BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c1045_g3_i1 len=858 path=[4399:0-857]

Length=858
                                                                      Score     E

ref|XP_009601264.1|  PREDICTED: protein CCC1-like                       329   4e-109   
ref|XP_009795907.1|  PREDICTED: membrane protein of ER body-like ...    324   4e-107   
ref|XP_006339489.1|  PREDICTED: vacuolar iron transporter 1.1-like      316   5e-104   
ref|XP_004229857.1|  PREDICTED: membrane protein of ER body-like ...    313   4e-103   
gb|EYU32043.1|  hypothetical protein MIMGU_mgv1a012136mg                306   2e-100   
ref|XP_011035491.1|  PREDICTED: uncharacterized protein LOC105133268    298   8e-97    
ref|XP_002273056.1|  PREDICTED: uncharacterized protein LOC100247141    290   7e-94    Vitis vinifera
emb|CDP08896.1|  unnamed protein product                                289   2e-93    
ref|XP_002320098.1|  hypothetical protein POPTR_0014s07360g             288   4e-93    Populus trichocarpa [western balsam poplar]
ref|XP_010058157.1|  PREDICTED: uncharacterized protein LOC104445927    286   3e-92    
ref|XP_004306855.1|  PREDICTED: vacuolar iron transporter 1.1-like      279   2e-89    
ref|XP_010278610.1|  PREDICTED: uncharacterized protein LOC104612745    255   2e-80    
gb|AES80071.2|  vacuolar iron transporter-like protein                  252   6e-79    
ref|XP_003623853.1|  hypothetical protein MTR_7g076320                  252   6e-79    
ref|XP_007139923.1|  hypothetical protein PHAVU_008G070000g             250   2e-78    
ref|XP_009760567.1|  PREDICTED: uncharacterized protein LOC104212...    249   4e-78    
ref|XP_004493024.1|  PREDICTED: fe(2+)/Mn(2+) transporter pcl1-like     246   2e-76    
ref|XP_008232868.1|  PREDICTED: vacuolar iron transporter 1-like        244   7e-76    
ref|XP_003551656.1|  PREDICTED: vacuolar iron transporter homolog...    243   2e-75    
ref|XP_007219588.1|  hypothetical protein PRUPE_ppa023441mg             241   1e-74    
ref|XP_010692355.1|  PREDICTED: protein CCC1-like                       235   7e-72    
ref|XP_008812462.1|  PREDICTED: uncharacterized protein LOC103723348    228   1e-69    
ref|XP_010907660.1|  PREDICTED: uncharacterized protein LOC105034276    209   2e-62    
ref|XP_009347929.1|  PREDICTED: uncharacterized protein LOC103939547    207   1e-61    
ref|XP_001775588.1|  predicted protein                                  194   3e-55    
ref|XP_009601265.1|  PREDICTED: uncharacterized protein LOC104096586    183   5e-53    
gb|KHG04908.1|  Vacuolar iron transporter 1 -like protein               183   2e-52    
gb|ACF74327.1|  unknown                                                 178   3e-51    Arachis hypogaea [goober]
ref|XP_001784209.1|  predicted protein                                  169   2e-46    
ref|XP_009760568.1|  PREDICTED: uncharacterized protein LOC104212...    161   2e-44    
ref|XP_002499518.1|  vacuolar iron family transporter                   147   3e-38    Micromonas commoda
ref|XP_003057924.1|  vacuolar iron transporter family                   142   1e-36    
ref|XP_004998958.1|  vacuolar iron family transporter                   137   9e-34    
ref|XP_007514497.1|  hypothetical protein Bathy02g05280                 134   3e-33    
ref|XP_003080166.1|  unnamed protein product                            133   4e-33    
ref|XP_001418832.1|  predicted protein                                  131   5e-33    Ostreococcus lucimarinus CCE9901
ref|XP_010249419.1|  PREDICTED: uncharacterized protein LOC104591961    122   2e-30    
gb|ETO33784.1|  hypothetical protein RFI_03318                          127   5e-30    
ref|XP_001743284.1|  hypothetical protein                               124   6e-30    Monosiga brevicollis MX1
ref|WP_021654933.1|  membrane protein                                   124   6e-30    
ref|WP_017414920.1|  hypothetical protein                               124   8e-30    
ref|WP_040212637.1|  membrane protein                                   123   1e-29    
ref|WP_021285175.1|  hypothetical protein                               122   2e-29    
ref|XP_004034652.1|  hypothetical protein IMG5_116370                   121   9e-29    
ref|XP_004989180.1|  vacuolar iron family transporter                   123   1e-28    
gb|ETO28210.1|  hypothetical protein RFI_08923                          121   2e-28    
ref|XP_009035578.1|  hypothetical protein AURANDRAFT_24305              118   1e-27    
gb|KDO25654.1|  hypothetical protein SPRG_08953                         117   3e-27    
ref|XP_001431434.1|  hypothetical protein                               114   2e-26    Paramecium tetraurelia strain d4-2
gb|KHO46772.1|  hypothetical protein QS98_C0001G0031                    114   4e-26    
gb|KFH13784.1|  putative integral membrane protein                      114   7e-26    
ref|XP_002368759.1|  integral membrane protein, putative                114   7e-26    Toxoplasma gondii ME49
ref|XP_008888441.1|  integral membrane protein, putative                113   9e-26    
ref|XP_003880882.1|  putative integral membrane protein                 113   1e-25    
emb|CCW71153.1|  unnamed protein product                                112   2e-25    
gb|ETK71867.1|  hypothetical protein L915_20945                         112   6e-25    
gb|ETL78520.1|  hypothetical protein L917_20677                         111   7e-25    
gb|ETP01296.1|  hypothetical protein F441_21432                         111   7e-25    
ref|XP_008898426.1|  hypothetical protein PPTG_06277                    111   7e-25    
ref|XP_001443844.1|  hypothetical protein                               110   8e-25    Paramecium tetraurelia strain d4-2
gb|KDO25655.1|  hypothetical protein SPRG_08954                         110   9e-25    
emb|CCC46827.1|  conserved hypothetical protein                         110   1e-24    
ref|XP_009533516.1|  hypothetical protein PHYSODRAFT_304534             110   1e-24    
emb|CDJ68315.1|  integral membrane protein, putative                    110   2e-24    
gb|AET50747.1|  hypothetical protein                                    110   2e-24    
emb|CDJ41383.1|  integral membrane protein, putative                    110   2e-24    
ref|XP_010700108.1|  hypothetical protein LPMP_270210                   109   2e-24    
ref|XP_009844725.1|  hypothetical protein H257_17583                    109   2e-24    
gb|AJF62085.1|  hypothetical protein QT06_C0001G1269                    109   2e-24    
ref|XP_009844728.1|  hypothetical protein H257_17585                    109   2e-24    
emb|CCW61037.1|  unnamed protein product                                109   2e-24    
ref|WP_034546422.1|  membrane protein                                   108   2e-24    
ref|WP_007722984.1|  MULTISPECIES: membrane protein                     108   3e-24    
ref|XP_008866843.1|  hypothetical protein H310_04314                    110   3e-24    
ref|XP_001565783.1|  conserved hypothetical protein                     108   6e-24    Leishmania braziliensis MHOM/BR/75/M2904
ref|XP_002902928.1|  conserved hypothetical protein                     108   7e-24    
ref|XP_843676.1|  hypothetical protein                                  107   9e-24    Trypanosoma brucei brucei TREU927
gb|KHO46051.1|  hypothetical protein QJ16_C0014G0009                    106   1e-23    
emb|CBN73842.1|  conserved unknown protein                              107   1e-23    
gb|EFA86545.1|  DUF125 family protein                                   108   2e-23    Polysphondylium pallidum PN500
ref|XP_002287480.1|  predicted protein                                  107   2e-23    Thalassiosira pseudonana CCMP1335
dbj|GAM25155.1|  hypothetical protein SAMD00019534_083300               107   2e-23    
ref|WP_003143319.1|  membrane protein                                   105   2e-23    
ref|XP_004349157.1|  integral membrane protein                          106   2e-23    
ref|WP_013711701.1|  membrane protein                                   105   3e-23    
emb|CCC89604.1|  conserved hypothetical protein                         106   3e-23    
ref|WP_035051274.1|  membrane protein                                   105   4e-23    
ref|XP_001742963.1|  hypothetical protein                               110   5e-23    Monosiga brevicollis MX1
emb|CCI47783.1|  unnamed protein product                                105   6e-23    
emb|CCA18517.1|  conserved hypothetical protein                         105   7e-23    
gb|EJK53909.1|  hypothetical protein THAOC_26564                        105   1e-22    
ref|WP_026466525.1|  membrane protein                                   102   2e-22    
ref|XP_011091401.1|  PREDICTED: uncharacterized protein LOC105171851    100   3e-22    
gb|EFA79351.1|  hypothetical protein PPL_07769                          102   5e-22    Polysphondylium pallidum PN500
ref|XP_002178292.1|  predicted protein                                  102   5e-22    Phaeodactylum tricornutum CCAP 1055/1
ref|WP_013561267.1|  hypothetical protein                               102   5e-22    
emb|CCD12544.1|  unnamed protein product                                100   7e-22    
ref|XP_001031125.1|  Integral membrane protein                          100   3e-21    Tetrahymena thermophila
ref|WP_035020406.1|  membrane protein                                 99.8    4e-21    
ref|WP_029215174.1|  hypothetical protein                               100   4e-21    
ref|WP_016896376.1|  hypothetical protein                             99.4    4e-21    
dbj|GAM16838.1|  hypothetical protein SAMD00019534_000130               100   4e-21    
ref|WP_014451770.1|  hypothetical protein                             99.8    6e-21    
ref|XP_802487.1|  hypothetical protein                                99.4    6e-21    Trypanosoma cruzi strain CL Brener
gb|EWM28095.1|  vacuolar iron family transporter                      99.8    7e-21    
ref|XP_003290810.1|  hypothetical protein DICPUDRAFT_81525            99.4    7e-21    
ref|WP_033191902.1|  membrane protein                                 99.4    7e-21    
emb|CDJ59224.1|  integral membrane protein, putative                  99.8    9e-21    
ref|XP_011132107.1|  VIT family protein                               99.8    9e-21    
ref|XP_814955.1|  hypothetical protein                                99.4    9e-21    Trypanosoma cruzi strain CL Brener
emb|CDI82782.1|  integral membrane protein, putative                  99.4    1e-20    
gb|EKG05392.1|  hypothetical protein TCSYLVIO_003530                  99.0    1e-20    
ref|XP_002511783.1|  conserved hypothetical protein                   95.1    1e-20    Ricinus communis
emb|CDJ28030.1|  integral membrane protein, putative                  99.0    1e-20    
ref|WP_006308795.1|  membrane protein                                 97.4    2e-20    
ref|XP_003721827.1|  conserved hypothetical protein                   97.4    4e-20    
gb|EKF35637.1|  hypothetical protein MOQ_002326                       97.1    6e-20    
gb|AGN32978.1|  hypothetical protein                                  96.7    6e-20    
ref|WP_027227062.1|  membrane protein                                 96.3    7e-20    
ref|WP_028378929.1|  membrane protein                                 95.9    7e-20    
ref|XP_636076.1|  hypothetical protein DDB_G0289715                   96.3    9e-20    Dictyostelium discoideum AX4
ref|XP_003876595.1|  conserved hypothetical protein                   96.3    1e-19    
emb|CCF73024.1|  unnamed protein product                              95.5    1e-19    
ref|XP_001466488.1|  conserved hypothetical protein                   95.9    1e-19    Leishmania infantum JPCM5
ref|XP_002771787.1|  conserved hypothetical protein                   95.9    2e-19    Perkinsus marinus ATCC 50983
ref|WP_034537598.1|  membrane protein                                 95.1    2e-19    
ref|WP_011994207.1|  hypothetical protein                             95.5    2e-19    
ref|WP_023179167.1|  membrane protein                                 94.7    2e-19    
ref|XP_009312468.1|  integral membrane protein                        95.5    2e-19    
ref|XP_002262306.1|  integral membrane protein, conserved             95.1    2e-19    Plasmodium knowlesi strain H
ref|XP_002771788.1|  conserved hypothetical protein                   95.9    2e-19    Perkinsus marinus ATCC 50983
ref|WP_012744710.1|  hypothetical protein                             95.1    2e-19    
gb|EAR83460.3|  integral membrane protein                             94.7    3e-19    Tetrahymena thermophila SB210
gb|EAP76430.1|  hypothetical protein ISM_16230                        94.0    3e-19    Roseovarius nubinhibens ISM
ref|WP_040618166.1|  GMP synthase                                     94.0    4e-19    
ref|XP_001031123.2|  Integral membrane protein                        94.4    4e-19    Tetrahymena thermophila
ref|WP_026969529.1|  membrane protein                                 93.2    7e-19    
ref|WP_010947293.1|  membrane protein                                 93.2    8e-19    
ref|WP_037295892.1|  GMP synthase                                     92.8    8e-19    
gb|EDM70849.1|  bifunctional GMP synthase/glutamine amidotransfer...  93.2    8e-19    Roseobacter sp. AzwK-3b
ref|WP_031270701.1|  MULTISPECIES: membrane protein                   92.8    9e-19    
gb|EAV46336.1|  hypothetical protein SIAM614_10918                    92.8    1e-18    Labrenzia aggregata IAM 12614
ref|WP_027221751.1|  membrane protein                                 92.4    1e-18    
ref|WP_024812307.1|  GMP synthase                                     92.4    1e-18    
ref|WP_018477600.1|  hypothetical protein                             92.4    1e-18    
gb|ERP85634.1|  membrane protein                                      92.4    1e-18    
ref|WP_027225037.1|  membrane protein                                 92.0    2e-18    
ref|XP_004225013.1|  integral membrane protein conserved              92.4    2e-18    
ref|WP_014843878.1|  membrane protein                                 92.0    2e-18    
ref|WP_040147301.1|  membrane protein                                 91.7    2e-18    
ref|WP_011215510.1|  membrane protein                                 91.7    2e-18    
ref|WP_011946561.1|  membrane protein                                 91.7    2e-18    
emb|CDO65513.1|  integral membrane protein, putative                  92.0    2e-18    
ref|XP_001350634.1|  integral membrane protein, putative              92.0    2e-18    Plasmodium falciparum 3D7
gb|EWC75359.1|  hypothetical protein C923_03957                       92.0    3e-18    
ref|WP_027265263.1|  membrane protein                                 91.7    3e-18    
ref|WP_011213843.1|  membrane protein                                 91.3    3e-18    
gb|ETW48078.1|  hypothetical protein PFMALIP_03785                    92.0    3e-18    
ref|XP_002142090.1|  hypothetical protein                             92.0    3e-18    Cryptosporidium muris RN66
ref|WP_010139525.1|  GMP synthase                                     91.3    3e-18    
ref|WP_015444475.1|  Integral membrane protein                        91.3    3e-18    
gb|EPY22245.1|  integral membrane protein                             91.7    3e-18    
ref|WP_014841688.1|  membrane protein                                 90.9    4e-18    
ref|XP_008622846.1|  hypothetical protein YYE_00942                   90.9    5e-18    
ref|XP_008814615.1|  hypothetical protein C922_00781                  90.9    5e-18    
ref|XP_001617325.1|  hypothetical protein                             90.9    5e-18    Plasmodium vivax Sal-1
ref|WP_040438957.1|  membrane protein                                 90.5    6e-18    
emb|CDR16841.1|  conserved Plasmodium protein, unknown function       90.9    6e-18    
emb|CBN77026.1|  conserved unknown protein                            90.9    6e-18    
ref|WP_028982124.1|  membrane protein                                 90.1    7e-18    
ref|WP_026954853.1|  membrane protein                                 90.1    7e-18    
dbj|BAQ17909.1|  integral membrane protein                            90.1    8e-18    
ref|XP_004345702.1|  conserved hypothetical protein                   90.5    9e-18    
gb|EUD74462.1|  hypothetical protein YYG_00413                        90.1    1e-17    
ref|WP_029035356.1|  membrane protein                                 89.7    1e-17    
ref|XP_678837.1|  hypothetical protein                                90.1    1e-17    Plasmodium berghei ANKA
ref|WP_028373937.1|  membrane protein                                 89.4    1e-17    
ref|XP_628219.1|  conserved integral membrane protein with 4 tran...  90.1    1e-17    Cryptosporidium parvum Iowa II
ref|WP_038838455.1|  membrane protein                                 89.0    1e-17    
gb|ETB61724.1|  hypothetical protein YYC_01554                        89.7    2e-17    
ref|WP_037206626.1|  GMP synthase                                     89.4    2e-17    
ref|XP_727449.1|  hypothetical protein                                89.4    2e-17    Plasmodium yoelii yoelii 17XNL
ref|XP_004357309.1|  hypothetical protein DFA_02586                   89.4    2e-17    
ref|WP_009759800.1|  membrane protein                                 88.6    3e-17    
gb|KHO52430.1|  hypothetical protein QT04_C0022G0012                  88.6    4e-17    
ref|WP_040609583.1|  GMP synthase                                     88.2    4e-17    
ref|WP_038032788.1|  membrane protein                                 88.2    4e-17    
gb|EPY24241.1|  integral membrane protein                             88.6    4e-17    
gb|EAQ03558.1|  hypothetical protein OB2597_03022                     88.2    4e-17    Pseudooceanicola batsensis HTCC2597
ref|WP_009034259.1|  membrane protein                                 87.8    4e-17    
ref|WP_008625436.1|  hypothetical protein                             87.8    5e-17    
ref|WP_015264365.1|  hypothetical protein                             86.7    1e-16    
ref|WP_026951189.1|  membrane protein                                 86.7    1e-16    
ref|WP_007673933.1|  membrane protein                                 86.7    1e-16    
ref|WP_020894141.1|  hypothetical protein                             86.7    1e-16    
ref|WP_008199463.1|  membrane protein                                 86.3    1e-16    
ref|WP_024281760.1|  membrane protein                                 86.3    1e-16    
gb|EMR03612.1|  VIT family protein                                    86.7    1e-16    
ref|WP_040396352.1|  membrane protein                                 86.3    1e-16    
ref|WP_025604799.1|  membrane protein                                 86.3    2e-16    
gb|ETO31266.1|  hypothetical protein RFI_05854                        84.0    2e-16    
emb|CDI79778.1|  integral membrane protein, putative                  85.9    2e-16    
ref|WP_014022957.1|  membrane protein                                 85.9    2e-16    
ref|XP_004363052.1|  transmembrane protein                            87.0    3e-16    
ref|WP_007465871.1|  Hypothetical protein                             85.5    3e-16    
dbj|GAL83562.1|  hypothetical protein MYP_789                         85.1    4e-16    
ref|WP_029037954.1|  membrane protein                                 85.1    4e-16    
ref|XP_004349158.1|  integral membrane protein                        85.1    5e-16    
ref|WP_013455466.1|  membrane protein                                 84.7    5e-16    
ref|WP_008196519.1|  membrane protein                                 84.7    6e-16    
emb|CEK09357.1|  conserved membrane protein of unknown function       84.3    7e-16    
gb|KGM47383.1|  GMP synthase                                          84.3    7e-16    
emb|CDJ27300.1|  Vacuolar iron transporter, related                   84.3    7e-16    
ref|WP_009186465.1|  membrane protein                                 84.0    9e-16    
ref|WP_028793732.1|  membrane protein                                 83.2    2e-15    
ref|WP_014770763.1|  membrane protein                                 82.8    2e-15    
ref|WP_026944943.1|  membrane protein                                 82.8    3e-15    
ref|WP_013653488.1|  membrane protein                                 82.8    3e-15    
ref|WP_037248672.1|  GMP synthase                                     82.4    3e-15    
ref|WP_019669624.1|  hypothetical protein                             82.4    4e-15    
ref|WP_014202654.1|  membrane protein                                 82.0    5e-15    
gb|ETW12810.1|  hypothetical protein ATO8_09713                       81.6    7e-15    
gb|AJF59991.1|  hypothetical protein QT03_C0001G0495                  81.6    7e-15    
ref|XP_636071.1|  transmembrane protein                               82.8    8e-15    Dictyostelium discoideum AX4
ref|WP_016415422.1|  hypothetical protein                             80.9    1e-14    
gb|AJE46925.1|  hypothetical protein P73_2210                         80.5    1e-14    
gb|EAU51298.1|  hypothetical protein OM2255_03492                     80.9    1e-14    Rhodobacterales bacterium HTCC2255
ref|WP_040780276.1|  GMP synthase                                     80.5    1e-14    
gb|KFM14568.1|  VIT domain containing protein                         80.1    2e-14    
ref|WP_036559509.1|  GMP synthase                                     80.1    2e-14    
ref|XP_007051949.1|  Uncharacterized protein TCM_005437               79.0    3e-14    
ref|WP_022947416.1|  membrane protein                                 79.7    3e-14    
gb|AIC14579.1|  vacuolar iron transporter family protein              79.3    3e-14    
ref|WP_037259766.1|  membrane protein                                 79.3    3e-14    
gb|KER06784.1|  integral membrane protein                             79.3    4e-14    
ref|WP_020414113.1|  hypothetical protein                             79.3    4e-14    
ref|WP_020591539.1|  hypothetical protein                             79.0    5e-14    
ref|WP_015019505.1|  membrane protein                                 79.0    5e-14    
ref|WP_009578995.1|  hypothetical protein                             79.0    6e-14    
ref|WP_036220716.1|  membrane protein                                 78.2    8e-14    
gb|AIF82981.1|  putative membrane protein                             77.8    1e-13    
gb|EKD64991.1|  protein of unknown function DUF125 transmembrane      78.2    1e-13    
ref|WP_036862056.1|  membrane protein                                 77.4    2e-13    
ref|WP_029066505.1|  membrane protein                                 77.0    2e-13    
ref|WP_018697798.1|  hypothetical protein                             77.0    2e-13    
ref|WP_023434145.1|  hypothetical protein                             77.0    2e-13    
gb|KHQ55340.1|  Integral membrane protein                             76.3    4e-13    
ref|WP_021819003.1|  hypothetical protein                             76.3    5e-13    
ref|WP_020530729.1|  hypothetical protein                             76.3    5e-13    
ref|XP_004035612.1|  hypothetical protein IMG5_095220                 75.5    7e-13    
gb|AHM04139.1|  nodulin 21-related protein                            75.5    8e-13    
gb|KCV83628.1|  hypothetical protein ATO10_02670                      75.1    1e-12    
ref|WP_029042455.1|  membrane protein                                 75.1    1e-12    
ref|WP_028080813.1|  membrane protein                                 77.0    1e-12    
ref|WP_035247658.1|  GMP synthase                                     75.1    1e-12    
ref|WP_038484461.1|  membrane protein                                 75.1    1e-12    
ref|WP_023010251.1|  membrane protein                                 75.1    1e-12    
ref|WP_027253995.1|  membrane protein                                 75.1    1e-12    
ref|WP_037043076.1|  membrane protein                                 74.3    2e-12    
ref|WP_039538770.1|  membrane protein                                 74.3    2e-12    
gb|KGE84950.1|  membrane protein                                      73.9    2e-12    
ref|WP_011507459.1|  membrane protein                                 74.7    3e-12    
ref|WP_035412359.1|  membrane protein                                 74.3    3e-12    
ref|WP_028486777.1|  membrane protein                                 73.9    3e-12    
gb|EAR20368.1|  integral membrane protein                             73.9    4e-12    Nitrococcus mobilis Nb-231
ref|WP_027961604.1|  membrane protein                                 73.6    4e-12    
emb|CDI06386.1|  conserved membrane hypothetical protein              73.2    4e-12    
gb|EKE03178.1|  Integral membrane protein                             73.6    4e-12    
ref|WP_028008804.1|  membrane protein                                 75.1    4e-12    
gb|KIF24272.1|  membrane protein                                      73.2    5e-12    
ref|WP_011784790.1|  MULTISPECIES: membrane protein                   73.2    6e-12    
ref|WP_036748589.1|  membrane protein                                 73.2    6e-12    
ref|WP_029239963.1|  membrane protein                                 72.8    6e-12    
ref|WP_008558535.1|  membrane protein                                 72.8    7e-12    
ref|WP_031360850.1|  membrane protein                                 74.3    8e-12    
ref|WP_008885384.1|  membrane protein                                 72.4    8e-12    
ref|WP_023366300.1|  hypothetical protein                             72.8    9e-12    
ref|XP_008621409.1|  hypothetical protein SDRG_16961                  71.2    9e-12    
ref|WP_040547239.1|  iron transporter                                 72.4    1e-11    
gb|EEF62062.1|  protein of unknown function DUF125 transmembrane      72.0    1e-11    
ref|WP_016353151.1|  hypothetical protein                             72.4    1e-11    
ref|XP_004830891.1|  integral membrane protein domain-containing ...  72.0    2e-11    
ref|WP_003087272.1|  membrane protein                                 70.5    2e-11    
ref|WP_037310799.1|  membrane protein                                 71.6    2e-11    
dbj|GAL65812.1|  integral membrane protein                            71.6    2e-11    
ref|XP_010090630.1|  hypothetical protein L484_003947                 71.6    2e-11    
ref|WP_039523498.1|  membrane protein                                 70.9    3e-11    
ref|WP_029644549.1|  hypothetical protein                             70.5    4e-11    
emb|CDQ36439.1|  VIT family protein                                   71.2    4e-11    
ref|WP_039691009.1|  membrane protein                                 69.3    5e-11    
ref|WP_004230888.1|  membrane protein                                 69.3    5e-11    
ref|WP_003091580.1|  hypothetical protein                             68.9    6e-11    
ref|WP_040725421.1|  membrane protein                                 70.5    6e-11    
ref|WP_027234678.1|  membrane protein                                 70.1    6e-11    
ref|WP_020649147.1|  hypothetical protein                             72.0    6e-11    
ref|WP_024344282.1|  membrane protein                                 68.9    6e-11    
ref|WP_008347784.1|  MULTISPECIES: membrane protein                   72.0    6e-11    
ref|WP_021141923.1|  MULTISPECIES: Integral membrane protein          68.9    7e-11    
ref|WP_033152227.1|  membrane protein                                 68.9    7e-11    
ref|WP_006531486.1|  membrane protein                                 68.9    7e-11    
gb|EWH01235.1|  membrane protein                                      69.7    7e-11    
ref|WP_014334460.1|  membrane protein                                 68.9    8e-11    
ref|WP_010438103.1|  membrane protein                                 69.7    8e-11    
ref|WP_027967950.1|  membrane protein                                 68.6    8e-11    
ref|WP_011048828.1|  membrane protein                                 69.7    1e-10    
ref|WP_028229157.1|  membrane protein                                 70.9    1e-10    
ref|WP_027976532.1|  membrane protein                                 68.2    1e-10    
ref|WP_026868979.1|  membrane protein                                 69.3    1e-10    
dbj|BAO92166.1|  uncharacterized protein BRPE67_DCDS10110             70.9    1e-10    
ref|WP_023005789.1|  hypothetical protein                             69.3    2e-10    
ref|WP_031506694.1|  membrane protein                                 68.9    2e-10    
ref|WP_014252593.1|  membrane protein                                 70.5    2e-10    
ref|WP_039697213.1|  membrane protein                                 67.8    2e-10    
ref|XP_001609731.1|  integral membrane protein                        68.9    2e-10    
gb|EKD78753.1|  hypothetical protein ACD_41C00279G0002                68.6    2e-10    
ref|WP_033358051.1|  membrane protein                                 68.2    3e-10    
ref|WP_018800758.1|  membrane protein                                 68.6    3e-10    
gb|EHN12523.1|  protein of unknown function DUF125 transmembrane      68.6    3e-10    
ref|WP_040597928.1|  membrane protein                                 68.6    3e-10    
ref|WP_025055131.1|  membrane protein                                 68.2    4e-10    
ref|WP_012178308.1|  GMP synthase                                     68.2    4e-10    
ref|WP_008297118.1|  membrane protein                                 67.8    4e-10    
ref|WP_035505664.1|  membrane protein                                 69.3    4e-10    
ref|WP_018803641.1|  membrane protein                                 67.8    4e-10    
gb|EKD78407.1|  protein of unknown function DUF125 transmembrane      67.4    5e-10    
ref|WP_021695423.1|  nodulin 21-related protein                       67.4    6e-10    
ref|WP_014964106.1|  MULTISPECIES: membrane protein                   67.0    7e-10    
ref|WP_028677496.1|  membrane protein                                 67.4    7e-10    
ref|WP_018380176.1|  hypothetical protein                             65.9    7e-10    
ref|WP_012181529.1|  membrane protein                                 67.0    8e-10    
ref|WP_018793362.1|  membrane protein                                 67.0    8e-10    
ref|WP_018584978.1|  membrane protein                                 67.0    8e-10    
ref|WP_018375021.1|  hypothetical protein                             65.9    8e-10    
ref|WP_040663403.1|  membrane protein                                 66.6    8e-10    
ref|WP_028499311.1|  membrane protein                                 68.6    9e-10    
ref|WP_018790358.1|  membrane protein                                 67.0    1e-09    
emb|CDR95048.1|  integral membrane protein, putative                  67.4    1e-09    
ref|WP_009853773.1|  membrane protein                                 65.5    1e-09    
ref|WP_020916429.1|  hypothetical protein                             65.5    1e-09    
ref|WP_040187728.1|  membrane protein                                 67.0    1e-09    
ref|WP_012961668.1|  membrane protein                                 65.5    1e-09    
ref|WP_003063844.1|  MULTISPECIES: membrane protein                   65.5    1e-09    
ref|XP_763977.1|  hypothetical protein                                66.6    1e-09    
gb|EWG99166.1|  membrane protein                                      66.2    1e-09    
ref|WP_017536780.1|  hypothetical protein                             66.6    1e-09    
ref|XP_005705862.1|  vacuolar iron transporter 1 isoform 2            67.4    1e-09    
ref|XP_005705861.1|  vacuolar iron transporter 1 isoform 1            67.4    1e-09    
ref|WP_028222904.1|  membrane protein                                 67.8    2e-09    
ref|XP_008866847.1|  hypothetical protein H310_04316                  65.1    2e-09    
ref|WP_018165277.1|  hypothetical protein                             64.7    2e-09    
ref|WP_007798116.1|  membrane protein                                 65.9    2e-09    
ref|WP_018785879.1|  membrane protein                                 65.9    2e-09    
ref|WP_035057546.1|  membrane protein                                 67.4    2e-09    
ref|WP_029020057.1|  membrane protein                                 65.9    2e-09    
ref|WP_029690711.1|  membrane protein                                 64.3    2e-09    
ref|WP_017769863.1|  hypothetical protein                             64.3    3e-09    
ref|WP_029027887.1|  membrane protein                                 65.5    3e-09    
ref|WP_030503432.1|  membrane protein                                 65.5    3e-09    
ref|WP_028202592.1|  membrane protein                                 67.0    3e-09    
ref|WP_015304639.1|  hypothetical protein                             65.5    3e-09    
ref|WP_017775582.1|  membrane protein                                 66.6    4e-09    
ref|WP_007456660.1|  membrane protein                                 65.1    4e-09    
ref|WP_015798271.1|  hypothetical protein                             65.1    4e-09    
gb|ETX28859.1|  hypothetical protein RISW2_03890                      65.1    5e-09    
ref|WP_030489492.1|  membrane protein                                 64.7    5e-09    
ref|WP_011491682.1|  membrane protein                                 66.2    5e-09    
ref|WP_007177079.1|  membrane protein                                 66.2    5e-09    
ref|XP_008381766.1|  PREDICTED: vacuolar iron transporter 1-like      64.7    6e-09    
ref|WP_030337617.1|  membrane protein                                 64.7    6e-09    
dbj|BAL54395.1|  hypothetical conserved protein                       64.7    6e-09    
ref|XP_733265.1|  hypothetical protein                                62.8    6e-09    
ref|WP_027263446.1|  membrane protein                                 64.7    6e-09    
ref|WP_013673380.1|  membrane protein                                 64.7    7e-09    
ref|WP_022899075.1|  membrane protein                                 64.3    8e-09    
ref|WP_028230669.1|  membrane protein                                 65.5    8e-09    
ref|WP_013284653.1|  MULTISPECIES: membrane protein                   64.3    8e-09    
ref|WP_008344675.1|  MULTISPECIES: membrane protein                   65.5    9e-09    
ref|XP_009692465.1|  uncharacterized protein TOT_040000534            63.5    9e-09    
ref|WP_035527781.1|  membrane protein                                 65.5    1e-08    
ref|WP_028990557.1|  membrane protein                                 64.3    1e-08    
ref|WP_024882502.1|  membrane protein                                 63.9    1e-08    
ref|WP_011880285.1|  membrane protein                                 65.1    1e-08    
ref|WP_010039460.1|  membrane protein                                 63.9    1e-08    
ref|XP_003292527.1|  hypothetical protein DICPUDRAFT_50495            63.5    1e-08    
ref|WP_018353543.1|  hypothetical protein                             63.5    1e-08    
ref|XP_010277787.1|  PREDICTED: vacuolar iron transporter 1-like      63.9    1e-08    
ref|WP_020271846.1|  putative Fe(2+)/Mn(2+) transporter pcl1          63.9    1e-08    
ref|WP_024851938.1|  membrane protein                                 63.9    1e-08    
ref|XP_002876777.1|  hypothetical protein ARALYDRAFT_484095           63.9    1e-08    
ref|NP_178286.1|  vacuolar iron transporter 1                         63.9    1e-08    
ref|WP_007733901.1|  MULTISPECIES: hypothetical protein               63.5    1e-08    
ref|WP_028209660.1|  membrane protein                                 64.7    2e-08    
ref|XP_008389156.1|  PREDICTED: vacuolar iron transporter 1-like      63.5    2e-08    
ref|WP_038086366.1|  membrane protein                                 63.5    2e-08    
gb|KFK33402.1|  hypothetical protein AALP_AA5G008100                  63.5    2e-08    
ref|WP_035700660.1|  membrane protein                                 62.8    2e-08    
ref|WP_028188710.1|  membrane protein                                 63.5    2e-08    
ref|WP_028803134.1|  membrane protein                                 63.5    2e-08    
emb|CEL18291.1|  hypothetical protein                                 63.2    2e-08    
ref|WP_024357460.1|  membrane protein                                 63.5    2e-08    
ref|WP_030446422.1|  membrane protein                                 63.2    2e-08    
ref|WP_028186528.1|  membrane protein                                 63.2    2e-08    
ref|WP_037937651.1|  membrane protein                                 63.2    2e-08    
ref|WP_037623364.1|  membrane protein                                 63.2    2e-08    
ref|WP_021332129.1|  membrane protein                                 63.2    2e-08    
ref|WP_019745057.1|  MULTISPECIES: membrane protein                   63.2    2e-08    
ref|WP_024905521.1|  membrane protein                                 64.3    2e-08    
ref|WP_024487286.1|  MULTISPECIES: hypothetical protein               63.2    2e-08    
ref|WP_030248602.1|  MULTISPECIES: membrane protein                   63.2    2e-08    
ref|WP_017882874.1|  hypothetical protein                             63.2    2e-08    
ref|WP_020039725.1|  hypothetical protein                             62.8    2e-08    
ref|XP_011021748.1|  PREDICTED: vacuolar iron transporter 1-like      63.2    2e-08    
ref|WP_018744496.1|  membrane protein                                 62.8    2e-08    
ref|WP_028153416.1|  membrane protein                                 62.8    2e-08    
ref|WP_025047820.1|  membrane protein                                 62.8    2e-08    
ref|XP_007223723.1|  hypothetical protein PRUPE_ppa010409mg           63.2    3e-08    
ref|WP_030683714.1|  membrane protein                                 63.2    3e-08    
ref|WP_027196412.1|  membrane protein                                 63.9    3e-08    
ref|WP_008328910.1|  hypothetical protein                             62.8    3e-08    
ref|WP_019871218.1|  membrane protein                                 62.8    3e-08    
gb|ABK94901.1|  unknown                                               62.8    3e-08    
ref|WP_018733589.1|  membrane protein                                 62.8    3e-08    
ref|XP_008220925.1|  PREDICTED: vacuolar iron transporter 1-like      62.8    3e-08    
ref|WP_030228415.1|  membrane protein                                 62.8    3e-08    
ref|WP_025619182.1|  membrane protein                                 62.8    3e-08    
ref|WP_013590956.1|  membrane protein                                 63.9    3e-08    
ref|XP_009036704.1|  hypothetical protein AURANDRAFT_53579            62.8    3e-08    
ref|WP_014972400.1|  membrane protein                                 63.9    3e-08    
ref|WP_019045471.1|  MULTISPECIES: membrane protein                   62.4    3e-08    
ref|WP_028360571.1|  membrane protein                                 63.9    3e-08    
ref|WP_025647887.1|  MULTISPECIES: membrane protein                   63.9    3e-08    
ref|WP_028927812.1|  membrane protein                                 62.4    4e-08    
ref|WP_034514934.1|  membrane protein                                 62.8    4e-08    
ref|XP_010090629.1|  UDP-galactose/UDP-glucose transporter 4          63.5    4e-08    
ref|XP_009101315.1|  PREDICTED: vacuolar iron transporter 1-like      62.4    4e-08    
ref|WP_020578627.1|  hypothetical protein                             62.4    4e-08    
ref|XP_003530927.1|  PREDICTED: vacuolar iron transporter 1-like      62.4    4e-08    
ref|XP_006355092.1|  PREDICTED: vacuolar iron transporter 1-like      62.4    4e-08    
ref|WP_030413655.1|  membrane protein                                 62.4    5e-08    
ref|WP_040050707.1|  membrane protein                                 63.5    5e-08    
ref|WP_012173338.1|  CCC1-related iron/manganese transporter comp...  62.0    5e-08    
ref|WP_035919578.1|  membrane protein                                 62.0    5e-08    
ref|WP_030972044.1|  MULTISPECIES: membrane protein                   62.4    5e-08    
ref|WP_004058851.1|  hypothetical protein                             61.2    5e-08    
ref|WP_026932403.1|  hypothetical protein                             62.0    5e-08    
ref|XP_005539433.1|  similar to transmembrane calcium/manganese t...  62.8    5e-08    
ref|XP_668356.1|  hypothetical protein                                61.2    5e-08    
ref|WP_028930268.1|  membrane protein                                 63.2    5e-08    
ref|WP_027652150.1|  membrane protein                                 62.0    5e-08    
ref|WP_019328059.1|  membrane protein                                 62.0    5e-08    
ref|WP_034911994.1|  membrane protein                                 62.0    6e-08    
ref|WP_020970586.1|  hypothetical protein                             62.0    6e-08    
ref|WP_018253633.1|  membrane protein                                 62.0    6e-08    
ref|WP_031031096.1|  membrane protein                                 62.0    6e-08    
ref|WP_018728240.1|  membrane protein                                 62.0    6e-08    
ref|WP_030831811.1|  membrane protein                                 62.0    6e-08    
ref|XP_009351566.1|  PREDICTED: vacuolar iron transporter 1-like      62.0    6e-08    
ref|WP_011879690.1|  membrane protein                                 62.8    6e-08    
gb|KFZ91255.1|  VIT family                                            61.6    7e-08    
ref|WP_008922194.1|  membrane protein                                 62.8    7e-08    
ref|WP_005087607.1|  MULTISPECIES: membrane protein                   61.6    7e-08    
ref|WP_005074688.1|  membrane protein                                 61.6    7e-08    
gb|KFG76041.1|  membrane protein                                      61.6    7e-08    
ref|WP_016348000.1|  hypothetical protein                             62.8    8e-08    
ref|WP_030948586.1|  membrane protein                                 61.6    8e-08    
ref|XP_003525220.1|  PREDICTED: vacuolar iron transporter 1-like      61.6    8e-08    
ref|WP_018796276.1|  membrane protein                                 61.2    9e-08    
gb|EIV13463.1|  putative membrane protein                             60.8    1e-07    
ref|WP_030932969.1|  membrane protein                                 61.2    1e-07    
ref|WP_021701889.1|  hypothetical protein                             61.6    1e-07    
ref|WP_028415665.1|  membrane protein                                 61.2    1e-07    
ref|WP_018486572.1|  membrane protein                                 61.2    1e-07    
ref|WP_033234345.1|  membrane protein                                 61.2    1e-07    
ref|XP_010932530.1|  PREDICTED: LOW QUALITY PROTEIN: vacuolar iro...  61.2    1e-07    
gb|AJC59062.1|  protein of unknown function DUF125 transmembrane      61.2    1e-07    
ref|WP_018722072.1|  membrane protein                                 60.8    1e-07    
ref|WP_039641862.1|  membrane protein                                 61.2    1e-07    
ref|WP_031115689.1|  membrane protein                                 61.2    1e-07    
ref|XP_006849784.1|  hypothetical protein AMTR_s00176p00023280        61.2    1e-07    
ref|WP_005060450.1|  membrane protein                                 60.8    1e-07    
ref|WP_015744158.1|  hypothetical protein                             61.2    1e-07    
ref|WP_028153679.1|  membrane protein                                 60.8    1e-07    
ref|WP_037757156.1|  membrane protein                                 60.8    1e-07    
ref|XP_009129203.1|  PREDICTED: vacuolar iron transporter 1 isofo...  60.8    1e-07    
ref|WP_012404509.1|  membrane protein                                 62.0    1e-07    
ref|WP_030049194.1|  membrane protein                                 60.8    1e-07    
ref|WP_018219003.1|  membrane protein                                 60.5    2e-07    
ref|XP_006395851.1|  hypothetical protein EUTSA_v10005591mg           60.8    2e-07    
ref|WP_035679908.1|  membrane protein                                 60.5    2e-07    
ref|WP_016342357.1|  hypothetical protein                             60.8    2e-07    
ref|WP_037128812.1|  membrane protein                                 60.5    2e-07    
gb|EHM20354.1|  hypothetical protein MMAS_16400                       60.5    2e-07    
ref|XP_008789258.1|  PREDICTED: vacuolar iron transporter 1.1         60.8    2e-07    
ref|WP_013732164.1|  membrane protein                                 60.5    2e-07    
gb|EEN89653.1|  membrane protein                                      60.5    2e-07    
ref|WP_011566633.1|  membrane protein                                 60.5    2e-07    
ref|WP_021100030.1|  nodulin 21-related protein                       60.5    2e-07    
ref|WP_035511319.1|  membrane protein                                 61.6    2e-07    
ref|WP_029672625.1|  membrane protein                                 61.6    2e-07    
gb|KDP38147.1|  hypothetical protein JCGZ_04790                       60.5    2e-07    



>ref|XP_009601264.1| PREDICTED: protein CCC1-like [Nicotiana tomentosiformis]
Length=264

 Score =   329 bits (843),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 186/255 (73%), Positives = 210/255 (82%), Gaps = 6/255 (2%)
 Frame = +2

Query  92   EDGEMEKKGKSEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLG  271
            EDGE+EK  K+   RPKEPWKGE V+SIV+AGLDAIVTSFSLISSISAGRLSS DVLVLG
Sbjct  16   EDGELEKGRKN--GRPKEPWKGEVVKSIVYAGLDAIVTSFSLISSISAGRLSSVDVLVLG  73

Query  272  FANLVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELN  451
            FANLVADGISMGFGD+VS+STE+DV AKE+ V EWDV++     +QELL+HYQ LGM   
Sbjct  74   FANLVADGISMGFGDYVSSSTEKDVAAKERTVTEWDVINQHRPQKQELLRHYQELGMNDT  133

Query  452  DATTVVTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPIL  631
            DA TVV IF+KY DI+V EKMA +KGL  P E      KPWKNGLITFAAF+VFGCAP+L
Sbjct  134  DANTVVNIFSKYQDIMVDEKMATEKGLLPPDEA----EKPWKNGLITFAAFIVFGCAPLL  189

Query  632  AFIILIPFTQNVTHKFMaacalsalaltllGIAKAKIASQSYTVSVAITLSNgaiagasa  811
            AFI+LIPFT N THKF+ A   SA+AL LLGIAKAKIASQ+Y +S AITL NG IAGA+A
Sbjct  190  AFIVLIPFTNNDTHKFIGAIVFSAVALALLGIAKAKIASQNYALSAAITLFNGLIAGAAA  249

Query  812  yaigWTLRNVAGLED  856
            Y IGWTLRNVAGLE+
Sbjct  250  YGIGWTLRNVAGLEE  264



>ref|XP_009795907.1| PREDICTED: membrane protein of ER body-like protein [Nicotiana 
sylvestris]
Length=264

 Score =   324 bits (830),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 189/271 (70%), Positives = 216/271 (80%), Gaps = 9/271 (3%)
 Frame = +2

Query  50   MAESSRYVQ--LGGSVEDGEMEKKGKSEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLIS  223
            MAE++R  +  L  SV DGE+EK  K  K RPKEPWKGE V+SIV+AGLDAIVTSFSLIS
Sbjct  1    MAENNRNGEAPLLRSV-DGELEKGRK--KGRPKEPWKGEVVKSIVYAGLDAIVTSFSLIS  57

Query  224  SISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIAL  403
            SISAGRLSS DVLVLGFANLVADGISM FGD+VS+STE+DV AKE+ V EWDV++     
Sbjct  58   SISAGRLSSVDVLVLGFANLVADGISMEFGDYVSSSTEKDVAAKERTVTEWDVINQHRPQ  117

Query  404  QQELLQHYQALGMELNDATTVVTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNG  583
            +QELL+HYQ LGM   DA TVV IF+KY DI+V EKMA +KGL  P     +  KPWKNG
Sbjct  118  KQELLRHYQELGMNDTDANTVVNIFSKYRDIMVDEKMATEKGLLPP----DQAEKPWKNG  173

Query  584  LITFAAFVVFGCAPILAFIILIPFTQNVTHKFMaacalsalaltllGIAKAKIASQSYTV  763
            LITFAAF+VFGCAP+LAFI+LIPFT N THKF+ A   SA+AL LLGIAKAKIA Q+Y +
Sbjct  174  LITFAAFIVFGCAPLLAFIVLIPFTNNDTHKFIGAIVFSAVALALLGIAKAKIAGQNYVL  233

Query  764  SVAITLSNgaiagasayaigWTLRNVAGLED  856
            S AITL NG IA A+AY IGWTLRNVAGLE+
Sbjct  234  SAAITLFNGLIASAAAYGIGWTLRNVAGLEE  264



>ref|XP_006339489.1| PREDICTED: vacuolar iron transporter 1.1-like [Solanum tuberosum]
Length=267

 Score =   316 bits (810),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 178/254 (70%), Positives = 208/254 (82%), Gaps = 5/254 (2%)
 Frame = +2

Query  95   DGEMEKKGKSEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGF  274
            DGE+EK GK +  RPKEPWKGE V+SIV+AGLDAIVTSFSLISSISAG LSS DVLVLGF
Sbjct  19   DGELEK-GKGKNGRPKEPWKGEVVKSIVYAGLDAIVTSFSLISSISAGHLSSVDVLVLGF  77

Query  275  ANLVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELND  454
            ANLVADGISMGFGD+VS+STE+DV  KE+ V EWDV++     ++ELL+HYQ LGM   D
Sbjct  78   ANLVADGISMGFGDYVSSSTEKDVAVKERTVTEWDVINQHRPQKEELLRHYQQLGMNETD  137

Query  455  ATTVVTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILA  634
            A TVV IFAKY DI++ EKMA +KGL  P     +  KPWK+G+ITF AF+VFGCAP+LA
Sbjct  138  ANTVVNIFAKYRDIMIDEKMAIQKGLLPP----DQADKPWKSGIITFTAFIVFGCAPLLA  193

Query  635  FIILIPFTQNVTHKFMaacalsalaltllGIAKAKIASQSYTVSVAITLSNgaiagasay  814
            FI+LIPFT+N T+KF+ AC  SA+AL LLGIAKAKIASQ+Y +S  ITL NG IAGA+AY
Sbjct  194  FIVLIPFTKNDTYKFIGACVFSAVALALLGIAKAKIASQNYALSAGITLFNGLIAGAAAY  253

Query  815  aigWTLRNVAGLED  856
             IGWTLRNVAGLE+
Sbjct  254  GIGWTLRNVAGLEE  267



>ref|XP_004229857.1| PREDICTED: membrane protein of ER body-like protein [Solanum 
lycopersicum]
Length=265

 Score =   313 bits (803),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 176/254 (69%), Positives = 208/254 (82%), Gaps = 7/254 (3%)
 Frame = +2

Query  95   DGEMEKKGKSEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGF  274
            DGE+EK    +  RPKEPWKGE V+SIV+AGLDAIVTSFSLISSISAG LSS DVLVLGF
Sbjct  19   DGELEK---GKNGRPKEPWKGEVVKSIVYAGLDAIVTSFSLISSISAGHLSSVDVLVLGF  75

Query  275  ANLVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELND  454
            ANLVADGISMGFGD+VS+STE+DV AKE+ V EWD+++   + ++ELL+HYQ LGM   D
Sbjct  76   ANLVADGISMGFGDYVSSSTEKDVAAKERTVTEWDIINQHRSQKEELLRHYQQLGMNDTD  135

Query  455  ATTVVTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILA  634
            A TVV IFAKY DI++ EKMA +KGL  P     +  KPWK+GLITF AF+VFGCAP+LA
Sbjct  136  ANTVVNIFAKYRDIMIDEKMAVQKGLLPP----DQADKPWKSGLITFTAFIVFGCAPLLA  191

Query  635  FIILIPFTQNVTHKFMaacalsalaltllGIAKAKIASQSYTVSVAITLSNgaiagasay  814
            FI+LIPFT+N T+KF+ AC  SA+AL LLGIAKAKIA Q+Y +S +ITL NG IAGA+AY
Sbjct  192  FIVLIPFTRNDTYKFIGACVFSAVALALLGIAKAKIAGQNYALSASITLFNGLIAGAAAY  251

Query  815  aigWTLRNVAGLED  856
             IGWTLRNVAGLE+
Sbjct  252  GIGWTLRNVAGLEE  265



>gb|EYU32043.1| hypothetical protein MIMGU_mgv1a012136mg [Erythranthe guttata]
Length=260

 Score =   306 bits (785),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 180/269 (67%), Positives = 208/269 (77%), Gaps = 9/269 (3%)
 Frame = +2

Query  50   MAESSRYVQLGGSVEDGEMEKKGKSEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSI  229
            MA     V L   + +G+M K G     RPKEPWKGEFV+SIV+AGLDAI+TSFSLISSI
Sbjct  1    MAGDDDVVPLLPPLINGDMGKNG-----RPKEPWKGEFVKSIVYAGLDAIITSFSLISSI  55

Query  230  SAGRLSSGDVLVLGFANLVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQ  409
            SAGRLSS DVLVLGFANLVADGISMGFGDF+STSTERDV AKE+ V EWDV +     QQ
Sbjct  56   SAGRLSSVDVLVLGFANLVADGISMGFGDFMSTSTERDVAAKERSVTEWDVENCRRNQQQ  115

Query  410  ELLQHYQALGMELNDATTVVTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLI  589
            +L++ YQ+LGM   DA  VV IFA+Y DILV EKMAA+KG+ +P     +  KPWKNGL+
Sbjct  116  DLVRRYQSLGMSTTDAAAVVGIFARYPDILVGEKMAAEKGILTP----DQSEKPWKNGLV  171

Query  590  TFAAFVVFGCAPILAFIILIPFTQNVTHKFMaacalsalaltllGIAKAKIASQSYTVSV  769
            TFAAF+ FGCAPILAFI+LIPFT +   KF+ AC +S LAL  LGIAKAKIA Q+Y VS 
Sbjct  172  TFAAFLFFGCAPILAFIVLIPFTNSDKMKFVGACVMSGLALVFLGIAKAKIAGQNYAVSA  231

Query  770  AITLSNgaiagasayaigWTLRNVAGLED  856
             I L NGAIAGA+AY IGWTLRNVAGL++
Sbjct  232  GIMLFNGAIAGAAAYGIGWTLRNVAGLQE  260



>ref|XP_011035491.1| PREDICTED: uncharacterized protein LOC105133268 [Populus euphratica]
Length=267

 Score =   298 bits (762),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 166/255 (65%), Positives = 203/255 (80%), Gaps = 5/255 (2%)
 Frame = +2

Query  92   EDGEMEKKGKSEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLG  271
            EDG   + G+ E+ RPKEPWKGE+V+S+V+AGLDAI+T FSLISSISA   S+ DVLVLG
Sbjct  18   EDGG-NRSGQVEEGRPKEPWKGEYVKSVVYAGLDAIITCFSLISSISATHSSTVDVLVLG  76

Query  272  FANLVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELN  451
            FANLVADGISMGFGD+VS+STE+DV AKE+ V EWDV +   A +QEL++ YQ LGM++N
Sbjct  77   FANLVADGISMGFGDYVSSSTEKDVAAKERAVTEWDVTNHGKAQRQELVRKYQQLGMDIN  136

Query  452  DATTVVTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPIL  631
            DA TVV IFAKY DILV EKM  +KG++ P E+     KPWKNGLIT  AF+VFGC P+L
Sbjct  137  DAATVVEIFAKYKDILVDEKMTTEKGMTPPDEE----EKPWKNGLITLVAFLVFGCLPLL  192

Query  632  AFIILIPFTQNVTHKFMaacalsalaltllGIAKAKIASQSYTVSVAITLSNgaiagasa  811
            +F++LIPFT + T KF+ AC ++ LAL +LGIAKAKI  Q+Y +SV IT+ NGA A A+A
Sbjct  193  SFVVLIPFTNDETMKFIGACFMAILALAVLGIAKAKITGQNYVLSVFITVGNGAFAAAAA  252

Query  812  yaigWTLRNVAGLED  856
            YAIGWTLRNVAGL D
Sbjct  253  YAIGWTLRNVAGLVD  267



>ref|XP_002273056.1| PREDICTED: uncharacterized protein LOC100247141 [Vitis vinifera]
 emb|CBI38841.3| unnamed protein product [Vitis vinifera]
Length=264

 Score =   290 bits (742),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 166/255 (65%), Positives = 203/255 (80%), Gaps = 6/255 (2%)
 Frame = +2

Query  92   EDGEMEKKGKSEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLG  271
            E GE E +  S  +RPKEPW+GE+V+SIV+AGLDAIVT FSLISS+SAG LSS DVLVLG
Sbjct  16   EGGEAENQKIS--KRPKEPWRGEYVKSIVYAGLDAIVTCFSLISSMSAGHLSSVDVLVLG  73

Query  272  FANLVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELN  451
            FANLVADGISMGFGDFVS+ TE+D    E++V EW+V +     + +L++HYQALGM+L+
Sbjct  74   FANLVADGISMGFGDFVSSGTEKDAAVMERVVTEWEVANQGGPQKTQLIRHYQALGMDLH  133

Query  452  DATTVVTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPIL  631
            DATTVV IF+KY DILV EKM A+KG+  P E      KPWK+GL+TFA+F+VFG AP+L
Sbjct  134  DATTVVNIFSKYRDILVDEKMTAQKGMLPPDEA----EKPWKSGLVTFASFLVFGSAPLL  189

Query  632  AFIILIPFTQNVTHKFMaacalsalaltllGIAKAKIASQSYTVSVAITLSNgaiagasa  811
            +FI+L PFT + T KF+ A  LSALAL LLGIAKA+IA Q+Y VS  +T  NGAIA A+A
Sbjct  190  SFIVLTPFTHSDTVKFVGASVLSALALVLLGIAKARIAGQNYAVSAVVTFFNGAIAAAAA  249

Query  812  yaigWTLRNVAGLED  856
            Y+IGWTLRNVAGL+D
Sbjct  250  YSIGWTLRNVAGLQD  264



>emb|CDP08896.1| unnamed protein product [Coffea canephora]
Length=267

 Score =   289 bits (740),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 168/259 (65%), Positives = 197/259 (76%), Gaps = 14/259 (5%)
 Frame = +2

Query  80   GGSVEDGEMEKKGKSEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDV  259
            GG + D E      ++  RPKEPWK E+ +SIV+AGLDAIVTSFSLISSIS G LSS DV
Sbjct  23   GGHIVDEE-----GTDSERPKEPWKKEYAKSIVYAGLDAIVTSFSLISSISGGHLSSVDV  77

Query  260  LVLGFANLVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALG  439
            LVLGF+NLVADGISMGFGDF+STSTERD+ A E+ V EW+V +     +QELLQ YQ LG
Sbjct  78   LVLGFSNLVADGISMGFGDFISTSTERDMAANERSVTEWEVANHGRPQEQELLQKYQDLG  137

Query  440  MELNDATTVVTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGC  619
            M   DATTVV++ AKY D++V EK          +    +  KPWK+GL+TFAAF+VFGC
Sbjct  138  MTPGDATTVVSVLAKYRDVMVHEKQ---------MLPPDQTEKPWKSGLVTFAAFIVFGC  188

Query  620  APILAFIILIPFTQNVTHKFMaacalsalaltllGIAKAKIASQSYTVSVAITLSNgaia  799
            AP+LAFIILIPFT+N  HKF+ AC  SA AL LLG+AKAKI  Q+Y  SVAITLSNGA+A
Sbjct  189  APLLAFIILIPFTKNDAHKFVGACVFSAFALILLGLAKAKIVGQNYVASVAITLSNGAVA  248

Query  800  gasayaigWTLRNVAGLED  856
            GA+AY IGWTLRNVAGLED
Sbjct  249  GAAAYGIGWTLRNVAGLED  267



>ref|XP_002320098.1| hypothetical protein POPTR_0014s07360g [Populus trichocarpa]
 gb|EEE98413.1| hypothetical protein POPTR_0014s07360g [Populus trichocarpa]
Length=267

 Score =   288 bits (737),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 169/255 (66%), Positives = 204/255 (80%), Gaps = 5/255 (2%)
 Frame = +2

Query  92   EDGEMEKKGKSEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLG  271
            EDG   + G+ E+ RPKEPWKGE+V+S+V+AGLDAI+T FSLISSISA   SS DVLVLG
Sbjct  18   EDGG-NRSGQVEEGRPKEPWKGEYVKSVVYAGLDAIITCFSLISSISATHSSSVDVLVLG  76

Query  272  FANLVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELN  451
            FANLVADGISMG GD+VS+STE+DV AKE+ V EWDV +   A +QEL++ YQ LGM++N
Sbjct  77   FANLVADGISMGLGDYVSSSTEKDVAAKERAVTEWDVTNHGRAQRQELVRKYQQLGMDIN  136

Query  452  DATTVVTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPIL  631
            DA TVV IFAKY DILV EKM A+KG++ P E+     KPWKNGLIT  AF+VFGC P+L
Sbjct  137  DAATVVEIFAKYKDILVDEKMTAEKGMTPPDEE----EKPWKNGLITLVAFLVFGCLPLL  192

Query  632  AFIILIPFTQNVTHKFMaacalsalaltllGIAKAKIASQSYTVSVAITLSNgaiagasa  811
            +F++LIPFT N T KF+ AC ++ LAL +LGIAKAKIA Q+Y +SV IT+ NGA A A+A
Sbjct  193  SFVVLIPFTNNETVKFIGACFMAILALAVLGIAKAKIAGQNYVLSVFITVGNGAFAAAAA  252

Query  812  yaigWTLRNVAGLED  856
            YAIGWTLRNVAGL D
Sbjct  253  YAIGWTLRNVAGLVD  267



>ref|XP_010058157.1| PREDICTED: uncharacterized protein LOC104445927 [Eucalyptus grandis]
 gb|KCW71706.1| hypothetical protein EUGRSUZ_E00219 [Eucalyptus grandis]
Length=269

 Score =   286 bits (731),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 163/255 (64%), Positives = 195/255 (76%), Gaps = 4/255 (2%)
 Frame = +2

Query  92   EDGEMEKKGKSEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLG  271
            +D E    G   + RPKEPWKGE V+SIV+AGLDAIVT FSLISSISAG L+SGDVLVLG
Sbjct  19   DDVEGCGDGMRRRERPKEPWKGEIVKSIVYAGLDAIVTCFSLISSISAGHLTSGDVLVLG  78

Query  272  FANLVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELN  451
            FANLVADGISMG GD+VS +TE+DV A+E+ V EWDV +     Q ELL+ YQ LGM   
Sbjct  79   FANLVADGISMGCGDYVSATTEQDVAAEERAVTEWDVTNRSQPEQMELLRKYQRLGMSAE  138

Query  452  DATTVVTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPIL  631
            DA TVV IF+KY D+LV EKM A+KG++ P     K  KPWKNGL+TF +F+VFG AP+L
Sbjct  139  DAETVVNIFSKYKDMLVDEKMMAQKGMTPP----DKEDKPWKNGLVTFVSFIVFGSAPLL  194

Query  632  AFIILIPFTQNVTHKFMaacalsalaltllGIAKAKIASQSYTVSVAITLSNgaiagasa  811
            +FIILIPFT + T KF+ AC LS LAL LLGIAKAKIA Q Y +S  +T+  GA A A+A
Sbjct  195  SFIILIPFTDSDTIKFIGACVLSVLALVLLGIAKAKIAGQKYALSAFVTVLYGATAAAAA  254

Query  812  yaigWTLRNVAGLED  856
            YA+GWTLRN+AGL++
Sbjct  255  YALGWTLRNIAGLDE  269



>ref|XP_004306855.1| PREDICTED: vacuolar iron transporter 1.1-like [Fragaria vesca 
subsp. vesca]
Length=276

 Score =   279 bits (714),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 162/247 (66%), Positives = 192/247 (78%), Gaps = 5/247 (2%)
 Frame = +2

Query  113  KGKSEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVAD  292
             G +   RPKEPWK E+ +SI++AGLDAIVT FSLISSISA RL+S DVLVLGFANLVAD
Sbjct  34   NGATGSSRPKEPWKTEYAKSILYAGLDAIVTCFSLISSISASRLTSADVLVLGFANLVAD  93

Query  293  GISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVT  472
            GISMG GDF+S+S E+DV  KE  V EWDV +     + ELLQ YQALGM+++DA TVV+
Sbjct  94   GISMGVGDFLSSSIEKDVATKEMTVTEWDVTNHGGLEKMELLQKYQALGMDVDDAATVVS  153

Query  473  IFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFIILIP  652
            IFAKY DILV EKM A   L  P E+ +   KPWKNGL+TF AF+VFG AP+L+FI+LIP
Sbjct  154  IFAKYKDILVQEKMMAHGRL--PPEEAE---KPWKNGLVTFVAFLVFGSAPLLSFIVLIP  208

Query  653  FTQNVTHKFMaacalsalaltllGIAKAKIASQSYTVSVAITLSNgaiagasayaigWTL  832
            FT N   KF  AC LSA+AL LLGIAKAKIA Q+Y +SVA+TL NGA A A+AY +GWTL
Sbjct  209  FTNNDLVKFAGACILSAVALALLGIAKAKIAGQNYALSVAVTLFNGAAAAAAAYVVGWTL  268

Query  833  RNVAGLE  853
            +N+AGLE
Sbjct  269  KNIAGLE  275



>ref|XP_010278610.1| PREDICTED: uncharacterized protein LOC104612745 [Nelumbo nucifera]
Length=259

 Score =   255 bits (652),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 153/250 (61%), Positives = 187/250 (75%), Gaps = 4/250 (2%)
 Frame = +2

Query  107  EKKGKSEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLV  286
            ++ GK    RPKEPW    V+SIV+AGLDAIVT FSLISSIS+   SS DVLVLGFANLV
Sbjct  14   DESGKQGGERPKEPWSEHTVKSIVYAGLDAIVTCFSLISSISSVHYSSVDVLVLGFANLV  73

Query  287  ADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTV  466
            A+GISMGF DF+ST T++D + +E++V EWDV +     Q EL+Q YQ LGM L DATTV
Sbjct  74   ANGISMGFADFISTGTKKDAIEEERLVTEWDVNNQGRQQQMELMQRYQQLGMSLEDATTV  133

Query  467  VTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFIIL  646
            V +F+KY DIL+ EKM  +KG+ SP        K W+NG++T AAF+ FGCAP+L F++L
Sbjct  134  VNVFSKYKDILIDEKMTTQKGMQSP----NNEEKAWQNGVVTLAAFLAFGCAPLLPFVVL  189

Query  647  IPFTQNVTHKFMaacalsalaltllGIAKAKIASQSYTVSVAITLSNgaiagasayaigW  826
            IPFT +   KF+ AC +SALAL LLGIAKA+IA +SY  S A+TL NGAIA ASAY IGW
Sbjct  190  IPFTWSERVKFLGACVVSALALALLGIAKARIAGRSYAFSTAVTLLNGAIAAASAYLIGW  249

Query  827  TLRNVAGLED  856
             LR+VAGLED
Sbjct  250  LLRDVAGLED  259



>gb|AES80071.2| vacuolar iron transporter-like protein [Medicago truncatula]
Length=264

 Score =   252 bits (643),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 151/254 (59%), Positives = 198/254 (78%), Gaps = 8/254 (3%)
 Frame = +2

Query  92   EDGEMEKKGKSEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLG  271
            + G++E+  +    RPKEPW+GE+V+SIV+ GLDAI+T FSLISSISA   SSG+VLVLG
Sbjct  18   DGGDLERNSE----RPKEPWRGEYVKSIVYGGLDAIITCFSLISSISASSSSSGNVLVLG  73

Query  272  FANLVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELN  451
            FANLVAD ISMGFGD VS S+ERDV+ +E+ V EWDV+++    Q+EL+++YQ+LGME N
Sbjct  74   FANLVADAISMGFGDIVSASSERDVIIEERRVTEWDVLNSRGNEQRELVRYYQSLGMEYN  133

Query  452  DATTVVTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPIL  631
            DATTVV IF KY D+LV ++MAA KG+        +  KPWKNGLITFA+F++FG  P+L
Sbjct  134  DATTVVNIFTKYNDVLVDQRMAADKGILPA----DQEVKPWKNGLITFASFMLFGSIPLL  189

Query  632  AFIILIPFTQNVTHKFMaacalsalaltllGIAKAKIASQSYTVSVAITLSNgaiagasa  811
            +FIILIPFT N + KF  AC +SAL L LLG+A+A+IA Q+  ++ AITL +G IAGA+A
Sbjct  190  SFIILIPFTDNDSVKFAGACLVSALGLALLGVARARIAGQNMMLTTAITLFSGVIAGAAA  249

Query  812  yaigWTLRNVAGLE  853
            Y +GW L+++AGLE
Sbjct  250  YLVGWLLKHIAGLE  263



>ref|XP_003623853.1| hypothetical protein MTR_7g076320 [Medicago truncatula]
 gb|ABN08245.1| Protein of unknown function DUF125, transmembrane [Medicago truncatula]
Length=262

 Score =   252 bits (643),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 151/254 (59%), Positives = 198/254 (78%), Gaps = 8/254 (3%)
 Frame = +2

Query  92   EDGEMEKKGKSEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLG  271
            + G++E+  +    RPKEPW+GE+V+SIV+ GLDAI+T FSLISSISA   SSG+VLVLG
Sbjct  16   DGGDLERNSE----RPKEPWRGEYVKSIVYGGLDAIITCFSLISSISASSSSSGNVLVLG  71

Query  272  FANLVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELN  451
            FANLVAD ISMGFGD VS S+ERDV+ +E+ V EWDV+++    Q+EL+++YQ+LGME N
Sbjct  72   FANLVADAISMGFGDIVSASSERDVIIEERRVTEWDVLNSRGNEQRELVRYYQSLGMEYN  131

Query  452  DATTVVTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPIL  631
            DATTVV IF KY D+LV ++MAA KG+        +  KPWKNGLITFA+F++FG  P+L
Sbjct  132  DATTVVNIFTKYNDVLVDQRMAADKGILPA----DQEVKPWKNGLITFASFMLFGSIPLL  187

Query  632  AFIILIPFTQNVTHKFMaacalsalaltllGIAKAKIASQSYTVSVAITLSNgaiagasa  811
            +FIILIPFT N + KF  AC +SAL L LLG+A+A+IA Q+  ++ AITL +G IAGA+A
Sbjct  188  SFIILIPFTDNDSVKFAGACLVSALGLALLGVARARIAGQNMMLTTAITLFSGVIAGAAA  247

Query  812  yaigWTLRNVAGLE  853
            Y +GW L+++AGLE
Sbjct  248  YLVGWLLKHIAGLE  261



>ref|XP_007139923.1| hypothetical protein PHAVU_008G070000g [Phaseolus vulgaris]
 gb|ESW11917.1| hypothetical protein PHAVU_008G070000g [Phaseolus vulgaris]
Length=269

 Score =   250 bits (639),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 155/265 (58%), Positives = 200/265 (75%), Gaps = 8/265 (3%)
 Frame = +2

Query  59   SSRYVQLGGSVEDGEMEKKGKSEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAG  238
            ++R +Q   + EDG   ++  SE  RP+EPWKG++V+SIVFAGLDAI+T FSLISSI+A 
Sbjct  12   TTRLLQT--AAEDGGDSERKSSE--RPREPWKGKYVKSIVFAGLDAIITCFSLISSINAS  67

Query  239  RLSSGDVLVLGFANLVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELL  418
              SSG VLVLGF+NLVAD ISMGFGD VS S+E++V+ +E+ V EWDV +     Q EL+
Sbjct  68   TRSSGHVLVLGFSNLVADAISMGFGDSVSASSEQEVIIEERKVTEWDVNNQRKKEQSELV  127

Query  419  QHYQALGMELNDATTVVTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFA  598
             HYQALGM+ NDAT VV IF KY DILV ++M A KG+        +  K WKNGL+TFA
Sbjct  128  NHYQALGMDCNDATMVVNIFTKYNDILVDQRMVADKGVL----PADQEVKHWKNGLVTFA  183

Query  599  AFVVFGCAPILAFIILIPFTQNVTHKFMaacalsalaltllGIAKAKIASQSYTVSVAIT  778
            +F++FG AP+L+FIILIPFT N + KF++AC +SALAL LLG+AKA+IA Q+   S A+T
Sbjct  184  SFMLFGSAPLLSFIILIPFTDNDSIKFLSACLVSALALALLGVAKARIAGQNIIFSAAVT  243

Query  779  LSNgaiagasayaigWTLRNVAGLE  853
            L +GAIA ASAY +GW L+++AGLE
Sbjct  244  LFSGAIAAASAYLVGWLLKHLAGLE  268



>ref|XP_009760567.1| PREDICTED: uncharacterized protein LOC104212900 isoform X1 [Nicotiana 
sylvestris]
Length=250

 Score =   249 bits (636),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 162/243 (67%), Positives = 187/243 (77%), Gaps = 9/243 (4%)
 Frame = +2

Query  131  RRPKEPWKG-EFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMG  307
             RPKEPWKG E V+SI+ AG DAIVTSFSLISSISA   SS D+LVLGFANLVADGIS G
Sbjct  16   ERPKEPWKGGEVVKSIMNAGPDAIVTSFSLISSISASHHSSVDILVLGFANLVADGISKG  75

Query  308  FGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKY  487
            F D+VS+ T+RDV  K++ V EWDV++     +Q LLQ YQALGM+L DA TV+ IFAKY
Sbjct  76   FWDYVSSRTQRDVAPKKRSVTEWDVINQHKPQKQGLLQQYQALGMDLTDANTVMNIFAKY  135

Query  488  MDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFIILIPFTQNV  667
             +ILV +KMA +KG S P E+G+   KPWKNGLIT AAF+V GC P+LAFI+LIPF    
Sbjct  136  RNILVDKKMATEKG-SLPQEQGE---KPWKNGLITCAAFIVCGCVPLLAFIVLIPF----  187

Query  668  THKFMaacalsalaltllGIAKAKIASQSYTVSVAITLSNgaiagasayaigWTLRNVAG  847
            THKF+ AC   A  L LLGIAKAKIA +S  +S A TL NGAIAGA+AY IGWTLRNVAG
Sbjct  188  THKFIGACVFYAAVLVLLGIAKAKIAGRSCPLSAATTLFNGAIAGAAAYGIGWTLRNVAG  247

Query  848  LED  856
            LED
Sbjct  248  LED  250



>ref|XP_004493024.1| PREDICTED: fe(2+)/Mn(2+) transporter pcl1-like [Cicer arietinum]
Length=266

 Score =   246 bits (627),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 150/251 (60%), Positives = 193/251 (77%), Gaps = 4/251 (2%)
 Frame = +2

Query  101  EMEKKGKSEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFAN  280
            E++   ++   RPKEPWKG +V+SIV+ GLDAI+T FSLISSISA   SSG+VLVLGFAN
Sbjct  19   EVDDLERNYSERPKEPWKGGYVKSIVYGGLDAIITCFSLISSISASSSSSGNVLVLGFAN  78

Query  281  LVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDAT  460
            LVAD ISMGFGD VS S+ERDVV +E+ V EWDV++     Q+EL+++YQ+LGM+ +DAT
Sbjct  79   LVADAISMGFGDIVSASSERDVVIEERRVTEWDVLNGREDEQRELVRYYQSLGMDYDDAT  138

Query  461  TVVTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFI  640
            TVV IF KY DILV +KM A KG+        + AKPWKNGLITFA+F+VFG  P+L+FI
Sbjct  139  TVVNIFTKYNDILVDQKMVADKGML----PADQEAKPWKNGLITFASFMVFGSIPLLSFI  194

Query  641  ILIPFTQNVTHKFMaacalsalaltllGIAKAKIASQSYTVSVAITLSNgaiagasayai  820
            ILIPFT +   KF++AC +SAL L LLG+A+A+IA Q+   + AIT+ +G IA A+AY +
Sbjct  195  ILIPFTDSDLVKFVSACLVSALGLALLGVARARIAGQNMMFTTAITVFSGVIAAAAAYLV  254

Query  821  gWTLRNVAGLE  853
            GW L++VAGLE
Sbjct  255  GWLLKHVAGLE  265



>ref|XP_008232868.1| PREDICTED: vacuolar iron transporter 1-like [Prunus mume]
Length=273

 Score =   244 bits (623),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 170/247 (69%), Positives = 199/247 (81%), Gaps = 8/247 (3%)
 Frame = +2

Query  119  KSEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGI  298
            KSE  RPKEPWKGE+ +SI++AGLDAIVT FSLISSISA R+SS DVLVLGFANLVADGI
Sbjct  34   KSE--RPKEPWKGEYAKSILYAGLDAIVTCFSLISSISASRISSVDVLVLGFANLVADGI  91

Query  299  SMGFGDFVSTSTERDVVAKEKIVAEWDVM-HTPIALQQELLQHYQALGMELNDATTVVTI  475
            SMGFGDF+S+S+E+DV AKE+ V EWDV  H+      ELL+ YQALGM++ DATTVV I
Sbjct  92   SMGFGDFMSSSSEKDVAAKEQAVTEWDVANHSGPEELLELLRRYQALGMDVTDATTVVNI  151

Query  476  FAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFIILIPF  655
            FAKY +ILV EKM A  G+  P E      KPWKNGL+TFAAF+VFG AP+L+FIILIPF
Sbjct  152  FAKYNNILVHEKMMA-HGMLQPDE----AEKPWKNGLVTFAAFLVFGSAPLLSFIILIPF  206

Query  656  TQNVTHKFMaacalsalaltllGIAKAKIASQSYTVSVAITLSNgaiagasayaigWTLR  835
            T N + KF+ AC LSALAL LLG AKAKIA Q+Y  SVA+TL NGAIA A+AYA+GW L+
Sbjct  207  TNNNSVKFVGACILSALALALLGAAKAKIAGQNYAFSVAVTLFNGAIAAAAAYALGWALK  266

Query  836  NVAGLED  856
            N+AGLE+
Sbjct  267  NIAGLEN  273



>ref|XP_003551656.1| PREDICTED: vacuolar iron transporter homolog 3-like [Glycine 
max]
Length=266

 Score =   243 bits (619),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 150/249 (60%), Positives = 190/249 (76%), Gaps = 4/249 (2%)
 Frame = +2

Query  107  EKKGKSEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLV  286
            E  G+ +  RPKEPWKGE+V+S+VFAGLDAI+T FSLISSISA   SS  VLVLG +NLV
Sbjct  21   EDGGERKSERPKEPWKGEYVKSMVFAGLDAIITCFSLISSISASTSSSVHVLVLGVSNLV  80

Query  287  ADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTV  466
            AD ISMGFGDFVS S+E+DV+ +E+ V EWDV++     Q EL++HYQ LGM+ NDAT V
Sbjct  81   ADAISMGFGDFVSASSEQDVIIEERRVTEWDVINQRDKEQTELVKHYQNLGMDYNDATMV  140

Query  467  VTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFIIL  646
            V IF KY DILV ++M A KG+        +  KPW+NGL+TFA+F++FG  P+L+FIIL
Sbjct  141  VNIFTKYNDILVDQRMVADKGML----PADQEVKPWRNGLVTFASFMLFGSTPLLSFIIL  196

Query  647  IPFTQNVTHKFMaacalsalaltllGIAKAKIASQSYTVSVAITLSNgaiagasayaigW  826
            IPFT N + KF++AC +SALAL LLG+AKA+IA Q+  +S A+TL  GAIA ASAY +GW
Sbjct  197  IPFTDNDSVKFLSACIVSALALALLGVAKARIAGQNIMLSAAVTLLCGAIAAASAYLVGW  256

Query  827  TLRNVAGLE  853
             L+ +AGLE
Sbjct  257  LLKLMAGLE  265



>ref|XP_007219588.1| hypothetical protein PRUPE_ppa023441mg [Prunus persica]
 gb|EMJ20787.1| hypothetical protein PRUPE_ppa023441mg [Prunus persica]
Length=273

 Score =   241 bits (616),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 169/247 (68%), Positives = 200/247 (81%), Gaps = 8/247 (3%)
 Frame = +2

Query  119  KSEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGI  298
            KSE  RPKEPWKGE+ +SI++AGLDAIVT FSLISSISA R+SS DVLVLGFANLVADGI
Sbjct  34   KSE--RPKEPWKGEYAKSILYAGLDAIVTCFSLISSISASRISSVDVLVLGFANLVADGI  91

Query  299  SMGFGDFVSTSTERDVVAKEKIVAEWDVM-HTPIALQQELLQHYQALGMELNDATTVVTI  475
            SMGFGDF+S+S+E+ V AKE+ V EWDV  H+      ELL+ YQALGM++NDATTVV+I
Sbjct  92   SMGFGDFMSSSSEKAVAAKERAVTEWDVANHSGPEELVELLRRYQALGMDINDATTVVSI  151

Query  476  FAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFIILIPF  655
            FAKY +ILV EKM A  G+  P E      KPWKNGL+TFAAF+VFG AP+L+FIILIPF
Sbjct  152  FAKYNNILVHEKMMA-HGMLPPDEA----EKPWKNGLVTFAAFLVFGSAPLLSFIILIPF  206

Query  656  TQNVTHKFMaacalsalaltllGIAKAKIASQSYTVSVAITLSNgaiagasayaigWTLR  835
            T + + KF+ AC LSALAL LLG AKAKIA Q+Y  SVA+TL NGAIA A+AYA+GW L+
Sbjct  207  TNDDSVKFVGACILSALALALLGAAKAKIAGQNYAFSVAVTLFNGAIAAAAAYALGWALK  266

Query  836  NVAGLED  856
            N+AGLE+
Sbjct  267  NIAGLEN  273



>ref|XP_010692355.1| PREDICTED: protein CCC1-like [Beta vulgaris subsp. vulgaris]
Length=299

 Score =   235 bits (599),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 148/258 (57%), Positives = 191/258 (74%), Gaps = 12/258 (5%)
 Frame = +2

Query  107  EKKGKSEKR-----RPKEP-WKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSG--DVL  262
            E++G+S +      +PK P WKGE  +SIV+ GLDAIVT FSLISSIS+        DVL
Sbjct  45   EERGRSAQNQEIRPKPKSPTWKGENAKSIVYGGLDAIVTCFSLISSISSSGGRMSSVDVL  104

Query  263  VLGFANLVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGM  442
            VLGFANLVADGISMGFGD++S+STE+++  KEK V +W+V H   +  ++L+Q YQ LGM
Sbjct  105  VLGFANLVADGISMGFGDYLSSSTEKEMAFKEKDVTQWEVDHHGTSQIRQLMQRYQELGM  164

Query  443  ELNDATTVVTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCA  622
            +  DATTV  IFAKY +I+V E M  +KGL  P     +  KPWK+GL+TF +F++FGCA
Sbjct  165  DPRDATTVADIFAKYKNIMVEENMMGQKGLLLP----DQEEKPWKSGLVTFISFLLFGCA  220

Query  623  PILAFIILIPFTQNVTHKFMaacalsalaltllGIAKAKIASQSYTVSVAITLSNgaiag  802
            P+L+FIILIPFT + T KF+ AC LS  ALTLLG+AKA I+  SYT+S  +T+SNG IA 
Sbjct  221  PLLSFIILIPFTDDDTIKFIGACILSIFALTLLGVAKANISGASYTLSALMTVSNGVIAA  280

Query  803  asayaigWTLRNVAGLED  856
            A AY+IGW+LRN+AGLE+
Sbjct  281  AVAYSIGWSLRNLAGLEE  298



>ref|XP_008812462.1| PREDICTED: uncharacterized protein LOC103723348 [Phoenix dactylifera]
Length=262

 Score =   228 bits (581),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 146/236 (62%), Positives = 177/236 (75%), Gaps = 5/236 (2%)
 Frame = +2

Query  149  WKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVST  328
            W  + V+S + AGLDAIVTSFSLISSISA RL+S DVLVLGFANLVA GISMGFGDFVST
Sbjct  27   WSEDSVKSAIDAGLDAIVTSFSLISSISATRLASVDVLVLGFANLVARGISMGFGDFVST  86

Query  329  STERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKYMDILVAE  508
            STE ++  KE+   E DV  +  + Q  LL  YQALG++L DATTVV +F+KY DILV E
Sbjct  87   STENEMAKKERATTEQDVSKSISSQQAGLLSTYQALGLDLEDATTVVNVFSKYQDILVDE  146

Query  509  KMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFIILIPFTQNVTHKFMaa  688
            KM A+KG+  P    ++  KPWK+GLI+FAAF++FG  P+L+F++LIPFT + + KF+ A
Sbjct  147  KMTAQKGVLPP----RQTEKPWKSGLISFAAFILFGNVPLLSFVVLIPFTGDDSTKFLGA  202

Query  689  calsalaltllGIAKAKIASQSYTVSVAITLSNgaiagasayaigWTLRNVAGLED  856
            C LSALAL LLG+A+AKI+ Q Y  SVA TL NG IA   AY IGW LRN AGL D
Sbjct  203  CLLSALALALLGLARAKISGQ-YLHSVAATLFNGGIAATCAYLIGWMLRNAAGLHD  257



>ref|XP_010907660.1| PREDICTED: uncharacterized protein LOC105034276 [Elaeis guineensis]
Length=257

 Score =   209 bits (531),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 146/236 (62%), Positives = 177/236 (75%), Gaps = 5/236 (2%)
 Frame = +2

Query  149  WKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVST  328
            W  + V+S++ AGLDAIVTSFSLISSISA RLSS DVLVLGFANLVA GISMGFGD VST
Sbjct  27   WSEDIVKSVIDAGLDAIVTSFSLISSISASRLSSVDVLVLGFANLVAGGISMGFGDLVST  86

Query  329  STERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKYMDILVAE  508
            STE+++  KE+   E DV  +  + Q +LL  YQALGM+L DA TVV + +KY DILV E
Sbjct  87   STEKEMAKKERATTEKDVSSSISSQQTQLLSTYQALGMDLEDAKTVVNVLSKYQDILVDE  146

Query  509  KMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFIILIPFTQNVTHKFMaa  688
            KM A+KG+  P    ++  KPWK+GLITFA+F++FG  P+L+F+ILIPFT + + KF+ A
Sbjct  147  KMTARKGMLPP----RQTEKPWKSGLITFASFILFGSVPLLSFVILIPFTGDDSTKFLGA  202

Query  689  calsalaltllGIAKAKIASQSYTVSVAITLSNgaiagasayaigWTLRNVAGLED  856
            C LSALAL LLG+A+AKI+   Y  SVA TL NG IA   AY IGW LRNVAGL D
Sbjct  203  CLLSALALALLGLARAKISGH-YVHSVAATLFNGCIAATCAYLIGWMLRNVAGLHD  257



>ref|XP_009347929.1| PREDICTED: uncharacterized protein LOC103939547 [Pyrus x bretschneideri]
 ref|XP_009347930.1| PREDICTED: uncharacterized protein LOC103939548 [Pyrus x bretschneideri]
Length=261

 Score =   207 bits (527),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 128/200 (64%), Positives = 156/200 (78%), Gaps = 5/200 (3%)
 Frame = +2

Query  254  DVLVLGFANLVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQA  433
            DVLVLGFANLVADGISMGFG+F S+++E++V +K++ V EWDV +       ELLQ YQ 
Sbjct  66   DVLVLGFANLVADGISMGFGEFTSSNSEKEVASKQRAVTEWDVGNRNGPELMELLQKYQE  125

Query  434  LGMELNDATTVVTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVF  613
            LGM+++DA TVV+IFAKY +ILV EKM A +G+  P     K  K WKNGL TF AF+VF
Sbjct  126  LGMDVDDAATVVSIFAKYNNILVREKMVA-QGMLPP----DKAEKSWKNGLATFPAFLVF  180

Query  614  GCAPILAFIILIPFTQNVTHKFMaacalsalaltllGIAKAKIASQSYTVSVAITLSNga  793
            G AP+L+FI+LIPFT N + KF+ AC LSA+AL LLGIAKAKIA Q+Y  SVAITL NG 
Sbjct  181  GSAPLLSFIVLIPFTNNDSVKFVGACVLSAIALALLGIAKAKIAGQNYAFSVAITLFNGT  240

Query  794  iagasayaigWTLRNVAGLE  853
            IA A+AYA+GWTL+NVAGLE
Sbjct  241  IAAAAAYAVGWTLKNVAGLE  260



>ref|XP_001775588.1| predicted protein [Physcomitrella patens]
 gb|EDQ59535.1| predicted protein [Physcomitrella patens]
Length=381

 Score =   194 bits (493),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 109/231 (47%), Positives = 160/231 (69%), Gaps = 4/231 (2%)
 Frame = +2

Query  149  WKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVST  328
            W GE+++SIV+ GLDAIVTSF+L++S+S G L +G VLVLGFANL+ADGISMG+GD++S+
Sbjct  150  WGGEYLKSIVYGGLDAIVTSFALVASVSGGDLPAGSVLVLGFANLIADGISMGYGDYLSS  209

Query  329  STERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKYMDILVAE  508
            + E+D  A ++++++W+  +       EL+  YQ  GME +DA  +V + +KY DI+V +
Sbjct  210  TAEKDYSANQQLISDWEAENDIHGEIMELVSAYQEQGMEKDDADKIVDVLSKYKDIMVDQ  269

Query  509  KMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFIILIPFTQNVTHKFMaa  688
            K+   +G+  P         P KNGL+TFA+F+ FG  P+L ++IL PFT N   KF+ A
Sbjct  270  KLTLTQGILPP----DPEDSPLKNGLVTFASFLAFGSTPLLTYLILKPFTNNNDLKFLGA  325

Query  689  calsalaltllGIAKAKIASQSYTVSVAITLSNgaiagasayaigWTLRNV  841
            C ++ LAL LLG AKA+I+ Q+   S+A+ + NG IA A+AY I + L NV
Sbjct  326  CIVTILALGLLGAAKARISGQNMLSSIAVVVFNGGIAAAAAYGISYLLNNV  376



>ref|XP_009601265.1| PREDICTED: uncharacterized protein LOC104096586 [Nicotiana tomentosiformis]
Length=200

 Score =   183 bits (464),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 98/146 (67%), Positives = 114/146 (78%), Gaps = 2/146 (1%)
 Frame = +2

Query  134  RPKEPWKG-EFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGF  310
            RPK+PWKG E V+SI+ AG DAIVTSFSLISSISA   SS D+LVLGFANLVADGIS GF
Sbjct  17   RPKKPWKGGEVVKSIMNAGPDAIVTSFSLISSISATHHSSVDILVLGFANLVADGISKGF  76

Query  311  GDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKYM  490
            GD+VS+ T+RDV  K++ V EWDV++     +Q LLQHYQALGM+L DA TVV IFAKY 
Sbjct  77   GDYVSSRTQRDVAPKKRSVIEWDVINQHKPQKQGLLQHYQALGMDLTDANTVVNIFAKYR  136

Query  491  DILVAEKMAAKKGLSSPLEKGKKPAK  568
            DILV +KMA +KG S P E+G   AK
Sbjct  137  DILVDKKMATEKG-SLPQEQGIAKAK  161



>gb|KHG04908.1| Vacuolar iron transporter 1 -like protein [Gossypium arboreum]
 gb|KHG05294.1| Vacuolar iron transporter 1 -like protein [Gossypium arboreum]
 gb|KHG05425.1| Vacuolar iron transporter 1 -like protein [Gossypium arboreum]
Length=260

 Score =   183 bits (465),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 120/230 (52%), Positives = 156/230 (68%), Gaps = 5/230 (2%)
 Frame = +2

Query  101  EMEKKGKSEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFAN  280
            E E K K E     E W+GE V+SIV+AGL A+ T FSLISS+SA  LSS +VL LG AN
Sbjct  20   ESEVKDKKE-VSGMEQWRGEIVKSIVYAGLKAVFTCFSLISSVSATNLSSVEVLALGIAN  78

Query  281  LVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDAT  460
            LVADGIS   GDF+S+ST+  +  KE  V +W++ +     +++LLQ YQ+LGM+L D+ 
Sbjct  79   LVADGISSSLGDFLSSSTKEGLAIKEMAVTQWELNNHRKDQEEQLLQQYQSLGMDLIDSN  138

Query  461  TVVTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFI  640
             VV IFAKY DIL  +KM A+KG+  P + G+   KPWKNG++ F  FV FG AP+L+F+
Sbjct  139  MVVNIFAKYNDILRDQKMTAQKGVMPPDQGGE---KPWKNGVVAFLTFVGFGAAPLLSFV  195

Query  641  ILIPFTQNVTHKFMaacalsalaltllGIAKAKIAS-QSYTVSVAITLSN  787
            +L PFT N    F+ AC +SA+ALT LGIAKAKI   ++Y  SV   L N
Sbjct  196  VLKPFTDNELVMFIGACFMSAIALTFLGIAKAKICGKRNYVRSVGFVLLN  245



>gb|ACF74327.1| unknown [Arachis hypogaea]
Length=199

 Score =   178 bits (452),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 122/166 (73%), Gaps = 5/166 (3%)
 Frame = +2

Query  134  RPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFG  313
            RPKEPWKGE+V+SIV+ GLDAI+T FSLISSISA   SS  VLVLGFANLVAD ISMG G
Sbjct  26   RPKEPWKGEYVKSIVYGGLDAIITCFSLISSISASTSSSVTVLVLGFANLVADAISMGLG  85

Query  314  DFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDAT-TVVTIFAKYM  490
            D+VS  TE+DV+ KE+ V EWDV++     Q +LL H+QALGM+ NDAT  VV IF KY 
Sbjct  86   DYVSARTEQDVIIKERRVTEWDVINHIDTEQSQLLTHFQALGMDYNDATLKVVNIFKKYK  145

Query  491  DILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPI  628
            DI+V ++M A KG+    E+      PWKNGL+TF +F++FG   I
Sbjct  146  DIMVDQRMVADKGMLPADEE----VTPWKNGLVTFTSFMLFGINSI  187



>ref|XP_001784209.1| predicted protein [Physcomitrella patens]
 gb|EDQ51007.1| predicted protein [Physcomitrella patens]
Length=311

 Score =   169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 116/276 (42%), Positives = 172/276 (62%), Gaps = 28/276 (10%)
 Frame = +2

Query  92   EDGEMEKKGKSEKR-----RPKEP----WKGEFVRSIVFAGLDAIVTSFSLISSISAGRL  244
            E+G++E  G S +R     + K P      G++++SIV+ GLDAIVTSF+L++S+S G L
Sbjct  39   EEGDVEA-GNSGRRTRVVGKEKPPAAFGLGGDYLKSIVYGGLDAIVTSFALVASVSGGDL  97

Query  245  SSGDVLVLGFANLVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQH  424
             +G VLVLGFANL+ADGISMG+GD++S+  E D  A ++++A+W+V +   +   +L+  
Sbjct  98   PAGAVLVLGFANLIADGISMGYGDYLSSKAENDYAANQQLIADWEVENDIHSEMMDLVSA  157

Query  425  YQALGMELNDA--------------TTVVTIFAKYMDILVAEKMAAKKGLSSPLEKGKKP  562
            YQ  GME +DA              + +V I +KY DI+   K+   +GL  P       
Sbjct  158  YQEQGMEKDDADKDDTGIETYAGLFSQIVDILSKYKDIMADMKLTMTQGLLPP----DAE  213

Query  563  AKPWKNGLITFAAFVVFGCAPILAFIILIPFTQNVTHKFMaacalsalaltllGIAKAKI  742
              P+KNG +TF +F+ FG  P+L ++IL PFT +   KF++AC ++ LAL LLG AKA+I
Sbjct  214  DSPFKNGCVTFISFLAFGSTPLLTYLILKPFTSSNDVKFLSACIVTILALALLGAAKARI  273

Query  743  ASQSYTVSVAITLSNgaiagasayaigWTLRNVAGL  850
            + Q    S+A+ + NG IA A+AY I + L NV GL
Sbjct  274  SGQKMLSSIAVVVFNGGIAAAAAYGISYLLNNVFGL  309



>ref|XP_009760568.1| PREDICTED: uncharacterized protein LOC104212900 isoform X2 [Nicotiana 
sylvestris]
Length=200

 Score =   161 bits (407),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 95/146 (65%), Positives = 112/146 (77%), Gaps = 2/146 (1%)
 Frame = +2

Query  134  RPKEPWKG-EFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGF  310
            RPKEPWKG E V+SI+ AG DAIVTSFSLISSISA   SS D+LVLGFANLVADGIS GF
Sbjct  17   RPKEPWKGGEVVKSIMNAGPDAIVTSFSLISSISASHHSSVDILVLGFANLVADGISKGF  76

Query  311  GDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKYM  490
             D+VS+ T+RDV  K++ V EWDV++     +Q LLQ YQALGM+L DA TV+ IFAKY 
Sbjct  77   WDYVSSRTQRDVAPKKRSVTEWDVINQHKPQKQGLLQQYQALGMDLTDANTVMNIFAKYR  136

Query  491  DILVAEKMAAKKGLSSPLEKGKKPAK  568
            +ILV +KMA +KG S P E+G   AK
Sbjct  137  NILVDKKMATEKG-SLPQEQGIAKAK  161



>ref|XP_002499518.1| vacuolar iron family transporter [Micromonas sp. RCC299]
 gb|ACO60776.1| vacuolar iron family transporter [Micromonas sp. RCC299]
Length=281

 Score =   147 bits (370),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 87/231 (38%), Positives = 142/231 (61%), Gaps = 4/231 (2%)
 Frame = +2

Query  155  GEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTST  334
            G++V+S+VF GLD I+T+F+++++   G LSS  +L++GFANL+ADG+SMGFGD++S+  
Sbjct  49   GKYVKSLVFGGLDGIITTFAVVAASVGGSLSSDVILLMGFANLIADGLSMGFGDYLSSQA  108

Query  335  ERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKYMDILVAEKM  514
            E D    E    +W++ + P   ++E+++ Y   GM   DA +V+ + AKY +  +   M
Sbjct  109  EVDYTKAEHRREKWELENYPEGEKREMVELYMKRGMTEEDAVSVIDVMAKYKNFFLDVMM  168

Query  515  AAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFIILIPFTQNVTHKFMaaca  694
              + GL  P E       PWKNG++TFA+FV FG  P+L++++      + +  F+ AC 
Sbjct  169  VEELGLMPPDEDD----SPWKNGVVTFASFVFFGFIPLLSYVLSSATGASDSVNFVVACI  224

Query  695  lsalaltllGIAKAKIASQSYTVSVAITLSNgaiagasayaigWTLRNVAG  847
            L+ + + LLG AKAK  +QS   S  + L NG +A  +AY + W + +  G
Sbjct  225  LTGVTMFLLGAAKAKFTNQSMLRSALLMLLNGGMAAVAAYLVSWGIASAMG  275



>ref|XP_003057924.1| vacuolar iron transporter family [Micromonas pusilla CCMP1545]
 gb|EEH57875.1| vacuolar iron transporter family [Micromonas pusilla CCMP1545]
Length=279

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 91/226 (40%), Positives = 142/226 (63%), Gaps = 4/226 (2%)
 Frame = +2

Query  155  GEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTST  334
            G++V+S+VF GLD I+T+F+++++   G L S  +L++GFANLVADG+SMGFGD++S+  
Sbjct  54   GKYVKSLVFGGLDGIITTFAVVAASVGGSLGSDVILLMGFANLVADGLSMGFGDYLSSKA  113

Query  335  ERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKYMDILVAEKM  514
            E +    E    +W++ + P   ++E+++ Y A GM   DA  V+ + AKY +  +   M
Sbjct  114  EFEYTRAEHKREKWELDNYPEGEKREMVELYVARGMTEADAENVIDVMAKYPNFFLDVMM  173

Query  515  AAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFIILIPFTQNVTHKFMaaca  694
              + GL  P + G+ PA   KNGL+TF AFV FG  P+ ++++      +    F+AAC 
Sbjct  174  VEELGLMPP-DDGESPA---KNGLVTFLAFVCFGFVPLTSYVLAGVTGASADANFIAACV  229

Query  695  lsalaltllGIAKAKIASQSYTVSVAITLSNgaiagasayaigWTL  832
            L+AL +  LG AKAK  +QS T S A+ L NG+IA  +AY + W +
Sbjct  230  LTALMMLALGAAKAKFTNQSTTRSAALMLLNGSIAATAAYLVSWGI  275



>ref|XP_004998958.1| vacuolar iron family transporter [Salpingoeca rosetta]
 gb|EGD72389.1| vacuolar iron family transporter [Salpingoeca rosetta]
Length=377

 Score =   137 bits (344),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 91/250 (36%), Positives = 154/250 (62%), Gaps = 9/250 (4%)
 Frame = +2

Query  116  GKSEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADG  295
            G + +R   E   G++V++ VF G+D IVT+F++++S++   L++G V+++GFANL+ADG
Sbjct  132  GAAPERHQTE--AGQYVKAAVFGGMDGIVTTFAVVASVNGADLATGVVIIMGFANLIADG  189

Query  296  ISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTI  475
            ISMG G+F+S  +E      E++  EW+  H P    +E++  Y   G    +AT ++TI
Sbjct  190  ISMGMGEFMSALSESQYTLSERVREEWEFDHNPEGEIKEMVDLYMEKGFSEEEATQIMTI  249

Query  476  FAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFIIL--I  649
             AK+ +  +   M  + GL  P ++G+ PA   KNGL+ F +FV FG  P+L+++ L  +
Sbjct  250  MAKHREFFIDHMMVEELGLMPP-DEGESPA---KNGLVMFLSFVAFGLVPLLSYLALSTV  305

Query  650  PFTQNVTHK-FMaacalsalaltllGIAKAKIASQSYTVSVAITLSNgaiagasayaigW  826
             F  N +   F  ACA++A+AL +LG  K++ ++QS+ +S    + NGA++  +AY +G 
Sbjct  306  DFGSNKSDALFGIACAMTAVALFILGAVKSRFSTQSWYMSGFSVVINGAVSAGAAYLVGL  365

Query  827  TLRNVAGLED  856
             L N+  L D
Sbjct  366  GLENLVSLND  375



>ref|XP_007514497.1| hypothetical protein Bathy02g05280 [Bathycoccus prasinos]
 emb|CCO14737.1| hypothetical protein Bathy02g05280 [Bathycoccus prasinos]
Length=299

 Score =   134 bits (336),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 88/234 (38%), Positives = 140/234 (60%), Gaps = 6/234 (3%)
 Frame = +2

Query  155  GEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTST  334
            G++V+S+VF GLD I+T+F+++++   G LS+  VL++GFANL ADG+SMGFGDF+S+  
Sbjct  69   GKYVKSLVFGGLDGIITTFAVVAASKGGSLSTEIVLLMGFANLFADGLSMGFGDFLSSKA  128

Query  335  ERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKYMDILVAEKM  514
            E +    EK   +W+  + P   ++E+++ Y   GM+  DAT ++   +KY DI V   M
Sbjct  129  EHEYATTEKKREKWEFDNFPEGEKREMVEIYMQRGMKEEDATIIIETMSKYEDIFVDVMM  188

Query  515  AAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFII-LIPFTQNVTHKFMaac  691
              + GL  P E+       + NGL+TF AF +FG  P++ ++I  +  + +    F++AC
Sbjct  189  VEELGLMPPEEE-----SSFMNGLVTFVAFSLFGFVPLMPYLIGRLAKSGSEDALFVSAC  243

Query  692  alsalaltllGIAKAKIASQSYTVSVAITLSNgaiagasayaigWTLRNVAGLE  853
            AL+A  L  LG AKAK  +Q+   S    L NG +A   AY + W +    G++
Sbjct  244  ALTAFTLFSLGAAKAKFTNQAQVKSGFFMLMNGGLAAICAYLVSWGISEGLGVK  297



>ref|XP_003080166.1| unnamed protein product [Ostreococcus tauri]
 emb|CAL54333.1| Domain of unknown function DUF125, transmembrane [Ostreococcus 
tauri]
Length=266

 Score =   133 bits (334),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 84/218 (39%), Positives = 125/218 (57%), Gaps = 17/218 (8%)
 Frame = +2

Query  155  GEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTST  334
            G +V+S+VF GLD  +T+F+++++   G L +  VL++GFANLVADG+SMGFGD++S+  
Sbjct  38   GRYVKSLVFGGLDGTITTFAVVAASKGGGLDANVVLLMGFANLVADGLSMGFGDYLSSKA  97

Query  335  ERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKYMDILVAEKM  514
            E +    EK   +W++ + P   ++E+++ Y A GM   DAT+V+   AKY +  +   M
Sbjct  98   ELEYARTEKKREKWELENYPEGEKREMIELYMARGMTEEDATSVINTLAKYKNFFLDLMM  157

Query  515  AAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFIILIPFT-------QNVTH  673
              + GL  P E       P KNGL+TF AF +FG      FI LIP+         +   
Sbjct  158  VEELGLMPPDETD----SPAKNGLVTFCAFGLFG------FIPLIPYVFGRAIGGASANA  207

Query  674  KFMaacalsalaltllGIAKAKIASQSYTVSVAITLSN  787
             F +ACAL+A  +  LG AKAK  +Q   +S    L N
Sbjct  208  MFGSACALTAFTMAALGAAKAKFTNQQVGMSALYMLIN  245



>ref|XP_001418832.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO97125.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=215

 Score =   131 bits (330),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 81/210 (39%), Positives = 123/210 (59%), Gaps = 5/210 (2%)
 Frame = +2

Query  161  FVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTSTER  340
            +V+S+VF GLD  +T+F+++++   G LS+  VL++GFANLVADGISMGFGD++S+  E 
Sbjct  1    YVKSLVFGGLDGTITTFAVVAASKGGGLSTEVVLLMGFANLVADGISMGFGDYLSSKAEL  60

Query  341  DVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKYMDILVAEKMAA  520
            D    EK   +W++ + P   ++E+++ + A G+   DAT V+   AKY +  +   M  
Sbjct  61   DYAKTEKKREKWELENYPEGEKREMIELFMARGVSEEDATMVIERLAKYKNFFLDLMMVE  120

Query  521  KKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFIILIPF-TQNVTHKFMaacal  697
            + GL  P E       P KNGL+TF AF +FG  P++ ++        N    F  AC L
Sbjct  121  ELGLMPPDETD----SPAKNGLVTFCAFALFGFVPLVPYVFGRAIGGANGDALFGLACGL  176

Query  698  salaltllGIAKAKIASQSYTVSVAITLSN  787
            +A+ +  LG AKAK  +Q+ T S    L N
Sbjct  177  TAMTMAALGAAKAKFTNQNVTSSALYMLLN  206



>ref|XP_010249419.1| PREDICTED: uncharacterized protein LOC104591961 [Nelumbo nucifera]
Length=126

 Score =   122 bits (305),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 75/114 (66%), Gaps = 6/114 (5%)
 Frame = +2

Query  302  MGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDAT--TVVTI  475
            MGF  F+S  T++D + +E++V EWDV +     Q EL+Q YQ LGM L DAT  TVV +
Sbjct  1    MGFAYFISIGTKKDAIEEERLVTEWDVNNHGRQQQMELIQRYQQLGMSLEDATTVTVVNV  60

Query  476  FAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAF  637
            F+KY DIL+ EKM  +KG+ SP        K WKNG++T AAF  FGCAP+L F
Sbjct  61   FSKYKDILIDEKMTTQKGMQSP----DNEEKAWKNGVVTLAAFFAFGCAPLLPF  110



>gb|ETO33784.1| hypothetical protein RFI_03318 [Reticulomyxa filosa]
Length=472

 Score =   127 bits (319),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 62/166 (37%), Positives = 101/166 (61%), Gaps = 4/166 (2%)
 Frame = +2

Query  155  GEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTST  334
            GEFV+SI++ GLD IVT+F+++S++    L    VLVLGFANL+ADG +MG GD++S S 
Sbjct  127  GEFVKSIIYGGLDGIVTTFAIVSAVHGANLKPEVVLVLGFANLIADGFAMGIGDYLSESA  186

Query  335  ERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKYMDILVAEKM  514
            E D    E+   +W+  +       E+++ Y+  G++  DA  ++   AKY D  +   +
Sbjct  187  EFDFAKSERNREKWEFENFKEGEISEMVEIYEKKGVKKEDAELILRTMAKYPDFFIDHML  246

Query  515  AAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFIILIP  652
              +  +  P+E+G+      KNGL+T A+F+ FGC P+L +++  P
Sbjct  247  IEELNI-QPVEEGESAV---KNGLVTMASFLCFGCIPLLTYVVTAP  288



>ref|XP_001743284.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ91998.1| predicted protein [Monosiga brevicollis MX1]
Length=264

 Score =   124 bits (311),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 74/216 (34%), Positives = 130/216 (60%), Gaps = 9/216 (4%)
 Frame = +2

Query  155  GEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTST  334
            G+++++ VF GLD I+T+F++++S++   LS+G V+++GFANL+ADG+SMG G+++S  +
Sbjct  30   GQYIKAAVFGGLDGIITTFAVVASVTGANLSAGVVIIMGFANLLADGLSMGVGEYLSGVS  89

Query  335  ERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKYMDILVAEKM  514
            E      E+   EW+  +      QE+++ Y   G+  +DA  ++ +  KY D  V   +
Sbjct  90   ELQFAQAERQREEWETENYLAGEVQEMVELYMEKGVTESDARQILDVMVKYKDFFVDHML  149

Query  515  AAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFIIL--IPF---TQNVTHKF  679
              + G+  P E       P KNGL+ F +FVVFG  P+L+++ L  + F   ++N    F
Sbjct  150  VQELGIMPPDES----ESPAKNGLVMFCSFVVFGLVPLLSYLALSTVDFGSESENDNALF  205

Query  680  MaacalsalaltllGIAKAKIASQSYTVSVAITLSN  787
              AC L+A+AL +LG  K++ ++Q++  S  + L N
Sbjct  206  GIACGLTAMALFVLGAIKSRFSTQTWYYSGLMVLVN  241



>ref|WP_021654933.1| membrane protein [Clostridiales bacterium oral taxon 876]
 gb|ERI93083.1| membrane protein [Clostridiales bacterium oral taxon 876 str. 
F0540]
Length=263

 Score =   124 bits (311),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 78/226 (35%), Positives = 134/226 (59%), Gaps = 21/226 (9%)
 Frame = +2

Query  119  KSEKRRPKEPWK-----GEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANL  283
            K+ + RP +  +     G++++S+++ GLD I+T+F++++ ++   LS G VL++GFANL
Sbjct  23   KAHQPRPTKAEENHSAAGQYIKSVIYGGLDGIITTFAVVAGVAGAALSPGVVLIMGFANL  82

Query  284  VADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATT  463
            V DG+SM  GD++ST  E +  A E+    W+V H P   +QEL++ Y   GM   DA T
Sbjct  83   VGDGLSMAIGDYLSTKAEMEFQASEREREAWEVEHFPHGEKQELMELYIQKGMTEEDAKT  142

Query  464  VVTIFAK----YMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPIL  631
            V  I +K    ++DI++ E++   +   SP+          KN L+TFA+F++FG  P+L
Sbjct  143  VTDIISKNKEAWVDIMMVEELGILQESESPI----------KNALVTFASFILFGFIPVL  192

Query  632  AFIILIPFTQNVT-HKFMaacalsalaltllGIAKAKIASQSYTVS  766
             + +L  F  N++ + F  +  L+ L L +LG  K K+  +++ VS
Sbjct  193  TY-VLSRFIPNLSINIFALSSVLTGLTLFILGALKTKVTGKNWIVS  237



>ref|WP_017414920.1| hypothetical protein [Clostridium tunisiense]
Length=259

 Score =   124 bits (310),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 74/214 (35%), Positives = 117/214 (55%), Gaps = 31/214 (14%)
 Frame = +2

Query  56   ESSRYVQLGGSVEDGEMEKKGKSEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISA  235
            E S+   LG + E+ +ME               G +++S+V+ G+D I+T+F++++ +  
Sbjct  19   EESKKAHLGAAGENHKME---------------GNYIKSLVYGGMDGIITTFAVVAGVVG  63

Query  236  GRLSSGDVLVLGFANLVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQEL  415
              LSSG +L+LG ANL+ADG SM  GD++ST  E +    E+    W+V + P   + EL
Sbjct  64   ASLSSGVILILGMANLLADGFSMAIGDYLSTKAEMEFKKGERAREAWEVENYPQGEKLEL  123

Query  416  LQHYQALGMELNDATTVVTIFAKY----MDILVAEKMAAKKGLSSPLEKGKKPAKPWKNG  583
             + Y A G+   D+  +V I +K+    +DI++ E++   +   SPL          KN 
Sbjct  124  KEIYMAKGISEEDSKQIVDIISKHKKAWVDIMMVEELGILEDNESPL----------KNA  173

Query  584  LITFAAFVVFGCAPILAFII--LIPFTQNVTHKF  679
            L+TF +FVVFG  P+LA+II   I F QN    F
Sbjct  174  LVTFFSFVVFGFIPVLAYIIGVKIDFIQNNVFAF  207



>ref|WP_040212637.1| membrane protein [Clostridium sp. MS1]
Length=263

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/188 (35%), Positives = 114/188 (61%), Gaps = 19/188 (10%)
 Frame = +2

Query  110  KKGKSEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVA  289
            ++GK EK   ++   G++++S+V+ GLD I+T+F++++ ++   LS   VL++GFANL+A
Sbjct  28   QQGKYEKHNTEQ---GQYIKSLVYGGLDGIITTFAVVAGVAGASLSPAIVLIMGFANLIA  84

Query  290  DGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVV  469
            DG+SM  GD++ST  E    + E+    W+V + P   + EL++ Y   GM   DA TV 
Sbjct  85   DGLSMAIGDYLSTKAEMQYKSLERERETWEVENYPEGEKLELIELYMDKGMSQEDAETVT  144

Query  470  TIFAK----YMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAF  637
             I +K    ++DI++ E++   +   SP+          KN ++TF +FV+FG  PILA+
Sbjct  145  EIISKNEKTWVDIMMIEELGIIEEEESPV----------KNAMVTFTSFVIFGFIPILAY  194

Query  638  II--LIPF  655
            ++   IP+
Sbjct  195  VLSRFIPY  202



>ref|WP_021285175.1| hypothetical protein [Clostridium sp. BL8]
 gb|EQB86346.1| hypothetical protein M918_14745 [Clostridium sp. BL8]
Length=259

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 74/211 (35%), Positives = 115/211 (55%), Gaps = 32/211 (15%)
 Frame = +2

Query  56   ESSRYVQLGGSVEDGEMEKKGKSEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISA  235
            E S+   LG S E+ +ME               G +++S+V+ G+D I+T+F++++ +  
Sbjct  19   EESKKAHLGASTENHKME---------------GNYIKSLVYGGMDGIITTFAVVAGVVG  63

Query  236  GRLSSGDVLVLGFANLVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQEL  415
              LSSG +L+LG ANL+ADG SM  GD++ST  E +    E+    W+V + P   + EL
Sbjct  64   ASLSSGVILILGMANLLADGFSMAIGDYLSTKAEMEFKKGERAREAWEVKNYPEGEKLEL  123

Query  416  LQHYQALGMELNDATTVVTIFAKY----MDILVAEKMAAKKGLSSPLEKGKKPAKPWKNG  583
             + Y A G+   D+  +V I +K+    +DI++ E++   +   SPL          KN 
Sbjct  124  KEIYMAKGINEEDSNQLVDIISKHKEAWVDIMMVEELGILEDSESPL----------KNA  173

Query  584  LITFAAFVVFGCAPILAFIILIP---FTQNV  667
            L+TF +F VFG  PILA+II I      QNV
Sbjct  174  LVTFFSFAVFGFIPILAYIIGIKIDFIEQNV  204



>ref|XP_004034652.1| hypothetical protein IMG5_116370 [Ichthyophthirius multifiliis]
 gb|EGR31166.1| hypothetical protein IMG5_116370 [Ichthyophthirius multifiliis]
Length=261

 Score =   121 bits (303),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 58/167 (35%), Positives = 98/167 (59%), Gaps = 6/167 (4%)
 Frame = +2

Query  155  GEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTST  334
            G F++S V+ GLD ++T++S++  ++   L SG +L LG ANL+ DG+SM  GD++S+ +
Sbjct  40   GIFIKSAVYGGLDGMITTYSVVMGVAGANLQSGVILALGIANLIGDGLSMALGDYLSSKS  99

Query  335  ERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKYMDILVAEKM  514
            E D   KE++  EW+V + P   ++E+++ YQ  G+   D+  +V I +KY  + +   M
Sbjct  100  ECDFYKKERMREEWEVDNNPEGEKEEMIEVYQKKGITYADSKALVDILSKYKKVWIDTMM  159

Query  515  AAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFIILIPF  655
              + G+    E       P  N ++TF +FV+FG  P+L FI    F
Sbjct  160  VDELGILPNDE------NPIYNAIVTFVSFVIFGSVPLLPFIFGFAF  200



>ref|XP_004989180.1| vacuolar iron family transporter [Salpingoeca rosetta]
 gb|EGD79411.1| vacuolar iron family transporter [Salpingoeca rosetta]
Length=477

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/165 (33%), Positives = 98/165 (59%), Gaps = 4/165 (2%)
 Frame = +2

Query  152  KGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTS  331
            +G+++++ VF GLD I+T+F+ ++S++   LS G V+++GFANL+ DG+SMG G+++S  
Sbjct  243  EGQYIKAAVFGGLDGIITTFATVASVTGANLSIGVVIIMGFANLIGDGLSMGVGEYLSAQ  302

Query  332  TERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKYMDILVAEK  511
            +E      E+   EW+  + P    +E+L+ Y+  G    DA   +++  ++ D  +   
Sbjct  303  SELQYAVSERNREEWEFDNNPSGEVREMLELYRKRGFSTQDAMQAISVMVQHPDFFIDHM  362

Query  512  MAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFIIL  646
            M  + GL  P         P + GL+ F AFVVFG  P+L++++L
Sbjct  363  MVEELGLMPP----DTSVSPARKGLVMFTAFVVFGLIPLLSYLVL  403



>gb|ETO28210.1| hypothetical protein RFI_08923 [Reticulomyxa filosa]
Length=315

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/166 (36%), Positives = 99/166 (60%), Gaps = 4/166 (2%)
 Frame = +2

Query  155  GEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTST  334
            GE+V+SI++ GLD I+T+F+++S++    L    VLVLGFANL+ADG SMG GD++S S 
Sbjct  98   GEYVKSIIYGGLDGIITTFAVVSAVHGANLEPETVLVLGFANLIADGFSMGMGDYLSESA  157

Query  335  ERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKYMDILVAEKM  514
            E D    E+   +W+  +       E+++ Y+  G+   DA  ++   AKY D  +   +
Sbjct  158  EYDFARSERDREKWEFENFQEGEILEMIEIYETKGITKEDAEVILRTMAKYPDFFIDHML  217

Query  515  AAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFIILIP  652
              +  +  P+E+ +      KNGL T A+F++FG  P+L++ ++ P
Sbjct  218  IEELNI-QPVEEHESAI---KNGLATMASFLIFGSIPLLSYAVMAP  259



>ref|XP_009035578.1| hypothetical protein AURANDRAFT_24305 [Aureococcus anophagefferens]
 gb|EGB09514.1| hypothetical protein AURANDRAFT_24305 [Aureococcus anophagefferens]
Length=278

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 66/197 (34%), Positives = 106/197 (54%), Gaps = 6/197 (3%)
 Frame = +2

Query  86   SVEDGEMEKKGKSEK----RRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSG  253
            S  D E+  K  +E+       +    G  +++IVF GLD I+T F+++SS +   +S  
Sbjct  20   SALDVELSSKAHAERASGTHDEQHSAVGGRLKTIVFGGLDGILTCFAIVSSCAGSDMSPR  79

Query  254  DVLVLGFANLVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQA  433
             VL+LG  N++AD ++MG G+++ST +  +  + E+   +W++ H P     E++  Y  
Sbjct  80   VVLLLGACNILADALAMGVGEYLSTKSSDEFASYERTREDWEMRHNPEGEILEMVDIYVG  139

Query  434  LGMELNDATTVVTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVF  613
             GM   DATTV+T  AKY D  V   M  + GL+ P  +    A   K+G + F AF VF
Sbjct  140  RGMSREDATTVITTMAKYHDFFVNVMMVEELGLTVPEPEAHCDA--MKDGFLMFLAFCVF  197

Query  614  GCAPILAFIILIPFTQN  664
            G  P+L + +L  F  +
Sbjct  198  GAFPLLGYALLPQFRPD  214



>gb|KDO25654.1| hypothetical protein SPRG_08953 [Saprolegnia parasitica CBS 223.65]
Length=281

 Score =   117 bits (293),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 62/172 (36%), Positives = 106/172 (62%), Gaps = 13/172 (8%)
 Frame = +2

Query  152  KGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTS  331
             G  ++S VF GLD I+T+F+ ++S++   L    +L+LG A+LVADG+SMG GD++ST 
Sbjct  46   NGGHIKSAVFGGLDGIITTFATVTSVAGSGLPHAVILILGLAHLVADGLSMGMGDYLSTQ  105

Query  332  TERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKY----MDIL  499
             E D++  E+    W++ + P   + E+++ Y+A G+   DA  VV   +KY    +DI+
Sbjct  106  AETDLINHERSRELWEMENFPEGEKAEMIELYEAKGISSEDAKIVVDTLSKYKEAFVDIM  165

Query  500  VAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFII-LIP  652
            + E++        P++  +    P+  GLITF +FV+FG  P+L+++I L+P
Sbjct  166  MVEELKLM-----PVDDDE---NPFIGGLITFGSFVLFGAVPLLSYLINLLP  209



>ref|XP_001431434.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK64036.1| unnamed protein product [Paramecium tetraurelia]
Length=263

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 60/179 (34%), Positives = 103/179 (58%), Gaps = 6/179 (3%)
 Frame = +2

Query  107  EKKGKSEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLV  286
            E++   E    K    GE ++S V+ GLD +VT+FS+++ ++   LS+G VL +G ANL+
Sbjct  24   EQQQLKEDHEEKHQSGGEHIKSAVYGGLDGMVTTFSVVAGVAGAGLSTGVVLGMGIANLI  83

Query  287  ADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTV  466
             DGISM  GD++ST +E +    E+   +W+V   P   ++E+++ Y++ G++ ++A  +
Sbjct  84   GDGISMALGDYISTRSEAEFTINERNREQWEVETNPEGEKKEMVEIYKSKGIDHDEAVII  143

Query  467  VTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFII  643
                AK   + V   M  + GL S  E       P K+ ++TF +F +FG  P+L FI+
Sbjct  144  AETLAKNKKVWVDVMMVEELGLMSIDE------HPIKDAIVTFFSFGLFGLMPLLPFIV  196



>gb|KHO46772.1| hypothetical protein QS98_C0001G0031 [archaeon GW2011_AR3]
Length=265

 Score =   114 bits (284),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 61/179 (34%), Positives = 104/179 (58%), Gaps = 6/179 (3%)
 Frame = +2

Query  107  EKKGKSEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLV  286
             +KG  EK    + + G+++   V+ GLD  VT+F+++S++    L+ G V+++GFANL+
Sbjct  25   HEKGVIEKSLHGKSFGGKYIGDFVYGGLDGTVTTFAIVSAVQGAALNPGIVIIMGFANLL  84

Query  287  ADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTV  466
            ADG SM  G+++ST  E +   +E+   EW++ H P   ++E+ Q Y+  G +  D    
Sbjct  85   ADGFSMATGNYLSTKAELEFQNEERKREEWEIEHVPDGEREEIRQIYKKKGFKGKDLDKA  144

Query  467  VTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFII  643
            V I      I V + M  ++   SP EK     +PW++ L TF+AF++ G  PIL+F++
Sbjct  145  VGIITSDKKIWV-DTMMMEELHFSPTEK-----RPWQSALATFSAFILAGFVPILSFVM  197



>gb|KFH13784.1| putative integral membrane protein [Toxoplasma gondii MAS]
Length=302

 Score =   114 bits (284),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 74/214 (35%), Positives = 113/214 (53%), Gaps = 8/214 (4%)
 Frame = +2

Query  158  EFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTSTE  337
            ++V+++VF GLD IVT F++++      LS   VL++G  NL+AD ISMGFG++VS + E
Sbjct  67   DYVKAVVFGGLDGIVTIFAIVAGCVGADLSCSQVLMVGLGNLLADAISMGFGEYVSAAAE  126

Query  338  RDVVAKEKIVAEWDVMHTPIALQQELLQHY-QALGMELNDATTVVTIFAKYMDILVAEKM  514
            +D V  EK   EW+V + P   ++E+++ Y +  G    DA ++V I  KY    V   M
Sbjct  127  KDFVEAEKQREEWEVENCPEEEKREMVEIYTEKYGFSRADAQSMVDITFKYKKFFVQHMM  186

Query  515  AAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFIILIP---FTQNVTHKFMa  685
              + GL    ++      P K GL+ F AF  FG  P+  FI  +            F+ 
Sbjct  187  VEELGLMYGFDE----PTPIKRGLVMFTAFCFFGLLPLAGFIGWVAAFGLGAEADMAFLM  242

Query  686  acalsalaltllGIAKAKIASQSYTVSVAITLSN  787
            AC +S + L +LG +K K   Q+ T S  +   N
Sbjct  243  ACVVSIMTLFILGFSKGKFVGQNPTKSACLMAMN  276



>ref|XP_002368759.1| integral membrane protein, putative [Toxoplasma gondii ME49]
 gb|EPR57123.1| putative integral membrane protein [Toxoplasma gondii GT1]
 gb|EPT27634.1| integral membrane protein, putative [Toxoplasma gondii ME49]
 gb|ESS33502.1| putative integral membrane protein [Toxoplasma gondii VEG]
 gb|KFG28131.1| putative integral membrane protein [Toxoplasma gondii p89]
 gb|KFG38757.1| putative integral membrane protein [Toxoplasma gondii GAB2-2007-GAL-DOM2]
 gb|KFG43162.1| putative integral membrane protein [Toxoplasma gondii FOU]
 gb|KFG58871.1| putative integral membrane protein [Toxoplasma gondii RUB]
 gb|KFH01807.1| putative integral membrane protein [Toxoplasma gondii VAND]
Length=302

 Score =   114 bits (284),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 74/214 (35%), Positives = 113/214 (53%), Gaps = 8/214 (4%)
 Frame = +2

Query  158  EFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTSTE  337
            ++V+++VF GLD IVT F++++      LS   VL++G  NL+AD ISMGFG++VS + E
Sbjct  67   DYVKAVVFGGLDGIVTIFAIVAGCVGADLSCSQVLMVGLGNLLADAISMGFGEYVSAAAE  126

Query  338  RDVVAKEKIVAEWDVMHTPIALQQELLQHY-QALGMELNDATTVVTIFAKYMDILVAEKM  514
            +D V  EK   EW+V + P   ++E+++ Y +  G    DA ++V I  KY    V   M
Sbjct  127  KDFVEAEKQREEWEVENCPEEEKREMVEIYTEKYGFSRADAQSMVDITFKYKKFFVQHMM  186

Query  515  AAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFIILIP---FTQNVTHKFMa  685
              + GL    ++      P K GL+ F AF  FG  P+  FI  +            F+ 
Sbjct  187  VEELGLMYGFDE----PTPIKRGLVMFTAFCFFGLLPLAGFIGWVAAFGLGAEADMAFLM  242

Query  686  acalsalaltllGIAKAKIASQSYTVSVAITLSN  787
            AC +S + L +LG +K K   Q+ T S  +   N
Sbjct  243  ACVVSIMTLFILGFSKGKFVGQNPTKSACLMAMN  276



>ref|XP_008888441.1| integral membrane protein, putative [Hammondia hammondi]
 gb|KEP60943.1| integral membrane protein, putative [Hammondia hammondi]
Length=302

 Score =   113 bits (283),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 75/214 (35%), Positives = 113/214 (53%), Gaps = 8/214 (4%)
 Frame = +2

Query  158  EFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTSTE  337
            ++V+++VF GLD IVT F++++      LS   VL++G  NL+AD ISMGFG++VS + E
Sbjct  67   DYVKAVVFGGLDGIVTIFAIVAGCVGADLSCSQVLMVGLGNLLADAISMGFGEYVSAAAE  126

Query  338  RDVVAKEKIVAEWDVMHTPIALQQELLQHY-QALGMELNDATTVVTIFAKYMDILVAEKM  514
            +D V  EK   EW+V + P   ++E+++ Y +  G    DA ++V I  KY    V   M
Sbjct  127  KDFVEAEKQREEWEVENCPEEEKREMVEIYTEKYGFSRADAQSMVDITFKYKKFFVQHMM  186

Query  515  AAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFIILIP---FTQNVTHKFMa  685
              + GL    ++      P K GL+ F AF  FG  P+  FI  +            F+ 
Sbjct  187  VEELGLMYGFDE----PTPIKRGLVMFTAFCFFGLLPLAGFIGWVAAFGLGAEADMAFLM  242

Query  686  acalsalaltllGIAKAKIASQSYTVSVAITLSN  787
            AC +S L L +LG +K K   Q+ T S  +   N
Sbjct  243  ACVVSILTLFVLGFSKGKFVGQNPTKSACLMALN  276



>ref|XP_003880882.1| putative integral membrane protein [Neospora caninum Liverpool]
 emb|CBZ50849.1| putative integral membrane protein [Neospora caninum Liverpool]
Length=302

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 76/214 (36%), Positives = 112/214 (52%), Gaps = 8/214 (4%)
 Frame = +2

Query  158  EFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTSTE  337
            ++V+++VF GLD IVT F++++      LS   VL++G  NL+AD ISMGFG++VS + E
Sbjct  67   DYVKAVVFGGLDGIVTIFAIVAGCVGADLSCSQVLMVGLGNLLADAISMGFGEYVSAAAE  126

Query  338  RDVVAKEKIVAEWDVMHTPIALQQELLQHY-QALGMELNDATTVVTIFAKYMDILVAEKM  514
            +D V  EK   EW+V + P   ++E+++ Y +  G    DA ++V I  KY    V   M
Sbjct  127  KDFVEAEKQREEWEVENCPEEEKREMVEIYTEKYGFSRADAQSMVDITFKYKKFFVQHMM  186

Query  515  AAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFIILIP---FTQNVTHKFMa  685
              + GL      G     P K GL+ F AF  FG  P+  FI  +            F+ 
Sbjct  187  VEELGLM----YGFDEPTPIKRGLVMFTAFCFFGLLPLAGFIGWVAAFGLGAEADMAFLM  242

Query  686  acalsalaltllGIAKAKIASQSYTVSVAITLSN  787
            AC +S L L +LG +K K   Q+ T S  +   N
Sbjct  243  ACVVSILTLFVLGFSKGKFVGQNPTKSACLMALN  276



>emb|CCW71153.1| unnamed protein product [Phytomonas sp. isolate Hart1]
Length=278

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/179 (32%), Positives = 100/179 (56%), Gaps = 8/179 (4%)
 Frame = +2

Query  119  KSEKRRP-----KEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANL  283
            +SE  +P           E+++SIVF GLD I+T F++IS+ +    +   VL+ GF+N+
Sbjct  31   RSEHNKPMNIESHNSSTSEYIKSIVFGGLDGIMTCFAVISAAAGSNGNYTTVLIFGFSNV  90

Query  284  VADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATT  463
            +ADG +MGFG+++S + ER+    E++  EW+V +       E++Q Y   G+   DA+T
Sbjct  91   IADGFTMGFGEYISGAAERENAMAERMREEWEVENAFDMEVDEMIQIYMDKGLSFEDAST  150

Query  464  VVTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFI  640
            +V+I +K   + V   M  + GL   ++    P  P K G +   +F+ FG  P+ A++
Sbjct  151  IVSIISKDHKVFVDFMMVEELGLLLDID---DPHGPKKQGTVMAISFICFGLVPLFAYL  206



>gb|ETK71867.1| hypothetical protein L915_20945, partial [Phytophthora parasitica]
 gb|ETL25296.1| hypothetical protein L916_20827, partial [Phytophthora parasitica]
Length=338

 Score =   112 bits (279),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 57/171 (33%), Positives = 103/171 (60%), Gaps = 13/171 (8%)
 Frame = +2

Query  155  GEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTST  334
            GE ++S V+ GLD I+T+F+ ++S++   L    +L++G A+LVADG+SMG GD +S+  
Sbjct  106  GEHIKSAVYGGLDGIITTFATVTSVAGSGLPHSVILIIGLAHLVADGLSMGLGDMLSSQA  165

Query  335  ERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKY----MDILV  502
            E D+   E+   +W+  + P    +E+++ Y+  G+  +DA  VV   AKY    +DI++
Sbjct  166  EADLANHERSREQWEFENYPEGEIEEMVELYEKKGISTDDALLVVHTLAKYKEAFIDIMM  225

Query  503  AEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFII-LIP  652
             E++        P++       P   G+ITF +F++FG  P+L++++ L+P
Sbjct  226  VEELNIM-----PVDDDD---SPLMGGIITFVSFMLFGVIPLLSYLVNLVP  268



>gb|ETL78520.1| hypothetical protein L917_20677, partial [Phytophthora parasitica]
Length=338

 Score =   111 bits (278),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 57/171 (33%), Positives = 103/171 (60%), Gaps = 13/171 (8%)
 Frame = +2

Query  155  GEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTST  334
            GE ++S V+ GLD I+T+F+ ++S++   L    +L++G A+LVADG+SMG GD +S+  
Sbjct  106  GEHIKSAVYGGLDGIITTFATVTSVAGSGLPHSVILIIGLAHLVADGLSMGLGDMLSSQA  165

Query  335  ERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKY----MDILV  502
            E D+   E+   +W+  + P    +E+++ Y+  G+  +DA  VV   AKY    +DI++
Sbjct  166  EADLANHERSREQWEFENYPEGEIEEMVELYEKKGISTDDALLVVHTLAKYKEAFIDIMM  225

Query  503  AEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFII-LIP  652
             E++        P++       P   G+ITF +F++FG  P+L++++ L+P
Sbjct  226  VEELNIM-----PVDDDD---SPLMGGIITFVSFMLFGVIPLLSYLVNLVP  268



>gb|ETP01296.1| hypothetical protein F441_21432 [Phytophthora parasitica CJ01A1]
Length=306

 Score =   111 bits (277),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 57/171 (33%), Positives = 103/171 (60%), Gaps = 13/171 (8%)
 Frame = +2

Query  155  GEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTST  334
            GE ++S V+ GLD I+T+F+ ++S++   L    +L++G A+LVADG+SMG GD +S+  
Sbjct  74   GEHIKSAVYGGLDGIITTFATVTSVAGSGLPHSVILIIGLAHLVADGLSMGLGDMLSSQA  133

Query  335  ERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKY----MDILV  502
            E D+   E+   +W+  + P    +E+++ Y+  G+  +DA  VV   AKY    +DI++
Sbjct  134  EADLANHERSREQWEFENYPEGEIEEMVELYEKKGISTDDALLVVHTLAKYKEAFIDIMM  193

Query  503  AEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFII-LIP  652
             E++        P++       P   G+ITF +F++FG  P+L++++ L+P
Sbjct  194  VEELNIM-----PVDDDD---SPLMGGIITFVSFMLFGVIPLLSYLVNLVP  236



>ref|XP_008898426.1| hypothetical protein PPTG_06277 [Phytophthora parasitica INRA-310]
 gb|ETI31481.1| hypothetical protein F443_21548 [Phytophthora parasitica P1569]
 gb|ETM31787.1| hypothetical protein L914_20694 [Phytophthora parasitica]
 gb|ETN16046.1| hypothetical protein PPTG_06277 [Phytophthora parasitica INRA-310]
 gb|ETO60207.1| hypothetical protein F444_21563 [Phytophthora parasitica P1976]
 gb|ETP29455.1| hypothetical protein F442_21389 [Phytophthora parasitica P10297]
Length=306

 Score =   111 bits (277),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 57/171 (33%), Positives = 103/171 (60%), Gaps = 13/171 (8%)
 Frame = +2

Query  155  GEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTST  334
            GE ++S V+ GLD I+T+F+ ++S++   L    +L++G A+LVADG+SMG GD +S+  
Sbjct  74   GEHIKSAVYGGLDGIITTFATVTSVAGSGLPHSVILIIGLAHLVADGLSMGLGDMLSSQA  133

Query  335  ERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKY----MDILV  502
            E D+   E+   +W+  + P    +E+++ Y+  G+  +DA  VV   AKY    +DI++
Sbjct  134  EADLANHERSREQWEFENYPEGEIEEMVELYEKKGISTDDALLVVHTLAKYKEAFIDIMM  193

Query  503  AEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFII-LIP  652
             E++        P++       P   G+ITF +F++FG  P+L++++ L+P
Sbjct  194  VEELNIM-----PVDDDD---SPLMGGIITFVSFMLFGVIPLLSYLVNLVP  236



>ref|XP_001443844.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK76447.1| unnamed protein product [Paramecium tetraurelia]
Length=286

 Score =   110 bits (276),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 54/175 (31%), Positives = 97/175 (55%), Gaps = 6/175 (3%)
 Frame = +2

Query  119  KSEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGI  298
            K +  + K    G ++RS VF G+D ++T+FS+++++  G      VL LG AN++ DG+
Sbjct  46   KQDSHQEKHSTGGNYLRSSVFGGMDGMMTTFSVVTAVIGGNFGVQAVLALGVANMIGDGL  105

Query  299  SMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIF  478
            SM  GD++ST +E+    +E+   +W+V +     ++E++  Y+  GM+  DA  ++ I 
Sbjct  106  SMALGDYLSTKSEQQFFKQEREREKWEVENNLEGEKKEMIDLYKKKGMDQEDAEKIMNII  165

Query  479  AKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFII  643
            +++ D  +   M  +  L            P  N L+TF AF++FG  PI+ FI+
Sbjct  166  SRHKDAFIDIMMLEELELGG------SEENPLMNALVTFIAFILFGLVPIIPFIV  214



>gb|KDO25655.1| hypothetical protein SPRG_08954 [Saprolegnia parasitica CBS 223.65]
Length=288

 Score =   110 bits (276),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 59/172 (34%), Positives = 103/172 (60%), Gaps = 13/172 (8%)
 Frame = +2

Query  152  KGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTS  331
             G  ++S V+ GLD I+T+F+ ++S++   L    +L+LG A+L+ADG+SMG GD +ST 
Sbjct  53   NGGHIKSAVYGGLDGIITTFATVTSVAGSGLPHAVILILGLAHLIADGLSMGMGDLLSTQ  112

Query  332  TERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKY----MDIL  499
             E D+V  E+    W++ + P   + E+++ Y+  G+   DA  VV   +KY    +DI+
Sbjct  113  AEIDLVNHERSRELWEMDNFPEGEKAEMVELYERKGISSKDAKLVVDTLSKYKEAFVDIM  172

Query  500  VAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFII-LIP  652
            + E++        P+++      P   GL+TF +FV+FG  P+L++++ LIP
Sbjct  173  MVEELHLM-----PVDEDD---DPLMGGLVTFGSFVLFGSVPLLSYLVNLIP  216



>emb|CCC46827.1| conserved hypothetical protein [Trypanosoma vivax Y486]
Length=284

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 65/188 (35%), Positives = 107/188 (57%), Gaps = 11/188 (6%)
 Frame = +2

Query  89   VEDGEMEKKGKSEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVL  268
            VE   +E +     R        E+V+S+VF GLD I+T+F+++S+      S   VL+ 
Sbjct  30   VERSRLEHQKPISHRELHGSAASEYVKSMVFGGLDGIMTTFAIVSAAVGSSSSFATVLIF  89

Query  269  GFANLVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMEL  448
            GF+N++ADG SMGFG++VS   ER+    E+   EW+V ++      E++Q Y+  G+  
Sbjct  90   GFSNVLADGFSMGFGEYVSGEAERENALAERNREEWEVENSFDMEVDEMVQIYEMKGLSH  149

Query  449  NDATTVVTIFAK----YMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFG  616
             DATT+V I AK    ++D ++ E++    G+   LE    P    K G++ F +F++FG
Sbjct  150  EDATTIVKIMAKDPKRFVDFMMTEEL----GILVNLEDVHGPK---KQGVVMFISFIIFG  202

Query  617  CAPILAFI  640
              P+LA++
Sbjct  203  TIPLLAYL  210



>ref|XP_009533516.1| hypothetical protein PHYSODRAFT_304534 [Phytophthora sojae]
 gb|EGZ10771.1| hypothetical protein PHYSODRAFT_304534 [Phytophthora sojae]
Length=306

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/186 (32%), Positives = 106/186 (57%), Gaps = 13/186 (7%)
 Frame = +2

Query  110  KKGKSEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVA  289
            + G     +      GE ++S V+ GLD I+T+F+ ++S++   L    +L++G A+LVA
Sbjct  59   EMGSHTHAQENHMTGGEHIKSAVYGGLDGIITTFATVTSVAGSGLPHSVILIIGLAHLVA  118

Query  290  DGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVV  469
            DG+SMG GD +S+  E D+   E+    W+  + P    +E+++ Y+  G+  +DA  VV
Sbjct  119  DGLSMGLGDMLSSQAEADLANHERSRELWEFENYPEGEIEEMVELYEKKGISTDDALLVV  178

Query  470  TIFAKY----MDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAF  637
               AKY    +DI++ E++        P+++      P   G+ITF +F++FG  P+L++
Sbjct  179  HTLAKYKEAFIDIMMVEELNLM-----PVDEDD---SPLMGGVITFVSFMLFGVIPLLSY  230

Query  638  II-LIP  652
            ++ LIP
Sbjct  231  LVNLIP  236



>emb|CDJ68315.1| integral membrane protein, putative [Eimeria necatrix]
Length=353

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/162 (35%), Positives = 93/162 (57%), Gaps = 6/162 (4%)
 Frame = +2

Query  158  EFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTSTE  337
            +++++IVF GLD IVT F++++      L    V+++G  NL+AD ISMGFG+FVS++ E
Sbjct  132  DYLKAIVFGGLDGIVTIFAIVAGCVGANLHPSKVVIIGIGNLLADAISMGFGEFVSSAAE  191

Query  338  RDVVAKEKIVAEWDVMHTPIALQQELLQHYQ-ALGMELNDATTVVTIFAKYMDILVAEKM  514
             D V  E+   EW++ + P   +QE+++ Y+   G    DA ++V I  KY +  V   M
Sbjct  192  DDFVKSERDREEWEIENCPDEEKQEMIEIYRDRYGFTEEDADSLVNITFKYREFFVRHMM  251

Query  515  AAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFI  640
              + GL +      +   P + G + FA+F +FG  P+  F+
Sbjct  252  VEELGLMA-----TEGPSPLRRGAVMFASFSIFGLLPLAGFV  288



>gb|AET50747.1| hypothetical protein [Eimeria tenella]
Length=320

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/162 (35%), Positives = 93/162 (57%), Gaps = 6/162 (4%)
 Frame = +2

Query  158  EFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTSTE  337
            +++++IVF GLD IVT F++++      L    V+++G  NL+AD ISMGFG+FVS++ E
Sbjct  89   DYLKAIVFGGLDGIVTIFAIVAGCVGANLHPSKVVIIGIGNLLADAISMGFGEFVSSAAE  148

Query  338  RDVVAKEKIVAEWDVMHTPIALQQELLQHYQ-ALGMELNDATTVVTIFAKYMDILVAEKM  514
             D V  E+   EW++ + P   +QE+++ Y+   G    DA ++V I  KY +  V   M
Sbjct  149  DDFVKSERDREEWEIENCPDEEKQEMIEIYRDRYGFTEEDADSLVNITFKYREFFVRHMM  208

Query  515  AAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFI  640
              + GL +      +   P + G + FA+F +FG  P+  F+
Sbjct  209  VEELGLMA-----TEGPSPLRRGAVMFASFSIFGLLPLAGFV  245



>emb|CDJ41383.1| integral membrane protein, putative [Eimeria tenella]
Length=295

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/162 (35%), Positives = 95/162 (59%), Gaps = 6/162 (4%)
 Frame = +2

Query  158  EFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTSTE  337
            +++++IVF GLD IVT F++++      L    V+++G  NL+AD ISMGFG+FVS++ E
Sbjct  64   DYLKAIVFGGLDGIVTIFAIVAGCVGANLHPSKVVIIGIGNLLADAISMGFGEFVSSAAE  123

Query  338  RDVVAKEKIVAEWDVMHTPIALQQELLQHYQ-ALGMELNDATTVVTIFAKYMDILVAEKM  514
             D V  E+   EW++ + P   +QE+++ Y+   G    DA ++V I  KY +  V   M
Sbjct  124  DDFVKSERDREEWEIENCPDEEKQEMIEIYRDRYGFTEEDADSLVNITFKYREFFVRHMM  183

Query  515  AAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFI  640
              + GL +     + P+ P + G + FA+F +FG  P+  F+
Sbjct  184  VEELGLMAT----EGPS-PLRRGAVMFASFSIFGLLPLAGFV  220



>ref|XP_010700108.1| hypothetical protein LPMP_270210 [Leishmania panamensis]
 gb|AIN99401.1| hypothetical protein LPMP_270210 [Leishmania panamensis]
Length=289

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/161 (37%), Positives = 99/161 (61%), Gaps = 3/161 (2%)
 Frame = +2

Query  158  EFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTSTE  337
            E+V+S+VF GLD I+T+F++I++ +    +   VL+ GF+N++ADG +MGFG++VS   E
Sbjct  54   EYVKSVVFGGLDGIMTTFAIIAAAAGSGGNYATVLIFGFSNVIADGFAMGFGEYVSGEAE  113

Query  338  RDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKYMDILVAEKMA  517
            R+    E+   EW+V ++      E++Q Y A G+  +DA T+V+I +K   + V   M 
Sbjct  114  RENAVSERHREEWEVENSFDLEVDEMVQIYMAKGLSFDDAQTIVSIISKDPKMFVDFMMV  173

Query  518  AKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFI  640
             + GL   L+       P K G++ F +FV+FG  P+LA++
Sbjct  174  EELGLLVDLDDAY---GPMKQGVVMFISFVLFGSIPLLAYL  211



>ref|XP_009844725.1| hypothetical protein H257_17583 [Aphanomyces astaci]
 gb|ETV65750.1| hypothetical protein H257_17583 [Aphanomyces astaci]
Length=283

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/174 (34%), Positives = 101/174 (58%), Gaps = 13/174 (7%)
 Frame = +2

Query  155  GEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTST  334
            G  ++S V+ GLD I+T+F+ ++S++   L    +L+LG A+LVADG+SMG GD +S+  
Sbjct  49   GGHIKSAVYGGLDGIITTFATVTSVAGSGLPHSVILILGLAHLVADGMSMGMGDVLSSQA  108

Query  335  ERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKY----MDILV  502
            E D+V  E+    W+  + P     E+++ Y+  G+   DA  VV   AKY    +DI++
Sbjct  109  EIDLVNHERAREMWEFDNFPEGEMDEMVELYEQKGIATEDAKLVVNTLAKYKEAFIDIMM  168

Query  503  AEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFII-LIPFTQ  661
             E++        P+++   P      GL+TF +FV+FG  P+ ++++ L+P  Q
Sbjct  169  VEELNLM-----PVDEDDNPV---IGGLVTFGSFVLFGAVPLFSYLVNLLPGVQ  214



>gb|AJF62085.1| hypothetical protein QT06_C0001G1269 [archaeon GW2011_AR15]
Length=263

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 72/205 (35%), Positives = 115/205 (56%), Gaps = 29/205 (14%)
 Frame = +2

Query  56   ESSRYVQLGGSVEDGEMEKKGKSEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISA  235
            ES++ V    ++E  E  K GK           G+FV    +  LD IVT+F+++S +  
Sbjct  19   ESTKKVHTKDAIEHAENHKTGKH---------LGDFV----YGALDGIVTTFAVVSGVEG  65

Query  236  GRLSSGDVLVLGFANLVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQEL  415
             +LSS  +L+LGFANL+ DG+SMG G+++ST +E D + KE+   EW++ + P   + E+
Sbjct  66   AQLSSSIILILGFANLLGDGVSMGVGNYLSTKSELDYIKKERKREEWEIENYPEGEKMEI  125

Query  416  LQHYQALGM---ELNDATTVVTIFAK-YMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNG  583
               +   G    +L+ AT +VT   K ++D ++ E++         +E+ K P     +G
Sbjct  126  RHIFHKKGFRGKDLDRATGIVTSDKKIWVDTMMTEELGL-------VEEEKTPV---ISG  175

Query  584  LITFAAFVVFGCAPILAFI--ILIP  652
            L TF AFV+ G  P+LAF+  ILIP
Sbjct  176  LATFTAFVIAGFIPLLAFVLKILIP  200



>ref|XP_009844728.1| hypothetical protein H257_17585 [Aphanomyces astaci]
 gb|ETV65753.1| hypothetical protein H257_17585 [Aphanomyces astaci]
Length=290

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/174 (34%), Positives = 101/174 (58%), Gaps = 13/174 (7%)
 Frame = +2

Query  155  GEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTST  334
            G  ++S V+ GLD I+T+F+ ++S++   L    +L+LG A+LVADG+SMG GD +S+  
Sbjct  56   GGHIKSAVYGGLDGIITTFATVTSVAGSGLPHSVILILGLAHLVADGMSMGMGDVLSSQA  115

Query  335  ERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKY----MDILV  502
            E D+V  E+    W+  + P     E+++ Y+  G+   DA  VV   AKY    +DI++
Sbjct  116  EIDLVNHERAREMWEFDNFPEGEMDEMVELYEQKGIATEDAKLVVNTLAKYKEAFIDIMM  175

Query  503  AEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFII-LIPFTQ  661
             E++        P+++   P      GL+TF +FV+FG  P+ ++++ L+P  Q
Sbjct  176  VEELNLM-----PVDEDDNPV---IGGLVTFGSFVLFGAVPLFSYLVNLLPGVQ  221



>emb|CCW61037.1| unnamed protein product [Phytomonas sp. isolate EM1]
Length=279

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/179 (31%), Positives = 100/179 (56%), Gaps = 8/179 (4%)
 Frame = +2

Query  119  KSEKRRP-----KEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANL  283
            ++E R+P           ++++SIVF GLD I+T F++I++ +    +   VL+ GF+N+
Sbjct  31   RAEHRKPINHESHNSSTSDYIKSIVFGGLDGIMTCFAVIAAAAGSNGNYATVLIFGFSNV  90

Query  284  VADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATT  463
            +ADG SMGF +++S + ER+    E++  EW+V +       E++Q Y   G+   DA+T
Sbjct  91   IADGFSMGFSEYISGAAERENAITERMREEWEVENAFDMEVDEMIQIYVDKGLSFEDAST  150

Query  464  VVTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFI  640
            +V+I +K   + V   M  + GL   ++    P  P K G +   +F+ FG  P+ A++
Sbjct  151  IVSIISKDHKVFVDFMMVEELGLLLDID---DPHGPKKQGTVMAVSFICFGVIPLFAYL  206



>ref|WP_034546422.1| membrane protein [Carnobacterium alterfunditum]
Length=235

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 66/213 (31%), Positives = 113/213 (53%), Gaps = 11/213 (5%)
 Frame = +2

Query  104  MEKKGKSEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANL  283
            MEK  ++ K R      G++++SIV+ GLD I+T+F++++    G LS    L+LGF+NL
Sbjct  1    MEKDAETPKNR-----GGQYIKSIVYGGLDGIITTFAVVAGSVGGELSFKVALILGFSNL  55

Query  284  VADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATT  463
            +ADG SM  GDF+ST ++ +     +   + D+   P   + +L+      G+  NDA  
Sbjct  56   LADGFSMAVGDFLSTKSQNEYEKNIRYKKQVDITQHPEQEKGQLMNSLVEQGINTNDANL  115

Query  464  VVTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFII  643
            +V   AKY    V + M  + G ++          P KN ++TF +F +FG  P+L +++
Sbjct  116  LVDTLAKYDKPFVNQVMKLEYGSNT------TEGSPVKNAVVTFLSFSIFGVVPLLIYVL  169

Query  644  LIPFTQNVTHKFMaacalsalaltllGIAKAKI  742
             +     + + F  A  L+ + L  LG  K+K+
Sbjct  170  AMYIPSLLDNSFFIASILTGMTLFSLGAMKSKV  202



>ref|WP_007722984.1| MULTISPECIES: membrane protein [Carnobacterium]
 gb|EDP68342.1| hypothetical protein CAT7_09880 [Carnobacterium sp. AT7]
Length=235

 Score =   108 bits (269),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 66/202 (33%), Positives = 114/202 (56%), Gaps = 6/202 (3%)
 Frame = +2

Query  152  KGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTS  331
            KG++++SIV+ GLD I+T+F++++    G LS   VL+LGF+NL+ADG SM  GDF+ST 
Sbjct  12   KGKYIKSIVYGGLDGIITTFAVVAGSVGGELSFKVVLILGFSNLLADGFSMAVGDFLSTK  71

Query  332  TERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKYMDILVAEK  511
            ++ +     +   +  +M  P    +++       G++  DA  +VT  AKY +  V + 
Sbjct  72   SQNEYEKTVRHKKQIAIMENPEQEAEQIKASLTEQGIDEQDANLLVTTLAKYEEPFVNQI  131

Query  512  MAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFIILIPFTQNVTHKFMaac  691
            M  + G S+  +       P KN ++TF +F VFG  P+L +++ +     + + F  A 
Sbjct  132  MKMEYGSSTTED------SPLKNAIVTFLSFSVFGVVPLLIYVLSMYIPGLLQNAFYIAA  185

Query  692  alsalaltllGIAKAKIASQSY  757
             L+ + L +LG AK+KI   ++
Sbjct  186  LLTGMTLFILGAAKSKITQSNW  207



>ref|XP_008866843.1| hypothetical protein H310_04314 [Aphanomyces invadans]
 gb|ETW03887.1| hypothetical protein H310_04314 [Aphanomyces invadans]
Length=472

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 65/204 (32%), Positives = 112/204 (55%), Gaps = 17/204 (8%)
 Frame = +2

Query  53   AESSRYVQLGGSVEDGEMEKKGKSEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSIS  232
            AE+SR + +          K G + +        G  ++S V+ GLD I+T+F+ ++S++
Sbjct  32   AEASRVIHIA---------KNGHASEAHLD---NGGHIKSAVYGGLDGIITTFATVTSVA  79

Query  233  AGRLSSGDVLVLGFANLVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQE  412
               L    +L+LG A+LVADG+SMG GD +S+  E D+V  E+    W+  + P     E
Sbjct  80   GSGLPHSVILILGLAHLVADGLSMGMGDVLSSQAEIDLVHHERAREMWEFDNFPEGEMDE  139

Query  413  LLQHYQALGMELNDATTVVTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLIT  592
            +++ Y+  G+  +DA  VV   AKY +  V   M  +  L  P+++ + P      GL+T
Sbjct  140  MVELYEKKGIPTHDAKLVVHTLAKYKEAFVDIMMVEELNL-MPVDEDENPL---IGGLVT  195

Query  593  FAAFVVFGCAPILAFII-LIPFTQ  661
            F +F++FG  P+L++++ L+P  Q
Sbjct  196  FGSFMLFGAVPLLSYLVNLVPGIQ  219


 Score = 86.7 bits (213),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 80/136 (59%), Gaps = 5/136 (4%)
 Frame = +2

Query  257  VLVLGFANLVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQAL  436
            +L+LG A+LVADG+SMG GD +S+  E D+V  E+    W+  + P     E+++ Y+  
Sbjct  272  ILILGLAHLVADGLSMGMGDVLSSQAEIDLVHHERAREMWEFDNFPEGEMDEMVELYEKK  331

Query  437  GMELNDATTVVTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFG  616
            G+  +DA  VV   AKY +  V   M  +  L  P+++ + P      GL+TF +F++FG
Sbjct  332  GIPTHDAKLVVHTLAKYKEAFVDIMMVEELNL-MPVDEDENPL---IGGLVTFGSFMLFG  387

Query  617  CAPILAFII-LIPFTQ  661
              P+L++++ L+P  Q
Sbjct  388  AVPLLSYLVNLVPGIQ  403



>ref|XP_001565783.1| conserved hypothetical protein [Leishmania braziliensis MHOM/BR/75/M2904]
 emb|CAM45299.1| conserved hypothetical protein [Leishmania braziliensis MHOM/BR/75/M2904]
Length=289

 Score =   108 bits (270),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 59/161 (37%), Positives = 98/161 (61%), Gaps = 3/161 (2%)
 Frame = +2

Query  158  EFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTSTE  337
            E+V+S+VF GLD I+T+F++I++ +    +   VL+ GF+N++ADG +MGFG++VS   E
Sbjct  54   EYVKSVVFGGLDGIMTTFAIIAAAAGSGGNYATVLIFGFSNVIADGFAMGFGEYVSGEAE  113

Query  338  RDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKYMDILVAEKMA  517
            R+    E+   EW+V ++      E++Q Y A G+  +DA T+V I +K   + V   M 
Sbjct  114  RENAVSERHREEWEVENSFDLEVDEMVQIYMAKGLSFDDAQTIVGIISKDPKMFVDFMMV  173

Query  518  AKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFI  640
             + GL   L+       P K G++ F +FV+FG  P+LA++
Sbjct  174  EELGLLVDLDDAY---GPMKQGVVMFISFVLFGSIPLLAYL  211



>ref|XP_002902928.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gb|EEY56098.1| conserved hypothetical protein [Phytophthora infestans T30-4]
Length=302

 Score =   108 bits (270),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 66/219 (30%), Positives = 117/219 (53%), Gaps = 32/219 (15%)
 Frame = +2

Query  59   SSRYVQLGGSVEDGEMEKKGKSEKRRPKEPWK----------------GEFVRSIVFAGL  190
            S+ Y Q+   V+D     +G +EK R     K                G+ ++S V+ GL
Sbjct  25   STSYNQVMVDVKDAY--SQGNAEKSRLLHQLKTDMGSHTHAMENHMTGGKHIKSAVYGGL  82

Query  191  DAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTSTERDVVAKEKIVA  370
            D I+T+F+ ++S++   L    +L++G A+LVADG+SMG GD +S+  E D+   E+   
Sbjct  83   DGIITTFATVTSVAGSGLPHSVILIIGLAHLVADGLSMGLGDMLSSQAEADLANHERSRE  142

Query  371  EWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKY----MDILVAEKMAAKKGLSS  538
            +W+  + P    +E+++ Y+  G+  +DA  VV   AKY    +DI++ E++        
Sbjct  143  QWEFENYPEGEIEEMVELYEKKGISTDDALLVVHTLAKYKEAFIDIMMVEELNIM-----  197

Query  539  PLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFII-LIP  652
            P++       P   G+ITF +F++FG  P+L++++ L P
Sbjct  198  PVDD----DSPLTGGVITFVSFMLFGIIPLLSYLVNLFP  232



>ref|XP_843676.1| hypothetical protein [Trypanosoma brucei brucei TREU927]
 gb|AAX69904.1| hypothetical protein, conserved [Trypanosoma brucei]
 gb|AAZ10117.1| hypothetical protein, conserved [Trypanosoma brucei brucei TREU927]
 emb|CBH09704.1| hypothetical protein, conserved [Trypanosoma brucei gambiense 
DAL972]
Length=281

 Score =   107 bits (268),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 66/186 (35%), Positives = 103/186 (55%), Gaps = 4/186 (2%)
 Frame = +2

Query  83   GSVEDGEMEKKGKSEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVL  262
            G +E   ME + K   +    P   ++V+S+VF GLD I+TSF+++S+      S   VL
Sbjct  28   GDIEMSRMEHQ-KHIYKEVHNPSASDYVKSVVFGGLDGIITSFTVVSAAVGSNSSVASVL  86

Query  263  VLGFANLVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGM  442
            + GF+N++ADG +MGFG++VS   ERD    E+   EW+V +       E++Q Y+  G+
Sbjct  87   IFGFSNVIADGFAMGFGEYVSGEAERDNALSERRREEWEVENAFDMEVDEMVQIYEMKGL  146

Query  443  ELNDATTVVTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCA  622
               DATT+V I +K   + V   M  + G+    E       P K GL+ F +F+ FG  
Sbjct  147  SHEDATTIVNIISKDPKLFVDFMMTEELGIIIDTE---DTHGPKKQGLVMFLSFMFFGAV  203

Query  623  PILAFI  640
            P+LA++
Sbjct  204  PLLAYL  209



>gb|KHO46051.1| hypothetical protein QJ16_C0014G0009 [archaeon GW2011_AR1]
Length=239

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 73/224 (33%), Positives = 120/224 (54%), Gaps = 12/224 (5%)
 Frame = +2

Query  119  KSEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGI  298
            K +       + G++++S V+ GLD +VT+F++++ +    LSS  +L+LGFANL+ADGI
Sbjct  4    KKDHEELHSSFGGKYLKSWVYGGLDGVVTTFAVVAGVVGASLSSAIILILGFANLIADGI  63

Query  299  SMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQAL---GMELNDATTVV  469
            SM  GD++ST ++ +    EK V E +    P   ++E+ +    L   G   NDA  + 
Sbjct  64   SMAVGDYLSTKSQGEYYKAEKGVEENETKKNP---REEITRMGLLLIKKGFNRNDAKKIS  120

Query  470  TIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFIILI  649
             + +K       +   A   L   L    +   P KN L TF AF++FG  P++ FII  
Sbjct  121  FLISK------NKNYQADTMLHDELGLAYENVNPGKNALSTFLAFLIFGMLPLIIFIIGT  174

Query  650  PFTQNVTHKFMaacalsalaltllGIAKAKIASQSYTVSVAITL  781
             F   + + F  A  LS +++ LLG+ K+KI ++++  S  IT 
Sbjct  175  VFNITIKNXFFWASILSGVSIFLLGVFKSKITNKNWFKSGMITF  218



>emb|CBN73842.1| conserved unknown protein [Ectocarpus siliculosus]
Length=291

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/179 (32%), Positives = 97/179 (54%), Gaps = 5/179 (3%)
 Frame = +2

Query  110  KKGKSEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVA  289
            + G++      E  KG++++++VF GLD I+TSF++++  + G L    VLVLGF+N+ A
Sbjct  45   RAGQAHDEAHSE--KGDYLKAMVFGGLDGILTSFAIVAGAAGGHLPVAVVLVLGFSNIFA  102

Query  290  DGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVV  469
            D +SMG G+++S+    + V  EK   EW++ +       E+++ ++  GM   DA  V+
Sbjct  103  DALSMGVGEYLSSKAHNEYVMAEKRREEWELKNHREGEILEMVEIFEERGMSRQDAEDVI  162

Query  470  TIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFIIL  646
               AKY D  V   M  + GL  P           K G + F +F  FG  P+L ++I+
Sbjct  163  GKMAKYDDFFVNLMMNEELGLQVPTGDDDDTV---KEGFVMFLSFAFFGAMPLLGYVIV  218



>gb|EFA86545.1| DUF125 family protein [Polysphondylium pallidum PN500]
Length=359

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 63/203 (31%), Positives = 112/203 (55%), Gaps = 14/203 (7%)
 Frame = +2

Query  53   AESSRYVQLGGSVEDGEMEKKGKSEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSIS  232
            A +SR  Q+   +   E   K KS  +   +   G++++SIV+ G+D +V+ F  ++ ++
Sbjct  88   ATTSRRKQIKSDI--NETLTKIKSINKEDLKLDTGKYIKSIVYGGMDGLVSIFVSVAVVA  145

Query  233  AGRLSSGDVLVLGFANLVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQE  412
             G+ S G +L + FA LVA  ISMG GD++ T  + D    E+    W+V + P   ++E
Sbjct  146  TGQASIGLLLSIAFAKLVAGAISMGMGDYLGTQADVDFAKGERQRESWEVEYYPEGEKKE  205

Query  413  LLQHYQALGMELNDATTVVTIFAK----YMDILVAEKMAAKKGLSSPLEKGKKPAKPWKN  580
            +++ Y + G+ L  AT VV I AK    ++DI++ E++       + +         WKN
Sbjct  206  MVEIYVSKGIPLEIATEVVDILAKNQKGFVDIMMVEELGIMPDTENEV--------AWKN  257

Query  581  GLITFAAFVVFGCAPILAFIILI  649
            GL+ F +F++FG  P+L + +L+
Sbjct  258  GLVNFVSFLIFGIIPMLPYFVLL  280



>ref|XP_002287480.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|EED94923.1| predicted protein [Thalassiosira pseudonana CCMP1335]
Length=278

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/165 (33%), Positives = 94/165 (57%), Gaps = 2/165 (1%)
 Frame = +2

Query  152  KGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTS  331
            +G  ++ ++F GLD I+T+F++++  + G +    +LVLGF+N+ AD ++MG G+F+S+ 
Sbjct  46   EGGMLKPLIFGGLDGILTAFAIVAGAAGGSMPIPVILVLGFSNIFADALAMGVGEFLSSK  105

Query  332  TERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKYMDILVAEK  511
             E + +  E+    W++ + P     E++  YQ  GM  +DA  V+   AKY +  V   
Sbjct  106  AENEWILSERRRENWEMENYPEGEIAEMIDIYQERGMTHDDAKLVIETMAKYKEFFVDVM  165

Query  512  MAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFIIL  646
            MA +  L  P E  K   +  K G++ F AF  FG  P+L +I++
Sbjct  166  MAEELALQVPDEDHK--IESMKEGVVMFGAFATFGSLPLLGYIVI  208



>dbj|GAM25155.1| hypothetical protein SAMD00019534_083300 [Acytostelium subglobosum 
LB1]
Length=276

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 60/175 (34%), Positives = 99/175 (57%), Gaps = 3/175 (2%)
 Frame = +2

Query  119  KSEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGI  298
            + +++ P +   GE ++SIVF GLD I+T+F+++++ S   LS   VLVLGFANLV D  
Sbjct  35   EEDRKEPHKEEAGEALKSIVFGGLDGIITTFAIVAAASGAGLSRVVVLVLGFANLVGDAF  94

Query  299  SMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIF  478
             M FGD+VS   E D + ++  + E  +   P   ++ L Q Y   G E +DA  +V + 
Sbjct  95   GMAFGDYVSEKAEEDHLIRQSKMLEKKLDSEPEIEKENLKQLYMTKGFEEDDAARIVELL  154

Query  479  AKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFII  643
              Y   +++  M  + G  +P   G   A   K+ ++TF +F+V G  P+L+F++
Sbjct  155  FPYKSTVMSIIMMDQHG-GNPDADGSSGA--IKSAMVTFLSFIVCGGIPLLSFVV  206



>ref|WP_003143319.1| membrane protein [Aerococcus viridans]
 gb|EFG49068.1| membrane protein [Aerococcus viridans ATCC 11563]
Length=234

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/173 (32%), Positives = 100/173 (58%), Gaps = 6/173 (3%)
 Frame = +2

Query  122  SEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGIS  301
            SE+ + +    G +V+S+V+ GLD IVT+F++++  + G LS   V++LGFANL+ADG+S
Sbjct  2    SEQSKKESLMNGNYVKSMVYGGLDGIVTTFAVVAGATGGALSLDVVIILGFANLLADGLS  61

Query  302  MGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFA  481
            M  GDF+S+ +E + V         D  +   +   +L  +YQA G+  +DA  +    A
Sbjct  62   MAVGDFLSSKSEGEFVENTIKKRRLDFKNDFSSEVAKLSANYQAKGISKDDADQISATLA  121

Query  482  KYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFI  640
             Y +I   E++ ++ G        +    P +N L+TF +F+++G  P++A++
Sbjct  122  NYPEIFEQERVNSEFG------DEEIETHPMRNALVTFFSFLIYGFIPLIAYV  168



>ref|XP_004349157.1| integral membrane protein [Capsaspora owczarzaki ATCC 30864]
 gb|EFW44382.1| integral membrane protein [Capsaspora owczarzaki ATCC 30864]
Length=285

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/192 (30%), Positives = 103/192 (54%), Gaps = 6/192 (3%)
 Frame = +2

Query  86   SVEDGEMEKKGKSEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLV  265
            S ED  +  + K++++        E++++I+F GLD I+T+F+++++  AG L    +L 
Sbjct  37   SAEDSPLLGRLKADEKH--RTGLSEYIQAIIFGGLDGIITTFAVVAAGVAGNLERKTILT  94

Query  266  LGFANLVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGME  445
            +GFANLV D  +M  GD++S+  E D    E+    W++ H P   ++E+++ Y   G+ 
Sbjct  95   IGFANLVGDAFAMAVGDYLSSRAELDHANSERAREAWEIEHDPDTEKKEMVEIYVDKGLS  154

Query  446  LNDATTVVTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAP  625
              DA  VV +     D  +   M  + G+            PWK+ +ITF +F++FG  P
Sbjct  155  HADAVKVVDLLFTNEDAFLNIMMMEELGIMPQ----DASVVPWKSAVITFVSFILFGGFP  210

Query  626  ILAFIILIPFTQ  661
            +LA+I    + +
Sbjct  211  MLAYICAADYNK  222



>ref|WP_013711701.1| membrane protein [Carnobacterium sp. 17-4]
 ref|YP_004375775.1| hypothetical protein CAR_c21020 [Carnobacterium sp. 17-4]
 gb|AEB30759.1| hypothetical protein CAR_c21020 [Carnobacterium sp. 17-4]
Length=238

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 68/210 (32%), Positives = 116/210 (55%), Gaps = 12/210 (6%)
 Frame = +2

Query  122  SEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGIS  301
            ++ R+  +   G++++SIV+ GLD IVT+F++++    G LS   +L+LGF+NL+ADG S
Sbjct  5    TDPRKNVQTSNGKYIKSIVYGGLDGIVTTFAVVAGSVGGELSLKVILILGFSNLLADGFS  64

Query  302  MGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQE---LLQHYQALGMELNDATTVVT  472
            M  GD++ST ++ +    EK++ + + +      +QE   ++  +   G+E  DA  +V 
Sbjct  65   MAVGDYLSTKSQNEY---EKMIRQNEQLEIVNHHEQEVKRMMNSFVDQGVEKEDAALIVK  121

Query  473  IFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFIILIP  652
              AKY +  V +    K G  S  E       P KN L TF +F +FG  P+L ++  + 
Sbjct  122  TLAKYEEPFVKQVRKEKYGTDSIEE------MPLKNALATFLSFSLFGVVPLLTYVFSLG  175

Query  653  FTQNVTHKFMaacalsalaltllGIAKAKI  742
                V + F+ A  L+ + L +LG  K+KI
Sbjct  176  LPILVQNSFLIASILTGITLFILGAVKSKI  205



>emb|CCC89604.1| conserved hypothetical protein [Trypanosoma congolense IL3000]
Length=281

 Score =   106 bits (264),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 63/188 (34%), Positives = 107/188 (57%), Gaps = 11/188 (6%)
 Frame = +2

Query  92   EDGEMEKKGKSEKRRP-----KEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGD  256
            +D EM ++   E ++P       P   ++V+S+VF GLD I+TSF+++S+       +  
Sbjct  28   DDIEMSRR---EHQKPLYNEGHSPAASDYVKSVVFGGLDGIITSFTVVSAAVGSSSGAAS  84

Query  257  VLVLGFANLVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQAL  436
            VL+ GF+N++ADG SMGFG++++   ERD    E+   EW+V +       E++Q Y+  
Sbjct  85   VLIFGFSNVLADGFSMGFGEYIAGEAERDNALSERRREEWEVENAFDMEVDEMVQIYEMK  144

Query  437  GMELNDATTVVTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFG  616
            G+   DATT+V I +K   + V   M  + G+   ++       P K GL+ F +F++FG
Sbjct  145  GLSHEDATTIVKIISKDPKLFVDFMMTEELGIIINMD---DKHGPKKQGLVMFLSFIIFG  201

Query  617  CAPILAFI  640
              P+LA++
Sbjct  202  TVPLLAYV  209



>ref|WP_035051274.1| membrane protein [Carnobacterium pleistocenium]
Length=235

 Score =   105 bits (261),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 67/213 (31%), Positives = 113/213 (53%), Gaps = 11/213 (5%)
 Frame = +2

Query  104  MEKKGKSEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANL  283
            ME K ++ + R      G++++SIV+ GLD I+T+F++++    G LS   VL+LGF+NL
Sbjct  1    MENKSETPRNR-----SGQYIKSIVYGGLDGIITTFAVVAGSFGGDLSFRVVLILGFSNL  55

Query  284  VADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATT  463
            +ADG SM  GDF+ST ++ +     +   +  +   PI  + +L       G+   DA  
Sbjct  56   LADGFSMAVGDFLSTKSQNEYEKNVRHKKQIAITQHPIQEKGQLRNSLIEQGVNEEDANL  115

Query  464  VVTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFII  643
            +V   AKY    V + M  + G ++  +       P KN  +TF +F VFG  P+L +I+
Sbjct  116  LVNTLAKYDKPFVNQVMKLEYGSNTTED------SPMKNAAVTFLSFSVFGVVPLLIYIV  169

Query  644  LIPFTQNVTHKFMaacalsalaltllGIAKAKI  742
             +     + + F+ A  L+ + L  LG  K+K+
Sbjct  170  AMFIPNLLENSFLIASTLTGMTLFSLGAMKSKV  202



>ref|XP_001742963.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ91677.1| predicted protein [Monosiga brevicollis MX1]
Length=1670

 Score =   110 bits (275),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 79/235 (34%), Positives = 136/235 (58%), Gaps = 8/235 (3%)
 Frame = +2

Query  155   GEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTST  334
             G++V++ VF GLD I+T+F++++S +  RLS+  ++++G ANL+ADG++MG G+++S+ +
Sbjct  1436  GQYVKAAVFGGLDGIITTFAVVASSNGARLSANVIVIMGVANLLADGLAMGMGEYLSSLS  1495

Query  335   ERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKYMDILVAEKM  514
             E      E+   EW++ +       E+++ Y   G+E  DA  ++ I +KY D  V   +
Sbjct  1496  ELQYARSERQREEWELENYEEGEISEMVELYMEKGIEEEDARQILHIMSKYKDFFVDHML  1555

Query  515   AAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFIIL--IPF--TQNVTHKFM  682
               + G+  P E       P+KNG++ F AF+ FG  P+L++++L  + F      T  F 
Sbjct  1556  VQELGIMPPDED----ESPFKNGVVMFLAFISFGLVPLLSYLMLQTVNFGSMDKDTALFA  1611

Query  683   aacalsalaltllGIAKAKIASQSYTVSVAITLSNgaiagasayaigWTLRNVAG  847
              AC  + LA+ +LG  K+K + QS+ +S    L NG  A  +AY +GW L    G
Sbjct  1612  IACGFTGLAMFVLGAIKSKFSQQSWFMSGLTVLVNGGAAAGAAYLVGWLLEKYVG  1666



>emb|CCI47783.1| unnamed protein product [Albugo candida]
Length=335

 Score =   105 bits (263),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 59/171 (35%), Positives = 99/171 (58%), Gaps = 13/171 (8%)
 Frame = +2

Query  155  GEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTST  334
            G F++S V+ GLD I+T+F+ ++S++   L    +L++G A+LVADG+SMG GD +S+  
Sbjct  103  GGFIKSAVYGGLDGIITTFATVTSVAGSGLPEIVILIIGLAHLVADGLSMGLGDMLSSQA  162

Query  335  ERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKY----MDILV  502
            E  +V  E+   EW+  + P    +E++  Y+  G+   DA  VV   AKY    +DI++
Sbjct  163  EAQLVRHERQREEWEFENYPEGEMEEMIALYEKKGISTEDARLVVKTLAKYKQAFIDIMM  222

Query  503  AEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFII-LIP  652
             E++        PL+           G+ITF +F+ FG  P+L++++ LIP
Sbjct  223  VEELNLM-----PLD---DEDSTLTGGVITFLSFMGFGIIPLLSYLVNLIP  265



>emb|CCA18517.1| conserved hypothetical protein [Albugo laibachii Nc14]
Length=336

 Score =   105 bits (263),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 59/171 (35%), Positives = 99/171 (58%), Gaps = 13/171 (8%)
 Frame = +2

Query  155  GEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTST  334
            G F++S V+ GLD I+T+F+ ++S++   L    +L++G A+LVADG+SMG GD +S+  
Sbjct  104  GGFIKSAVYGGLDGIITTFATVTSVAGSGLPEIVILIIGLAHLVADGLSMGLGDMLSSQA  163

Query  335  ERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKY----MDILV  502
            E  +V  E+   EW+  + P    +E++  Y+  G+   DA  VV   AKY    +DI++
Sbjct  164  EAQLVRHERQREEWEFENYPEGEMEEMIALYEKKGISTEDAKLVVETLAKYKQAFIDIMM  223

Query  503  AEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFII-LIP  652
             E++        PL+           G+ITF +F+ FG  P+L++++ LIP
Sbjct  224  VEELNLM-----PLD---DEDSTLTGGVITFLSFMGFGIIPLLSYLLNLIP  266



>gb|EJK53909.1| hypothetical protein THAOC_26564 [Thalassiosira oceanica]
Length=297

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 57/181 (31%), Positives = 98/181 (54%), Gaps = 18/181 (10%)
 Frame = +2

Query  152  KGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTS  331
            +G F++ ++F GLD I+TSF++++  + G+LS   VLVLGF+N++AD ++MG G+F+S+ 
Sbjct  45   EGGFLKPLIFGGLDGILTSFAIVAGAAGGQLSVPVVLVLGFSNILADALAMGVGEFLSSK  104

Query  332  TERDVVAKEKIVAEWDVMHTP----------------IALQQELLQHYQALGMELNDATT  463
             E + +  E+    W++   P                 +   E++  Y   GM   DAT+
Sbjct  105  AENEWILSERKRESWEMETYPEGECRRRKCTTPENSYPSQHNEMIDIYTERGMSKEDATS  164

Query  464  VVTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFII  643
            V+ I +KY +  V   MA +  L  P E      +  K G++ F +F  FG  P+L ++I
Sbjct  165  VIRIMSKYKEFFVDVMMAEELALQIPEE--NHVTESMKEGVVMFFSFATFGSLPLLGYVI  222

Query  644  L  646
            +
Sbjct  223  I  223



>ref|WP_026466525.1| membrane protein [Aerococcus urinaeequi]
Length=234

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/173 (30%), Positives = 98/173 (57%), Gaps = 6/173 (3%)
 Frame = +2

Query  122  SEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGIS  301
            S+  R       ++V+S+V+ GLD I+T+F+++S ++ G L    V+VLGF+NL+ADG+S
Sbjct  2    SKANRFNFRMNSDYVKSMVYGGLDGIITTFAVVSGVTGGALDFQIVIVLGFSNLLADGLS  61

Query  302  MGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFA  481
            M  GD++S+ +E + + KE    + +  +       +  ++Y   G+   DA+ +    A
Sbjct  62   MAVGDYLSSKSENEFITKEIEQHQSNFKYDFQTELNDFKEYYTNKGLTETDASLISETLA  121

Query  482  KYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFI  640
            KY +++  E++    G        +  A P  N LITF +F+++G  P++A++
Sbjct  122  KYPEVIEQERINMIFG------TAETEAHPIYNALITFCSFILYGFIPLIAYV  168



>ref|XP_011091401.1| PREDICTED: uncharacterized protein LOC105171851 [Sesamum indicum]
Length=133

 Score =   100 bits (248),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 55/74 (74%), Gaps = 0/74 (0%)
 Frame = +2

Query  302  MGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFA  481
            MGFGDFVSTSTERDV AKE+ V EWDV +   + Q+EL+Q YQALGM   DA  VV IFA
Sbjct  1    MGFGDFVSTSTERDVAAKERSVTEWDVENRRRSQQEELVQRYQALGMHAADAAMVVGIFA  60

Query  482  KYMDILVAEKMAAK  523
            KY DILV EKM  +
Sbjct  61   KYPDILVDEKMVGR  74



>gb|EFA79351.1| hypothetical protein PPL_07769 [Polysphondylium pallidum PN500]
Length=267

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 59/174 (34%), Positives = 100/174 (57%), Gaps = 3/174 (2%)
 Frame = +2

Query  119  KSEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGI  298
            + +++   +   GE V+SIVF GLD I+T+F+++++ +   L+ G +L++GFANL+ D  
Sbjct  26   EEDRKEQHKEEAGEVVKSIVFGGLDGIMTTFAIVAAAAGAGLTRGVILIIGFANLLGDAF  85

Query  299  SMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIF  478
             M FGD+VS   E D + K+  + E  +   P   +  L   Y + G E  DA  +V + 
Sbjct  86   GMAFGDYVSERAEEDHLLKQSKLLEKKIDTEPEIEKARLKDVYISKGFEDADAARIVELL  145

Query  479  AKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFI  640
              Y   +++  M  + G S+P E+G   A   K+ ++TFA+F+V G  P+LAF+
Sbjct  146  FPYKSTVMSIMMMEEHG-SAPDEEGSSGA--IKSAVVTFASFMVCGGIPLLAFV  196



>ref|XP_002178292.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC49957.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=280

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 55/180 (31%), Positives = 97/180 (54%), Gaps = 5/180 (3%)
 Frame = +2

Query  107  EKKGKSEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLV  286
            + K  SE     E   G  ++ I+F GLD I+TSF++++  + G LS   VL+LG +N+ 
Sbjct  31   DAKSASEDGHQTE---GGMLKPIIFGGLDGILTSFAIVAGAAGGELSPQVVLILGVSNIF  87

Query  287  ADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTV  466
            AD +SMG G+F+S+    + +  E+   EW++ + P    +E+++ ++  GM   DA + 
Sbjct  88   ADALSMGVGEFLSSKANNEWILSERAREEWELENYPEGEIKEMVEIFEDKGMSHEDAVSC  147

Query  467  VTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFIIL  646
            +   AKY D  V   M  +  L  P +   +  +  K G++ F +F  FG  P+L +++ 
Sbjct  148  INTMAKYKDFFVDIMMQQELELQVPDKDHIR--ESMKEGVVMFCSFAFFGALPLLGYVLF  205



>ref|WP_013561267.1| hypothetical protein [Anaerolinea thermophila]
 ref|YP_004175522.1| hypothetical protein ANT_28960 [Anaerolinea thermophila UNI-1]
 dbj|BAJ64922.1| hypothetical membrane protein [Anaerolinea thermophila UNI-1]
Length=274

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 58/175 (33%), Positives = 100/175 (57%), Gaps = 20/175 (11%)
 Frame = +2

Query  158  EFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTSTE  337
            E++ S+V+ GLD I+T+F+++S ++   L    +++LG AN+ ADG SM  G ++S  +E
Sbjct  47   EYIGSMVYGGLDGIITTFAVVSGVAGAGLKPEIIIILGLANVFADGFSMATGAYLSEKSE  106

Query  338  RDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFA----KYMDILVA  505
             ++  +E+    W+V H P A ++EL Q Y A G    DA  +V I A    +++D ++ 
Sbjct  107  MELYERERQRESWEVEHFPEAEKEELRQLYLAQGYPEEDANQMVEIKARDKQRWVDAMML  166

Query  506  EKMAAKKGLSSPLEKGKKPA--KPWKNGLITFAAFVVFGCAPILAFII--LIPFT  658
            E++               PA  KP  + L+TF AFV+ G  P++ F++  L+PF+
Sbjct  167  EEL------------NLLPADTKPLTSALVTFGAFVIAGLLPLMVFLLDWLLPFS  209



>emb|CCD12544.1| unnamed protein product [Trypanosoma congolense IL3000]
Length=209

 Score =   100 bits (250),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 61/184 (33%), Positives = 103/184 (56%), Gaps = 11/184 (6%)
 Frame = +2

Query  92   EDGEMEKKGKSEKRRP-----KEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGD  256
            +D EM ++   E ++P       P   ++V+S+VF GLD I+TSF+++S+       +  
Sbjct  28   DDIEMSRR---EHQKPLYNEGHSPAASDYVKSVVFGGLDGIITSFTVVSAAVGSSSGAAS  84

Query  257  VLVLGFANLVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQAL  436
            VL+ GF+N++ADG SMGFG++++   ERD    E+   EW+V +       E++Q Y+  
Sbjct  85   VLIFGFSNVLADGFSMGFGEYIAGEAERDNALSERRREEWEVENAFDMEVDEMVQIYEMK  144

Query  437  GMELNDATTVVTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFG  616
            G+   DATT+V I +K   + V   M  + G+   ++    P    K GL+ F +F++FG
Sbjct  145  GLSHEDATTIVKIISKDPKLFVDFMMTEELGIIINMDDKHGPK---KQGLVMFLSFIIFG  201

Query  617  CAPI  628
              P+
Sbjct  202  TVPL  205



>ref|XP_001031125.1| Integral membrane protein [Tetrahymena thermophila]
 gb|EAR83462.1| integral membrane protein [Tetrahymena thermophila SB210]
Length=279

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 56/177 (32%), Positives = 100/177 (56%), Gaps = 15/177 (8%)
 Frame = +2

Query  98   GEMEKKGKSEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFA  277
            G+ ++K KS+         G +++S V+ GLD  +T++S++  ++   L++  V+ LG A
Sbjct  32   GQEDEKLKSDHNEDHNN-SGAYIKSAVYGGLDGTITTYSVVMGVAGANLATIVVVALGVA  90

Query  278  NLVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDA  457
            NL+ DGI M  GD++ST +E +   KE+   EW+V + P   + E+++ Y+  G+   DA
Sbjct  91   NLIGDGICMALGDYLSTKSEIEFQRKERAREEWEVENNPDEEKNEMVELYEQKGITREDA  150

Query  458  TTVVTIFAK----YMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFG  616
             +VV I +K    ++DI++ E++        P+          KN ++TF AFV+FG
Sbjct  151  RSVVEIISKNKQAWVDIMMIEELGLLPEEEDPV----------KNAIVTFIAFVLFG  197



>ref|WP_035020406.1| membrane protein [Carnobacterium sp. WN1374]
Length=235

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 66/214 (31%), Positives = 110/214 (51%), Gaps = 16/214 (7%)
 Frame = +2

Query  131  RRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGF  310
            R+ ++   G++++SIV+ GLD IVT+F++++    G LS   +L+LGF+NL+ADG SM  
Sbjct  5    RKKRQTSNGKYIKSIVYGGLDGIVTTFAVVAGSVGGELSLNVILILGFSNLLADGFSMAV  64

Query  311  GDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQE-----LLQHYQALGMELNDATTVVTI  475
            GD++ST ++ +    EK+   W      I    E     ++  +   G++  DA  +V  
Sbjct  65   GDYLSTKSQNEY---EKMT--WQKEQLEIVNHHEKEMKRMMDSFVDQGVDKEDANVIVKT  119

Query  476  FAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFIILIPF  655
             AKY    + +    K G  S          P KN L TF +F +FG  P+L ++  +  
Sbjct  120  LAKYEKPFINQVWKEKYGSDST------EQLPLKNALATFLSFSLFGVVPLLTYVFSLGL  173

Query  656  TQNVTHKFMaacalsalaltllGIAKAKIASQSY  757
               V + F  A  L+ + L +LG  K+KI   ++
Sbjct  174  PILVQNSFFIASMLTGITLFILGAVKSKINQSNW  207



>ref|WP_029215174.1| hypothetical protein [bacterium JKG1]
Length=268

 Score =   100 bits (248),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 57/185 (31%), Positives = 97/185 (52%), Gaps = 7/185 (4%)
 Frame = +2

Query  92   EDGEMEKKGKSEKRRPK-EPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVL  268
            E  ++E+      RR +   W G ++ S+V+ GLD I+T+F+++S ++   L S  +L+L
Sbjct  20   EPRQVEQPTPGATRRQRFSTWLGTYLGSMVYGGLDGIITTFAVVSGVAGADLDSRVILIL  79

Query  269  GFANLVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMEL  448
            G  NL+ADG SMG GD++ST +ER+  A+E      ++  +P A +  L   Y   G   
Sbjct  80   GIGNLLADGFSMGTGDYLSTKSEREYYAREARRQAREIEQSPEAPRARLRALYLQHGYSE  139

Query  449  NDATTVVTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPI  628
             +A  +V +  +     V   +  + GL       ++   P  N L TF AFV+ G  P+
Sbjct  140  QEADALVAVQTRDRQRWVNALLIEELGLV------RQEVNPLYNALATFLAFVIAGAVPL  193

Query  629  LAFII  643
            L +++
Sbjct  194  LIYLL  198



>ref|WP_016896376.1| hypothetical protein [Aerococcus viridans]
Length=234

 Score = 99.4 bits (246),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 97/170 (57%), Gaps = 6/170 (4%)
 Frame = +2

Query  131  RRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGF  310
             R       ++V+S+V+ GLD I+T+F+++S ++ G L    V++LGF+NL+ADG+SM  
Sbjct  5    NRFNFRMNSDYVKSMVYGGLDGIITTFAVVSGVTGGALDFQIVIILGFSNLLADGLSMAV  64

Query  311  GDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKYM  490
            GD++S+ +E + + KE    + +  +   +   +  ++Y   G+   DA+++    AKY 
Sbjct  65   GDYLSSKSENEFITKEIEQHQSNFNYDFQSELNDFKEYYINKGLTETDASSISETLAKYP  124

Query  491  DILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFI  640
             ++  E++    G        +  A P  N L+TF +F+++G  P++A++
Sbjct  125  KVIEQERINMIFG------TAETEAHPINNALVTFLSFILYGFIPLIAYV  168



>dbj|GAM16838.1| hypothetical protein SAMD00019534_000130, partial [Acytostelium 
subglobosum LB1]
Length=352

 Score =   100 bits (250),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 59/190 (31%), Positives = 105/190 (55%), Gaps = 12/190 (6%)
 Frame = +2

Query  92   EDGEMEKKGKSEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLG  271
            E G    K  S K+   +   G++++SI++ G+D +V+ F  ++ ++ G      +LV+ 
Sbjct  91   EIGSTISKITSVKKEDLKLDTGKYIKSIIYGGMDGLVSIFVSVAVVATGHDKIMVLLVIA  150

Query  272  FANLVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELN  451
             A LVA  ISMG GD++ T  + D    E++  EW+V + P   ++E+++ Y + G+ + 
Sbjct  151  LAKLVAGAISMGMGDYLGTQADVDFAKGERMREEWEVEYYPEGEKKEMVEIYVSKGIPVE  210

Query  452  DATTVVTIFAK----YMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGC  619
             AT VV I AK    ++DI++ E++    G+    E+       WKNGLI F +F +FG 
Sbjct  211  VATEVVDILAKNKKGFVDIMMVEEL----GIMPDSEQ----EVAWKNGLINFISFTIFGI  262

Query  620  APILAFIILI  649
             PI  +++ +
Sbjct  263  IPIFPYLVFL  272



>ref|WP_014451770.1| hypothetical protein [Fervidobacterium pennivorans]
 ref|YP_005471449.1| hypothetical protein [Fervidobacterium pennivorans DSM 9078]
 gb|AFG35330.1| putative membrane protein [Fervidobacterium pennivorans DSM 9078]
Length=278

 Score = 99.8 bits (247),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 60/186 (32%), Positives = 96/186 (52%), Gaps = 10/186 (5%)
 Frame = +2

Query  95   DGEMEKKGKSEKRRPKEPW----KGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVL  262
            D E  KK  S     KEPW    +G+++   V+   D IVT+F+ IS I+   LS    +
Sbjct  26   DLETHKKLHSPDEIGKEPWHKTEQGKYIGQAVYGASDGIVTTFAAISGIAGANLSPKIAI  85

Query  263  VLGFANLVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGM  442
            ++G ANL ADGISM  GD++S  +E+D +  EK    W++ H P A + E+ + Y+  G+
Sbjct  86   IVGLANLFADGISMAIGDYLSEKSEKDYIKSEKERELWEIEHLPEAEKLEVREIYKRKGL  145

Query  443  ELNDATTVVTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCA  622
                   +V       +I V   +  + G+       +    P K+ +ITF +FV+ G  
Sbjct  146  TGEKLEHLVEAITSNKEIWVDTMLHEELGIF------EDDTNPLKSAIITFLSFVIAGFM  199

Query  623  PILAFI  640
            P++A+I
Sbjct  200  PLIAYI  205



>ref|XP_802487.1| hypothetical protein [Trypanosoma cruzi strain CL Brener]
 gb|EAN81041.1| hypothetical protein, conserved [Trypanosoma cruzi]
Length=249

 Score = 99.4 bits (246),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 64/186 (34%), Positives = 105/186 (56%), Gaps = 8/186 (4%)
 Frame = +2

Query  95   DGEMEKKGKSEKRRPKEPWKG----EFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVL  262
            D EM ++ +  K  P E +      ++++S+VF GLD I+T+F+++++      S   +L
Sbjct  29   DLEMSRR-EHAKPLPHEEFHSSTASDYIKSVVFGGLDGIMTTFAIVAAAVGSNNSYVTIL  87

Query  263  VLGFANLVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGM  442
            + GF+N++ADG SMGFG++VS   ER+    E+   EW+V +       E++Q Y+A G+
Sbjct  88   IFGFSNVIADGFSMGFGEYVSGEAERENALAERRREEWEVENAFDLEVDEMVQIYEAKGL  147

Query  443  ELNDATTVVTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCA  622
               DATT+V I +K   + V   M  + GL   L        P K G + F +FV+FG  
Sbjct  148  SHEDATTIVNIISKDPKLFVDFMMTEELGLLLDL---SDVHGPKKQGAVMFISFVMFGFL  204

Query  623  PILAFI  640
            P+LA++
Sbjct  205  PLLAYV  210



>gb|EWM28095.1| vacuolar iron family transporter [Nannochloropsis gaditana]
Length=300

 Score = 99.8 bits (247),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 60/169 (36%), Positives = 93/169 (55%), Gaps = 7/169 (4%)
 Frame = +2

Query  155  GEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTST  334
            G++V+S++F GLD I+TSF++++  + G L    V+VLGF+N+ AD  SMG G+++S+  
Sbjct  65   GDYVKSMIFGGLDGILTSFAIVAGAAGGGLPVEVVMVLGFSNIFADAFSMGMGEYLSSKA  124

Query  335  ERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKYMDILVAEKM  514
              + V KEK    W++ +      +E++  Y   GME +DA  VV   +KY D  V   M
Sbjct  125  HNEFVFKEKERESWELQNFREGEIKEMIDIYVERGMEPDDAEDVVRKMSKYDDFFVNVMM  184

Query  515  AAKKGLSSPLEKGKKPAKPW-KNGLITFAAFVVFGCAPILAFIILIPFT  658
              + GL  P      P     K G++ F +F  FG  P+L +  LIP  
Sbjct  185  VEELGLQVP-----DPNDDIVKEGVVMFLSFAGFGAMPLLGY-ALIPLC  227



>ref|XP_003290810.1| hypothetical protein DICPUDRAFT_81525 [Dictyostelium purpureum]
 gb|EGC32641.1| hypothetical protein DICPUDRAFT_81525 [Dictyostelium purpureum]
Length=277

 Score = 99.4 bits (246),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 51/175 (29%), Positives = 95/175 (54%), Gaps = 1/175 (1%)
 Frame = +2

Query  119  KSEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGI  298
            + +++ P +   GEF++SIVF GLD I+T+F+++++ +   L+ G +L++ FANL+ D I
Sbjct  33   EEDRKEPHKEESGEFIKSIVFGGLDGIITTFAIVAAATGAGLTRGVILIVAFANLLGDAI  92

Query  299  SMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIF  478
             M  GD+VS   E D +  E+   E  +   P   +  L++ Y+  G     A  +V + 
Sbjct  93   GMAVGDYVSELAEEDQIKLEQSKLEKQIEENPEEQKLVLVELYEDKGFTNEQAKRIVELL  152

Query  479  AKYMDILVAEKMAAKKG-LSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFI  640
              Y   + +  M  + G ++   E G       K+ L+TF +F++ G  P+L+++
Sbjct  153  FPYRKTVTSIMMMEEHGAVAEDEEDGGSKYGAIKSALVTFGSFLICGGIPLLSYL  207



>ref|WP_033191902.1| membrane protein [Fervidobacterium islandicum]
 gb|KHG32014.1| membrane protein [Fervidobacterium islandicum]
Length=278

 Score = 99.4 bits (246),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 58/186 (31%), Positives = 98/186 (53%), Gaps = 10/186 (5%)
 Frame = +2

Query  95   DGEMEKKGKSEKRRPKEPW----KGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVL  262
            D E  +K  S ++  KEPW    +G+++   V+   D IVT+F+ IS I+   L+    +
Sbjct  26   DLETHRKLHSPEQIGKEPWHKTEQGKYIGQAVYGASDGIVTTFAAISGIAGANLNPKIAI  85

Query  263  VLGFANLVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGM  442
            ++G ANL ADGISM  GD++S  +E+D +  EK    W+V H P A + E+ + Y+  G+
Sbjct  86   IVGLANLFADGISMAIGDYLSEKSEKDYIRYEKEREMWEVEHMPEAEKLEVKEIYKRKGL  145

Query  443  ELNDATTVVTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCA  622
                   +V       +I V   +  + GL       +    P K+ ++TF +FV+ G  
Sbjct  146  SGEKLENLVDAITSNKEIWVDTMLHEELGLF------EDDTNPLKSAVVTFLSFVIAGFM  199

Query  623  PILAFI  640
            P++A++
Sbjct  200  PLIAYV  205



>emb|CDJ59224.1| integral membrane protein, putative [Eimeria maxima]
Length=321

 Score = 99.8 bits (247),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 61/200 (31%), Positives = 104/200 (52%), Gaps = 10/200 (5%)
 Frame = +2

Query  56   ESSRYVQLGGSVEDGEMEKKGKSE----KRRPKEPWKGEFVRSIVFAGLDAIVTSFSLIS  223
            +++R V+  G       ++K   E         +    +++++IVF GLD IVT F++++
Sbjct  52   DATRQVKRAGEAHQHTHQQKAYDELSCSHTESHKKTSSDYLKAIVFGGLDGIVTIFAIVA  111

Query  224  SISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIAL  403
                  L    V+++G  NL+AD ISMGFG+FVS++ E D V  E+   EW++ + P   
Sbjct  112  GCVGANLHPSKVVIIGIGNLLADAISMGFGEFVSSAAEEDFVKSEREREEWEIENCPNEE  171

Query  404  QQELLQHYQ-ALGMELNDATTVVTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKN  580
            +QE+++ Y+   G    DA  +V I  KY +  V   M  + GL +      +   P + 
Sbjct  172  KQEMVEIYRDRYGFTDEDADCLVNITFKYREFFVQHMMVEELGLMA-----NEGPSPIRR  226

Query  581  GLITFAAFVVFGCAPILAFI  640
            G + FA+F +FG  P+  F+
Sbjct  227  GAVMFASFSIFGLLPLAGFV  246



>ref|XP_011132107.1| VIT family protein [Gregarina niphandrodes]
 gb|EZG48326.1| VIT family protein [Gregarina niphandrodes]
Length=313

 Score = 99.8 bits (247),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 62/200 (31%), Positives = 98/200 (49%), Gaps = 5/200 (3%)
 Frame = +2

Query  155  GEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTST  334
            G  VRS+VF GLD IVT F+L++       +    + +G  NL+AD  +MG+G++VS+  
Sbjct  55   GSVVRSVVFGGLDGIVTMFALLAGCMGAETTVLQTVTIGVGNLIADAFAMGYGEYVSSKA  114

Query  335  ERDVVAKEKIVAEWDVMHTPIALQQELLQHY-QALGMELNDATTVVTIFAKYMDILVAEK  511
            E + V  E    +W++ H P   ++E++  Y +  G    DA   V I  +Y D  +   
Sbjct  115  EEEYVEGETKREKWEMYHYPEGERKEMMTLYMEKYGFTAQDAEFYVDIGMQYPDYFLQHM  174

Query  512  MAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFIILIPFTQNVTHKFMaac  691
            M  + GL+           P   G + F +F+  G  P+  F++L     N  H F   C
Sbjct  175  MFEELGLTLT----DSSTSPRITGTVMFLSFLFHGLVPLGGFLLLSYLLPNNKHAFYGTC  230

Query  692  alsalaltllGIAKAKIASQ  751
            A++   L  LG  KAK++ Q
Sbjct  231  AMTICTLLALGYVKAKLSGQ  250



>ref|XP_814955.1| hypothetical protein [Trypanosoma cruzi strain CL Brener]
 gb|EAN93104.1| hypothetical protein, conserved [Trypanosoma cruzi]
Length=284

 Score = 99.4 bits (246),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 62/190 (33%), Positives = 108/190 (57%), Gaps = 16/190 (8%)
 Frame = +2

Query  95   DGEMEKKGKSEKRRPKEPWKG----EFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVL  262
            D EM ++ +  K  P E +      ++++S+VF GLD I+T+F+++++      S   +L
Sbjct  29   DLEMSRR-EHAKPLPHEEFHSSTASDYIKSVVFGGLDGIMTTFAIVAAAVGSNNSYVTIL  87

Query  263  VLGFANLVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGM  442
            + GF+N++ADG SMGFG++VS   ER+    E+   EW+V +       E++Q Y+A G+
Sbjct  88   IFGFSNVIADGFSMGFGEYVSGEAERENALAERRREEWEVENAFDLEVDEMVQIYEAKGL  147

Query  443  ELNDATTVVTIFAK----YMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVV  610
               DATT+V I +K    ++D ++ E++     LS           P K G + F +F++
Sbjct  148  SHEDATTIVNIISKDPKLFVDFMMTEELGLLLDLS-------DVHGPKKQGAVMFISFII  200

Query  611  FGCAPILAFI  640
            FG  P+LA++
Sbjct  201  FGFLPLLAYV  210



>emb|CDI82782.1| integral membrane protein, putative [Eimeria praecox]
Length=295

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 57/174 (33%), Positives = 96/174 (55%), Gaps = 6/174 (3%)
 Frame = +2

Query  122  SEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGIS  301
            S+ +   +    +++++IVF GLD IVT F++++      L    V+++G  NL+AD IS
Sbjct  52   SDHKEAHKRTSSDYLKAIVFGGLDGIVTIFAIVAGCVGANLHPSKVVIIGIGNLLADAIS  111

Query  302  MGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQ-ALGMELNDATTVVTIF  478
            MGFG+FVS++ E D V  E+   EW++ + P   +QE+++ Y+   G    DA  +V I 
Sbjct  112  MGFGEFVSSAAEEDFVKSEREREEWEIENCPNEEKQEMVEIYRDRYGFTDEDADCLVKIT  171

Query  479  AKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFI  640
             KY +  V   M  + GL +      +   P + G + FA+F +FG  P+  F+
Sbjct  172  FKYREFFVQHMMVEELGLMA-----TEGPSPLRRGAVMFASFSIFGLLPLAGFV  220



>gb|EKG05392.1| hypothetical protein TCSYLVIO_003530 [Trypanosoma cruzi]
 gb|ESS65088.1| hypothetical protein TCDM_06620 [Trypanosoma cruzi Dm28c]
Length=284

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 63/190 (33%), Positives = 108/190 (57%), Gaps = 16/190 (8%)
 Frame = +2

Query  95   DGEMEKKGKSEKRRPKEPWKG----EFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVL  262
            D EM ++ +  K  P E +      ++++S+VF GLD I+T+F+++++      S   +L
Sbjct  29   DLEMSRR-EHAKPLPHEEFHSSTASDYIKSVVFGGLDGIMTTFAIVAAAVGSNNSYVTIL  87

Query  263  VLGFANLVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGM  442
            + GF+N++ADG SMGFG++VS   ER+    E+   EW+V +       E++Q Y+A G+
Sbjct  88   IFGFSNVIADGFSMGFGEYVSGEAERENALAERRREEWEVENAFDLEVDEMVQIYEAKGL  147

Query  443  ELNDATTVVTIFAK----YMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVV  610
               DATT+V I +K    ++D ++ E++     LS           P K G + F +FV+
Sbjct  148  SHEDATTIVNIISKDPKLFVDFMMTEELGLLLDLS-------DVHGPKKQGAVMFISFVM  200

Query  611  FGCAPILAFI  640
            FG  P+LA++
Sbjct  201  FGFLPLLAYV  210



>ref|XP_002511783.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50452.1| conserved hypothetical protein [Ricinus communis]
Length=117

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 65/97 (67%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = +2

Query  566  KPWKNGLITFAAFVVFGCAPILAFIILIPFTQNVTHKFMaacalsalaltllGIAKAKIA  745
            KPWKN L+TF AF+VFG  P+L+FI+LIPFT +   KF  ACAL+A AL LLGI+K KIA
Sbjct  15   KPWKNALVTFLAFLVFGSLPLLSFIVLIPFTNSDQVKFTGACALAAAALVLLGISKGKIA  74

Query  746  SQSYTVSVAITLSNgaiagasayaigWTLRNVAGLED  856
             QSY  SV ITL+NGAIA  +AY++GWTLRNVA LED
Sbjct  75   GQSYVPSVVITLTNGAIAATAAYSLGWTLRNVAHLED  111



>emb|CDJ28030.1| integral membrane protein, putative [Eimeria mitis]
Length=321

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 56/162 (35%), Positives = 93/162 (57%), Gaps = 6/162 (4%)
 Frame = +2

Query  158  EFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTSTE  337
            +++++IVF GLD IVT F++++      L    V+++G  NL+AD ISMGFG+FVS++ E
Sbjct  91   DYLKAIVFGGLDGIVTIFAIVAGCVGANLHPSKVVIIGVGNLLADAISMGFGEFVSSAAE  150

Query  338  RDVVAKEKIVAEWDVMHTPIALQQELLQHYQ-ALGMELNDATTVVTIFAKYMDILVAEKM  514
             D V  E+   EW++ + P   +QE+++ Y+   G    DA  +V I  KY +  V   M
Sbjct  151  EDFVKSEREREEWEIENCPNEEKQEMVEIYRDRYGFTEEDADCLVNITFKYREFFVQHMM  210

Query  515  AAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFI  640
              + GL +      +   P + G++ FA+F +FG  P+  F+
Sbjct  211  VEELGLMA-----TEGPSPIRRGVVMFASFSIFGLLPLAGFV  247



>ref|WP_006308795.1| membrane protein [Facklamia languida]
 gb|EHR37207.1| hypothetical protein HMPREF9708_00768 [Facklamia languida CCUG 
37842]
Length=223

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 62/174 (36%), Positives = 96/174 (55%), Gaps = 20/174 (11%)
 Frame = +2

Query  152  KGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTS  331
            KGE ++S+V+ GLD  +T+F++++  + G L    +++LGFANL+ADGISM  GD++S+ 
Sbjct  8    KGEGLKSMVYGGLDGAITTFAVVAGATGGELDMRVIIILGFANLLADGISMAVGDYLSSK  67

Query  332  TERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKYMDILVAEK  511
            +E++     +   +  +  +P    Q L Q YQ  GM+  DA  V  I +KY      E 
Sbjct  68   SEKEYDENNR-KKQQALSSSP----QGLAQVYQDNGMQAEDAQKVADILSKYDQDTQDEL  122

Query  512  MAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFII------LIPF  655
            +    G +S  E     + P  N LITF +F +FG  P+L FI       LIP+
Sbjct  123  I----GFNSEPE-----SHPLYNALITFFSFAIFGLVPLLVFIASYFNPGLIPY  167



>ref|XP_003721827.1| conserved hypothetical protein [Leishmania major strain Friedlin]
 emb|CBZ12081.1| conserved hypothetical protein [Leishmania major strain Friedlin]
Length=289

 Score = 97.4 bits (241),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 62/174 (36%), Positives = 102/174 (59%), Gaps = 6/174 (3%)
 Frame = +2

Query  128  KRRPKEPWK---GEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGI  298
            K  P+E       E+V+S+VF GLD I+T+F++I++ +    +   VL+ GF+N++ADG 
Sbjct  41   KEMPQENHNVSASEYVKSLVFGGLDGIMTTFAIIAAAAGSGGNKATVLIFGFSNVIADGF  100

Query  299  SMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIF  478
            SMGFG++VS   ER+    E+   EW+V ++      E++Q Y A G+  +DA T+V I 
Sbjct  101  SMGFGEYVSGEAERENAISERRREEWEVENSFDLEIDEMVQIYMAKGLSFDDAHTIVGII  160

Query  479  AKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFI  640
            +K   + V   M  + GL   ++    P    K G++ FA+F+ FG  P+LA++
Sbjct  161  SKDPKMFVDFMMVEELGLLMDMDDAHGPK---KQGVVMFASFMFFGSIPLLAYL  211



>gb|EKF35637.1| hypothetical protein MOQ_002326 [Trypanosoma cruzi marinkellei]
Length=284

 Score = 97.1 bits (240),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 61/190 (32%), Positives = 107/190 (56%), Gaps = 16/190 (8%)
 Frame = +2

Query  95   DGEMEKKGKSEKRRPKEPWKG----EFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVL  262
            D EM ++ +  K  P   +      ++++S+VF GLD I+T+F+++++      S   +L
Sbjct  29   DLEMSRR-EHAKPLPHTEFHSSTASDYIKSVVFGGLDGIMTTFAIVAAAVGSNNSYVTIL  87

Query  263  VLGFANLVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGM  442
            + GF+N++ADG SMGFG++VS   ER+    E+   EW+V +       E++Q Y+A G+
Sbjct  88   IFGFSNVIADGFSMGFGEYVSGEAERENALAERRREEWEVENAFDLEVDEMVQIYEAKGL  147

Query  443  ELNDATTVVTIFAK----YMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVV  610
               DATT+V I +K    ++D ++ E++     LS           P K G + F +F++
Sbjct  148  SHEDATTIVNIISKDPKLFVDFMMTEELGLLLDLS-------DVHGPKKQGAVMFLSFII  200

Query  611  FGCAPILAFI  640
            FG  P+LA++
Sbjct  201  FGFLPLLAYV  210



>gb|AGN32978.1| hypothetical protein [Trypanosoma rangeli]
Length=284

 Score = 96.7 bits (239),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 58/165 (35%), Positives = 98/165 (59%), Gaps = 11/165 (7%)
 Frame = +2

Query  158  EFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTSTE  337
            ++++S+VF GLD I+T+F+++++      S   +LV GF+N++ADG SMGFG++VS   E
Sbjct  53   DYIKSVVFGGLDGIMTTFAIVAAAVGSNSSYTAILVFGFSNVIADGFSMGFGEYVSGEAE  112

Query  338  RDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAK----YMDILVA  505
            R+    E+   EW+V +       E++Q Y+A G+   DATT+V I +K    ++D ++ 
Sbjct  113  RENALIERRREEWEVENAFDLEVDEMVQIYEAKGLSHEDATTIVNIISKDPRLFVDFMMM  172

Query  506  EKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFI  640
            E++     LS           P K G++ F +F +FG  P+LA+I
Sbjct  173  EELGLVLDLS-------DVHSPKKQGIVMFFSFFLFGIIPLLAYI  210



>ref|WP_027227062.1| membrane protein [Legionella pneumophila]
Length=241

 Score = 96.3 bits (238),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 56/193 (29%), Positives = 106/193 (55%), Gaps = 11/193 (6%)
 Frame = +2

Query  83   GSVEDGEMEKKGKSEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVL  262
            G++E G  +K+ +  +R  + P    ++R  ++ G+D +VT+F+++S +  G+LSS  +L
Sbjct  2    GNLEHGHSQKEIR--ERLTQTP-SQNYLRDWIYGGIDGVVTTFAIVSGVVGGQLSSLVIL  58

Query  263  VLGFANLVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGM  442
            +LGFANL+ADG SM   +++ T +E D   + K + E  +   P   + E+ Q +Q  G+
Sbjct  59   ILGFANLLADGFSMAASNYLGTKSEVDQYQRYKAIEEKHIEFIPEGEKNEIKQIFQNKGL  118

Query  443  ELNDATTVVTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCA  622
                   VV        + +   +  + GL + L        P+K+ L TF+AF++FG  
Sbjct  119  HDQALEQVVDEITANRALWIKTMLQEEYGLPASLR------LPFKSALYTFSAFLLFGII  172

Query  623  PILAFIILI--PF  655
            P++ +++++  PF
Sbjct  173  PLIPYVLVMSNPF  185



>ref|WP_028378929.1| membrane protein [Legionella pneumophila]
Length=241

 Score = 95.9 bits (237),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 56/193 (29%), Positives = 106/193 (55%), Gaps = 11/193 (6%)
 Frame = +2

Query  83   GSVEDGEMEKKGKSEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVL  262
            G++E G  +K+ +  +R  + P    ++R  ++ G+D +VT+F+++S +  G+LSS  +L
Sbjct  2    GNLEHGHSQKEIR--ERLTQTP-SQNYLRDWIYGGIDGVVTTFAIVSGVVGGQLSSLVIL  58

Query  263  VLGFANLVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGM  442
            +LGFANL+ADG SM   +++ T +E D   + K + E  +   P   + E+ Q +Q  G+
Sbjct  59   ILGFANLLADGFSMAASNYLGTKSEVDQYQRYKAIEEKHIEFIPEGEKNEIKQIFQNKGL  118

Query  443  ELNDATTVVTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCA  622
                   VV        + +   +  + GL + L        P+K+ L TF+AF++FG  
Sbjct  119  HGQALEQVVDEITANRALWIKTMLQEEYGLPASLR------LPFKSALYTFSAFLLFGII  172

Query  623  PILAFIILI--PF  655
            P++ +++++  PF
Sbjct  173  PLIPYVLVMSNPF  185



>ref|XP_636076.1| hypothetical protein DDB_G0289715 [Dictyostelium discoideum AX4]
 gb|EAL62569.1| hypothetical protein DDB_G0289715 [Dictyostelium discoideum AX4]
Length=281

 Score = 96.3 bits (238),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 54/179 (30%), Positives = 96/179 (54%), Gaps = 5/179 (3%)
 Frame = +2

Query  119  KSEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGI  298
            + +++ P +   GEF++SIVF GLD I+T+F+++++ +   L+ G +L++ FANL+ D I
Sbjct  33   EEDRKEPHKEESGEFIKSIVFGGLDGIMTTFAIVAAATGAGLTRGVILIIAFANLLGDAI  92

Query  299  SMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIF  478
             M  GD+VS   E D +  E    E D+   P   +  L++ Y+  G   + A+ +V + 
Sbjct  93   GMAVGDYVSEIAEEDQLKLEYKKLEQDIDSNPDEQKSILIEIYEKKGFTNSQASRIVELL  152

Query  479  AKYMDILVAEKMAAKKGLS-----SPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFI  640
              Y   + +  M  + G +          G       K+ L+TFA+F+V G  P+LA++
Sbjct  153  FPYRKTVTSIMMMEEHGATVDDDDDEEGGGGTDYGAIKSALVTFASFLVCGGIPLLAYL  211



>ref|XP_003876595.1| conserved hypothetical protein [Leishmania mexicana MHOM/GT/2001/U1103]
 emb|CBZ28116.1| conserved hypothetical protein [Leishmania mexicana MHOM/GT/2001/U1103]
Length=289

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 65/196 (33%), Positives = 108/196 (55%), Gaps = 4/196 (2%)
 Frame = +2

Query  53   AESSRYVQLGGSVEDGEMEKKGKSEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSIS  232
             +++R     G VE    E   K  ++        E+V+S+VF GLD I+T+F++I++ +
Sbjct  20   CDAARAAFRAGDVEASRREHM-KGMQQENHNTSASEYVKSLVFGGLDGIMTTFAIIAAAA  78

Query  233  AGRLSSGDVLVLGFANLVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQE  412
                    VL+ GF+N++ADG SMGFG++VS   ER+    E+   EW+V ++      E
Sbjct  79   GSGGDKATVLIFGFSNVIADGFSMGFGEYVSGEAERENAISERRREEWEVENSFDLEIDE  138

Query  413  LLQHYQALGMELNDATTVVTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLIT  592
            ++Q Y A G+  +DA T+V I +K   + V   M  + GL   ++       P K G++ 
Sbjct  139  MVQIYMAKGLSFDDAHTIVGIISKDPKMFVDFMMVEELGLLVDID---DTHGPKKQGVVM  195

Query  593  FAAFVVFGCAPILAFI  640
            FA+F+ FG  P+LA++
Sbjct  196  FASFMFFGSIPLLAYL  211



>emb|CCF73024.1| unnamed protein product [Babesia microti strain RI]
Length=262

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 64/208 (31%), Positives = 98/208 (47%), Gaps = 10/208 (5%)
 Frame = +2

Query  50   MAESSRYVQ-LGGSVEDGEMEKKGKSEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISS  226
            M +S+ Y+  L G      M     SE  +      GE+++ IVF GLD IVT F++IS 
Sbjct  1    MEDSAIYISSLNGQDMTYYMSNFDHSEYHKGA---SGEYLKIIVFGGLDGIVTIFAIISG  57

Query  227  ISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQ  406
                 +    ++ +G  NL ADG+SMG G+F S   E D +  E     W++ + P   +
Sbjct  58   CIGASIDPIKIIFIGLGNLFADGLSMGLGEFASHKAEMDYIDSEMKRETWEIEYFPEEEK  117

Query  407  QELLQHYQA-LGMELNDATTVVTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNG  583
             E+   Y    G    DA ++V +  K     +   M  + GL   +  G   + P K  
Sbjct  118  NEMYNIYTTRYGFSDEDAKSLVNLTFKNKRFFLEHMMVEELGL---IANGDDKSSPVKRA  174

Query  584  LITFAAFVVFGCAPILAF--IILIPFTQ  661
            LI F +F++FG  P++ F   IL+P T 
Sbjct  175  LIMFLSFMIFGIIPLVGFSLSILVPHTD  202



>ref|XP_001466488.1| conserved hypothetical protein [Leishmania infantum JPCM5]
 ref|XP_003861879.1| hypothetical protein, conserved [Leishmania donovani]
 emb|CAM69209.1| conserved hypothetical protein [Leishmania infantum JPCM5]
 emb|CBZ35182.1| hypothetical protein, conserved [Leishmania donovani]
Length=289

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 66/199 (33%), Positives = 110/199 (55%), Gaps = 10/199 (5%)
 Frame = +2

Query  53   AESSRYVQLGGSVEDGEMEKKGKSEKRRPKEPWK---GEFVRSIVFAGLDAIVTSFSLIS  223
             +++R     G VE    E      K  P+E       E+V+S+VF GLD I+T+F++I+
Sbjct  20   CDAARAAFRAGDVEASRREHM----KEMPQENHNVSASEYVKSLVFGGLDGIMTTFAIIA  75

Query  224  SISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIAL  403
            + +    +   VL+ GF+N++ADG +MGFG++VS   ER+    E+   EW+V ++    
Sbjct  76   AAAGSGGNKATVLIFGFSNVIADGFAMGFGEYVSGEAERENAISERRREEWEVENSFDLE  135

Query  404  QQELLQHYQALGMELNDATTVVTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNG  583
              E++Q Y A G+  +DA T+V I +K   + V   M  + GL   ++    P    K G
Sbjct  136  IDEMVQIYMAKGLSFDDAHTIVGIISKDPKMFVDFMMVEELGLLVDIDDAHGPK---KQG  192

Query  584  LITFAAFVVFGCAPILAFI  640
            ++ FA+F+ FG  P+LA++
Sbjct  193  VVMFASFMFFGSIPLLAYL  211



>ref|XP_002771787.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
 ref|XP_002783272.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
 gb|EER03603.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
 gb|EER15068.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
Length=306

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 67/200 (34%), Positives = 110/200 (55%), Gaps = 6/200 (3%)
 Frame = +2

Query  161  FVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTSTER  340
            +V+ +VF GLD I T F+LI+     +L+   ++ +G  NLVA    MGFG++VS   E 
Sbjct  75   YVKPMVFGGLDGISTMFALIAGSVGAQLTLAHMVAVGVGNLVAGAFGMGFGEYVSAKAET  134

Query  341  DVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKYMDILVAEKMAA  520
            DV  KE+   +W+V + P     E++Q Y+  G+  +DA TV T  +KY +  +   M  
Sbjct  135  DVAVKEQNREQWEVENYPEGEISEMVQLYRTRGISKDDAITVATTLSKYKEFWIEHMMLT  194

Query  521  KKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFIILIPFTQN--VTHKFMaaca  694
            + GL  P++     A    +G   F +F++FG  P+L++++LI   ++  V   F     
Sbjct  195  ELGL-FPVDAEDSAA---ASGFAMFCSFMIFGSVPLLSYLLLIMLIKDLPVAGAFAGTVC  250

Query  695  lsalaltllGIAKAKIASQS  754
             S L L +LG+ K+K+ SQ+
Sbjct  251  TSLLTLFVLGVVKSKVVSQN  270



>ref|WP_034537598.1| membrane protein [Carnobacterium inhibens]
Length=235

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 59/202 (29%), Positives = 109/202 (54%), Gaps = 6/202 (3%)
 Frame = +2

Query  152  KGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTS  331
            KG++++SIV+ GLD I+T+F++++    G LS   VL+LGF+NL+ADG SM  GD++ST 
Sbjct  12   KGKYIKSIVYGGLDGIITTFAVVAGSVGGELSFKVVLILGFSNLLADGFSMAVGDYLSTK  71

Query  332  TERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKYMDILVAEK  511
            ++ +      +  + D+ +       ++++ +   G+   DA  +V   AKY +  V + 
Sbjct  72   SQNEYEKTLHLKKQSDIRNHQENEVNKMIRSFINQGITQPDAEVLVNTLAKYEEPFVNQI  131

Query  512  MAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFIILIPFTQNVTHKFMaac  691
            M    G     +       P KN   TF +F +FG  P+L +++ I     + + F+ A 
Sbjct  132  MKENYGTDLTED------SPIKNAAATFLSFSIFGVVPLLIYVLSIYIPGLLQNTFLIAS  185

Query  692  alsalaltllGIAKAKIASQSY  757
             L+ + L +LG  K+++   ++
Sbjct  186  LLTGVTLFILGAVKSRVTQSNW  207



>ref|WP_011994207.1| hypothetical protein [Fervidobacterium nodosum]
 ref|YP_001410550.1| hypothetical protein Fnod_1044 [Fervidobacterium nodosum Rt17-B1]
 gb|ABS60893.1| protein of unknown function DUF125 transmembrane [Fervidobacterium 
nodosum Rt17-B1]
Length=274

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 61/186 (33%), Positives = 98/186 (53%), Gaps = 10/186 (5%)
 Frame = +2

Query  95   DGEMEKKGKSEKRRPKEPW----KGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVL  262
            D E  KK  S     KEPW    +G+++   V+   D IVT+F+ IS ++   LS    L
Sbjct  23   DLETHKKLHSPDEIGKEPWHKTEQGKYIGQAVYGASDGIVTTFAAISGVAGANLSPKVAL  82

Query  263  VLGFANLVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGM  442
            ++G ANL ADGISM  GD++S  +E+D +A E+    W+V H P A + E+ + Y+  G+
Sbjct  83   IVGLANLFADGISMAIGDYLSEKSEKDYLAAERERERWEVEHMPEAEKHEIREIYKRKGL  142

Query  443  ELNDATTVVTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCA  622
                   +V       D+ V   +  + GL       +  + P K+ L+TF AF++ G  
Sbjct  143  SGEKLDKLVDAITSDKDLWVETMLHEELGLF------EDDSSPLKSALVTFFAFIIAGFM  196

Query  623  PILAFI  640
            P++A++
Sbjct  197  PLIAYV  202



>ref|WP_023179167.1| membrane protein [Carnobacterium sp. WN1359]
 ref|YP_008719205.1| membrane protein [Carnobacterium sp. WN1359]
 gb|AGY82435.1| membrane protein [Carnobacterium sp. WN1359]
Length=235

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/169 (32%), Positives = 92/169 (54%), Gaps = 8/169 (5%)
 Frame = +2

Query  152  KGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTS  331
            KG++++SIV+ GLD I+T+F++++    G LS   VL+LGF+NL+ADG SM  GD++ST 
Sbjct  12   KGKYIKSIVYGGLDGIITTFAVVAGSVGGELSFKVVLILGFSNLLADGFSMAVGDYLSTK  71

Query  332  TERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKYMDILVAEK  511
            ++ +      +  + D+ +       ++++ +   G+   DA  +V   AKY +  V + 
Sbjct  72   SQNEYEKTLHLKKQSDIRNHQENEVNKMIRSFINQGITQPDAEVLVNTLAKYEEPFVNQI  131

Query  512  MAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFI--ILIP  652
            M    G     +       P KN   TF +F +FG  P+L ++  I IP
Sbjct  132  MKENYGTDLAED------SPIKNAAATFLSFSIFGVVPLLIYVLSIYIP  174



>ref|XP_009312468.1| integral membrane protein [Trypanosoma grayi]
 gb|KEG09295.1| integral membrane protein [Trypanosoma grayi]
Length=285

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 63/187 (34%), Positives = 106/187 (57%), Gaps = 8/187 (4%)
 Frame = +2

Query  92   EDGEMEKKGKSEKRRPKEPWKG----EFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDV  259
             D EM +  + +K  P   +      ++++S+VF GLD I+T+F+++++      +   V
Sbjct  29   RDVEMSRL-EHQKPLPHAEYHSSTASDYIKSVVFGGLDGIMTTFAIVAAAVGSNSTFASV  87

Query  260  LVLGFANLVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALG  439
            L+ GF+N++ADG SMGFG++VS   ER+    E+   EW+V +       E++Q Y+A G
Sbjct  88   LIFGFSNVIADGFSMGFGEYVSGEAERENARAERRREEWEVENAFDMEVDEMVQIYEAKG  147

Query  440  MELNDATTVVTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGC  619
            +   DATT+V I +K   + V   M  + GL   L     P    K G++ FA+F++FG 
Sbjct  148  LSHEDATTIVNIISKDPKLFVDFMMTEELGLILDLSDLHGPK---KQGVVMFASFLIFGT  204

Query  620  APILAFI  640
             P+LA++
Sbjct  205  IPLLAYV  211



>ref|XP_002262306.1| integral membrane protein, conserved [Plasmodium knowlesi strain 
H]
 emb|CAQ42184.1| integral membrane protein, conserved [Plasmodium knowlesi strain 
H]
Length=273

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/212 (27%), Positives = 108/212 (51%), Gaps = 6/212 (3%)
 Frame = +2

Query  125  EKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISM  304
            +K   +     + +++I+F  LD I+T F+++S     +++   V+++G  NL A+ ISM
Sbjct  32   DKHGEQHSLDKDNLKTIIFGSLDGIITIFAIVSGCVGAKITPAQVIIIGVGNLFANAISM  91

Query  305  GFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHY-QALGMELNDATTVVTIFA  481
            GF ++ ST+ +RD +  EK   EW++ + P   +QE++  Y      +  DA  +V I  
Sbjct  92   GFSEYTSTTAQRDFMLAEKKREEWEIENCPSEEKQEMIDIYMNKYKFDSEDARNLVEITF  151

Query  482  KYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFIILIPFTQ  661
            +  +  +   M+ + GL    E      +  K G+I F +F VFG  P+ +++    F Q
Sbjct  152  RNKNFFLEHMMSEELGLIITHEDKN---ESLKKGIIMFLSFCVFGMIPLFSYVAYTFFFQ  208

Query  662  NVTHK--FMaacalsalaltllGIAKAKIASQ  751
               +   F+     + + L +LGI K++  +Q
Sbjct  209  YTDYNTSFVVVFVSTLITLFILGIFKSQFTNQ  240



>ref|XP_002771788.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
 gb|EER03604.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
Length=348

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/155 (34%), Positives = 84/155 (54%), Gaps = 4/155 (3%)
 Frame = +2

Query  161  FVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTSTER  340
            +V+ +VF GLD I T F+LI+     +L+   ++ +G  NLVA    MGFG++VS   E 
Sbjct  75   YVKPMVFGGLDGISTMFALIAGSVGAQLTLAHMVAVGVGNLVAGAFGMGFGEYVSAKAET  134

Query  341  DVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKYMDILVAEKMAA  520
            DV  KE+   +W+V + P     E++Q Y+  G+  +DA TV T  +KY +  +   M  
Sbjct  135  DVAVKEQNREQWEVENYPEGEISEMVQLYRTRGISKDDAITVATTLSKYKEFWIEHMMLT  194

Query  521  KKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAP  625
            + GL  P++     A    +G   F +F++FG  P
Sbjct  195  ELGL-FPVDAEDSAA---ASGFAMFCSFMIFGSVP  225



>ref|WP_012744710.1| hypothetical protein [Kosmotoga olearia]
 ref|YP_002939927.1| hypothetical protein Kole_0198 [Kosmotoga olearia TBF 19.5.1]
 gb|ACR78923.1| protein of unknown function DUF125 transmembrane [Kosmotoga olearia 
TBF 19.5.1]
Length=271

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 55/199 (28%), Positives = 107/199 (54%), Gaps = 12/199 (6%)
 Frame = +2

Query  92   EDGEMEKKGKSEKRRPKEPWK----GEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDV  259
             D  + +     K+  +EPW     G ++ S V+   D IVT+F++++ ++  +L    V
Sbjct  18   RDLSLHQMAHDPKKIGQEPWHKTEAGRYIGSAVYGASDGIVTTFAVVAGVAGAQLDPKIV  77

Query  260  LVLGFANLVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALG  439
            L++GFANL ADG SM  GD++S  +E+D +  E+    W+V   P   ++E+ + Y+  G
Sbjct  78   LIMGFANLFADGFSMAVGDYLSEKSEQDYIKSEREREAWEVDVNPEGEREEIREIYKRKG  137

Query  440  MELNDATTVVTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGC  619
            ++      +V +     ++ +   M  + G+        + + P K+ ++TF +FV+ G 
Sbjct  138  LKGEKLEQMVELITSDKELWIDTMMKEELGIME-----DEGSSPLKSAIVTFLSFVIAGF  192

Query  620  APILAFII--LIP-FTQNV  667
             P++A++   L+P F+QN+
Sbjct  193  MPLVAYVFASLVPFFSQNM  211



>gb|EAR83460.3| integral membrane protein [Tetrahymena thermophila SB210]
Length=283

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 55/184 (30%), Positives = 102/184 (55%), Gaps = 6/184 (3%)
 Frame = +2

Query  128  KRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMG  307
              + +    G F++S V+ GLD ++T+++++  ++   L +  +L LG ++L+ DGI M 
Sbjct  49   NHKEQHNTSGAFIKSAVYGGLDGLITTYAVVMGVAGAELQTVVILALGVSSLIGDGICMS  108

Query  308  FGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKY  487
             GD++ST +E +   +E+   EW+V + P   + E+++ Y+  G+   DAT +V I +KY
Sbjct  109  LGDYLSTKSEIEFQRRERHREEWEVDNLPEEEKAEMIELYENKGISREDATQIVEIMSKY  168

Query  488  MDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFIILIPFTQNV  667
                V   M  + GL  P E+      P KN ++T  +F++FG  P++ F+I   F+ + 
Sbjct  169  KQAWVDIMMVEELGL-IPQEE-----NPIKNAIVTLTSFILFGQIPLIPFVITQIFSIDA  222

Query  668  THKF  679
               F
Sbjct  223  NELF  226



>gb|EAP76430.1| hypothetical protein ISM_16230 [Roseovarius nubinhibens ISM]
Length=229

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 55/174 (32%), Positives = 92/174 (53%), Gaps = 11/174 (6%)
 Frame = +2

Query  158  EFVRSIVFAGLDAIVTSFSLISSISA----GRLSSGD--VLVLGFANLVADGISMGFGDF  319
            EF++ I++ G D IVT+F++++  +     G L  G   VLV G ANL AD +SMG G+F
Sbjct  6    EFLKQIIYGGNDGIVTTFAIVAGFAGASAEGVLQIGGLAVLVFGLANLFADAVSMGLGEF  65

Query  320  VSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKYMDIL  499
            +S  ++ D+  K +     ++   P   + EL +  +  G+   +A T   + +++  I+
Sbjct  66   LSLRSQHDLYRKRRESELREIAENPDHERMELFEILRQRGVPPGEADTAAELLSRHPSIM  125

Query  500  VAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFIILIPFTQ  661
                M  + G+S P +       P  +GL TF AFVVFG  P+L + ++ P  Q
Sbjct  126  ADLMMTYEFGMSHPEDD-----SPALSGLFTFLAFVVFGAVPLLPYFVMEPTPQ  174



>ref|WP_040618166.1| GMP synthase [Roseovarius nubinhibens]
Length=241

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 55/174 (32%), Positives = 92/174 (53%), Gaps = 11/174 (6%)
 Frame = +2

Query  158  EFVRSIVFAGLDAIVTSFSLISSISA----GRLSSGD--VLVLGFANLVADGISMGFGDF  319
            EF++ I++ G D IVT+F++++  +     G L  G   VLV G ANL AD +SMG G+F
Sbjct  18   EFLKQIIYGGNDGIVTTFAIVAGFAGASAEGVLQIGGLAVLVFGLANLFADAVSMGLGEF  77

Query  320  VSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKYMDIL  499
            +S  ++ D+  K +     ++   P   + EL +  +  G+   +A T   + +++  I+
Sbjct  78   LSLRSQHDLYRKRRESELREIAENPDHERMELFEILRQRGVPPGEADTAAELLSRHPSIM  137

Query  500  VAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFIILIPFTQ  661
                M  + G+S P +       P  +GL TF AFVVFG  P+L + ++ P  Q
Sbjct  138  ADLMMTYEFGMSHPEDD-----SPALSGLFTFLAFVVFGAVPLLPYFVMEPTPQ  186



>ref|XP_001031123.2| Integral membrane protein [Tetrahymena thermophila]
Length=277

 Score = 94.4 bits (233),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 55/184 (30%), Positives = 102/184 (55%), Gaps = 6/184 (3%)
 Frame = +2

Query  128  KRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMG  307
              + +    G F++S V+ GLD ++T+++++  ++   L +  +L LG ++L+ DGI M 
Sbjct  43   NHKEQHNTSGAFIKSAVYGGLDGLITTYAVVMGVAGAELQTVVILALGVSSLIGDGICMS  102

Query  308  FGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKY  487
             GD++ST +E +   +E+   EW+V + P   + E+++ Y+  G+   DAT +V I +KY
Sbjct  103  LGDYLSTKSEIEFQRRERHREEWEVDNLPEEEKAEMIELYENKGISREDATQIVEIMSKY  162

Query  488  MDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFIILIPFTQNV  667
                V   M  + GL  P E+      P KN ++T  +F++FG  P++ F+I   F+ + 
Sbjct  163  KQAWVDIMMVEELGL-IPQEE-----NPIKNAIVTLTSFILFGQIPLIPFVITQIFSIDA  216

Query  668  THKF  679
               F
Sbjct  217  NELF  220



>ref|WP_026969529.1| membrane protein [Algoriphagus terrigena]
Length=240

 Score = 93.2 bits (230),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 50/161 (31%), Positives = 88/161 (55%), Gaps = 6/161 (4%)
 Frame = +2

Query  158  EFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTSTE  337
            E++R  V+ G+D  VT+F++++      L +G +L+LGFANL+ADG SM  G ++S  +E
Sbjct  18   EYLREFVYGGIDGAVTTFAVVAGGFGANLDAGVLLILGFANLLADGFSMSVGAYLSAKSE  77

Query  338  RDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKYMDILVAEKMA  517
            RD  +K + +  W+V + P   ++E+ + Y+  G E    T +V       ++ V+E M 
Sbjct  78   RDNFSKHEKIEYWEVENMPETEREEIAEIYREKGFEGELLTNIVDHICANKELWVSEMMK  137

Query  518  AKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFI  640
             + GL       ++   P+K G  T  +F   G  P+L ++
Sbjct  138  DELGLI------RETKSPFKIGFATLLSFSAVGLIPLLVYL  172



>ref|WP_010947293.1| membrane protein [Legionella pneumophila]
 ref|YP_095593.1| hypothetical protein lpg1564 [Legionella pneumophila subsp. pneumophila 
str. Philadelphia 1]
 ref|YP_005185866.1| integral membrane protein [Legionella pneumophila subsp. pneumophila 
ATCC 43290]
 gb|AAU27646.1| integral membrane protein [Legionella pneumophila subsp. pneumophila 
str. Philadelphia 1]
 gb|AEW51767.1| integral membrane protein [Legionella pneumophila subsp. pneumophila 
ATCC 43290]
Length=247

 Score = 93.2 bits (230),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 53/190 (28%), Positives = 100/190 (53%), Gaps = 6/190 (3%)
 Frame = +2

Query  80   GGSVEDGEMEKKGKSEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDV  259
            G ++E+ E     K  + R  +     ++R  ++ G+D +VT+F+++S +  G+LSS  +
Sbjct  4    GSAMENLEHGHSQKEIRDRLAQVPSQNYLRDWIYGGIDGVVTTFAIVSGVVGGQLSSLVI  63

Query  260  LVLGFANLVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALG  439
            L+LGFANL+ADG SM   +++ T +E D   + K + E  +   P   + E+ Q +Q  G
Sbjct  64   LILGFANLLADGFSMAASNYLGTKSEVDQFQRYKTIEEKHIDFIPEGEKNEIKQIFQNKG  123

Query  440  MELNDATTVVTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGC  619
            +       VV        + +   +  + GL + L        P K+ L TF+AF++FG 
Sbjct  124  LHGQTLDQVVEEITANRALWIKTMLQEEYGLPATLR------FPLKSALYTFSAFLLFGI  177

Query  620  APILAFIILI  649
             P++ +++++
Sbjct  178  IPLIPYVLVM  187



>ref|WP_037295892.1| GMP synthase [Roseobacter sp. AzwK-3b]
Length=241

 Score = 92.8 bits (229),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 50/171 (29%), Positives = 88/171 (51%), Gaps = 11/171 (6%)
 Frame = +2

Query  158  EFVRSIVFAGLDAIVTSFSLISSISAG------RLSSGDVLVLGFANLVADGISMGFGDF  319
            EF++ IV+ G D IVT+F++++  +        ++    VLV G ANL AD +SMG G+F
Sbjct  18   EFLKQIVYGGNDGIVTTFAIVAGFAGASADGVAQIGGVAVLVFGLANLFADAVSMGLGEF  77

Query  320  VSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKYMDIL  499
            +S  ++ D+    +     ++   P   + EL +  +  G+   +A T   I +++  I+
Sbjct  78   LSARSQHDLYRARRQAELREIARNPEQERMELFEILRQRGLPAGEADTATAILSRHPQIM  137

Query  500  VAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFIILIP  652
                M  + G+  P E+      P  NGL TF +FV+FG  P++ + +  P
Sbjct  138  ADLMMTYEFGMQDPDEE-----NPALNGLFTFMSFVIFGSIPLVPYFLFEP  183



>gb|EDM70849.1| bifunctional GMP synthase/glutamine amidotransferase protein 
[Roseobacter sp. AzwK-3b]
Length=244

 Score = 93.2 bits (230),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 50/171 (29%), Positives = 88/171 (51%), Gaps = 11/171 (6%)
 Frame = +2

Query  158  EFVRSIVFAGLDAIVTSFSLISSISAG------RLSSGDVLVLGFANLVADGISMGFGDF  319
            EF++ IV+ G D IVT+F++++  +        ++    VLV G ANL AD +SMG G+F
Sbjct  21   EFLKQIVYGGNDGIVTTFAIVAGFAGASADGVAQIGGVAVLVFGLANLFADAVSMGLGEF  80

Query  320  VSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKYMDIL  499
            +S  ++ D+    +     ++   P   + EL +  +  G+   +A T   I +++  I+
Sbjct  81   LSARSQHDLYRARRQAELREIARNPEQERMELFEILRQRGLPAGEADTATAILSRHPQIM  140

Query  500  VAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFIILIP  652
                M  + G+  P E+      P  NGL TF +FV+FG  P++ + +  P
Sbjct  141  ADLMMTYEFGMQDPDEE-----NPALNGLFTFMSFVIFGSIPLVPYFLFEP  186



>ref|WP_031270701.1| MULTISPECIES: membrane protein [Labrenzia]
Length=243

 Score = 92.8 bits (229),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 54/164 (33%), Positives = 89/164 (54%), Gaps = 6/164 (4%)
 Frame = +2

Query  161  FVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTSTER  340
            ++R  V+ G+D  VT+F++++      LS   +L+LG ANL ADG SM   ++  + +E 
Sbjct  27   YLRDWVYGGIDGAVTTFAIVAGSVGADLSPTIILILGAANLFADGFSMAAANYTGSKSEI  86

Query  341  DVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKYMDILVAEKMAA  520
            +  A+ K V E  +   P   ++E+ Q ++A G +  D  T+V + +    I +   M A
Sbjct  87   EDYARLKAVEEKHIAVAPDGEREEIRQIFRAKGYDGPDLETLVELVSSNKSIWIETMMQA  146

Query  521  KKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFIILIP  652
            + GLS+          P +  L TFAAFV+FG  P+L F+I +P
Sbjct  147  EYGLSNTAR------SPMRAALYTFAAFVLFGSIPLLPFVIPVP  184



>gb|EAV46336.1| hypothetical protein SIAM614_10918 [Stappia aggregata IAM 12614]
Length=261

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 59/200 (30%), Positives = 100/200 (50%), Gaps = 15/200 (8%)
 Frame = +2

Query  77   LGGSVEDGEMEKKGKSEKRRPKE--------PWKGEFVRSIVFAGLDAIVTSFSLISSIS  232
            LG ++E+  M         RP +        P    ++R  V+ G+D  VT+F++++   
Sbjct  10   LGKTIEEDFMPTPRLEHSHRPDDIANRLASGP-NASYLRDWVYGGIDGTVTTFAIVAGSI  68

Query  233  AGRLSSGDVLVLGFANLVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQE  412
               LS+  +L+LG ANL ADG SM   ++  + +E +  A+ K V E  +   P   ++E
Sbjct  69   GADLSATIILILGAANLFADGFSMAAANYSGSKSEIEDYARLKAVEEKHIAVAPDGEREE  128

Query  413  LLQHYQALGMELNDATTVVTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLIT  592
            + Q ++A G + +D  T+V + +    I +   M A+ GL+           P K  L T
Sbjct  129  IRQIFRAKGYDGSDLDTLVELVSSNKSIWIETMMQAEYGLTDSAR------SPLKAALYT  182

Query  593  FAAFVVFGCAPILAFIILIP  652
            FAAFV+FG  P++ F+  +P
Sbjct  183  FAAFVLFGSIPLMPFVFPVP  202



>ref|WP_027221751.1| membrane protein [Legionella pneumophila]
Length=241

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/191 (28%), Positives = 100/191 (52%), Gaps = 8/191 (4%)
 Frame = +2

Query  89   VEDGEMEKKGKSEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVL  268
            +E+ E     K  + R  +     ++R  ++ G+D +VT+F+++S +  G+LSS  +L+L
Sbjct  1    MENLEHGHSQKEIRERLTQTPSQNYLRDWIYGGIDGVVTTFAIVSGVVGGQLSSLVILIL  60

Query  269  GFANLVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMEL  448
            GFANL+ADG SM   +++ T +E D   + K + E  +   P   ++E+ Q +Q  G+  
Sbjct  61   GFANLLADGFSMAASNYLGTKSEVDQYQRYKTIEEKHIEFIPEGEKKEIKQIFQNKGLHD  120

Query  449  NDATTVVTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPI  628
                 +V        + +   +  + GL + L        P+K  L TF+AF+ FG  P+
Sbjct  121  QTLDQIVDEITANRALWIKTMLQEEYGLPASLR------FPFKAALYTFSAFLFFGIIPL  174

Query  629  LAFIILI--PF  655
            + +++++  PF
Sbjct  175  IPYVLVMNNPF  185



>ref|WP_024812307.1| GMP synthase [Oceanicola sp. HL-35]
Length=241

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 56/177 (32%), Positives = 91/177 (51%), Gaps = 11/177 (6%)
 Frame = +2

Query  158  EFVRSIVFAGLDAIVTSFSLISSISAG------RLSSGDVLVLGFANLVADGISMGFGDF  319
            E ++ IV+ G D IVT+F++++  +        ++ +  VLV G ANL AD +SMG G+F
Sbjct  18   EHLKQIVYGGNDGIVTTFAIVAGFAGAAAEGVAQIGAVAVLVFGLANLFADAVSMGLGEF  77

Query  320  VSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKYMDIL  499
            +S  ++ D+    +     D+   P A +  L+   +  G+ L +A    TI A++ D +
Sbjct  78   LSARSQADLYHARRHGTRHDIASNPEAERAGLVAILRRRGLPLPEAEDTATIIARHPDFM  137

Query  500  VAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFIILIPFTQNVT  670
                M    GLS P +       P  NGL+TFA+FVVFG  P++ + +  P     T
Sbjct  138  ADLVMTYDTGLSDPADD-----TPALNGLVTFASFVVFGVVPLVPYFLFKPMDGTFT  189



>ref|WP_018477600.1| hypothetical protein [Pontibacter roseus]
Length=242

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/164 (30%), Positives = 85/164 (52%), Gaps = 6/164 (4%)
 Frame = +2

Query  149  WKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVST  328
            +K E++   V+ G+D  +T+F++++      L    V++LG ANL+ADG SM  G+F ST
Sbjct  15   FKKEYISEFVYGGIDGAITTFAVVAGAEGASLGVTVVIILGLANLIADGFSMSVGNFFST  74

Query  329  STERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKYMDILVAE  508
               RD   ++K +  W+V H     + E+ + Y A G + +    VV +     D+ V  
Sbjct  75   KASRDNFDRQKAIEYWEVEHLGETEKNEIREIYAAKGFKGDLLENVVEVITSDKDVWVDT  134

Query  509  KMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFI  640
             M  + G++      +    P K   +TF +F+V G  P+LA+I
Sbjct  135  MMKEELGMT------QDDKTPIKTASVTFLSFIVVGAIPLLAYI  172



>gb|ERP85634.1| membrane protein [Labrenzia sp. C1B10]
 gb|ERS07151.1| membrane protein [Labrenzia sp. C1B70]
Length=259

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 54/164 (33%), Positives = 89/164 (54%), Gaps = 6/164 (4%)
 Frame = +2

Query  161  FVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTSTER  340
            ++R  V+ G+D  VT+F++++      LS   +L+LG ANL ADG SM   ++  + +E 
Sbjct  43   YLRDWVYGGIDGAVTTFAIVAGSVGADLSPTIILILGAANLFADGFSMAAANYTGSKSEI  102

Query  341  DVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKYMDILVAEKMAA  520
            +  A+ K V E  +   P   ++E+ Q ++A G +  D  T+V + +    I +   M A
Sbjct  103  EDYARLKAVEEKHIAVAPDGEREEIRQIFRAKGYDGPDLETLVELVSSNKSIWIETMMQA  162

Query  521  KKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFIILIP  652
            + GLS+          P +  L TFAAFV+FG  P+L F+I +P
Sbjct  163  EYGLSNTAR------SPMRAALYTFAAFVLFGSIPLLPFVIPVP  200



>ref|WP_027225037.1| membrane protein [Legionella pneumophila]
Length=241

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/187 (28%), Positives = 98/187 (52%), Gaps = 6/187 (3%)
 Frame = +2

Query  89   VEDGEMEKKGKSEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVL  268
            +E+ E     K  + R  +     ++R  ++ G+D +VT+F+++S +  G+LSS  +L+L
Sbjct  1    MENLEHGHSQKEMRERLAQIPSQNYLRDWIYGGIDGVVTTFAIVSGVVGGQLSSLVILIL  60

Query  269  GFANLVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMEL  448
            GFANL+ADG SM   +++ T +E D   + K + E  +   P   + E+ Q +Q  G+  
Sbjct  61   GFANLLADGFSMAASNYLGTKSEVDQFQRYKTIEEKHIDFIPEGEKNEIKQIFQNKGLHG  120

Query  449  NDATTVVTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPI  628
                 VV        + +   +  + GL + L        P K+ L TF+AF++FG  P+
Sbjct  121  QTLDQVVEEITANRALWIKTMLQEEYGLPAALR------FPLKSALYTFSAFLLFGIIPL  174

Query  629  LAFIILI  649
            + +++++
Sbjct  175  IPYVLVM  181



>ref|XP_004225013.1| integral membrane protein conserved [Plasmodium cynomolgi strain 
B]
 dbj|GAB69066.1| integral membrane protein conserved [Plasmodium cynomolgi strain 
B]
Length=273

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 59/228 (26%), Positives = 111/228 (49%), Gaps = 11/228 (5%)
 Frame = +2

Query  92   EDGEMEKKGKS-----EKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGD  256
            ED E  K+        +K   +     + +++I+F  LD I+T F+++S     +++   
Sbjct  16   EDVEKSKEAHDSYHSLDKHGEQHSLDRDNLKTIIFGSLDGIITIFAIVSGCVGAKITPAQ  75

Query  257  VLVLGFANLVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHY-QA  433
            V+++G  NL A+ ISMGF ++ ST+ +RD +  EK   EW++ + P   +QE++  Y   
Sbjct  76   VIIIGVGNLFANAISMGFSEYTSTTAQRDFMLAEKKREEWEIENCPSEEKQEMIDIYMNK  135

Query  434  LGMELNDATTVVTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVF  613
               +  DA  +V I  +  +  +   M+ + GL    E      +  K G I F +F +F
Sbjct  136  YKFDSEDARNLVEITFRNKNFFLEHMMSEELGLIITHEDKN---ESLKKGFIMFLSFCIF  192

Query  614  GCAPILAFIILIPFTQNVTHK--FMaacalsalaltllGIAKAKIASQ  751
            G  P+ +++    F +   +   F      + + L +LGI K++  +Q
Sbjct  193  GMIPLCSYVAYTFFFEYTDYNTSFFVVFVSTLITLFILGIFKSQFTNQ  240



>ref|WP_014843878.1| membrane protein [Legionella pneumophila]
 ref|YP_006508724.1| integral membrane protein [Legionella pneumophila subsp. pneumophila]
 emb|CCD08843.1| integral membrane protein [Legionella pneumophila subsp. pneumophila]
Length=241

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/187 (28%), Positives = 98/187 (52%), Gaps = 6/187 (3%)
 Frame = +2

Query  89   VEDGEMEKKGKSEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVL  268
            +E+ E     K  + R  +     ++R  ++ G+D +VT+F+++S +  G+LSS  +L+L
Sbjct  1    MENLEHGHSQKEMRERLAQIPSQNYLRDWIYGGIDGVVTTFAIVSGVVGGQLSSLVILIL  60

Query  269  GFANLVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMEL  448
            GFANL+ADG SM   +++ T +E D   + K + E  +   P   + E+ Q +Q  G+  
Sbjct  61   GFANLLADGFSMAASNYLGTKSEVDQFQRYKTIEEKHIDFIPEGEKNEIKQIFQNKGLHG  120

Query  449  NDATTVVTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPI  628
                 VV        + +   +  + GL + L        P K+ L TF+AF++FG  P+
Sbjct  121  QTLDQVVEEITANRALWIKTMLQEEYGLPAALR------FPLKSALYTFSAFLLFGIIPL  174

Query  629  LAFIILI  649
            + +++++
Sbjct  175  IPYVLVM  181



>ref|WP_040147301.1| membrane protein [Legionella pneumophila]
Length=241

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/187 (28%), Positives = 98/187 (52%), Gaps = 6/187 (3%)
 Frame = +2

Query  89   VEDGEMEKKGKSEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVL  268
            +E+ E     K  K R  +     ++R  ++ G+D +VT+F+++S +  G+LSS  +L+L
Sbjct  1    MENLEHGHSQKEIKERLAQIPSQNYLRDWIYGGIDGVVTTFAIVSGVVGGQLSSLVILIL  60

Query  269  GFANLVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMEL  448
            GFANL+ADG SM   +++ T +E D   + K + E  +   P   + E+ Q +Q  G+  
Sbjct  61   GFANLLADGFSMAASNYLGTKSEVDQFQRYKTIEEKHIDFIPEGEKNEIKQIFQNKGLHG  120

Query  449  NDATTVVTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPI  628
                 VV        + +   +  + GL + L        P K+ L TF+AF++FG  P+
Sbjct  121  QALDQVVEEITANRALWIKTMLQEEYGLPATLR------FPLKSALYTFSAFLLFGIIPL  174

Query  629  LAFIILI  649
            + +++++
Sbjct  175  IPYVLVM  181



>ref|WP_011215510.1| membrane protein [Legionella pneumophila]
 ref|YP_126808.1| hypothetical protein lpl1462 [Legionella pneumophila str. Lens]
 emb|CAH15702.1| hypothetical protein lpl1462 [Legionella pneumophila str. Lens]
Length=241

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/187 (28%), Positives = 98/187 (52%), Gaps = 6/187 (3%)
 Frame = +2

Query  89   VEDGEMEKKGKSEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVL  268
            +E+ E     K  + R  +     ++R  ++ G+D +VT+F+++S +  G+LSS  +L+L
Sbjct  1    MENLEHGHSQKEIRDRLAQAPSQNYLRDWIYGGIDGVVTTFAIVSGVVGGQLSSLVILIL  60

Query  269  GFANLVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMEL  448
            GFANL+ADG SM   +++ T +E D   + K + E  +   P   + E+ Q +Q  G+  
Sbjct  61   GFANLLADGFSMAASNYLGTKSEVDQFQRYKTIEEKHIDFIPEGEKNEIKQIFQNKGLHG  120

Query  449  NDATTVVTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPI  628
                 VV        + +   +  + GL + L        P K+ L TF+AF++FG  P+
Sbjct  121  QTLDQVVEEITANRALWIKTMLQEEYGLPATLR------FPLKSALYTFSAFLLFGIIPL  174

Query  629  LAFIILI  649
            + +++++
Sbjct  175  IPYVLVM  181



>ref|WP_011946561.1| membrane protein [Legionella pneumophila]
 ref|YP_001250306.1| integral membrane protein [Legionella pneumophila str. Corby]
 ref|YP_003618847.1| hypothetical protein lpa_02270 [Legionella pneumophila 2300/99 
Alcoy]
 gb|ABQ54960.1| integral membrane protein [Legionella pneumophila str. Corby]
 gb|ADG24895.1| putative membrane protein [Legionella pneumophila 2300/99 Alcoy]
Length=241

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/187 (28%), Positives = 98/187 (52%), Gaps = 6/187 (3%)
 Frame = +2

Query  89   VEDGEMEKKGKSEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVL  268
            +E+ E     K  K R  +     ++R  ++ G+D +VT+F+++S +  G+LSS  +L+L
Sbjct  1    MENLEHGHSQKEIKERLAQIPSQNYLRDWIYGGIDGVVTTFAIVSGVVGGQLSSLVILIL  60

Query  269  GFANLVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMEL  448
            GFANL+ADG SM   +++ T +E D   + K + E  +   P   + E+ Q +Q  G+  
Sbjct  61   GFANLLADGFSMAASNYLGTKSEVDQFQRYKTIEEKHIDFIPEGEKNEIKQIFQNKGLHG  120

Query  449  NDATTVVTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPI  628
                 VV        + +   +  + GL + L        P K+ L TF+AF++FG  P+
Sbjct  121  QALDQVVEEITANRALWIKTMLQEEYGLPATLR------FPLKSALYTFSAFLLFGIIPL  174

Query  629  LAFIILI  649
            + +++++
Sbjct  175  IPYVLVM  181



>emb|CDO65513.1| integral membrane protein, putative [Plasmodium reichenowi]
Length=273

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 54/199 (27%), Positives = 104/199 (52%), Gaps = 6/199 (3%)
 Frame = +2

Query  164  VRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTSTERD  343
            +++I+F  LD I+T F+++S     +++   V+++G  NL A+ ISMGF ++ S++ +RD
Sbjct  45   LKTIIFGSLDGIITIFAIVSGCVGAKITPTQVIIIGIGNLFANAISMGFSEYTSSTAQRD  104

Query  344  VVAKEKIVAEWDVMHTPIALQQELLQHY-QALGMELNDATTVVTIFAKYMDILVAEKMAA  520
             +  EK   EW++ + P   +QE++  Y      +  DA  +V I  +  +  +   M+ 
Sbjct  105  FMLAEKKREEWEIENCPSEEKQEMIDIYMNKYKFDSEDARNLVEITFRNKNFFLEHMMSE  164

Query  521  KKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFIILIPF--TQNVTHKFMaaca  694
            + GL   +   +   +  K G+I F +F VFG  P+ A++    F    + T  F+    
Sbjct  165  ELGL---IVTNEDKNECLKKGIIMFLSFAVFGIIPLSAYVAYTVFFGYTDYTTSFLVVFI  221

Query  695  lsalaltllGIAKAKIASQ  751
             +   L +LG+ K++  +Q
Sbjct  222  STLTTLFILGLFKSQFTNQ  240



>ref|XP_001350634.1| integral membrane protein, putative [Plasmodium falciparum 3D7]
 gb|AAN36314.1| integral membrane protein, putative [Plasmodium falciparum 3D7]
 gb|ETW17617.1| hypothetical protein PFFVO_03499 [Plasmodium falciparum Vietnam 
Oak-Knoll (FVO)]
 gb|ETW30038.1| hypothetical protein PFFCH_02531 [Plasmodium falciparum FCH/4]
 gb|ETW35450.1| hypothetical protein PFTANZ_03868 [Plasmodium falciparum Tanzania 
(2000708)]
 gb|ETW41634.1| hypothetical protein PFNF135_04044 [Plasmodium falciparum NF135/5.C10]
 gb|ETW55917.1| hypothetical protein PFUGPA_01961 [Plasmodium falciparum Palo 
Alto/Uganda]
 gb|ETW60270.1| hypothetical protein PFMC_03813 [Plasmodium falciparum CAMP/Malaysia]
 gb|EUT82510.1| hypothetical protein PFAG_03885 [Plasmodium falciparum Santa 
Lucia]
 gb|EWC87661.1| hypothetical protein PFNF54_03785 [Plasmodium falciparum NF54]
Length=273

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 54/199 (27%), Positives = 104/199 (52%), Gaps = 6/199 (3%)
 Frame = +2

Query  164  VRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTSTERD  343
            +++I+F  LD I+T F+++S     +++   V+++G  NL A+ ISMGF ++ S++ +RD
Sbjct  45   LKTIIFGSLDGIITIFAIVSGCVGAKITPTQVIIIGIGNLFANAISMGFSEYTSSTAQRD  104

Query  344  VVAKEKIVAEWDVMHTPIALQQELLQHY-QALGMELNDATTVVTIFAKYMDILVAEKMAA  520
             +  EK   EW++ + P   +QE++  Y      +  DA  +V I  +  +  +   M+ 
Sbjct  105  FMLAEKKREEWEIENCPSEEKQEMIDIYMNKYKFDSEDARNLVEITFRNKNFFLEHMMSE  164

Query  521  KKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFIILIPF--TQNVTHKFMaaca  694
            + GL   +   +   +  K G+I F +F VFG  P+ A++    F    + T  F+    
Sbjct  165  ELGL---IVTNEDKNECLKKGIIMFLSFAVFGIIPLSAYVAYTVFFGYTDYTTSFLVVFI  221

Query  695  lsalaltllGIAKAKIASQ  751
             +   L +LG+ K++  +Q
Sbjct  222  STLTTLFILGLFKSQFTNQ  240



>gb|EWC75359.1| hypothetical protein C923_03957 [Plasmodium falciparum UGT5.1]
Length=268

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 54/199 (27%), Positives = 104/199 (52%), Gaps = 6/199 (3%)
 Frame = +2

Query  164  VRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTSTERD  343
            +++I+F  LD I+T F+++S     +++   V+++G  NL A+ ISMGF ++ S++ +RD
Sbjct  40   LKTIIFGSLDGIITIFAIVSGCVGAKITPTQVIIIGIGNLFANAISMGFSEYTSSTAQRD  99

Query  344  VVAKEKIVAEWDVMHTPIALQQELLQHY-QALGMELNDATTVVTIFAKYMDILVAEKMAA  520
             +  EK   EW++ + P   +QE++  Y      +  DA  +V I  +  +  +   M+ 
Sbjct  100  FMLAEKKREEWEIENCPSEEKQEMIDIYMNKYKFDSEDARNLVEITFRNKNFFLEHMMSE  159

Query  521  KKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFIILIPF--TQNVTHKFMaaca  694
            + GL   +   +   +  K G+I F +F VFG  P+ A++    F    + T  F+    
Sbjct  160  ELGL---IVTNEDKNECLKKGIIMFLSFAVFGIIPLSAYVAYTVFFGYTDYTTSFLVVFI  216

Query  695  lsalaltllGIAKAKIASQ  751
             +   L +LG+ K++  +Q
Sbjct  217  STLTTLFILGLFKSQFTNQ  235



>ref|WP_027265263.1| membrane protein [Legionella pneumophila]
Length=241

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 52/187 (28%), Positives = 98/187 (52%), Gaps = 6/187 (3%)
 Frame = +2

Query  89   VEDGEMEKKGKSEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVL  268
            +E+ E     K  + R  +     ++R  ++ G+D +VT+F+++S +  G+LSS  +L+L
Sbjct  1    MENLEHGHSQKEIRDRLAQAPSQNYLRDWIYGGIDGVVTTFAIVSGVVGGQLSSLVILIL  60

Query  269  GFANLVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMEL  448
            GFANL+ADG SM   +++ T +E D   + K + E  +   P   + E+ Q +Q  G+  
Sbjct  61   GFANLLADGFSMAASNYLGTKSEVDQFQRYKTIEEKHIDFIPEGEKNEIKQIFQNKGLHG  120

Query  449  NDATTVVTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPI  628
                 VV        + +   +  + GL + L        P K+ L TF+AF++FG  P+
Sbjct  121  QTLDQVVEEITANRALWIKTMLQEEYGLPATLR------FPLKSALYTFSAFLLFGIIPL  174

Query  629  LAFIILI  649
            + +++++
Sbjct  175  IPYVLVM  181



>ref|WP_011213843.1| membrane protein [Legionella pneumophila]
 ref|YP_123845.1| hypothetical protein lpp1521 [Legionella pneumophila str. Paris]
 emb|CAH12672.1| hypothetical protein lpp1521 [Legionella pneumophila str. Paris]
 gb|ERB41482.1| membrane protein [Legionella pneumophila str. 121004]
 gb|ERH42513.1| membrane protein [Legionella pneumophila str. Leg01/11]
 gb|ERH46492.1| membrane protein [Legionella pneumophila str. Leg01/53]
 gb|ERI46483.1| membrane protein [Legionella pneumophila str. Leg01/20]
Length=241

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 53/187 (28%), Positives = 98/187 (52%), Gaps = 6/187 (3%)
 Frame = +2

Query  89   VEDGEMEKKGKSEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVL  268
            +E+ E     K  K R  +     ++R  ++ G+D +VT+F+++S +  G+LSS  +L+L
Sbjct  1    MENLEHGHSQKEIKERLAQIPSQNYLRDWIYGGIDGVVTTFAIVSGVVGGQLSSLVILIL  60

Query  269  GFANLVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMEL  448
            GFANL+ADG SM   +++ T +E D   + K + E  +   P   + E+ Q +Q  G+  
Sbjct  61   GFANLLADGFSMAASNYLGTKSEVDQFQRYKTIEEKHIDFIPEGEKSEIKQIFQNKGLHG  120

Query  449  NDATTVVTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPI  628
                 VV        + +   +  + GL + L        P K+ L TF+AF++FG  P+
Sbjct  121  QALDQVVEEITANRALWIKTMLQEEYGLPATLR------FPLKSALYTFSAFLLFGIIPL  174

Query  629  LAFIILI  649
            + +++++
Sbjct  175  IPYVLVM  181



>gb|ETW48078.1| hypothetical protein PFMALIP_03785 [Plasmodium falciparum MaliPS096_E11]
Length=283

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 54/199 (27%), Positives = 104/199 (52%), Gaps = 6/199 (3%)
 Frame = +2

Query  164  VRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTSTERD  343
            +++I+F  LD I+T F+++S     +++   V+++G  NL A+ ISMGF ++ S++ +RD
Sbjct  45   LKTIIFGSLDGIITIFAIVSGCVGAKITPTQVIIIGIGNLFANAISMGFSEYTSSTAQRD  104

Query  344  VVAKEKIVAEWDVMHTPIALQQELLQHY-QALGMELNDATTVVTIFAKYMDILVAEKMAA  520
             +  EK   EW++ + P   +QE++  Y      +  DA  +V I  +  +  +   M+ 
Sbjct  105  FMLAEKKREEWEIENCPSEEKQEMIDIYMNKYKFDSEDARNLVEITFRNKNFFLEHMMSE  164

Query  521  KKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFIILIPF--TQNVTHKFMaaca  694
            + GL   +   +   +  K G+I F +F VFG  P+ A++    F    + T  F+    
Sbjct  165  ELGL---IVTNEDKNECLKKGIIMFLSFAVFGIIPLSAYVAYTVFFGYTDYTTSFLVVFI  221

Query  695  lsalaltllGIAKAKIASQ  751
             +   L +LG+ K++  +Q
Sbjct  222  STLTTLFILGLFKSQFTNQ  240



>ref|XP_002142090.1| hypothetical protein [Cryptosporidium muris RN66]
 gb|EEA07741.1| hypothetical protein, conserved [Cryptosporidium muris RN66]
Length=300

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 54/195 (28%), Positives = 93/195 (48%), Gaps = 15/195 (8%)
 Frame = +2

Query  56   ESSRYVQLGGSVEDGEMEKKGKSEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISA  235
            ESSR   +G   ++  +                 E ++ +VF GLD IVT F+L+S   A
Sbjct  32   ESSRMAHIGDLHQENHIHSHS-------------ELLKIVVFGGLDGIVTIFALVSGCVA  78

Query  236  GRLSSGDVLVLGFANLVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQEL  415
                   +  +   +L+AD  +M  G++VS+S E + +  EK   EW++ H P     E+
Sbjct  79   VHFKLKQIFTICMGSLLADAFAMSMGEYVSSSAEHEFINAEKQREEWEIEHCPEEEISEM  138

Query  416  LQHYQ-ALGMELNDATTVVTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLIT  592
            ++ Y+   G  L DA  +  +  KY +  ++  M  + GL   + +  +  +P K  L  
Sbjct  139  VEIYRNKHGFSLQDANDMARLAFKYKNFFISHMMMEELGLLCEVNESPR-LQPIKGALTM  197

Query  593  FAAFVVFGCAPILAF  637
            F +F +FG  P+L+F
Sbjct  198  FLSFSLFGSIPLLSF  212



>ref|WP_010139525.1| GMP synthase [Oceanicola sp. S124]
Length=241

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 55/172 (32%), Positives = 85/172 (49%), Gaps = 13/172 (8%)
 Frame = +2

Query  158  EFVRSIVFAGLDAIVTSFSLISSISAGRLSSG-------DVLVLGFANLVADGISMGFGD  316
            E++R IV+ G D IVT+F+++S   AG  + G        VLV G ANL AD +SMG G+
Sbjct  18   EYLRQIVYGGNDGIVTTFAIVSGF-AGAQADGIAQIGGLAVLVFGLANLFADAVSMGLGE  76

Query  317  FVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKYMDI  496
            F+S    RD+    + +   ++   P   + EL    +  G+   DA     I   +  I
Sbjct  77   FLSGRAHRDLYHARRELELREIAENPDQERDELEVILRQRGLSQQDAHATAEIMVHHPSI  136

Query  497  LVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFIILIP  652
            +    M  + G+  P E       P  NGL+TF +F+ FG AP++ + +  P
Sbjct  137  MADLMMTYEFGMHDPEED-----SPAVNGLVTFLSFLAFGAAPLVPYFLHAP  183



>ref|WP_015444475.1| Integral membrane protein [Legionella pneumophila]
 ref|YP_007568180.1| Integral membrane protein [Legionella pneumophila subsp. pneumophila 
LPE509]
 ref|YP_008063253.1| integral membrane protein [Legionella pneumophila subsp. pneumophila 
str. Thunder Bay]
 gb|AGH53728.1| Integral membrane protein [Legionella pneumophila subsp. pneumophila 
LPE509]
 gb|AGN14452.1| integral membrane protein [Legionella pneumophila subsp. pneumophila 
str. Thunder Bay]
Length=241

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 52/187 (28%), Positives = 98/187 (52%), Gaps = 6/187 (3%)
 Frame = +2

Query  89   VEDGEMEKKGKSEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVL  268
            +E+ E     K  + R  +     ++R  ++ G+D +VT+F+++S +  G+LSS  +L+L
Sbjct  1    MENLEHGHSQKEIRDRLAQVPSQNYLRDWIYGGIDGVVTTFAIVSGVVGGQLSSLVILIL  60

Query  269  GFANLVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMEL  448
            GFANL+ADG SM   +++ T +E D   + K + E  +   P   + E+ Q +Q  G+  
Sbjct  61   GFANLLADGFSMAASNYLGTKSEVDQFQRYKTIEEKHIDFIPEGEKNEIKQIFQNKGLHG  120

Query  449  NDATTVVTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPI  628
                 VV        + +   +  + GL + L        P K+ L TF+AF++FG  P+
Sbjct  121  QTLDQVVEEITANRALWIKTMLQEEYGLPATLR------FPLKSALYTFSAFLLFGIIPL  174

Query  629  LAFIILI  649
            + +++++
Sbjct  175  IPYVLVM  181



>gb|EPY22245.1| integral membrane protein [Strigomonas culicis]
 gb|EPY24920.1| integral membrane protein [Strigomonas culicis]
 gb|EPY30963.1| integral membrane protein [Strigomonas culicis]
Length=282

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 59/161 (37%), Positives = 100/161 (62%), Gaps = 3/161 (2%)
 Frame = +2

Query  158  EFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTSTE  337
            E+V+S+VF GLD I T+F++I++ +    +   VL+ GF+N++ADG SMGFG++VS   E
Sbjct  52   EYVKSVVFGGLDGITTTFAIIAAAAGSNGNFATVLIFGFSNVIADGFSMGFGEYVSGEAE  111

Query  338  RDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKYMDILVAEKMA  517
            R+    E+   EW+V ++      E++Q Y + G+  +DA ++V+I +K   + V   M 
Sbjct  112  RENALTERRREEWEVENSFDLEVDEMVQIYVSRGLSFDDANSIVSIISKDPKLFVDFMMI  171

Query  518  AKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFI  640
             + GL   L+  + P    K GL+ F +F++FGC P+LA++
Sbjct  172  EELGLLIDLDDHQGPK---KQGLVMFTSFLMFGCIPLLAYL  209



>ref|WP_014841688.1| membrane protein [Legionella pneumophila]
 ref|YP_006505547.1| integral membrane protein [Legionella pneumophila subsp. pneumophila]
 emb|CCD05612.1| integral membrane protein [Legionella pneumophila subsp. pneumophila]
Length=241

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 51/187 (27%), Positives = 97/187 (52%), Gaps = 6/187 (3%)
 Frame = +2

Query  89   VEDGEMEKKGKSEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVL  268
            +E+ E     K  + R  +     ++R  ++ G+D +VT+F+++S +  G+LSS  +L+L
Sbjct  1    MENLEHGHSQKEIRDRLAQVPSQNYLRDWIYGGIDGVVTTFAIVSGVVGGQLSSLVILIL  60

Query  269  GFANLVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMEL  448
            GFANL+ADG SM   +++ T +E D   + K + E  +   P   + E+ Q +Q  G+  
Sbjct  61   GFANLLADGFSMAASNYLGTKSEVDQFQRYKTIEEKHIDFIPEGEKNEIKQIFQNKGLHG  120

Query  449  NDATTVVTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPI  628
                 VV        + +   +  + GL +       P  P K+   TF+AF++FG  P+
Sbjct  121  QTLDQVVEEITANRALWIKTMLQEEYGLPAA------PRFPLKSAFYTFSAFLLFGIIPL  174

Query  629  LAFIILI  649
            + +++++
Sbjct  175  IPYVLVM  181



>ref|XP_008622846.1| hypothetical protein YYE_00942 [Plasmodium vinckei vinckei]
 gb|KEG04040.1| hypothetical protein YYE_00942 [Plasmodium vinckei vinckei]
Length=273

 Score = 90.9 bits (224),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 52/212 (25%), Positives = 108/212 (51%), Gaps = 6/212 (3%)
 Frame = +2

Query  125  EKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISM  304
            +K   +     + +++I+F  LD I+T F+++S      ++   V+++G  NL A+ ISM
Sbjct  32   DKHDEQHSLDKDHLKTIIFGSLDGIITIFAIVSGCVGANITPAQVIIIGVGNLFANAISM  91

Query  305  GFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHY-QALGMELNDATTVVTIFA  481
            GF ++ S++ + D +A E+   EW++ + P   +QE++  Y      +  DA  +V I  
Sbjct  92   GFSEYTSSTAQIDFMAAERQREEWEIENCPTEEKQEMIDIYINKYKFDSKDAKNLVEITF  151

Query  482  KYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFIILIPF--  655
            +  +  +   M+ + GL   +   +  ++  K G++ F +F  FG  P+ ++++   F  
Sbjct  152  RNKNFFLEHMMSEELGL---ILTNEDKSEALKKGILMFLSFCFFGMIPLFSYVLYNMFFG  208

Query  656  TQNVTHKFMaacalsalaltllGIAKAKIASQ  751
              N T  F      + + L +LG+ K++  +Q
Sbjct  209  AANYTASFAVVFISTLITLFILGLFKSQFTTQ  240



>ref|XP_008814615.1| hypothetical protein C922_00781 [Plasmodium inui San Antonio 
1]
 gb|EUD69089.1| hypothetical protein C922_00781 [Plasmodium inui San Antonio 
1]
Length=273

 Score = 90.9 bits (224),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 55/212 (26%), Positives = 107/212 (50%), Gaps = 6/212 (3%)
 Frame = +2

Query  125  EKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISM  304
            +K   +     + +++I+F  LD I+T F+++S     +++   V+++G  NL A+ ISM
Sbjct  32   DKHGEQHSLDRDNLKTIIFGSLDGIITIFAIVSGCVGAKITPAQVIIIGVGNLFANAISM  91

Query  305  GFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHY-QALGMELNDATTVVTIFA  481
            GF ++ ST+ +RD +  EK   EW++ + P   +QE++  Y      +  DA  +V I  
Sbjct  92   GFSEYTSTAAQRDFMLAEKKREEWEIENCPSEEKQEMIDIYMNKYKFDSEDARNLVEITF  151

Query  482  KYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFIILIPFTQ  661
            +  +  +   M+ + GL    E      +  K G + F +F VFG  P+ +++    F +
Sbjct  152  RNKNFFLEHMMSEELGLIVTHEDKN---ESLKKGTLMFLSFCVFGMIPLCSYVAYTFFFE  208

Query  662  NVTHK--FMaacalsalaltllGIAKAKIASQ  751
               +   F+     + + L +LGI K++  +Q
Sbjct  209  YTDYNTSFVVVFVSTLITLFILGIFKSQFTNQ  240



>ref|XP_001617325.1| hypothetical protein [Plasmodium vivax Sal-1]
 gb|EDL47598.1| hypothetical protein, conserved [Plasmodium vivax]
Length=273

 Score = 90.9 bits (224),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 60/228 (26%), Positives = 111/228 (49%), Gaps = 11/228 (5%)
 Frame = +2

Query  92   EDGEMEKKGKS-----EKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGD  256
            ED E  K+        +K   +     + +++I+F  LD I+T F+++S     +++   
Sbjct  16   EDVEKSKEAHDSYHSLDKHGEQHSLDRDNLKTIIFGSLDGIITIFAIVSGCVGAKITPAQ  75

Query  257  VLVLGFANLVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHY-QA  433
            V+++G  NL A+ ISMGF ++ ST+ +RD +  EK   EW++ + P   +QE++  Y   
Sbjct  76   VIIIGVGNLFANAISMGFSEYTSTTAQRDFMLAEKKREEWEIENCPSEEKQEMIDIYMNK  135

Query  434  LGMELNDATTVVTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVF  613
               +  DA  +V I  +     +   M+ + GL    E      +  K G+I F +F VF
Sbjct  136  YKFDSEDARNLVEITFRNKIFFLEHMMSEELGLIITHEDKN---ESLKKGIIMFLSFCVF  192

Query  614  GCAPILAFIILIPFTQNVTHK--FMaacalsalaltllGIAKAKIASQ  751
            G  P+ +++    F +   +   F      + + L +LGI K++  +Q
Sbjct  193  GMIPLCSYVAYTFFFEYTDYNTSFFVVFVSTLITLFILGIFKSQFTNQ  240



>ref|WP_040438957.1| membrane protein [Labrenzia aggregata]
Length=243

 Score = 90.5 bits (223),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 52/164 (32%), Positives = 89/164 (54%), Gaps = 6/164 (4%)
 Frame = +2

Query  161  FVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTSTER  340
            ++R  V+ G+D  VT+F++++      LS+  +L+LG ANL ADG SM   ++  + +E 
Sbjct  27   YLRDWVYGGIDGTVTTFAIVAGSIGADLSATIILILGAANLFADGFSMAAANYSGSKSEI  86

Query  341  DVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKYMDILVAEKMAA  520
            +  A+ K V E  +   P   ++E+ Q ++A G + +D  T+V + +    I +   M A
Sbjct  87   EDYARLKAVEEKHIAVAPDGEREEIRQIFRAKGYDGSDLDTLVELVSSNKSIWIETMMQA  146

Query  521  KKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFIILIP  652
            + GL+           P K  L TFAAFV+FG  P++ F+  +P
Sbjct  147  EYGLTDSAR------SPLKAALYTFAAFVLFGSIPLMPFVFPVP  184



>emb|CDR16841.1| conserved Plasmodium protein, unknown function [Plasmodium chabaudi 
chabaudi]
Length=273

 Score = 90.9 bits (224),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 52/212 (25%), Positives = 107/212 (50%), Gaps = 6/212 (3%)
 Frame = +2

Query  125  EKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISM  304
            +K         + +++I+F  LD I+T F+++S      ++   V+++G  NL A+ ISM
Sbjct  32   DKHAENHSLDKDHLKTIIFGSLDGIITIFAIVSGCVGANITPAQVIIIGVGNLFANAISM  91

Query  305  GFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHY-QALGMELNDATTVVTIFA  481
            GF ++ S++ + D +A E+   EW++ + P   +QE++  Y      +  DA  +V I  
Sbjct  92   GFSEYTSSTAQIDFMAAERQREEWEIENCPTEEKQEMIDIYINKYKFDSKDAKNLVEITF  151

Query  482  KYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFIILIPF--  655
            +  +  +   M+ + GL   +   +   + +K G++ F +F  FG  P+ ++++   F  
Sbjct  152  RNKNFFLEHMMSEELGL---ILTNEDKTEAFKKGILMFLSFCFFGMIPLFSYVLYNLFFS  208

Query  656  TQNVTHKFMaacalsalaltllGIAKAKIASQ  751
              N T  F      + + L +LG+ K++  +Q
Sbjct  209  AANYTASFAVVFISTLITLFILGLFKSQFTTQ  240



>emb|CBN77026.1| conserved unknown protein [Ectocarpus siliculosus]
Length=301

 Score = 90.9 bits (224),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 53/187 (28%), Positives = 98/187 (52%), Gaps = 14/187 (7%)
 Frame = +2

Query  98   GEMEKKGKSEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFA  277
            G     G ++     + WK     + VF  LD ++TSF++++  S G L +  VL++G +
Sbjct  45   GGQPDGGDADSESESDIWK-----AAVFGALDGVLTSFAVVAGASGGGLGTQAVLIVGVS  99

Query  278  NLVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDA  457
            ++VADG+SMG G+++S+    + +  E+   EW++ +      + ++  Y   GM   DA
Sbjct  100  SIVADGLSMGLGEYLSSKAMNEYMDIERKREEWELANHREGEVENMVDTYMRRGMSREDA  159

Query  458  TTVVTIFAKYMD-----ILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCA  622
              V    +KY D     ++VAE + +    S PL++    A   + GL+TF +F + G  
Sbjct  160  QEVSARLSKYDDCFVDAVMVAEGVGSSMFASPPLDE----AGSIREGLVTFGSFALSGIV  215

Query  623  PILAFII  643
            P+L++ +
Sbjct  216  PLLSYAL  222



>ref|WP_028982124.1| membrane protein [Sporocytophaga myxococcoides]
Length=243

 Score = 90.1 bits (222),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 51/164 (31%), Positives = 84/164 (51%), Gaps = 6/164 (4%)
 Frame = +2

Query  158  EFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTSTE  337
            +++   V+ G+D  +T+F++++  +   LS   V++LGFANL+ADG SM  G+F ST  E
Sbjct  20   DYISEFVYGGIDGAITTFAVVAGATGANLSISVVIILGFANLIADGFSMSVGNFFSTKAE  79

Query  338  RDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKYMDILVAEKMA  517
            +D   K K V  W++ +      +E+ + Y+  G +      VV +     D+ V   M 
Sbjct  80   QDTYEKNKAVEYWEIENMREKEIEEVREIYEKKGFKGELLDKVVEVIISNKDVWVDTMM-  138

Query  518  AKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFIILI  649
                    LE  K    P+K   +TF +FV  G  P+LA++  I
Sbjct  139  -----KEELEMSKDERTPFKTAGMTFISFVTIGLIPLLAYVFAI  177



>ref|WP_026954853.1| membrane protein [Algoriphagus vanfongensis]
Length=240

 Score = 90.1 bits (222),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 51/171 (30%), Positives = 91/171 (53%), Gaps = 6/171 (4%)
 Frame = +2

Query  158  EFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTSTE  337
            E++R  V+ G+D  VT+F++++      L  G +++LGFANL+ADG SM  G ++S  +E
Sbjct  17   EYLREFVYGGIDGAVTTFAVVAGGYGANLEPGILIILGFANLLADGFSMSVGAYLSAKSE  76

Query  338  RDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKYMDILVAEKMA  517
             D   K + + +W+V + P + + E+   Y+A G + +    +V       ++ V+E M 
Sbjct  77   NDNFDKHEKIEQWEVENLPDSERSEIEDIYKAKGFKGHLLAQIVDHICSDKELWVSEMMK  136

Query  518  AKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFIILIPFTQNVT  670
             + G+       K    P+K GL T  +F++ G  P+L ++    F  NV 
Sbjct  137  DELGMM------KDSKSPFKIGLATLISFILVGFIPLLIYLWDFFFPTNVN  181



>dbj|BAQ17909.1| integral membrane protein [Methyloceanibacter caenitepidi]
Length=240

 Score = 90.1 bits (222),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 50/160 (31%), Positives = 89/160 (56%), Gaps = 6/160 (4%)
 Frame = +2

Query  161  FVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTSTER  340
            ++R  V+ G+D  VT+F++++ +    LS+  V++LG ANL+ADG SM   +F  T  ER
Sbjct  25   YLRDWVYGGIDGTVTTFAVMAGVVGANLSATVVVILGLANLLADGFSMAASNFTGTKAER  84

Query  341  DVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKYMDILVAEKMAA  520
            D   + + + E  +   P   ++E+ Q +++ G E     TVVT+ +++ +  V   M  
Sbjct  85   DEYEQLRRMEERHIDLAPEGEREEIRQIFRSKGFEGEALETVVTVLSQHRESWVEAMMTE  144

Query  521  KKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFI  640
            + G+++     + PA+     L TF AFVV G  P+L ++
Sbjct  145  EHGMAA---VQRSPARA---ALYTFIAFVVCGSVPLLPYL  178



>ref|XP_004345702.1| conserved hypothetical protein [Capsaspora owczarzaki ATCC 30864]
 gb|EFW40980.1| hypothetical protein CAOG_06112 [Capsaspora owczarzaki ATCC 30864]
Length=271

 Score = 90.5 bits (223),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 61/198 (31%), Positives = 103/198 (52%), Gaps = 13/198 (7%)
 Frame = +2

Query  53   AESSRYVQLGGSVEDGEMEKKGKSEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSIS  232
            A ++R V+L      G  E+  +S  R          ++S++ AGLD +  SF+LI  + 
Sbjct  12   AFATRDVELSRISHSGISERNNESTNRH---------IKSVIGAGLDGVAISFALICVVV  62

Query  233  AGRLSSGDVLVLGFANLVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQE  412
                  G VLV+G A  +A GISMGFG ++S   E   + +E++  EW++ + P    QE
Sbjct  63   GAGYGWGVVLVMGVAVQLASGISMGFGIYLSEDAELQYIKRERLREEWELENHPEGELQE  122

Query  413  LLQHYQALGMELNDATTVVTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLIT  592
            +++ Y   G    DAT+V+ I A+Y +  V   +  + GL  P         P +NG+I 
Sbjct  123  MVEIYVENGFSDEDATSVIGIMARYKEFFVDHMLVQELGLLPP----SLAESPCRNGVIA  178

Query  593  FAAFVVFGCAPILAFIIL  646
              +F++FG  P+++F++ 
Sbjct  179  ALSFILFGSVPLISFLVF  196



>gb|EUD74462.1| hypothetical protein YYG_00413 [Plasmodium vinckei petteri]
Length=273

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/212 (25%), Positives = 107/212 (50%), Gaps = 6/212 (3%)
 Frame = +2

Query  125  EKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISM  304
            +K         + +++I+F  LD I+T F+++S      ++   V+++G  NL A+ ISM
Sbjct  32   DKHAENHSLDKDHLKTIIFGSLDGIITIFAIVSGCVGANITPAQVIIIGVGNLFANAISM  91

Query  305  GFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHY-QALGMELNDATTVVTIFA  481
            GF ++ S++ + D +A E+   EW++ + P   +QE++  Y      +  DA  +V I  
Sbjct  92   GFSEYTSSTAQIDFMAAERQREEWEIENCPTEEKQEMIDIYINKYKFDSKDAKNLVEITF  151

Query  482  KYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFIILIPF--  655
            +  +  +   M+ + GL   +   +  ++  K G++ F +F  FG  P+ ++++   F  
Sbjct  152  RNKNFFLEHMMSEELGL---ILTNEDKSEALKKGILMFLSFCFFGMIPLFSYVLYNLFFS  208

Query  656  TQNVTHKFMaacalsalaltllGIAKAKIASQ  751
              N T  F      + + L +LG+ K++  +Q
Sbjct  209  AANYTASFAVVFISTLITLFILGLFKSQFTTQ  240



>ref|WP_029035356.1| membrane protein [Salinimicrobium terrae]
Length=241

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/177 (28%), Positives = 88/177 (50%), Gaps = 6/177 (3%)
 Frame = +2

Query  110  KKGKSEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVA  289
            ++ +   R+    +  +++   V+ G+D  +T+F++++      L    V++LG ANL+A
Sbjct  2    QESQLHSRQKLLFFNKDYISEFVYGGIDGAITTFAVVAGSEGANLGIQVVVILGLANLIA  61

Query  290  DGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVV  469
            DG SM  G+F ST  ERD   + K V  W++ H      QE+ + Y A G + +    VV
Sbjct  62   DGFSMSVGNFFSTKAERDTFDRHKQVEYWEIEHLRDKEIQEIREIYAAKGFKGDLLEQVV  121

Query  470  TIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFI  640
             +     D+ V   M         LE  K    P+K   +TF +F++ G  P+L+++
Sbjct  122  EVITADKDVWVDTMM------KEELEMVKSDKAPYKTAGMTFFSFIIVGSVPLLSYV  172



>ref|XP_678837.1| hypothetical protein [Plasmodium berghei strain ANKA]
 emb|CAH98090.1| conserved hypothetical protein [Plasmodium berghei]
 emb|CDS52060.1| conserved Plasmodium protein, unknown function [Plasmodium berghei 
ANKA]
Length=273

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/212 (24%), Positives = 107/212 (50%), Gaps = 6/212 (3%)
 Frame = +2

Query  125  EKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISM  304
            +K         + +++I+F  LD I+T F+++S      ++   V+++G  NL A+ ISM
Sbjct  32   DKHAEHHSLDKDHLKTIIFGSLDGIITIFAIVSGCVGANITPAQVIIIGVGNLFANAISM  91

Query  305  GFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHY-QALGMELNDATTVVTIFA  481
            GF ++ S++ + D +  E+   EW++ + P   +QE++  Y      +  DA  +V I  
Sbjct  92   GFSEYTSSTAQIDFMLAERQREEWEIENCPTEEKQEMIDIYINKYKFDSKDAKNLVEITF  151

Query  482  KYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFIILIPF--  655
            +     +   M+ + GL   +   +  ++ +K G++ F +F  FG  P+ ++++   F  
Sbjct  152  RNKHFFLEHMMSEELGL---ILTNEDKSEAFKKGILMFLSFCFFGMIPLFSYVLYNLFFS  208

Query  656  TQNVTHKFMaacalsalaltllGIAKAKIASQ  751
             +N T  F      + + L +LG+ K++  +Q
Sbjct  209  AENYTSSFAVVFISTLITLFILGLFKSQFTTQ  240



>ref|WP_028373937.1| membrane protein [Legionella lansingensis]
Length=241

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 58/194 (30%), Positives = 100/194 (52%), Gaps = 17/194 (9%)
 Frame = +2

Query  110  KKGKSEK----RRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFA  277
            + G S+K    R  K P +  ++R  ++ G+D  VT+F+++S +  G+LSS  +L+LGFA
Sbjct  5    EHGHSKKEIIERFAKAPAQ-SYLRDWIYGGIDGAVTTFAIVSGVVGGQLSSLVILILGFA  63

Query  278  NLVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDA  457
            NL+ADG SM   +++ T +E++   + K + E  +   P   ++E+ Q +Q  G+     
Sbjct  64   NLLADGFSMAASNYLGTKSEQEQYQRYKAIEEKHIERKPEGEKKEIRQIFQNKGLTGEAL  123

Query  458  TTVVTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAF  637
              VV        + ++  +  + GL   +        P+K+ L TF AF+ FG      F
Sbjct  124  EIVVDEITANRALWISTMLQEEYGLPISIR------SPYKSALYTFLAFLCFG------F  171

Query  638  IILIPFTQNVTHKF  679
            I L+P+  N T  F
Sbjct  172  IPLLPYVFNFTDTF  185



>ref|XP_628219.1| conserved integral membrane protein with 4 transmembrane domains, 
possible plant or bacterial origin [Cryptosporidium parvum 
Iowa II]
 gb|EAK90667.1| conserved integral membrane protein with 4 transmembrane domains, 
possible plant or bacterial origin [Cryptosporidium parvum 
Iowa II]
Length=312

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 56/177 (32%), Positives = 89/177 (50%), Gaps = 6/177 (3%)
 Frame = +2

Query  125  EKRRP-KEPWKG---EFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVAD  292
             KR P KE   G   E ++ IVF GLD I+T FSL+S   A   ++  +  +   +L+AD
Sbjct  60   HKRYPHKEEHLGTQSELLKVIVFGGLDGIITIFSLVSGCVAAGFTTIQLFTICMGSLLAD  119

Query  293  GISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQ-ALGMELNDATTVV  469
              +M  G++VS+  E++ V  E+   +W+V + P     E+   YQ   G    DA  +V
Sbjct  120  AFAMSVGEYVSSKAEKEFVHSEQEREKWEVENCPEEEISEMYNLYQLKYGFSEEDAQKMV  179

Query  470  TIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFI  640
             +  KY D  ++  M  + GL        +P+ P K     F +F +FG  P+L+F+
Sbjct  180  DLTFKYKDFFISNMMFEELGLIIEQGDSSQPS-PLKTATFMFFSFALFGLIPMLSFV  235



>ref|WP_038838455.1| membrane protein, partial [Legionella pneumophila]
Length=227

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/164 (29%), Positives = 90/164 (55%), Gaps = 6/164 (4%)
 Frame = +2

Query  158  EFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTSTE  337
             ++R  ++ G+D +VT+F+++S +  G+LSS  +L+LGFANL+ADG SM   +++ T +E
Sbjct  10   NYLRDWIYGGIDGVVTTFAIVSGVVGGQLSSLVILILGFANLLADGFSMAASNYLGTKSE  69

Query  338  RDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKYMDILVAEKMA  517
             D   + K + E  +   P   + E+ Q +Q  G+       VV        + +   + 
Sbjct  70   VDQFQRYKTIEEKHIDFIPEGEKNEIKQIFQNKGLHGQTLDQVVEEITANRALWIKTMLQ  129

Query  518  AKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFIILI  649
             + GL + L        P K+ L TF+AF++FG  P++ +++++
Sbjct  130  EEYGLPATLR------FPLKSALYTFSAFLLFGIIPLIPYVLVM  167



>gb|ETB61724.1| hypothetical protein YYC_01554 [Plasmodium yoelii 17X]
 emb|CDU20756.1| conserved Plasmodium protein, unknown function [Plasmodium yoelii]
 emb|CDZ14384.1| conserved Plasmodium protein, unknown function [Plasmodium yoelii]
Length=273

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/212 (24%), Positives = 107/212 (50%), Gaps = 6/212 (3%)
 Frame = +2

Query  125  EKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISM  304
            +K         + +++I+F  LD I+T F+++S      ++   V+++G  NL A+ ISM
Sbjct  32   DKHAEHHSLDKDHLKTIIFGSLDGIITIFAIVSGCVGANITPAQVIIIGVGNLFANAISM  91

Query  305  GFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHY-QALGMELNDATTVVTIFA  481
            GF ++ S++ + D +  E+   EW++ + P   +QE++  Y      +  DA  +V I  
Sbjct  92   GFSEYTSSTAQIDFMLAERQREEWEIENCPTEEKQEMIDIYINKYKFDSKDARNLVEITF  151

Query  482  KYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFIILIPF--  655
            +     +   M+ + GL   +   +  ++ +K G++ F +F  FG  P+ ++++   F  
Sbjct  152  RNKHFFLEHMMSEELGL---ILTNEDKSEAFKKGILMFLSFCFFGMIPLFSYVLYNLFFS  208

Query  656  TQNVTHKFMaacalsalaltllGIAKAKIASQ  751
             +N T  F      + + L +LG+ K++  +Q
Sbjct  209  AENYTASFAVVFISTLITLFILGLFKSQFTTQ  240



>ref|WP_037206626.1| GMP synthase [Rhodovulum sp. NI22]
 gb|KGB82516.1| GMP synthase [Rhodovulum sp. NI22]
Length=238

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 57/174 (33%), Positives = 93/174 (53%), Gaps = 21/174 (12%)
 Frame = +2

Query  158  EFVRSIVFAGLDAIVTSFSLISSISAGRLSSG-------DVLVLGFANLVADGISMGFGD  316
            E+++ IV+ G D IVT+F++++   AG  + G        VL+ G ANL AD +SMG G+
Sbjct  15   EYLKQIVYGGNDGIVTTFAIVAGF-AGASAEGVAQIGGLAVLIFGLANLFADAVSMGLGE  73

Query  317  FVSTSTERDVVAKEKIVAEWDVMHT----PIALQQELLQHYQALGMELNDATTVVTIFAK  484
            F+S  ++R++   ++     D++H     P A +  L +   A GM  +DA     + A+
Sbjct  74   FLSARSQRELYRGQR----ADLLHRMSDHPAAERAHLGRLLHARGMSQSDADAASALIAR  129

Query  485  YMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFIIL  646
               ++    M    GL+ P   G+ PA    NGL+TF AFV FG  PI+ + ++
Sbjct  130  QPTLMAELIMKYDSGLNDP--DGETPA---LNGLVTFLAFVAFGVIPIVPYFLM  178



>ref|XP_727449.1| hypothetical protein [Plasmodium yoelii yoelii 17XNL]
 gb|EAA19014.1| hypothetical protein [Plasmodium yoelii yoelii]
Length=269

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/212 (24%), Positives = 107/212 (50%), Gaps = 6/212 (3%)
 Frame = +2

Query  125  EKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISM  304
            +K         + +++I+F  LD I+T F+++S      ++   V+++G  NL A+ ISM
Sbjct  32   DKHAEHHSLDKDHLKTIIFGSLDGIITIFAIVSGCVGANITPAQVIIIGVGNLFANAISM  91

Query  305  GFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHY-QALGMELNDATTVVTIFA  481
            GF ++ S++ + D +  E+   EW++ + P   +QE++  Y      +  DA  +V I  
Sbjct  92   GFSEYTSSTAQIDFMLAERQREEWEIENCPTEEKQEMIDIYINKYKFDSKDARNLVEITF  151

Query  482  KYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFIILIPF--  655
            +     +   M+ + GL   +   +  ++ +K G++ F +F  FG  P+ ++++   F  
Sbjct  152  RNKHFFLEHMMSEELGL---ILTNEDKSEAFKKGILMFLSFCFFGMIPLFSYVLYNLFFS  208

Query  656  TQNVTHKFMaacalsalaltllGIAKAKIASQ  751
             +N T  F      + + L +LG+ K++  +Q
Sbjct  209  AENYTASFAVVFISTLITLFILGLFKSQFTTQ  240



>ref|XP_004357309.1| hypothetical protein DFA_02586 [Dictyostelium fasciculatum]
 gb|EGG18847.1| hypothetical protein DFA_02586 [Dictyostelium fasciculatum]
Length=279

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 60/203 (30%), Positives = 97/203 (48%), Gaps = 26/203 (13%)
 Frame = +2

Query  107  EKKGKSEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLIS------------------SIS  232
            E K   +    KEP K      IVF GLD I+T+F++++                  + +
Sbjct  19   ESKLVHDTEDRKEPHK----EYIVFGGLDGIITTFAIVAVYDDVLMYYCIIVIDMYLAAA  74

Query  233  AGRLSSGDVLVLGFANLVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQE  412
               L+ G VL+LGFANL+ D + M FGD+VS   E D + K  +  E  + + P   +Q 
Sbjct  75   GAGLTRGVVLILGFANLLGDALGMAFGDYVSEKAEEDQLKKHTLELEEKLQNNPDQEKQN  134

Query  413  LLQHYQALGMELNDATTVVTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLIT  592
            L++ Y   G +   A+ +  +   Y   + +  M  + G     E+G   A   K+ L+T
Sbjct  135  LIEIYMKKGYDEQQASRIAELLFPYKTTVTSIMMMEEHG--DTYEEGDSGA--MKSALVT  190

Query  593  FAAFVVFGCAPILAFIILIPFTQ  661
            F +F+V G  P+LAF+    F++
Sbjct  191  FGSFMVCGGIPLLAFLCAGGFSK  213



>ref|WP_009759800.1| membrane protein [Roseibium sp. TrichSKD4]
 gb|EFO29556.1| integral membrane protein [Roseibium sp. TrichSKD4]
Length=244

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 56/173 (32%), Positives = 88/173 (51%), Gaps = 7/173 (4%)
 Frame = +2

Query  125  EKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISM  304
            E+R    P K  ++R  V+ G+D  VT+F++++      LS+  VLVLG ANL+ADG SM
Sbjct  17   EQRLSAGP-KISYLRDWVYGGIDGAVTTFAIVAGAVGANLSATIVLVLGVANLLADGFSM  75

Query  305  GFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAK  484
               ++  T +E D   + + + +  + H P   ++E+ Q Y+  G +  +  T+V+I   
Sbjct  76   AAANYSGTKSENDDFDRLQEIEDKHIRHDPEGEREEVRQIYRNKGYDGEELETLVSILTS  135

Query  485  YMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFII  643
                 +   M  + GLSS          P K    TF AFVV G  P+L F+I
Sbjct  136  RKAAWIETMMQEEYGLSSATR------SPLKAAGSTFVAFVVCGSLPLLPFVI  182



>gb|KHO52430.1| hypothetical protein QT04_C0022G0012 [archaeon GW2011_AR11]
Length=273

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 62/203 (31%), Positives = 104/203 (51%), Gaps = 8/203 (4%)
 Frame = +2

Query  65   RYVQLGGSVEDGEMEKKGKSEK--RRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAG  238
            R  Q    V+D E  K   + K     +E  +G  +   VF  +D  VT+F+++S ++  
Sbjct  17   RSAQHAFRVKDTEATKAAHTRKAIHAAEEHKEGTHIGDFVFGAIDGSVTTFAVVSGVAGA  76

Query  239  RLSSGDVLVLGFANLVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELL  418
             LSS  V++LG ANL+ DGISM  G+++S+ +ER+ +  E+   EW++ H P   ++E+ 
Sbjct  77   ALSSNIVIILGLANLLGDGISMAVGNYLSSKSEREFIQGERRREEWEIEHYPEGEREEIR  136

Query  419  QHYQALGMELNDATTVVTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFA  598
            + ++  G        VV        I V   MA + GLS      + P  P   G++TFA
Sbjct  137  EIFRRKGFRGRQLKQVVKTITSDKKIWVDTMMAEELGLS------EDPKSPAMKGIVTFA  190

Query  599  AFVVFGCAPILAFIILIPFTQNV  667
            +FV  G  P++ + + + F  +V
Sbjct  191  SFVAVGSIPLIPYALGLFFDTSV  213



>ref|WP_040609583.1| GMP synthase [Oceanicola batsensis]
Length=243

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 53/172 (31%), Positives = 86/172 (50%), Gaps = 13/172 (8%)
 Frame = +2

Query  158  EFVRSIVFAGLDAIVTSFSLISSISAGRLSSG-------DVLVLGFANLVADGISMGFGD  316
            EF++ IV+ G D IVT+F++++   AG  + G        VLV G ANL ADG+SMG G+
Sbjct  20   EFLKQIVYGGNDGIVTTFAIVAGF-AGAQAEGVQQIGGLAVLVFGLANLFADGVSMGLGE  78

Query  317  FVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKYMDI  496
            F+S     D+    + +   ++   P   + EL       G+   +A  V  I  ++ ++
Sbjct  79   FLSGRAGNDLFHTRRRMELREIAENPDQERAELFTILCQRGLPPGEADKVTDILLRHPEM  138

Query  497  LVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFIILIP  652
            +    M  + G+  P E       P  NGL TF +F+ FG  P++ + +L P
Sbjct  139  MADLMMTYEFGMHDPAED-----DPAVNGLFTFGSFITFGAIPLVPYFLLEP  185



>ref|WP_038032788.1| membrane protein [Thermonema rossianum]
Length=244

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 54/186 (29%), Positives = 101/186 (54%), Gaps = 18/186 (10%)
 Frame = +2

Query  104  MEKKGKSEKRRPKE---PWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGF  274
            ++KK +  +RR  +    W+ +++   V+ G+D  +T+F++++  +   L S  V++LG 
Sbjct  2    VDKKTQHIERRLHQNDGKWR-DYIAEFVYGGIDGSITTFAVVAGAAGAHLDSSVVIILGL  60

Query  275  ANLVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGME---  445
            ANL+ADG SM  G ++S  TE++   K + +  W+V H P   ++E+ + Y+  G E   
Sbjct  61   ANLIADGFSMSVGAYLSAKTEKEEYKKHERIEYWEVEHMPEREKEEVREIYRQKGFEEPL  120

Query  446  LNDATTVVTIFAK-YMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCA  622
            L+    V+T   K ++D+++ E++   K   SP             GL TF AF++ G  
Sbjct  121  LSQVVEVITADKKRWVDVMMKEELGMIKDERSPF----------ALGLSTFIAFLLVGAI  170

Query  623  PILAFI  640
            P+L ++
Sbjct  171  PLLVYV  176



>gb|EPY24241.1| integral membrane protein [Angomonas deanei]
 gb|EPY26440.1| integral membrane protein [Angomonas deanei]
 gb|EPY30202.1| integral membrane protein [Angomonas deanei]
 gb|EPY39266.1| integral membrane protein [Angomonas deanei]
 gb|EPY39892.1| integral membrane protein [Angomonas deanei]
Length=279

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 60/181 (33%), Positives = 101/181 (56%), Gaps = 11/181 (6%)
 Frame = +2

Query  119  KSEKRRPKEPWKGE--------FVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGF  274
            ++ +R  ++P+  E        +V+S+VF GLD I T+F++I++ +    +   VL+ G 
Sbjct  32   EASRREHQKPFHAESHNSSASEYVKSVVFGGLDGITTTFAIIAAAAGSNGTYATVLIFGI  91

Query  275  ANLVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELND  454
            +N++ADG SMGFG+++    ER+    E+   EW+V ++      E++Q Y   G+   D
Sbjct  92   SNVIADGFSMGFGEYIGGEAERENALSERRREEWEVENSFDLEVDEMVQIYMGRGLSFED  151

Query  455  ATTVVTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILA  634
            ATT+V I +K   + V   M  + GL   LE    P    K GL+ F +F++FG  P+LA
Sbjct  152  ATTIVKIISKDQRMFVDFMMVEELGLLVDLEDAHGPK---KQGLVMFVSFLLFGFVPLLA  208

Query  635  F  637
            +
Sbjct  209  Y  209



>gb|EAQ03558.1| hypothetical protein OB2597_03022 [Oceanicola batsensis HTCC2597]
Length=263

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 53/172 (31%), Positives = 86/172 (50%), Gaps = 13/172 (8%)
 Frame = +2

Query  158  EFVRSIVFAGLDAIVTSFSLISSISAGRLSSG-------DVLVLGFANLVADGISMGFGD  316
            EF++ IV+ G D IVT+F++++   AG  + G        VLV G ANL ADG+SMG G+
Sbjct  40   EFLKQIVYGGNDGIVTTFAIVAGF-AGAQAEGVQQIGGLAVLVFGLANLFADGVSMGLGE  98

Query  317  FVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKYMDI  496
            F+S     D+    + +   ++   P   + EL       G+   +A  V  I  ++ ++
Sbjct  99   FLSGRAGNDLFHTRRRMELREIAENPDQERAELFTILCQRGLPPGEADKVTDILLRHPEM  158

Query  497  LVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFIILIP  652
            +    M  + G+  P E       P  NGL TF +F+ FG  P++ + +L P
Sbjct  159  MADLMMTYEFGMHDPAED-----DPAVNGLFTFGSFITFGAIPLVPYFLLEP  205



>ref|WP_009034259.1| membrane protein [Indibacter alkaliphilus]
 gb|EOZ96708.1| hypothetical protein A33Q_2018 [Indibacter alkaliphilus LW1]
Length=242

 Score = 87.8 bits (216),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 50/160 (31%), Positives = 85/160 (53%), Gaps = 6/160 (4%)
 Frame = +2

Query  161  FVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTSTER  340
            ++R  V+ G+D  VT+F++++      LSS  +++LGFANL ADG SM  G ++S  +E+
Sbjct  19   YLREFVYGGIDGAVTTFAVVAGAVGASLSSEIIIILGFANLFADGFSMSVGAYLSAKSEK  78

Query  341  DVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKYMDILVAEKMAA  520
            +   K K +  W++ + P    QE+   Y+A G E      VVT+     +  V E M  
Sbjct  79   ESYQKHKNIEYWEIDNIPEKEIQEVRDIYKAKGFEGKLLEQVVTVITSDRERWVEEMM--  136

Query  521  KKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFI  640
                 + LE   +   P+K GL T  +F++ G  P++ ++
Sbjct  137  ----KNELEMIPEEKSPFKIGLATLISFILIGFIPLMIYV  172



>ref|WP_008625436.1| hypothetical protein [Mariniradius saccharolyticus]
 gb|EMS34154.1| hypothetical protein C943_03971 [Mariniradius saccharolyticus 
AK6]
Length=241

 Score = 87.8 bits (216),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 50/171 (29%), Positives = 88/171 (51%), Gaps = 6/171 (4%)
 Frame = +2

Query  158  EFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTSTE  337
             ++R  V+ G+D  VT+F++++      L +  +L+LGFANL+ADG SM  G ++S  +E
Sbjct  17   HYLREFVYGGIDGAVTTFAVVAGAVGANLDTSIILILGFANLLADGFSMSVGAYLSAKSE  76

Query  338  RDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKYMDILVAEKMA  517
            ++   K + +  W+V + P   ++E+LQ Y+A G E      VV +     D  V E M 
Sbjct  77   KENYQKHRAIEYWEVDNIPEMEREEVLQIYKAKGFEGELLEKVVDVITADRDRWVDEMM-  135

Query  518  AKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFIILIPFTQNVT  670
                  + L+  +    P+  GL T  +FV+ G  P+  ++    F   ++
Sbjct  136  -----KNELDMIEDSKSPFNIGLATLISFVLVGFIPLAFYVYDFVFESGIS  181



>ref|WP_015264365.1| hypothetical protein [Echinicola vietnamensis]
 ref|YP_007222808.1| hypothetical protein Echvi_0514 [Echinicola vietnamensis DSM 
17526]
 gb|AGA76798.1| putative membrane protein [Echinicola vietnamensis DSM 17526]
Length=238

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 54/181 (30%), Positives = 95/181 (52%), Gaps = 20/181 (11%)
 Frame = +2

Query  143  EPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFV  322
            E + GEFV    + G+D  VT+F++++      L +  +++LGFANL+ADG SM  G ++
Sbjct  14   EKYIGEFV----YGGIDGCVTTFAVVAGSVGAGLDASIIIILGFANLLADGFSMSIGAYL  69

Query  323  STSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVV-TIFA---KYM  490
            S  +E+D   K +    W++ H P   ++E+   Y+A G E      VV TI +   +++
Sbjct  70   SAKSEKDNYYKHRNREYWEIKHLPHEEEEEIRTIYRAKGFEGTLLEQVVQTIISDRDRWV  129

Query  491  DILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFI--ILIPFTQN  664
            D+++ E+          LE  K   KP   GL T+ +F+  G  P++ ++     P + N
Sbjct  130  DVMMKEE----------LEMIKDKKKPLLIGLFTYLSFISIGLIPLMTYVWDYFYPISGN  179

Query  665  V  667
            +
Sbjct  180  I  180



>ref|WP_026951189.1| membrane protein [Algoriphagus mannitolivorans]
Length=239

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/174 (29%), Positives = 90/174 (52%), Gaps = 6/174 (3%)
 Frame = +2

Query  158  EFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTSTE  337
            E++R  V+ G+D  VT+F++++      L  G +++LGFANL+ADG SM  G ++S  +E
Sbjct  17   EYLREFVYGGIDGAVTTFAVVAGGYGANLDPGILIILGFANLLADGFSMSVGAYLSAKSE  76

Query  338  RDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKYMDILVAEKMA  517
            RD   K + +  W++ + P   ++E+ + Y+  G +      +V       D+ VAE M 
Sbjct  77   RDNFDKHEKIEYWEIENLPEIEREEIAEIYREKGFQGELLDQIVDHICSDKDLWVAEMMK  136

Query  518  AKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFIILIPFTQNVTHKF  679
             + G+       K+   P K GL T  +F++ G  P++ ++    F   +   F
Sbjct  137  DELGMM------KENKSPLKIGLATLISFIMVGFIPLMVYLWNFFFPMEINSFF  184



>ref|WP_007673933.1| membrane protein [alpha proteobacterium BAL199]
 gb|EDP64215.1| hypothetical protein BAL199_08338 [alpha proteobacterium BAL199]
Length=241

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 53/160 (33%), Positives = 84/160 (53%), Gaps = 6/160 (4%)
 Frame = +2

Query  161  FVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTSTER  340
            ++R +VF G+D  VT+F++++ +    LS   VL+LG ANL+ADG SM   ++ ST TE 
Sbjct  27   YLRDLVFGGIDGAVTTFAIVAGVVGADLSPRIVLILGAANLLADGFSMAAANYSSTRTEV  86

Query  341  DVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKYMDILVAEKMAA  520
            D  A  + + E  +  TP   ++E+ Q   A G + +     V +     D  +   MA 
Sbjct  87   DEYAHLRAMEERHIDTTPDGEREEVRQILHAKGFDGDTLRQAVKLITANRDRWIDMMMAD  146

Query  521  KKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFI  640
            + GL  P+++      P K    TFAAF+V G  P+  F+
Sbjct  147  EHGL-QPVQR-----SPVKAAGATFAAFIVCGSVPLAPFV  180



>ref|WP_020894141.1| hypothetical protein [Cyclobacterium qasimii]
 gb|EPR69839.1| hypothetical protein ADICYQ_1223 [Cyclobacterium qasimii M12-11B]
Length=241

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/161 (30%), Positives = 85/161 (53%), Gaps = 6/161 (4%)
 Frame = +2

Query  158  EFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTSTE  337
            E++R  V+ G+D  VT+F++++      L    +++LGFANL ADG+SM  G ++S+ +E
Sbjct  18   EYLREFVYGGIDGAVTTFAVVAGAVGASLDPMVIIILGFANLFADGLSMSIGAYLSSKSE  77

Query  338  RDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKYMDILVAEKMA  517
            ++   K K +  W+V + P+  ++E++  Y+  G E      VV +     D  V E M 
Sbjct  78   KENYQKHKNIEYWEVDNLPMKEREEIVTIYKEKGFEGELLQKVVDVIVSDRDRWVNEMM-  136

Query  518  AKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFI  640
                    L   ++   P+K GL T  +FVV G  P+  ++
Sbjct  137  -----KDELNMIEEVKSPFKIGLATLISFVVIGFIPLTVYV  172



>ref|WP_008199463.1| membrane protein [Algoriphagus machipongonensis]
 gb|EAZ80691.1| integral membrane protein [Algoriphagus machipongonensis]
Length=241

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/161 (30%), Positives = 86/161 (53%), Gaps = 6/161 (4%)
 Frame = +2

Query  158  EFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTSTE  337
            E++   V+ G+D  VT+F++++      L  G +++LGFANL+ADG SM  G ++S  +E
Sbjct  18   EYLSEFVYGGIDGAVTTFAVVAGGFGADLDPGIIIILGFANLLADGFSMSVGAYLSAKSE  77

Query  338  RDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKYMDILVAEKMA  517
            ++   K + +  W+V + P   ++E+ + Y+A G +      VV       D+ VAE M 
Sbjct  78   KENFKKHEAIEYWEVDNLPEKEREEISEIYEAKGFKGELLEQVVDQITSNKDLWVAEMM-  136

Query  518  AKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFI  640
                    L   ++   P+K GL TF +F++ G  P+  ++
Sbjct  137  -----KDELNMMEETKSPFKIGLATFISFIIVGFIPLTVYL  172



>ref|WP_024281760.1| membrane protein [Algoriphagus marincola]
Length=241

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/162 (32%), Positives = 90/162 (56%), Gaps = 6/162 (4%)
 Frame = +2

Query  158  EFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTSTE  337
            E++R  V+ G+D  VT+F++++      L +G +++LGFANL+ADG SM  G ++S  T+
Sbjct  18   EYMREFVYGGIDGAVTTFAVVAGGFGANLDTGIIIILGFANLLADGFSMSVGAYLSAKTD  77

Query  338  RDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKYMDILVAEKMA  517
            R+   K + +  W+V + P   ++E+ + Y+A G +      VV       D+ VAE M 
Sbjct  78   RENFKKHEKIEYWEVENIPEKEREEIREIYEAKGFKGELLEKVVDQICSDKDLWVAEMM-  136

Query  518  AKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFII  643
                    LE  ++   P+K GL T  +F++ G  P+L ++I
Sbjct  137  -----KDELEMMEENKSPFKIGLATLISFILVGFIPLLVYLI  173



>gb|EMR03612.1| VIT family protein [Cesiribacter andamanensis AMV16]
Length=253

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/174 (30%), Positives = 95/174 (55%), Gaps = 18/174 (10%)
 Frame = +2

Query  134  RPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFG  313
            RP + + GEFV    + G+D  VT+F++++  + G LS+  VL+LGFANL+ADG +M  G
Sbjct  25   RPVQDYLGEFV----YGGIDGSVTTFAVVAGAAGGGLSAQVVLILGFANLIADGFAMSVG  80

Query  314  DFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFA----  481
             ++S  +++D  +  +    W+V H P   +QE+ +  QA G +      VV +      
Sbjct  81   SYLSAKSQQDNFSMHERTEYWEVDHLPERERQEVREIMQAKGFKGELLEKVVDVLTADRD  140

Query  482  KYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFII  643
            +++D+++ E++   +   SP   G           +TFA+F+  G  P+L +++
Sbjct  141  RWVDVMMKEELGMIRETKSPFAIGG----------VTFASFIAVGLVPLLTYVL  184



>ref|WP_040396352.1| membrane protein [Cesiribacter andamanensis]
Length=238

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/174 (30%), Positives = 95/174 (55%), Gaps = 18/174 (10%)
 Frame = +2

Query  134  RPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFG  313
            RP + + GEFV    + G+D  VT+F++++  + G LS+  VL+LGFANL+ADG +M  G
Sbjct  10   RPVQDYLGEFV----YGGIDGSVTTFAVVAGAAGGGLSAQVVLILGFANLIADGFAMSVG  65

Query  314  DFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFA----  481
             ++S  +++D  +  +    W+V H P   +QE+ +  QA G +      VV +      
Sbjct  66   SYLSAKSQQDNFSMHERTEYWEVDHLPERERQEVREIMQAKGFKGELLEKVVDVLTADRD  125

Query  482  KYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFII  643
            +++D+++ E++   +   SP   G           +TFA+F+  G  P+L +++
Sbjct  126  RWVDVMMKEELGMIRETKSPFAIGG----------VTFASFIAVGLVPLLTYVL  169



>ref|WP_025604799.1| membrane protein [Pontibacter actiniarum]
Length=242

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/162 (28%), Positives = 83/162 (51%), Gaps = 6/162 (4%)
 Frame = +2

Query  158  EFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTSTE  337
            E++   V+ G+D  +T+F++++       ++  V++LG ANL+ADG SM  G+F ST   
Sbjct  18   EYIAEFVYGGIDGAITTFAVVAGAEGANFNTSVVIILGLANLIADGFSMSVGNFFSTKAS  77

Query  338  RDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKYMDILVAEKMA  517
            RD   + K    W+V + P    +E+ + Y A G +      VV +     ++ V   M 
Sbjct  78   RDNFDRHKATEYWEVDNLPDREVEEIREAYAAKGFQGELLDQVVEVITSNKEVWVDTMMK  137

Query  518  AKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFII  643
             + G++      +    P K   +TF +FV+ G  P+L++++
Sbjct  138  EELGMT------QDDKTPVKTASVTFISFVLIGSIPLLSYLV  173



>gb|ETO31266.1| hypothetical protein RFI_05854 [Reticulomyxa filosa]
Length=140

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 66/114 (58%), Gaps = 0/114 (0%)
 Frame = +2

Query  101  EMEKKGKSEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFAN  280
            E+E+KG            GE V+S+V+ GLD I+T+F+++SS+    L    VLV+GFAN
Sbjct  14   EIEEKGYKTTSEENHKNLGEIVKSVVYGGLDGIITTFAIVSSVHGANLPQAVVLVVGFAN  73

Query  281  LVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGM  442
            ++A+  SMG GD++S S E D    E+   +W+  +       E+++ Y+  GM
Sbjct  74   VIANAFSMGIGDYLSESAEFDYARSERNREKWEFENFKEGEIMEMVEIYEKKGM  127



>emb|CDI79778.1| integral membrane protein, putative [Eimeria acervulina]
Length=251

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/138 (37%), Positives = 80/138 (58%), Gaps = 6/138 (4%)
 Frame = +2

Query  158  EFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTSTE  337
            +++++IVF GLD IVT F++++      L    V+++G  NL+AD ISMGFG+FVS++ E
Sbjct  46   DYLKAIVFGGLDGIVTIFAIVAGCVGANLHPSKVVIIGIGNLLADAISMGFGEFVSSAAE  105

Query  338  RDVVAKEKIVAEWDVMHTPIALQQELLQHYQ-ALGMELNDATTVVTIFAKYMDILVAEKM  514
             D V  E+   EW++ + P   +QE+++ Y+   G    DA  +V I  KY +  V   M
Sbjct  106  EDFVKSEREREEWEIENCPNEEKQEMVEIYRDRYGFTDEDADCLVNITFKYREFFVQHMM  165

Query  515  AAKKGL-----SSPLEKG  553
              + GL      SPL +G
Sbjct  166  VEELGLMVTEGPSPLRRG  183



>ref|WP_014022957.1| membrane protein [Cyclobacterium marinum]
 ref|YP_004776908.1| hypothetical protein [Cyclobacterium marinum DSM 745]
 gb|AEL28677.1| protein of unknown function DUF125 transmembrane [Cyclobacterium 
marinum DSM 745]
Length=241

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/161 (32%), Positives = 87/161 (54%), Gaps = 6/161 (4%)
 Frame = +2

Query  158  EFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTSTE  337
            E++R  V+ G+D  VT+F++++      L    ++VLGFANL ADG+SM  G ++S+ +E
Sbjct  18   EYLREFVYGGIDGAVTTFAVVAGAVGANLDPMVIIVLGFANLFADGLSMSIGAYLSSKSE  77

Query  338  RDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKYMDILVAEKMA  517
            ++   K K +  W+V + P   ++E++  Y+  G E      VV +     D  V E M 
Sbjct  78   KENYQKHKNIEYWEVDNIPKKEREEIVAIYKEKGFEGKLLQEVVEVIVADRDRWVNEMMK  137

Query  518  AKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFI  640
             +  +   +E+ K P K    GL T  +FVV G  P++ ++
Sbjct  138  DELNM---IEEVKSPLKI---GLATLISFVVVGFIPLIVYV  172



>ref|XP_004363052.1| transmembrane protein [Dictyostelium fasciculatum]
 gb|EGG25201.1| transmembrane protein [Dictyostelium fasciculatum]
Length=378

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 50/183 (27%), Positives = 100/183 (55%), Gaps = 12/183 (7%)
 Frame = +2

Query  113  KGKSEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVAD  292
            K KS  R   +    ++++SI++ G+D +V+ F  ++ +++G      +LV+  A L+A 
Sbjct  125  KVKSINRDDLKLDTSKYLKSIIYGGMDGLVSIFVSVAVVASGDAPISVLLVIAVAKLIAG  184

Query  293  GISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVT  472
             ISMG GD++ T  + D    E+    W+V +     ++E+++ Y   G+    AT VV 
Sbjct  185  AISMGMGDYLGTQADVDFAKGERQRETWEVEYYIEGEKKEMVEIYCEKGIPEEIATEVVN  244

Query  473  IFAK----YMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFI  640
            I A     ++D+++ E++       +P  +G+     WKNG++ F +F++FG  P+L ++
Sbjct  245  ILATNTKGFVDVMMVEELGI-----TPDAEGE---VAWKNGMVNFVSFLIFGIIPLLPYL  296

Query  641  ILI  649
            + +
Sbjct  297  VYL  299



>ref|WP_007465871.1| Hypothetical protein [Photobacterium sp. AK15]
 gb|ELR65804.1| Hypothetical protein C942_00890 [Photobacterium sp. AK15]
Length=253

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 67/255 (26%), Positives = 125/255 (49%), Gaps = 11/255 (4%)
 Frame = +2

Query  89   VEDGEMEKKGKSEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVL  268
            +E+   + + ++ + R ++  K + +   V  G+D  VT+F+++S        +G  L+L
Sbjct  6    IEELHRDHQPEAIRERLQQSPKSQNISDAVLGGIDGCVTTFAVVSGAVGAGFPAGVALIL  65

Query  269  GFANLVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMEL  448
            GFANLVADG SM   ++ S   +++     + + E+ +   P   ++E+ Q ++  G + 
Sbjct  66   GFANLVADGFSMAISNYESNKAQQEYADSLRQMEEFHIDEVPDGEREEIRQIFRQKGFDG  125

Query  449  NDATTVVTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPI  628
                 +V        + V   +  + G+   L        PW +  +TFAAFVV G  P+
Sbjct  126  EILEAIVETLTDDKKLWVETMLTEEHGIHKTL------TNPWVSAGVTFAAFVVIGTVPL  179

Query  629  LAFIIL-IPFTQNVTHKFMaacalsalaltllGIAKAKIASQSYTVSVAITLSNgaiaga  805
            L F+++ +P +Q    +F  +  L+AL   L+G+ K+ +  Q   ++   TL  G  A  
Sbjct  180  LPFLMMSLPLSQ----QFFISAGLAALMFFLIGVLKSLVFGQPAIMAGLRTLLTGGAAAG  235

Query  806  sayaigWTLRNVAGL  850
             AY  G+ LR + G+
Sbjct  236  LAYLTGYILREIVGV  250



>dbj|GAL83562.1| hypothetical protein MYP_789 [Sporocytophaga myxococcoides]
Length=240

 Score = 85.1 bits (209),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 50/164 (30%), Positives = 84/164 (51%), Gaps = 6/164 (4%)
 Frame = +2

Query  158  EFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTSTE  337
            +++   ++ G+D  +T+F++++  +   LS   V++LGFANL+ADG SM  G++ ST  E
Sbjct  17   DYISEFIYGGIDGAITTFAVVAGAAGANLSISVVIILGFANLIADGFSMSVGNYFSTKAE  76

Query  338  RDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKYMDILVAEKMA  517
            +D   K K V  W++ +      +E+ + YQ  G E      VV +     D+ V   M 
Sbjct  77   QDTYEKNKAVEYWEIENMREKEIEEIREIYQKKGFEGELLNRVVEVIISNKDVWVDTMM-  135

Query  518  AKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFIILI  649
                    LE  +    P+K   +TF +FV  G  P+LA++  I
Sbjct  136  -----KEELEMSRDERTPFKTAGMTFLSFVTIGLIPLLAYLFAI  174



>ref|WP_029037954.1| membrane protein [Salinimicrobium xinjiangense]
Length=241

 Score = 85.1 bits (209),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 50/177 (28%), Positives = 88/177 (50%), Gaps = 6/177 (3%)
 Frame = +2

Query  110  KKGKSEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVA  289
            ++ K   R+    +  +++   V+ G+D  +T+F++++      L    V++LG ANL+A
Sbjct  2    EESKIHSRQKILFFNKDYIPEFVYGGIDGAITTFAVVAGAEGASLGLSVVVILGIANLIA  61

Query  290  DGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVV  469
            DG SM  G+F ST  ERD   + + +  W+V +      +E+ + Y A G E      VV
Sbjct  62   DGFSMSVGNFFSTKAERDSYERHRQIEYWEVENLREKEIEEIREIYAAKGFEGKLLEDVV  121

Query  470  TIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFI  640
             +     D+ V   M  +      LE  K    P+K   +TF +F+V G  P+L+++
Sbjct  122  EVITSNKDVWVDTMMKEE------LEMVKSDKTPYKTAGMTFISFIVVGSVPLLSYV  172



>ref|XP_004349158.1| integral membrane protein [Capsaspora owczarzaki ATCC 30864]
 gb|EFW44383.1| integral membrane protein [Capsaspora owczarzaki ATCC 30864]
Length=260

 Score = 85.1 bits (209),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 70/223 (31%), Positives = 109/223 (49%), Gaps = 8/223 (4%)
 Frame = +2

Query  125  EKRRPKEPWKG---EFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADG  295
            EK    E  KG   E+V+SIV+ GLD +V+    ++S+    +    +L LG A L A  
Sbjct  20   EKLVSTEKHKGGGTEYVKSIVYGGLDGVVSILVSVASVYGSPVGIKFILALGAAKLAAGA  79

Query  296  ISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTI  475
             SMG GDF+ST  E D + +E++  EW+V +     + E+++ Y   G+    AT VV I
Sbjct  80   FSMGIGDFLSTKAEVDFIVRERLREEWEVDNYIEGERAEMIEIYVNYGLSKQAATEVVEI  139

Query  476  FAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFIIL-IP  652
             +K     V   M  + GL+           P K+GL+ F +F++FG  P+L +I   I 
Sbjct  140  ISKNKQTFVNTMMVEELGLNPE----DIDQSPLKHGLVNFGSFLLFGILPLLVYIAFAID  195

Query  653  FTQNVTHKFMaacalsalaltllGIAKAKIASQSYTVSVAITL  781
              ++    F  +  ++   L  LG+ KA      Y  S  +TL
Sbjct  196  GNEDDNLAFAISAGMTGFGLLSLGVGKAFFTGTPYISSTLMTL  238



>ref|WP_013455466.1| membrane protein [Marivirga tractuosa]
 ref|YP_004055432.1| hypothetical protein Ftrac_3350 [Marivirga tractuosa DSM 4126]
 gb|ADR23324.1| protein of unknown function DUF125 transmembrane [Marivirga tractuosa 
DSM 4126]
Length=242

 Score = 84.7 bits (208),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 58/207 (28%), Positives = 106/207 (51%), Gaps = 7/207 (3%)
 Frame = +2

Query  161  FVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTSTER  340
            ++   V+ G+D  +T+F++++      L +  +++LGFANL ADG SM  G ++S  +E+
Sbjct  21   YLSEFVYGGIDGSITTFAVVAGAVGAGLDNSVIIILGFANLFADGFSMSIGAYMSAKSEK  80

Query  341  DVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKYMDILVAEKMAA  520
                K+K +  W+V + P   ++E+   Y   G E    + VV +  K  D  V   M  
Sbjct  81   QHFEKQKAIEYWEVDNMPDTEKEEIRDIYIEKGFEEPLLSQVVEVITKDKDRWVDVMMKD  140

Query  521  KKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFIILIPFTQNVTHKFMaacals  700
            + GL       ++   P++ GL TF +F++ G  P+L F +       +T+KF  A  L+
Sbjct  141  ELGLV------EEEKSPFQTGLFTFISFLIIGLIPLLVF-VADYINIEITNKFFWASILT  193

Query  701  alaltllGIAKAKIASQSYTVSVAITL  781
              A  ++G  K+++ + S    ++ TL
Sbjct  194  GAAFVIIGFLKSRVTNNSIIKGISETL  220



>ref|WP_008196519.1| membrane protein [Labrenzia alexandrii]
 gb|EEE47431.1| Integral membrane protein [Labrenzia alexandrii DFL-11]
Length=244

 Score = 84.7 bits (208),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 49/160 (31%), Positives = 86/160 (54%), Gaps = 6/160 (4%)
 Frame = +2

Query  161  FVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTSTER  340
            ++R  V+ G+D  VT+F++++      LS+  +L+LG ANL+ADG SM   ++  + +E 
Sbjct  27   YLRDWVYGGIDGAVTTFAIVAGSVGANLSTRIILILGVANLLADGFSMAAANYSGSKSEN  86

Query  341  DVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKYMDILVAEKMAA  520
            +   + + + E  +   P   ++E+ Q ++A G E  D   +V +        +   M A
Sbjct  87   EDFQRLRAIEEKHIRVEPDGEREEIRQIFRAKGYEGADLEDIVRLVTSNRTTWIETMMLA  146

Query  521  KKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFI  640
            + G+S   + G+ P K     L TFAAFV+FG  P+L F+
Sbjct  147  EYGVS---DGGRAPMKA---ALYTFAAFVLFGALPLLPFL  180



>emb|CEK09357.1| conserved membrane protein of unknown function [Legionella hackeliae]
Length=241

 Score = 84.3 bits (207),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 57/199 (29%), Positives = 103/199 (52%), Gaps = 12/199 (6%)
 Frame = +2

Query  161  FVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTSTER  340
            ++R  ++ G+D  VT+F+++S +  G+LSS  +L+LGFANL+ADG SM   +++ T  E 
Sbjct  25   YLRDWIYGGIDGAVTTFAIVSGVVGGQLSSVVILILGFANLLADGFSMAASNYLGTKAEM  84

Query  341  DVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKYMDILVAEKMAA  520
            +   K K + E  +   P   ++E+ Q +Q  G++ +    VV        + V   +  
Sbjct  85   EQYHKLKAIEEKHIDIIPEGEREEIRQIFQNKGLKGDALDMVVNEITSNKSLWVKTMLQE  144

Query  521  KKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFIILIPFTQNVTHKFMaacals  700
            + GL  PL        P K+   TF AF++FG  P      L P+  N+++ F  +   +
Sbjct  145  EYGL--PL----LIRTPLKSACYTFLAFLIFGLIP------LFPYVFNMSNAFFWSNIGT  192

Query  701  alaltllGIAKAKIASQSY  757
             +   ++G  K+  +S+S+
Sbjct  193  GITFFIIGSIKSHWSSKSW  211



>gb|KGM47383.1| GMP synthase [Oceanicola sp. 22II-S11g]
Length=244

 Score = 84.3 bits (207),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 53/170 (31%), Positives = 87/170 (51%), Gaps = 13/170 (8%)
 Frame = +2

Query  158  EFVRSIVFAGLDAIVTSFSLISSISAGRLSSG-------DVLVLGFANLVADGISMGFGD  316
            +FV+ IV+ G D IVT+F++++   AG  + G        VLV G ANL AD +SMG G+
Sbjct  21   DFVKQIVYGGNDGIVTTFAIVAGF-AGAQAEGVAQIGGLAVLVFGLANLFADAVSMGLGE  79

Query  317  FVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKYMDI  496
            F+S   + D+    +      +   P A Q  L Q     G+  ++A  +  I  ++ ++
Sbjct  80   FLSGRAQNDLYRSRRTAELRVIASDPAAEQAALAQLMAQRGLPRDEAGQMARIVVRHPEV  139

Query  497  LVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFIIL  646
            +    M  + GL  P +       P  +GL+TF +FV+FGC PI  + ++
Sbjct  140  MADMMMRYEHGLQDPSD-----GSPAIDGLVTFCSFVLFGCVPIAPYFLM  184



>emb|CDJ27300.1| Vacuolar iron transporter, related [Eimeria mitis]
Length=233

 Score = 84.3 bits (207),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 75/126 (60%), Gaps = 1/126 (1%)
 Frame = +2

Query  158  EFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTSTE  337
            +++++IVF GLD IVT F++++      L    V+++G  NL+AD ISMGFG+FVS++ E
Sbjct  91   DYLKAIVFGGLDGIVTIFAIVAGCVGANLHPSKVVIIGVGNLLADAISMGFGEFVSSAAE  150

Query  338  RDVVAKEKIVAEWDVMHTPIALQQELLQHYQ-ALGMELNDATTVVTIFAKYMDILVAEKM  514
             D V  E+   EW++ + P   +QE+++ Y+   G    DA  +V I  KY +  V   M
Sbjct  151  EDFVKSEREREEWEIENCPNEEKQEMVEIYRDRYGFTEEDADCLVNITFKYREFFVQHMM  210

Query  515  AAKKGL  532
              + GL
Sbjct  211  VEELGL  216



>ref|WP_009186465.1| membrane protein [Cecembia lonarensis]
 gb|EKB47954.1| VIT family protein [Cecembia lonarensis LW9]
Length=246

 Score = 84.0 bits (206),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 48/160 (30%), Positives = 84/160 (53%), Gaps = 6/160 (4%)
 Frame = +2

Query  161  FVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTSTER  340
            ++R  V+ G+D  VT+F++++      L    +++LGFANL+ADG SM  G ++S  +E+
Sbjct  21   YLREFVYGGIDGAVTTFAVVAGAVGASLDISIIIILGFANLLADGFSMSVGAYLSAKSEK  80

Query  341  DVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKYMDILVAEKMAA  520
            +   K + +  W+V + P   ++E+++ Y+A G E      VV +     D  V E M  
Sbjct  81   ENYLKHRDIEYWEVDNIPEKEREEIVEIYRAKGFEGRLLEQVVDVIVSDRDRWVNEMM--  138

Query  521  KKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFI  640
                   LE   +   P+K GL T  +F+  G  P+L ++
Sbjct  139  ----KDELEMIPESKSPFKIGLATLVSFIFVGFIPLLVYV  174



>ref|WP_028793732.1| membrane protein [Thalassobaculum salexigens]
Length=242

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 52/167 (31%), Positives = 87/167 (52%), Gaps = 20/167 (12%)
 Frame = +2

Query  161  FVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTSTER  340
            ++R  ++ G+D  VT+F++++ ++   LS G +L+LGFANL+ADG SM   ++  T  E+
Sbjct  24   YLRDWIYGGIDGAVTTFAIVAGVAGAELSVGVILILGFANLIADGFSMAAANYSGTKAEK  83

Query  341  DVVAKEKIVAEWDVMHTPIALQQELLQHYQALGME---LNDATTVVTI----FAKYMDIL  499
            D  A+   +    +   P   ++E+ Q + A G E   L  A   +T     +AK M  L
Sbjct  84   DDAARVLAMEHRHIAAEPDGEREEIRQIFAAKGFEGRALERAVDTITADEERWAKTM--L  141

Query  500  VAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFI  640
            V E   A      P+ +      PW    +TF+AFVV G  P++ ++
Sbjct  142  VEEHHLA------PVTR-----SPWTAAWVTFSAFVVCGLVPLIPYM  177



>ref|WP_014770763.1| membrane protein [Belliella baltica]
 ref|YP_006405501.1| hypothetical protein Belba_0075 [Belliella baltica DSM 15883]
 gb|AFL82746.1| putative membrane protein [Belliella baltica DSM 15883]
Length=240

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/160 (29%), Positives = 82/160 (51%), Gaps = 6/160 (4%)
 Frame = +2

Query  161  FVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTSTER  340
            ++R  V+ G+D  VT+F++++      L    +++LGFANL+ADG SM  G ++S+ +++
Sbjct  19   YLREFVYGGIDGAVTTFAVVAGAVGANLDPAIIIILGFANLLADGFSMSVGAYLSSKSDQ  78

Query  341  DVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKYMDILVAEKMAA  520
            +   K K V  W+V + P   + E+ + Y+  G E      VV +     D  V E M  
Sbjct  79   ENYDKHKAVEYWEVDNLPEKERHEIEEIYREKGFEGELLQQVVNVITADKDRWVNEMM--  136

Query  521  KKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFI  640
                   L   ++   P+K GL T  +F+  G  P++ ++
Sbjct  137  ----KDELNMMEETKSPFKIGLATLISFITIGFIPLMIYV  172



>ref|WP_026944943.1| membrane protein [Algoriphagus marincola]
Length=241

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 51/162 (31%), Positives = 89/162 (55%), Gaps = 6/162 (4%)
 Frame = +2

Query  158  EFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTSTE  337
            E++R  V+ G+D  VT+F++++      L +G +++LGFANL+ADG SM  G ++S  T+
Sbjct  18   EYMREFVYGGIDGAVTTFAVVAGGFGANLDTGIIIILGFANLLADGFSMSVGAYLSAKTD  77

Query  338  RDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKYMDILVAEKMA  517
            R+   K + +  W+V + P   ++E+ + Y+A G +      VV        + VAE M 
Sbjct  78   RENFKKHEKIEYWEVENIPEKEREEIREIYEAKGFKGELLEKVVDQICSDKVLWVAEMM-  136

Query  518  AKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFII  643
                    LE  ++   P+K GL T  +F++ G  P+L ++I
Sbjct  137  -----KDELEMMEENKSPFKIGLATLISFILVGFIPLLVYLI  173



>ref|WP_013653488.1| membrane protein [Polymorphum gilvum]
 ref|YP_004304478.1| hypothetical protein SL003B_2751 [Polymorphum gilvum SL003B-26A1]
 gb|ADZ71174.1| Integral membrane protein [Polymorphum gilvum SL003B-26A1]
Length=252

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 62/202 (31%), Positives = 101/202 (50%), Gaps = 11/202 (5%)
 Frame = +2

Query  161  FVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTSTER  340
            ++R  V+ G+D  VT+F++++      LS+  VL+LG ANL+ADG SM   ++  T  E 
Sbjct  33   YLRDWVYGGIDGAVTTFAIVAGSLGANLSASIVLILGLANLLADGFSMAAANYSGTKAET  92

Query  341  DVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKYMDILVAEKMAA  520
            D   + K V E  +   P   ++E+ Q ++A G E  +   +V +        +   M  
Sbjct  93   DDYRRLKRVEEKHIELEPEGEREEIRQIFRAKGYEGEELEALVAMITSSHRTWIETMMLE  152

Query  521  KKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFIILIPFTQNVTHKFMaacals  700
            + GLS      K    P +  L TFAAFV+ G  P+L F+   P +  +T   M     +
Sbjct  153  EYGLS------KVQRSPLRAALSTFAAFVLCGAVPLLPFLFGAPASAGLTTTVM-----T  201

Query  701  alaltllGIAKAKIASQSYTVS  766
            A A   +G AK++ ++QS+  S
Sbjct  202  AAAFFGIGSAKSRWSTQSWYAS  223



>ref|WP_037248672.1| GMP synthase [Roseovarius sp. MCTG156(2b)]
Length=229

 Score = 82.4 bits (202),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 50/169 (30%), Positives = 84/169 (50%), Gaps = 13/169 (8%)
 Frame = +2

Query  161  FVRSIVFAGLDAIVTSFSLISSISAGRLSSG-------DVLVLGFANLVADGISMGFGDF  319
            F++ IV+ G D IVT+F++++   AG  + G        VL+ G ANL AD +SMG G+F
Sbjct  7    FLKQIVYGGTDGIVTTFAIVAGF-AGAQAEGVAQIGGLAVLLFGMANLFADAVSMGLGEF  65

Query  320  VSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKYMDIL  499
            +S   + D+           +  TP A  + L    +  G+  +++     IF+ +  ++
Sbjct  66   LSLRAQHDLYRSRMTRELHAITETPEAQIRHLAALLRTRGLTEDESQATADIFSHHPTLM  125

Query  500  VAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFIIL  646
                ++   GLSSP         P   GL TF AFV+FG  P++ +++ 
Sbjct  126  SETILSHSMGLSSP-----GAENPMIKGLFTFGAFVLFGIVPLIPYLLF  169



>ref|WP_019669624.1| hypothetical protein [Eudoraea adriatica]
Length=247

 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 50/184 (27%), Positives = 96/184 (52%), Gaps = 20/184 (11%)
 Frame = +2

Query  134  RPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFG  313
            +  E + GEFV    + G+D  VT+F++++      L S  +++LGFANL+ADG +M  G
Sbjct  20   KKYEKYLGEFV----YGGIDGCVTTFAVVAGSVGAGLDSAIIIILGFANLLADGFAMSVG  75

Query  314  DFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFA----  481
             ++S  T++D   K K +  W+V + P   ++E+   Y+  G E      VV +      
Sbjct  76   AYLSNKTKKDNYNKHKQIEYWEVDNLPELEKEEIRVIYKEQGFEGELLEEVVKVITSDKE  135

Query  482  KYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFII--LIPF  655
            +++++++ E++       SPL  G           +T+ +F++ G  P+L +++  + PF
Sbjct  136  RWVNVMMKEELVMFDEDKSPLIIGG----------VTYFSFILIGVIPLLVYVLDYIYPF  185

Query  656  TQNV  667
              N+
Sbjct  186  NYNL  189



>ref|WP_014202654.1| membrane protein [Owenweeksia hongkongensis]
 ref|YP_004989950.1| hypothetical protein [Owenweeksia hongkongensis DSM 17368]
 gb|AEV33305.1| putative membrane protein [Owenweeksia hongkongensis DSM 17368]
Length=247

 Score = 82.0 bits (201),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 53/171 (31%), Positives = 96/171 (56%), Gaps = 18/171 (11%)
 Frame = +2

Query  143  EPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFV  322
            + + GEFV    + G+D  VT+F++++  +  +L S  V++LGFANL+ADG +M  G ++
Sbjct  24   QDYLGEFV----YGGIDGSVTTFAVVAGAAGAQLDSKVVIILGFANLIADGFAMSVGSYL  79

Query  323  STSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFA----KYM  490
            ST +E++   K K V  W+V + P   + E+ + Y+A G E      VV +      +++
Sbjct  80   STKSEKENYNKHKAVEYWEVDNLPDKERAEVREIYEAKGFEGELLEQVVDVITEDRHRWV  139

Query  491  DILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFII  643
            D+++ E++   +   SPL  G           +TF +F +FG  P+LA+++
Sbjct  140  DVMMKEELEMMEESKSPLAMGG----------VTFLSFQLFGLIPLLAYVV  180



>gb|ETW12810.1| hypothetical protein ATO8_09713 [Roseivivax atlanticus]
Length=249

 Score = 81.6 bits (200),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 49/166 (30%), Positives = 91/166 (55%), Gaps = 16/166 (10%)
 Frame = +2

Query  176  VFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTSTERDVVAK  355
            V+  +D  VT+F++++ +    L +  +++LG AN++ADG+SM  G+F +T TE D VA+
Sbjct  35   VYGAIDGAVTTFAIVAGVQGAGLPTSVIVILGLANVLADGVSMALGNFTATRTEADEVAR  94

Query  356  EKIVAEWDVMHTPIALQQELLQHYQALGME---LNDATTVVTIFAK-YMDILVAEKMAAK  523
             + +    +   P   ++EL Q   A G+E   L DA T ++   + ++D++V ++    
Sbjct  95   IRTIETRHIERVPEGEREELRQILAAKGLEGQVLADAVTAISRRRESWIDLMVTDEYG--  152

Query  524  KGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFIILI--PF  655
            + LS P        +   +  +TF AF+  G  P+L F++ +  PF
Sbjct  153  RSLSPP--------RAGTSAGVTFVAFLAAGAVPLLPFVMPLEAPF  190



>gb|AJF59991.1| hypothetical protein QT03_C0001G0495 [archaeon GW2011_AR10]
Length=265

 Score = 81.6 bits (200),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 56/183 (31%), Positives = 98/183 (54%), Gaps = 9/183 (5%)
 Frame = +2

Query  101  EMEKKGKSEKRRPKEPWK---GEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLG  271
            E  KK  S K   +E  +   G++V  +V+  LD IVT+F++++  +   LS+G +++LG
Sbjct  19   EETKKAHSHKAFDEEQAQEGHGDYVGDMVYGALDGIVTTFAVVAGAAGAGLSAGIIIILG  78

Query  272  FANLVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELN  451
            FANL+ADG+SM  G+++S  +E+D   +E+    W+V + P    +E+ Q Y+  G    
Sbjct  79   FANLLADGLSMAAGNYLSMKSEQDYFKREREREAWEVENYPEGEVEEIRQIYRRKGFSGQ  138

Query  452  DATTVVTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPIL  631
                +V +      + V   M  + G+  P +K      P K G  T+ AF++ G  P++
Sbjct  139  TLEQLVGLITSKKSVWVDTMMVEELGM-IPAQK-----SPLKAGAYTYFAFLIAGFVPLM  192

Query  632  AFI  640
             F+
Sbjct  193  VFV  195



>ref|XP_636071.1| transmembrane protein [Dictyostelium discoideum AX4]
 gb|EAL62565.1| transmembrane protein [Dictyostelium discoideum AX4]
Length=356

 Score = 82.8 bits (203),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 65/223 (29%), Positives = 115/223 (52%), Gaps = 25/223 (11%)
 Frame = +2

Query  110  KKGKSEKRRPKEPWKGEFVRSIVFAGLDAIVTSF-SLISSISAGRLSSGDVLVLGFANLV  286
            +K K EK   K+ +  ++++SI++ G+D +V+ F S+  S S+       +L++  + LV
Sbjct  104  RKPKIEK---KQSFLSKYLKSIIYGGMDGLVSIFVSIAVSFSSSDAKISVLLIIVLSKLV  160

Query  287  ADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTV  466
            A  ISMG GD++ T  + D    E+    W+V +     + E+++ Y   G+    A  V
Sbjct  161  AGAISMGMGDYLGTQADIDFARGERKREAWEVEYYLEGEKSEMVEIYTKKGIPEEVAREV  220

Query  467  VTIFA----KYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILA  634
            V I +     ++D+++ E++     + S          PWKNGL+ F +FV FG  P+L 
Sbjct  221  VDILSLNPKGFVDVMMVEELGIMPDVES--------QTPWKNGLVNFTSFVFFGILPLLP  272

Query  635  FIIL--------IPFTQNVTHKFMaacalsalaltllGIAKAK  739
            ++          IP  Q++ + F+    ++AL L L+GI KAK
Sbjct  273  YLAFLAIATVAKIPSDQHL-YLFLIVIGITALTLFLIGIFKAK  314



>ref|WP_016415422.1| hypothetical protein [Halomonas anticariensis]
 gb|EPC03308.1| hypothetical protein L861_17345 [Halomonas anticariensis FP35 
= DSM 16096]
Length=252

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 53/197 (27%), Positives = 94/197 (48%), Gaps = 9/197 (5%)
 Frame = +2

Query  92   EDGEMEKKGKSEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLG  271
            E  E E + +   RR  +P K + +   +  G+D  VT+F+++S       S+   LVLG
Sbjct  7    ESLEREHRPEEISRRLDKPPKVQTLPDAILGGIDGCVTTFAVVSGAFGAGFSATVALVLG  66

Query  272  FANLVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELN  451
            FANL+ADG SM   ++ S   +R+ +   +      +   P   + E+ Q +Q  G +  
Sbjct  67   FANLLADGFSMAISNYESIQAQREYIDDIRESERHHIDMVPEGERDEIRQIFQRKGFDGE  126

Query  452  DATTVVTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPIL  631
                VV + ++  ++ V   +  + GL       K    P ++ L TF AF++ G  P+L
Sbjct  127  TLERVVEVISQDREVWVDTMLTEEHGLQ------KMGLSPMRSALTTFVAFLIVGAMPLL  180

Query  632  AFIILIPFTQNVTHKFM  682
             +   +PF  + T +F+
Sbjct  181  PYA--VPFL-DTTRQFL  194



>gb|AJE46925.1| hypothetical protein P73_2210 [Celeribacter indicus]
Length=231

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 57/180 (32%), Positives = 86/180 (48%), Gaps = 23/180 (13%)
 Frame = +2

Query  122  SEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAG------RLSSGDVLVLGFANL  283
            SE RR        +++ IV+ G D IVT+F++++  +        R+ +  VLV G ANL
Sbjct  5    SEYRR--------YLKQIVYGGNDGIVTTFAIVAGFAGAGAEGAERIGTLAVLVFGLANL  56

Query  284  VADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATT  463
             AD  SMG G+F+S                  +   P      L +H +A G+   DATT
Sbjct  57   FADAASMGLGEFLSARA----ARDLIRRRRRALCEAPSEQVSRLARHLRAKGLSTLDATT  112

Query  464  VVTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFII  643
            +  + AK  D+L    +   +G   P   G+ P   W   L+TFAAFV FG  P+L +++
Sbjct  113  MAALAAKSPDLLSGMILTQVEGREDP---GEGPL--WPRALVTFAAFVAFGAIPLLPYLL  167



>gb|EAU51298.1| hypothetical protein OM2255_03492 [alpha proteobacterium HTCC2255]
Length=245

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 55/186 (30%), Positives = 88/186 (47%), Gaps = 15/186 (8%)
 Frame = +2

Query  107  EKKGKSEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGD------VLVL  268
            E KG+     P      EF++ I++ G D IVT+F++++  +              VL+ 
Sbjct  10   EHKGREHHISPV----AEFIKQIIYGGNDGIVTTFAVVAGFAGAGAGGIAEIGGIAVLLF  65

Query  269  GFANLVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMEL  448
            G ANL ADG +MG G+F+S  +E+D+    +    +++ + P   + E ++  Q  G  L
Sbjct  66   GLANLFADGAAMGLGEFLSARSEQDLYHSVREKELFEIKNNPEMERIEAIEMLQDRGFSL  125

Query  449  NDATTVVTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPI  628
            N A  +  I   Y D      MA +  ++ P         P  NGL TF AF+ FG  P+
Sbjct  126  NHAKEMTDILEHYPDHYADFMMAYEIQMADP-----NGENPILNGLATFLAFLCFGIIPL  180

Query  629  LAFIIL  646
            L + I 
Sbjct  181  LPYFIF  186



>ref|WP_040780276.1| GMP synthase [Rhodobacterales bacterium HTCC2255]
Length=238

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 55/186 (30%), Positives = 88/186 (47%), Gaps = 15/186 (8%)
 Frame = +2

Query  107  EKKGKSEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGD------VLVL  268
            E KG+     P      EF++ I++ G D IVT+F++++  +              VL+ 
Sbjct  3    EHKGREHHISPV----AEFIKQIIYGGNDGIVTTFAVVAGFAGAGAGGIAEIGGIAVLLF  58

Query  269  GFANLVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMEL  448
            G ANL ADG +MG G+F+S  +E+D+    +    +++ + P   + E ++  Q  G  L
Sbjct  59   GLANLFADGAAMGLGEFLSARSEQDLYHSVREKELFEIKNNPEMERIEAIEMLQDRGFSL  118

Query  449  NDATTVVTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPI  628
            N A  +  I   Y D      MA +  ++ P         P  NGL TF AF+ FG  P+
Sbjct  119  NHAKEMTDILEHYPDHYADFMMAYEIQMADP-----NGENPILNGLATFLAFLCFGIIPL  173

Query  629  LAFIIL  646
            L + I 
Sbjct  174  LPYFIF  179



>gb|KFM14568.1| VIT domain containing protein [Marine Group I thaumarchaeote 
SCGC AAA799-D11]
Length=226

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 57/203 (28%), Positives = 101/203 (50%), Gaps = 7/203 (3%)
 Frame = +2

Query  176  VFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTSTERDVVAK  355
            ++  +D  VT+F++++ +    LS G +L+LGFANL ADG SM   +F ++    + +  
Sbjct  9    IYGSIDGAVTTFAIVAGVVGAGLSPGTILILGFANLFADGFSMAAANFQASKARNEFIQM  68

Query  356  EKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKYMDILVAEKMAAKKGLS  535
            ++   EW++ +     ++E+   Y+  G +      +V I      + V   M  + GL 
Sbjct  69   KRKQEEWEIDNLEDQEKEEIRDIYRKKGFKDELLEEIVRIITSRRKVWVDTMMKEELGL-  127

Query  536  SPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFIILIPFTQNV-THKFMaacalsalal  712
              +E  KKP     + + TF  F V G  P++ FI+   F  N+ +  F+ +    A+A 
Sbjct  128  --IEDEKKPV---DSSVSTFVGFNVIGVIPLIPFIMFFSFDLNLGSDAFLYSTISVAIAF  182

Query  713  tllGIAKAKIASQSYTVSVAITL  781
             ++G+ KAKI  +S   S   TL
Sbjct  183  FVVGMIKAKIVKKSKIRSGIYTL  205



>ref|WP_036559509.1| GMP synthase [Oceanicola sp. MCTG156(1a)]
Length=238

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/177 (28%), Positives = 85/177 (48%), Gaps = 11/177 (6%)
 Frame = +2

Query  158  EFVRSIVFAGLDAIVTSFSLISSISAG------RLSSGDVLVLGFANLVADGISMGFGDF  319
            +F++ IV+ G D IVT+F+++S  +        ++ +  VLV G ANL ADG+SMG G+F
Sbjct  15   QFLKQIVYGGNDGIVTTFAVVSGFAGASADGVAQIGALAVLVFGLANLFADGVSMGLGEF  74

Query  320  VSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKYMDIL  499
            +S  +++ +    +   +  +   P     EL   +   GM  +DA     +     ++ 
Sbjct  75   LSARSQKKLYTARRRDLQARIRQAPDDAADELAAQFIQRGMTPDDAARAAGLLQGDANVT  134

Query  500  VAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFIILIPFTQNVT  670
                M   +   +P +      +   NGL+TF AF+ FG  P+  + I    T+N T
Sbjct  135  TDLLMQWSEDQPAPTDD-----RAGMNGLVTFLAFIAFGSIPLAPYFIDTSGTRNFT  186



>ref|XP_007051949.1| Uncharacterized protein TCM_005437 [Theobroma cacao]
 gb|EOX96106.1| Uncharacterized protein TCM_005437 [Theobroma cacao]
Length=200

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 70/125 (56%), Gaps = 15/125 (12%)
 Frame = +2

Query  128  KRRPKEP-WKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISM  304
            K RP+EP WKGE V+SIV+AGL AIVT FS ISS+SA +LS G            D    
Sbjct  25   KTRPREPYWKGETVKSIVYAGLVAIVTYFSPISSVSASQLSFGK---------WRDITEP  75

Query  305  GFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQ---HYQALGMELNDATTVVTI  475
              GDF+STST++D+  KE+ V EWD +        + L+   H +  G   ND    ++I
Sbjct  76   SLGDFLSTSTKKDLAVKERAVTEWDAIKDQQQQLLQHLRIPWHGRRRGQHDND--LAISI  133

Query  476  FAKYM  490
             A +M
Sbjct  134  GACFM  138



>ref|WP_022947416.1| membrane protein [Methylohalobius crimeensis]
Length=253

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 70/252 (28%), Positives = 129/252 (51%), Gaps = 17/252 (7%)
 Frame = +2

Query  107  EKKGKSEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLV  286
            E   ++ K+R + P + ++V   +  G+D  VT+F+++S       S+   LVLGFANL+
Sbjct  12   EHHPEAIKQRLQGPPRPQYVSDAILGGIDGCVTTFAVVSGAVGAGFSATVALVLGFANLL  71

Query  287  ADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTV  466
            ADG SM   ++ S   + +     +   E  +   P   ++E+ Q ++  G E      +
Sbjct  72   ADGFSMAVSNYESIKAQSEFEESVQRTEEEHIDRIPEGEREEIRQIFRQKGFEGEILAQI  131

Query  467  VTIFAK----YMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILA  634
            V    +    +++ ++AE+   +KG  SPL          ++ + TFAAF++ G  P++ 
Sbjct  132  VETITQDRRLWIETMLAEEHGIRKGGPSPL----------RSAVTTFAAFLIVGAVPLIP  181

Query  635  FIILIPFTQNVTHKFMaacalsalaltllGIAKAKIASQSYTVSVAITLSNgaiagasay  814
            F  L+P    +  +F+A+  L+AL   L+G+ K+ + ++   +S   TL  G+ A A A+
Sbjct  182  F--LLP-GWEMQRQFIASSILAALMFCLIGMLKSLVFAKPIFISGINTLLTGSAAAALAF  238

Query  815  aigWTLRNVAGL  850
              G+ LR V G+
Sbjct  239  LTGYLLRGVFGI  250



>gb|AIC14579.1| vacuolar iron transporter family protein [Nitrososphaera viennensis 
EN76]
Length=227

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 44/161 (27%), Positives = 79/161 (49%), Gaps = 6/161 (4%)
 Frame = +2

Query  164  VRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTSTERD  343
            +   V+   D  VT+F++++ +    LS   VL+LGFANL ADG SM  G++++T ++++
Sbjct  5    LEDFVYGATDGAVTTFAIVAGVVGASLSPAIVLILGFANLFADGFSMAVGNYLATKSQKE  64

Query  344  VVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKYMDILVAEKMAAK  523
             + + +   EW++ H     +QE+   Y   G +      +V I      + +   M  +
Sbjct  65   AIERARQREEWEIDHLADQEKQEIRDIYAKKGFKDEILEEIVRIITSRRKVWLDTMMKEE  124

Query  524  KGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFIIL  646
             GL           +P    + TFAAF   G  P+L F+++
Sbjct  125  LGLVD------DKRRPLDTAITTFAAFNAIGFIPLLPFVVV  159



>ref|WP_037259766.1| membrane protein [Roseivivax halodurans]
 gb|ETX15594.1| membrane protein [Roseivivax halodurans JCM 10272]
Length=248

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 55/188 (29%), Positives = 96/188 (51%), Gaps = 22/188 (12%)
 Frame = +2

Query  122  SEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGIS  301
            +E RRP        +   V+  +D  VT+F++++ +    L +  VL+LG ANL+ADG+S
Sbjct  25   AEARRPGH------LGDAVYGAIDGSVTTFAIVAGVQGAELPTSVVLILGLANLLADGVS  78

Query  302  MGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGME---LNDATTVVT  472
            M  G++ +   E + V++ + V    +   P   ++EL Q   A G+    L DA + + 
Sbjct  79   MALGNYAANRAEAEEVSRLRDVEGRHIDTVPEGEREELRQILAAKGLAGSVLEDAVSQIG  138

Query  473  IFAK-YMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFIILI  649
               + ++D+++ ++    K LS P  +           L+TFAAFV  G  P+L F+I +
Sbjct  139  ARREAWIDLMLTDEYG--KSLSPPRAR--------SAALVTFAAFVAAGSVPLLPFVIGV  188

Query  650  --PFTQNV  667
              PF  +V
Sbjct  189  AQPFLVSV  196



>gb|KER06784.1| integral membrane protein [Marine Group I thaumarchaeote SCGC 
AAA799-E16]
Length=226

 Score = 79.3 bits (194),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 57/203 (28%), Positives = 101/203 (50%), Gaps = 7/203 (3%)
 Frame = +2

Query  176  VFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTSTERDVVAK  355
            ++  +D  VT+F++++ +    LS G +L+LGFANL ADG SM   +F ++    + +  
Sbjct  9    IYGSIDGAVTTFAIVAGVVGAGLSPGIILILGFANLFADGFSMAAANFQASKARNEFIQM  68

Query  356  EKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKYMDILVAEKMAAKKGLS  535
            ++   EW++ +     ++E+   Y+  G +      +V I      + V   M  + GL 
Sbjct  69   KRKQEEWEIDNLEDQEKEEIRDIYRKKGFKDELLEEIVRIITSRRKVWVDTMMKEELGL-  127

Query  536  SPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFIILIPFTQNV-THKFMaacalsalal  712
              +E  KKP     + + TF  F V G  P++ FI+   F  N+ +  F+ +    A+A 
Sbjct  128  --IEDEKKPV---DSSVSTFVGFNVIGVIPLIPFIMFFSFDLNLGSDAFLYSTISVAIAF  182

Query  713  tllGIAKAKIASQSYTVSVAITL  781
             ++G+ KAKI  +S   S   TL
Sbjct  183  FVVGMIKAKIVKKSKIRSGIYTL  205



>ref|WP_020414113.1| hypothetical protein [Microbulbifer variabilis]
Length=255

 Score = 79.3 bits (194),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 63/241 (26%), Positives = 110/241 (46%), Gaps = 18/241 (7%)
 Frame = +2

Query  83   GSVEDGEMEKKGKSEKRRP--------KEPWKGEFVRSIVFAGLDAIVTSFSLISSISAG  238
            G  E  +  ++   E+ RP        KEP + + V   V   +D  VT+F++++     
Sbjct  3    GREEKSKQSRRALLEEHRPERIHARLGKEP-RSQRVSDFVLGAIDGCVTTFAIVAGAFGA  61

Query  239  RLSSGDVLVLGFANLVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELL  418
              +   VLV+GFANL+ADG SM   ++ + S ERD  A         +   P   ++E+ 
Sbjct  62   GFTESVVLVMGFANLIADGFSMAVSNYEAVSVERDQAAAAARTERQHIDLVPEGEREEIR  121

Query  419  QHYQALGMELNDATTVVTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFA  598
            Q +Q  G +      VV        + +   +A + G+S      +   +P  + ++TF 
Sbjct  122  QIFQRKGFQGQVLDEVVATITANRQLWIDTMLAEEYGIS------RSARRPLGSAIVTFL  175

Query  599  AFVVFGCAPILAFIILIPFTQNVTHKFMaacalsalaltllGIAKAKIASQSYTVSVAIT  778
            AF+  G  P+L ++I  P     + +F ++ AL+A     +G+ K  + SQ    + A T
Sbjct  176  AFIGVGAVPLLPYLIR-PL--ETSEQFYSSAALAACTFFAIGLCKGLVFSQRVLAAGAKT  232

Query  779  L  781
            L
Sbjct  233  L  233



>ref|WP_020591539.1| hypothetical protein [Kiloniella laminariae]
Length=240

 Score = 79.0 bits (193),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 51/184 (28%), Positives = 96/184 (52%), Gaps = 12/184 (7%)
 Frame = +2

Query  101  EMEKKGKSEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFAN  280
            E +    + + R  E     ++R  V+  +D  VT+F+++S +   +LS   +L+LG AN
Sbjct  4    EHDHSQTAIRARLAEETSVNYLRDWVYGSIDGAVTTFAVVSGVVGAQLSLRVILILGVAN  63

Query  281  LVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGME---LN  451
            L+ADG SM  G++ +T +E D   + + +    +   P   ++E+ Q   A G+    L 
Sbjct  64   LLADGFSMAAGNYSATKSELDDAERLREIERKHIRQVPEGEREEIRQILIAKGLRGHTLE  123

Query  452  DATTVVTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPIL  631
            +AT  +T      ++ +   +A + G+ SP+ +      P ++ L+TF+AF + G  P+L
Sbjct  124  EATDAIT---SNEELWINTMLAEEYGI-SPVSR-----NPLRSALVTFSAFFLCGAIPLL  174

Query  632  AFII  643
             FI+
Sbjct  175  PFIL  178



>ref|WP_015019505.1| membrane protein [Candidatus Nitrososphaera gargensis]
 ref|YP_006862627.1| vacuolar iron transporter family protein [Candidatus Nitrososphaera 
gargensis Ga9.2]
 gb|AFU58970.1| vacuolar iron transporter family protein [Candidatus Nitrososphaera 
gargensis Ga9.2]
Length=227

 Score = 79.0 bits (193),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 47/157 (30%), Positives = 81/157 (52%), Gaps = 6/157 (4%)
 Frame = +2

Query  176  VFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTSTERDVVAK  355
            V+   D  VT+F++++ +    LS   VL+LGFANL+ADG SM  G++++T  +R+ + K
Sbjct  9    VYGATDGAVTTFAVVAGVIGASLSPSIVLILGFANLLADGFSMAVGNYLATKAQREYIEK  68

Query  356  EKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKYMDILVAEKMAAKKGLS  535
             +   EW++ +     +QE+   Y   G +      VV +      + +   M  + GL 
Sbjct  69   ARKREEWEIDNLVEQEKQEIRDIYAKKGFKDELLNEVVRVIISCRKVWIDTMMREELGL-  127

Query  536  SPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFIIL  646
              +E  K+P       + TFAAF   G  P+L F+++
Sbjct  128  --IEDSKRPRDA---AVTTFAAFNAVGLIPLLPFVVM  159



>ref|WP_009578995.1| hypothetical protein [Fulvivirga imtechensis]
 gb|ELR72406.1| hypothetical protein C900_01562 [Fulvivirga imtechensis AK7]
Length=245

 Score = 79.0 bits (193),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 62/229 (27%), Positives = 108/229 (47%), Gaps = 10/229 (4%)
 Frame = +2

Query  110  KKGKSEKRRPKEP----WKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFA  277
            K+  SE R  +E     +   ++   V+ G+D  +T+F++++  +        VL+ GFA
Sbjct  2    KQAISESRLHQEGKLWLFDKNYISEFVYGGIDGAITTFAVVAGAAGANADLYWVLIFGFA  61

Query  278  NLVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDA  457
            NL+ADG SM  G+F S   ERD   K K +  W++ +      QE+   Y A G +    
Sbjct  62   NLIADGFSMSVGNFFSVKAERDNFEKHKAIEYWEIENLRNREVQEIRDIYAAKGFKGELL  121

Query  458  TTVVTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAF  637
              VV +     D+ V   M         LE  K    P+K    TF +F + G  P+L++
Sbjct  122  EQVVAVITADKDVWVDTMM------KEELEMTKDDKTPYKTAGATFLSFNLVGVIPLLSY  175

Query  638  IILIPFTQNVTHKFMaacalsalaltllGIAKAKIASQSYTVSVAITLS  784
            ++ +    +    F+ +C  + LAL ++G  K+ +  +  +V +  TL+
Sbjct  176  VMAVFVDIDKDKLFLTSCIATGLALVIVGYLKSIVTQKRVSVGILETLA  224



>ref|WP_036220716.1| membrane protein [Maritalea myrionectae]
Length=242

 Score = 78.2 bits (191),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 45/164 (27%), Positives = 84/164 (51%), Gaps = 6/164 (4%)
 Frame = +2

Query  161  FVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTSTER  340
            ++R  ++ G+D  VT+F++++ +    LS+G V+VLG ANL+ADG SM   ++  T  E 
Sbjct  25   YLRDWIYGGIDGAVTTFAIVAGVVGAELSAGVVVVLGIANLLADGFSMAASNYSGTKAEI  84

Query  341  DVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKYMDILVAEKMAA  520
            D   +   V +  +   P   ++E+ Q +   G    +   +V +   + D+ +   MA 
Sbjct  85   DDYNRVLEVEKRHIRQHPEGEREEVRQIFANKGYSGEELEEIVNLITTHEDMWLETMMAE  144

Query  521  KKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFIILIP  652
            + GLS+          P +  L TF AF++ G  P++ + + +P
Sbjct  145  EYGLSNVQR------SPIRAALATFWAFLLCGAVPLVPYFLGLP  182



>gb|AIF82981.1| putative membrane protein [Candidatus Nitrososphaera evergladensis 
SR1]
Length=228

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/155 (29%), Positives = 79/155 (51%), Gaps = 6/155 (4%)
 Frame = +2

Query  176  VFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTSTERDVVAK  355
            V+   D  VT+F++++ +    LS   VL+LGFANL ADG SM  G++++T ++++ + +
Sbjct  9    VYGATDGAVTTFAVVAGVVGASLSPAIVLILGFANLFADGFSMAVGNYLATKSQKEAIER  68

Query  356  EKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKYMDILVAEKMAAKKGLS  535
             +   EW++ H     +QE+   Y   G +      +V I      + +   M  + GL 
Sbjct  69   ARQREEWEIDHLADQEKQEIRDIYAKKGFKDELLEEIVRIITSRRKVWLDTMMKEELGL-  127

Query  536  SPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFI  640
              +E  ++P       + TFAAF   G  P+L F+
Sbjct  128  --IEDRRRPI---DTAVTTFAAFNAIGVIPLLPFV  157



>gb|EKD64991.1| protein of unknown function DUF125 transmembrane [uncultured 
bacterium]
Length=264

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/167 (28%), Positives = 94/167 (56%), Gaps = 13/167 (8%)
 Frame = +2

Query  155  GEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTST  334
            G+++   ++   D I+T+F++I+      L+   +++LGFANL+ADGISMG  +F+   +
Sbjct  44   GKYIGDFIYGANDGIITTFAVIAGSFGASLTPMVIIILGFANLLADGISMGASNFLGRKS  103

Query  335  ERDVVAKEKIVAEWDVMHTPIALQQELLQHYQA---LGMELNDATTVVTIFAK-YMDILV  502
            E+D    ++   EW++ H      +E+ + Y+    +G +L  A  ++T   K ++D ++
Sbjct  104  EQDYAQAQRQKEEWEIDHLREIEVEEIREIYERKGFVGKDLERAVEIITSDKKVWLDTMM  163

Query  503  AEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFII  643
             +++   +         +K   P ++GL TFA+FVV G  P+L +++
Sbjct  164  RDELNIIE---------EKNNDPVRHGLATFASFVVAGLFPLLPYLV  201



>ref|WP_036862056.1| membrane protein [Porticoccus hydrocarbonoclasticus]
Length=247

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/164 (30%), Positives = 86/164 (52%), Gaps = 14/164 (9%)
 Frame = +2

Query  161  FVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTSTER  340
            +VR  ++  +D  +T+F++++ ++   LSS  +++LGFANL+ADG SM   +++ T  E 
Sbjct  25   YVRDFIYGAVDGAITTFAIVAGVAGAGLSSSVIIILGFANLLADGFSMAVSNYLGTRAEN  84

Query  341  DVVAKEKIVAEWDVMHTPIALQQELLQHYQALGME---LNDATTVVTIFAK-YMDILVAE  508
                K +     ++   P    +E+ Q Y   G E   L+DA  V+T   K ++D +V E
Sbjct  85   QHRIKIRNRELEEIKRFPEGEVEEIRQIYARKGFEGRILDDAVDVITSDEKTWVDTMVQE  144

Query  509  KMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFI  640
            +     GLS       +   P K GL TF AF + G  P++ ++
Sbjct  145  EF----GLS------LQSHDPLKAGLATFGAFCLVGFIPLMTYV  178



>ref|WP_029066505.1| membrane protein [Labrenzia sp. DG1229]
Length=243

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/161 (29%), Positives = 85/161 (53%), Gaps = 6/161 (4%)
 Frame = +2

Query  161  FVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLVADGISMGFGDFVSTSTER  340
            ++R  ++ G+D  VT+F++++      LS   +L+LG ANL+ADG SM   ++  + +E 
Sbjct  27   YLRDWIYGGIDGAVTTFAIVAGAVGAALSPKIILILGVANLLADGFSMAAANYSGSKSET  86

Query  341  DVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTVVTIFAKYMDILVAEKMAA  520
            +  A+   + E  +   P   ++E+ Q +++ G + +D   +V +        +   M +
Sbjct  87   EDYARLMAIEEKHIAVAPEGEKEEIRQIFRSKGYQGSDLDDLVRLVTSNRTTWIETMMQS  146

Query  521  KKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFII  643
            + GLS+          P+K  L TFAAFVV G  P+L F++
Sbjct  147  EYGLSAATR------SPFKAALATFAAFVVCGSLPLLPFLM  181



>ref|WP_018697798.1| hypothetical protein [Amorphus coralli]
Length=239

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 49/186 (26%), Positives = 92/186 (49%), Gaps = 6/186 (3%)
 Frame = +2

Query  95   DGEMEKKGKSEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGF  274
            D E     ++ +RR  +     ++R  V+ G+D  VT+F++++       S+  +L+LG 
Sbjct  2    DTEHSHSPEAIERRLADGPSVSYLRDWVYGGIDGTVTTFAVVAGSLGADFSARVMLILGV  61

Query  275  ANLVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELND  454
            ANL+ADG SM   ++ ++  +++   + + V    V   P   +QE+ Q ++  G E   
Sbjct  62   ANLLADGFSMAAANYSASRADQEDYRRLRAVELRHVRTEPDGERQEIRQIFKNKGYEGKA  121

Query  455  ATTVVTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILA  634
               +V +  +  D+ +   +A + G S+        A P K    TFA+FVV G  P+  
Sbjct  122  LEEMVALITERQDVWIDTMLAEEYGRST------VQADPRKTAAATFASFVVCGSLPLAP  175

Query  635  FIILIP  652
            F++ +P
Sbjct  176  FVLGLP  181



>ref|WP_023434145.1| hypothetical protein [Lutibaculum baratangense]
 gb|ESR22899.1| hypothetical protein N177_4036 [Lutibaculum baratangense AMV1]
Length=240

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 53/177 (30%), Positives = 90/177 (51%), Gaps = 14/177 (8%)
 Frame = +2

Query  101  EMEKKGKSEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFAN  280
            E +   ++  RR  E  +  +VR  V+  +D  VT+F++++      LS   V++LG AN
Sbjct  5    EHDHSPQAIARRLAEGPRVSYVRDWVYGAIDGAVTTFAIVAGAIGAELSPRVVIILGVAN  64

Query  281  LVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGME---LN  451
            L+ADG SM   ++  T  ER+  A+ + +    V   P   ++E+ Q Y A G E   L 
Sbjct  65   LLADGFSMAAANYSGTQAEREGYARLREMEARHVAEAPDGEREEIRQIYAARGFEGRSLR  124

Query  452  DATTVVTIFAK-YMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGC  619
            D   +VT   K ++D ++ E    + G+ SP+++      PW+   +T  AFV+ G 
Sbjct  125  DIVRLVTAREKTWIDTMMLE----EHGM-SPVQR-----SPWRAAAVTMLAFVLAGS  171



>gb|KHQ55340.1| Integral membrane protein [Ponticoccus sp. UMTAT08]
Length=237

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 49/185 (26%), Positives = 91/185 (49%), Gaps = 11/185 (6%)
 Frame = +2

Query  101  EMEKKGKSE----KRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVL  268
            ++ + G SE    +R    P +G+ +   V+  +D  VT+F++++ ++   LS   ++ L
Sbjct  2    DLPEHGHSEGEIAERLAHPPGRGD-LSDAVYGAIDGCVTTFAIVAGVAGAGLSPFVIVAL  60

Query  269  GFANLVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMEL  448
            G AN++ADG SM  G++ +T  +RD   + + + E  +   P   ++EL +  +  G+  
Sbjct  61   GLANVLADGFSMAAGNYSATKADRDNKLRLRQIEERHIRLYPDGERRELREILRQKGLSG  120

Query  449  NDATTVVTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPI  628
                  V   AK   I +   +  + G+      G     P +  L+TF AF+V G  P+
Sbjct  121  ATLDDAVEQIAKNRQIWIETMLEGEYGI------GSVDPHPMRAALVTFGAFLVAGAVPL  174

Query  629  LAFII  643
            L F+I
Sbjct  175  LPFLI  179



>ref|WP_021819003.1| hypothetical protein [Halomonas sp. BJGMM-B45]
 gb|ERL51391.1| hypothetical protein BJB45_14480 [Halomonas sp. BJGMM-B45]
Length=250

 Score = 76.3 bits (186),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 50/179 (28%), Positives = 84/179 (47%), Gaps = 6/179 (3%)
 Frame = +2

Query  107  EKKGKSEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFANLV  286
            + +  + +RR   P +       V  G+D  VT+F+++SS      S    LVLG ANL+
Sbjct  12   DHRPAAVRRRLMAPVRASVFPDAVLGGIDGCVTTFAVVSSAFGAGFSPQVALVLGAANLI  71

Query  287  ADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDATTV  466
            ADG SM   ++ +   +   VA  +      +   P   ++E+ Q ++A G E      V
Sbjct  72   ADGFSMAVSNYEAGQAQLAHVASAERTERQHIALVPEGEREEVRQLFRAKGFEGELLEQV  131

Query  467  VTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFII  643
            V    +  DI V+  +  + GLS+      +   P +  L TF+ F+V G  P+L ++I
Sbjct  132  VDTLCRDPDIWVSTMLREEYGLST------EGVSPLRAALATFSTFIVIGSIPLLPYLI  184



>ref|WP_020530729.1| hypothetical protein [Flexithrix dorotheae]
Length=244

 Score = 76.3 bits (186),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 56/181 (31%), Positives = 91/181 (50%), Gaps = 10/181 (6%)
 Frame = +2

Query  101  EMEKKGKSEKRRPKEPWKGEFVRSIVFAGLDAIVTSFSLISSISAGRLSSGDVLVLGFAN  280
            E +K G +      + + GEFV    + G+D  VT+F++++  +   L +  V++LGFAN
Sbjct  6    ENKKHGNNSFLAKYQDYLGEFV----YGGIDGSVTTFAVVAGAAGAGLDASVVIILGFAN  61

Query  281  LVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELLQHYQALGMELNDAT  460
            L+ADG SM  G ++S  +E++  AK + +  W+V H P   + E+ + YQ  G +     
Sbjct  62   LIADGFSMSVGSYLSNKSEKENYAKHEKIEYWEVEHIPEEEEMEIREIYQKKGFKGELLE  121

Query  461  TVVTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFAAFVVFGCAPILAFI  640
             VVT+  K     V E M         LE       P   G +TF AF+V G  P+  ++
Sbjct  122  QVVTVITKDKKRWVDEMM------KDELEMMPSNKSPLSMGAVTFLAFIVVGFIPLFVYV  175

Query  641  I  643
            +
Sbjct  176  L  176



>ref|XP_004035612.1| hypothetical protein IMG5_095220 [Ichthyophthirius multifiliis]
 gb|EGR32126.1| hypothetical protein IMG5_095220 [Ichthyophthirius multifiliis]
Length=244

 Score = 75.5 bits (184),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 50/195 (26%), Positives = 92/195 (47%), Gaps = 48/195 (25%)
 Frame = +2

Query  83   GSVEDGEMEKKGKS--EKRRP------KEPWKGEFVRSIVFAGLDAIVTSFSLISSISAG  238
            G+VE  ++  +  +   + RP           G +++S V+ GLD ++T++S++  ++  
Sbjct  16   GNVEQMKIAHRNNTIENEERPLTQQIEDHNQSGTYIKSAVYGGLDGMITTYSVVMGVAGA  75

Query  239  RLSSGDVLVLGFANLVADGISMGFGDFVSTSTERDVVAKEKIVAEWDVMHTPIALQQELL  418
             L++  VL LG ANL+ DG+SM  GD++ST         +++ AE               
Sbjct  76   SLANVVVLALGIANLIGDGLSMALGDYLST---------KRLSAE---------------  111

Query  419  QHYQALGMELNDATTVVTIFAKYMDILVAEKMAAKKGLSSPLEKGKKPAKPWKNGLITFA  598
                       D+ T++ I +K   + V   M  + G+    ++      P KN ++TF 
Sbjct  112  -----------DSKTIIDILSKNKKVWVDAMMVEELGMLPSDDE-----NPIKNAIVTFF  155

Query  599  AFVVFGCAPILAFII  643
            +F +FG  PI+ FI+
Sbjct  156  SFALFGLVPIIPFIV  170



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1740960733735