=944

 Score =   166 bits (420),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 102/132 (77%), Gaps = 4/132 (3%)
 Frame = -1

Query  393  TPANTPASKIERTPASTPGGQ-RSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIV  217
            TP  TP+SK  RTP+ TPGG  +++E+KI+VTVR+RPL+ KEQ+A D +AWE  DEH+I+
Sbjct  5    TPITTPSSKTRRTPSCTPGGGPKAQEEKILVTVRVRPLSPKEQAAYDLIAWEFSDEHTII  64

Query  216  YKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSG  37
             K + HER   PT  +TFDKVF P+   + VYEEG + VALS L GINATIFAYGQTSSG
Sbjct  65   SKNLTHER---PTGPYTFDKVFDPSCSNQKVYEEGARDVALSVLSGINATIFAYGQTSSG  121

Query  36   KTYTMRGITEKA  1
            KT+TMRGITE A
Sbjct  122  KTFTMRGITENA  133



>ref|XP_010323978.1| PREDICTED: kinesin-like protein NACK2 [Solanum lycopersicum]
Length=960

 Score =   166 bits (420),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 86/147 (59%), Positives = 108/147 (73%), Gaps = 6/147 (4%)
 Frame = -1

Query  438  MTIKVPGTPASRIERTPANTPASKIERT-PASTPGGQRSKEDKIMVTVRLRPLNKKEQSA  262
            M I VPGTP S+  RTP+  P S+  RT P+STPGG + +E+KI+VT+R+RPL+ KEQ+A
Sbjct  1    MVIGVPGTPLSKTGRTPSRFPGSR--RTIPSSTPGGPKLREEKILVTIRVRPLSPKEQAA  58

Query  261  KDNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALM  82
             D +AW+  D+ +IV K + HER   P   ++FD VF P   T  VYE+G + VALSAL 
Sbjct  59   YDLIAWDFPDQQTIVSKNLIHERHTGP---YSFDNVFDPTCSTSKVYEQGARDVALSALN  115

Query  81   GINATIFAYGQTSSGKTYTMRGITEKA  1
            GINATIFAYGQTSSGKT+TMRGITE A
Sbjct  116  GINATIFAYGQTSSGKTFTMRGITESA  142



>ref|XP_004508036.1| PREDICTED: centromere-associated protein E-like isoform X1 [Cicer 
arietinum]
Length=946

 Score =   166 bits (419),  Expect = 5e-43, Method: Composition-based stats.
 Identities = 87/140 (62%), Positives = 105/140 (75%), Gaps = 10/140 (7%)
 Frame = -1

Query  420  GTPASRIERTPANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWE  241
            GTPA       A TP+SKI+RT A TPGG + +E+KI VTVR+RPLN+KEQ+  D +AW+
Sbjct  3    GTPA-------AATPSSKIQRTLAGTPGGPKIREEKIRVTVRMRPLNRKEQAMYDLIAWD  55

Query  240  CIDEHSIVYKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIF  61
            C+DEHSIV+K    ER   P   +TFD+VF P   T+ VY+EG K VALSAL GINATIF
Sbjct  56   CLDEHSIVFKNPNQERPAIP---YTFDRVFAPACSTQKVYDEGAKDVALSALSGINATIF  112

Query  60   AYGQTSSGKTYTMRGITEKA  1
            AYGQTSSGKT+TM+GITE A
Sbjct  113  AYGQTSSGKTFTMKGITENA  132



>gb|EEC70757.1| hypothetical protein OsI_02172 [Oryza sativa Indica Group]
Length=326

 Score =   158 bits (400),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 93/116 (80%), Gaps = 3/116 (3%)
 Frame = -1

Query  345  TPGGQ-RSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPHERSPQPTSFF  169
            TPGG  R KE+KI VTVR+RPL+KKE + KD VAWEC D  +I+YK  P +R+  PTS+ 
Sbjct  5    TPGGSTRVKEEKIFVTVRVRPLSKKELALKDQVAWECDDNQTILYKGPPQDRAA-PTSY-  62

Query  168  TFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITEKA  1
            TFDKVFGP S TE VYEEG K VA+SAL GINATIFAYGQTSSGKT+TMRG+TE A
Sbjct  63   TFDKVFGPASQTEVVYEEGAKDVAMSALTGINATIFAYGQTSSGKTFTMRGVTESA  118



>gb|EMS62599.1| Kinesin-related protein 4 [Triticum urartu]
Length=1276

 Score =   166 bits (420),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 85/131 (65%), Positives = 101/131 (77%), Gaps = 3/131 (2%)
 Frame = -1

Query  390  PANTPASKIERTPASTPGGQ-RSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVY  214
            P +TP SKIER P  TPGG  +SKE+KI VTVR+RPL+KKE + KD V WEC D  +I+Y
Sbjct  6    PPSTPMSKIERAPTLTPGGSSKSKEEKIFVTVRVRPLSKKELAMKDQVVWECADSQTILY  65

Query  213  KPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGK  34
            K  P +R+  PTS+ TFDKVFG +  T  VYE+G K VA+SAL GINATIFAYGQTSSGK
Sbjct  66   KGPPQDRAA-PTSY-TFDKVFGQSCQTGLVYEDGAKDVAMSALTGINATIFAYGQTSSGK  123

Query  33   TYTMRGITEKA  1
            T+TMRG+TE A
Sbjct  124  TFTMRGVTESA  134



>ref|XP_008460563.1| PREDICTED: kinesin-like protein NACK2 isoform X2 [Cucumis melo]
Length=929

 Score =   164 bits (415),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 79/128 (62%), Positives = 100/128 (78%), Gaps = 4/128 (3%)
 Frame = -1

Query  381  TPASKIERTPASTPGGQ-RSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPM  205
            TP  KI+RTP++TPG   R++E+ I+VTVR+RPLN+KEQ+  D VAW+C+D+H++V+K  
Sbjct  4    TPLPKIQRTPSTTPGRCPRAREENILVTVRMRPLNRKEQAMYDLVAWDCLDQHTLVFKNP  63

Query  204  PHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYT  25
             HER   P   + FDKVF P   T+ VY+EG K VALSAL G+NATIFAYGQTSSGKT+T
Sbjct  64   NHERPLNP---YCFDKVFDPTCSTQRVYDEGAKDVALSALTGMNATIFAYGQTSSGKTFT  120

Query  24   MRGITEKA  1
            MRGITE A
Sbjct  121  MRGITEYA  128



>ref|XP_008460562.1| PREDICTED: kinesin-like protein NACK2 isoform X1 [Cucumis melo]
Length=935

 Score =   164 bits (416),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 79/128 (62%), Positives = 100/128 (78%), Gaps = 4/128 (3%)
 Frame = -1

Query  381  TPASKIERTPASTPGGQ-RSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPM  205
            TP  KI+RTP++TPG   R++E+ I+VTVR+RPLN+KEQ+  D VAW+C+D+H++V+K  
Sbjct  4    TPLPKIQRTPSTTPGRCPRAREENILVTVRMRPLNRKEQAMYDLVAWDCLDQHTLVFKNP  63

Query  204  PHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYT  25
             HER   P   + FDKVF P   T+ VY+EG K VALSAL G+NATIFAYGQTSSGKT+T
Sbjct  64   NHERPLNP---YCFDKVFDPTCSTQRVYDEGAKDVALSALTGMNATIFAYGQTSSGKTFT  120

Query  24   MRGITEKA  1
            MRGITE A
Sbjct  121  MRGITEYA  128



>ref|XP_011039916.1| PREDICTED: kinesin-like protein NACK2 [Populus euphratica]
Length=949

 Score =   163 bits (413),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 82/129 (64%), Positives = 102/129 (79%), Gaps = 5/129 (4%)
 Frame = -1

Query  381  TPASK-IERTPASTPGG-QRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKP  208
            TPASK I+RTP++TPGG  R +E+KI+VTVR+RPL+++EQ+  D +AW+C D+H+I++K 
Sbjct  4    TPASKMIQRTPSTTPGGGTRVREEKILVTVRVRPLSRREQALYDLIAWDCPDDHTILFKN  63

Query  207  MPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTY  28
               ER   P + + FDKVF P+  T  VYEEG K VALSAL GINATIFAYGQTSSGKTY
Sbjct  64   PNQER---PATSYKFDKVFDPSCSTLKVYEEGAKNVALSALTGINATIFAYGQTSSGKTY  120

Query  27   TMRGITEKA  1
            TMRGITE A
Sbjct  121  TMRGITENA  129



>ref|XP_006381563.1| TETRASPORE family protein [Populus trichocarpa]
 gb|ERP59360.1| TETRASPORE family protein [Populus trichocarpa]
Length=952

 Score =   163 bits (412),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 82/129 (64%), Positives = 102/129 (79%), Gaps = 5/129 (4%)
 Frame = -1

Query  381  TPASK-IERTPASTPGG-QRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKP  208
            TPASK I+RTP++TPGG  R +E+KI+VTVR+RPL+++EQ+  D +AW+C D+H+I++K 
Sbjct  7    TPASKMIQRTPSTTPGGGTRVREEKILVTVRVRPLSRREQALYDLIAWDCPDDHTILFKN  66

Query  207  MPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTY  28
               ER   P + + FDKVF P+  T  VYEEG K VALSAL GINATIFAYGQTSSGKTY
Sbjct  67   PNQER---PATSYKFDKVFDPSCSTLKVYEEGAKNVALSALTGINATIFAYGQTSSGKTY  123

Query  27   TMRGITEKA  1
            TMRGITE A
Sbjct  124  TMRGITENA  132



>gb|EPS71432.1| hypothetical protein M569_03327 [Genlisea aurea]
Length=921

 Score =   162 bits (410),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 98/127 (77%), Gaps = 1/127 (1%)
 Frame = -1

Query  381  TPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMP  202
            TP++KI RTPASTPGG + +E+ I+VTVR+RPL+ KE ++ + VAW+  DEH+IV K + 
Sbjct  8    TPSTKIRRTPASTPGGSKVQEENILVTVRMRPLSSKELASYELVAWDIPDEHTIVSKNLA  67

Query  201  HERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTM  22
            H+R+    S+  FDKVFGP   T  VYE G + VALSAL GINATIFAYGQTSSGKT+TM
Sbjct  68   HDRNAGSGSYM-FDKVFGPTCSTSKVYEAGARDVALSALSGINATIFAYGQTSSGKTFTM  126

Query  21   RGITEKA  1
            RGITE A
Sbjct  127  RGITEYA  133



>ref|XP_008361127.1| PREDICTED: kinesin-like protein NACK1 [Malus domestica]
Length=1003

 Score =   162 bits (410),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 97/115 (84%), Gaps = 2/115 (2%)
 Frame = -1

Query  345  TPGGQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPHERSPQPTSFFT  166
            TPG  R+K++KI+V V LRPL+K+E+ AK+ V+W+C+ +++IVYKP PHERS Q TS FT
Sbjct  5    TPGTPRAKKEKIVVLVCLRPLSKREELAKEQVSWDCLGDNTIVYKPPPHERSAQSTS-FT  63

Query  165  FDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITEKA  1
            FDKVFGP S TE VYEEGV+ VALS+LMGINATIFAYGQ+ SGKTYTMR I EKA
Sbjct  64   FDKVFGPGS-TEAVYEEGVRNVALSSLMGINATIFAYGQSGSGKTYTMRRIMEKA  117



>gb|EYU28300.1| hypothetical protein MIMGU_mgv1a001029mg [Erythranthe guttata]
Length=908

 Score =   159 bits (401),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 96/127 (76%), Gaps = 3/127 (2%)
 Frame = -1

Query  381  TPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMP  202
            TP+SKI RTPA TPGG + +E+ I+VTVR+RPL+ +E +A D VAWE  DE++IV K + 
Sbjct  8    TPSSKIRRTPACTPGGPKVREENILVTVRMRPLSSRELAAYDLVAWEITDENTIVSKNLY  67

Query  201  HERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTM  22
            HER       ++FDKVF P   T  VYE+G + VALSAL GINATIFAYGQTSSGKT+TM
Sbjct  68   HERHG---GTYSFDKVFDPTCSTRKVYEDGARDVALSALNGINATIFAYGQTSSGKTFTM  124

Query  21   RGITEKA  1
            RG+TE A
Sbjct  125  RGVTENA  131



>ref|XP_011078149.1| PREDICTED: kinesin-like protein NACK2 [Sesamum indicum]
Length=943

 Score =   157 bits (398),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 82/146 (56%), Positives = 100/146 (68%), Gaps = 14/146 (10%)
 Frame = -1

Query  438  MTIKVPGTPASRIERTPANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAK  259
            MTI  P TP+S+I+RT           TPA TPGG + +E+ I+VTVR+RPL+ KE +A 
Sbjct  1    MTIGTPVTPSSKIKRT-----------TPACTPGGPKVREENILVTVRIRPLSSKELAAY  49

Query  258  DNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMG  79
            D VAW+  DE+ IV K + HER       + FDKVF P   T+ VYEEG + VALSAL G
Sbjct  50   DLVAWDVTDENIIVSKNLYHERHG---GLYKFDKVFDPTCSTQKVYEEGARDVALSALSG  106

Query  78   INATIFAYGQTSSGKTYTMRGITEKA  1
            INATIFAYGQTSSGKT+TMRG+ E A
Sbjct  107  INATIFAYGQTSSGKTFTMRGVAENA  132



>ref|XP_009365403.1| PREDICTED: uncharacterized protein LOC103955247 [Pyrus x bretschneideri]
Length=1221

 Score =   157 bits (397),  Expect = 8e-40, Method: Composition-based stats.
 Identities = 79/117 (68%), Positives = 98/117 (84%), Gaps = 2/117 (2%)
 Frame = -1

Query  351  ASTPGGQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPHERSPQPTSF  172
            + TPG  R+K++KI+V V LRPL+K+E+ AK+ V+W+C+ +++IVYKP PHERS Q  SF
Sbjct  61   SRTPGTPRAKKEKIVVLVCLRPLSKREELAKEQVSWDCLGDNTIVYKPPPHERSTQSASF  120

Query  171  FTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITEKA  1
             TFDKVFGP S TE VYEEGV+ VALS+LMGINATIFAYGQ+ SGKTYTM+GI EKA
Sbjct  121  -TFDKVFGPGS-TEAVYEEGVRNVALSSLMGINATIFAYGQSGSGKTYTMKGIMEKA  175



>ref|XP_009786272.1| PREDICTED: kinesin-like protein NACK2 isoform X4 [Nicotiana sylvestris]
Length=953

 Score =   155 bits (392),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 98/136 (72%), Gaps = 8/136 (6%)
 Frame = -1

Query  393  TPANTPASKIERTPASTPGGQRS-----KEDKIMVTVRLRPLNKKEQSAKDNVAWECIDE  229
            TP  TP SKI RTP+  PG +R+     +E+KI+VT+R+RPL+ KEQ+A D +AW+  DE
Sbjct  5    TPVTTPLSKIVRTPSRVPGSRRTTPSKIREEKILVTIRVRPLSPKEQAAYDLIAWDFPDE  64

Query  228  HSIVYKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQ  49
             +IV K + HER   P   ++FD VF P   T  VYE+G + VALSAL GINATIFAYGQ
Sbjct  65   QTIVSKNLNHERHTGP---YSFDYVFDPTCSTSKVYEQGARDVALSALNGINATIFAYGQ  121

Query  48   TSSGKTYTMRGITEKA  1
            TSSGKT+TMRGITE A
Sbjct  122  TSSGKTFTMRGITESA  137



>ref|XP_009786271.1| PREDICTED: kinesin-like protein NACK2 isoform X3 [Nicotiana sylvestris]
Length=955

 Score =   155 bits (392),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 98/136 (72%), Gaps = 8/136 (6%)
 Frame = -1

Query  393  TPANTPASKIERTPASTPGGQRS-----KEDKIMVTVRLRPLNKKEQSAKDNVAWECIDE  229
            TP  TP SKI RTP+  PG +R+     +E+KI+VT+R+RPL+ KEQ+A D +AW+  DE
Sbjct  5    TPVTTPLSKIVRTPSRVPGSRRTTPSKIREEKILVTIRVRPLSPKEQAAYDLIAWDFPDE  64

Query  228  HSIVYKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQ  49
             +IV K + HER   P   ++FD VF P   T  VYE+G + VALSAL GINATIFAYGQ
Sbjct  65   QTIVSKNLNHERHTGP---YSFDYVFDPTCSTSKVYEQGARDVALSALNGINATIFAYGQ  121

Query  48   TSSGKTYTMRGITEKA  1
            TSSGKT+TMRGITE A
Sbjct  122  TSSGKTFTMRGITESA  137



>sp|Q8S949.1|NACK2_TOBAC RecName: Full=Kinesin-like protein NACK2; AltName: Full=NPK1-activating 
kinesin 2 [Nicotiana tabacum]
 dbj|BAB86284.1| kinesin-like protein NACK2 [Nicotiana tabacum]
Length=955

 Score =   155 bits (392),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 98/136 (72%), Gaps = 8/136 (6%)
 Frame = -1

Query  393  TPANTPASKIERTPASTPGGQRS-----KEDKIMVTVRLRPLNKKEQSAKDNVAWECIDE  229
            TP  TP SKI RTP+  PG +R+     +E+KI+VT+R+RPL+ KEQ+A D +AW+  DE
Sbjct  5    TPVTTPLSKIVRTPSRVPGSRRTTPSKIREEKILVTIRVRPLSPKEQAAYDLIAWDFPDE  64

Query  228  HSIVYKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQ  49
             +IV K + HER   P   ++FD VF P   T  VYE+G + VALSAL GINATIFAYGQ
Sbjct  65   QTIVSKNLNHERHTGP---YSFDYVFDPTCSTSKVYEQGARDVALSALNGINATIFAYGQ  121

Query  48   TSSGKTYTMRGITEKA  1
            TSSGKT+TMRGITE A
Sbjct  122  TSSGKTFTMRGITESA  137



>ref|XP_009786269.1| PREDICTED: kinesin-like protein NACK2 isoform X1 [Nicotiana sylvestris]
Length=958

 Score =   155 bits (392),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 98/136 (72%), Gaps = 8/136 (6%)
 Frame = -1

Query  393  TPANTPASKIERTPASTPGGQRS-----KEDKIMVTVRLRPLNKKEQSAKDNVAWECIDE  229
            TP  TP SKI RTP+  PG +R+     +E+KI+VT+R+RPL+ KEQ+A D +AW+  DE
Sbjct  5    TPVTTPLSKIVRTPSRVPGSRRTTPSKIREEKILVTIRVRPLSPKEQAAYDLIAWDFPDE  64

Query  228  HSIVYKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQ  49
             +IV K + HER   P   ++FD VF P   T  VYE+G + VALSAL GINATIFAYGQ
Sbjct  65   QTIVSKNLNHERHTGP---YSFDYVFDPTCSTSKVYEQGARDVALSALNGINATIFAYGQ  121

Query  48   TSSGKTYTMRGITEKA  1
            TSSGKT+TMRGITE A
Sbjct  122  TSSGKTFTMRGITESA  137



>ref|XP_009786270.1| PREDICTED: kinesin-like protein NACK2 isoform X2 [Nicotiana sylvestris]
Length=956

 Score =   155 bits (392),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 98/136 (72%), Gaps = 8/136 (6%)
 Frame = -1

Query  393  TPANTPASKIERTPASTPGGQRS-----KEDKIMVTVRLRPLNKKEQSAKDNVAWECIDE  229
            TP  TP SKI RTP+  PG +R+     +E+KI+VT+R+RPL+ KEQ+A D +AW+  DE
Sbjct  5    TPVTTPLSKIVRTPSRVPGSRRTTPSKIREEKILVTIRVRPLSPKEQAAYDLIAWDFPDE  64

Query  228  HSIVYKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQ  49
             +IV K + HER   P   ++FD VF P   T  VYE+G + VALSAL GINATIFAYGQ
Sbjct  65   QTIVSKNLNHERHTGP---YSFDYVFDPTCSTSKVYEQGARDVALSALNGINATIFAYGQ  121

Query  48   TSSGKTYTMRGITEKA  1
            TSSGKT+TMRGITE A
Sbjct  122  TSSGKTFTMRGITESA  137



>ref|XP_009625447.1| PREDICTED: kinesin-like protein NACK2 [Nicotiana tomentosiformis]
Length=953

 Score =   155 bits (392),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 98/136 (72%), Gaps = 8/136 (6%)
 Frame = -1

Query  393  TPANTPASKIERTPASTPGGQRS-----KEDKIMVTVRLRPLNKKEQSAKDNVAWECIDE  229
            TP  TP SKI RTP+  PG +R+     +E+KI+VT+R+RPL+ KEQ+A D +AW+  DE
Sbjct  5    TPVTTPLSKIVRTPSRVPGSRRTTPSKIREEKILVTIRVRPLSPKEQAAYDLIAWDFPDE  64

Query  228  HSIVYKPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQ  49
             +IV K + HER   P   ++FD VF P   T  VYE+G + VALSAL GINATIFAYGQ
Sbjct  65   QTIVSKNLNHERHTGP---YSFDYVFDPTCSTSKVYEQGARDVALSALNGINATIFAYGQ  121

Query  48   TSSGKTYTMRGITEKA  1
            TSSGKT+TMRGITE A
Sbjct  122  TSSGKTFTMRGITESA  137



>ref|XP_010687583.1| PREDICTED: kinesin-like protein NACK2 [Beta vulgaris subsp. vulgaris]
Length=940

 Score =   155 bits (391),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 96/127 (76%), Gaps = 3/127 (2%)
 Frame = -1

Query  381  TPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMP  202
            TP SKI+ TP+ TPGG + +E+KI+V VR+RPL+ +EQ+  D +A +C D+ S+V+K   
Sbjct  8    TPLSKIKTTPSCTPGGTKVREEKILVMVRVRPLSSREQAMYDLIALDCPDDQSVVFKNPN  67

Query  201  HERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTM  22
             ER   P+S FTFD+VF P  +T  VYE G + VALSAL GINATIFAYGQTSSGKT+TM
Sbjct  68   DER---PSSSFTFDRVFSPTCVTAKVYEGGARDVALSALTGINATIFAYGQTSSGKTFTM  124

Query  21   RGITEKA  1
            RGITE A
Sbjct  125  RGITEYA  131



>ref|XP_010535793.1| PREDICTED: kinesin-like protein NACK2 isoform X1 [Tarenaya hassleriana]
Length=953

 Score =   152 bits (383),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 80/143 (56%), Positives = 100/143 (70%), Gaps = 14/143 (10%)
 Frame = -1

Query  432  IKVPGTPASRIERTPANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAKDN  253
            I++ GTP          TP +KI+R  +STPGG R KE+KI+VTVR+RPLN +E S  D 
Sbjct  6    IEMMGTP---------KTPLNKIDRGISSTPGGSRVKEEKILVTVRMRPLNGRELSKYDL  56

Query  252  VAWECIDEHSIVYK-PMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGI  76
            +AWEC D+ +I+YK P P     +P + ++FDKVF P   T  VYE G + VALSAL G 
Sbjct  57   IAWECPDDQTILYKNPNPE----RPAARYSFDKVFEPTCSTLKVYEGGARDVALSALTGT  112

Query  75   NATIFAYGQTSSGKTYTMRGITE  7
            NATIFAYGQTSSGKT+TM+GITE
Sbjct  113  NATIFAYGQTSSGKTFTMKGITE  135



>ref|XP_010535794.1| PREDICTED: kinesin-like protein NACK2 isoform X2 [Tarenaya hassleriana]
 ref|XP_010535795.1| PREDICTED: kinesin-like protein NACK2 isoform X2 [Tarenaya hassleriana]
Length=946

 Score =   151 bits (382),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 94/126 (75%), Gaps = 5/126 (4%)
 Frame = -1

Query  381  TPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYK-PM  205
            TP +KI+R  +STPGG R KE+KI+VTVR+RPLN +E S  D +AWEC D+ +I+YK P 
Sbjct  7    TPLNKIDRGISSTPGGSRVKEEKILVTVRMRPLNGRELSKYDLIAWECPDDQTILYKNPN  66

Query  204  PHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYT  25
            P     +P + ++FDKVF P   T  VYE G + VALSAL G NATIFAYGQTSSGKT+T
Sbjct  67   PE----RPAARYSFDKVFEPTCSTLKVYEGGARDVALSALTGTNATIFAYGQTSSGKTFT  122

Query  24   MRGITE  7
            M+GITE
Sbjct  123  MKGITE  128



>gb|EMT03728.1| Kinesin-related protein 4 [Aegilops tauschii]
Length=919

 Score =   151 bits (381),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 94/117 (80%), Gaps = 4/117 (3%)
 Frame = -1

Query  345  TPGGQ-RSKEDKIMVTVRLRPLNKKEQSAKDN-VAWECIDEHSIVYKPMPHERSPQPTSF  172
            TPGG  R++E+KI+VTVR+RPL+K+E + KD  VAWEC D  +I+YK  P +R+  PTS+
Sbjct  5    TPGGSSRAQEEKILVTVRVRPLSKRELAMKDQKVAWECTDSQTILYKGPPQDRAA-PTSY  63

Query  171  FTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITEKA  1
             TFDKVFGP   T+ VYE+G K VA+SAL GINATIFAYGQTSSGKT+TMRG+TE A
Sbjct  64   -TFDKVFGPACQTDLVYEDGAKDVAMSALTGINATIFAYGQTSSGKTFTMRGVTESA  119



>ref|XP_002987833.1| hypothetical protein SELMODRAFT_126650 [Selaginella moellendorffii]
 gb|EFJ11136.1| hypothetical protein SELMODRAFT_126650 [Selaginella moellendorffii]
Length=869

 Score =   150 bits (379),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 90/116 (78%), Gaps = 2/116 (2%)
 Frame = -1

Query  348  STPGGQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPHERSPQPTSFF  169
            STPG  RSKE+KI VTVR+RP++ +E + +D   WEC D+H++ YK  P +RSP P  + 
Sbjct  22   STPGKCRSKEEKIFVTVRVRPMSSREIAQRDTADWECPDDHTVSYKQQP-DRSPYPARY-  79

Query  168  TFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITEKA  1
            +FD+VFGP S T+ VYEEG K VALSAL GIN+TIFAYGQTSSGKT+TMRG+ E A
Sbjct  80   SFDRVFGPESSTKVVYEEGAKDVALSALSGINSTIFAYGQTSSGKTFTMRGVIENA  135



>ref|XP_002992286.1| hypothetical protein SELMODRAFT_135047 [Selaginella moellendorffii]
 gb|EFJ06667.1| hypothetical protein SELMODRAFT_135047 [Selaginella moellendorffii]
Length=869

 Score =   150 bits (379),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 90/116 (78%), Gaps = 2/116 (2%)
 Frame = -1

Query  348  STPGGQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPHERSPQPTSFF  169
            STPG  RSKE+KI VTVR+RP++ +E + +D   WEC D+H++ YK  P +RSP P  + 
Sbjct  22   STPGKCRSKEEKIFVTVRVRPMSSREIAQRDTADWECPDDHTVSYKQQP-DRSPYPARY-  79

Query  168  TFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITEKA  1
            +FD+VFGP S T+ VYEEG K VALSAL GIN+TIFAYGQTSSGKT+TMRG+ E A
Sbjct  80   SFDRVFGPESSTKVVYEEGAKDVALSALSGINSTIFAYGQTSSGKTFTMRGVIENA  135



>ref|XP_006419132.1| hypothetical protein EUTSA_v10002392mg [Eutrema salsugineum]
 gb|ESQ37568.1| hypothetical protein EUTSA_v10002392mg [Eutrema salsugineum]
Length=940

 Score =   150 bits (378),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 94/128 (73%), Gaps = 3/128 (2%)
 Frame = -1

Query  390  PANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYK  211
            P  TP SKI+R   STPGG R  E+KI+VTVR+RPLN +E +  D +AW+C D+ +IV+K
Sbjct  4    PPRTPLSKIDRANPSTPGGSRVTEEKILVTVRMRPLNWREHAKYDLIAWDCPDDQTIVFK  63

Query  210  PMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKT  31
                ER+    + ++FDKVF P S T+ VYE G + VALSAL G NATIFAYGQTSSGKT
Sbjct  64   NPNPERA---AAKYSFDKVFEPISATQEVYEGGSRDVALSALAGTNATIFAYGQTSSGKT  120

Query  30   YTMRGITE  7
            +TMRG+TE
Sbjct  121  FTMRGVTE  128



>ref|XP_009150293.1| PREDICTED: kinesin-like protein NACK2 [Brassica rapa]
Length=911

 Score =   147 bits (371),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 94/126 (75%), Gaps = 4/126 (3%)
 Frame = -1

Query  381  TPASKIER-TPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPM  205
            TP+SKI R  P+STPGG R  E+ I+VTVR+RPLN +E +  D +AW+C D+H+IV+K  
Sbjct  7    TPSSKINRANPSSTPGGSRVTEENILVTVRMRPLNSREHAKYDLIAWDCPDDHTIVFKNP  66

Query  204  PHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYT  25
              ER+    + ++FDKV+ P   T+ VYE G + VALSAL G NATIFAYGQTSSGKT+T
Sbjct  67   NPERA---AAKYSFDKVYEPTCATQEVYEGGSRDVALSALAGTNATIFAYGQTSSGKTFT  123

Query  24   MRGITE  7
            MRG+T+
Sbjct  124  MRGVTD  129



>emb|CDY30956.1| BnaA06g19570D [Brassica napus]
Length=911

 Score =   147 bits (371),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 94/126 (75%), Gaps = 4/126 (3%)
 Frame = -1

Query  381  TPASKIER-TPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPM  205
            TP+SKI R  P+STPGG R  E+ I+VTVR+RPLN +E +  D +AW+C D+H+IV+K  
Sbjct  7    TPSSKINRANPSSTPGGSRVTEENILVTVRMRPLNSREHAKYDLIAWDCPDDHTIVFKNP  66

Query  204  PHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYT  25
              ER+    + ++FDKV+ P   T+ VYE G + VALSAL G NATIFAYGQTSSGKT+T
Sbjct  67   NPERA---AAKYSFDKVYEPTCATQEVYEGGSRDVALSALAGTNATIFAYGQTSSGKTFT  123

Query  24   MRGITE  7
            MRG+T+
Sbjct  124  MRGVTD  129



>ref|XP_010430934.1| PREDICTED: kinesin-like protein NACK2 [Camelina sativa]
Length=888

 Score =   145 bits (366),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 93/130 (72%), Gaps = 6/130 (5%)
 Frame = -1

Query  390  PANTPASKIERTPA-STPGGQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVY  214
            P  TP SKI+R     TPGG +  E+KI+VT+R+RPLN +E +  D +AWEC D+ +IV+
Sbjct  4    PPRTPLSKIDRVNNPYTPGGSKVTEEKILVTIRMRPLNSREHAKYDLIAWECPDDQTIVF  63

Query  213  K-PMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSG  37
            K P P     +P + ++FDKVF P   T+ VYE G + VALSAL G NATIFAYGQTSSG
Sbjct  64   KNPNPE----RPATKYSFDKVFEPTCATQEVYEGGSRDVALSALAGTNATIFAYGQTSSG  119

Query  36   KTYTMRGITE  7
            KT+TMRG+TE
Sbjct  120  KTFTMRGVTE  129



>ref|XP_006290563.1| hypothetical protein CARUB_v10016650mg [Capsella rubella]
 gb|EOA23461.1| hypothetical protein CARUB_v10016650mg [Capsella rubella]
Length=941

 Score =   145 bits (366),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 93/129 (72%), Gaps = 4/129 (3%)
 Frame = -1

Query  390  PANTPASKIERTPA-STPGGQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVY  214
            P  TP SKI+R     TPGG +  E+KI+VTVR+RPLN +EQ+  D +AWEC D+ +IV+
Sbjct  4    PPRTPLSKIDRVNNPYTPGGSKVTEEKILVTVRMRPLNWREQAKYDLIAWECPDDQTIVF  63

Query  213  KPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGK  34
            K    ER+    + ++FDKVF P   T+ VYE G + VALSAL G NATIFAYGQTSSGK
Sbjct  64   KNHNPERA---ATKYSFDKVFEPTCATQEVYEGGSRDVALSALAGTNATIFAYGQTSSGK  120

Query  33   TYTMRGITE  7
            T+TMRG+TE
Sbjct  121  TFTMRGVTE  129



>emb|CDY44836.1| BnaCnng11920D [Brassica napus]
Length=909

 Score =   144 bits (364),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 90/124 (73%), Gaps = 3/124 (2%)
 Frame = -1

Query  381  TPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMP  202
            TP+SKI R   STPGG R  E+ I+VTVR+RPLN +E +  D +AW+C D+H++V+K   
Sbjct  7    TPSSKINRANPSTPGGSRVTEENILVTVRMRPLNSREHAKYDLIAWDCPDDHTLVFKNPN  66

Query  201  HERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTM  22
             ER+    + ++FDKV+ P   T  VYE G + VALSAL G NATIFAYGQTSSGKT+TM
Sbjct  67   PERA---ATKYSFDKVYEPTCATHEVYEGGSRDVALSALAGTNATIFAYGQTSSGKTFTM  123

Query  21   RGIT  10
            RG+T
Sbjct  124  RGVT  127



>ref|XP_002875601.1| hypothetical protein ARALYDRAFT_323079 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51860.1| hypothetical protein ARALYDRAFT_323079 [Arabidopsis lyrata subsp. 
lyrata]
Length=942

 Score =   143 bits (360),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 92/129 (71%), Gaps = 4/129 (3%)
 Frame = -1

Query  390  PANTPASKIERTPA-STPGGQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVY  214
            P  TP SK++R     TPGG +  E+KI+VTVR+RPLN +E +  D +AWEC D+ +IV+
Sbjct  4    PPRTPLSKVDRVNNPYTPGGSKVTEEKILVTVRMRPLNWREHAKYDLIAWECPDDQTIVF  63

Query  213  KPMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGK  34
            K    ER+    + F+FDKVF P   T+ VYE G + VALSAL G NATIFAYGQTSSGK
Sbjct  64   KNPNPERA---ATKFSFDKVFEPTCATQEVYEGGSRDVALSALAGTNATIFAYGQTSSGK  120

Query  33   TYTMRGITE  7
            T+TMRG+TE
Sbjct  121  TFTMRGVTE  129



>ref|XP_010514712.1| PREDICTED: kinesin-like protein NACK2 [Camelina sativa]
 ref|XP_010514713.1| PREDICTED: kinesin-like protein NACK2 [Camelina sativa]
 ref|XP_010514714.1| PREDICTED: kinesin-like protein NACK2 [Camelina sativa]
 ref|XP_010514715.1| PREDICTED: kinesin-like protein NACK2 [Camelina sativa]
Length=940

 Score =   142 bits (359),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 73/131 (56%), Positives = 94/131 (72%), Gaps = 7/131 (5%)
 Frame = -1

Query  390  PANTPASKIERTPAS--TPGGQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIV  217
            P  TP SKI+R   +  TPGG +  E+KI+VT+R+RPLN +EQ+  D +A EC D+ +IV
Sbjct  4    PPRTPLSKIDRVNNNPYTPGGSKVTEEKILVTIRMRPLNSREQAKYDLIALECPDDQTIV  63

Query  216  YK-PMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSS  40
            +K P P     +P + ++FDKVF P   T+ VYE G + VALSAL G NATIFAYGQTSS
Sbjct  64   FKNPNPE----RPATKYSFDKVFEPTCATQEVYEGGSRDVALSALAGTNATIFAYGQTSS  119

Query  39   GKTYTMRGITE  7
            GKT+TMRG+TE
Sbjct  120  GKTFTMRGVTE  130



>emb|CAB89042.1| kinesin-like protein [Arabidopsis thaliana]
Length=932

 Score =   142 bits (358),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 93/128 (73%), Gaps = 3/128 (2%)
 Frame = -1

Query  390  PANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYK  211
            P  TP SKI+++   TP G +  E+KI+VTVR+RPLN +E +  D +AWEC D+ +IV+K
Sbjct  3    PPRTPLSKIDKSNPYTPCGSKVTEEKILVTVRMRPLNWREHAKYDLIAWECPDDETIVFK  62

Query  210  PMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKT  31
                +++P   + ++FDKVF P   T+ VYE G + VALSAL G NATIFAYGQTSSGKT
Sbjct  63   NPNPDKAP---TKYSFDKVFEPTCATQEVYEGGSRDVALSALAGTNATIFAYGQTSSGKT  119

Query  30   YTMRGITE  7
            +TMRG+TE
Sbjct  120  FTMRGVTE  127



>ref|NP_189907.2| kinesin TETRASPORE [Arabidopsis thaliana]
 sp|Q8LNZ2.1|NACK2_ARATH RecName: Full=Kinesin-like protein NACK2; Short=AtNACK2; AltName: 
Full=NPK1-activating kinesin 2; AltName: Full=Protein STUD; 
AltName: Full=Protein TETRASPORE [Arabidopsis thaliana]
 dbj|BAC03248.1| kinesin-like protein [Arabidopsis thaliana]
 gb|AEE77774.1| kinesin TETRASPORE [Arabidopsis thaliana]
Length=938

 Score =   142 bits (358),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 93/128 (73%), Gaps = 3/128 (2%)
 Frame = -1

Query  390  PANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYK  211
            P  TP SKI+++   TP G +  E+KI+VTVR+RPLN +E +  D +AWEC D+ +IV+K
Sbjct  4    PPRTPLSKIDKSNPYTPCGSKVTEEKILVTVRMRPLNWREHAKYDLIAWECPDDETIVFK  63

Query  210  PMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKT  31
                +++P   + ++FDKVF P   T+ VYE G + VALSAL G NATIFAYGQTSSGKT
Sbjct  64   NPNPDKAP---TKYSFDKVFEPTCATQEVYEGGSRDVALSALAGTNATIFAYGQTSSGKT  120

Query  30   YTMRGITE  7
            +TMRG+TE
Sbjct  121  FTMRGVTE  128



>emb|CAD42234.1| kinesin-like protein [Arabidopsis thaliana]
 emb|CAD48111.1| putative kinesin protein [Arabidopsis thaliana]
Length=937

 Score =   142 bits (358),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 93/128 (73%), Gaps = 3/128 (2%)
 Frame = -1

Query  390  PANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYK  211
            P  TP SKI+++   TP G +  E+KI+VTVR+RPLN +E +  D +AWEC D+ +IV+K
Sbjct  3    PPRTPLSKIDKSNPYTPCGSKVTEEKILVTVRMRPLNWREHAKYDLIAWECPDDETIVFK  62

Query  210  PMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKT  31
                +++P   + ++FDKVF P   T+ VYE G + VALSAL G NATIFAYGQTSSGKT
Sbjct  63   NPNPDKAP---TKYSFDKVFEPTCATQEVYEGGSRDVALSALAGTNATIFAYGQTSSGKT  119

Query  30   YTMRGITE  7
            +TMRG+TE
Sbjct  120  FTMRGVTE  127



>emb|CAD42658.1| kinesin-like protein [Arabidopsis thaliana]
 emb|CAD45645.1| putative kinesin-like protein [Arabidopsis thaliana]
Length=937

 Score =   142 bits (357),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 93/128 (73%), Gaps = 3/128 (2%)
 Frame = -1

Query  390  PANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYK  211
            P  TP SKI+++   TP G +  E+KI+VTVR+RPLN +E +  D +AWEC D+ +IV+K
Sbjct  3    PPRTPLSKIDKSNPYTPCGSKVTEEKILVTVRMRPLNWREHAKYDLIAWECPDDETIVFK  62

Query  210  PMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKT  31
                +++P   + ++FDKVF P   T+ VYE G + VALSAL G NATIFAYGQTSSGKT
Sbjct  63   NPNPDKAP---TKYSFDKVFEPTCATQEVYEGGSRDVALSALAGTNATIFAYGQTSSGKT  119

Query  30   YTMRGITE  7
            +TMRG+TE
Sbjct  120  FTMRGVTE  127



>ref|XP_010503028.1| PREDICTED: kinesin-like protein NACK2 [Camelina sativa]
 ref|XP_010503029.1| PREDICTED: kinesin-like protein NACK2 [Camelina sativa]
 ref|XP_010503030.1| PREDICTED: kinesin-like protein NACK2 [Camelina sativa]
 ref|XP_010503031.1| PREDICTED: kinesin-like protein NACK2 [Camelina sativa]
Length=940

 Score =   141 bits (356),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/131 (56%), Positives = 93/131 (71%), Gaps = 7/131 (5%)
 Frame = -1

Query  390  PANTPASKIERTPA--STPGGQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIV  217
            P  TP SKI+R      TPGG +  E+KI+VT+R+RPLN +EQ+  D +A EC D+ +IV
Sbjct  4    PPRTPLSKIDRVNNIPYTPGGSKVTEEKILVTIRMRPLNSREQAKYDLIALECPDDQTIV  63

Query  216  YK-PMPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSS  40
            +K P P     +P + ++FDKVF P   T+ VYE G + VALSAL G NATIFAYGQTSS
Sbjct  64   FKNPNPE----RPATKYSFDKVFEPACATQEVYEGGSRDVALSALAGTNATIFAYGQTSS  119

Query  39   GKTYTMRGITE  7
            GKT+TMRG+TE
Sbjct  120  GKTFTMRGVTE  130



>ref|XP_002301999.2| kinesin motor family protein [Populus trichocarpa]
 gb|EEE81272.2| kinesin motor family protein [Populus trichocarpa]
Length=915

 Score =   136 bits (343),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 91/126 (72%), Gaps = 8/126 (6%)
 Frame = -1

Query  357  TPASTPGGQ-------RSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPH  199
            + AS+ GG          +E++I+V+VRLRPLN++E    D   WECI+  +I++K    
Sbjct  2    SAASSTGGDDLTSDETSGQEERILVSVRLRPLNEREIVRNDVSDWECINNSTIIFKSNMP  61

Query  198  ERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMR  19
            ERS  PT++ TFD+VFG + LT+ VYEEGVK +AL A+ G+N+TIFAYGQTSSGKTYTMR
Sbjct  62   ERSMFPTAY-TFDRVFGSDCLTKQVYEEGVKEIALLAVSGVNSTIFAYGQTSSGKTYTMR  120

Query  18   GITEKA  1
            GITE A
Sbjct  121  GITEYA  126



>ref|XP_001779285.1| predicted protein [Physcomitrella patens]
 gb|EDQ55887.1| predicted protein [Physcomitrella patens]
Length=951

 Score =   135 bits (339),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 72/122 (59%), Positives = 85/122 (70%), Gaps = 1/122 (1%)
 Frame = -1

Query  366  IERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPHERSP  187
            IER   +     RS E+KI VTVR+RPL+ KE +  D   W C  E SI +K    ERSP
Sbjct  5    IERGGGAQLTRVRSGEEKIYVTVRVRPLSAKEVARSDASDWVCTSEQSIAFKHALQERSP  64

Query  186  QPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITE  7
             P ++ T D+VFGP+ LT  VYEEG K VALSAL G+N+TIFAYGQTSSGKTYTMRG+TE
Sbjct  65   FPAAY-TLDRVFGPDCLTRRVYEEGAKDVALSALTGLNSTIFAYGQTSSGKTYTMRGVTE  123

Query  6    KA  1
             A
Sbjct  124  SA  125



>ref|XP_011028954.1| PREDICTED: kinesin-like protein NACK1 isoform X2 [Populus euphratica]
Length=912

 Score =   134 bits (337),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 91/126 (72%), Gaps = 8/126 (6%)
 Frame = -1

Query  357  TPASTPGGQ-------RSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPH  199
            + AS+ GG          +E++I+V+VRLRPLN++E +  D   WECI+  +I++K    
Sbjct  2    SAASSIGGDDLTSDETSGQEERILVSVRLRPLNEREIARNDVSDWECINNSTIIFKSNMP  61

Query  198  ERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMR  19
            ERS  PT++ TFD+VF  + LT+ VYEEGVK +AL A+ G+N+TIFAYGQTSSGKTYTMR
Sbjct  62   ERSMFPTAY-TFDRVFRSDCLTKQVYEEGVKEIALLAVSGVNSTIFAYGQTSSGKTYTMR  120

Query  18   GITEKA  1
            GITE A
Sbjct  121  GITEYA  126



>ref|XP_011028953.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Populus euphratica]
Length=915

 Score =   134 bits (337),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 91/126 (72%), Gaps = 8/126 (6%)
 Frame = -1

Query  357  TPASTPGGQ-------RSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPH  199
            + AS+ GG          +E++I+V+VRLRPLN++E +  D   WECI+  +I++K    
Sbjct  2    SAASSIGGDDLTSDETSGQEERILVSVRLRPLNEREIARNDVSDWECINNSTIIFKSNMP  61

Query  198  ERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMR  19
            ERS  PT++ TFD+VF  + LT+ VYEEGVK +AL A+ G+N+TIFAYGQTSSGKTYTMR
Sbjct  62   ERSMFPTAY-TFDRVFRSDCLTKQVYEEGVKEIALLAVSGVNSTIFAYGQTSSGKTYTMR  120

Query  18   GITEKA  1
            GITE A
Sbjct  121  GITEYA  126



>gb|EMS53749.1| Kinesin-related protein 4 [Triticum urartu]
Length=917

 Score =   132 bits (332),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 83/117 (71%), Gaps = 18/117 (15%)
 Frame = -1

Query  345  TPGGQ-RSKEDKIMVTVRLRPLNKKEQSAKDN-VAWECIDEHSIVYKPMPHERSPQPTSF  172
            TPGG  R++E+KI+VTVR+RPL+K+E + KD  VAWEC D  +I+Y              
Sbjct  3    TPGGSSRAQEEKILVTVRVRPLSKRELAMKDQKVAWECADSQTILYT-------------  49

Query  171  FTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITEKA  1
               DKVFGP   T+ VYE+G K VA+SAL GINATIFAYGQTSSGKT+TMRG+TE A
Sbjct  50   ---DKVFGPACQTDLVYEDGAKDVAMSALTGINATIFAYGQTSSGKTFTMRGVTESA  103



>ref|XP_011074638.1| PREDICTED: kinesin-like protein NACK1 isoform X2 [Sesamum indicum]
Length=974

 Score =   131 bits (329),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 86/119 (72%), Gaps = 3/119 (3%)
 Frame = -1

Query  351  ASTPGGQRS--KEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPHERSPQPT  178
            +S   GQ S  ++++I V+VRLRPLN++E S  D   WECI+  +I++K    ERS  PT
Sbjct  8    SSVWDGQDSSPRDERIFVSVRLRPLNERELSRNDVPEWECINNTTIIFKNGLQERSLSPT  67

Query  177  SFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITEKA  1
            ++ TFD+VFGP + T  VYEE  K +ALS L G+N++IFAYGQTSSGKTYTM GITE A
Sbjct  68   AY-TFDRVFGPQNPTRQVYEEAAKKIALSVLSGMNSSIFAYGQTSSGKTYTMSGITEYA  125



>ref|XP_011074636.1| PREDICTED: kinesin-like protein NACK2 isoform X1 [Sesamum indicum]
 ref|XP_011074637.1| PREDICTED: kinesin-like protein NACK2 isoform X1 [Sesamum indicum]
Length=989

 Score =   131 bits (329),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 86/119 (72%), Gaps = 3/119 (3%)
 Frame = -1

Query  351  ASTPGGQRS--KEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPHERSPQPT  178
            +S   GQ S  ++++I V+VRLRPLN++E S  D   WECI+  +I++K    ERS  PT
Sbjct  8    SSVWDGQDSSPRDERIFVSVRLRPLNERELSRNDVPEWECINNTTIIFKNGLQERSLSPT  67

Query  177  SFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITEKA  1
            ++ TFD+VFGP + T  VYEE  K +ALS L G+N++IFAYGQTSSGKTYTM GITE A
Sbjct  68   AY-TFDRVFGPQNPTRQVYEEAAKKIALSVLSGMNSSIFAYGQTSSGKTYTMSGITEYA  125



>gb|KHN25430.1| Centromere-associated protein E [Glycine soja]
Length=909

 Score =   130 bits (327),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 86/112 (77%), Gaps = 1/112 (1%)
 Frame = -1

Query  336  GQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDK  157
            G  S+E+KI+V++RLRPLN+KE +A ++  WECI++ +I+Y+    E S  P+++ TFD+
Sbjct  17   GVSSREEKILVSIRLRPLNEKEIAANESADWECINDTTILYRNTLREGSTFPSAY-TFDR  75

Query  156  VFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITEKA  1
            VF  + +T  VYEEG K VALS + GIN++IFAYGQTSSGKTYTM GITE A
Sbjct  76   VFRGDCVTRQVYEEGAKEVALSVVSGINSSIFAYGQTSSGKTYTMVGITEYA  127



>gb|EYU38855.1| hypothetical protein MIMGU_mgv1a000996mg [Erythranthe guttata]
Length=917

 Score =   129 bits (325),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 82/112 (73%), Gaps = 3/112 (3%)
 Frame = -1

Query  336  GQRS--KEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPHERSPQPTSFFTF  163
            GQ S  +E+KI V VRLRPLN++E S  D   WECI+  ++++K    ERS  PT++ TF
Sbjct  14   GQDSSIQEEKIFVAVRLRPLNEREISKNDVSDWECINSTTVIFKNSLQERSLLPTAY-TF  72

Query  162  DKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITE  7
            D+VFG +S T  VYEE  K +ALS L G+N+TIFAYGQTSSGKT+TM GITE
Sbjct  73   DRVFGHDSPTRQVYEEAAKKIALSVLSGMNSTIFAYGQTSSGKTFTMSGITE  124



>ref|XP_010436197.1| PREDICTED: kinesin-like protein NACK1 [Camelina sativa]
Length=124

 Score =   120 bits (300),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 80/109 (73%), Gaps = 1/109 (1%)
 Frame = -1

Query  327  SKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFG  148
            ++E+KI+V VRLRPLN+KE +A +   WECI++ +I+Y+    E S  P+++ +FD+V+ 
Sbjct  9    AREEKILVLVRLRPLNEKEIAANEAADWECINDTTILYRNTLREGSNFPSAY-SFDRVYR  67

Query  147  PNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITEKA  1
                T  +YE+G K +ALS + GIN +IFAYGQTSSGKTYTM GITE A
Sbjct  68   GECPTRQIYEDGTKEIALSVVKGINCSIFAYGQTSSGKTYTMSGITEFA  116



>ref|XP_010436196.1| PREDICTED: kinesin-like protein NACK1 [Camelina sativa]
Length=118

 Score =   119 bits (299),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 80/109 (73%), Gaps = 1/109 (1%)
 Frame = -1

Query  327  SKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFG  148
            ++E+KI+V VRLRPLN+KE +A +   WECI++ +I+Y+    E S  P+++ +FD+V+ 
Sbjct  9    AREEKILVLVRLRPLNEKEIAANEAADWECINDTTILYRNTLREGSNFPSAY-SFDRVYR  67

Query  147  PNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITEKA  1
                T  +YE+G K +ALS + GIN +IFAYGQTSSGKTYTM GITE A
Sbjct  68   GECPTRQIYEDGTKEIALSVVKGINCSIFAYGQTSSGKTYTMSGITEFA  116



>ref|XP_002510482.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF52669.1| ATP binding protein, putative [Ricinus communis]
Length=939

 Score =   129 bits (324),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 83/108 (77%), Gaps = 1/108 (1%)
 Frame = -1

Query  324  KEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFGP  145
            +E+KI V+VR+RPLN++E +  D   WECI+ ++I++K    +RS  PT++ TFD+VFG 
Sbjct  24   QEEKIFVSVRMRPLNEREVARNDICDWECINNNTIIFKSNMPDRSMVPTAY-TFDRVFGS  82

Query  144  NSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITEKA  1
               T+ VYEEG K +AL+A+ GIN++IFAYGQTSSGKTYTM G+TE A
Sbjct  83   ECSTKQVYEEGAKEIALAAVSGINSSIFAYGQTSSGKTYTMDGVTEYA  130



>ref|XP_010526582.1| PREDICTED: kinesin-like protein NACK1 isoform X2 [Tarenaya hassleriana]
Length=732

 Score =   128 bits (322),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 91/129 (71%), Gaps = 6/129 (5%)
 Frame = -1

Query  387  ANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKP  208
            A     K+E+T A  P GQ   E+KI+V VRLRPLN+KE +A +   WECI++ +I+Y+ 
Sbjct  5    AGEELKKMEKTQA--PPGQ---EEKILVLVRLRPLNEKEIAANEVADWECINDTTILYRN  59

Query  207  MPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTY  28
               E S  P+++ TFD+V+  + +T  VYEEG K +ALS + GIN++IFAYGQTSSGKTY
Sbjct  60   TLREGSTFPSAY-TFDRVYRGDCMTRQVYEEGTKEIALSVVEGINSSIFAYGQTSSGKTY  118

Query  27   TMRGITEKA  1
            TM GITE A
Sbjct  119  TMNGITEFA  127



>ref|XP_007017694.1| ATP binding microtubule motor family protein, putative isoform 
1 [Theobroma cacao]
 ref|XP_007017695.1| ATP binding microtubule motor family protein, putative isoform 
1 [Theobroma cacao]
 gb|EOY14919.1| ATP binding microtubule motor family protein, putative isoform 
1 [Theobroma cacao]
 gb|EOY14920.1| ATP binding microtubule motor family protein, putative isoform 
1 [Theobroma cacao]
Length=1062

 Score =   129 bits (323),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 81/112 (72%), Gaps = 1/112 (1%)
 Frame = -1

Query  336  GQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDK  157
            G   +E+KI V+VRLRPLN+K+++      WECI+  +IV+K    ERS  P ++ TFD+
Sbjct  14   GLSGQEEKIFVSVRLRPLNEKDRARNSVSDWECINNDTIVFKNSLPERSMFPAAY-TFDR  72

Query  156  VFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITEKA  1
            VF  +S T  VYEEG K +ALS L GIN+TIFAYGQTSSGKTYTM GITE A
Sbjct  73   VFACDSHTRQVYEEGAKQIALSVLSGINSTIFAYGQTSSGKTYTMSGITEYA  124



>ref|XP_010526578.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Tarenaya hassleriana]
 ref|XP_010526579.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Tarenaya hassleriana]
 ref|XP_010526580.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Tarenaya hassleriana]
 ref|XP_010526581.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Tarenaya hassleriana]
Length=840

 Score =   128 bits (322),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 91/129 (71%), Gaps = 6/129 (5%)
 Frame = -1

Query  387  ANTPASKIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKP  208
            A     K+E+T A  P GQ   E+KI+V VRLRPLN+KE +A +   WECI++ +I+Y+ 
Sbjct  5    AGEELKKMEKTQA--PPGQ---EEKILVLVRLRPLNEKEIAANEVADWECINDTTILYRN  59

Query  207  MPHERSPQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTY  28
               E S  P+++ TFD+V+  + +T  VYEEG K +ALS + GIN++IFAYGQTSSGKTY
Sbjct  60   TLREGSTFPSAY-TFDRVYRGDCMTRQVYEEGTKEIALSVVEGINSSIFAYGQTSSGKTY  118

Query  27   TMRGITEKA  1
            TM GITE A
Sbjct  119  TMNGITEFA  127



>ref|XP_007131750.1| hypothetical protein PHAVU_011G038800g [Phaseolus vulgaris]
 gb|ESW03744.1| hypothetical protein PHAVU_011G038800g [Phaseolus vulgaris]
Length=892

 Score =   128 bits (322),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 84/112 (75%), Gaps = 1/112 (1%)
 Frame = -1

Query  336  GQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDK  157
            G   +E+KI+V++RLRPLN+KE +A ++  WECI++ +I+Y+    E S  P+++ TFDK
Sbjct  17   GVSGREEKILVSIRLRPLNEKEIAANESADWECINDTTILYRNTLREGSTFPSAY-TFDK  75

Query  156  VFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITEKA  1
            VF  +  T  VYEEG K VALS + GIN++IFAYGQTSSGKTYTM GITE A
Sbjct  76   VFRGDCATRQVYEEGAKEVALSVVGGINSSIFAYGQTSSGKTYTMVGITEYA  127



>ref|XP_007131749.1| hypothetical protein PHAVU_011G038800g [Phaseolus vulgaris]
 gb|ESW03743.1| hypothetical protein PHAVU_011G038800g [Phaseolus vulgaris]
Length=891

 Score =   128 bits (322),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 84/112 (75%), Gaps = 1/112 (1%)
 Frame = -1

Query  336  GQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDK  157
            G   +E+KI+V++RLRPLN+KE +A ++  WECI++ +I+Y+    E S  P+++ TFDK
Sbjct  17   GVSGREEKILVSIRLRPLNEKEIAANESADWECINDTTILYRNTLREGSTFPSAY-TFDK  75

Query  156  VFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITEKA  1
            VF  +  T  VYEEG K VALS + GIN++IFAYGQTSSGKTYTM GITE A
Sbjct  76   VFRGDCATRQVYEEGAKEVALSVVGGINSSIFAYGQTSSGKTYTMVGITEYA  127



>gb|KDP46700.1| hypothetical protein JCGZ_06488 [Jatropha curcas]
Length=1012

 Score =   128 bits (321),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 80/105 (76%), Gaps = 3/105 (3%)
 Frame = -1

Query  315  KIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKP--MPHERSPQPTSFFTFDKVFGPN  142
            KI+V+VRLRPLN+KE +  D   WECI+E++I+Y+      ERS  PT++ TFD+VF P+
Sbjct  15   KILVSVRLRPLNEKETARNDVSDWECINENTIIYRNNLSVSERSMYPTAY-TFDRVFRPD  73

Query  141  SLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITE  7
              T  VYEEG K VAL+ + GIN++IFAYGQTSSGKTYTM GITE
Sbjct  74   CSTRQVYEEGAKEVALAVVSGINSSIFAYGQTSSGKTYTMSGITE  118



>ref|XP_009393646.1| PREDICTED: kinesin-like protein NACK1 [Musa acuminata subsp. 
malaccensis]
Length=913

 Score =   127 bits (320),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 82/111 (74%), Gaps = 3/111 (3%)
 Frame = -1

Query  339  GGQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPHERSPQPTSFFTFD  160
            GG  +KE++I+V+VR+RPLN KE    D   W+CID+ ++V+K    ERS  PT++ TFD
Sbjct  17   GG--TKEERIVVSVRMRPLNAKEMEKSDPSDWDCIDDTTVVFKNSLPERSVFPTAY-TFD  73

Query  159  KVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITE  7
            + FG +  T  VY+EG K VALS + GINA+IFAYGQTSSGKTYTM GITE
Sbjct  74   RAFGCDCNTRRVYDEGAKEVALSVVSGINASIFAYGQTSSGKTYTMAGITE  124



>ref|XP_009398104.1| PREDICTED: kinesin-like protein NACK1 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009398105.1| PREDICTED: kinesin-like protein NACK1 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009398106.1| PREDICTED: kinesin-like protein NACK1 [Musa acuminata subsp. 
malaccensis]
Length=957

 Score =   127 bits (320),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 82/106 (77%), Gaps = 1/106 (1%)
 Frame = -1

Query  324  KEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFGP  145
            K +KI V+VRLRPL++KE +A D+  WECI++ +I+++    ERS  PT++ TFD+VF  
Sbjct  31   KVEKIFVSVRLRPLSEKEVAANDSCDWECINDTTIIFRNSLPERSMIPTAY-TFDRVFRS  89

Query  144  NSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITE  7
            +  T+ VYEEG K +ALS + GIN+TIFAYGQTSSGKTYTM GITE
Sbjct  90   DCTTKQVYEEGAKEIALSVVSGINSTIFAYGQTSSGKTYTMTGITE  135



>ref|XP_006659658.1| PREDICTED: kinesin-like protein NACK2-like [Oryza brachyantha]
Length=998

 Score =   127 bits (320),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 82/106 (77%), Gaps = 3/106 (3%)
 Frame = -1

Query  324  KEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFGP  145
            KE++IMV+VRLRPLN +E  A D+  WECI   +++++    ER+  PT++ T+D+VFGP
Sbjct  18   KEERIMVSVRLRPLNGRE--AGDSCDWECISPTTVMFRSTVPERAMFPTAY-TYDRVFGP  74

Query  144  NSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITE  7
            +S T  VYEEG K VALS + GIN++IFAYGQTSSGKTYTM GITE
Sbjct  75   DSSTRQVYEEGAKEVALSVVSGINSSIFAYGQTSSGKTYTMTGITE  120



>gb|EEE69110.1| hypothetical protein OsJ_28179 [Oryza sativa Japonica Group]
Length=987

 Score =   127 bits (320),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 82/106 (77%), Gaps = 3/106 (3%)
 Frame = -1

Query  324  KEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFGP  145
            KE++IMV+VRLRPLN +E  A D+  WECI   +++++    ER+  PT++ T+D+VFGP
Sbjct  18   KEERIMVSVRLRPLNGRE--AGDSCDWECISPTTVMFRSTVPERAMFPTAY-TYDRVFGP  74

Query  144  NSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITE  7
            +S T  VYEEG K VALS + GIN++IFAYGQTSSGKTYTM GITE
Sbjct  75   DSSTRQVYEEGAKEVALSVVSGINSSIFAYGQTSSGKTYTMTGITE  120



>ref|NP_001062429.1| Os08g0547500 [Oryza sativa Japonica Group]
 dbj|BAD09938.1| putative kinesin heavy chain [Oryza sativa Japonica Group]
 dbj|BAF24343.1| Os08g0547500 [Oryza sativa Japonica Group]
Length=986

 Score =   127 bits (320),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 82/106 (77%), Gaps = 3/106 (3%)
 Frame = -1

Query  324  KEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFGP  145
            KE++IMV+VRLRPLN +E  A D+  WECI   +++++    ER+  PT++ T+D+VFGP
Sbjct  18   KEERIMVSVRLRPLNGRE--AGDSCDWECISPTTVMFRSTVPERAMFPTAY-TYDRVFGP  74

Query  144  NSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITE  7
            +S T  VYEEG K VALS + GIN++IFAYGQTSSGKTYTM GITE
Sbjct  75   DSSTRQVYEEGAKEVALSVVSGINSSIFAYGQTSSGKTYTMTGITE  120



>gb|EPS66399.1| hypothetical protein M569_08373, partial [Genlisea aurea]
Length=430

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 80/110 (73%), Gaps = 1/110 (1%)
 Frame = -1

Query  336  GQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDK  157
            G    E+KI+V VRLRPL++KE    +   WECI+  +I+Y+    ERS  PT++ +FD+
Sbjct  19   GNGGGEEKILVLVRLRPLSEKETLQNEVADWECINATTILYRNSIQERSGLPTAY-SFDR  77

Query  156  VFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITE  7
            VF  ++ T  VY+EG++ +ALS + GIN+TIFAYGQTSSGKTYTM GITE
Sbjct  78   VFRGDNTTRDVYDEGIRDIALSVVGGINSTIFAYGQTSSGKTYTMNGITE  127



>gb|EEC83991.1| hypothetical protein OsI_30145 [Oryza sativa Indica Group]
Length=969

 Score =   127 bits (319),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 82/106 (77%), Gaps = 3/106 (3%)
 Frame = -1

Query  324  KEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFGP  145
            KE++IMV+VRLRPLN +E  A D+  WECI   +++++    ER+  PT++ T+D+VFGP
Sbjct  18   KEERIMVSVRLRPLNGRE--AGDSCDWECISPTTVMFRSTVPERAMFPTAY-TYDRVFGP  74

Query  144  NSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITE  7
            +S T  VYEEG K VALS + GIN++IFAYGQTSSGKTYTM GITE
Sbjct  75   DSSTRQVYEEGAKEVALSVVSGINSSIFAYGQTSSGKTYTMTGITE  120



>dbj|BAD09937.1| putative kinesin heavy chain [Oryza sativa Japonica Group]
Length=1003

 Score =   127 bits (319),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 82/106 (77%), Gaps = 3/106 (3%)
 Frame = -1

Query  324  KEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFGP  145
            KE++IMV+VRLRPLN +E  A D+  WECI   +++++    ER+  PT++ T+D+VFGP
Sbjct  34   KEERIMVSVRLRPLNGRE--AGDSCDWECISPTTVMFRSTVPERAMFPTAY-TYDRVFGP  90

Query  144  NSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITE  7
            +S T  VYEEG K VALS + GIN++IFAYGQTSSGKTYTM GITE
Sbjct  91   DSSTRQVYEEGAKEVALSVVSGINSSIFAYGQTSSGKTYTMTGITE  136



>ref|XP_009407965.1| PREDICTED: kinesin-like protein NACK2 [Musa acuminata subsp. 
malaccensis]
Length=959

 Score =   127 bits (319),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 75/103 (73%), Gaps = 1/103 (1%)
 Frame = -1

Query  315  KIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFGPNSL  136
            +I+V+VRLRPLN KE    D   WECID  ++V+K    +RS  PT++ TFD+VFG    
Sbjct  26   RILVSVRLRPLNAKELERNDTSDWECIDRTTVVFKNNLPDRSMYPTAY-TFDRVFGSKCG  84

Query  135  TETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITE  7
            T  VYEEG K VALS + GINATIFAYGQT+SGKTYTM GITE
Sbjct  85   TRDVYEEGAKEVALSVVSGINATIFAYGQTNSGKTYTMTGITE  127



>gb|KHF98979.1| Kinesin-related 11 [Gossypium arboreum]
Length=949

 Score =   127 bits (319),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 87/121 (72%), Gaps = 3/121 (2%)
 Frame = -1

Query  369  KIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPHERS  190
            ++E+   +   G R  E++I+V VRLRPL+ KE  A +   WECI++++I+Y+    E S
Sbjct  11   QVEKEQKAQTAGAR--EERILVVVRLRPLSDKEIIANEVADWECINDNTILYRNTLREGS  68

Query  189  PQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGIT  10
              P+++ TFD+VF  + LT+ VYEEG K VALS + GIN+TIFAYGQTSSGKTYTM GIT
Sbjct  69   TFPSAY-TFDRVFRGDCLTKQVYEEGAKEVALSVVSGINSTIFAYGQTSSGKTYTMTGIT  127

Query  9    E  7
            E
Sbjct  128  E  128



>ref|XP_006403945.1| hypothetical protein EUTSA_v10010086mg [Eutrema salsugineum]
 gb|ESQ45398.1| hypothetical protein EUTSA_v10010086mg [Eutrema salsugineum]
Length=1032

 Score =   127 bits (319),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 82/114 (72%), Gaps = 3/114 (3%)
 Frame = -1

Query  336  GQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPH--ERSPQPTSFFTF  163
            G   +E+KI V+VRLRPLN KE+   D   WECI++ +++Y+      ERS  PT++ TF
Sbjct  10   GSSEREEKIFVSVRLRPLNVKERVRNDVADWECINDETVIYRSHLSISERSMYPTAY-TF  68

Query  162  DKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITEKA  1
            D+VFGP   T  VY++G K VALS + G++A++FAYGQTSSGKTYTM GIT+ A
Sbjct  69   DRVFGPECCTREVYDQGAKEVALSVVSGVHASVFAYGQTSSGKTYTMSGITDYA  122



>ref|XP_009386558.1| PREDICTED: kinesin-like protein NACK1 [Musa acuminata subsp. 
malaccensis]
Length=933

 Score =   127 bits (318),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 79/110 (72%), Gaps = 1/110 (1%)
 Frame = -1

Query  330  RSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVF  151
            R KE++I+V+VR+RPLN KE    D   WEC +  +IV+K    ER+  PT++ TFDKVF
Sbjct  51   RRKEERILVSVRVRPLNAKEIGRNDPSDWECRNNTTIVFKNAHSERTMYPTAY-TFDKVF  109

Query  150  GPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITEKA  1
            G    T  VY+EG K VALS + GINA+IFAYGQTSSGKTYTM GITE A
Sbjct  110  GCECDTRHVYDEGAKEVALSVVDGINASIFAYGQTSSGKTYTMTGITEYA  159



>gb|KHN39844.1| Centromere-associated protein E [Glycine soja]
Length=889

 Score =   127 bits (318),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 85/112 (76%), Gaps = 1/112 (1%)
 Frame = -1

Query  336  GQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDK  157
            G  S+E+KI+V++RLRPLN+KE +A ++  WECI++ +I+Y+    E S  P+++ TFD+
Sbjct  17   GVSSREEKILVSIRLRPLNEKEIAANESADWECINDTTILYRNTLREGSTFPSAY-TFDR  75

Query  156  VFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITEKA  1
            VF  + +T  VYEEG K VA S + GIN++IFAYGQTSSGKTYTM GITE A
Sbjct  76   VFRGDCVTRQVYEEGAKEVAPSVVSGINSSIFAYGQTSSGKTYTMVGITEYA  127



>ref|XP_002452842.1| hypothetical protein SORBIDRAFT_04g033453 [Sorghum bicolor]
 gb|EES05818.1| hypothetical protein SORBIDRAFT_04g033453 [Sorghum bicolor]
Length=146

 Score =   118 bits (295),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 81/111 (73%), Gaps = 1/111 (1%)
 Frame = -1

Query  339  GGQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPHERSPQPTSFFTFD  160
            GG   + D+I V VRLRPL++KE +  +   WECI++ +++++    +R   PT++ TFD
Sbjct  25   GGSVGRMDRIQVLVRLRPLSEKEVARGEPAEWECINDTTVMFRSTFPDRPTAPTAY-TFD  83

Query  159  KVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITE  7
            +VF  +  T+ VYEEGV+ VALS + GIN++IFAYGQTSSGKTYTM G+TE
Sbjct  84   RVFHSDCSTKEVYEEGVREVALSVVSGINSSIFAYGQTSSGKTYTMTGVTE  134



>ref|XP_002280678.2| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010664763.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010664764.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
Length=937

 Score =   127 bits (318),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 84/113 (74%), Gaps = 5/113 (4%)
 Frame = -1

Query  330  RSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYK---PMPHERSPQPTSFFTFD  160
            + +E+KI+V+VRLRPL+ KE S      WECI+ ++I+YK    +P ERS  PT++ TFD
Sbjct  15   KGQEEKILVSVRLRPLDVKENSRYHVSDWECINVNTIIYKNSLSLP-ERSQFPTAY-TFD  72

Query  159  KVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITEKA  1
            +VFG N  T  VY+EG K VALS + GIN++IFAYGQTSSGKTYTM GITE A
Sbjct  73   RVFGQNCSTREVYDEGAKEVALSVVNGINSSIFAYGQTSSGKTYTMTGITEYA  125



>emb|CDY29004.1| BnaC07g32100D [Brassica napus]
Length=1011

 Score =   127 bits (318),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 83/114 (73%), Gaps = 3/114 (3%)
 Frame = -1

Query  336  GQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPH--ERSPQPTSFFTF  163
            G   +E+KI V+VRLRPLN KE+   +   WECI++ +++Y+      ERS  PT++ TF
Sbjct  10   GSSGREEKIFVSVRLRPLNVKERVKNEEADWECINDETVIYRSHLSLSERSMYPTAY-TF  68

Query  162  DKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITEKA  1
            D+VFGP   T+ VY++G K VALS + G++A++FAYGQTSSGKTYTM GIT+ A
Sbjct  69   DRVFGPECCTKEVYDQGAKEVALSVVSGVHASVFAYGQTSSGKTYTMSGITDYA  122



>emb|CDX90660.1| BnaA03g41210D [Brassica napus]
Length=1024

 Score =   126 bits (317),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 83/114 (73%), Gaps = 3/114 (3%)
 Frame = -1

Query  336  GQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPH--ERSPQPTSFFTF  163
            G   +E+KI V+VRLRPLN KE+   +   WECI++ +++Y+      ERS  PT++ TF
Sbjct  10   GSSGREEKIFVSVRLRPLNVKERVKNEEADWECINDETVIYRSHLSLSERSMYPTAY-TF  68

Query  162  DKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITEKA  1
            D+VFGP   T+ VY++G K VALS + G++A++FAYGQTSSGKTYTM GIT+ A
Sbjct  69   DRVFGPERCTKEVYDQGAKEVALSVVSGVHASVFAYGQTSSGKTYTMSGITDYA  122



>ref|XP_009136598.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Brassica rapa]
 ref|XP_009136599.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Brassica rapa]
Length=1026

 Score =   126 bits (316),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 83/114 (73%), Gaps = 3/114 (3%)
 Frame = -1

Query  336  GQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPH--ERSPQPTSFFTF  163
            G   +E+KI V+VRLRPLN KE+   +   WECI++ +++Y+      ERS  PT++ TF
Sbjct  12   GSSGREEKIFVSVRLRPLNVKERVKNEEADWECINDETVIYRSHLSLSERSMYPTAY-TF  70

Query  162  DKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITEKA  1
            D+VFGP   T+ VY++G K VALS + G++A++FAYGQTSSGKTYTM GIT+ A
Sbjct  71   DRVFGPERCTKEVYDQGAKEVALSVVSGVHASVFAYGQTSSGKTYTMSGITDYA  124



>ref|XP_002876073.1| kinesin motor family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52332.1| kinesin motor family protein [Arabidopsis lyrata subsp. lyrata]
Length=1008

 Score =   126 bits (316),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 83/114 (73%), Gaps = 3/114 (3%)
 Frame = -1

Query  336  GQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPH--ERSPQPTSFFTF  163
            G   +E+KI V+VRLRPLN KE++  D   WECI++ +++Y+      ERS  PT++ TF
Sbjct  10   GPSGREEKIFVSVRLRPLNVKERARNDVADWECINDETVIYRSHLSISERSMYPTAY-TF  68

Query  162  DKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITEKA  1
            D+VFGP   T  VY++G K VALS + G++A++FAYGQTSSGKTYTM GIT+ A
Sbjct  69   DRVFGPECSTREVYDQGAKEVALSVVSGVHASVFAYGQTSSGKTYTMSGITDYA  122



>ref|XP_009386197.1| PREDICTED: kinesin-like protein NACK1 [Musa acuminata subsp. 
malaccensis]
Length=941

 Score =   126 bits (316),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 80/107 (75%), Gaps = 1/107 (1%)
 Frame = -1

Query  327  SKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFG  148
            +KE++I+V+VR+RPLN KE    D   WEC+++ +I++K    ERS  PT++ TFDKVFG
Sbjct  19   AKEERILVSVRVRPLNAKEIEKNDPSDWECVNDTTIMFKNSLPERSAFPTAY-TFDKVFG  77

Query  147  PNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITE  7
              S T  VY+EG K VALS + GINA+IFAYGQTSSGKTYTM  ITE
Sbjct  78   HQSNTRHVYDEGAKEVALSVVNGINASIFAYGQTSSGKTYTMTSITE  124



>ref|XP_010113382.1| Kinesin-related protein 4 [Morus notabilis]
 gb|EXC35389.1| Kinesin-related protein 4 [Morus notabilis]
Length=1016

 Score =   125 bits (315),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 82/114 (72%), Gaps = 6/114 (5%)
 Frame = -1

Query  342  PGGQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKP--MPHERSPQPTSFF  169
            PGG   +E+KI V++RLRPLN+KE S  D   WECI++ +I+Y+      ERS  PT + 
Sbjct  13   PGG---REEKIFVSIRLRPLNEKEASRNDVSDWECINDDTIIYRNNLSVSERSMYPTGY-  68

Query  168  TFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITE  7
            TFD+VF  +  T  VY+EG K VALS + GIN++IFAYGQTSSGKTYTM GITE
Sbjct  69   TFDRVFSFDCPTRQVYKEGAKDVALSVVSGINSSIFAYGQTSSGKTYTMSGITE  122



>ref|NP_001190049.1| ATP binding microtubule motor family protein [Arabidopsis thaliana]
 gb|AEE78757.1| ATP binding microtubule motor family protein [Arabidopsis thaliana]
Length=1054

 Score =   125 bits (315),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 83/114 (73%), Gaps = 3/114 (3%)
 Frame = -1

Query  336  GQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPH--ERSPQPTSFFTF  163
            G   +E+KI V+VRLRPLN +E++  D   WECI++ +++Y+      ERS  PT++ TF
Sbjct  10   GSSGREEKIFVSVRLRPLNVRERARNDVADWECINDETVIYRSHLSISERSMYPTAY-TF  68

Query  162  DKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITEKA  1
            D+VFGP   T  VY++G K VALS + G++A++FAYGQTSSGKTYTM GIT+ A
Sbjct  69   DRVFGPECSTREVYDQGAKEVALSVVSGVHASVFAYGQTSSGKTYTMIGITDYA  122



>ref|NP_190684.3| ATP binding microtubule motor family protein [Arabidopsis thaliana]
 gb|AEE78756.1| ATP binding microtubule motor family protein [Arabidopsis thaliana]
Length=1052

 Score =   125 bits (315),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 83/114 (73%), Gaps = 3/114 (3%)
 Frame = -1

Query  336  GQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPH--ERSPQPTSFFTF  163
            G   +E+KI V+VRLRPLN +E++  D   WECI++ +++Y+      ERS  PT++ TF
Sbjct  10   GSSGREEKIFVSVRLRPLNVRERARNDVADWECINDETVIYRSHLSISERSMYPTAY-TF  68

Query  162  DKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITEKA  1
            D+VFGP   T  VY++G K VALS + G++A++FAYGQTSSGKTYTM GIT+ A
Sbjct  69   DRVFGPECSTREVYDQGAKEVALSVVSGVHASVFAYGQTSSGKTYTMIGITDYA  122



>ref|XP_004974129.1| PREDICTED: kinesin-like protein NACK1-like isoform X3 [Setaria 
italica]
 ref|XP_004974130.1| PREDICTED: kinesin-like protein NACK1-like isoform X4 [Setaria 
italica]
Length=1028

 Score =   125 bits (315),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 82/107 (77%), Gaps = 3/107 (3%)
 Frame = -1

Query  327  SKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFG  148
            +KE++IMV+VRLRPLN +E  A D+  WECI   +I+++    ER+  PT++ T+D+VFG
Sbjct  12   AKEERIMVSVRLRPLNGRE--AGDSSDWECISPTTIMFRSTVPERAMFPTAY-TYDRVFG  68

Query  147  PNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITE  7
            P+  T  VYEEG K VALS + GIN++IFAYGQTSSGKTYTM GITE
Sbjct  69   PSCSTRQVYEEGAKEVALSVVSGINSSIFAYGQTSSGKTYTMTGITE  115



>emb|CDY03483.1| BnaC01g15990D [Brassica napus]
Length=177

 Score =   118 bits (295),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 76/104 (73%), Gaps = 4/104 (4%)
 Frame = -1

Query  321  EDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFGPN  142
            E+KI+V+VR+RPLN+KE++  D   WECI+  +I+     H  S +P+  FTFDKVFG  
Sbjct  7    EEKILVSVRVRPLNEKEKTRNDRCDWECINNTTIICNA--HNLSDKPS--FTFDKVFGFE  62

Query  141  SLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGIT  10
              T+ VY++G + VAL  L GIN++IFAYGQTSSGKTYTM GIT
Sbjct  63   CPTKQVYDDGAREVALCVLSGINSSIFAYGQTSSGKTYTMTGIT  106



>ref|XP_004974127.1| PREDICTED: kinesin-like protein NACK1-like isoform X1 [Setaria 
italica]
Length=1045

 Score =   125 bits (315),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 82/107 (77%), Gaps = 3/107 (3%)
 Frame = -1

Query  327  SKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFG  148
            +KE++IMV+VRLRPLN +E  A D+  WECI   +I+++    ER+  PT++ T+D+VFG
Sbjct  29   AKEERIMVSVRLRPLNGRE--AGDSSDWECISPTTIMFRSTVPERAMFPTAY-TYDRVFG  85

Query  147  PNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITE  7
            P+  T  VYEEG K VALS + GIN++IFAYGQTSSGKTYTM GITE
Sbjct  86   PSCSTRQVYEEGAKEVALSVVSGINSSIFAYGQTSSGKTYTMTGITE  132



>ref|XP_004974128.1| PREDICTED: kinesin-like protein NACK1-like isoform X2 [Setaria 
italica]
Length=1044

 Score =   125 bits (315),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 82/107 (77%), Gaps = 3/107 (3%)
 Frame = -1

Query  327  SKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFG  148
            +KE++IMV+VRLRPLN +E  A D+  WECI   +I+++    ER+  PT++ T+D+VFG
Sbjct  29   AKEERIMVSVRLRPLNGRE--AGDSSDWECISPTTIMFRSTVPERAMFPTAY-TYDRVFG  85

Query  147  PNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITE  7
            P+  T  VYEEG K VALS + GIN++IFAYGQTSSGKTYTM GITE
Sbjct  86   PSCSTRQVYEEGAKEVALSVVSGINSSIFAYGQTSSGKTYTMTGITE  132



>ref|XP_010550452.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Tarenaya hassleriana]
 ref|XP_010550453.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Tarenaya hassleriana]
Length=1064

 Score =   125 bits (315),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 82/112 (73%), Gaps = 3/112 (3%)
 Frame = -1

Query  336  GQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPH--ERSPQPTSFFTF  163
            GQ  +E+KI V+VRLRPLN+KE +      WECI++  I+Y+      ERS  P+++ TF
Sbjct  12   GQSGREEKIFVSVRLRPLNEKEIARNGVSDWECINDTMIIYRSHLSISERSMYPSAY-TF  70

Query  162  DKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITE  7
            D+VFGP S T  VYE+G K VALS + G+NA++FAYGQTSSGKTYTM GIT+
Sbjct  71   DRVFGPESSTRQVYEQGAKEVALSVVGGVNASVFAYGQTSSGKTYTMIGITD  122



>emb|CAB62637.1| putative protein [Arabidopsis thaliana]
Length=968

 Score =   125 bits (314),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 83/114 (73%), Gaps = 3/114 (3%)
 Frame = -1

Query  336  GQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPH--ERSPQPTSFFTF  163
            G   +E+KI V+VRLRPLN +E++  D   WECI++ +++Y+      ERS  PT++ TF
Sbjct  10   GSSGREEKIFVSVRLRPLNVRERARNDVADWECINDETVIYRSHLSISERSMYPTAY-TF  68

Query  162  DKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITEKA  1
            D+VFGP   T  VY++G K VALS + G++A++FAYGQTSSGKTYTM GIT+ A
Sbjct  69   DRVFGPECSTREVYDQGAKEVALSVVSGVHASVFAYGQTSSGKTYTMIGITDYA  122



>ref|XP_007203241.1| hypothetical protein PRUPE_ppa001146mg [Prunus persica]
 gb|EMJ04440.1| hypothetical protein PRUPE_ppa001146mg [Prunus persica]
Length=896

 Score =   125 bits (313),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 83/118 (70%), Gaps = 6/118 (5%)
 Frame = -1

Query  354  PASTPGGQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKP--MPHERSPQP  181
            P   PG   S  D+I V+VRLRPL++KE +  D   WECI++ +++Y+      ERS  P
Sbjct  9    PTQEPG---SHGDRIFVSVRLRPLSEKETARNDVSDWECINDSTVIYRNNLSVSERSMYP  65

Query  180  TSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITE  7
            T++ TFD+VFG +  T  VYEEG K VALS + GIN++IFAYGQTSSGKTYTM GITE
Sbjct  66   TAY-TFDRVFGTDCSTMRVYEEGAKKVALSVVSGINSSIFAYGQTSSGKTYTMSGITE  122



>ref|XP_008241798.1| PREDICTED: kinesin-like protein NACK1 [Prunus mume]
Length=960

 Score =   125 bits (313),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 83/118 (70%), Gaps = 6/118 (5%)
 Frame = -1

Query  354  PASTPGGQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKP--MPHERSPQP  181
            P   PG   S  D+I V+VRLRPL++KE +  D   WECI++ +++Y+      ERS  P
Sbjct  9    PMQEPG---SHGDRIFVSVRLRPLSEKETARNDVSDWECINDSTVIYRNNLSVSERSMYP  65

Query  180  TSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITE  7
            T++ TFD+VFG +  T  VYEEG K VALS + GIN++IFAYGQTSSGKTYTM GITE
Sbjct  66   TAY-TFDRVFGTDCSTTRVYEEGAKKVALSVVSGINSSIFAYGQTSSGKTYTMSGITE  122



>ref|XP_009777060.1| PREDICTED: LOW QUALITY PROTEIN: kinesin-like protein NACK1 [Nicotiana 
sylvestris]
Length=889

 Score =   124 bits (312),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 79/111 (71%), Gaps = 1/111 (1%)
 Frame = -1

Query  339  GGQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPHERSPQPTSFFTFD  160
            G   S E+KI+V VRLRPL++KE +  +   WECI+E +I Y+    ERS  PT++ TFD
Sbjct  17   GTALSGEEKILVLVRLRPLSEKEIARNEASDWECINETTIFYRNSFQERSGLPTAY-TFD  75

Query  159  KVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITE  7
            KVF  +  T  VYE G K +ALS + GIN+TIFAYGQTSSGKTYTM GITE
Sbjct  76   KVFRGDCTTREVYEGGTKDIALSVVRGINSTIFAYGQTSSGKTYTMNGITE  126



>ref|XP_008444776.1| PREDICTED: kinesin-like protein NACK1 [Cucumis melo]
Length=948

 Score =   124 bits (312),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 80/105 (76%), Gaps = 1/105 (1%)
 Frame = -1

Query  321  EDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFGPN  142
            E+ I V++RLRPLN+KE    D+  WEC++ +S++++    ERS  P S+ TFD+VFG +
Sbjct  18   EETIRVSIRLRPLNEKELMKNDSSDWECLNSNSVMFRSTLPERSLFPHSY-TFDRVFGID  76

Query  141  SLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITE  7
            S T+ VYEEG K VALS + GIN+TIFAYGQTSSGKT+TM G+T+
Sbjct  77   STTKQVYEEGAKEVALSVVNGINSTIFAYGQTSSGKTFTMNGVTQ  121



>ref|XP_002531511.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF30865.1| conserved hypothetical protein [Ricinus communis]
Length=959

 Score =   124 bits (312),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 80/106 (75%), Gaps = 3/106 (3%)
 Frame = -1

Query  318  DKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKP--MPHERSPQPTSFFTFDKVFGP  145
            +KI+V+VRLRPLN+KE +  D   WECI++++++Y+      ERS  PT++  FD+VF P
Sbjct  14   EKILVSVRLRPLNEKETARNDVSDWECINDNTVIYRNNLSVSERSMYPTAY-AFDRVFRP  72

Query  144  NSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITE  7
            +  T  VYEEG K VALS + GIN+++FAYGQTSSGKTYTM GITE
Sbjct  73   DCTTGQVYEEGAKEVALSVVSGINSSVFAYGQTSSGKTYTMSGITE  118



>gb|EPS66111.1| hypothetical protein M569_08665, partial [Genlisea aurea]
Length=856

 Score =   124 bits (311),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 78/108 (72%), Gaps = 1/108 (1%)
 Frame = -1

Query  324  KEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFGP  145
            +E+KI V +RLRPLN++E S  D   W+CI++ ++V+     ERS  P ++ TFD+VFG 
Sbjct  1    EEEKIFVAIRLRPLNERELSKNDVSEWDCINDTTVVFNNSLQERSLLPAAY-TFDRVFGF  59

Query  144  NSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITEKA  1
             S T  VY E  K +ALSA+ GIN+TIFAYGQTSSGKTYTM G+TE A
Sbjct  60   ESPTRQVYNEAAKKIALSAISGINSTIFAYGQTSSGKTYTMTGVTEYA  107



>emb|CDX73746.1| BnaC08g22570D [Brassica napus]
Length=968

 Score =   124 bits (311),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 83/114 (73%), Gaps = 3/114 (3%)
 Frame = -1

Query  336  GQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPH--ERSPQPTSFFTF  163
            G   +E+KI V+VRLRPL+ +E+   D   WECI++ +++Y+      ERS  PT++ TF
Sbjct  10   GSSGREEKIFVSVRLRPLSVRERVRNDVADWECINDETVIYRSHLSISERSMYPTAY-TF  68

Query  162  DKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITEKA  1
            D+VFGP   T+ VY++G K VALS + G++A++FAYGQTSSGKTYTM GIT+ A
Sbjct  69   DRVFGPECCTKDVYDQGAKEVALSVVSGVHASVFAYGQTSSGKTYTMSGITDYA  122



>ref|XP_011025920.1| PREDICTED: kinesin-like protein NACK2 [Populus euphratica]
Length=998

 Score =   124 bits (312),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 79/107 (74%), Gaps = 3/107 (3%)
 Frame = -1

Query  321  EDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPM--PHERSPQPTSFFTFDKVFG  148
            E+KI+V+VRLRPLN+KE +  D   WECI++ +++Y+      ERS  PT++  FD+VFG
Sbjct  22   EEKILVSVRLRPLNEKEIAKNDVSDWECINDDTVIYRNSLSVSERSMYPTAY-KFDRVFG  80

Query  147  PNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITE  7
            P   T  VY EG K VALS + GIN+++FAYGQTSSGKTYTM GITE
Sbjct  81   PGCSTRQVYGEGAKEVALSVVSGINSSVFAYGQTSSGKTYTMSGITE  127



>ref|XP_008382370.1| PREDICTED: LOW QUALITY PROTEIN: kinesin-like protein NACK1 [Malus 
domestica]
Length=929

 Score =   124 bits (311),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 82/110 (75%), Gaps = 1/110 (1%)
 Frame = -1

Query  336  GQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDK  157
            G  ++E+KI+V VRLRPL++KE +A +   WECI++ +I+Y+    E S  PT++ TFDK
Sbjct  17   GASAREEKILVLVRLRPLSEKEVAANEVADWECINDTTILYRNTLREGSTFPTAY-TFDK  75

Query  156  VFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITE  7
            VF  +  T  VY+EG + +ALS + GIN++IFAYGQTSSGKTYTM GITE
Sbjct  76   VFRGDCSTRQVYDEGAQQIALSVVNGINSSIFAYGQTSSGKTYTMNGITE  125



>ref|XP_009115792.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Brassica rapa]
Length=1008

 Score =   124 bits (311),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 83/114 (73%), Gaps = 3/114 (3%)
 Frame = -1

Query  336  GQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPH--ERSPQPTSFFTF  163
            G   +E+KI V+VRLRPL+ +E+   D   WECI++ +++Y+      ERS  PT++ TF
Sbjct  12   GSSGREEKIFVSVRLRPLSVRERVRNDVADWECINDETVIYRSHLSISERSMYPTAY-TF  70

Query  162  DKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITEKA  1
            D+VFGP   T+ VY++G K VALS + G++A++FAYGQTSSGKTYTM GIT+ A
Sbjct  71   DRVFGPECCTKDVYDQGAKDVALSVVSGVHASVFAYGQTSSGKTYTMSGITDYA  124



>ref|XP_009124539.1| PREDICTED: kinesin-like protein NACK1, partial [Brassica rapa]
Length=139

 Score =   115 bits (289),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 76/107 (71%), Gaps = 3/107 (3%)
 Frame = -1

Query  321  EDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPH--ERSPQPTSFFTFDKVFG  148
            E+KI V+VRLRPLN KE    ++  WECI+  +I+Y+      +RS  P+++ +FD+VFG
Sbjct  22   EEKISVSVRLRPLNDKEMLRNNSPDWECINSTTIMYRSHLSISDRSMYPSAY-SFDRVFG  80

Query  147  PNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITE  7
            P   T  VY++G K VA S + G+NA++FAYGQTSSGKTYTM GIT 
Sbjct  81   PECCTRQVYDQGAKEVAFSVVSGVNASVFAYGQTSSGKTYTMSGITH  127



>ref|XP_009378441.1| PREDICTED: kinesin-like protein NACK1 [Pyrus x bretschneideri]
 ref|XP_009378442.1| PREDICTED: kinesin-like protein NACK1 [Pyrus x bretschneideri]
 ref|XP_009378443.1| PREDICTED: kinesin-like protein NACK1 [Pyrus x bretschneideri]
 ref|XP_009378444.1| PREDICTED: kinesin-like protein NACK1 [Pyrus x bretschneideri]
Length=928

 Score =   124 bits (311),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 82/110 (75%), Gaps = 1/110 (1%)
 Frame = -1

Query  336  GQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDK  157
            G  ++E+KI+V VRLRPL++KE +A +   WECI++ +I+Y+    E S  PT++ TFDK
Sbjct  17   GASAREEKILVLVRLRPLSEKEVAANEVADWECINDTTILYRNTLREGSTFPTAY-TFDK  75

Query  156  VFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITE  7
            VF  +  T  VY+EG + +ALS + GIN++IFAYGQTSSGKTYTM GITE
Sbjct  76   VFRGDCSTRQVYDEGAQQIALSVVNGINSSIFAYGQTSSGKTYTMNGITE  125



>ref|XP_007135918.1| hypothetical protein PHAVU_009G003000g [Phaseolus vulgaris]
 ref|XP_007135919.1| hypothetical protein PHAVU_009G003000g [Phaseolus vulgaris]
 gb|ESW07912.1| hypothetical protein PHAVU_009G003000g [Phaseolus vulgaris]
 gb|ESW07913.1| hypothetical protein PHAVU_009G003000g [Phaseolus vulgaris]
Length=888

 Score =   124 bits (311),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 81/113 (72%), Gaps = 1/113 (1%)
 Frame = -1

Query  339  GGQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPHERSPQPTSFFTFD  160
            GG    E+KI+V VRLRPLN+KE    +   WECI++ +I+Y+    E S  P+++ TFD
Sbjct  16   GGVGGHEEKILVLVRLRPLNEKEVEVNEVADWECINDTTILYRNTLREGSTFPSAY-TFD  74

Query  159  KVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITEKA  1
            +VF  +  T+ VYEEG K +ALS + GIN++IFAYGQTSSGKTYTM GITE A
Sbjct  75   RVFRGDCSTKQVYEEGAKAIALSVVGGINSSIFAYGQTSSGKTYTMIGITEYA  127



>gb|EYU40392.1| hypothetical protein MIMGU_mgv1a001117mg [Erythranthe guttata]
Length=884

 Score =   124 bits (311),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 80/105 (76%), Gaps = 1/105 (1%)
 Frame = -1

Query  321  EDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFGPN  142
            E+KI+V VRLRPL++KE +  +   WECI+  +I+Y+    ERS  PT++ +FD+VF  +
Sbjct  23   EEKILVLVRLRPLSEKEIARNEVADWECINSTTILYRNSLQERSGLPTAY-SFDRVFRGD  81

Query  141  SLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITE  7
            S T  VY+EG+K +ALS + G+N+T+FAYGQTSSGKTYTM GITE
Sbjct  82   SQTREVYDEGIKEIALSVVDGVNSTVFAYGQTSSGKTYTMNGITE  126



>emb|CDX77978.1| BnaA09g31730D [Brassica napus]
Length=987

 Score =   124 bits (311),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 83/114 (73%), Gaps = 3/114 (3%)
 Frame = -1

Query  336  GQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPH--ERSPQPTSFFTF  163
            G   +E+KI V+VRLRPL+ +E+   D   WECI++ +++Y+      ERS  PT++ TF
Sbjct  10   GSSGREEKIFVSVRLRPLSVRERVRNDVADWECINDETVIYRSHLSISERSMYPTAY-TF  68

Query  162  DKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITEKA  1
            D+VFGP   T+ VY++G K VALS + G++A++FAYGQTSSGKTYTM GIT+ A
Sbjct  69   DRVFGPECCTKDVYDQGAKEVALSVVSGVHASVFAYGQTSSGKTYTMSGITDYA  122



>ref|XP_009345268.1| PREDICTED: kinesin-like protein NACK1 [Pyrus x bretschneideri]
 ref|XP_009345269.1| PREDICTED: kinesin-like protein NACK1 [Pyrus x bretschneideri]
 ref|XP_009345270.1| PREDICTED: kinesin-like protein NACK1 [Pyrus x bretschneideri]
Length=928

 Score =   124 bits (310),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 82/110 (75%), Gaps = 1/110 (1%)
 Frame = -1

Query  336  GQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDK  157
            G  ++E+KI+V VRLRPL++KE +A +   WECI++ +I+Y+    E S  PT++ TFDK
Sbjct  17   GATAREEKILVLVRLRPLSEKEVAASEVADWECINDTTILYRNTLREGSTFPTAY-TFDK  75

Query  156  VFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITE  7
            VF  +  T  VY+EG + +ALS + GIN++IFAYGQTSSGKTYTM GITE
Sbjct  76   VFRGDCSTRQVYDEGAQQIALSVVNGINSSIFAYGQTSSGKTYTMNGITE  125



>ref|XP_009101918.1| PREDICTED: kinesin-like protein NACK1 [Brassica rapa]
Length=763

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 81/109 (74%), Gaps = 1/109 (1%)
 Frame = -1

Query  327  SKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFG  148
            ++E+K++V VRLRPLNKKE +A +   WECI++ +I+Y+    + S  P+++ +FD+V+G
Sbjct  9    NREEKVLVLVRLRPLNKKEIAANEATDWECINDTTILYRNTLRQGSNIPSTY-SFDRVYG  67

Query  147  PNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITEKA  1
                T  VYE+G K +ALS + GIN +IFAYGQTSSGKTYTM GITE A
Sbjct  68   GECPTRQVYEDGAKEIALSVVKGINCSIFAYGQTSSGKTYTMTGITEFA  116



>ref|XP_006435104.1| hypothetical protein CICLE_v10000097mg [Citrus clementina]
 gb|ESR48344.1| hypothetical protein CICLE_v10000097mg [Citrus clementina]
Length=1104

 Score =   124 bits (310),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 77/108 (71%), Gaps = 1/108 (1%)
 Frame = -1

Query  324  KEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFGP  145
            +E++I+V VRLRPLN+KE +  D   WECI+ +SIV+K    ERS  P ++ TFD+VFG 
Sbjct  20   QEERILVFVRLRPLNEKEYARNDVSDWECINNNSIVFKNSLLERSVYPPAY-TFDRVFGC  78

Query  144  NSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITEKA  1
               T  VYEE  K V LS + GIN+T FAYGQTSSGKTYTM GITE A
Sbjct  79   ECPTRQVYEEAAKEVTLSVVNGINSTFFAYGQTSSGKTYTMGGITENA  126



>ref|XP_008236841.1| PREDICTED: kinesin-like protein NACK2 [Prunus mume]
 ref|XP_008236842.1| PREDICTED: kinesin-like protein NACK2 [Prunus mume]
Length=926

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 82/110 (75%), Gaps = 1/110 (1%)
 Frame = -1

Query  336  GQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDK  157
            G  ++E+KI+V VRLRPL++KE ++ +   WECI++ SI+Y+    E S  PT++ TFD+
Sbjct  17   GAGAREEKILVLVRLRPLSEKEVASNEVADWECINDTSILYRNTLREGSTFPTAY-TFDR  75

Query  156  VFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITE  7
            VF  +  T  VYEEG + +ALS + GIN++IFAYGQTSSGKTYTM GITE
Sbjct  76   VFRGDCSTRQVYEEGAQQIALSVVNGINSSIFAYGQTSSGKTYTMDGITE  125



>gb|EMT22069.1| Kinesin-related protein 4 [Aegilops tauschii]
Length=1013

 Score =   124 bits (310),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 82/107 (77%), Gaps = 3/107 (3%)
 Frame = -1

Query  327  SKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFG  148
            +KE++IMV+VR+RPLN +E  + D+  WECI   +++++    +R+  PT++ T+D+VFG
Sbjct  17   AKEERIMVSVRMRPLNGRE--SGDSSDWECISPTTVMFRSTVPDRAMFPTAY-TYDRVFG  73

Query  147  PNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITE  7
            PN  T  VYEEG K VALS + GIN++IFAYGQTSSGKTYTM GITE
Sbjct  74   PNCSTRQVYEEGAKEVALSVVNGINSSIFAYGQTSSGKTYTMTGITE  120



>gb|KDP27640.1| hypothetical protein JCGZ_19645 [Jatropha curcas]
Length=965

 Score =   124 bits (310),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 80/109 (73%), Gaps = 1/109 (1%)
 Frame = -1

Query  327  SKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFG  148
            S+E+KI+V VRLRPLN+KE    +   WECI++ +I+Y+    E S  P+++ +FD+VF 
Sbjct  20   SREEKILVLVRLRPLNEKEIVTNEVADWECINDTTILYRNTLREGSTFPSAY-SFDRVFR  78

Query  147  PNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITEKA  1
             +  T  VYEEG K VALS + GIN++IFAYGQTSSGKTYTM GITE A
Sbjct  79   GDCSTRQVYEEGAKEVALSVVSGINSSIFAYGQTSSGKTYTMMGITEYA  127



>ref|XP_006380794.1| hypothetical protein POPTR_0007s13860g [Populus trichocarpa]
 ref|XP_006380795.1| hypothetical protein POPTR_0007s13860g [Populus trichocarpa]
 ref|XP_006380796.1| hypothetical protein POPTR_0007s13860g [Populus trichocarpa]
 gb|ERP58591.1| hypothetical protein POPTR_0007s13860g [Populus trichocarpa]
 gb|ERP58592.1| hypothetical protein POPTR_0007s13860g [Populus trichocarpa]
 gb|ERP58593.1| hypothetical protein POPTR_0007s13860g [Populus trichocarpa]
Length=998

 Score =   123 bits (309),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 78/107 (73%), Gaps = 3/107 (3%)
 Frame = -1

Query  321  EDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPM--PHERSPQPTSFFTFDKVFG  148
            E+KI+V+VRLRPLN+KE    D   WECI++ +++Y+      ERS  PT++  FD+VFG
Sbjct  22   EEKILVSVRLRPLNEKEIGKNDVSDWECINDDTVIYRNSLSVSERSMYPTAY-KFDRVFG  80

Query  147  PNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITE  7
            P   T  VY EG K VALS + GIN+++FAYGQTSSGKTYTM GITE
Sbjct  81   PGCSTRQVYGEGAKEVALSVVSGINSSVFAYGQTSSGKTYTMSGITE  127



>ref|XP_006279726.1| hypothetical protein CARUB_v10027496mg [Capsella rubella]
 gb|EOA12624.1| hypothetical protein CARUB_v10027496mg [Capsella rubella]
Length=1054

 Score =   123 bits (309),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 80/108 (74%), Gaps = 1/108 (1%)
 Frame = -1

Query  324  KEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFGP  145
            K +KI+V+VR+RP N+KE++  D   WEC++  +I+      ERS  P+++ TFDKVFG 
Sbjct  6    KGEKILVSVRVRPQNEKEKARNDICDWECVNNTTIICNSNLPERSLFPSTY-TFDKVFGF  64

Query  144  NSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITEKA  1
            NS T+ VYE+G K VAL  L GIN++IFAYGQTSSGKTYTM GITE A
Sbjct  65   NSATKQVYEDGAKEVALCVLDGINSSIFAYGQTSSGKTYTMSGITEFA  112



>ref|XP_010515505.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Camelina sativa]
Length=1032

 Score =   123 bits (309),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 82/114 (72%), Gaps = 3/114 (3%)
 Frame = -1

Query  336  GQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPH--ERSPQPTSFFTF  163
            G   +E+KI V+VRLRPL+ KE+   D   WECI++ +++Y+      ERS  PT++ TF
Sbjct  10   GPSGREEKIFVSVRLRPLSVKERVRNDVADWECINDETVLYRSHLSISERSMYPTAY-TF  68

Query  162  DKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITEKA  1
            D+VFGP   T  VY++G K VALS + G++A++FAYGQTSSGKTYTM GIT+ A
Sbjct  69   DRVFGPECCTREVYDQGAKEVALSVVNGVHASVFAYGQTSSGKTYTMSGITDYA  122



>ref|XP_011083601.1| PREDICTED: kinesin-like protein NACK1 [Sesamum indicum]
 ref|XP_011083602.1| PREDICTED: kinesin-like protein NACK1 [Sesamum indicum]
Length=913

 Score =   123 bits (308),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 79/112 (71%), Gaps = 3/112 (3%)
 Frame = -1

Query  336  GQRS--KEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPHERSPQPTSFFTF  163
            GQ S  +E+KI V VR+RPLN++E    D   WECI+  +IV+K    ERS  PT+  TF
Sbjct  17   GQDSSAQEEKIFVAVRVRPLNERELGKNDVSDWECINSTTIVFKNSLAERSLVPTAH-TF  75

Query  162  DKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITE  7
            D+VFG  + T  VYEE  K +ALS L G+N+TIFAYGQTSSGKTYTM GITE
Sbjct  76   DRVFGTEASTGQVYEEAAKKIALSVLSGMNSTIFAYGQTSSGKTYTMTGITE  127



>ref|XP_010271468.1| PREDICTED: kinesin-like protein NACK2 [Nelumbo nucifera]
Length=976

 Score =   123 bits (308),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 82/107 (77%), Gaps = 1/107 (1%)
 Frame = -1

Query  327  SKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFG  148
            ++E+KI V+VRLRPLN KE +  +   WECI++++I+++    ERS  PT++ TFD+VF 
Sbjct  20   TREEKIFVSVRLRPLNAKEIARNEVSDWECINDNTIIFRNSLPERSMYPTAY-TFDRVFR  78

Query  147  PNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITE  7
             +  T+ VYEEG K VALS + GIN++IFAYGQTSSGKT+TM GITE
Sbjct  79   CDCSTKQVYEEGAKEVALSVVSGINSSIFAYGQTSSGKTHTMSGITE  125



>ref|XP_006473602.1| PREDICTED: kinesin-like protein NACK1-like isoform X3 [Citrus 
sinensis]
Length=1100

 Score =   123 bits (309),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 77/108 (71%), Gaps = 1/108 (1%)
 Frame = -1

Query  324  KEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFGP  145
            +E++I+V VRLRPLN+KE +  D   WECI+ +SIV+K    ERS  P ++ TFD+VFG 
Sbjct  20   QEERILVFVRLRPLNEKEYARNDVSDWECINNNSIVFKNSLLERSVYPPAY-TFDRVFGC  78

Query  144  NSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITEKA  1
               T  VYEE  K V LS + GIN+T FAYGQTSSGKTYTM GITE A
Sbjct  79   ECPTRQVYEEAAKEVTLSVVNGINSTFFAYGQTSSGKTYTMGGITEYA  126



>ref|XP_010649060.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010649061.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010649062.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010649063.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010649064.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010649065.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010649066.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010649067.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010649068.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010649069.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 emb|CBI17403.3| unnamed protein product [Vitis vinifera]
Length=973

 Score =   123 bits (308),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 83/107 (78%), Gaps = 5/107 (5%)
 Frame = -1

Query  318  DKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYK---PMPHERSPQPTSFFTFDKVFG  148
            ++++V+VRLRPLN+KE S  D + WECI++ +I++K   P+P ERS  P+++ TFD+VF 
Sbjct  18   ERVVVSVRLRPLNEKEISRNDALDWECINDTTIIFKNHLPIP-ERSMYPSAY-TFDRVFR  75

Query  147  PNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITE  7
             +S T  VYE G K VALS + GIN++IFAYGQTSSGKT+TM GITE
Sbjct  76   SDSTTREVYEAGAKEVALSVVSGINSSIFAYGQTSSGKTFTMSGITE  122



>gb|KDO84748.1| hypothetical protein CISIN_1g001290mg [Citrus sinensis]
Length=1104

 Score =   123 bits (308),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 77/108 (71%), Gaps = 1/108 (1%)
 Frame = -1

Query  324  KEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFGP  145
            +E++I+V VRLRPLN+KE +  D   WECI+ +SIV+K    ERS  P ++ TFD+VFG 
Sbjct  20   QEERILVFVRLRPLNEKEYARNDVSDWECINNNSIVFKNSLLERSVYPPAY-TFDRVFGC  78

Query  144  NSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITEKA  1
               T  VYEE  K V LS + GIN+T FAYGQTSSGKTYTM GITE A
Sbjct  79   ECPTRQVYEEAAKEVTLSVVNGINSTFFAYGQTSSGKTYTMGGITEYA  126



>ref|XP_006473601.1| PREDICTED: kinesin-like protein NACK1-like isoform X2 [Citrus 
sinensis]
Length=1112

 Score =   123 bits (308),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 77/108 (71%), Gaps = 1/108 (1%)
 Frame = -1

Query  324  KEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFGP  145
            +E++I+V VRLRPLN+KE +  D   WECI+ +SIV+K    ERS  P ++ TFD+VFG 
Sbjct  20   QEERILVFVRLRPLNEKEYARNDVSDWECINNNSIVFKNSLLERSVYPPAY-TFDRVFGC  78

Query  144  NSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITEKA  1
               T  VYEE  K V LS + GIN+T FAYGQTSSGKTYTM GITE A
Sbjct  79   ECPTRQVYEEAAKEVTLSVVNGINSTFFAYGQTSSGKTYTMGGITEYA  126



>ref|XP_006473600.1| PREDICTED: kinesin-like protein NACK1-like isoform X1 [Citrus 
sinensis]
Length=1114

 Score =   123 bits (308),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 77/108 (71%), Gaps = 1/108 (1%)
 Frame = -1

Query  324  KEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFGP  145
            +E++I+V VRLRPLN+KE +  D   WECI+ +SIV+K    ERS  P ++ TFD+VFG 
Sbjct  20   QEERILVFVRLRPLNEKEYARNDVSDWECINNNSIVFKNSLLERSVYPPAY-TFDRVFGC  78

Query  144  NSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITEKA  1
               T  VYEE  K V LS + GIN+T FAYGQTSSGKTYTM GITE A
Sbjct  79   ECPTRQVYEEAAKEVTLSVVNGINSTFFAYGQTSSGKTYTMGGITEYA  126



>gb|KDO84747.1| hypothetical protein CISIN_1g001290mg [Citrus sinensis]
Length=1106

 Score =   123 bits (308),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 77/108 (71%), Gaps = 1/108 (1%)
 Frame = -1

Query  324  KEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFGP  145
            +E++I+V VRLRPLN+KE +  D   WECI+ +SIV+K    ERS  P ++ TFD+VFG 
Sbjct  20   QEERILVFVRLRPLNEKEYARNDVSDWECINNNSIVFKNSLLERSVYPPAY-TFDRVFGC  78

Query  144  NSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITEKA  1
               T  VYEE  K V LS + GIN+T FAYGQTSSGKTYTM GITE A
Sbjct  79   ECPTRQVYEEAAKEVTLSVVNGINSTFFAYGQTSSGKTYTMGGITEYA  126



>ref|XP_002512997.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF49500.1| ATP binding protein, putative [Ricinus communis]
Length=842

 Score =   122 bits (307),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 80/107 (75%), Gaps = 1/107 (1%)
 Frame = -1

Query  327  SKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFG  148
            ++E+KI+V VRLRPLN KE  A +   WEC+++ +I+Y+    E S  P+++ TFD+VF 
Sbjct  20   AREEKILVLVRLRPLNDKEIVADEVADWECLNDTTILYRNTLREGSTFPSAY-TFDRVFR  78

Query  147  PNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITE  7
             +S T  VY+EG K VALS + GIN++IFAYGQTSSGKTYTM GITE
Sbjct  79   GDSSTRQVYDEGAKEVALSVVSGINSSIFAYGQTSSGKTYTMIGITE  125



>ref|XP_008791672.1| PREDICTED: kinesin-like protein NACK1 isoform X2 [Phoenix dactylifera]
Length=867

 Score =   122 bits (307),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 81/106 (76%), Gaps = 1/106 (1%)
 Frame = -1

Query  324  KEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFGP  145
            K ++I+V+VRLRPL++KE + KD   WECI++ +I+++    ER+  PT++ TFD+VF  
Sbjct  36   KVERILVSVRLRPLSEKEIARKDPCDWECINDTTIIFRSSVPERAMFPTAY-TFDRVFWC  94

Query  144  NSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITE  7
            +  T  VYE+G K VALS + GIN++IFAYGQTSSGKTYTM GITE
Sbjct  95   DCATRQVYEDGAKEVALSVVSGINSSIFAYGQTSSGKTYTMSGITE  140



>ref|XP_010426656.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Camelina sativa]
 ref|XP_010426657.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Camelina sativa]
 ref|XP_010426658.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Camelina sativa]
 ref|XP_010426659.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Camelina sativa]
Length=1040

 Score =   123 bits (308),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 82/114 (72%), Gaps = 3/114 (3%)
 Frame = -1

Query  336  GQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPH--ERSPQPTSFFTF  163
            G   +E+KI V+VRLRPL+ KE+   D   WECI++ +++Y+      ERS  PT++ TF
Sbjct  10   GPSGREEKIFVSVRLRPLSVKERVRNDVADWECINDETVLYRSHLSISERSMYPTAY-TF  68

Query  162  DKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITEKA  1
            D+VFGP   T  VY++G K VALS + G++A++FAYGQTSSGKTYTM GIT+ A
Sbjct  69   DRVFGPECCTREVYDQGAKEVALSVVNGVHASVFAYGQTSSGKTYTMTGITDYA  122



>ref|XP_008791670.1| PREDICTED: kinesin-like protein NACK2 isoform X1 [Phoenix dactylifera]
 ref|XP_008791671.1| PREDICTED: kinesin-like protein NACK2 isoform X1 [Phoenix dactylifera]
Length=975

 Score =   122 bits (307),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 81/106 (76%), Gaps = 1/106 (1%)
 Frame = -1

Query  324  KEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFGP  145
            K ++I+V+VRLRPL++KE + KD   WECI++ +I+++    ER+  PT++ TFD+VF  
Sbjct  36   KVERILVSVRLRPLSEKEIARKDPCDWECINDTTIIFRSSVPERAMFPTAY-TFDRVFWC  94

Query  144  NSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITE  7
            +  T  VYE+G K VALS + GIN++IFAYGQTSSGKTYTM GITE
Sbjct  95   DCATRQVYEDGAKEVALSVVSGINSSIFAYGQTSSGKTYTMSGITE  140



>ref|XP_009617690.1| PREDICTED: kinesin-like protein NACK2 [Nicotiana tomentosiformis]
 ref|XP_009617691.1| PREDICTED: kinesin-like protein NACK2 [Nicotiana tomentosiformis]
Length=928

 Score =   122 bits (306),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 83/121 (69%), Gaps = 5/121 (4%)
 Frame = -1

Query  369  KIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPHERS  190
            K E+   +  GG    E+KI+V VRLRPL++KE    +   WECI+E +I+Y+    ERS
Sbjct  11   KWEKMQGAALGG----EEKILVLVRLRPLSEKEIVRSEVSDWECINETTILYRNSLQERS  66

Query  189  PQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGIT  10
              PT++ TFD+V+  +  T  VYE G K +ALS + GIN+TIFAYGQTSSGKTYTM GIT
Sbjct  67   GLPTAY-TFDRVYRGDCSTREVYEGGTKDIALSVVSGINSTIFAYGQTSSGKTYTMNGIT  125

Query  9    E  7
            E
Sbjct  126  E  126



>gb|AAK50070.1|AF372930_1 AT5g66310/K1L20_9 [Arabidopsis thaliana]
Length=425

 Score =   119 bits (299),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 77/109 (71%), Gaps = 3/109 (3%)
 Frame = -1

Query  321  EDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPH--ERSPQPTSFFTFDKVFG  148
            ++KI V+VR+RPLN KE+   D   WECI+  +I+Y+      ERS  P+++ TFD+VF 
Sbjct  16   QEKIYVSVRMRPLNDKEKFRNDVPDWECINNTTIIYRSHLSISERSMYPSAY-TFDRVFS  74

Query  147  PNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITEKA  1
            P   T  VYE+G K VA S + G+NA++FAYGQTSSGKTYTM GIT+ A
Sbjct  75   PECCTRQVYEQGAKEVAFSVVSGVNASVFAYGQTSSGKTYTMSGITDCA  123



>gb|EPS64209.1| hypothetical protein M569_10571, partial [Genlisea aurea]
Length=466

 Score =   119 bits (299),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 77/108 (71%), Gaps = 4/108 (4%)
 Frame = -1

Query  315  KIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPM---PHERSPQPTSFFTFDKVFGP  145
            KI V+VRLRPLN KE    D   WECID++++V++ +     +RS  PT  +TFD+VF  
Sbjct  1    KIFVSVRLRPLNVKEIYRNDVSDWECIDDNTVVFRNVCLSASDRSMYPT-VYTFDRVFKS  59

Query  144  NSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITEKA  1
            +  T  VYE+G K VA+S L GIN+T+FAYGQT+SGKTYTM G+TE A
Sbjct  60   DCSTREVYEKGAKEVAISVLQGINSTVFAYGQTNSGKTYTMTGVTEFA  107



>ref|XP_009760421.1| PREDICTED: kinesin-like protein NACK2 [Nicotiana sylvestris]
 ref|XP_009760422.1| PREDICTED: kinesin-like protein NACK2 [Nicotiana sylvestris]
 ref|XP_009760423.1| PREDICTED: kinesin-like protein NACK2 [Nicotiana sylvestris]
Length=929

 Score =   122 bits (306),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 83/121 (69%), Gaps = 5/121 (4%)
 Frame = -1

Query  369  KIERTPASTPGGQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPHERS  190
            K E+   +  GG    E+KI+V VRLRPL++KE    +   WECI+E +I+Y+    ERS
Sbjct  11   KWEKMQGAALGG----EEKILVLVRLRPLSEKEIVRSEVSDWECINETTILYRNSLQERS  66

Query  189  PQPTSFFTFDKVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGIT  10
              PT++ TFD+V+  +  T  VYE G K +ALS + GIN+TIFAYGQTSSGKTYTM GIT
Sbjct  67   GLPTAY-TFDRVYRGDCSTREVYEGGTKDIALSVVSGINSTIFAYGQTSSGKTYTMNGIT  125

Query  9    E  7
            E
Sbjct  126  E  126



>gb|EMS48622.1| Kinesin-related protein 4 [Triticum urartu]
Length=1238

 Score =   122 bits (307),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 82/107 (77%), Gaps = 3/107 (3%)
 Frame = -1

Query  327  SKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFG  148
            +KE++IMV+VR+RPLN +E  + D+  WECI   +++++    +R+  PT++ T+D+VFG
Sbjct  273  AKEERIMVSVRVRPLNGRE--SGDSSDWECISPTTVMFRSTVPDRAMFPTAY-TYDRVFG  329

Query  147  PNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITE  7
            PN  T  VYEEG K VALS + GIN++IFAYGQTSSGKTYTM GITE
Sbjct  330  PNCSTRQVYEEGAKEVALSVVSGINSSIFAYGQTSSGKTYTMTGITE  376



>ref|XP_007201806.1| hypothetical protein PRUPE_ppa001038mg [Prunus persica]
 gb|EMJ03005.1| hypothetical protein PRUPE_ppa001038mg [Prunus persica]
Length=926

 Score =   122 bits (306),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 82/110 (75%), Gaps = 1/110 (1%)
 Frame = -1

Query  336  GQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDK  157
            G  ++E+KI+V VRLRPL++KE ++ +   WECI++ +I+Y+    E S  PT++ TFD+
Sbjct  17   GAGAREEKILVLVRLRPLSEKEVASNEVADWECINDTTILYRNTLREGSTFPTAY-TFDR  75

Query  156  VFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITE  7
            VF  +  T  VYEEG + +ALS + GIN++IFAYGQTSSGKTYTM GITE
Sbjct  76   VFRGDCSTRQVYEEGAQQIALSVVNGINSSIFAYGQTSSGKTYTMDGITE  125



>ref|XP_011047311.1| PREDICTED: kinesin-like protein NACK2 isoform X1 [Populus euphratica]
 ref|XP_011047320.1| PREDICTED: kinesin-like protein NACK2 isoform X1 [Populus euphratica]
 ref|XP_011047328.1| PREDICTED: kinesin-like protein NACK2 isoform X1 [Populus euphratica]
Length=983

 Score =   122 bits (306),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 80/107 (75%), Gaps = 1/107 (1%)
 Frame = -1

Query  327  SKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFG  148
            ++E+KI+V VRLRPL+ KE  A +   WECI++ +I+Y+    E S  P+++ TFD+VF 
Sbjct  20   AREEKILVLVRLRPLSDKEILANEVADWECINDTTILYRNTLREGSTFPSAY-TFDRVFR  78

Query  147  PNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITE  7
             ++ T  VYEEGVK  ALS + GIN++IFAYGQTSSGKTYTM GITE
Sbjct  79   GDNATREVYEEGVKEAALSVVSGINSSIFAYGQTSSGKTYTMMGITE  125



>ref|XP_003527612.1| PREDICTED: kinesin-like protein NACK1-like isoform X1 [Glycine 
max]
 ref|XP_006581109.1| PREDICTED: kinesin-like protein NACK1-like isoform X2 [Glycine 
max]
Length=880

 Score =   122 bits (306),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 80/113 (71%), Gaps = 1/113 (1%)
 Frame = -1

Query  339  GGQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPHERSPQPTSFFTFD  160
            GG    E+KI+V VRLRPL++KE    +   WECI++ +I+Y+    E S  P+++ TFD
Sbjct  16   GGVGGHEEKILVLVRLRPLSEKEIDVNEAADWECINDTTILYRNTLREGSSFPSAY-TFD  74

Query  159  KVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITEKA  1
            +VF  +  T+ VYEEG K +ALS + GIN+ IFAYGQTSSGKTYTM GITE A
Sbjct  75   RVFRGDCSTKQVYEEGAKEIALSVVGGINSCIFAYGQTSSGKTYTMIGITEYA  127



>ref|XP_011047336.1| PREDICTED: kinesin-like protein NACK2 isoform X2 [Populus euphratica]
Length=976

 Score =   122 bits (306),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 80/107 (75%), Gaps = 1/107 (1%)
 Frame = -1

Query  327  SKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFG  148
            ++E+KI+V VRLRPL+ KE  A +   WECI++ +I+Y+    E S  P+++ TFD+VF 
Sbjct  20   AREEKILVLVRLRPLSDKEILANEVADWECINDTTILYRNTLREGSTFPSAY-TFDRVFR  78

Query  147  PNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITE  7
             ++ T  VYEEGVK  ALS + GIN++IFAYGQTSSGKTYTM GITE
Sbjct  79   GDNATREVYEEGVKEAALSVVSGINSSIFAYGQTSSGKTYTMMGITE  125



>gb|KHN20030.1| Kinesin-related protein 4 [Glycine soja]
Length=887

 Score =   122 bits (305),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 80/113 (71%), Gaps = 1/113 (1%)
 Frame = -1

Query  339  GGQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPHERSPQPTSFFTFD  160
            GG    E+KI+V VRLRPL++KE    +   WECI++ +I+Y+    E S  P+++ TFD
Sbjct  16   GGVGGHEEKILVLVRLRPLSEKEIDVNEAADWECINDTTILYRNTLREGSSFPSAY-TFD  74

Query  159  KVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITEKA  1
            +VF  +  T+ VYEEG K +ALS + GIN+ IFAYGQTSSGKTYTM GITE A
Sbjct  75   RVFRGDCSTKQVYEEGAKEIALSVVGGINSCIFAYGQTSSGKTYTMIGITEYA  127



>gb|KDO49885.1| hypothetical protein CISIN_1g002139mg [Citrus sinensis]
Length=758

 Score =   121 bits (304),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 81/107 (76%), Gaps = 1/107 (1%)
 Frame = -1

Query  327  SKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFG  148
            ++E+KI+V VRLRPL++KE +A +   WECI++ +I+Y+    E S  P+++ TFD+VF 
Sbjct  20   AREEKILVLVRLRPLSEKEITADEATDWECINDTTILYRNTLREGSTFPSAY-TFDRVFW  78

Query  147  PNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITE  7
             +  T  VYE+G K +ALS + GIN++IFAYGQTSSGKTYTM GITE
Sbjct  79   GDCSTTQVYEDGAKEIALSVVSGINSSIFAYGQTSSGKTYTMTGITE  125



>ref|XP_010465682.1| PREDICTED: kinesin-like protein NACK1 [Camelina sativa]
Length=1039

 Score =   122 bits (305),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 81/109 (74%), Gaps = 3/109 (3%)
 Frame = -1

Query  321  EDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPH--ERSPQPTSFFTFDKVFG  148
            E+KI V+VR+RPLN KE+   D   W+CI++ +I+Y+      +RS  P+++ TFD+VFG
Sbjct  16   EEKIYVSVRMRPLNDKERLRNDVPDWDCINDTTIIYRSHLSISDRSMYPSAY-TFDRVFG  74

Query  147  PNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITEKA  1
            P+S T  VY++G K VA S + G+NA++FAYGQTSSGKTYTM GIT+ A
Sbjct  75   PDSCTRQVYDQGAKEVAFSVVTGVNASVFAYGQTSSGKTYTMSGITDCA  123



>ref|XP_010484662.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Camelina sativa]
Length=1040

 Score =   122 bits (305),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 81/109 (74%), Gaps = 3/109 (3%)
 Frame = -1

Query  321  EDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPH--ERSPQPTSFFTFDKVFG  148
            E+KI V+VR+RPLN KE+   D   W+CI++ +I+Y+      +RS  P+++ TFD+VFG
Sbjct  16   EEKIYVSVRMRPLNDKERLRNDVPDWDCINDTTIIYRSHLSISDRSMYPSAY-TFDRVFG  74

Query  147  PNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITEKA  1
            P+S T  VY++G K VA S + G+NA++FAYGQTSSGKTYTM GIT+ A
Sbjct  75   PDSCTRQVYDQGAKEVAFSVVTGVNASVFAYGQTSSGKTYTMSGITDCA  123



>ref|XP_006854867.1| hypothetical protein AMTR_s00182p00038530 [Amborella trichopoda]
 gb|ERN16334.1| hypothetical protein AMTR_s00182p00038530 [Amborella trichopoda]
Length=969

 Score =   122 bits (305),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 79/111 (71%), Gaps = 6/111 (5%)
 Frame = -1

Query  339  GGQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPHERSPQPTSFFTFD  160
            GG+R     I+V++RLRPLN KE +  D   WECI++ +I+++    ERS  P ++ TFD
Sbjct  20   GGER-----ILVSIRLRPLNAKEIARNDTTDWECINDTTIIFRNSVPERSMAPVAY-TFD  73

Query  159  KVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITE  7
            +VF  +  T  VYE+  K VALSA+ GIN+TIFAYGQTSSGKTYTM GITE
Sbjct  74   RVFRSDCSTRQVYEDAAKQVALSAVSGINSTIFAYGQTSSGKTYTMIGITE  124



>gb|KHN33713.1| Centromere-associated protein E [Glycine soja]
Length=899

 Score =   121 bits (304),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 81/113 (72%), Gaps = 1/113 (1%)
 Frame = -1

Query  339  GGQRSKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPHERSPQPTSFFTFD  160
            GG    E+KI+V VRLRPL++KE    +   WECI++ +I+Y+    E S  P+++ TFD
Sbjct  16   GGVGGHEEKILVLVRLRPLSEKEIDVNETGDWECINDTTILYRNTLREGSTFPSAY-TFD  74

Query  159  KVFGPNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITEKA  1
            +VF  +  T+ VYEEG K +ALS + GIN++IFAYGQTSSGKTYTM GITE A
Sbjct  75   RVFRGDCSTKQVYEEGAKDIALSVVGGINSSIFAYGQTSSGKTYTMIGITEYA  127



>ref|XP_010444813.1| PREDICTED: kinesin-like protein NACK2 [Camelina sativa]
Length=1040

 Score =   122 bits (305),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 81/109 (74%), Gaps = 3/109 (3%)
 Frame = -1

Query  321  EDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPH--ERSPQPTSFFTFDKVFG  148
            E+KI V+VR+RPLN KE+   D   W+CI++ +I+Y+      +RS  P+++ TFD+VFG
Sbjct  16   EEKIYVSVRMRPLNDKERLRNDVPDWDCINDTTIIYRSHLSISDRSMYPSAY-TFDRVFG  74

Query  147  PNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITEKA  1
            P+S T  VY++G K VA S + G+NA++FAYGQTSSGKTYTM GIT+ A
Sbjct  75   PDSCTRQVYDQGAKEVAFSVVTGVNASVFAYGQTSSGKTYTMSGITDCA  123



>ref|XP_004167109.1| PREDICTED: uncharacterized LOC101212680 [Cucumis sativus]
Length=956

 Score =   121 bits (304),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 79/107 (74%), Gaps = 1/107 (1%)
 Frame = -1

Query  321  EDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFGPN  142
            E+ I V++RLRPLN+KE    D+  WECI+  S++++    ERS  P S+ TFD+VFG +
Sbjct  18   EETIRVSIRLRPLNEKELMKNDSSDWECINSTSVMFRSTLPERSLFPHSY-TFDRVFGID  76

Query  141  SLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITEKA  1
            S T+ VYEEG + V LS + GIN+TIFAYGQTSSGKT+TM G+T+ +
Sbjct  77   STTKQVYEEGAREVVLSVVNGINSTIFAYGQTSSGKTFTMNGVTQHS  123



>ref|XP_004152764.1| PREDICTED: uncharacterized protein LOC101212680 [Cucumis sativus]
 gb|KGN62654.1| hypothetical protein Csa_2G365120 [Cucumis sativus]
Length=956

 Score =   121 bits (304),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 79/107 (74%), Gaps = 1/107 (1%)
 Frame = -1

Query  321  EDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFGPN  142
            E+ I V++RLRPLN+KE    D+  WECI+  S++++    ERS  P S+ TFD+VFG +
Sbjct  18   EETIRVSIRLRPLNEKELMKNDSSDWECINSTSVMFRSTLPERSLFPHSY-TFDRVFGID  76

Query  141  SLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITEKA  1
            S T+ VYEEG + V LS + GIN+TIFAYGQTSSGKT+TM G+T+ +
Sbjct  77   STTKQVYEEGAREVVLSVVNGINSTIFAYGQTSSGKTFTMNGVTQHS  123



>ref|XP_006423481.1| hypothetical protein CICLE_v10027758mg [Citrus clementina]
 gb|ESR36721.1| hypothetical protein CICLE_v10027758mg [Citrus clementina]
Length=960

 Score =   121 bits (304),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 81/107 (76%), Gaps = 1/107 (1%)
 Frame = -1

Query  327  SKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFG  148
            ++E+KI+V VRLRPL++KE +A +   WECI++ +I+Y+    E S  P+++ TFD+VF 
Sbjct  20   AREEKILVLVRLRPLSEKEITADEATDWECINDTTILYRNTLREGSTFPSAY-TFDRVFR  78

Query  147  PNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITE  7
             +  T  VYE+G K +ALS + GIN++IFAYGQTSSGKTYTM GITE
Sbjct  79   GDCSTRQVYEDGAKEIALSVVSGINSSIFAYGQTSSGKTYTMTGITE  125



>ref|XP_006423482.1| hypothetical protein CICLE_v10027758mg [Citrus clementina]
 ref|XP_006423483.1| hypothetical protein CICLE_v10027758mg [Citrus clementina]
 ref|XP_006423486.1| hypothetical protein CICLE_v10027758mg [Citrus clementina]
 gb|ESR36722.1| hypothetical protein CICLE_v10027758mg [Citrus clementina]
 gb|ESR36723.1| hypothetical protein CICLE_v10027758mg [Citrus clementina]
 gb|ESR36726.1| hypothetical protein CICLE_v10027758mg [Citrus clementina]
Length=962

 Score =   121 bits (304),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 81/107 (76%), Gaps = 1/107 (1%)
 Frame = -1

Query  327  SKEDKIMVTVRLRPLNKKEQSAKDNVAWECIDEHSIVYKPMPHERSPQPTSFFTFDKVFG  148
            ++E+KI+V VRLRPL++KE +A +   WECI++ +I+Y+    E S  P+++ TFD+VF 
Sbjct  20   AREEKILVLVRLRPLSEKEITADEATDWECINDTTILYRNTLREGSTFPSAY-TFDRVFR  78

Query  147  PNSLTETVYEEGVKTVALSALMGINATIFAYGQTSSGKTYTMRGITE  7
             +  T  VYE+G K +ALS + GIN++IFAYGQTSSGKTYTM GITE
Sbjct  79   GDCSTRQVYEDGAKEIALSVVSGINSSIFAYGQTSSGKTYTMTGITE  125



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1042394327856