BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c10458_g2_i1 len=524 path=[381:0-523]

Length=524
                                                                      Score     E

ref|XP_010096378.1|  hypothetical protein L484_021126                   135   2e-37   
ref|XP_011071014.1|  PREDICTED: transcription factor PRE6-like          137   3e-37   
ref|XP_004238782.1|  PREDICTED: transcription factor PRE6-like          134   4e-37   
emb|CDP00307.1|  unnamed protein product                                134   4e-37   
ref|XP_011075476.1|  PREDICTED: transcription factor PRE6               134   5e-37   
ref|XP_002276549.1|  PREDICTED: transcription factor PRE6               134   1e-36   Vitis vinifera
gb|EYU22434.1|  hypothetical protein MIMGU_mgv1a017116mg                133   1e-36   
gb|KDP41169.1|  hypothetical protein JCGZ_15576                         132   2e-36   
ref|XP_002520108.1|  transcription regulator, putative                  132   3e-36   Ricinus communis
ref|XP_007046125.1|  Basic helix-loop-helix DNA-binding superfami...    132   5e-36   
ref|XP_009610531.1|  PREDICTED: transcription factor PRE6-like          130   1e-35   
ref|XP_009777244.1|  PREDICTED: transcription factor PRE6-like          130   2e-35   
ref|XP_003532055.1|  PREDICTED: transcription factor bHLH135            130   2e-35   
ref|XP_010044722.1|  PREDICTED: transcription factor PRE3-like          130   2e-35   
ref|XP_009767697.1|  PREDICTED: transcription factor PRE6-like          130   3e-35   
ref|XP_007153819.1|  hypothetical protein PHAVU_003G067500g             130   3e-35   
ref|XP_007226915.1|  hypothetical protein PRUPE_ppa016030mg             129   4e-35   
ref|XP_009622200.1|  PREDICTED: transcription factor PRE6-like          129   4e-35   
ref|XP_003519021.1|  PREDICTED: transcription factor bHLH135            128   2e-34   
ref|XP_003543767.1|  PREDICTED: transcription factor bHLH135            127   2e-34   
gb|KHG03267.1|  Transcription factor protein                            126   5e-34   
ref|NP_001237910.1|  uncharacterized protein LOC100305611               126   6e-34   
ref|XP_008221650.1|  PREDICTED: transcription factor PRE6-like          126   7e-34   
ref|XP_010242417.1|  PREDICTED: transcription factor PRE6-like          126   7e-34   
ref|XP_003517952.1|  PREDICTED: transcription factor bHLH135-like       126   7e-34   
ref|XP_007157666.1|  hypothetical protein PHAVU_002G088400g             126   8e-34   
ref|XP_003534454.1|  PREDICTED: transcription factor bHLH135            125   1e-33   
ref|XP_006344270.1|  PREDICTED: transcription factor bHLH135-like       125   2e-33   
gb|KFK44602.1|  hypothetical protein AALP_AA1G280300                    125   2e-33   
ref|XP_007139582.1|  hypothetical protein PHAVU_008G041800g             125   2e-33   
ref|XP_003551974.1|  PREDICTED: transcription factor bHLH135-like       125   2e-33   
gb|AFK41511.1|  unknown                                                 124   3e-33   
ref|XP_009110054.1|  PREDICTED: transcription factor PRE6               124   3e-33   
ref|XP_010552588.1|  PREDICTED: transcription factor PRE6               124   4e-33   
emb|CDY28427.1|  BnaC07g12550D                                          124   4e-33   
ref|XP_010256912.1|  PREDICTED: transcription factor ILI6-like          124   4e-33   
ref|XP_006438657.1|  hypothetical protein CICLE_v10033182mg             124   4e-33   
ref|XP_006415982.1|  hypothetical protein EUTSA_v10009197mg             124   5e-33   
ref|NP_849712.1|  basic helix-loop-helix protein KIDARI                 124   5e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004151201.1|  PREDICTED: transcription factor bHLH135-like       124   5e-33   
ref|NP_001241066.1|  uncharacterized protein LOC100784537               124   6e-33   
ref|XP_010550064.1|  PREDICTED: transcription factor PRE5               123   9e-33   
ref|XP_006303467.1|  hypothetical protein CARUB_v10010751mg             123   1e-32   
ref|XP_007032495.1|  Basic helix-loop-helix (bHLH) DNA-binding fa...    123   1e-32   
ref|XP_006827167.1|  hypothetical protein AMTR_s00010p00254240          122   2e-32   
ref|XP_004237036.1|  PREDICTED: transcription factor PRE6-like          122   2e-32   
ref|XP_004233358.1|  PREDICTED: transcription factor PRE6 isoform X2    122   3e-32   
ref|XP_006357115.1|  PREDICTED: transcription factor bHLH135-like       122   3e-32   
ref|XP_009389574.1|  PREDICTED: transcription factor ILI6-like          122   3e-32   
ref|XP_010460241.1|  PREDICTED: transcription factor PRE6-like          122   3e-32   
ref|XP_010551862.1|  PREDICTED: transcription factor PRE1-like          121   5e-32   
ref|XP_008446331.1|  PREDICTED: transcription factor PRE6-like          121   6e-32   
ref|XP_009103115.1|  PREDICTED: transcription factor PRE6-like          121   7e-32   
ref|XP_004297318.1|  PREDICTED: transcription factor bHLH135-like       121   7e-32   
ref|XP_007138203.1|  hypothetical protein PHAVU_009G189200g             120   9e-32   
ref|XP_006482579.1|  PREDICTED: transcription factor bHLH135-like       120   1e-31   
ref|XP_010681766.1|  PREDICTED: transcription factor PRE3-like          120   1e-31   
gb|KDP45499.1|  hypothetical protein JCGZ_09748                         120   1e-31   
ref|XP_003613657.1|  Transcription factor bHLH135                       120   1e-31   
ref|XP_009758713.1|  PREDICTED: transcription factor PRE5-like          120   1e-31   
ref|XP_002323848.2|  hypothetical protein POPTR_0017s11760g             120   1e-31   Populus trichocarpa [western balsam poplar]
ref|XP_008465587.1|  PREDICTED: transcription factor PRE6-like          120   2e-31   
ref|NP_001235265.1|  uncharacterized protein LOC100527636               120   2e-31   
gb|KDO82876.1|  hypothetical protein CISIN_1g041198mg                   120   2e-31   
gb|KHG28499.1|  Transcription factor protein                            120   2e-31   
ref|XP_006431132.1|  hypothetical protein CICLE_v10013209mg             120   2e-31   
gb|AFK36119.1|  unknown                                                 120   2e-31   
gb|KFK33759.1|  hypothetical protein AALP_AA5G056500                    119   2e-31   
ref|XP_004135185.1|  PREDICTED: transcription factor bHLH135-like       120   2e-31   
ref|XP_002511551.1|  transcription regulator, putative                  119   2e-31   Ricinus communis
ref|XP_002517494.1|  transcription regulator, putative                  119   3e-31   Ricinus communis
ref|XP_009805005.1|  PREDICTED: transcription factor PRE1-like          119   3e-31   
ref|XP_010528329.1|  PREDICTED: transcription factor PRE5               119   3e-31   
ref|XP_010032347.1|  PREDICTED: transcription factor PRE5-like          119   5e-31   
ref|XP_009115425.1|  PREDICTED: transcription factor PRE6-like          119   5e-31   
ref|XP_002274840.1|  PREDICTED: transcription factor PRE3               119   5e-31   Vitis vinifera
ref|XP_002283094.1|  PREDICTED: transcription factor PRE6               119   5e-31   Vitis vinifera
ref|XP_004296550.1|  PREDICTED: transcription factor bHLH135-like       119   7e-31   
ref|XP_004146747.1|  PREDICTED: transcription factor bHLH135-like       118   1e-30   
ref|XP_010102446.1|  hypothetical protein L484_006129                   118   1e-30   
ref|XP_010066932.1|  PREDICTED: transcription factor PRE6               118   1e-30   
ref|XP_007037282.1|  Activation-tagged BRI1(brassinosteroid-insen...    118   1e-30   
ref|XP_009602440.1|  PREDICTED: transcription factor PRE5-like          118   1e-30   
ref|XP_003527066.1|  PREDICTED: transcription factor bHLH135            117   1e-30   
emb|CDP02219.1|  unnamed protein product                                117   1e-30   
ref|XP_003621179.1|  Transcription factor style2.1                      117   2e-30   
ref|XP_010693223.1|  PREDICTED: transcription factor PRE6               117   2e-30   
ref|XP_008339920.1|  PREDICTED: transcription factor PRE6-like          117   2e-30   
ref|NP_974372.1|  protein PACLOBUTRAZOL RESISTANCE 5                    117   2e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004499430.1|  PREDICTED: transcription factor bHLH135-like       117   2e-30   
gb|KEH24995.1|  transcription factor                                    117   2e-30   
ref|XP_011044025.1|  PREDICTED: transcription factor PRE3-like          117   2e-30   
ref|XP_007210171.1|  hypothetical protein PRUPE_ppa018631mg             117   2e-30   
ref|XP_008389506.1|  PREDICTED: transcription factor PRE6-like          117   3e-30   
emb|CAN67278.1|  hypothetical protein VITISV_022020                     117   3e-30   Vitis vinifera
ref|XP_006439625.1|  hypothetical protein CICLE_v10023072mg             117   3e-30   
ref|XP_008459306.1|  PREDICTED: transcription factor PRE6-like          117   3e-30   
ref|XP_009111609.1|  PREDICTED: transcription factor PRE5               117   3e-30   
ref|XP_011012195.1|  PREDICTED: transcription factor PRE1-like          116   4e-30   
gb|ABK95506.1|  unknown                                                 116   5e-30   Populus trichocarpa [western balsam poplar]
ref|XP_004138158.1|  PREDICTED: transcription factor bHLH135-like       116   5e-30   
ref|XP_009591471.1|  PREDICTED: transcription factor PRE1-like          116   5e-30   
ref|XP_002305320.1|  hypothetical protein POPTR_0004s13380g             116   5e-30   Populus trichocarpa [western balsam poplar]
ref|XP_004490021.1|  PREDICTED: transcription factor bHLH135-like       116   5e-30   
ref|NP_001234290.1|  transcription factor style2.1                      116   6e-30   
ref|XP_010037162.1|  PREDICTED: transcription factor PRE3-like          116   6e-30   
ref|XP_011013171.1|  PREDICTED: transcription factor PRE1-like          116   6e-30   
ref|XP_007215198.1|  hypothetical protein PRUPE_ppa014004mg             115   9e-30   
ref|XP_009360364.1|  PREDICTED: transcription factor PRE6               115   9e-30   
ref|XP_011047163.1|  PREDICTED: transcription factor PRE3-like          115   1e-29   
ref|XP_008239815.1|  PREDICTED: transcription factor PRE3-like          115   1e-29   
ref|XP_008453188.1|  PREDICTED: transcription factor PRE3-like          115   1e-29   
ref|XP_006395335.1|  hypothetical protein EUTSA_v10005197mg             115   1e-29   
ref|XP_009787611.1|  PREDICTED: transcription factor PRE1-like          115   1e-29   
emb|CDY00110.1|  BnaC09g01910D                                          115   1e-29   
gb|AAM67002.1|  DNA-binding protein-like                                115   2e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008437438.1|  PREDICTED: transcription factor PRE3-like          115   2e-29   
ref|XP_010551523.1|  PREDICTED: transcription factor PRE6-like          115   2e-29   
ref|XP_009610749.1|  PREDICTED: transcription factor PRE3-like          115   2e-29   
ref|XP_004511222.1|  PREDICTED: transcription factor bHLH135-like       114   3e-29   
ref|XP_002318605.1|  bHLH family protein                                114   3e-29   Populus trichocarpa [western balsam poplar]
ref|XP_009369325.1|  PREDICTED: transcription factor PRE3               114   3e-29   
ref|XP_004489383.1|  PREDICTED: transcription factor bHLH135-like       114   3e-29   
ref|XP_006374476.1|  bHLH family protein                                114   5e-29   
ref|XP_004299384.1|  PREDICTED: transcription factor bHLH135-like       113   6e-29   
ref|XP_009129354.1|  PREDICTED: transcription factor PRE5-like          113   6e-29   
ref|XP_010317103.1|  PREDICTED: transcription factor PRE5 isoform X1    114   8e-29   
ref|XP_009151837.1|  PREDICTED: transcription factor PRE5-like          113   9e-29   
gb|AFK43493.1|  unknown                                                 113   1e-28   
emb|CDY65320.1|  BnaC06g42240D                                          113   1e-28   
ref|XP_010531809.1|  PREDICTED: transcription factor PRE5-like          112   1e-28   
ref|XP_004241574.1|  PREDICTED: transcription factor PRE3               112   1e-28   
ref|XP_010435835.1|  PREDICTED: transcription factor PRE1               112   2e-28   
ref|XP_009125118.1|  PREDICTED: transcription factor PRE1               112   2e-28   
ref|XP_010108968.1|  hypothetical protein L484_027163                   112   2e-28   
ref|XP_006292118.1|  hypothetical protein CARUB_v10018314mg             112   2e-28   
ref|XP_009347048.1|  PREDICTED: transcription factor PRE6-like          112   2e-28   
ref|XP_008341557.1|  PREDICTED: transcription factor PRE6-like          112   3e-28   
ref|XP_004152438.1|  PREDICTED: transcription factor bHLH135-like       112   3e-28   
ref|XP_009772499.1|  PREDICTED: transcription factor PRE3-like          112   3e-28   
emb|CDY04040.1|  BnaC02g37550D                                          112   3e-28   
ref|XP_008374533.1|  PREDICTED: transcription factor PRE3-like          111   3e-28   
ref|XP_006284840.1|  hypothetical protein CARUB_v10006122mg             112   3e-28   
ref|XP_002870750.1|  hypothetical protein ARALYDRAFT_916307             111   4e-28   
gb|EYU24397.1|  hypothetical protein MIMGU_mgv1a017140mg                111   4e-28   
ref|XP_010539967.1|  PREDICTED: transcription factor PRE3               111   5e-28   
gb|KFK33185.1|  hypothetical protein AALP_AA6G341300                    110   7e-28   
ref|XP_008379346.1|  PREDICTED: transcription factor PRE1               110   8e-28   
ref|XP_011087224.1|  PREDICTED: transcription factor PRE3               110   8e-28   
ref|XP_004491783.1|  PREDICTED: transcription factor bHLH135-like       110   1e-27   
ref|XP_009386696.1|  PREDICTED: transcription factor ILI6-like          110   1e-27   
emb|CDP12359.1|  unnamed protein product                                110   1e-27   
ref|XP_008385279.1|  PREDICTED: transcription factor PRE3-like          110   1e-27   
ref|XP_009104757.1|  PREDICTED: transcription factor PRE3-like          109   2e-27   
emb|CDX85840.1|  BnaC06g22940D                                          109   2e-27   
ref|NP_198802.1|  bHLH transcription factor PRE1                        109   2e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002877136.1|  transcription regulator                            108   4e-27   
ref|XP_009615362.1|  PREDICTED: transcription factor PRE3-like          108   5e-27   
ref|XP_004293633.1|  PREDICTED: transcription factor bHLH135-like       108   5e-27   
ref|XP_009126035.1|  PREDICTED: transcription factor PRE2-like          108   9e-27   
ref|XP_010514602.1|  PREDICTED: transcription factor PRE5               108   9e-27   
ref|XP_010695477.1|  PREDICTED: transcription factor PRE3-like          107   1e-26   
emb|CDX91006.1|  BnaC02g05910D                                          107   1e-26   
ref|XP_009803678.1|  PREDICTED: transcription factor PRE3-like          107   2e-26   
emb|CDY68961.1|  BnaCnng61200D                                          107   2e-26   
ref|XP_009131445.1|  PREDICTED: transcription factor PRE2-like          107   2e-26   
emb|CDX78615.1|  BnaA03g05270D                                          107   2e-26   
ref|NP_001049112.1|  Os03g0171300                                       107   2e-26   Oryza sativa Japonica Group [Japonica rice]
gb|KFK25753.1|  hypothetical protein AALP_AA8G155000                    107   3e-26   
ref|XP_006400033.1|  hypothetical protein EUTSA_v10015131mg             107   3e-26   
gb|KFK41891.1|  hypothetical protein AALP_AA2G185600                    107   3e-26   
ref|XP_003558708.2|  PREDICTED: transcription factor ILI6 isoform X2    107   3e-26   
gb|EPS67081.1|  hypothetical protein M569_07696                         106   5e-26   
emb|CDY69564.1|  BnaAnng30830D                                          106   5e-26   
ref|NP_197020.1|  protein banquo 2                                      106   5e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010502885.1|  PREDICTED: transcription factor PRE5-like          105   6e-26   
ref|XP_009121603.1|  PREDICTED: transcription factor PRE2               105   8e-26   
ref|XP_006649473.1|  PREDICTED: transcription factor bHLH135-like...    107   8e-26   
ref|XP_006390417.1|  hypothetical protein EUTSA_v10019683mg             105   8e-26   
ref|XP_009106117.1|  PREDICTED: transcription factor PRE3-like          105   8e-26   
ref|XP_011085763.1|  PREDICTED: transcription factor PRE1-like          105   9e-26   
ref|XP_009416873.1|  PREDICTED: transcription factor ILI5-like          105   9e-26   
ref|XP_010416307.1|  PREDICTED: transcription factor PRE3               105   1e-25   
ref|XP_010939543.1|  PREDICTED: transcription factor ILI6-like          105   1e-25   
ref|XP_002888981.1|  hypothetical protein ARALYDRAFT_476585             105   1e-25   
ref|XP_004983143.1|  PREDICTED: transcription factor bHLH135-like       105   1e-25   
ref|XP_009388768.1|  PREDICTED: transcription factor ILI6-like          104   2e-25   
ref|XP_009149879.1|  PREDICTED: transcription factor PRE4               104   2e-25   
ref|XP_006343153.1|  PREDICTED: transcription factor bHLH135-like       104   2e-25   
ref|XP_006395334.1|  hypothetical protein EUTSA_v10005197mg             103   2e-25   
emb|CDX85055.1|  BnaC05g20000D                                          104   2e-25   
ref|XP_009128048.1|  PREDICTED: transcription factor PRE3               104   2e-25   
ref|XP_008797129.1|  PREDICTED: transcription factor ILI6-like          104   3e-25   
ref|XP_006661757.1|  PREDICTED: transcription factor bHLH135-like       103   3e-25   
ref|XP_009407356.1|  PREDICTED: transcription factor ILI5-like          103   4e-25   
emb|CDY24160.1|  BnaC03g57170D                                          103   4e-25   
ref|NP_177590.1|  transcription factor bHLH135                          103   5e-25   Arabidopsis thaliana [mouse-ear cress]
gb|EPS68402.1|  hypothetical protein M569_06365                         103   5e-25   
ref|XP_010550611.1|  PREDICTED: transcription factor PRE4               103   6e-25   
ref|XP_011098606.1|  PREDICTED: transcription factor PRE1-like          103   7e-25   
ref|XP_006288963.1|  hypothetical protein CARUB_v10002337mg             103   8e-25   
ref|XP_010425666.1|  PREDICTED: transcription factor PRE5-like          102   8e-25   
emb|CDX73095.1|  BnaC06g35430D                                          102   9e-25   
ref|XP_010917014.1|  PREDICTED: transcription factor ILI6-like          102   1e-24   
ref|XP_009395121.1|  PREDICTED: transcription factor ILI6-like          102   1e-24   
ref|XP_010029295.1|  PREDICTED: transcription factor PRE5-like          102   1e-24   
ref|XP_008784394.1|  PREDICTED: transcription factor ILI6-like          102   1e-24   
ref|XP_009393531.1|  PREDICTED: transcription factor ILI6-like          102   2e-24   
ref|XP_009409993.1|  PREDICTED: transcription factor ILI5-like          101   2e-24   
ref|XP_006404347.1|  hypothetical protein EUTSA_v10010858mg             101   3e-24   
ref|XP_010547809.1|  PREDICTED: transcription factor PRE4-like          101   3e-24   
sp|Q338G6.1|ILI7_ORYSJ  RecName: Full=Transcription factor ILI7; ...    100   5e-24   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ44693.1|  hypothetical protein OsJ_29320                          100   5e-24   Oryza sativa Japonica Group [Japonica rice]
sp|A2Z730.1|ILI7_ORYSI  RecName: Full=Transcription factor ILI7; ...    100   5e-24   Oryza sativa Indica Group [Indian rice]
ref|NP_190355.2|  atypical non-DNA binding bHLH protein BNQ3            100   5e-24   Arabidopsis thaliana [mouse-ear cress]
emb|CAB41854.1|  hypothetical protein                                   100   7e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011071625.1|  PREDICTED: transcription factor PRE3-like          100   8e-24   
ref|XP_004985540.1|  PREDICTED: transcription factor bHLH135-like       100   9e-24   
ref|XP_010937071.1|  PREDICTED: transcription factor ILI6-like        99.8    1e-23   
ref|XP_002465780.1|  hypothetical protein SORBIDRAFT_01g045710        99.8    1e-23   Sorghum bicolor [broomcorn]
ref|XP_010926221.1|  PREDICTED: transcription factor ILI6-like        99.8    2e-23   
ref|XP_008780728.1|  PREDICTED: transcription factor ILI6-like        99.4    2e-23   
ref|XP_009401395.1|  PREDICTED: transcription factor ILI5-like        99.8    3e-23   
ref|XP_010515078.1|  PREDICTED: transcription factor PRE4-like        99.0    3e-23   
ref|XP_008808056.1|  PREDICTED: transcription factor ILI5-like is...  98.6    3e-23   
ref|XP_010426218.1|  PREDICTED: transcription factor PRE4             98.6    4e-23   
ref|XP_008651476.1|  PREDICTED: transcription factor ILI6             98.6    4e-23   
ref|XP_010937075.1|  PREDICTED: transcription factor ILI5-like        98.2    5e-23   
ref|XP_009409165.1|  PREDICTED: transcription factor ILI3-like        97.8    6e-23   
ref|XP_006292883.1|  hypothetical protein CARUB_v10019148mg           98.2    6e-23   
gb|KHG06126.1|  Transcription factor protein                          97.1    1e-22   
ref|XP_009403179.1|  PREDICTED: transcription factor ILI5-like        96.7    2e-22   
ref|XP_010939530.1|  PREDICTED: transcription factor ILI5-like        96.7    2e-22   
ref|XP_009413611.1|  PREDICTED: transcription factor ILI3-like        96.3    2e-22   
ref|XP_010503380.1|  PREDICTED: transcription factor PRE4-like        95.9    4e-22   
ref|XP_010917019.1|  PREDICTED: transcription factor ILI5-like        95.9    4e-22   
ref|XP_008784341.1|  PREDICTED: transcription factor ILI5-like        95.5    5e-22   
gb|KFK34072.1|  hypothetical protein AALP_AA5G098800                  98.2    8e-22   
ref|XP_008804467.1|  PREDICTED: transcription factor ILI6-like        95.1    1e-21   
ref|XP_004983139.1|  PREDICTED: transcription factor bHLH135-like     94.4    2e-21   
ref|XP_008808055.1|  PREDICTED: transcription factor ILI5-like is...  94.0    2e-21   
ref|XP_009401191.1|  PREDICTED: transcription factor ILI3-like        94.0    2e-21   
gb|EPS59766.1|  protein banquo 3                                      93.6    2e-21   
ref|XP_010926541.1|  PREDICTED: transcription factor ILI3-like        92.8    5e-21   
ref|XP_008803188.1|  PREDICTED: transcription factor ILI3             92.8    5e-21   
ref|XP_009390918.1|  PREDICTED: transcription factor ILI6-like        92.8    6e-21   
ref|XP_009393721.1|  PREDICTED: transcription factor ILI5-like        92.8    6e-21   
emb|CDY63469.1|  BnaCnng42180D                                        92.4    8e-21   
ref|XP_009589864.1|  PREDICTED: transcription factor PRE3-like        91.7    2e-20   
gb|EYU34661.1|  hypothetical protein MIMGU_mgv1a018243mg              91.7    2e-20   
ref|XP_009380170.1|  PREDICTED: transcription factor ILI7-like        90.9    3e-20   
dbj|BAK06826.1|  predicted protein                                    90.9    3e-20   
ref|XP_009398947.1|  PREDICTED: transcription factor ILI3-like        90.1    5e-20   
ref|XP_009406651.1|  PREDICTED: transcription factor ILI5-like        90.1    5e-20   
ref|NP_001152510.1|  DNA binding protein                              90.1    6e-20   Zea mays [maize]
gb|EMS57081.1|  hypothetical protein TRIUR3_30914                     89.0    2e-19   
ref|XP_002452552.1|  hypothetical protein SORBIDRAFT_04g027930        88.2    4e-19   Sorghum bicolor [broomcorn]
gb|EMT26736.1|  hypothetical protein F775_32795                       89.0    5e-19   
ref|XP_003570648.1|  PREDICTED: transcription factor ILI5             87.8    5e-19   
ref|XP_004953911.1|  PREDICTED: transcription factor bHLH135-like     87.8    5e-19   
ref|XP_009389730.1|  PREDICTED: transcription factor ILI3-like        87.4    5e-19   
gb|AAM74282.1|AC083943_22  Hypothetical protein similar to putati...  87.4    6e-19   Oryza sativa Japonica Group [Japonica rice]
gb|EMT32161.1|  Transcription factor bHLH135                          86.7    1e-18   
sp|Q6YUX0.1|ILI5_ORYSJ  RecName: Full=Transcription factor ILI5; ...  86.3    1e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009380994.1|  PREDICTED: transcription factor ILI3-like        86.3    2e-18   
sp|Q7X742.2|ILI1_ORYSJ  RecName: Full=Transcription factor ILI1; ...  86.7    2e-18   Oryza sativa Japonica Group [Japonica rice]
gb|EMT04374.1|  Transcription factor bHLH135                          85.9    3e-18   
ref|NP_001148242.1|  LOC100281850                                     85.5    3e-18   Zea mays [maize]
ref|XP_006661756.1|  PREDICTED: transcription factor bHLH135-like     84.7    7e-18   
ref|XP_006647889.1|  PREDICTED: transcription factor bHLH135-like     84.0    1e-17   
ref|NP_001151208.1|  LOC100284841                                     83.2    2e-17   Zea mays [maize]
ref|NP_001152393.1|  DNA binding protein                              83.2    3e-17   Zea mays [maize]
ref|XP_006655931.1|  PREDICTED: transcription factor bHLH135-like     82.8    4e-17   
gb|EMT28039.1|  Transcription factor bHLH135                          82.8    4e-17   
ref|XP_010497842.1|  PREDICTED: transcription factor PRE1-like        81.6    6e-17   
ref|XP_004977000.1|  PREDICTED: transcription factor bHLH135-like     82.4    6e-17   
ref|XP_006652899.1|  PREDICTED: transcription factor bHLH135-like     82.4    7e-17   
ref|XP_004985532.1|  PREDICTED: transcription factor bHLH135-like     82.0    7e-17   
ref|XP_003564054.1|  PREDICTED: transcription factor ILI4-like        81.6    9e-17   
gb|EPS71427.1|  transcription factor style2.1                         81.6    1e-16   
ref|XP_008668794.1|  PREDICTED: transcription factor ILI1-like        82.0    1e-16   
ref|XP_002436744.1|  hypothetical protein SORBIDRAFT_10g008000        81.6    1e-16   
ref|XP_002448623.1|  hypothetical protein SORBIDRAFT_06g030340        82.0    1e-16   
ref|XP_004965032.1|  PREDICTED: transcription factor bHLH135-like     81.3    1e-16   
ref|NP_001149761.1|  DNA binding protein                              81.3    1e-16   
ref|XP_006649478.1|  PREDICTED: transcription factor bHLH135-like     81.3    1e-16   
ref|NP_001057203.1|  Os06g0226500                                     81.3    1e-16   
gb|KCW48830.1|  hypothetical protein EUGRSUZ_K02466                   81.3    1e-16   
ref|XP_009419459.1|  PREDICTED: transcription factor ILI3-like        80.9    2e-16   
ref|XP_009409145.1|  PREDICTED: transcription factor ILI5-like        80.9    2e-16   
ref|NP_001049114.1|  Os03g0171700                                     80.1    3e-16   
dbj|BAK04484.1|  predicted protein                                    80.5    4e-16   
gb|AGT17211.1|  transcription factor                                  79.7    5e-16   
ref|XP_009389867.1|  PREDICTED: transcription factor ILI3-like        79.3    6e-16   
ref|XP_008351836.1|  PREDICTED: transcription factor PRE6-like        79.3    7e-16   
ref|XP_009623625.1|  PREDICTED: transcription factor PRE1-like        78.6    1e-15   
ref|XP_002467276.1|  hypothetical protein SORBIDRAFT_01g022440        78.6    1e-15   
emb|CBI15246.3|  unnamed protein product                              78.2    2e-15   
ref|XP_006439622.1|  hypothetical protein CICLE_v10024517mg           78.6    2e-15   
ref|XP_011087225.1|  PREDICTED: transcription factor ILI5-like        77.8    2e-15   
ref|XP_008393139.1|  PREDICTED: transcription factor PRE6-like        77.8    3e-15   
ref|XP_010242423.1|  PREDICTED: transcription factor PRE6-like        77.8    3e-15   
gb|ABD32218.2|  Helix-loop-helix DNA-binding                          77.0    4e-15   
ref|XP_009631846.1|  PREDICTED: transcription factor PRE6-like        77.4    4e-15   
ref|XP_009420735.1|  PREDICTED: transcription factor ILI5-like        77.0    5e-15   
dbj|BAJ91340.1|  predicted protein                                    77.0    5e-15   
ref|XP_008393138.1|  PREDICTED: transcription factor PRE6-like        77.0    6e-15   
ref|XP_002511555.1|  DNA binding protein, putative                    76.6    7e-15   
gb|KDP31231.1|  hypothetical protein JCGZ_11607                       76.6    9e-15   
gb|EYU24396.1|  hypothetical protein MIMGU_mgv1a018583mg              76.3    9e-15   
ref|XP_003558707.1|  PREDICTED: transcription factor ILI3             76.3    9e-15   
ref|XP_007037290.1|  Basic helix-loop-helix DNA-binding family pr...  76.3    1e-14   
dbj|BAJ97978.1|  predicted protein                                    74.7    2e-14   
gb|EMT13985.1|  hypothetical protein F775_15902                       74.7    3e-14   
ref|XP_009780893.1|  PREDICTED: transcription factor ILI6-like        75.5    3e-14   
gb|ABF94217.1|  hypothetical protein LOC_Os03g07510                   75.1    4e-14   
ref|XP_010229116.1|  PREDICTED: transcription factor ILI7 isoform X1  75.1    7e-14   
ref|XP_009773320.1|  PREDICTED: transcription factor ILI5-like        73.9    7e-14   
ref|XP_009616651.1|  PREDICTED: transcription factor ILI5-like        73.9    7e-14   
emb|CDP12349.1|  unnamed protein product                              71.2    6e-13   
gb|KGN63980.1|  DNA binding protein                                   70.5    1e-12   
ref|XP_007140557.1|  hypothetical protein PHAVU_008G122600g           69.3    3e-12   
gb|EMT05397.1|  Transcription factor bHLH135                          69.3    4e-12   
gb|KHN07208.1|  Transcription factor bHLH135                          68.2    9e-12   
ref|XP_003580657.1|  PREDICTED: transcription factor ILI1-like        68.6    1e-11   
ref|NP_001048118.2|  Os02g0747900                                     66.2    2e-11   
ref|XP_010092048.1|  hypothetical protein L484_005298                 67.0    2e-11   
ref|XP_008663647.1|  PREDICTED: transcription factor ILI1-like        64.7    2e-10   
ref|NP_001068236.1|  Os11g0603000                                     64.7    2e-10   
gb|EEC68440.1|  hypothetical protein OsI_36646                        62.8    5e-10   
ref|XP_008440200.1|  PREDICTED: transcription factor PRE5-like        62.4    8e-10   
emb|CCD74522.1|  unknown                                              63.5    1e-09   
gb|KHN15226.1|  Transcription factor bHLH135                          62.0    1e-09   
gb|AAV88077.1|  hypothetical bHLH family protein                      63.2    2e-09   
ref|XP_003622994.1|  DNA-binding protein-like protein                 60.8    4e-09   
ref|XP_009369317.1|  PREDICTED: transcription factor PRE6-like        60.5    5e-09   
ref|XP_007210662.1|  hypothetical protein PRUPE_ppa022186mg           59.7    9e-09   
ref|XP_008374534.1|  PREDICTED: transcription factor PRE6-like        58.5    3e-08   
ref|XP_004515611.1|  PREDICTED: transcription factor bHLH135-like     52.8    2e-06   
gb|ABD32217.2|  hypothetical protein MtrDRAFT_AC148762g31v2           49.7    2e-05   
gb|EPS57632.1|  hypothetical protein M569_17185                       48.5    7e-05   



>ref|XP_010096378.1| hypothetical protein L484_021126 [Morus notabilis]
 gb|EXB63853.1| hypothetical protein L484_021126 [Morus notabilis]
Length=93

 Score =   135 bits (340),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/77 (88%), Positives = 71/77 (92%), Gaps = 0/77 (0%)
 Frame = -1

Query  407  SSRISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQ  228
            S  ISDDQI DLVSKLQRLIPEIR RRSDKVSASKVLQETCNYIR+LHREVDDLSDRLSQ
Sbjct  14   SMNISDDQITDLVSKLQRLIPEIRNRRSDKVSASKVLQETCNYIRNLHREVDDLSDRLSQ  73

Query  227  LLESTDGDSAQAAIIRS  177
            LL +T+ DSAQAAIIRS
Sbjct  74   LLATTENDSAQAAIIRS  90



>ref|XP_011071014.1| PREDICTED: transcription factor PRE6-like [Sesamum indicum]
Length=181

 Score =   137 bits (346),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/74 (92%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLE  219
            ISDDQIADLVSKLQ+LIPEIR RRSDKVSASKVLQETCNYIR+LHREVDDLSDRLS+LL+
Sbjct  105  ISDDQIADLVSKLQQLIPEIRNRRSDKVSASKVLQETCNYIRNLHREVDDLSDRLSELLD  164

Query  218  STDGDSAQAAIIRS  177
            STD DSAQAAIIRS
Sbjct  165  STDSDSAQAAIIRS  178



>ref|XP_004238782.1| PREDICTED: transcription factor PRE6-like [Solanum lycopersicum]
 ref|XP_006363238.1| PREDICTED: transcription factor bHLH135-like [Solanum tuberosum]
Length=86

 Score =   134 bits (338),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 68/74 (92%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLE  219
            ISDDQIADLVSKLQ+LIPEIR RRSDKVSASKVLQETCNYIR+LHREVD LS+RLSQLLE
Sbjct  10   ISDDQIADLVSKLQQLIPEIRNRRSDKVSASKVLQETCNYIRNLHREVDGLSERLSQLLE  69

Query  218  STDGDSAQAAIIRS  177
            STD DSAQAAIIRS
Sbjct  70   STDSDSAQAAIIRS  83



>emb|CDP00307.1| unnamed protein product [Coffea canephora]
Length=92

 Score =   134 bits (338),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 67/74 (91%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLE  219
            I+DDQIADLV+KLQ+LIPE+R RRSDKVSASKVLQETCNYIRSLHREVDDLSDRLS+LLE
Sbjct  16   ITDDQIADLVTKLQQLIPELRRRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSELLE  75

Query  218  STDGDSAQAAIIRS  177
            STD DSAQAAIIRS
Sbjct  76   STDSDSAQAAIIRS  89



>ref|XP_011075476.1| PREDICTED: transcription factor PRE6 [Sesamum indicum]
Length=95

 Score =   134 bits (337),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 70/79 (89%), Positives = 75/79 (95%), Gaps = 2/79 (3%)
 Frame = -1

Query  407  SSRISDDQIADLVSKLQRLIPEIRG--RRSDKVSASKVLQETCNYIRSLHREVDDLSDRL  234
            ++RISDDQIADLVSKLQ+LIPEIR   RRSDKVSASKVLQETCNYIRSLHREVDDLSDRL
Sbjct  14   AARISDDQIADLVSKLQQLIPEIRNSRRRSDKVSASKVLQETCNYIRSLHREVDDLSDRL  73

Query  233  SQLLESTDGDSAQAAIIRS  177
            S+LL+STD DSAQAAIIRS
Sbjct  74   SELLDSTDSDSAQAAIIRS  92



>ref|XP_002276549.1| PREDICTED: transcription factor PRE6 [Vitis vinifera]
 emb|CAN68305.1| hypothetical protein VITISV_041983 [Vitis vinifera]
 emb|CBI31987.3| unnamed protein product [Vitis vinifera]
Length=92

 Score =   134 bits (336),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/76 (91%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = -1

Query  404  SRISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQL  225
            SRISDDQIADLVSKLQ+LIPEIR RRSDKVSASKVLQETCNYIR+LHREVDDLSDRLS L
Sbjct  14   SRISDDQIADLVSKLQQLIPEIRNRRSDKVSASKVLQETCNYIRNLHREVDDLSDRLSAL  73

Query  224  LESTDGDSAQAAIIRS  177
            L STD DS QAAIIRS
Sbjct  74   LASTDTDSDQAAIIRS  89



>gb|EYU22434.1| hypothetical protein MIMGU_mgv1a017116mg [Erythranthe guttata]
Length=92

 Score =   133 bits (335),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/74 (89%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLE  219
            ISDDQIADLVSKLQ+LIPEIR RRSDKVS SKVLQETCNYI++LHREVDDLSDRLS+LLE
Sbjct  16   ISDDQIADLVSKLQQLIPEIRNRRSDKVSGSKVLQETCNYIKNLHREVDDLSDRLSELLE  75

Query  218  STDGDSAQAAIIRS  177
            STD +SAQAAIIRS
Sbjct  76   STDSNSAQAAIIRS  89



>gb|KDP41169.1| hypothetical protein JCGZ_15576 [Jatropha curcas]
Length=94

 Score =   132 bits (333),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/74 (92%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLE  219
            ISDDQI DLVSKLQ+LIPEI+ RRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLL 
Sbjct  17   ISDDQIIDLVSKLQQLIPEIQSRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLA  76

Query  218  STDGDSAQAAIIRS  177
            STD DSAQAAIIRS
Sbjct  77   STDSDSAQAAIIRS  90



>ref|XP_002520108.1| transcription regulator, putative [Ricinus communis]
 gb|EEF42163.1| transcription regulator, putative [Ricinus communis]
Length=93

 Score =   132 bits (332),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/74 (91%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLE  219
            ISDDQI DLVSKLQ+LIPEIR RRSDKVSASKVLQETCNYI+SLHREVDDLSDRLS+LL 
Sbjct  16   ISDDQIIDLVSKLQQLIPEIRNRRSDKVSASKVLQETCNYIKSLHREVDDLSDRLSELLA  75

Query  218  STDGDSAQAAIIRS  177
            STD DSAQAAIIRS
Sbjct  76   STDSDSAQAAIIRS  89



>ref|XP_007046125.1| Basic helix-loop-helix DNA-binding superfamily protein [Theobroma 
cacao]
 gb|EOY01957.1| Basic helix-loop-helix DNA-binding superfamily protein [Theobroma 
cacao]
Length=92

 Score =   132 bits (331),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 66/74 (89%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLE  219
            I+DDQI DLVSKLQ+LIPE+RGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLS+LL 
Sbjct  16   ITDDQITDLVSKLQQLIPELRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSELLA  75

Query  218  STDGDSAQAAIIRS  177
            STD DS QAAIIRS
Sbjct  76   STDTDSDQAAIIRS  89



>ref|XP_009610531.1| PREDICTED: transcription factor PRE6-like [Nicotiana tomentosiformis]
Length=93

 Score =   130 bits (328),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/74 (89%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLE  219
            ISDDQIADLVSKLQ+LIPEIR RRSDKVSASKVLQETCNYIR+LH EVD LSDRLSQLLE
Sbjct  17   ISDDQIADLVSKLQQLIPEIRNRRSDKVSASKVLQETCNYIRNLHSEVDGLSDRLSQLLE  76

Query  218  STDGDSAQAAIIRS  177
            ST+ DSAQA+IIRS
Sbjct  77   STESDSAQASIIRS  90



>ref|XP_009777244.1| PREDICTED: transcription factor PRE6-like [Nicotiana sylvestris]
Length=93

 Score =   130 bits (327),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLE  219
            ISDDQIADLVSKLQ+LIPEIR RRSDKV+ASKVLQETCNYIR+LHREVD LSDRLSQLLE
Sbjct  17   ISDDQIADLVSKLQQLIPEIRNRRSDKVTASKVLQETCNYIRNLHREVDGLSDRLSQLLE  76

Query  218  STDGDSAQAAIIRS  177
            ST+ DS QA+IIRS
Sbjct  77   STESDSVQASIIRS  90



>ref|XP_003532055.1| PREDICTED: transcription factor bHLH135 [Glycine max]
 gb|KHN06839.1| Transcription factor bHLH135 [Glycine soja]
Length=93

 Score =   130 bits (327),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = -1

Query  419  QPAESSRISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSD  240
            Q   S+ I+D QI DL+SKLQ+LIPE+R RRSDKVSASKVLQETCNYI+SLHREVDDLSD
Sbjct  10   QSGVSTEITDAQITDLISKLQQLIPELRARRSDKVSASKVLQETCNYIKSLHREVDDLSD  69

Query  239  RLSQLLESTDGDSAQAAIIRS  177
            RLSQLL +TD +SAQAAIIRS
Sbjct  70   RLSQLLATTDSNSAQAAIIRS  90



>ref|XP_010044722.1| PREDICTED: transcription factor PRE3-like [Eucalyptus grandis]
 gb|KCW86822.1| hypothetical protein EUGRSUZ_B03420 [Eucalyptus grandis]
Length=91

 Score =   130 bits (327),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 69/81 (85%), Positives = 71/81 (88%), Gaps = 2/81 (2%)
 Frame = -1

Query  419  QPAESSRISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSD  240
            Q    SRISDDQIADLVSKLQRLIPEIR RRSDKVSASKVLQETCNYIRSLHREVDDLS+
Sbjct  10   QSEGGSRISDDQIADLVSKLQRLIPEIRNRRSDKVSASKVLQETCNYIRSLHREVDDLSE  69

Query  239  RLSQLLESTDGDSAQAAIIRS  177
            RLS+LL   D DS QAAIIRS
Sbjct  70   RLSELL--ADSDSEQAAIIRS  88



>ref|XP_009767697.1| PREDICTED: transcription factor PRE6-like [Nicotiana sylvestris]
Length=92

 Score =   130 bits (326),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/76 (87%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = -1

Query  404  SRISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQL  225
            SRISDDQIADLVSKLQ LIPEIR RRSDKV+ASKVLQETCNYIRSLHREV+DLS+RLS L
Sbjct  14   SRISDDQIADLVSKLQLLIPEIRNRRSDKVTASKVLQETCNYIRSLHREVEDLSERLSVL  73

Query  224  LESTDGDSAQAAIIRS  177
            L+ST+ DSAQ AIIRS
Sbjct  74   LDSTESDSAQGAIIRS  89



>ref|XP_007153819.1| hypothetical protein PHAVU_003G067500g [Phaseolus vulgaris]
 gb|ESW25813.1| hypothetical protein PHAVU_003G067500g [Phaseolus vulgaris]
Length=93

 Score =   130 bits (326),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/77 (83%), Positives = 71/77 (92%), Gaps = 0/77 (0%)
 Frame = -1

Query  407  SSRISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQ  228
            S+ I+D QI DLVSKLQ+LIPE+R RRSDKVSASKVLQETCNYI+SLHREVDDLSDRLSQ
Sbjct  14   STEITDAQITDLVSKLQQLIPELRARRSDKVSASKVLQETCNYIKSLHREVDDLSDRLSQ  73

Query  227  LLESTDGDSAQAAIIRS  177
            LL +TD +SAQAAIIRS
Sbjct  74   LLATTDSNSAQAAIIRS  90



>ref|XP_007226915.1| hypothetical protein PRUPE_ppa016030mg [Prunus persica]
 gb|EMJ28114.1| hypothetical protein PRUPE_ppa016030mg [Prunus persica]
Length=93

 Score =   129 bits (325),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -1

Query  419  QPAESSRISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSD  240
            Q   S  ISD+QI DLVSKLQ+L+PEIR RRSDKVSASKVLQETCNYIR+LHREVDDLSD
Sbjct  10   QSGTSRNISDEQITDLVSKLQQLLPEIRNRRSDKVSASKVLQETCNYIRNLHREVDDLSD  69

Query  239  RLSQLLESTDGDSAQAAIIRS  177
            RLS+LL STD DS QAAIIRS
Sbjct  70   RLSELLASTDMDSDQAAIIRS  90



>ref|XP_009622200.1| PREDICTED: transcription factor PRE6-like [Nicotiana tomentosiformis]
Length=92

 Score =   129 bits (324),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 66/76 (87%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = -1

Query  404  SRISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQL  225
            SRISDDQIADLVSKLQ LIPEIR RRSDKV+AS VLQETCNYIRSLHREV+DLS+RLS L
Sbjct  14   SRISDDQIADLVSKLQLLIPEIRNRRSDKVTASTVLQETCNYIRSLHREVEDLSERLSVL  73

Query  224  LESTDGDSAQAAIIRS  177
            L+ST+ DSAQAAIIRS
Sbjct  74   LDSTESDSAQAAIIRS  89



>ref|XP_003519021.1| PREDICTED: transcription factor bHLH135 [Glycine max]
 gb|KHN01198.1| Transcription factor bHLH135 [Glycine soja]
 gb|KHN08689.1| Transcription factor bHLH135 [Glycine soja]
Length=93

 Score =   128 bits (321),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = -1

Query  419  QPAESSRISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSD  240
            Q   S+ I+D QI DLVSKLQ+LIPE+R RRSDKVSA+KVLQETCNYI++LHREVDDLSD
Sbjct  10   QSGASAEITDAQITDLVSKLQQLIPELRARRSDKVSAAKVLQETCNYIKNLHREVDDLSD  69

Query  239  RLSQLLESTDGDSAQAAIIRS  177
            RLS+LL +TD +SAQAAIIRS
Sbjct  70   RLSELLANTDSNSAQAAIIRS  90



>ref|XP_003543767.1| PREDICTED: transcription factor bHLH135 [Glycine max]
 ref|XP_007151219.1| hypothetical protein PHAVU_004G027700g [Phaseolus vulgaris]
 gb|ESW23213.1| hypothetical protein PHAVU_004G027700g [Phaseolus vulgaris]
 gb|KHN13231.1| Transcription factor bHLH135 [Glycine soja]
 gb|KHN45491.1| Transcription factor bHLH135 [Glycine soja]
Length=91

 Score =   127 bits (320),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = -1

Query  419  QPAESSRISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSD  240
            Q + S+RISDDQI DLVSKL++L+PEIR RRSDKVSASKVLQETCNYIRSLHREVDDLS+
Sbjct  8    QQSASTRISDDQIIDLVSKLRQLVPEIRDRRSDKVSASKVLQETCNYIRSLHREVDDLSE  67

Query  239  RLSQLLESTDGDSAQAAIIRS  177
            RLSQLL + D DS +AAIIRS
Sbjct  68   RLSQLLATIDADSPEAAIIRS  88



>gb|KHG03267.1| Transcription factor protein [Gossypium arboreum]
Length=92

 Score =   126 bits (317),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 64/76 (84%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = -1

Query  404  SRISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQL  225
            SRISDDQI +LVSKL++L+PEIR RRSDKVSASKVLQETCNYIRSLHREVDDLS+RLSQL
Sbjct  14   SRISDDQIIELVSKLRQLLPEIRDRRSDKVSASKVLQETCNYIRSLHREVDDLSERLSQL  73

Query  224  LESTDGDSAQAAIIRS  177
            L + D DSA+AAIIRS
Sbjct  74   LATIDADSAEAAIIRS  89



>ref|NP_001237910.1| uncharacterized protein LOC100305611 [Glycine max]
 gb|ACU13383.1| unknown [Glycine max]
Length=91

 Score =   126 bits (317),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = -1

Query  419  QPAESSRISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSD  240
            Q + S+RISDDQI DLVSKL++L+PEIR RRSDKVSASKVLQETCNYIRSLHREV+DLS+
Sbjct  8    QQSASTRISDDQIIDLVSKLRQLVPEIRDRRSDKVSASKVLQETCNYIRSLHREVNDLSE  67

Query  239  RLSQLLESTDGDSAQAAIIRS  177
            RLSQLL + D DS +AAIIRS
Sbjct  68   RLSQLLATIDADSPEAAIIRS  88



>ref|XP_008221650.1| PREDICTED: transcription factor PRE6-like [Prunus mume]
 ref|XP_008221651.1| PREDICTED: transcription factor PRE6-like [Prunus mume]
Length=94

 Score =   126 bits (317),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLE  219
            ISD+QI DLVSKLQ+L+PEIR RRSDKVSASKVLQETCNYI++LHREVDDLSDRLS+LL 
Sbjct  18   ISDEQITDLVSKLQQLLPEIRNRRSDKVSASKVLQETCNYIKNLHREVDDLSDRLSELLA  77

Query  218  STDGDSAQAAIIRS  177
            STD DS QAAIIRS
Sbjct  78   STDMDSDQAAIIRS  91



>ref|XP_010242417.1| PREDICTED: transcription factor PRE6-like [Nelumbo nucifera]
Length=92

 Score =   126 bits (317),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLE  219
            I+DDQI DLVSKLQ+L+PEIR RRSDKVSA+KVLQETCNYIRSLHREVDDLS+RLS+LL 
Sbjct  16   ITDDQINDLVSKLQQLLPEIRDRRSDKVSAAKVLQETCNYIRSLHREVDDLSERLSELLA  75

Query  218  STDGDSAQAAIIRS  177
            +TD +SAQAAIIRS
Sbjct  76   TTDTNSAQAAIIRS  89



>ref|XP_003517952.1| PREDICTED: transcription factor bHLH135-like [Glycine max]
Length=93

 Score =   126 bits (317),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = -1

Query  419  QPAESSRISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSD  240
            Q   S+ I+D QI DLVSKLQ+LIPE+R RRSDKVS++KVLQETCNYI++LHREVDDLSD
Sbjct  10   QSGASAEITDAQITDLVSKLQQLIPELRARRSDKVSSAKVLQETCNYIKNLHREVDDLSD  69

Query  239  RLSQLLESTDGDSAQAAIIRS  177
            RLS+LL +TD +SAQAAIIRS
Sbjct  70   RLSELLANTDSNSAQAAIIRS  90



>ref|XP_007157666.1| hypothetical protein PHAVU_002G088400g [Phaseolus vulgaris]
 gb|ESW29660.1| hypothetical protein PHAVU_002G088400g [Phaseolus vulgaris]
Length=93

 Score =   126 bits (316),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 61/77 (79%), Positives = 71/77 (92%), Gaps = 0/77 (0%)
 Frame = -1

Query  407  SSRISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQ  228
            S+ I+D QI DLVSKLQ+LIPE+R RRSDKVSA+KVLQETCNYI++LHREVDDLSDRLS+
Sbjct  14   SAEITDAQITDLVSKLQQLIPELRARRSDKVSAAKVLQETCNYIKNLHREVDDLSDRLSE  73

Query  227  LLESTDGDSAQAAIIRS  177
            LL +TD +SAQAAIIRS
Sbjct  74   LLANTDSNSAQAAIIRS  90



>ref|XP_003534454.1| PREDICTED: transcription factor bHLH135 [Glycine max]
 gb|KHN11598.1| Transcription factor bHLH135 [Glycine soja]
Length=92

 Score =   125 bits (314),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = -1

Query  419  QPAESSRISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSD  240
            Q + S+RISDDQI +LVSKL++L+PEIR RRSDKVSASKVLQETCNYIRSLHREV DLS+
Sbjct  8    QHSGSTRISDDQIIELVSKLRQLVPEIRNRRSDKVSASKVLQETCNYIRSLHREVSDLSE  67

Query  239  RLSQLLESTDGDSAQAAIIRS  177
            RLSQLL + D DSA+A IIRS
Sbjct  68   RLSQLLTTIDADSAEAGIIRS  88



>ref|XP_006344270.1| PREDICTED: transcription factor bHLH135-like [Solanum tuberosum]
Length=95

 Score =   125 bits (314),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 72/82 (88%), Gaps = 1/82 (1%)
 Frame = -1

Query  419  QPAESSRISDDQIADLVSKLQRLIPEIRG-RRSDKVSASKVLQETCNYIRSLHREVDDLS  243
            Q + +SRISDDQIADLVSKLQ LIPE R  R SDKV ASKVLQETCNYIRSLHREV+DLS
Sbjct  11   QSSGASRISDDQIADLVSKLQLLIPESRSTRSSDKVEASKVLQETCNYIRSLHREVEDLS  70

Query  242  DRLSQLLESTDGDSAQAAIIRS  177
            DRLS LLEST+ DSAQAAIIRS
Sbjct  71   DRLSVLLESTESDSAQAAIIRS  92



>gb|KFK44602.1| hypothetical protein AALP_AA1G280300 [Arabis alpina]
Length=94

 Score =   125 bits (314),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  392  DDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLEST  213
            DDQI+DLVSKLQ LIPEIR RRSDKVSASKVLQETCNYIR+LHREVDDLSDRLS+LL ST
Sbjct  19   DDQISDLVSKLQHLIPEIRRRRSDKVSASKVLQETCNYIRNLHREVDDLSDRLSELLAST  78

Query  212  DGDSAQAAIIRS  177
            D +SA+AAIIRS
Sbjct  79   DDNSAEAAIIRS  90



>ref|XP_007139582.1| hypothetical protein PHAVU_008G041800g [Phaseolus vulgaris]
 gb|ESW11576.1| hypothetical protein PHAVU_008G041800g [Phaseolus vulgaris]
Length=92

 Score =   125 bits (313),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = -1

Query  419  QPAESSRISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSD  240
            Q + S+RISDDQI +LVSKL++L+PEIR RRSDKVSASKVLQETCNYIRSLHREV DLS+
Sbjct  8    QHSGSTRISDDQIIELVSKLRQLVPEIRSRRSDKVSASKVLQETCNYIRSLHREVSDLSE  67

Query  239  RLSQLLESTDGDSAQAAIIRS  177
            RLSQLL + D DSA+A IIRS
Sbjct  68   RLSQLLTTIDADSAEAGIIRS  88



>ref|XP_003551974.1| PREDICTED: transcription factor bHLH135-like [Glycine max]
 gb|KHN32887.1| Transcription factor bHLH135 [Glycine soja]
Length=93

 Score =   125 bits (313),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/77 (79%), Positives = 70/77 (91%), Gaps = 0/77 (0%)
 Frame = -1

Query  407  SSRISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQ  228
            S+ I+D QI D++SKLQ+LIPE+  RRSDKVSASKVLQETCNYI+SLHREVDDLSDRLSQ
Sbjct  14   STEITDAQITDIISKLQQLIPELDARRSDKVSASKVLQETCNYIKSLHREVDDLSDRLSQ  73

Query  227  LLESTDGDSAQAAIIRS  177
            LL +TD +SAQAAIIRS
Sbjct  74   LLATTDSNSAQAAIIRS  90



>gb|AFK41511.1| unknown [Lotus japonicus]
Length=93

 Score =   124 bits (312),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLE  219
            ISD QI DL+SKLQ+LIPE+R RRSDKVSA+KVLQETCNYI++LHREVDDLSDRLS+LL 
Sbjct  17   ISDAQITDLISKLQQLIPELRARRSDKVSAAKVLQETCNYIKNLHREVDDLSDRLSELLA  76

Query  218  STDGDSAQAAIIRS  177
            +TD +SAQAAIIRS
Sbjct  77   TTDSNSAQAAIIRS  90



>ref|XP_009110054.1| PREDICTED: transcription factor PRE6 [Brassica rapa]
 emb|CDY46428.1| BnaA08g20020D [Brassica napus]
Length=94

 Score =   124 bits (312),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  392  DDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLEST  213
            DDQI+DLV+KLQ LIPE+R RRSDKVSASKVLQETCNYIR+LHREVDDLSDRLS+LL ST
Sbjct  19   DDQISDLVTKLQHLIPELRRRRSDKVSASKVLQETCNYIRNLHREVDDLSDRLSELLAST  78

Query  212  DGDSAQAAIIRS  177
            D DSA+AAIIRS
Sbjct  79   DDDSAEAAIIRS  90



>ref|XP_010552588.1| PREDICTED: transcription factor PRE6 [Tarenaya hassleriana]
Length=95

 Score =   124 bits (312),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 63/77 (82%), Positives = 71/77 (92%), Gaps = 0/77 (0%)
 Frame = -1

Query  407  SSRISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQ  228
            +SRIS+DQIADLVSKLQ LIPE+R RRSDKVSASKVLQETCNYI++LHREVDDL DRLS+
Sbjct  15   NSRISEDQIADLVSKLQLLIPELRRRRSDKVSASKVLQETCNYIKNLHREVDDLGDRLSE  74

Query  227  LLESTDGDSAQAAIIRS  177
            LL STD +S +AAIIRS
Sbjct  75   LLASTDHNSPEAAIIRS  91



>emb|CDY28427.1| BnaC07g12550D [Brassica napus]
Length=94

 Score =   124 bits (312),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLE  219
            ISDDQI+DLV+KLQ LIPE+R RRSDKVSASKVLQETCNYIR+LHREVDDLSDRLS+ L 
Sbjct  17   ISDDQISDLVTKLQHLIPELRRRRSDKVSASKVLQETCNYIRNLHREVDDLSDRLSEFLA  76

Query  218  STDGDSAQAAIIRS  177
            STD +SA+AAIIRS
Sbjct  77   STDDNSAEAAIIRS  90



>ref|XP_010256912.1| PREDICTED: transcription factor ILI6-like [Nelumbo nucifera]
Length=92

 Score =   124 bits (311),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLE  219
            I+DDQI DLVSKLQ+L+PEIR RRSDKVSAS VLQETCNYIRSLHREVDDLS+RLS+LL 
Sbjct  16   ITDDQINDLVSKLQQLLPEIRDRRSDKVSASMVLQETCNYIRSLHREVDDLSERLSELLA  75

Query  218  STDGDSAQAAIIRS  177
            +TD  SAQAAIIRS
Sbjct  76   TTDASSAQAAIIRS  89



>ref|XP_006438657.1| hypothetical protein CICLE_v10033182mg [Citrus clementina]
 ref|XP_006483196.1| PREDICTED: transcription factor bHLH135-like [Citrus sinensis]
 ref|XP_006483197.1| PREDICTED: transcription factor bHLH135-like [Citrus sinensis]
 ref|XP_006495343.1| PREDICTED: transcription factor bHLH135-like [Citrus sinensis]
 gb|ESR51897.1| hypothetical protein CICLE_v10033182mg [Citrus clementina]
Length=93

 Score =   124 bits (311),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLE  219
            ISDDQI DLVSKLQ+LIPE+R RRSDKVSASK+LQETC+YIRSLHREVDDLSDRLS+LL 
Sbjct  17   ISDDQIGDLVSKLQQLIPELRSRRSDKVSASKILQETCDYIRSLHREVDDLSDRLSELLA  76

Query  218  STDGDSAQAAIIRS  177
            S D +SA+AAIIRS
Sbjct  77   SIDSNSAEAAIIRS  90



>ref|XP_006415982.1| hypothetical protein EUTSA_v10009197mg [Eutrema salsugineum]
 gb|ESQ34335.1| hypothetical protein EUTSA_v10009197mg [Eutrema salsugineum]
Length=94

 Score =   124 bits (311),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  392  DDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLEST  213
            DDQI+DLVSKLQ LIPE+R RRSDKVSASKVLQETCNYIR+LHREVDDLSDRLS+LL ST
Sbjct  19   DDQISDLVSKLQHLIPELRRRRSDKVSASKVLQETCNYIRNLHREVDDLSDRLSELLSST  78

Query  212  DGDSAQAAIIRS  177
            D +SA+AAIIRS
Sbjct  79   DDNSAEAAIIRS  90



>ref|NP_849712.1| basic helix-loop-helix protein KIDARI [Arabidopsis thaliana]
 ref|XP_002893369.1| hypothetical protein ARALYDRAFT_472704 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_010498979.1| PREDICTED: transcription factor PRE6 [Camelina sativa]
 sp|Q8GW32.1|PRE6_ARATH RecName: Full=Transcription factor PRE6; AltName: Full=Basic 
helix-loop-helix protein 163; Short=AtbHLH163; Short=bHLH 163; 
AltName: Full=Protein KIDARI; AltName: Full=Protein PACLOBUTRAZOL 
RESISTANCE 6; AltName: Full=bHLH transcription factor 
bHLH163 [Arabidopsis thaliana]
 dbj|BAC43682.1| unknown protein [Arabidopsis thaliana]
 gb|AAO42932.1| At1g26948 [Arabidopsis thaliana]
 gb|EFH69628.1| hypothetical protein ARALYDRAFT_472704 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AEE30763.1| basic helix-loop-helix protein KIDARI [Arabidopsis thaliana]
Length=94

 Score =   124 bits (311),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  392  DDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLEST  213
            DDQI+DLVSKLQ LIPE+R RRSDKVSASKVLQETCNYIR+LHREVDDLSDRLS+LL ST
Sbjct  19   DDQISDLVSKLQHLIPELRRRRSDKVSASKVLQETCNYIRNLHREVDDLSDRLSELLAST  78

Query  212  DGDSAQAAIIRS  177
            D +SA+AAIIRS
Sbjct  79   DDNSAEAAIIRS  90



>ref|XP_004151201.1| PREDICTED: transcription factor bHLH135-like, partial [Cucumis 
sativus]
Length=82

 Score =   124 bits (310),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 71/77 (92%), Gaps = 0/77 (0%)
 Frame = -1

Query  407  SSRISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQ  228
            +SRISDDQI +LVSKL++L+PEIR RR DKVSASKVLQETCNYIR+LHREVDDLS+RLSQ
Sbjct  2    ASRISDDQIIELVSKLRQLVPEIRHRRPDKVSASKVLQETCNYIRNLHREVDDLSERLSQ  61

Query  227  LLESTDGDSAQAAIIRS  177
            LL + D DSA+AAIIRS
Sbjct  62   LLSTIDSDSAEAAIIRS  78



>ref|NP_001241066.1| uncharacterized protein LOC100784537 [Glycine max]
 gb|ACU19172.1| unknown [Glycine max]
 gb|KHN13624.1| Transcription factor bHLH135 [Glycine soja]
Length=92

 Score =   124 bits (310),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -1

Query  419  QPAESSRISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSD  240
            Q + S+RISDDQI +LVSKL++L+PEIR RRSDKVSASKVLQETCNYIR LHREV DLS+
Sbjct  8    QHSGSTRISDDQIIELVSKLRQLVPEIRNRRSDKVSASKVLQETCNYIRGLHREVSDLSE  67

Query  239  RLSQLLESTDGDSAQAAIIRS  177
            RLSQLL + D DSA+A IIRS
Sbjct  68   RLSQLLTTIDADSAEAGIIRS  88



>ref|XP_010550064.1| PREDICTED: transcription factor PRE5 [Tarenaya hassleriana]
Length=91

 Score =   123 bits (309),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 72/80 (90%), Gaps = 1/80 (1%)
 Frame = -1

Query  413  AESSRISDDQIADLVSKLQRLIPEIR-GRRSDKVSASKVLQETCNYIRSLHREVDDLSDR  237
            A  SRISDDQI DLVSKL++L+PEIR  RRSDKVSASKVLQETCNYIR+LHREVDDLS+R
Sbjct  9    ASVSRISDDQIIDLVSKLRQLLPEIRPNRRSDKVSASKVLQETCNYIRNLHREVDDLSER  68

Query  236  LSQLLESTDGDSAQAAIIRS  177
            LSQLLE+ D DS +AAIIRS
Sbjct  69   LSQLLETIDADSPEAAIIRS  88



>ref|XP_006303467.1| hypothetical protein CARUB_v10010751mg [Capsella rubella]
 gb|EOA36365.1| hypothetical protein CARUB_v10010751mg [Capsella rubella]
Length=94

 Score =   123 bits (309),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/72 (85%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -1

Query  392  DDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLEST  213
            DDQI+DLV+KLQ LIPE+R RRSDKVSASKVLQETCNYIR+LHREVDDLSDRLS+LL ST
Sbjct  19   DDQISDLVTKLQHLIPELRRRRSDKVSASKVLQETCNYIRNLHREVDDLSDRLSELLAST  78

Query  212  DGDSAQAAIIRS  177
            D +SA+AAIIRS
Sbjct  79   DDNSAEAAIIRS  90



>ref|XP_007032495.1| Basic helix-loop-helix (bHLH) DNA-binding family protein [Theobroma 
cacao]
 gb|EOY03421.1| Basic helix-loop-helix (bHLH) DNA-binding family protein [Theobroma 
cacao]
Length=91

 Score =   123 bits (308),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLE  219
            ISDDQI +LVSKL++L+PEIR RRSDKVSASKVLQETCNYIRSLHREVDDLS+RLSQLL 
Sbjct  15   ISDDQIIELVSKLRQLLPEIRDRRSDKVSASKVLQETCNYIRSLHREVDDLSERLSQLLA  74

Query  218  STDGDSAQAAIIRS  177
            + D DSA+AAIIRS
Sbjct  75   TIDSDSAEAAIIRS  88



>ref|XP_006827167.1| hypothetical protein AMTR_s00010p00254240 [Amborella trichopoda]
 gb|ERM94404.1| hypothetical protein AMTR_s00010p00254240 [Amborella trichopoda]
Length=92

 Score =   122 bits (307),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLE  219
            I+DDQI DLVSKLQ L+PEIR R SDKVSASKVLQETCNYI+SLHREVDDLS++LS+LLE
Sbjct  16   ITDDQIIDLVSKLQSLLPEIRNRSSDKVSASKVLQETCNYIKSLHREVDDLSEKLSELLE  75

Query  218  STDGDSAQAAIIRS  177
            +T+  SAQAAIIRS
Sbjct  76   TTETSSAQAAIIRS  89



>ref|XP_004237036.1| PREDICTED: transcription factor PRE6-like [Solanum lycopersicum]
Length=95

 Score =   122 bits (307),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 71/82 (87%), Gaps = 1/82 (1%)
 Frame = -1

Query  419  QPAESSRISDDQIADLVSKLQRLIPEIRG-RRSDKVSASKVLQETCNYIRSLHREVDDLS  243
            Q + +SRISDDQIADLVSKLQ LIPE R  R SDKV ASKVLQE CNYIRSLHREV+DLS
Sbjct  11   QSSGASRISDDQIADLVSKLQLLIPESRSTRSSDKVEASKVLQEICNYIRSLHREVEDLS  70

Query  242  DRLSQLLESTDGDSAQAAIIRS  177
            DRLS LLEST+ DSAQAAIIRS
Sbjct  71   DRLSVLLESTESDSAQAAIIRS  92



>ref|XP_004233358.1| PREDICTED: transcription factor PRE6 isoform X2 [Solanum lycopersicum]
Length=94

 Score =   122 bits (306),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/77 (79%), Positives = 69/77 (90%), Gaps = 0/77 (0%)
 Frame = -1

Query  407  SSRISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQ  228
            +SRISDDQI  LVSKLQ+L+PEIR RRS+K SASKVLQETCNYIR+LH+EVDDLSDRLSQ
Sbjct  15   TSRISDDQIIQLVSKLQQLLPEIRNRRSNKASASKVLQETCNYIRNLHKEVDDLSDRLSQ  74

Query  227  LLESTDGDSAQAAIIRS  177
            LL + D DS +AAIIRS
Sbjct  75   LLSTIDADSPEAAIIRS  91



>ref|XP_006357115.1| PREDICTED: transcription factor bHLH135-like [Solanum tuberosum]
Length=93

 Score =   122 bits (306),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/77 (79%), Positives = 69/77 (90%), Gaps = 0/77 (0%)
 Frame = -1

Query  407  SSRISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQ  228
            +SRISDDQI  LVSKLQ+L+PEIR RRS+K SASKVLQETCNYIR+LH+EVDDLSDRLSQ
Sbjct  14   TSRISDDQIIQLVSKLQQLLPEIRNRRSNKASASKVLQETCNYIRNLHKEVDDLSDRLSQ  73

Query  227  LLESTDGDSAQAAIIRS  177
            LL + D DS +AAIIRS
Sbjct  74   LLSTIDADSPEAAIIRS  90



>ref|XP_009389574.1| PREDICTED: transcription factor ILI6-like [Musa acuminata subsp. 
malaccensis]
Length=93

 Score =   122 bits (306),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = -1

Query  419  QPAESSRISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSD  240
            Q + +SRI+D+QI DLVSKLQ ++PE R RRSD+VSA+KVLQETCNYIRSLHREVDDLS+
Sbjct  10   QSSSASRITDEQINDLVSKLQAVLPEARIRRSDRVSAAKVLQETCNYIRSLHREVDDLSE  69

Query  239  RLSQLLESTDGDSAQAAIIRS  177
            RLS+LL ST+  SAQAAIIRS
Sbjct  70   RLSELLASTESSSAQAAIIRS  90



>ref|XP_010460241.1| PREDICTED: transcription factor PRE6-like [Camelina sativa]
 ref|XP_010477789.1| PREDICTED: transcription factor PRE6-like [Camelina sativa]
Length=94

 Score =   122 bits (306),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/72 (85%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = -1

Query  392  DDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLEST  213
            DDQI+DLVSKLQ LIPE+  RRSDKVSASKVLQETCNYIR+LHREVDDLSDRLS+LL ST
Sbjct  19   DDQISDLVSKLQHLIPELHRRRSDKVSASKVLQETCNYIRNLHREVDDLSDRLSELLAST  78

Query  212  DGDSAQAAIIRS  177
            D +SA+AAIIRS
Sbjct  79   DDNSAEAAIIRS  90



>ref|XP_010551862.1| PREDICTED: transcription factor PRE1-like [Tarenaya hassleriana]
Length=91

 Score =   121 bits (304),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 73/80 (91%), Gaps = 1/80 (1%)
 Frame = -1

Query  413  AESSRISDDQIADLVSKLQRLIPEIR-GRRSDKVSASKVLQETCNYIRSLHREVDDLSDR  237
            A +SRISDDQI DLVSKL++L+PEIR  RRSDKVSASKVLQETCNYIR+L+REVDDLS+R
Sbjct  9    ASASRISDDQIIDLVSKLRQLLPEIRPNRRSDKVSASKVLQETCNYIRNLNREVDDLSER  68

Query  236  LSQLLESTDGDSAQAAIIRS  177
            LSQLLE+ D DS +AAI+RS
Sbjct  69   LSQLLETIDADSPEAAIVRS  88



>ref|XP_008446331.1| PREDICTED: transcription factor PRE6-like [Cucumis melo]
Length=95

 Score =   121 bits (303),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 64/75 (85%), Positives = 69/75 (92%), Gaps = 1/75 (1%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIR-GRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLL  222
            ISD+QIADL+SKLQ+LIPEIR GR S +VSASKVLQETCNYIRSL REVDDLSDRLSQLL
Sbjct  18   ISDEQIADLISKLQQLIPEIRNGRSSSRVSASKVLQETCNYIRSLQREVDDLSDRLSQLL  77

Query  221  ESTDGDSAQAAIIRS  177
             STD +SAQAAIIRS
Sbjct  78   ASTDPESAQAAIIRS  92



>ref|XP_009103115.1| PREDICTED: transcription factor PRE6-like [Brassica rapa]
 emb|CDY40269.1| BnaA07g09310D [Brassica napus]
Length=94

 Score =   121 bits (303),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 60/72 (83%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = -1

Query  392  DDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLEST  213
            DDQI+DLV+KLQ LIPE+R RRSDKVSASKVLQETCNYIR+LHREVDDLSDRLS+ L ST
Sbjct  19   DDQISDLVTKLQHLIPELRRRRSDKVSASKVLQETCNYIRNLHREVDDLSDRLSEFLAST  78

Query  212  DGDSAQAAIIRS  177
            D +SA+AAIIRS
Sbjct  79   DDNSAEAAIIRS  90



>ref|XP_004297318.1| PREDICTED: transcription factor bHLH135-like [Fragaria vesca 
subsp. vesca]
Length=98

 Score =   121 bits (304),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 72/78 (92%), Gaps = 1/78 (1%)
 Frame = -1

Query  407  SSRISDDQIADLVSKLQRLIPEIRGRRSD-KVSASKVLQETCNYIRSLHREVDDLSDRLS  231
            ++ ISD+QIADLVSKLQ+L+PEIR RRSD KVSASKVLQETCNYI++LHREVDDLS+RLS
Sbjct  18   NNNISDEQIADLVSKLQQLLPEIRHRRSDNKVSASKVLQETCNYIKNLHREVDDLSERLS  77

Query  230  QLLESTDGDSAQAAIIRS  177
            QLL +TD DS QA+IIRS
Sbjct  78   QLLATTDMDSDQASIIRS  95



>ref|XP_007138203.1| hypothetical protein PHAVU_009G189200g [Phaseolus vulgaris]
 gb|ESW10197.1| hypothetical protein PHAVU_009G189200g [Phaseolus vulgaris]
Length=92

 Score =   120 bits (302),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 69/74 (93%), Gaps = 2/74 (3%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLE  219
            I+DDQI DLVSKLQ+L+PEIR RRSDKVSASKVLQETCNYIRSLHREVDDLS+RLS+LL 
Sbjct  17   ITDDQINDLVSKLQQLLPEIRDRRSDKVSASKVLQETCNYIRSLHREVDDLSERLSELLA  76

Query  218  STDGDSAQAAIIRS  177
            +T  DSAQAAIIR+
Sbjct  77   TT--DSAQAAIIRN  88



>ref|XP_006482579.1| PREDICTED: transcription factor bHLH135-like [Citrus sinensis]
Length=91

 Score =   120 bits (302),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -1

Query  419  QPAESSRISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSD  240
            Q A  SRISDDQI +LVSKL++L+PEIR RR  KVSASKVLQETCNYIRSLHREVDDLS+
Sbjct  8    QAAGVSRISDDQIIELVSKLRQLLPEIRDRRPQKVSASKVLQETCNYIRSLHREVDDLSE  67

Query  239  RLSQLLESTDGDSAQAAIIRS  177
            RLSQLL + D DS +AAIIRS
Sbjct  68   RLSQLLSTIDADSPEAAIIRS  88



>ref|XP_010681766.1| PREDICTED: transcription factor PRE3-like [Beta vulgaris subsp. 
vulgaris]
Length=94

 Score =   120 bits (302),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 70/82 (85%), Gaps = 1/82 (1%)
 Frame = -1

Query  419  QPAESSRISDDQIADLVSKLQRLIPEIRG-RRSDKVSASKVLQETCNYIRSLHREVDDLS  243
            Q    S ISDDQIADLV KLQ+LIPEIRG RR+   SA++VLQETCNYIRSLHREVDDLS
Sbjct  10   QSGGVSGISDDQIADLVHKLQQLIPEIRGSRRNSDKSANRVLQETCNYIRSLHREVDDLS  69

Query  242  DRLSQLLESTDGDSAQAAIIRS  177
            DRL++LL STD DSAQAAIIRS
Sbjct  70   DRLAELLASTDSDSAQAAIIRS  91



>gb|KDP45499.1| hypothetical protein JCGZ_09748 [Jatropha curcas]
Length=91

 Score =   120 bits (302),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -1

Query  419  QPAESSRISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSD  240
            Q A   RISD+QI +L+SKL++L+PEIR RRSDKVSASKVLQETCNYIR+LHREVDDLS+
Sbjct  8    QSASVPRISDEQIIELISKLRQLLPEIRDRRSDKVSASKVLQETCNYIRNLHREVDDLSE  67

Query  239  RLSQLLESTDGDSAQAAIIRS  177
            RLSQLL + D DS +AAIIRS
Sbjct  68   RLSQLLTTIDADSPEAAIIRS  88



>ref|XP_003613657.1| Transcription factor bHLH135 [Medicago truncatula]
 gb|AES96615.1| transcription factor [Medicago truncatula]
 gb|AFK37543.1| unknown [Medicago truncatula]
Length=93

 Score =   120 bits (301),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = -1

Query  401  RISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLL  222
             I+D QI DL+SKLQ+LIPE+   RS+KVSA+KVLQETCNYI++LHREVDDLSDRLSQLL
Sbjct  16   EITDAQITDLISKLQQLIPELHASRSNKVSATKVLQETCNYIKNLHREVDDLSDRLSQLL  75

Query  221  ESTDGDSAQAAIIRS  177
             STD +SAQAAIIRS
Sbjct  76   ASTDSNSAQAAIIRS  90



>ref|XP_009758713.1| PREDICTED: transcription factor PRE5-like [Nicotiana sylvestris]
Length=92

 Score =   120 bits (301),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 69/77 (90%), Gaps = 0/77 (0%)
 Frame = -1

Query  407  SSRISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQ  228
            +SRISDDQI +L+SKLQ+L+PEIR RR+ K SASKVLQETCNYIRSLH+EVDDLSDRLSQ
Sbjct  13   TSRISDDQIIELMSKLQQLLPEIRTRRTSKASASKVLQETCNYIRSLHKEVDDLSDRLSQ  72

Query  227  LLESTDGDSAQAAIIRS  177
            LL + D DS +AAIIRS
Sbjct  73   LLSTIDADSPEAAIIRS  89



>ref|XP_002323848.2| hypothetical protein POPTR_0017s11760g [Populus trichocarpa]
 gb|EEF03981.2| hypothetical protein POPTR_0017s11760g [Populus trichocarpa]
Length=90

 Score =   120 bits (301),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 73/83 (88%), Gaps = 2/83 (2%)
 Frame = -1

Query  419  QPAESS--RISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDL  246
            +P +SS  RI+DDQI DLVSKL++L+PEI  RRSDKVSASKVLQETCNYIR+LHREVDDL
Sbjct  5    RPRQSSVPRITDDQIIDLVSKLRQLLPEISQRRSDKVSASKVLQETCNYIRNLHREVDDL  64

Query  245  SDRLSQLLESTDGDSAQAAIIRS  177
            S+RLSQLL + D DS +AAIIRS
Sbjct  65   SERLSQLLATIDADSPEAAIIRS  87



>ref|XP_008465587.1| PREDICTED: transcription factor PRE6-like [Cucumis melo]
Length=96

 Score =   120 bits (301),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/75 (83%), Positives = 69/75 (92%), Gaps = 1/75 (1%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRG-RRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLL  222
            ISDDQIADLVSKLQRLIPE+R  R S KVSAS+VLQETCNYIR+LHREVDDLS+RLSQLL
Sbjct  19   ISDDQIADLVSKLQRLIPELRNPRASHKVSASRVLQETCNYIRNLHREVDDLSERLSQLL  78

Query  221  ESTDGDSAQAAIIRS  177
             +T+ DSA+AAIIRS
Sbjct  79   AATENDSAEAAIIRS  93



>ref|NP_001235265.1| uncharacterized protein LOC100527636 [Glycine max]
 ref|XP_006577791.1| PREDICTED: uncharacterized protein LOC100527636 isoform X1 [Glycine 
max]
 gb|ACU16765.1| unknown [Glycine max]
 gb|KHN21870.1| Transcription factor bHLH135 [Glycine soja]
Length=92

 Score =   120 bits (300),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 69/74 (93%), Gaps = 2/74 (3%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLE  219
            I+DDQI DLVSKLQ+L+PEIR RRSDKVSASKVLQETCNYIRSLHREVDDLS+RLS+LL 
Sbjct  17   ITDDQINDLVSKLQQLLPEIRDRRSDKVSASKVLQETCNYIRSLHREVDDLSERLSELLA  76

Query  218  STDGDSAQAAIIRS  177
            +T  D+AQAAIIR+
Sbjct  77   TT--DTAQAAIIRN  88



>gb|KDO82876.1| hypothetical protein CISIN_1g041198mg [Citrus sinensis]
Length=93

 Score =   120 bits (300),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLE  219
            IS DQI DLVSKLQ+LIPE+R RRSDKVSASK+LQETC+YIRSLHREVDDLSDRLS+LL 
Sbjct  17   ISYDQIGDLVSKLQQLIPELRSRRSDKVSASKILQETCDYIRSLHREVDDLSDRLSELLA  76

Query  218  STDGDSAQAAIIRS  177
            S D +SA+AAIIRS
Sbjct  77   SIDSNSAEAAIIRS  90



>gb|KHG28499.1| Transcription factor protein [Gossypium arboreum]
Length=94

 Score =   120 bits (300),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -1

Query  404  SRISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQL  225
            SRISDDQI  LVSKL+ L+PEIR  RSDKVSASKVLQETCNYIRSLH+EV+DLSDRLSQL
Sbjct  16   SRISDDQIIALVSKLRHLLPEIRDNRSDKVSASKVLQETCNYIRSLHKEVEDLSDRLSQL  75

Query  224  LESTDGDSAQAAIIRS  177
            L + D +SA+AAIIRS
Sbjct  76   LATIDAESAEAAIIRS  91



>ref|XP_006431132.1| hypothetical protein CICLE_v10013209mg [Citrus clementina]
 gb|ESR44372.1| hypothetical protein CICLE_v10013209mg [Citrus clementina]
Length=91

 Score =   120 bits (300),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -1

Query  419  QPAESSRISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSD  240
            Q A  SRISDDQI +LV+KL++L+PEIR RR  KVSASKVLQETCNYIRSLHREVDDLS+
Sbjct  8    QAAGVSRISDDQIIELVAKLRQLLPEIRDRRPQKVSASKVLQETCNYIRSLHREVDDLSE  67

Query  239  RLSQLLESTDGDSAQAAIIRS  177
            RLSQLL + D DS +AAIIRS
Sbjct  68   RLSQLLSTIDADSPEAAIIRS  88



>gb|AFK36119.1| unknown [Lotus japonicus]
Length=92

 Score =   120 bits (300),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 69/74 (93%), Gaps = 2/74 (3%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLE  219
            I+DDQI DLVSKLQ+L+PEIR RRSDKVSASKVLQETCNYIRSLHREVDDLS+RLS+LL 
Sbjct  17   ITDDQIHDLVSKLQQLLPEIRERRSDKVSASKVLQETCNYIRSLHREVDDLSERLSELLA  76

Query  218  STDGDSAQAAIIRS  177
            +T  D+AQAAIIR+
Sbjct  77   TT--DTAQAAIIRN  88



>gb|KFK33759.1| hypothetical protein AALP_AA5G056500 [Arabis alpina]
Length=92

 Score =   119 bits (299),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 72/82 (88%), Gaps = 1/82 (1%)
 Frame = -1

Query  419  QPAESSRISDDQIADLVSKLQRLIPEIRGRR-SDKVSASKVLQETCNYIRSLHREVDDLS  243
            Q + +SRISDDQ+ DLVSKL++L+PEIR RR SDKVSASKVLQETCNYIR LHREVD+LS
Sbjct  8    QSSTASRISDDQMIDLVSKLRQLLPEIRERRRSDKVSASKVLQETCNYIRKLHREVDNLS  67

Query  242  DRLSQLLESTDGDSAQAAIIRS  177
            DRLSQLLES D +S +A +IRS
Sbjct  68   DRLSQLLESVDEESPEATVIRS  89



>ref|XP_004135185.1| PREDICTED: transcription factor bHLH135-like [Cucumis sativus]
 ref|XP_004155314.1| PREDICTED: transcription factor bHLH135-like [Cucumis sativus]
 gb|KGN51900.1| Transcription regulator [Cucumis sativus]
Length=95

 Score =   120 bits (300),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/75 (84%), Positives = 69/75 (92%), Gaps = 1/75 (1%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIR-GRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLL  222
            ISD+QIADL+SKLQ+LIPEIR GR S +VSASKVLQETCNYIRSL REVDDLSDRLS+LL
Sbjct  18   ISDEQIADLISKLQQLIPEIRNGRSSSRVSASKVLQETCNYIRSLQREVDDLSDRLSELL  77

Query  221  ESTDGDSAQAAIIRS  177
             STD +SAQAAIIRS
Sbjct  78   ASTDPESAQAAIIRS  92



>ref|XP_002511551.1| transcription regulator, putative [Ricinus communis]
 gb|EEF52153.1| transcription regulator, putative [Ricinus communis]
Length=91

 Score =   119 bits (299),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 69/74 (93%), Gaps = 2/74 (3%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLE  219
            I+DDQI DLVSKLQ+L+PEIR RRSDKVSA+KVLQETCNYIRSLHREVDDLS+RLS+LL 
Sbjct  16   ITDDQILDLVSKLQQLLPEIRNRRSDKVSAAKVLQETCNYIRSLHREVDDLSERLSELLA  75

Query  218  STDGDSAQAAIIRS  177
            +T  D+AQAAIIR+
Sbjct  76   TT--DTAQAAIIRN  87



>ref|XP_002517494.1| transcription regulator, putative [Ricinus communis]
 gb|EEF45036.1| transcription regulator, putative [Ricinus communis]
Length=90

 Score =   119 bits (299),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = -1

Query  401  RISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLL  222
            RI+DDQI DLVSKL++L+PEIR RR DKVSASKVLQETCNYIR+LHREVDDLS+RLSQLL
Sbjct  13   RITDDQIIDLVSKLRQLLPEIRQRRPDKVSASKVLQETCNYIRNLHREVDDLSERLSQLL  72

Query  221  ESTDGDSAQAAIIRS  177
             + D DS +AAIIRS
Sbjct  73   ATIDADSPEAAIIRS  87



>ref|XP_009805005.1| PREDICTED: transcription factor PRE1-like [Nicotiana sylvestris]
Length=92

 Score =   119 bits (299),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLE  219
            ISDDQI DLVSKLQ+L+PEIR RRS+K SASKVLQETCNYIR+L+REVDDLSDRLSQLL 
Sbjct  16   ISDDQIIDLVSKLQQLLPEIRTRRSNKASASKVLQETCNYIRNLNREVDDLSDRLSQLLS  75

Query  218  STDGDSAQAAIIRS  177
            + D DS +AAIIRS
Sbjct  76   TIDADSPEAAIIRS  89



>ref|XP_010528329.1| PREDICTED: transcription factor PRE5 [Tarenaya hassleriana]
Length=92

 Score =   119 bits (298),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 73/82 (89%), Gaps = 1/82 (1%)
 Frame = -1

Query  419  QPAESSRISDDQIADLVSKLQRLIPEIRGRR-SDKVSASKVLQETCNYIRSLHREVDDLS  243
            Q + S RISDDQI DLV KL++L+PEIR RR S+KVSASKVLQETCNYIR+LHREVD+LS
Sbjct  8    QSSNSPRISDDQIIDLVGKLRQLLPEIRERRRSNKVSASKVLQETCNYIRNLHREVDNLS  67

Query  242  DRLSQLLESTDGDSAQAAIIRS  177
            +RLSQLL+S D DSA+AA+IRS
Sbjct  68   ERLSQLLDSVDEDSAEAAVIRS  89



>ref|XP_010032347.1| PREDICTED: transcription factor PRE5-like [Eucalyptus grandis]
 gb|KCW51755.1| hypothetical protein EUGRSUZ_J01215 [Eucalyptus grandis]
Length=93

 Score =   119 bits (298),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = -1

Query  446  MssrrsrsRQPAESSRISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSL  267
            MS+RRS S Q    SRI+DDQ+ +LVSKL++L+PEIR  RSDKVSASKVLQETC+YIRSL
Sbjct  1    MSNRRSSSTQSGTPSRITDDQMIELVSKLRQLLPEIRSSRSDKVSASKVLQETCSYIRSL  60

Query  266  HREVDDLSDRLSQLLESTDGDSAQAAIIRS  177
            HREV DLS+RLSQLL + D DSA+AAIIRS
Sbjct  61   HREVADLSERLSQLLSTVDADSAEAAIIRS  90



>ref|XP_009115425.1| PREDICTED: transcription factor PRE6-like [Brassica rapa]
 emb|CDY16207.1| BnaA09g29410D [Brassica napus]
Length=95

 Score =   119 bits (298),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 58/72 (81%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = -1

Query  392  DDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLEST  213
            DDQI+DLV++LQ LIPE+R RRSDKVSAS VLQETCNYIR+LHREVDDLSDRLS+LL +T
Sbjct  20   DDQISDLVTRLQHLIPELRRRRSDKVSASTVLQETCNYIRNLHREVDDLSDRLSELLATT  79

Query  212  DGDSAQAAIIRS  177
            D +SA+AAIIRS
Sbjct  80   DDNSAEAAIIRS  91



>ref|XP_002274840.1| PREDICTED: transcription factor PRE3 [Vitis vinifera]
 emb|CBI15249.3| unnamed protein product [Vitis vinifera]
Length=91

 Score =   119 bits (297),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 69/74 (93%), Gaps = 2/74 (3%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLE  219
            I+DDQI DLVSKLQ+L+PEIRGR SDKVSA+KVLQETCNYIRSL+REVDDLS+RLS+LL 
Sbjct  16   ITDDQINDLVSKLQQLLPEIRGRHSDKVSAAKVLQETCNYIRSLNREVDDLSERLSELLA  75

Query  218  STDGDSAQAAIIRS  177
            +T  DSAQAAIIRS
Sbjct  76   TT--DSAQAAIIRS  87



>ref|XP_002283094.1| PREDICTED: transcription factor PRE6 [Vitis vinifera]
 emb|CBI22188.3| unnamed protein product [Vitis vinifera]
Length=90

 Score =   119 bits (297),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 59/72 (82%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = -1

Query  392  DDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLEST  213
            DDQI +LVSKLQ+L+PEIR RRSDKVSASKVLQETCNYIRSLHREVDDLS+RLS+LL + 
Sbjct  16   DDQIIELVSKLQQLLPEIRNRRSDKVSASKVLQETCNYIRSLHREVDDLSERLSRLLATV  75

Query  212  DGDSAQAAIIRS  177
            D DS +AAIIRS
Sbjct  76   DADSPEAAIIRS  87



>ref|XP_004296550.1| PREDICTED: transcription factor bHLH135-like [Fragaria vesca 
subsp. vesca]
Length=94

 Score =   119 bits (297),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLE  219
            I DDQI +LVSKL++L+PEIR RRSDKVSASKVLQETC+YIR+LHREVDDLS+RLSQLL 
Sbjct  17   IKDDQIIELVSKLRQLVPEIRDRRSDKVSASKVLQETCSYIRNLHREVDDLSERLSQLLA  76

Query  218  STDGDSAQAAIIRS  177
            + D DSA+AAIIRS
Sbjct  77   TIDADSAEAAIIRS  90



>ref|XP_004146747.1| PREDICTED: transcription factor bHLH135-like [Cucumis sativus]
 ref|XP_004162540.1| PREDICTED: transcription factor bHLH135-like [Cucumis sativus]
 gb|KGN47805.1| hypothetical protein Csa_6G404200 [Cucumis sativus]
Length=96

 Score =   118 bits (295),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 69/80 (86%), Gaps = 1/80 (1%)
 Frame = -1

Query  413  AESSRISDDQIADLVSKLQRLIPEIRG-RRSDKVSASKVLQETCNYIRSLHREVDDLSDR  237
            A S  ISDDQIADLVSKLQRLIPE+R  R S K SAS+VLQETCNYIR+LHREVDDLS+R
Sbjct  14   AASPLISDDQIADLVSKLQRLIPELRNPRASHKASASRVLQETCNYIRNLHREVDDLSER  73

Query  236  LSQLLESTDGDSAQAAIIRS  177
            LSQLL +T+ DSA+A IIRS
Sbjct  74   LSQLLAATENDSAEATIIRS  93



>ref|XP_010102446.1| hypothetical protein L484_006129 [Morus notabilis]
 gb|EXB93467.1| hypothetical protein L484_006129 [Morus notabilis]
Length=91

 Score =   118 bits (295),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 69/74 (93%), Gaps = 2/74 (3%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLE  219
            I+DDQI DLVSKLQ+L+PEIR RRSDKVSA+KVLQETCNYIRSLHREVDDLS+RLS+LL 
Sbjct  16   ITDDQINDLVSKLQQLLPEIRDRRSDKVSAAKVLQETCNYIRSLHREVDDLSERLSELLA  75

Query  218  STDGDSAQAAIIRS  177
            ++  D+AQAAIIRS
Sbjct  76   TS--DTAQAAIIRS  87



>ref|XP_010066932.1| PREDICTED: transcription factor PRE6 [Eucalyptus grandis]
 gb|KCW64977.1| hypothetical protein EUGRSUZ_G02519 [Eucalyptus grandis]
Length=94

 Score =   118 bits (295),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = -1

Query  419  QPAESSRISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSD  240
            QP+  + +SD+QI+DL+SKL++LIP++R   +DKVSASK+LQETCNYIRSLHREVDDLSD
Sbjct  11   QPSSVAGMSDEQISDLLSKLRQLIPQLRTNHTDKVSASKLLQETCNYIRSLHREVDDLSD  70

Query  239  RLSQLLESTDGDSAQAAIIRS  177
            +LSQLL STD DS QAAIIRS
Sbjct  71   QLSQLLASTDRDSDQAAIIRS  91



>ref|XP_007037282.1| Activation-tagged BRI1(brassinosteroid-insensitive 1)-suppressor 
1 [Theobroma cacao]
 gb|EOY21783.1| Activation-tagged BRI1(brassinosteroid-insensitive 1)-suppressor 
1 [Theobroma cacao]
Length=91

 Score =   118 bits (295),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 68/74 (92%), Gaps = 2/74 (3%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLE  219
            I+DDQI DLV+KLQ+L+PEIR R SDKVSA+KVLQETCNYIRSLHREVDDLS+RLS+LL 
Sbjct  16   ITDDQIDDLVTKLQQLLPEIRNRHSDKVSAAKVLQETCNYIRSLHREVDDLSERLSELLA  75

Query  218  STDGDSAQAAIIRS  177
            +T  DSAQAAIIRS
Sbjct  76   TT--DSAQAAIIRS  87



>ref|XP_009602440.1| PREDICTED: transcription factor PRE5-like [Nicotiana tomentosiformis]
Length=93

 Score =   118 bits (295),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 69/77 (90%), Gaps = 0/77 (0%)
 Frame = -1

Query  407  SSRISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQ  228
            +SRISDDQI +L+SKLQ+L+PEI  RR++K SASKVLQETCNYIRSLH+EVDDLSDRLSQ
Sbjct  14   TSRISDDQIIELMSKLQQLLPEIPTRRTNKASASKVLQETCNYIRSLHKEVDDLSDRLSQ  73

Query  227  LLESTDGDSAQAAIIRS  177
            LL + D DS +AAIIRS
Sbjct  74   LLSTIDADSPEAAIIRS  90



>ref|XP_003527066.1| PREDICTED: transcription factor bHLH135 [Glycine max]
 gb|KHN30821.1| Transcription factor bHLH135 [Glycine soja]
Length=92

 Score =   117 bits (294),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 69/74 (93%), Gaps = 2/74 (3%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLE  219
            I+DDQI DLVSKLQ+L+PEIR RRSDKVSASKVLQETCNYIRSLHREV DLS+RLS+LL+
Sbjct  17   ITDDQINDLVSKLQQLLPEIRDRRSDKVSASKVLQETCNYIRSLHREVGDLSERLSELLD  76

Query  218  STDGDSAQAAIIRS  177
            +T  D+AQAAIIR+
Sbjct  77   TT--DTAQAAIIRN  88



>emb|CDP02219.1| unnamed protein product [Coffea canephora]
Length=93

 Score =   117 bits (294),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLE  219
            I+DDQI +LVSKLQ+L+PEIR RRS+K SASKVLQ+TCNYIRSLH+EVDDLSDRLSQLL 
Sbjct  15   ITDDQIIELVSKLQQLLPEIRTRRSNKASASKVLQDTCNYIRSLHKEVDDLSDRLSQLLS  74

Query  218  STDGDSAQAAIIRS  177
            + D DS +AAIIRS
Sbjct  75   TIDADSPEAAIIRS  88



>ref|XP_003621179.1| Transcription factor style2.1 [Medicago truncatula]
 gb|AES77397.1| transcription factor [Medicago truncatula]
Length=93

 Score =   117 bits (294),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = -1

Query  419  QPAESSRISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSD  240
            Q   S+RISDDQI DLV KL++L+PEIR RRSDKV ASKVLQETCNYIR+L REVDDLS 
Sbjct  9    QSGGSTRISDDQIIDLVCKLRQLVPEIRNRRSDKVPASKVLQETCNYIRNLQREVDDLSL  68

Query  239  RLSQLLESTDGDSAQAAIIRS  177
            RLSQLL + D DSA+A+IIRS
Sbjct  69   RLSQLLATIDSDSAEASIIRS  89



>ref|XP_010693223.1| PREDICTED: transcription factor PRE6 [Beta vulgaris subsp. vulgaris]
Length=93

 Score =   117 bits (294),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLE  219
            ISDDQI  LVSKLQ+L+PE+R RRSDKVSASKVLQETCNYIR+L RE+DDLSDRLSQLL 
Sbjct  16   ISDDQIIQLVSKLQQLVPEVRQRRSDKVSASKVLQETCNYIRNLQREMDDLSDRLSQLLT  75

Query  218  STDGDSAQAAIIRS  177
            + D DS +A IIRS
Sbjct  76   TVDADSEEAQIIRS  89



>ref|XP_008339920.1| PREDICTED: transcription factor PRE6-like [Malus domestica]
Length=96

 Score =   117 bits (294),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/72 (81%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = -1

Query  392  DDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLEST  213
            DDQI DLVSKLQ+L+PEIR RRS+K SASKVLQETCNYIR+LHREVDDLS+RLS+LL +T
Sbjct  22   DDQITDLVSKLQQLLPEIRPRRSNKASASKVLQETCNYIRNLHREVDDLSERLSELLATT  81

Query  212  DGDSAQAAIIRS  177
            D D+ QAAIIRS
Sbjct  82   DMDNDQAAIIRS  93



>ref|NP_974372.1| protein PACLOBUTRAZOL RESISTANCE 5 [Arabidopsis thaliana]
 sp|Q9LJX1.1|PRE5_ARATH RecName: Full=Transcription factor PRE5; AltName: Full=Basic 
helix-loop-helix protein 164; Short=AtbHLH164; Short=bHLH 164; 
AltName: Full=Protein PACLOBUTRAZOL RESISTANCE 5; AltName: 
Full=bHLH transcription factor bHLH164 [Arabidopsis thaliana]
 dbj|BAB02128.1| DNA-binding protein-like [Arabidopsis thaliana]
 gb|ABD57465.1| At3g28857 [Arabidopsis thaliana]
 gb|AEE77497.1| basic helix-loop-helix (bHLH) DNA-binding family protein [Arabidopsis 
thaliana]
Length=92

 Score =   117 bits (293),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 71/82 (87%), Gaps = 1/82 (1%)
 Frame = -1

Query  419  QPAESSRISDDQIADLVSKLQRLIPEIRGRR-SDKVSASKVLQETCNYIRSLHREVDDLS  243
            Q + +SRISDDQ+ DLVSKL++ +PEI  RR SDKVSASKVLQETCNYIR LHREVD+LS
Sbjct  8    QTSNASRISDDQMIDLVSKLRQFLPEIHERRRSDKVSASKVLQETCNYIRKLHREVDNLS  67

Query  242  DRLSQLLESTDGDSAQAAIIRS  177
            DRLSQLL+S D DS +AA+IRS
Sbjct  68   DRLSQLLDSVDEDSPEAAVIRS  89



>ref|XP_004499430.1| PREDICTED: transcription factor bHLH135-like [Cicer arietinum]
Length=93

 Score =   117 bits (293),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 68/74 (92%), Gaps = 2/74 (3%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLE  219
            I+DDQI DLVSKLQ+L+PEIR R SDKVSAS+VLQETCNYIRSLHREVDDLS+RLS+LL 
Sbjct  18   ITDDQIHDLVSKLQQLLPEIRNRSSDKVSASRVLQETCNYIRSLHREVDDLSERLSELLA  77

Query  218  STDGDSAQAAIIRS  177
            +T  DSAQAAIIR+
Sbjct  78   TT--DSAQAAIIRN  89



>gb|KEH24995.1| transcription factor [Medicago truncatula]
Length=92

 Score =   117 bits (293),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLE  219
            ISDDQI +LVSKL++L+PEIR RRSDKVSASKVLQETCNYIR+LHREVDDLS+RLSQLL 
Sbjct  15   ISDDQIIELVSKLRQLVPEIRHRRSDKVSASKVLQETCNYIRNLHREVDDLSERLSQLLV  74

Query  218  STDGDSAQAAIIRS  177
            + D DS +A IIRS
Sbjct  75   TIDADSPEANIIRS  88



>ref|XP_011044025.1| PREDICTED: transcription factor PRE3-like [Populus euphratica]
Length=91

 Score =   117 bits (293),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/72 (79%), Positives = 68/72 (94%), Gaps = 2/72 (3%)
 Frame = -1

Query  392  DDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLEST  213
            DDQI DLV+KLQ+L+PEIR RRSDKVSA+K+LQETCNYI+SLHREVDDLS+RLS+LLE+T
Sbjct  18   DDQILDLVTKLQQLLPEIRNRRSDKVSAAKILQETCNYIKSLHREVDDLSERLSELLETT  77

Query  212  DGDSAQAAIIRS  177
              D+AQAAIIR+
Sbjct  78   --DTAQAAIIRN  87



>ref|XP_007210171.1| hypothetical protein PRUPE_ppa018631mg [Prunus persica]
 gb|EMJ11370.1| hypothetical protein PRUPE_ppa018631mg [Prunus persica]
Length=92

 Score =   117 bits (293),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 70/77 (91%), Gaps = 3/77 (4%)
 Frame = -1

Query  404  SRISDDQIADLVSKLQRLIPEIRG-RRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQ  228
            +RISDDQI DLVSKLQ+L+PEIR  RRSDKVSA+ VLQETCNYIRSLHREVDDLS+RLS+
Sbjct  14   ARISDDQINDLVSKLQQLLPEIRNSRRSDKVSAATVLQETCNYIRSLHREVDDLSERLSE  73

Query  227  LLESTDGDSAQAAIIRS  177
            LL +T  DSAQAA+IRS
Sbjct  74   LLATT--DSAQAAVIRS  88



>ref|XP_008389506.1| PREDICTED: transcription factor PRE6-like [Malus domestica]
Length=96

 Score =   117 bits (293),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 56/72 (78%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = -1

Query  392  DDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLEST  213
            D+QI DLV+KLQ+L+PEIR RRSDK SASKVL+ETCNYIR+LHREVDDLS+RLS+LL +T
Sbjct  22   DEQITDLVTKLQQLLPEIRNRRSDKASASKVLEETCNYIRNLHREVDDLSERLSELLATT  81

Query  212  DGDSAQAAIIRS  177
            D D+ QAAIIRS
Sbjct  82   DMDNDQAAIIRS  93



>emb|CAN67278.1| hypothetical protein VITISV_022020 [Vitis vinifera]
Length=91

 Score =   117 bits (292),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 68/74 (92%), Gaps = 2/74 (3%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLE  219
            I+DDQI DLVSKLQ+L+PEIRGR SDKVSA+KVLQETCNYIRSL+REVDDLS+RLS+LL 
Sbjct  16   ITDDQINDLVSKLQQLLPEIRGRHSDKVSAAKVLQETCNYIRSLNREVDDLSERLSELLA  75

Query  218  STDGDSAQAAIIRS  177
            +T  D AQAAIIRS
Sbjct  76   TT--DXAQAAIIRS  87



>ref|XP_006439625.1| hypothetical protein CICLE_v10023072mg [Citrus clementina]
 ref|XP_006476632.1| PREDICTED: transcription factor bHLH135-like [Citrus sinensis]
 gb|ESR52865.1| hypothetical protein CICLE_v10023072mg [Citrus clementina]
 gb|KDO76090.1| hypothetical protein CISIN_1g048534mg [Citrus sinensis]
Length=91

 Score =   117 bits (292),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 67/74 (91%), Gaps = 2/74 (3%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLE  219
            I+DDQI DLVSKLQ+L+PE+R  RSDKVSA KVLQETCNYIRSLHREVDDLS+RLS+LL 
Sbjct  16   ITDDQINDLVSKLQQLLPELRNNRSDKVSAGKVLQETCNYIRSLHREVDDLSERLSELLA  75

Query  218  STDGDSAQAAIIRS  177
            +T  D+AQAAIIRS
Sbjct  76   TT--DTAQAAIIRS  87



>ref|XP_008459306.1| PREDICTED: transcription factor PRE6-like [Cucumis melo]
 gb|KGN52451.1| Transcription regulator [Cucumis sativus]
Length=91

 Score =   117 bits (292),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/72 (81%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = -1

Query  392  DDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLEST  213
            DDQI +LVSKL++L+PEIR RR DKVSASKVLQETCNYIR+LHREVDDLS+RLSQLL + 
Sbjct  16   DDQIIELVSKLRQLVPEIRHRRPDKVSASKVLQETCNYIRNLHREVDDLSERLSQLLSTI  75

Query  212  DGDSAQAAIIRS  177
            D DSA+AAIIRS
Sbjct  76   DSDSAEAAIIRS  87



>ref|XP_009111609.1| PREDICTED: transcription factor PRE5 [Brassica rapa]
 emb|CDY20013.1| BnaA09g02380D [Brassica napus]
Length=92

 Score =   117 bits (292),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 68/76 (89%), Gaps = 1/76 (1%)
 Frame = -1

Query  401  RISDDQIADLVSKLQRLIPEIRGRR-SDKVSASKVLQETCNYIRSLHREVDDLSDRLSQL  225
            RISDDQ+ DLVSKL+ L+PEIR RR SDKVSASKVLQETCNYIR LHREVD+LSDRLSQL
Sbjct  14   RISDDQMIDLVSKLRVLLPEIRERRRSDKVSASKVLQETCNYIRKLHREVDNLSDRLSQL  73

Query  224  LESTDGDSAQAAIIRS  177
            L+S D DS +AA+IRS
Sbjct  74   LDSVDEDSQEAAVIRS  89



>ref|XP_011012195.1| PREDICTED: transcription factor PRE1-like [Populus euphratica]
Length=90

 Score =   116 bits (291),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = -1

Query  401  RISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLL  222
            RI+DDQI DLVSKL++L+PEI  RRS+K SASKVLQETCNYIR+LHREVDDLS+RLSQLL
Sbjct  13   RITDDQIIDLVSKLRQLLPEISQRRSEKASASKVLQETCNYIRNLHREVDDLSERLSQLL  72

Query  221  ESTDGDSAQAAIIRS  177
             + D DS +AAIIRS
Sbjct  73   ATIDADSPEAAIIRS  87



>gb|ABK95506.1| unknown [Populus trichocarpa]
Length=84

 Score =   116 bits (290),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = -1

Query  401  RISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLL  222
            RI+DDQI  LVSKL++L+PEIR RRSDKVSASKVLQETCNYI++LHREVDDLS+RLSQLL
Sbjct  7    RITDDQIIHLVSKLRQLLPEIRQRRSDKVSASKVLQETCNYIKNLHREVDDLSERLSQLL  66

Query  221  ESTDGDSAQAAIIRS  177
             + D DS +A IIRS
Sbjct  67   ATIDSDSPEAEIIRS  81



>ref|XP_004138158.1| PREDICTED: transcription factor bHLH135-like [Cucumis sativus]
 ref|XP_004154981.1| PREDICTED: transcription factor bHLH135-like [Cucumis sativus]
Length=92

 Score =   116 bits (291),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 69/74 (93%), Gaps = 2/74 (3%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLE  219
            I+DDQI DLVSKLQ+L+PEIR R+SDKVSASKVLQETCNYIR+LHREVDDLS+RLS+LL 
Sbjct  17   ITDDQINDLVSKLQQLLPEIRHRQSDKVSASKVLQETCNYIRNLHREVDDLSERLSELLA  76

Query  218  STDGDSAQAAIIRS  177
            ++  D+AQAAIIRS
Sbjct  77   TS--DTAQAAIIRS  88



>ref|XP_009591471.1| PREDICTED: transcription factor PRE1-like [Nicotiana tomentosiformis]
Length=93

 Score =   116 bits (291),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 58/72 (81%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = -1

Query  392  DDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLEST  213
            DDQI DLVSKLQ+L+PEIR RRS+K SASKVLQETCNYIR+L+REVDDLSDRLSQLL + 
Sbjct  19   DDQIIDLVSKLQQLLPEIRTRRSNKASASKVLQETCNYIRNLNREVDDLSDRLSQLLSTI  78

Query  212  DGDSAQAAIIRS  177
            D DS +AAIIRS
Sbjct  79   DADSPEAAIIRS  90



>ref|XP_002305320.1| hypothetical protein POPTR_0004s13380g [Populus trichocarpa]
 gb|EEE85831.1| hypothetical protein POPTR_0004s13380g [Populus trichocarpa]
Length=90

 Score =   116 bits (290),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = -1

Query  401  RISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLL  222
            RI+DDQI  LVSKL++L+PEIR RRSDKVSASKVLQETCNYI++LHREVDDLS+RLSQLL
Sbjct  13   RITDDQIIHLVSKLRQLLPEIRQRRSDKVSASKVLQETCNYIKNLHREVDDLSERLSQLL  72

Query  221  ESTDGDSAQAAIIRS  177
             + D DS +A IIRS
Sbjct  73   ATIDSDSPEAEIIRS  87



>ref|XP_004490021.1| PREDICTED: transcription factor bHLH135-like [Cicer arietinum]
Length=94

 Score =   116 bits (291),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLE  219
            I+D QI DLV+KL RLIPE+R  RS KVSA+KVLQETCNYI++LHREVDDLSDRLSQLL 
Sbjct  17   ITDAQITDLVAKLLRLIPELRPSRSGKVSAAKVLQETCNYIKNLHREVDDLSDRLSQLLA  76

Query  218  STDGDSAQAAIIRS  177
            +TD +SAQAAIIRS
Sbjct  77   TTDSNSAQAAIIRS  90



>ref|NP_001234290.1| transcription factor style2.1 [Solanum lycopersicum]
 ref|XP_006338463.1| PREDICTED: transcription factor bHLH135-like [Solanum tuberosum]
 gb|ABX82930.1| transcription factor style2.1 [Solanum lycopersicum]
 gb|ABX82931.1| transcription factor style2.1 [Solanum pennellii]
 gb|ABX82932.1| transcription factor style2.1 [Solanum lycopersicum]
 gb|ABX82933.1| transcription factor style2.1 [Solanum pennellii]
Length=92

 Score =   116 bits (290),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLE  219
            ISDDQI +LVSKLQ+L+PEIR RRS K SASKVLQETCNYIR+L+R+VDDLSDRLSQLL 
Sbjct  16   ISDDQIIELVSKLQQLLPEIRNRRSSKASASKVLQETCNYIRNLNRQVDDLSDRLSQLLS  75

Query  218  STDGDSAQAAIIRS  177
            + D DS +AAIIRS
Sbjct  76   TIDADSPEAAIIRS  89



>ref|XP_010037162.1| PREDICTED: transcription factor PRE3-like [Eucalyptus grandis]
 gb|KCW48828.1| hypothetical protein EUGRSUZ_K02464 [Eucalyptus grandis]
Length=91

 Score =   116 bits (290),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 68/74 (92%), Gaps = 2/74 (3%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLE  219
            ISDDQI DLVSKLQ+L+PEIR RRSDKVSA+KVLQETCN+IRSLHREVDDLS+RLS+LL 
Sbjct  16   ISDDQIIDLVSKLQQLLPEIRNRRSDKVSAAKVLQETCNHIRSLHREVDDLSERLSELLA  75

Query  218  STDGDSAQAAIIRS  177
            ++D D  QAA+IR+
Sbjct  76   NSDSD--QAAVIRN  87



>ref|XP_011013171.1| PREDICTED: transcription factor PRE1-like [Populus euphratica]
Length=90

 Score =   116 bits (290),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = -1

Query  401  RISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLL  222
            RI+DDQI +LVSKL++L+PEIR RRSDKVSASKVLQETCNYI++LHREVDDLS+RLSQLL
Sbjct  13   RITDDQIINLVSKLRQLLPEIRQRRSDKVSASKVLQETCNYIKNLHREVDDLSERLSQLL  72

Query  221  ESTDGDSAQAAIIRS  177
             + D DS +A IIRS
Sbjct  73   ATIDFDSPEAEIIRS  87



>ref|XP_007215198.1| hypothetical protein PRUPE_ppa014004mg [Prunus persica]
 ref|XP_007215199.1| hypothetical protein PRUPE_ppa014004mg [Prunus persica]
 ref|XP_008230751.1| PREDICTED: transcription factor PRE6-like [Prunus mume]
 gb|EMJ16397.1| hypothetical protein PRUPE_ppa014004mg [Prunus persica]
 gb|EMJ16398.1| hypothetical protein PRUPE_ppa014004mg [Prunus persica]
Length=91

 Score =   115 bits (289),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLE  219
            I DDQI +LVSKL++L+PEIR RRSDKVSASKVLQETC+YIR+LHREVDDLS+RLSQLL 
Sbjct  14   IKDDQIIELVSKLRQLVPEIRDRRSDKVSASKVLQETCSYIRNLHREVDDLSERLSQLLS  73

Query  218  STDGDSAQAAIIRS  177
            + D DS +AAIIRS
Sbjct  74   TIDADSPEAAIIRS  87



>ref|XP_009360364.1| PREDICTED: transcription factor PRE6 [Pyrus x bretschneideri]
Length=96

 Score =   115 bits (289),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 56/72 (78%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = -1

Query  392  DDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLEST  213
            D+QI DLV+KLQ+L+PEIR RRSDK SASKVLQ+TCNYIR+LHREVDDLS+RLS+LL +T
Sbjct  22   DEQITDLVTKLQQLLPEIRNRRSDKASASKVLQDTCNYIRNLHREVDDLSERLSELLATT  81

Query  212  DGDSAQAAIIRS  177
            D D+ QAAIIRS
Sbjct  82   DIDNDQAAIIRS  93



>ref|XP_011047163.1| PREDICTED: transcription factor PRE3-like [Populus euphratica]
 ref|XP_011047164.1| PREDICTED: transcription factor PRE3-like [Populus euphratica]
Length=91

 Score =   115 bits (289),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/77 (74%), Positives = 69/77 (90%), Gaps = 2/77 (3%)
 Frame = -1

Query  407  SSRISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQ  228
             SRI+DDQI DLV+KLQ+L+P  R RRS+KVSA+K LQETCNYI+SLHREVDDLS+RLS+
Sbjct  13   GSRINDDQILDLVTKLQQLLPGTRNRRSEKVSAAKALQETCNYIKSLHREVDDLSERLSE  72

Query  227  LLESTDGDSAQAAIIRS  177
            LLE+T  D+AQAAIIR+
Sbjct  73   LLETT--DTAQAAIIRN  87



>ref|XP_008239815.1| PREDICTED: transcription factor PRE3-like [Prunus mume]
Length=92

 Score =   115 bits (289),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/77 (79%), Positives = 69/77 (90%), Gaps = 3/77 (4%)
 Frame = -1

Query  404  SRISDDQIADLVSKLQRLIPEIRG-RRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQ  228
            +RISDDQI DLVSKLQ+L+PEIR  RRSDK SA+ VLQETCNYIRSLHREVDDLS+RLS+
Sbjct  14   ARISDDQINDLVSKLQQLLPEIRNSRRSDKASAATVLQETCNYIRSLHREVDDLSERLSE  73

Query  227  LLESTDGDSAQAAIIRS  177
            LL +T  DSAQAA+IRS
Sbjct  74   LLATT--DSAQAAVIRS  88



>ref|XP_008453188.1| PREDICTED: transcription factor PRE3-like [Cucumis melo]
Length=92

 Score =   115 bits (288),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 69/74 (93%), Gaps = 2/74 (3%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLE  219
            I+DDQI DLVSKLQ+L+PEIR R+SDKVSA+KVLQETCNYIR+LHREVDDLS+RLS+LL 
Sbjct  17   ITDDQINDLVSKLQQLLPEIRHRQSDKVSAAKVLQETCNYIRNLHREVDDLSERLSELLA  76

Query  218  STDGDSAQAAIIRS  177
            ++  D+AQAAIIRS
Sbjct  77   TS--DTAQAAIIRS  88



>ref|XP_006395335.1| hypothetical protein EUTSA_v10005197mg [Eutrema salsugineum]
 gb|ESQ32621.1| hypothetical protein EUTSA_v10005197mg [Eutrema salsugineum]
Length=92

 Score =   115 bits (288),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 68/76 (89%), Gaps = 1/76 (1%)
 Frame = -1

Query  401  RISDDQIADLVSKLQRLIPEIRGRR-SDKVSASKVLQETCNYIRSLHREVDDLSDRLSQL  225
            RISDDQ+ DLVSKL++L+PEIR RR SDKVSASKVLQETCNYIR LH EVD+LSDRLSQL
Sbjct  14   RISDDQMIDLVSKLRQLLPEIRERRRSDKVSASKVLQETCNYIRKLHSEVDNLSDRLSQL  73

Query  224  LESTDGDSAQAAIIRS  177
            L+S D DS +AA+IRS
Sbjct  74   LDSVDEDSHEAAVIRS  89



>ref|XP_009787611.1| PREDICTED: transcription factor PRE1-like [Nicotiana sylvestris]
Length=90

 Score =   115 bits (287),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/72 (81%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = -1

Query  392  DDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLEST  213
            DDQI DLVSKLQ+L+PEIR RRS K SASKVLQETCNYIRSL+RE+DDLSDRLSQLL + 
Sbjct  16   DDQIIDLVSKLQQLLPEIRTRRSSKASASKVLQETCNYIRSLNRELDDLSDRLSQLLSTV  75

Query  212  DGDSAQAAIIRS  177
            D DS +AAIIRS
Sbjct  76   DADSPEAAIIRS  87



>emb|CDY00110.1| BnaC09g01910D [Brassica napus]
Length=92

 Score =   115 bits (287),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 68/76 (89%), Gaps = 1/76 (1%)
 Frame = -1

Query  401  RISDDQIADLVSKLQRLIPEIRGRR-SDKVSASKVLQETCNYIRSLHREVDDLSDRLSQL  225
            RISDDQ+ DLVSKL+ L+PEIR RR SDKVSASKVLQETCNYIR LHR+VD+LSDRLSQL
Sbjct  14   RISDDQMIDLVSKLRVLLPEIRERRRSDKVSASKVLQETCNYIRKLHRKVDNLSDRLSQL  73

Query  224  LESTDGDSAQAAIIRS  177
            L+S D DS +AA+IRS
Sbjct  74   LDSVDEDSQEAAVIRS  89



>gb|AAM67002.1| DNA-binding protein-like [Arabidopsis thaliana]
Length=92

 Score =   115 bits (287),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/82 (73%), Positives = 70/82 (85%), Gaps = 1/82 (1%)
 Frame = -1

Query  419  QPAESSRISDDQIADLVSKLQRLIPEIRGRR-SDKVSASKVLQETCNYIRSLHREVDDLS  243
            Q + +SRISDDQ+ DLVSKL++ +PEI  RR SDKVSAS VLQETCNYIR LHREVD+LS
Sbjct  8    QTSNASRISDDQMIDLVSKLRQFLPEIHERRRSDKVSASXVLQETCNYIRKLHREVDNLS  67

Query  242  DRLSQLLESTDGDSAQAAIIRS  177
            DRLSQLL+S D DS +AA+IRS
Sbjct  68   DRLSQLLDSVDEDSPEAAVIRS  89



>ref|XP_008437438.1| PREDICTED: transcription factor PRE3-like [Cucumis melo]
Length=90

 Score =   115 bits (287),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 67/74 (91%), Gaps = 2/74 (3%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLE  219
            ISD+QI DLV KLQ+L+PEIR R SDKVSA+KVLQETCNYIRSLHREVDDLS+RLS+LL 
Sbjct  15   ISDEQITDLVHKLQQLLPEIRNRHSDKVSAAKVLQETCNYIRSLHREVDDLSERLSELLA  74

Query  218  STDGDSAQAAIIRS  177
            ++  D+AQAAIIRS
Sbjct  75   TS--DTAQAAIIRS  86



>ref|XP_010551523.1| PREDICTED: transcription factor PRE6-like [Tarenaya hassleriana]
Length=94

 Score =   115 bits (287),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLE  219
            IS+DQIADLVSKLQRLIPE+R RRSDKVSAS+VLQETC YI++LH+EVD LS+RLS+LL 
Sbjct  17   ISEDQIADLVSKLQRLIPELRRRRSDKVSASRVLQETCEYIKNLHKEVDGLSERLSELLA  76

Query  218  STDGDSAQAAIIRS  177
            STD +S +AAIIR+
Sbjct  77   STDDNSPEAAIIRN  90



>ref|XP_009610749.1| PREDICTED: transcription factor PRE3-like [Nicotiana tomentosiformis]
Length=91

 Score =   115 bits (287),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 68/74 (92%), Gaps = 2/74 (3%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLE  219
            IS+DQI DLVSKLQ+L+PE+R R SDKVSA++VLQETCNYIRSLHREVDDLSDRLS+LLE
Sbjct  16   ISEDQINDLVSKLQQLLPELRNRSSDKVSAARVLQETCNYIRSLHREVDDLSDRLSELLE  75

Query  218  STDGDSAQAAIIRS  177
            ++  D+ QAA+IRS
Sbjct  76   TS--DTTQAALIRS  87



>ref|XP_004511222.1| PREDICTED: transcription factor bHLH135-like [Cicer arietinum]
Length=92

 Score =   114 bits (286),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 58/77 (75%), Positives = 69/77 (90%), Gaps = 1/77 (1%)
 Frame = -1

Query  407  SSRISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQ  228
            SS I+D QI DL++KLQRLIPE+  RRSDKVS +KVL+ETCNYI++LHREVDDLSDRLSQ
Sbjct  14   SSEITDAQINDLINKLQRLIPEL-ARRSDKVSPTKVLKETCNYIKNLHREVDDLSDRLSQ  72

Query  227  LLESTDGDSAQAAIIRS  177
            LL++ D +SAQAAIIRS
Sbjct  73   LLDTIDPNSAQAAIIRS  89



>ref|XP_002318605.1| bHLH family protein [Populus trichocarpa]
 gb|EEE96825.1| bHLH family protein [Populus trichocarpa]
Length=91

 Score =   114 bits (285),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/72 (78%), Positives = 67/72 (93%), Gaps = 2/72 (3%)
 Frame = -1

Query  392  DDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLEST  213
            DDQI DLV+KLQ+L+PEIR RRSDKVSA+K+LQETCNYI+SLHREV DLS+RLS+LLE+T
Sbjct  18   DDQILDLVTKLQQLLPEIRNRRSDKVSAAKILQETCNYIKSLHREVGDLSERLSELLETT  77

Query  212  DGDSAQAAIIRS  177
              D+AQAAIIR+
Sbjct  78   --DTAQAAIIRN  87



>ref|XP_009369325.1| PREDICTED: transcription factor PRE3 [Pyrus x bretschneideri]
Length=92

 Score =   114 bits (285),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 68/75 (91%), Gaps = 3/75 (4%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRG-RRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLL  222
            ISDDQI DLVSKLQ+L+PEIR  RRSDKVSAS VLQETCNYIR+LHREVDDLS+RLS+LL
Sbjct  16   ISDDQINDLVSKLQQLLPEIRNSRRSDKVSASTVLQETCNYIRNLHREVDDLSERLSELL  75

Query  221  ESTDGDSAQAAIIRS  177
             +T  D+AQAA+IRS
Sbjct  76   ATT--DTAQAAVIRS  88



>ref|XP_004489383.1| PREDICTED: transcription factor bHLH135-like [Cicer arietinum]
Length=92

 Score =   114 bits (285),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLE  219
            ISD+QI +LVSKL++L+PEIR RRSDKVSASKVLQETCNYIR+L+REVDDLS+RLSQLL 
Sbjct  15   ISDEQIIELVSKLRQLVPEIRHRRSDKVSASKVLQETCNYIRTLNREVDDLSERLSQLLT  74

Query  218  STDGDSAQAAIIRS  177
            + D DS +A IIRS
Sbjct  75   TIDADSPEANIIRS  88



>ref|XP_006374476.1| bHLH family protein [Populus trichocarpa]
 gb|ERP52273.1| bHLH family protein [Populus trichocarpa]
Length=91

 Score =   114 bits (284),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 67/74 (91%), Gaps = 2/74 (3%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLE  219
            I+DDQI DLV+KLQ+L+PE R RRS+KVSA+K LQETCNYI+SLHREVDDLS+RLS+LLE
Sbjct  16   INDDQILDLVTKLQQLLPETRNRRSEKVSAAKALQETCNYIKSLHREVDDLSERLSELLE  75

Query  218  STDGDSAQAAIIRS  177
            +T  D+ QAAIIR+
Sbjct  76   TT--DTTQAAIIRN  87



>ref|XP_004299384.1| PREDICTED: transcription factor bHLH135-like [Fragaria vesca 
subsp. vesca]
Length=92

 Score =   113 bits (283),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 68/75 (91%), Gaps = 3/75 (4%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRG-RRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLL  222
            ISDDQI DLV+KLQ+L+PEIR  RRSDKVSAS VLQETCNYIR+LHREVDDLS+RLS+LL
Sbjct  16   ISDDQINDLVTKLQQLLPEIRNSRRSDKVSASTVLQETCNYIRNLHREVDDLSERLSELL  75

Query  221  ESTDGDSAQAAIIRS  177
             +T  D+AQAA+IRS
Sbjct  76   ATT--DTAQAAVIRS  88



>ref|XP_009129354.1| PREDICTED: transcription factor PRE5-like [Brassica rapa]
 emb|CDY70014.1| BnaA02g36990D [Brassica napus]
Length=92

 Score =   113 bits (283),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 59/76 (78%), Positives = 68/76 (89%), Gaps = 1/76 (1%)
 Frame = -1

Query  401  RISDDQIADLVSKLQRLIPEIRGRR-SDKVSASKVLQETCNYIRSLHREVDDLSDRLSQL  225
            RISDDQ+ DLVSKL +L+PEIR RR SDKVSASKVLQETCNYIR LHREVD+LSDRLSQL
Sbjct  14   RISDDQMIDLVSKLCQLLPEIRERRRSDKVSASKVLQETCNYIRKLHREVDNLSDRLSQL  73

Query  224  LESTDGDSAQAAIIRS  177
            L++ D DS +A++IRS
Sbjct  74   LDAVDEDSHEASVIRS  89



>ref|XP_010317103.1| PREDICTED: transcription factor PRE5 isoform X1 [Solanum lycopersicum]
Length=106

 Score =   114 bits (284),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 61/89 (69%), Positives = 69/89 (78%), Gaps = 12/89 (13%)
 Frame = -1

Query  407  SSRISDDQIADLVSKLQRLIPEIRGRRSDK------------VSASKVLQETCNYIRSLH  264
            +SRISDDQI  LVSKLQ+L+PEIR RRS+K             SASKVLQETCNYIR+LH
Sbjct  15   TSRISDDQIIQLVSKLQQLLPEIRNRRSNKKSTMNLRIDPSQASASKVLQETCNYIRNLH  74

Query  263  REVDDLSDRLSQLLESTDGDSAQAAIIRS  177
            +EVDDLSDRLSQLL + D DS +AAIIRS
Sbjct  75   KEVDDLSDRLSQLLSTIDADSPEAAIIRS  103



>ref|XP_009151837.1| PREDICTED: transcription factor PRE5-like [Brassica rapa]
 emb|CDX86409.1| BnaA06g31260D [Brassica napus]
Length=92

 Score =   113 bits (282),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 69/78 (88%), Gaps = 1/78 (1%)
 Frame = -1

Query  407  SSRISDDQIADLVSKLQRLIPEIRGRR-SDKVSASKVLQETCNYIRSLHREVDDLSDRLS  231
            ++RISDDQI DLVSKL++ +PEIR RR SDKVSASKVLQETCNYIR LHREVD++SDRLS
Sbjct  12   ATRISDDQIIDLVSKLRQFLPEIRERRRSDKVSASKVLQETCNYIRKLHREVDNISDRLS  71

Query  230  QLLESTDGDSAQAAIIRS  177
             LL+S D DS +AA+IR+
Sbjct  72   LLLDSVDEDSQEAAVIRN  89



>gb|AFK43493.1| unknown [Medicago truncatula]
 gb|KEH33416.1| transcription factor [Medicago truncatula]
Length=92

 Score =   113 bits (282),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 68/74 (92%), Gaps = 2/74 (3%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLE  219
            I+DDQI DLVSKLQ+L+PEIR R SDKVSAS+VLQETCNYIR+L+REVDDLS+RLS+LL 
Sbjct  17   ITDDQIHDLVSKLQQLLPEIRNRSSDKVSASRVLQETCNYIRNLNREVDDLSERLSELLA  76

Query  218  STDGDSAQAAIIRS  177
            +T  D+AQAAIIR+
Sbjct  77   TT--DTAQAAIIRN  88



>emb|CDY65320.1| BnaC06g42240D [Brassica napus]
 emb|CDX67440.1| BnaA07g14800D [Brassica napus]
Length=92

 Score =   113 bits (282),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 70/76 (92%), Gaps = 1/76 (1%)
 Frame = -1

Query  401  RISDDQIADLVSKLQRLIPEI-RGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQL  225
            RISDDQI DLV+KL++++PEI + RRSDKVSASKVLQETCNYIR+L+REVD+LS+RL+QL
Sbjct  14   RISDDQIIDLVTKLRQILPEIGQRRRSDKVSASKVLQETCNYIRNLNREVDNLSERLAQL  73

Query  224  LESTDGDSAQAAIIRS  177
            LES D DS QAA+IRS
Sbjct  74   LESVDEDSPQAAVIRS  89



>ref|XP_010531809.1| PREDICTED: transcription factor PRE5-like [Tarenaya hassleriana]
Length=92

 Score =   112 bits (281),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 66/73 (90%), Gaps = 1/73 (1%)
 Frame = -1

Query  392  DDQIADLVSKLQRLIPEIRGRR-SDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLES  216
            DDQI DLV+KL+  +PEIR RR SDKVSASKVLQETCNYIR+LHREVD+LS+RLSQLL+S
Sbjct  17   DDQIVDLVTKLRHFLPEIRDRRRSDKVSASKVLQETCNYIRNLHREVDNLSERLSQLLDS  76

Query  215  TDGDSAQAAIIRS  177
             D DSA+AA+IRS
Sbjct  77   VDEDSAEAAVIRS  89



>ref|XP_004241574.1| PREDICTED: transcription factor PRE3 [Solanum lycopersicum]
 ref|XP_006354787.1| PREDICTED: transcription factor bHLH135-like [Solanum tuberosum]
Length=92

 Score =   112 bits (281),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 68/74 (92%), Gaps = 2/74 (3%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLE  219
            IS+DQI DLV+KLQ+L+PE+R R SDKVSAS+VLQ+TCNYI+SLHREVDDLSDRLS+LLE
Sbjct  17   ISEDQINDLVNKLQQLLPELRNRSSDKVSASRVLQDTCNYIKSLHREVDDLSDRLSELLE  76

Query  218  STDGDSAQAAIIRS  177
            S+  D+ QAA+IRS
Sbjct  77   SS--DTTQAALIRS  88



>ref|XP_010435835.1| PREDICTED: transcription factor PRE1 [Camelina sativa]
 ref|XP_010441099.1| PREDICTED: transcription factor PRE1 [Camelina sativa]
 ref|XP_010450758.1| PREDICTED: transcription factor PRE1 [Camelina sativa]
Length=93

 Score =   112 bits (281),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 70/76 (92%), Gaps = 1/76 (1%)
 Frame = -1

Query  401  RISDDQIADLVSKLQRLIPEI-RGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQL  225
            RISDDQ+ DLV+KL++++PEI + RRSDKVSASKVLQETCNYIRSL+REVD+LS+RLSQL
Sbjct  15   RISDDQMIDLVTKLRQILPEIGQRRRSDKVSASKVLQETCNYIRSLNREVDNLSERLSQL  74

Query  224  LESTDGDSAQAAIIRS  177
            LES D DS +AA+IRS
Sbjct  75   LESVDEDSPEAAVIRS  90



>ref|XP_009125118.1| PREDICTED: transcription factor PRE1 [Brassica rapa]
Length=92

 Score =   112 bits (280),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = -1

Query  401  RISDDQIADLVSKLQRLIPEI-RGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQL  225
            RISDDQI DLV+KL+ ++PEI + RRSDKVSASKVLQETCNYIR+L+REVD+LS+RL+QL
Sbjct  14   RISDDQIIDLVTKLREILPEIGQRRRSDKVSASKVLQETCNYIRNLNREVDNLSERLAQL  73

Query  224  LESTDGDSAQAAIIRS  177
            LES D DS QAA+IRS
Sbjct  74   LESVDEDSPQAAVIRS  89



>ref|XP_010108968.1| hypothetical protein L484_027163 [Morus notabilis]
 gb|EXC20608.1| hypothetical protein L484_027163 [Morus notabilis]
Length=91

 Score =   112 bits (280),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/72 (78%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = -1

Query  392  DDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLEST  213
            DDQI +LVSKL+RL+PEIR R S KV+ASKVLQETCNYIR+LHREVDDLS RL+QLL + 
Sbjct  16   DDQILELVSKLRRLVPEIRDRPSGKVAASKVLQETCNYIRNLHREVDDLSQRLTQLLATI  75

Query  212  DGDSAQAAIIRS  177
            D DSA+AAIIRS
Sbjct  76   DADSAEAAIIRS  87



>ref|XP_006292118.1| hypothetical protein CARUB_v10018314mg [Capsella rubella]
 gb|EOA25016.1| hypothetical protein CARUB_v10018314mg [Capsella rubella]
Length=92

 Score =   112 bits (280),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/73 (79%), Positives = 65/73 (89%), Gaps = 1/73 (1%)
 Frame = -1

Query  392  DDQIADLVSKLQRLIPEIRGRR-SDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLES  216
            DDQI DLVSKL++ +PEIR RR SDKVSA+KVLQETCNYIR LHREVD+LSDRLSQLLES
Sbjct  17   DDQIIDLVSKLRQFLPEIRERRRSDKVSATKVLQETCNYIRRLHREVDNLSDRLSQLLES  76

Query  215  TDGDSAQAAIIRS  177
             D DS +AA+IRS
Sbjct  77   VDEDSPEAAVIRS  89



>ref|XP_009347048.1| PREDICTED: transcription factor PRE6-like [Pyrus x bretschneideri]
Length=91

 Score =   112 bits (279),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLE  219
            I DDQI +LVSKL++L+PEIR RRS+KV ASKVLQETC+YIR+LHREVDDLS+RLSQLL 
Sbjct  14   IKDDQIIELVSKLRQLVPEIRDRRSNKVPASKVLQETCSYIRNLHREVDDLSERLSQLLS  73

Query  218  STDGDSAQAAIIRS  177
            + D DS +AAIIRS
Sbjct  74   TIDADSPEAAIIRS  87



>ref|XP_008341557.1| PREDICTED: transcription factor PRE6-like [Malus domestica]
Length=91

 Score =   112 bits (279),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLE  219
            I DDQI +LVSKL++L+PEIR RRS+KV ASKVLQETCNYIR+LH EVDDLS+RLSQLL 
Sbjct  14   IKDDQIIELVSKLRQLVPEIRDRRSNKVPASKVLQETCNYIRNLHXEVDDLSERLSQLLS  73

Query  218  STDGDSAQAAIIRS  177
            + D DS +AAIIRS
Sbjct  74   TIDADSPEAAIIRS  87



>ref|XP_004152438.1| PREDICTED: transcription factor bHLH135-like [Cucumis sativus]
 ref|XP_004169011.1| PREDICTED: transcription factor bHLH135-like [Cucumis sativus]
 gb|KGN64245.1| hypothetical protein Csa_1G045430 [Cucumis sativus]
Length=90

 Score =   112 bits (279),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/72 (78%), Positives = 65/72 (90%), Gaps = 2/72 (3%)
 Frame = -1

Query  392  DDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLEST  213
            D+QI DLV KLQ+L+PEIR R SDKVSA+KVLQETCNYIRSLHREVDDLS+RLS+LL ++
Sbjct  17   DEQITDLVHKLQQLLPEIRNRHSDKVSAAKVLQETCNYIRSLHREVDDLSERLSELLATS  76

Query  212  DGDSAQAAIIRS  177
              D+AQAAIIRS
Sbjct  77   --DTAQAAIIRS  86



>ref|XP_009772499.1| PREDICTED: transcription factor PRE3-like [Nicotiana sylvestris]
Length=91

 Score =   112 bits (279),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 68/74 (92%), Gaps = 2/74 (3%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLE  219
            IS+DQI DLVSKLQ+++PE++ R SDKVSA++VLQETCNYIRSLHREVDDLSDRLS+LLE
Sbjct  16   ISEDQINDLVSKLQQVLPELQNRSSDKVSAARVLQETCNYIRSLHREVDDLSDRLSELLE  75

Query  218  STDGDSAQAAIIRS  177
            ++  D+ QAA+IRS
Sbjct  76   TS--DTTQAALIRS  87



>emb|CDY04040.1| BnaC02g37550D [Brassica napus]
Length=92

 Score =   112 bits (279),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 67/76 (88%), Gaps = 1/76 (1%)
 Frame = -1

Query  401  RISDDQIADLVSKLQRLIPEIRGRR-SDKVSASKVLQETCNYIRSLHREVDDLSDRLSQL  225
            RISDDQ+ DLVSKL +L+PEIR RR SDKVSASKVL ETCNYIR LHREVD+LSDRLSQL
Sbjct  14   RISDDQMIDLVSKLCQLLPEIRERRRSDKVSASKVLHETCNYIRKLHREVDNLSDRLSQL  73

Query  224  LESTDGDSAQAAIIRS  177
            L++ D DS +A++IRS
Sbjct  74   LDAVDEDSHEASVIRS  89



>ref|XP_008374533.1| PREDICTED: transcription factor PRE3-like [Malus domestica]
 ref|XP_008356616.1| PREDICTED: transcription factor PRE3-like [Malus domestica]
Length=92

 Score =   111 bits (278),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 67/75 (89%), Gaps = 3/75 (4%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRG-RRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLL  222
            ISDDQI DLVSKLQ+L+PEIR  R SDKVSAS VLQETCNYIR+LHREVDDLS+RLS+LL
Sbjct  16   ISDDQINDLVSKLQQLLPEIRNSRXSDKVSASTVLQETCNYIRNLHREVDDLSERLSELL  75

Query  221  ESTDGDSAQAAIIRS  177
             +T  D+AQAA+IRS
Sbjct  76   ATT--DTAQAAVIRS  88



>ref|XP_006284840.1| hypothetical protein CARUB_v10006122mg [Capsella rubella]
 gb|EOA17738.1| hypothetical protein CARUB_v10006122mg [Capsella rubella]
Length=94

 Score =   112 bits (279),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 70/76 (92%), Gaps = 1/76 (1%)
 Frame = -1

Query  401  RISDDQIADLVSKLQRLIPEI-RGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQL  225
            RISDDQ+ DLV+KL++++PEI + RRSDKVSASKVLQETCNYIR+L+REVD+LS+RLSQL
Sbjct  16   RISDDQMIDLVTKLRQILPEIGQRRRSDKVSASKVLQETCNYIRNLNREVDNLSERLSQL  75

Query  224  LESTDGDSAQAAIIRS  177
            LES D DS +AA+IRS
Sbjct  76   LESVDEDSPEAAVIRS  91



>ref|XP_002870750.1| hypothetical protein ARALYDRAFT_916307 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_006405588.1| hypothetical protein EUTSA_v10028074mg [Eutrema salsugineum]
 gb|EFH47009.1| hypothetical protein ARALYDRAFT_916307 [Arabidopsis lyrata subsp. 
lyrata]
 gb|ESQ47041.1| hypothetical protein EUTSA_v10028074mg [Eutrema salsugineum]
Length=92

 Score =   111 bits (278),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 70/76 (92%), Gaps = 1/76 (1%)
 Frame = -1

Query  401  RISDDQIADLVSKLQRLIPEI-RGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQL  225
            RISDDQ+ DLV+KL++++PEI + RRSDKVSASKVLQETCNYIR+L+REVD+LS+RLSQL
Sbjct  14   RISDDQMIDLVTKLRQILPEIGQRRRSDKVSASKVLQETCNYIRNLNREVDNLSERLSQL  73

Query  224  LESTDGDSAQAAIIRS  177
            LES D DS +AA+IRS
Sbjct  74   LESVDEDSPEAAVIRS  89



>gb|EYU24397.1| hypothetical protein MIMGU_mgv1a017140mg [Erythranthe guttata]
Length=91

 Score =   111 bits (278),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 67/74 (91%), Gaps = 2/74 (3%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLE  219
            ++DDQI +LVSKLQ+L+PE+  RRSDK SA+KVLQETCNYIRSLHREVDDLS+RLS+LLE
Sbjct  16   VTDDQINELVSKLQQLLPEMHSRRSDKRSAAKVLQETCNYIRSLHREVDDLSERLSELLE  75

Query  218  STDGDSAQAAIIRS  177
            +T  D+ QAA+IR+
Sbjct  76   NT--DTTQAALIRN  87



>ref|XP_010539967.1| PREDICTED: transcription factor PRE3 [Tarenaya hassleriana]
Length=92

 Score =   111 bits (277),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 66/74 (89%), Gaps = 2/74 (3%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLE  219
            ISDDQI DL+ KLQ+L+PE+R R SDKVSA +VLQETCNYIR+LHREVDDLS+RLS+LL 
Sbjct  16   ISDDQINDLILKLQQLLPELRNRSSDKVSAGRVLQETCNYIRNLHREVDDLSERLSELLA  75

Query  218  STDGDSAQAAIIRS  177
            +T  DSAQAA+IRS
Sbjct  76   NT--DSAQAALIRS  87



>gb|KFK33185.1| hypothetical protein AALP_AA6G341300 [Arabis alpina]
Length=92

 Score =   110 bits (276),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 72/82 (88%), Gaps = 1/82 (1%)
 Frame = -1

Query  419  QPAESSRISDDQIADLVSKLQRLIPEI-RGRRSDKVSASKVLQETCNYIRSLHREVDDLS  243
            Q   + RISDDQ+ DLV+KL++++PE+ + RRSDKVSASKVLQETCNYIR+L++EVD+LS
Sbjct  8    QSPSAPRISDDQMIDLVTKLRQILPEMGQRRRSDKVSASKVLQETCNYIRNLNKEVDNLS  67

Query  242  DRLSQLLESTDGDSAQAAIIRS  177
            DRLSQLLES D DS +AA+IRS
Sbjct  68   DRLSQLLESVDEDSPEAAVIRS  89



>ref|XP_008379346.1| PREDICTED: transcription factor PRE1 [Malus domestica]
Length=91

 Score =   110 bits (276),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLE  219
            I DDQI +LVSKL++L+PEIR RRS+K  ASKVLQETC+YIR+LHREVDDLS+RLSQLL 
Sbjct  14   IKDDQIIELVSKLRQLVPEIRDRRSNKAPASKVLQETCSYIRNLHREVDDLSERLSQLLS  73

Query  218  STDGDSAQAAIIRS  177
            + D DS +AAIIRS
Sbjct  74   TIDADSPEAAIIRS  87



>ref|XP_011087224.1| PREDICTED: transcription factor PRE3 [Sesamum indicum]
Length=91

 Score =   110 bits (276),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 66/74 (89%), Gaps = 2/74 (3%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLE  219
            I+DDQI +LVSKLQ+L+PE+  RRSDK SA+KVLQETCNYIRSLHREVDDLS+RLS+LL 
Sbjct  16   ITDDQINELVSKLQQLLPEMHNRRSDKRSAAKVLQETCNYIRSLHREVDDLSERLSELLA  75

Query  218  STDGDSAQAAIIRS  177
            +T  D+ QAA+IRS
Sbjct  76   NT--DTTQAALIRS  87



>ref|XP_004491783.1| PREDICTED: transcription factor bHLH135-like [Cicer arietinum]
Length=93

 Score =   110 bits (274),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = -1

Query  419  QPAESSRISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSD  240
            Q   S+RISDDQI DLV KL++L+PEIR R  +K  ASKVLQETCNYIRSL REV+DLS 
Sbjct  9    QSGGSTRISDDQIIDLVCKLRQLVPEIRNRHPNKAPASKVLQETCNYIRSLQREVEDLSL  68

Query  239  RLSQLLESTDGDSAQAAIIRS  177
            RLSQLL++ D DSA+A+IIRS
Sbjct  69   RLSQLLDTIDADSAEASIIRS  89



>ref|XP_009386696.1| PREDICTED: transcription factor ILI6-like [Musa acuminata subsp. 
malaccensis]
Length=93

 Score =   110 bits (274),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLE  219
            I+D+QI DLVSKLQ ++PE R R +++VSA++VLQETCNYIRSLHREVDDLS+RLS+LL 
Sbjct  17   ITDEQINDLVSKLQAVLPEARIRGAERVSAARVLQETCNYIRSLHREVDDLSERLSELLA  76

Query  218  STDGDSAQAAIIRS  177
            +T+  SAQAAIIRS
Sbjct  77   TTEASSAQAAIIRS  90



>emb|CDP12359.1| unnamed protein product [Coffea canephora]
Length=93

 Score =   110 bits (274),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 67/74 (91%), Gaps = 2/74 (3%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLE  219
            I+DDQI DLVSKLQ+L+PE+R R SDKVSA++VLQETCNYIRSLHREVDDLS+RLS+LL 
Sbjct  16   ITDDQIIDLVSKLQQLLPELRNRCSDKVSAARVLQETCNYIRSLHREVDDLSERLSELL-  74

Query  218  STDGDSAQAAIIRS  177
              + D++QAA+IRS
Sbjct  75   -ANSDTSQAALIRS  87



>ref|XP_008385279.1| PREDICTED: transcription factor PRE3-like [Malus domestica]
 ref|XP_008366350.1| PREDICTED: transcription factor PRE3-like [Malus domestica]
Length=92

 Score =   110 bits (274),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 67/75 (89%), Gaps = 3/75 (4%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRG-RRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLL  222
            ISDDQI DLVSKLQ+L+PEIR  RRS KVSAS +LQETCNYIR+LHREVDDLS+RLS+LL
Sbjct  16   ISDDQINDLVSKLQQLLPEIRNSRRSGKVSASTLLQETCNYIRNLHREVDDLSERLSELL  75

Query  221  ESTDGDSAQAAIIRS  177
             +T  D+AQAA+IRS
Sbjct  76   ATT--DTAQAAVIRS  88



>ref|XP_009104757.1| PREDICTED: transcription factor PRE3-like [Brassica rapa]
Length=93

 Score =   109 bits (273),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 73/82 (89%), Gaps = 3/82 (4%)
 Frame = -1

Query  419  QPAESSRISDDQIADLVSKLQRLIPEIR-GRRSDKVSASKVLQETCNYIRSLHREVDDLS  243
            Q + +SRIS++QI DL+ KLQ+L+PE+R  RRSDKVSA++VLQETCNYIR+LHREVDDLS
Sbjct  10   QVSGTSRISEEQINDLIIKLQQLLPELRDSRRSDKVSAARVLQETCNYIRNLHREVDDLS  69

Query  242  DRLSQLLESTDGDSAQAAIIRS  177
            +RLS+LL +T  D+AQAA+IRS
Sbjct  70   ERLSELLANT--DTAQAALIRS  89



>emb|CDX85840.1| BnaC06g22940D [Brassica napus]
 emb|CDX85841.1| BnaC06g22930D [Brassica napus]
 emb|CDX68180.1| BnaA07g22200D [Brassica napus]
Length=93

 Score =   109 bits (273),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 73/82 (89%), Gaps = 3/82 (4%)
 Frame = -1

Query  419  QPAESSRISDDQIADLVSKLQRLIPEIR-GRRSDKVSASKVLQETCNYIRSLHREVDDLS  243
            Q + +SRIS++QI DL+ KLQ+L+PE+R  RRSDKVSA++VLQETCNYIR+LHREVDDLS
Sbjct  10   QVSGTSRISEEQINDLIIKLQQLLPELRDSRRSDKVSAARVLQETCNYIRNLHREVDDLS  69

Query  242  DRLSQLLESTDGDSAQAAIIRS  177
            +RLS+LL +T  D+AQAA+IRS
Sbjct  70   ERLSELLANT--DTAQAALIRS  89



>ref|NP_198802.1| bHLH transcription factor PRE1 [Arabidopsis thaliana]
 sp|Q9FLE9.1|PRE1_ARATH RecName: Full=Transcription factor PRE1; AltName: Full=Basic 
helix-loop-helix protein 136; Short=AtbHLH136; Short=bHLH 136; 
AltName: Full=Protein BANQUO 1; AltName: Full=Protein PACLOBUTRAZOL 
RESISTANCE 1; AltName: Full=bHLH transcription factor 
bHLH136 [Arabidopsis thaliana]
 dbj|BAB10210.1| DNA-binding protein-like [Arabidopsis thaliana]
 gb|AAM65786.1| DNA-binding protein-like [Arabidopsis thaliana]
 gb|AED94484.1| bHLH transcription factor PRE1 [Arabidopsis thaliana]
Length=92

 Score =   109 bits (272),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = -1

Query  401  RISDDQIADLVSKLQRLIPEI-RGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQL  225
            RISD+Q+ DLVSKL++++PEI + RRSDK SASKVLQETCNYIR+L+REVD+LS+RLSQL
Sbjct  14   RISDNQMIDLVSKLRQILPEIGQRRRSDKASASKVLQETCNYIRNLNREVDNLSERLSQL  73

Query  224  LESTDGDSAQAAIIRS  177
            LES D DS +AA+IRS
Sbjct  74   LESVDEDSPEAAVIRS  89



>ref|XP_002877136.1| transcription regulator [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53395.1| transcription regulator [Arabidopsis lyrata subsp. lyrata]
Length=92

 Score =   108 bits (271),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 65/73 (89%), Gaps = 1/73 (1%)
 Frame = -1

Query  392  DDQIADLVSKLQRLIPEIRGRR-SDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLES  216
            DDQ+ DLVSKL++ +PEI+ RR SDKVSASKVLQETCNYIR LHREVD+LSDRLSQLL+S
Sbjct  17   DDQMIDLVSKLRQFLPEIQERRRSDKVSASKVLQETCNYIRKLHREVDNLSDRLSQLLDS  76

Query  215  TDGDSAQAAIIRS  177
             D DS +AA+IRS
Sbjct  77   VDEDSPEAAVIRS  89



>ref|XP_009615362.1| PREDICTED: transcription factor PRE3-like [Nicotiana tomentosiformis]
Length=93

 Score =   108 bits (271),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 66/74 (89%), Gaps = 2/74 (3%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLE  219
            IS+DQI DLVSKLQ L+PE+R R SDKVSA++VLQ+TCNYIR LHREVDDLS+RLSQLL 
Sbjct  18   ISEDQINDLVSKLQDLLPELRNRSSDKVSAARVLQDTCNYIRGLHREVDDLSERLSQLLA  77

Query  218  STDGDSAQAAIIRS  177
            ++  D+AQAA+IRS
Sbjct  78   TS--DTAQAALIRS  89



>ref|XP_004293633.1| PREDICTED: transcription factor bHLH135-like [Fragaria vesca 
subsp. vesca]
Length=93

 Score =   108 bits (271),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLE  219
            I DDQI +LVSKL++L+PE R RRSD+VSASKVLQETC+YIR+L REV+DLS+RLSQLL 
Sbjct  16   IRDDQIIELVSKLRQLVPETRDRRSDQVSASKVLQETCSYIRNLQREVEDLSERLSQLLA  75

Query  218  STDGDSAQAAIIRS  177
            + D DSA+AAI RS
Sbjct  76   TIDADSAEAAIFRS  89



>ref|XP_009126035.1| PREDICTED: transcription factor PRE2-like [Brassica rapa]
 emb|CDX85562.1| BnaA02g02510D [Brassica napus]
Length=93

 Score =   108 bits (269),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 63/73 (86%), Gaps = 1/73 (1%)
 Frame = -1

Query  392  DDQIADLVSKLQRLIPEIR-GRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLES  216
            DDQI DL+SKL++ IPEIR  RRS  VSASKVLQETCNYIR+LH+E DDLSDRLSQLLE+
Sbjct  17   DDQITDLISKLRQSIPEIRQNRRSSTVSASKVLQETCNYIRNLHKEADDLSDRLSQLLET  76

Query  215  TDGDSAQAAIIRS  177
             D +S QAAIIRS
Sbjct  77   IDPNSPQAAIIRS  89



>ref|XP_010514602.1| PREDICTED: transcription factor PRE5 [Camelina sativa]
Length=92

 Score =   108 bits (269),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 65/73 (89%), Gaps = 1/73 (1%)
 Frame = -1

Query  392  DDQIADLVSKLQRLIPEIRGRR-SDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLES  216
            DDQ+ DLV KL++ +PEIR RR S+KVSASKVLQETCNYIR+LHREVD+LSDRLSQLL+S
Sbjct  17   DDQMIDLVGKLRQFLPEIRERRRSEKVSASKVLQETCNYIRNLHREVDNLSDRLSQLLDS  76

Query  215  TDGDSAQAAIIRS  177
             D DS +AA+IRS
Sbjct  77   VDEDSPEAAVIRS  89



>ref|XP_010695477.1| PREDICTED: transcription factor PRE3-like [Beta vulgaris subsp. 
vulgaris]
Length=92

 Score =   107 bits (268),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 66/75 (88%), Gaps = 3/75 (4%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEI-RGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLL  222
            I+DDQI DLV KLQ+L+PE+   RR DKVSAS+VLQETCNYI+SLHREVDDLS+RLSQLL
Sbjct  16   ITDDQIQDLVCKLQQLLPELHNARRPDKVSASRVLQETCNYIKSLHREVDDLSERLSQLL  75

Query  221  ESTDGDSAQAAIIRS  177
            E+T  D+ QAA+IRS
Sbjct  76   ENT--DTTQAALIRS  88



>emb|CDX91006.1| BnaC02g05910D [Brassica napus]
Length=93

 Score =   107 bits (268),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 63/73 (86%), Gaps = 1/73 (1%)
 Frame = -1

Query  392  DDQIADLVSKLQRLIPEIR-GRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLES  216
            DDQI DL+SKL++ IPEIR  RRS  VSASKVLQETCNYIR+LH+E DDLSDRLSQLLE+
Sbjct  17   DDQITDLISKLRQSIPEIRQNRRSSTVSASKVLQETCNYIRNLHKEADDLSDRLSQLLET  76

Query  215  TDGDSAQAAIIRS  177
             D +S QAA+IRS
Sbjct  77   IDPNSPQAAVIRS  89



>ref|XP_009803678.1| PREDICTED: transcription factor PRE3-like [Nicotiana sylvestris]
Length=93

 Score =   107 bits (267),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 66/74 (89%), Gaps = 2/74 (3%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLE  219
            IS+DQI DLVSKLQ L+PE+R R SDKVS+++VLQ+TCNYIR LHREVDDLS+RLSQLL 
Sbjct  18   ISEDQINDLVSKLQDLLPELRNRSSDKVSSARVLQDTCNYIRGLHREVDDLSERLSQLLA  77

Query  218  STDGDSAQAAIIRS  177
            ++  D+AQAA+IRS
Sbjct  78   TS--DTAQAALIRS  89



>emb|CDY68961.1| BnaCnng61200D [Brassica napus]
Length=93

 Score =   107 bits (267),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 63/73 (86%), Gaps = 1/73 (1%)
 Frame = -1

Query  392  DDQIADLVSKLQRLIPEIR-GRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLES  216
            DDQI DL+SKL++ IPEIR  RRS  VSASKVLQETCNYIR+LH+E DDLSDRLSQLLE+
Sbjct  17   DDQITDLISKLRQSIPEIRQNRRSSTVSASKVLQETCNYIRNLHKEADDLSDRLSQLLET  76

Query  215  TDGDSAQAAIIRS  177
             D ++ QAAIIRS
Sbjct  77   IDPNNPQAAIIRS  89



>ref|XP_009131445.1| PREDICTED: transcription factor PRE2-like [Brassica rapa]
Length=94

 Score =   107 bits (266),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 66/75 (88%), Gaps = 1/75 (1%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIR-GRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLL  222
            I+DDQI +L+SKL++ IPEIR  RRS+ VSASKVLQETCNYIR+L++E DDLSDRLSQLL
Sbjct  16   INDDQITELISKLRQSIPEIRQNRRSNTVSASKVLQETCNYIRNLNKEADDLSDRLSQLL  75

Query  221  ESTDGDSAQAAIIRS  177
            E+ D +S QAA+IRS
Sbjct  76   ETIDPNSPQAAVIRS  90



>emb|CDX78615.1| BnaA03g05270D [Brassica napus]
 emb|CDX70597.1| BnaC03g06810D [Brassica napus]
Length=94

 Score =   107 bits (266),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 66/75 (88%), Gaps = 1/75 (1%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIR-GRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLL  222
            I+DDQI +L+SKL++ IPEIR  RRS+ VSASKVLQETCNYIR+L++E DDLSDRLSQLL
Sbjct  16   INDDQITELISKLRQSIPEIRQNRRSNTVSASKVLQETCNYIRNLNKEADDLSDRLSQLL  75

Query  221  ESTDGDSAQAAIIRS  177
            E+ D +S QAA+IRS
Sbjct  76   ETIDPNSPQAAVIRS  90



>ref|NP_001049112.1| Os03g0171300 [Oryza sativa Japonica Group]
 sp|Q0DUR2.1|ILI6_ORYSJ RecName: Full=Transcription factor ILI6; Short=OsILI6; AltName: 
Full=Protein INCREASED LEAF INCLINATION 6; AltName: Full=Protein 
POSITIVE REGULATOR OF GRAIN LENGTH 1 [Oryza sativa Japonica 
Group]
 sp|B8APB5.1|ILI6_ORYSI RecName: Full=Transcription factor ILI6; Short=OsILI6; AltName: 
Full=Protein INCREASED LEAF INCLINATION 6 [Oryza sativa Indica 
Group]
 dbj|BAF11026.1| Os03g0171300 [Oryza sativa Japonica Group]
 gb|EAZ25749.1| hypothetical protein OsJ_09588 [Oryza sativa Japonica Group]
 gb|EEC74604.1| hypothetical protein OsI_10199 [Oryza sativa Indica Group]
Length=92

 Score =   107 bits (266),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLE  219
            I+D+QI+DLVSKLQ L+PE R R +D+V +S+VLQETCNYIRSLH+EVDDLS+RLS+LL 
Sbjct  16   ITDEQISDLVSKLQDLLPEARLRSNDRVPSSRVLQETCNYIRSLHQEVDDLSERLSELLA  75

Query  218  STDGDSAQAAIIRS  177
            ++D  SAQAAIIRS
Sbjct  76   TSDMSSAQAAIIRS  89



>gb|KFK25753.1| hypothetical protein AALP_AA8G155000 [Arabis alpina]
Length=92

 Score =   107 bits (266),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 64/73 (88%), Gaps = 1/73 (1%)
 Frame = -1

Query  392  DDQIADLVSKLQRLIPEIR-GRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLES  216
            DDQI DL+SKL++ IPEIR  RRS+ VSASKVLQETCNYIR+L++E DDLSDRLSQLLE+
Sbjct  16   DDQITDLISKLRQSIPEIRQNRRSNTVSASKVLQETCNYIRNLNKEADDLSDRLSQLLET  75

Query  215  TDGDSAQAAIIRS  177
             D +S QAAIIRS
Sbjct  76   IDPNSPQAAIIRS  88



>ref|XP_006400033.1| hypothetical protein EUTSA_v10015131mg [Eutrema salsugineum]
 gb|ESQ41486.1| hypothetical protein EUTSA_v10015131mg [Eutrema salsugineum]
Length=94

 Score =   107 bits (266),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 64/73 (88%), Gaps = 1/73 (1%)
 Frame = -1

Query  392  DDQIADLVSKLQRLIPEIR-GRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLES  216
            DDQI DL+SKL++ IPEIR  RRS+ VSASKVLQETCNYIR+L++E DDLSDRLSQLLE+
Sbjct  18   DDQITDLISKLRQSIPEIRQNRRSNTVSASKVLQETCNYIRNLNKEADDLSDRLSQLLET  77

Query  215  TDGDSAQAAIIRS  177
             D +S QAAIIRS
Sbjct  78   IDPNSPQAAIIRS  90



>gb|KFK41891.1| hypothetical protein AALP_AA2G185600 [Arabis alpina]
Length=93

 Score =   107 bits (266),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 68/75 (91%), Gaps = 3/75 (4%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIR-GRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLL  222
            IS+DQI DL+ KLQ+L+PE+R  RRSDKVSA++VLQETCNYIR+LHREVDDLS+RLS+LL
Sbjct  17   ISEDQINDLIIKLQQLLPELRDSRRSDKVSAARVLQETCNYIRNLHREVDDLSERLSELL  76

Query  221  ESTDGDSAQAAIIRS  177
             +T  D+AQAA+IRS
Sbjct  77   ANT--DTAQAALIRS  89



>ref|XP_003558708.2| PREDICTED: transcription factor ILI6 isoform X2 [Brachypodium 
distachyon]
Length=122

 Score =   107 bits (267),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLE  219
            I+D+QI+DLVSKLQ L+PE R R +D+V +S+VLQETC+YIRSLHREVDDLS+RLS+LL 
Sbjct  46   ITDEQISDLVSKLQDLLPEARLRSNDRVPSSRVLQETCSYIRSLHREVDDLSERLSELLA  105

Query  218  STDGDSAQAAIIRS  177
            ++D  SAQAAIIRS
Sbjct  106  TSDMSSAQAAIIRS  119



>gb|EPS67081.1| hypothetical protein M569_07696, partial [Genlisea aurea]
Length=96

 Score =   106 bits (264),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 70/81 (86%), Gaps = 5/81 (6%)
 Frame = -1

Query  404  SRISDDQIADLVSKLQRLIPEIR--GRRS---DKVSASKVLQETCNYIRSLHREVDDLSD  240
            +RISDDQIADLVS+LQ+L+PE    GRRS   DKV ASKVLQ+TCNYIRSLH+EV +LSD
Sbjct  14   TRISDDQIADLVSRLQQLVPESHRGGRRSSPSDKVPASKVLQDTCNYIRSLHQEVGNLSD  73

Query  239  RLSQLLESTDGDSAQAAIIRS  177
            +LS+LLE+++ DS QAAIIRS
Sbjct  74   QLSELLETSNVDSDQAAIIRS  94



>emb|CDY69564.1| BnaAnng30830D, partial [Brassica napus]
Length=88

 Score =   106 bits (264),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 71/82 (87%), Gaps = 3/82 (4%)
 Frame = -1

Query  419  QPAESSRISDDQIADLVSKLQRLIPEIR-GRRSDKVSASKVLQETCNYIRSLHREVDDLS  243
            Q + ++RIS+DQI DLV KLQ+L+PE+R   RSDKVSA++VLQ+TCNYIR+LHREVDDLS
Sbjct  5    QSSGTTRISEDQINDLVIKLQQLLPELRDSHRSDKVSAARVLQDTCNYIRNLHREVDDLS  64

Query  242  DRLSQLLESTDGDSAQAAIIRS  177
            +RLS+LL   + D+AQAA+IRS
Sbjct  65   ERLSELL--ANSDTAQAALIRS  84



>ref|NP_197020.1| protein banquo 2 [Arabidopsis thaliana]
 ref|XP_002873710.1| bHLH family protein [Arabidopsis lyrata subsp. lyrata]
 sp|Q9LXG5.1|PRE2_ARATH RecName: Full=Transcription factor PRE2; AltName: Full=Basic 
helix-loop-helix protein 134; Short=AtbHLH134; Short=bHLH 134; 
AltName: Full=Protein BANQUO 2; AltName: Full=Protein PACLOBUTRAZOL 
RESISTANCE 2; AltName: Full=bHLH transcription factor 
bHLH134 [Arabidopsis thaliana]
 emb|CAB89326.1| putative protein [Arabidopsis thaliana]
 dbj|BAC43472.1| unknown protein [Arabidopsis thaliana]
 gb|AAO63880.1| putative bHLH protein [Arabidopsis thaliana]
 gb|EFH49969.1| bHLH family protein [Arabidopsis lyrata subsp. lyrata]
 gb|AED92123.1| protein banquo 2 [Arabidopsis thaliana]
Length=94

 Score =   106 bits (264),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 64/73 (88%), Gaps = 1/73 (1%)
 Frame = -1

Query  392  DDQIADLVSKLQRLIPEIR-GRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLES  216
            DDQI DL+SKL++ IPEIR  RRS+ VSASKVLQETCNYIR+L++E DDLSDRL+QLLES
Sbjct  18   DDQITDLISKLRQSIPEIRQNRRSNTVSASKVLQETCNYIRNLNKEADDLSDRLTQLLES  77

Query  215  TDGDSAQAAIIRS  177
             D +S QAA+IRS
Sbjct  78   IDPNSPQAAVIRS  90



>ref|XP_010502885.1| PREDICTED: transcription factor PRE5-like [Camelina sativa]
Length=92

 Score =   105 bits (263),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 63/73 (86%), Gaps = 1/73 (1%)
 Frame = -1

Query  392  DDQIADLVSKLQRLIPEIRGRR-SDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLES  216
            DDQI DLV KL++ +PEIR RR S+KVSASKVLQETCNYIR LHREVD+LSDRLSQLL+S
Sbjct  17   DDQIIDLVGKLRQFLPEIRERRRSEKVSASKVLQETCNYIRKLHREVDNLSDRLSQLLDS  76

Query  215  TDGDSAQAAIIRS  177
             D DS +AA+I S
Sbjct  77   VDEDSPEAAVISS  89



>ref|XP_009121603.1| PREDICTED: transcription factor PRE2 [Brassica rapa]
 emb|CDX69545.1| BnaA10g18940D [Brassica napus]
Length=94

 Score =   105 bits (262),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 63/73 (86%), Gaps = 1/73 (1%)
 Frame = -1

Query  392  DDQIADLVSKLQRLIPEIR-GRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLES  216
            DDQI DL+SKL++ IPEIR  RRS  VSASKVLQETCNYIR+L++E DDLSDRLSQLLE+
Sbjct  18   DDQITDLISKLRQSIPEIRQNRRSSTVSASKVLQETCNYIRNLNKEADDLSDRLSQLLET  77

Query  215  TDGDSAQAAIIRS  177
             D +S QAAIIRS
Sbjct  78   IDPNSPQAAIIRS  90



>ref|XP_006649473.1| PREDICTED: transcription factor bHLH135-like isoform X1 [Oryza 
brachyantha]
 ref|XP_006649474.1| PREDICTED: transcription factor bHLH135-like isoform X2 [Oryza 
brachyantha]
 ref|XP_006649475.1| PREDICTED: transcription factor bHLH135-like isoform X3 [Oryza 
brachyantha]
Length=157

 Score =   107 bits (267),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLE  219
            I+D+QI+DLVSKLQ L+PE R R +D++ +S+VLQETCNYIRSLH+EVDDLS+RLS+LL 
Sbjct  81   ITDEQISDLVSKLQDLLPEARLRSNDRMPSSRVLQETCNYIRSLHQEVDDLSERLSELLA  140

Query  218  STDGDSAQAAIIRS  177
            S+D  SAQAAIIRS
Sbjct  141  SSDMSSAQAAIIRS  154



>ref|XP_006390417.1| hypothetical protein EUTSA_v10019683mg [Eutrema salsugineum]
 gb|ESQ27703.1| hypothetical protein EUTSA_v10019683mg [Eutrema salsugineum]
Length=93

 Score =   105 bits (262),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 68/75 (91%), Gaps = 3/75 (4%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIR-GRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLL  222
            IS+DQI +L+ KLQ+L+PE+R  RRSDKVSA++VLQETCNYIR+LHREVDDLS+RLS+LL
Sbjct  17   ISEDQINELIIKLQQLLPELRDSRRSDKVSAARVLQETCNYIRNLHREVDDLSERLSELL  76

Query  221  ESTDGDSAQAAIIRS  177
             +T  D+AQAA+IRS
Sbjct  77   ANT--DTAQAALIRS  89



>ref|XP_009106117.1| PREDICTED: transcription factor PRE3-like [Brassica rapa]
 emb|CDX96550.1| BnaA07g31610D [Brassica napus]
Length=90

 Score =   105 bits (262),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 66/73 (90%), Gaps = 3/73 (4%)
 Frame = -1

Query  392  DDQIADLVSKLQRLIPEIRG-RRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLES  216
            +DQI DL+ KLQ+L+PE+R  RRSDKVSAS+VLQETCNYIR+LHREVDDLS+RLS+LL +
Sbjct  16   EDQINDLIIKLQQLLPELRNSRRSDKVSASRVLQETCNYIRNLHREVDDLSERLSELLAN  75

Query  215  TDGDSAQAAIIRS  177
            T  D+AQAA+IRS
Sbjct  76   T--DTAQAALIRS  86



>ref|XP_011085763.1| PREDICTED: transcription factor PRE1-like [Sesamum indicum]
Length=95

 Score =   105 bits (262),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 64/76 (84%), Gaps = 2/76 (3%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRG--RRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQL  225
            I+DDQI +LVSKL +L+PEIR   RRS+K SA KVLQETCNYIR+LH+E+DDLS RLSQL
Sbjct  18   ITDDQIIELVSKLHQLLPEIRNTTRRSNKASADKVLQETCNYIRNLHKEMDDLSARLSQL  77

Query  224  LESTDGDSAQAAIIRS  177
            L + D DS +AAIIR+
Sbjct  78   LSTVDTDSPEAAIIRT  93



>ref|XP_009416873.1| PREDICTED: transcription factor ILI5-like [Musa acuminata subsp. 
malaccensis]
Length=85

 Score =   105 bits (262),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = -1

Query  404  SRISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQL  225
            SRIS+++I +L+SKLQ L+PE R R + + SA+KVL+ETCNYI+SLHREVDDLSDRLS+L
Sbjct  6    SRISEEEITELISKLQSLLPETRRRGASRASAAKVLKETCNYIKSLHREVDDLSDRLSEL  65

Query  224  LESTDGDSAQAAIIRS  177
            + + D DSAQA I+RS
Sbjct  66   MATMDVDSAQAEIVRS  81



>ref|XP_010416307.1| PREDICTED: transcription factor PRE3 [Camelina sativa]
 ref|XP_010428437.1| PREDICTED: transcription factor PRE3 [Camelina sativa]
 ref|XP_010471539.1| PREDICTED: transcription factor PRE3 [Camelina sativa]
Length=93

 Score =   105 bits (261),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 68/75 (91%), Gaps = 3/75 (4%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIR-GRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLL  222
            IS+DQI DL+ KLQ+L+PE+R  RRSDKVSA++VLQ+TCNYIR+LHREVDDLS+RLS+LL
Sbjct  17   ISEDQINDLILKLQQLLPELRDSRRSDKVSAARVLQDTCNYIRNLHREVDDLSERLSELL  76

Query  221  ESTDGDSAQAAIIRS  177
             +T  D+AQAA+IRS
Sbjct  77   ANT--DTAQAALIRS  89



>ref|XP_010939543.1| PREDICTED: transcription factor ILI6-like [Elaeis guineensis]
Length=92

 Score =   105 bits (261),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLE  219
            ++DDQI DLVSKLQ L+PE R R +D+VSA+KVLQ+TCNYI+SLH+EVD+LS+RL++LL 
Sbjct  16   MTDDQIIDLVSKLQALLPEARNRSTDRVSAAKVLQDTCNYIKSLHQEVDNLSERLAELLA  75

Query  218  STDGDSAQAAIIRS  177
            +TD    QAA+IRS
Sbjct  76   TTDTTGDQAAVIRS  89



>ref|XP_002888981.1| hypothetical protein ARALYDRAFT_476585 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_006301219.1| hypothetical protein CARUB_v10021619mg [Capsella rubella]
 gb|EFH65240.1| hypothetical protein ARALYDRAFT_476585 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EOA34117.1| hypothetical protein CARUB_v10021619mg [Capsella rubella]
Length=93

 Score =   105 bits (261),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 68/75 (91%), Gaps = 3/75 (4%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIR-GRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLL  222
            IS+DQI DL+ KLQ+L+PE+R  RRSDKVSA++VLQ+TCNYIR+LHREVDDLS+RLS+LL
Sbjct  17   ISEDQINDLIIKLQQLLPELRDSRRSDKVSAARVLQDTCNYIRNLHREVDDLSERLSELL  76

Query  221  ESTDGDSAQAAIIRS  177
             +T  D+AQAA+IRS
Sbjct  77   ANT--DTAQAALIRS  89



>ref|XP_004983143.1| PREDICTED: transcription factor bHLH135-like [Setaria italica]
Length=94

 Score =   105 bits (261),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLE  219
            ISD+QI+DLV+KLQ L+PE R R +D+V +++VLQETC+YIRSLHREVDDLSDRLS+LL 
Sbjct  18   ISDEQISDLVAKLQALLPEARLRSNDRVPSARVLQETCSYIRSLHREVDDLSDRLSELLA  77

Query  218  STDGDSAQAAIIRS  177
            + D  +AQAA+IRS
Sbjct  78   TADVSTAQAAVIRS  91



>ref|XP_009388768.1| PREDICTED: transcription factor ILI6-like [Musa acuminata subsp. 
malaccensis]
Length=92

 Score =   104 bits (260),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLE  219
            I+D+QI DL++KLQ ++PE   R +D+VSA+KVLQ+TCNYIRSLHREVDDLS+RLS+LL 
Sbjct  16   ITDEQINDLLTKLQAVLPEAHLRSTDRVSAAKVLQDTCNYIRSLHREVDDLSERLSELLA  75

Query  218  STDGDSAQAAIIRS  177
            + D +SAQAAIIRS
Sbjct  76   NNDINSAQAAIIRS  89



>ref|XP_009149879.1| PREDICTED: transcription factor PRE4 [Brassica rapa]
 emb|CDY36934.1| BnaA06g17190D [Brassica napus]
Length=93

 Score =   104 bits (260),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 67/79 (85%), Gaps = 4/79 (5%)
 Frame = -1

Query  407  SSRISDDQIADLVSKLQRLIPEI--RGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRL  234
            +S IS+DQI DLV +L RL+PE+    RRS KVSASKVLQETC YIR+L++EVDDLS+RL
Sbjct  14   TSMISEDQINDLVLQLHRLLPELGNNNRRSGKVSASKVLQETCTYIRNLNKEVDDLSERL  73

Query  233  SQLLESTDGDSAQAAIIRS  177
            SQLLEST  DSAQAA+IRS
Sbjct  74   SQLLEST--DSAQAALIRS  90



>ref|XP_006343153.1| PREDICTED: transcription factor bHLH135-like [Solanum tuberosum]
Length=96

 Score =   104 bits (260),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/71 (72%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = -1

Query  392  DDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLEST  213
            DDQI +LVSKL + +PEI+ RRS+K SA+KVLQETCNYIRSL+REV+DLSDRLSQLL + 
Sbjct  22   DDQIIELVSKLHQFLPEIQTRRSNKASATKVLQETCNYIRSLNREVNDLSDRLSQLLSTI  81

Query  212  DGDSAQAAIIR  180
            D +S +AAIIR
Sbjct  82   DTESPEAAIIR  92



>ref|XP_006395334.1| hypothetical protein EUTSA_v10005197mg [Eutrema salsugineum]
 gb|ESQ32620.1| hypothetical protein EUTSA_v10005197mg [Eutrema salsugineum]
Length=73

 Score =   103 bits (258),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 61/68 (90%), Gaps = 1/68 (1%)
 Frame = -1

Query  377  DLVSKLQRLIPEIRGRR-SDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLESTDGDS  201
            DLVSKL++L+PEIR RR SDKVSASKVLQETCNYIR LH EVD+LSDRLSQLL+S D DS
Sbjct  3    DLVSKLRQLLPEIRERRRSDKVSASKVLQETCNYIRKLHSEVDNLSDRLSQLLDSVDEDS  62

Query  200  AQAAIIRS  177
             +AA+IRS
Sbjct  63   HEAAVIRS  70



>emb|CDX85055.1| BnaC05g20000D [Brassica napus]
Length=94

 Score =   104 bits (259),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 63/73 (86%), Gaps = 1/73 (1%)
 Frame = -1

Query  392  DDQIADLVSKLQRLIPEIR-GRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLES  216
            DDQI DL+SKL++ IPEIR  RRS  VSASKVLQETCNYIR+L++E +DLSDRLSQLLE+
Sbjct  18   DDQITDLISKLRQSIPEIRQNRRSSTVSASKVLQETCNYIRNLNKEANDLSDRLSQLLET  77

Query  215  TDGDSAQAAIIRS  177
             D +S QAAIIRS
Sbjct  78   IDPNSPQAAIIRS  90



>ref|XP_009128048.1| PREDICTED: transcription factor PRE3 [Brassica rapa]
Length=93

 Score =   104 bits (259),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 69/78 (88%), Gaps = 3/78 (4%)
 Frame = -1

Query  407  SSRISDDQIADLVSKLQRLIPEIR-GRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLS  231
            ++RIS+DQI DLV KLQ+L+PE+R   RSDKVSA++VLQ+TCNYIR+LHREVDDLS+RLS
Sbjct  14   TTRISEDQINDLVIKLQQLLPELRDSHRSDKVSAARVLQDTCNYIRNLHREVDDLSERLS  73

Query  230  QLLESTDGDSAQAAIIRS  177
            +LL   + D+AQAA++RS
Sbjct  74   ELL--ANSDTAQAALLRS  89



>ref|XP_008797129.1| PREDICTED: transcription factor ILI6-like [Phoenix dactylifera]
Length=92

 Score =   104 bits (259),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLE  219
            I+D+QI DLVSKLQ L+PE   R +++VSA++VLQ+TC+YIR+LHREVDDLS+RLS+LL 
Sbjct  16   ITDEQINDLVSKLQALLPEAGIRSNERVSAARVLQDTCSYIRNLHREVDDLSERLSELLA  75

Query  218  STDGDSAQAAIIRS  177
            +TD  SAQAAIIRS
Sbjct  76   TTDASSAQAAIIRS  89



>ref|XP_006661757.1| PREDICTED: transcription factor bHLH135-like [Oryza brachyantha]
Length=94

 Score =   103 bits (258),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 70/82 (85%), Gaps = 1/82 (1%)
 Frame = -1

Query  419  QPAESSRISDDQIADLVSKLQRLIPEIRGRRS-DKVSASKVLQETCNYIRSLHREVDDLS  243
            +P+ ++RI+D+QI DLVSKLQ L+PE R R S D+V +++VLQETC+YIRSLHREVDDLS
Sbjct  10   RPSPAARITDEQIGDLVSKLQALLPEARLRSSNDRVPSARVLQETCSYIRSLHREVDDLS  69

Query  242  DRLSQLLESTDGDSAQAAIIRS  177
            +RL++LL + D  +AQAA+IRS
Sbjct  70   ERLAELLAAADVSTAQAAVIRS  91



>ref|XP_009407356.1| PREDICTED: transcription factor ILI5-like [Musa acuminata subsp. 
malaccensis]
Length=85

 Score =   103 bits (257),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = -1

Query  404  SRISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQL  225
            SRIS+++IA+L+SKLQ L+PE R R + + S++K+L+ETCNYI+SLHREVDDLSDRLS++
Sbjct  6    SRISEEEIAELLSKLQSLLPEARRRGTSRASSAKLLKETCNYIKSLHREVDDLSDRLSEM  65

Query  224  LESTDGDSAQAAIIRS  177
            + + D DSAQA IIRS
Sbjct  66   MATMDMDSAQAEIIRS  81



>emb|CDY24160.1| BnaC03g57170D [Brassica napus]
Length=93

 Score =   103 bits (257),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 67/79 (85%), Gaps = 4/79 (5%)
 Frame = -1

Query  407  SSRISDDQIADLVSKLQRLIPEIRG--RRSDKVSASKVLQETCNYIRSLHREVDDLSDRL  234
            +S IS+DQI DLV +L RL+PE+    RRS KVSASKVLQETC YIR+L++EVDDLS+RL
Sbjct  14   ASMISEDQINDLVLQLHRLLPELGNNHRRSGKVSASKVLQETCTYIRNLNKEVDDLSERL  73

Query  233  SQLLESTDGDSAQAAIIRS  177
            SQLLEST  DSAQAA+IRS
Sbjct  74   SQLLEST--DSAQAALIRS  90



>ref|NP_177590.1| transcription factor bHLH135 [Arabidopsis thaliana]
 sp|Q9CA64.1|PRE3_ARATH RecName: Full=Transcription factor PRE3; AltName: Full=Basic 
helix-loop-helix protein 135; Short=AtbHLH135; Short=bHLH 135; 
AltName: Full=Protein ACTIVATION-TAGGED BRI1 SUPPRESSOR 1; 
Short=ATBS1; AltName: Full=Protein PACLOBUTRAZOL RESISTANCE 
3; AltName: Full=Protein TARGET OF MOOPTEROS 7; AltName: Full=Transcription 
factor EN 67; AltName: Full=bHLH transcription 
factor bHLH135 [Arabidopsis thaliana]
 gb|AAG52350.1|AC011765_2 putative DNA-binding protein; 54988-54618 [Arabidopsis thaliana]
 gb|AAM65825.1| putative DNA-binding protein [Arabidopsis thaliana]
 gb|AAO23611.1| At1g74500 [Arabidopsis thaliana]
 dbj|BAE99399.1| putative DNA-binding protein [Arabidopsis thaliana]
 gb|AEE35600.1| transcription factor bHLH135 [Arabidopsis thaliana]
Length=93

 Score =   103 bits (257),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 67/75 (89%), Gaps = 3/75 (4%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIR-GRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLL  222
            IS+DQI DL+ KLQ+L+PE+R  RRSDKVSA++VLQ+TCNYIR+LHREVDDLS+RLS+LL
Sbjct  17   ISEDQINDLIIKLQQLLPELRDSRRSDKVSAARVLQDTCNYIRNLHREVDDLSERLSELL  76

Query  221  ESTDGDSAQAAIIRS  177
               + D+AQAA+IRS
Sbjct  77   --ANSDTAQAALIRS  89



>gb|EPS68402.1| hypothetical protein M569_06365 [Genlisea aurea]
Length=93

 Score =   103 bits (257),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 66/78 (85%), Gaps = 1/78 (1%)
 Frame = -1

Query  407  SSRISDDQIADLVSKLQRLIPEIRGRR-SDKVSASKVLQETCNYIRSLHREVDDLSDRLS  231
            + RI+DDQI +LVSKL +L+PEIR  R S+K+SA+KVLQETCNYIR LH+EV DLS+RLS
Sbjct  14   AGRITDDQIIELVSKLHQLLPEIRANRGSNKLSANKVLQETCNYIRDLHKEVIDLSERLS  73

Query  230  QLLESTDGDSAQAAIIRS  177
            QLL + D DS +AAIIR+
Sbjct  74   QLLSTIDSDSPEAAIIRN  91



>ref|XP_010550611.1| PREDICTED: transcription factor PRE4 [Tarenaya hassleriana]
Length=92

 Score =   103 bits (256),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 66/75 (88%), Gaps = 3/75 (4%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRGRRS-DKVSASKVLQETCNYIRSLHREVDDLSDRLSQLL  222
            I+++QI DLV +L RL+PE+R RRS +KVSAS+VLQETC+YIRSLH+EVDDLS+RLSQLL
Sbjct  16   ITEEQINDLVVQLHRLVPELRDRRSSNKVSASRVLQETCSYIRSLHKEVDDLSERLSQLL  75

Query  221  ESTDGDSAQAAIIRS  177
            E+   DSAQAA IRS
Sbjct  76   ET--ADSAQAAFIRS  88



>ref|XP_011098606.1| PREDICTED: transcription factor PRE1-like [Sesamum indicum]
Length=94

 Score =   103 bits (256),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 62/73 (85%), Gaps = 1/73 (1%)
 Frame = -1

Query  392  DDQIADLVSKLQRLIPEIRG-RRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLES  216
            DDQI DLVSKL +L+PEIR  RR +K SA+KVLQETCNYIR LH+EVD+LS+RLSQLL +
Sbjct  20   DDQIIDLVSKLHQLLPEIRTTRRPNKASANKVLQETCNYIRDLHKEVDNLSERLSQLLST  79

Query  215  TDGDSAQAAIIRS  177
             D +S +AAIIRS
Sbjct  80   IDANSPEAAIIRS  92



>ref|XP_006288963.1| hypothetical protein CARUB_v10002337mg [Capsella rubella]
 ref|XP_010420171.1| PREDICTED: transcription factor PRE2 [Camelina sativa]
 ref|XP_010453645.1| PREDICTED: transcription factor PRE2 [Camelina sativa]
 ref|XP_010492341.1| PREDICTED: transcription factor PRE2 [Camelina sativa]
 gb|EOA21861.1| hypothetical protein CARUB_v10002337mg [Capsella rubella]
Length=94

 Score =   103 bits (256),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 63/73 (86%), Gaps = 1/73 (1%)
 Frame = -1

Query  392  DDQIADLVSKLQRLIPEIR-GRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLES  216
            DDQIADL+SKL + IPEIR  RRS  VSASKVLQETCNYIR+L++E DDLSDRL+QLL++
Sbjct  18   DDQIADLISKLGQSIPEIRQNRRSSTVSASKVLQETCNYIRNLNKEADDLSDRLTQLLDT  77

Query  215  TDGDSAQAAIIRS  177
             D +S QAA+IRS
Sbjct  78   IDPNSPQAAVIRS  90



>ref|XP_010425666.1| PREDICTED: transcription factor PRE5-like [Camelina sativa]
Length=92

 Score =   102 bits (255),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 62/73 (85%), Gaps = 1/73 (1%)
 Frame = -1

Query  392  DDQIADLVSKLQRLIPEIRGRRS-DKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLES  216
            DDQ+ DLV KL++ +PEIR RR  +KVSASKVLQETCNYIR LHREVD+LSDRLSQLL+S
Sbjct  17   DDQMIDLVGKLRQFLPEIRERRRPEKVSASKVLQETCNYIRKLHREVDNLSDRLSQLLDS  76

Query  215  TDGDSAQAAIIRS  177
             D DS +AA+I S
Sbjct  77   VDEDSPEAAVISS  89



>emb|CDX73095.1| BnaC06g35430D [Brassica napus]
Length=90

 Score =   102 bits (255),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 66/73 (90%), Gaps = 3/73 (4%)
 Frame = -1

Query  392  DDQIADLVSKLQRLIPEIRG-RRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLES  216
            +DQI DL+ KLQ+L+PE+R  RRSDKVSAS+VLQETC+YIR+LHREVDDLS+RLS+LL +
Sbjct  16   EDQINDLIIKLQQLLPELRNSRRSDKVSASRVLQETCSYIRNLHREVDDLSERLSELLAN  75

Query  215  TDGDSAQAAIIRS  177
            T  D+AQAA+IRS
Sbjct  76   T--DTAQAALIRS  86



>ref|XP_010917014.1| PREDICTED: transcription factor ILI6-like [Elaeis guineensis]
Length=92

 Score =   102 bits (255),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLE  219
            I+D+QI DLVSKLQ L+PE   R +++VSA+ VLQ+TCNYIRSLH+E +DLS+RLS+LL 
Sbjct  16   ITDEQINDLVSKLQALLPEAGIRSNERVSAASVLQDTCNYIRSLHQEANDLSERLSELLA  75

Query  218  STDGDSAQAAIIRS  177
            +TD  SAQAAIIRS
Sbjct  76   TTDASSAQAAIIRS  89



>ref|XP_009395121.1| PREDICTED: transcription factor ILI6-like [Musa acuminata subsp. 
malaccensis]
Length=92

 Score =   102 bits (254),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = -1

Query  413  AESSRISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRL  234
            A SSRI+D+QIADL++KLQ L+PE R R +D+VSA++VLQ+ CN+IRSL REVD LS RL
Sbjct  11   ATSSRITDEQIADLLAKLQALLPEHRIRSTDRVSAAEVLQDACNHIRSLQREVDGLSGRL  70

Query  233  SQLLESTDGDSAQAAIIRS  177
            +QLL  TD   AQAA+IRS
Sbjct  71   AQLLAMTDSSDAQAAVIRS  89



>ref|XP_010029295.1| PREDICTED: transcription factor PRE5-like [Eucalyptus grandis]
 gb|KCW56186.1| hypothetical protein EUGRSUZ_I01936 [Eucalyptus grandis]
Length=90

 Score =   102 bits (254),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 64/73 (88%), Gaps = 1/73 (1%)
 Frame = -1

Query  392  DDQIADLVSKLQRLIPEIRGRR-SDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLES  216
            DDQI DLVSKL++ +PEIR RR SDKV ASKVLQETCN+I++LH+EVD+LS+RLSQLL +
Sbjct  16   DDQITDLVSKLRQHLPEIRDRRRSDKVPASKVLQETCNHIKNLHQEVDNLSERLSQLLST  75

Query  215  TDGDSAQAAIIRS  177
             D DS +AAIIRS
Sbjct  76   IDPDSPEAAIIRS  88



>ref|XP_008784394.1| PREDICTED: transcription factor ILI6-like [Phoenix dactylifera]
Length=92

 Score =   102 bits (254),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLE  219
            I+DDQI DLVSKLQ L+PE R R +D+ SA+KVLQ+TCNYIRSLH+E+D LS+RL++LL 
Sbjct  16   ITDDQIIDLVSKLQALLPEARRRSTDRGSAAKVLQDTCNYIRSLHQEMDGLSERLAELLA  75

Query  218  STDGDSAQAAIIRS  177
            +TD  S QAAIIRS
Sbjct  76   TTDTTSDQAAIIRS  89



>ref|XP_009393531.1| PREDICTED: transcription factor ILI6-like [Musa acuminata subsp. 
malaccensis]
Length=92

 Score =   102 bits (253),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = -1

Query  404  SRISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQL  225
            +RI+D+QI +L+SKLQ ++PE R   +D+VSA+KVLQETC++IR LHREVDDLS+RLS+L
Sbjct  14   TRITDEQINELISKLQSVLPEARRGGNDRVSAAKVLQETCSHIRRLHREVDDLSERLSEL  73

Query  224  LESTDGDSAQAAIIRS  177
            L+S D +SAQAA IRS
Sbjct  74   LDSADLNSAQAAFIRS  89



>ref|XP_009409993.1| PREDICTED: transcription factor ILI5-like [Musa acuminata subsp. 
malaccensis]
Length=85

 Score =   101 bits (252),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = -1

Query  404  SRISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQL  225
            SRIS+++I +L+SKLQ L+PE R R + + S++K+LQETCNYIRSL REVDDLSDRLS L
Sbjct  6    SRISEEEINELISKLQSLLPETRRRGAGRASSAKLLQETCNYIRSLRREVDDLSDRLSAL  65

Query  224  LESTDGDSAQAAIIRS  177
            +E+ D +SA+A I+RS
Sbjct  66   METMDNNSAEAEIVRS  81



>ref|XP_006404347.1| hypothetical protein EUTSA_v10010858mg [Eutrema salsugineum]
 gb|ESQ45800.1| hypothetical protein EUTSA_v10010858mg [Eutrema salsugineum]
Length=92

 Score =   101 bits (251),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 67/78 (86%), Gaps = 3/78 (4%)
 Frame = -1

Query  407  SSRISDDQIADLVSKLQRLIPEI-RGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLS  231
            +S  ++DQI DLV +L RL+PE+   RRS KVSASKVLQETC+YIR+L++EVDDLS+RLS
Sbjct  13   ASMFTEDQINDLVHQLHRLLPELGNTRRSGKVSASKVLQETCSYIRNLNKEVDDLSERLS  72

Query  230  QLLESTDGDSAQAAIIRS  177
            QLLEST  DSAQAA+IRS
Sbjct  73   QLLEST--DSAQAALIRS  88



>ref|XP_010547809.1| PREDICTED: transcription factor PRE4-like [Tarenaya hassleriana]
Length=93

 Score =   101 bits (252),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 65/78 (83%), Gaps = 3/78 (4%)
 Frame = -1

Query  407  SSRISDDQIADLVSKLQRLIPEIRGRR-SDKVSASKVLQETCNYIRSLHREVDDLSDRLS  231
             S I+DDQI D+V +L R++PE+  RR SDKVSAS+ LQETC+YIR+LH+EVDDLS+RL+
Sbjct  13   GSMITDDQINDIVVQLHRIVPELGNRRPSDKVSASRALQETCSYIRNLHKEVDDLSERLT  72

Query  230  QLLESTDGDSAQAAIIRS  177
            QLLES   DSAQAA IRS
Sbjct  73   QLLES--ADSAQAAFIRS  88



>sp|Q338G6.1|ILI7_ORYSJ RecName: Full=Transcription factor ILI7; Short=OsILI7; AltName: 
Full=Basic helix-loop-helix protein 173; Short=OsbHLH173; 
AltName: Full=Protein INCREASED LEAF INCLINATION 7; AltName: 
Full=bHLH transcription factor bHLH173 [Oryza sativa Japonica 
Group]
 gb|ABB47567.1| hypothetical protein LOC_Os10g26460 [Oryza sativa Japonica Group]
Length=91

 Score =   100 bits (250),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLE  219
            I+D+QI DLVSKLQ L+PE R R +D+V +++VLQETC+YIRSLHREVDDLS+RL++LL 
Sbjct  15   ITDEQIGDLVSKLQALLPEARLRSNDRVPSARVLQETCSYIRSLHREVDDLSERLAELLA  74

Query  218  STDGDSAQAAIIRS  177
            + D  +AQAA+IR 
Sbjct  75   AADVSTAQAAVIRG  88



>gb|EAZ44693.1| hypothetical protein OsJ_29320 [Oryza sativa Japonica Group]
Length=91

 Score =   100 bits (250),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLE  219
            I+D+QI DLVSKLQ L+PE R R +D+V +++VLQETC+YIRSLHREVDDLS+RL++LL 
Sbjct  15   ITDEQIGDLVSKLQALLPEARLRSNDRVPSARVLQETCSYIRSLHREVDDLSERLAELLA  74

Query  218  STDGDSAQAAIIRS  177
            + D  +AQAA+IR 
Sbjct  75   AADVSTAQAAVIRG  88



>sp|A2Z730.1|ILI7_ORYSI RecName: Full=Transcription factor ILI7; AltName: Full=Basic 
helix-loop-helix protein 173; AltName: Full=Protein INCREASED 
LEAF INCLINATION 7; AltName: Full=bHLH transcription factor 
bHLH173 [Oryza sativa Indica Group]
 gb|EAY78414.1| hypothetical protein OsI_33503 [Oryza sativa Indica Group]
Length=91

 Score =   100 bits (250),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLE  219
            I+D+QI DLVSKLQ L+PE R R +D+V +++VLQETC+YIRSLHREVDDLS+RL++LL 
Sbjct  15   ITDEQIGDLVSKLQALLPEARLRSNDRVPSARVLQETCSYIRSLHREVDDLSERLAELLA  74

Query  218  STDGDSAQAAIIRS  177
            + D  +AQAA+IR 
Sbjct  75   AADVSTAQAAVIRG  88



>ref|NP_190355.2| atypical non-DNA binding bHLH protein BNQ3 [Arabidopsis thaliana]
 sp|F4JCN9.1|PRE4_ARATH RecName: Full=Transcription factor PRE4; AltName: Full=Basic 
helix-loop-helix protein 161; Short=AtbHLH161; Short=bHLH 161; 
AltName: Full=Protein BANQUO 3; AltName: Full=Protein PACLOBUTRAZOL 
RESISTANCE 4; AltName: Full=bHLH transcription factor 
bHLH161 [Arabidopsis thaliana]
 gb|AEE78321.1| protein banquo 3 [Arabidopsis thaliana]
Length=92

 Score =   100 bits (250),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 67/78 (86%), Gaps = 3/78 (4%)
 Frame = -1

Query  407  SSRISDDQIADLVSKLQRLIPEI-RGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLS  231
            +S I+D+QI DLV +L RL+PE+   RRS KVSAS+VLQETC+YIR+L +EVDDLS+RLS
Sbjct  13   ASMITDEQINDLVLQLHRLLPELANNRRSGKVSASRVLQETCSYIRNLSKEVDDLSERLS  72

Query  230  QLLESTDGDSAQAAIIRS  177
            QLLEST  DSAQAA+IRS
Sbjct  73   QLLEST--DSAQAALIRS  88



>emb|CAB41854.1| hypothetical protein [Arabidopsis thaliana]
Length=78

 Score =   100 bits (248),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 65/75 (87%), Gaps = 3/75 (4%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEI-RGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLL  222
            I+D+QI DLV +L RL+PE+   RRS KVSAS+VLQETC+YIR+L +EVDDLS+RLSQLL
Sbjct  2    ITDEQINDLVLQLHRLLPELANNRRSGKVSASRVLQETCSYIRNLSKEVDDLSERLSQLL  61

Query  221  ESTDGDSAQAAIIRS  177
            EST  DSAQAA+IRS
Sbjct  62   EST--DSAQAALIRS  74



>ref|XP_011071625.1| PREDICTED: transcription factor PRE3-like [Sesamum indicum]
Length=93

 Score =   100 bits (249),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 64/77 (83%), Gaps = 2/77 (3%)
 Frame = -1

Query  407  SSRISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQ  228
            SSRIS+D+I +L+S+L +LIPE+   RSDK SA KVLQETCNYIRSL REVDDLS+RLS+
Sbjct  15   SSRISEDRINELISQLHQLIPEMHNSRSDKRSAGKVLQETCNYIRSLEREVDDLSERLSE  74

Query  227  LLESTDGDSAQAAIIRS  177
            LL +TD +   AA++RS
Sbjct  75   LLATTDAN--HAALLRS  89



>ref|XP_004985540.1| PREDICTED: transcription factor bHLH135-like [Setaria italica]
Length=92

 Score =   100 bits (248),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLE  219
            I+++QI+DLVSKLQ L+PE R + + +V +++VLQETCNYIRSLH+EVDDLS+RLS+LL 
Sbjct  16   ITEEQISDLVSKLQDLLPEARLQSNARVPSARVLQETCNYIRSLHQEVDDLSERLSELLA  75

Query  218  STDGDSAQAAIIRS  177
            ++D  SAQAAIIRS
Sbjct  76   TSDMSSAQAAIIRS  89



>ref|XP_010937071.1| PREDICTED: transcription factor ILI6-like [Elaeis guineensis]
Length=92

 Score = 99.8 bits (247),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLE  219
            I+DDQI DLVSKLQ L+PE   R +++ SA+KVLQ+TCNYIRSLH+E+DDLS+RL++LL 
Sbjct  16   ITDDQIIDLVSKLQALLPESHRRSTERESAAKVLQDTCNYIRSLHQEMDDLSERLAELLA  75

Query  218  STDGDSAQAAIIRS  177
            +T+  S QAAIIRS
Sbjct  76   TTETTSDQAAIIRS  89



>ref|XP_002465780.1| hypothetical protein SORBIDRAFT_01g045710 [Sorghum bicolor]
 gb|EER92778.1| hypothetical protein SORBIDRAFT_01g045710 [Sorghum bicolor]
Length=92

 Score = 99.8 bits (247),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLE  219
            I+++QI+DLVSKLQ L+PE R + + +V +++VLQETCNYIRSLH+EVDDLS+RLS+LL 
Sbjct  16   ITEEQISDLVSKLQDLLPEARLQSNARVPSARVLQETCNYIRSLHQEVDDLSERLSELLA  75

Query  218  STDGDSAQAAIIRS  177
            ++D  SAQAA+IRS
Sbjct  76   TSDMSSAQAAVIRS  89



>ref|XP_010926221.1| PREDICTED: transcription factor ILI6-like [Elaeis guineensis]
Length=93

 Score = 99.8 bits (247),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLE  219
            I+D+QI DLVSKLQ L+PE   R ++ + A++VLQ+TCN+IRSLH+EVDDLS+RLS+LL 
Sbjct  17   ITDEQINDLVSKLQALLPEAGIRSNNSMPAARVLQDTCNHIRSLHQEVDDLSERLSELLA  76

Query  218  STDGDSAQAAIIRS  177
            +TD  SAQAAIIRS
Sbjct  77   TTDTTSAQAAIIRS  90



>ref|XP_008780728.1| PREDICTED: transcription factor ILI6-like [Phoenix dactylifera]
Length=92

 Score = 99.4 bits (246),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = -1

Query  392  DDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLEST  213
            ++QI DLVSKL+ L+PE   R +   SA++VLQ+TCNYIRSLHREVDDLS+RLS+LL +T
Sbjct  18   EEQINDLVSKLEALLPEASIRSNSSASAARVLQDTCNYIRSLHREVDDLSERLSELLATT  77

Query  212  DGDSAQAAIIRS  177
            D  SAQAAIIRS
Sbjct  78   DTTSAQAAIIRS  89



>ref|XP_009401395.1| PREDICTED: transcription factor ILI5-like [Musa acuminata subsp. 
malaccensis]
Length=130

 Score = 99.8 bits (247),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -1

Query  404  SRISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQL  225
            SRIS+++I +LVSKLQ L+PE R R S + SASK+L+ETCNYIR L+REVDDLS+RLS L
Sbjct  51   SRISEEEINELVSKLQSLLPEARRRGSGRASASKLLKETCNYIRKLNREVDDLSNRLSAL  110

Query  224  LESTDGDSAQAAIIRS  177
            + + D DSA+A IIRS
Sbjct  111  MATMDSDSAEADIIRS  126



>ref|XP_010515078.1| PREDICTED: transcription factor PRE4-like [Camelina sativa]
Length=93

 Score = 99.0 bits (245),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 65/75 (87%), Gaps = 3/75 (4%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEI-RGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLL  222
            I+++QI DLV +L RL+PE+   RRS KVSAS+VLQETC+YIR+L +EVDDLS+RLSQLL
Sbjct  17   ITEEQINDLVLQLHRLLPELGNNRRSGKVSASRVLQETCSYIRNLSKEVDDLSERLSQLL  76

Query  221  ESTDGDSAQAAIIRS  177
            EST  DSAQAA+IRS
Sbjct  77   EST--DSAQAALIRS  89



>ref|XP_008808056.1| PREDICTED: transcription factor ILI5-like isoform X2 [Phoenix 
dactylifera]
Length=85

 Score = 98.6 bits (244),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -1

Query  404  SRISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQL  225
            SRI++++I +L+SKLQ ++PE R R + + SASK+L+ETCNYI+SLHREVDDLSDRLS L
Sbjct  6    SRITEEEINELISKLQSILPESRRRGTSRASASKLLKETCNYIKSLHREVDDLSDRLSDL  65

Query  224  LESTDGDSAQAAIIRS  177
            L + D +SA A I+RS
Sbjct  66   LATMDTNSAHAEIVRS  81



>ref|XP_010426218.1| PREDICTED: transcription factor PRE4 [Camelina sativa]
Length=93

 Score = 98.6 bits (244),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 65/75 (87%), Gaps = 3/75 (4%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEI-RGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLL  222
            I+++QI DLV +L RL+PE+   RRS KVSAS+VLQETC+YIR+L +EVDDLS+RLSQLL
Sbjct  17   ITEEQINDLVLQLHRLLPELGNNRRSGKVSASRVLQETCSYIRNLSKEVDDLSERLSQLL  76

Query  221  ESTDGDSAQAAIIRS  177
            EST  DSAQAA+IRS
Sbjct  77   EST--DSAQAALIRS  89



>ref|XP_008651476.1| PREDICTED: transcription factor ILI6 [Zea mays]
 tpg|DAA43623.1| TPA: putative HLH DNA-binding domain superfamily protein [Zea 
mays]
 gb|AIB05569.1| bHLH transcription factor, partial [Zea mays]
Length=92

 Score = 98.6 bits (244),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLE  219
            I+++QI+DLVSKLQ L+PE R + + +V +++VLQETCNYIR+LH+EVDDLS+RLS+LL 
Sbjct  16   ITEEQISDLVSKLQDLLPEARLQSNARVPSARVLQETCNYIRNLHQEVDDLSERLSELLA  75

Query  218  STDGDSAQAAIIRS  177
            ++D  SAQAA+IRS
Sbjct  76   TSDMSSAQAAVIRS  89



>ref|XP_010937075.1| PREDICTED: transcription factor ILI5-like [Elaeis guineensis]
Length=85

 Score = 98.2 bits (243),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -1

Query  404  SRISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQL  225
            SRI++++I +L+SKLQ ++PE R R + + SASK+L+ETCNYI+SLHREVDDLSDRLS L
Sbjct  6    SRITEEEINELISKLQSVLPEARRRGASRASASKLLKETCNYIKSLHREVDDLSDRLSDL  65

Query  224  LESTDGDSAQAAIIRS  177
            + S D +S QA I+RS
Sbjct  66   MASMDTNSPQAEIVRS  81



>ref|XP_009409165.1| PREDICTED: transcription factor ILI3-like [Musa acuminata subsp. 
malaccensis]
Length=85

 Score = 97.8 bits (242),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 63/79 (80%), Gaps = 0/79 (0%)
 Frame = -1

Query  413  AESSRISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRL  234
               SRI+D++I +LVSKLQ L+PE R R + +VSASK+L+ETC+YI+SLHREVD LSDRL
Sbjct  3    GRGSRITDEEINELVSKLQSLLPESRRRNTGRVSASKLLKETCSYIKSLHREVDGLSDRL  62

Query  233  SQLLESTDGDSAQAAIIRS  177
            S L+ + D +S QA IIRS
Sbjct  63   SGLMVTMDSNSPQAEIIRS  81



>ref|XP_006292883.1| hypothetical protein CARUB_v10019148mg [Capsella rubella]
 gb|EOA25781.1| hypothetical protein CARUB_v10019148mg [Capsella rubella]
Length=92

 Score = 98.2 bits (243),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 64/75 (85%), Gaps = 3/75 (4%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEI-RGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLL  222
            IS++QI DLV +L RL+PE+   RRS KVSAS+VLQETC+YIR+L +EVDDLS+RLSQLL
Sbjct  16   ISEEQINDLVLQLHRLLPELGNNRRSGKVSASRVLQETCSYIRNLSKEVDDLSERLSQLL  75

Query  221  ESTDGDSAQAAIIRS  177
            ESTD D  QAA+IRS
Sbjct  76   ESTDSD--QAALIRS  88



>gb|KHG06126.1| Transcription factor protein [Gossypium arboreum]
Length=91

 Score = 97.1 bits (240),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 63/77 (82%), Gaps = 1/77 (1%)
 Frame = -1

Query  404  SRISDDQIADLVSKLQRLIPEIRGRRSDKVS-ASKVLQETCNYIRSLHREVDDLSDRLSQ  228
            + IS++QI  L+S L++L+PEI    S K S A+KVL++TCNYI++LHREVDDLSDRLSQ
Sbjct  12   TNISEEQITQLLSTLRQLLPEIPHSHSHKASSAAKVLEQTCNYIKTLHREVDDLSDRLSQ  71

Query  227  LLESTDGDSAQAAIIRS  177
            LL + D DSA+AAIIRS
Sbjct  72   LLATIDADSAEAAIIRS  88



>ref|XP_009403179.1| PREDICTED: transcription factor ILI5-like [Musa acuminata subsp. 
malaccensis]
Length=85

 Score = 96.7 bits (239),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = -1

Query  404  SRISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQL  225
            SR+S+++I +L+SKLQ L+PE R R   + SA+K+L+ETCNYIRSL+REVDDLS RLS L
Sbjct  6    SRVSEEEINELISKLQSLLPEARRRGGGRASAAKLLKETCNYIRSLNREVDDLSGRLSAL  65

Query  224  LESTDGDSAQAAIIRS  177
            + + D +SA+A IIRS
Sbjct  66   MATMDNNSAEAEIIRS  81



>ref|XP_010939530.1| PREDICTED: transcription factor ILI5-like [Elaeis guineensis]
Length=85

 Score = 96.7 bits (239),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = -1

Query  404  SRISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQL  225
            SRI++++I +L+SKLQ ++PE R R + + SASK+L+ETCNYI+SLHREVDDLSDRLS L
Sbjct  6    SRITEEEINELISKLQSILPETRRRGTSRASASKLLKETCNYIKSLHREVDDLSDRLSDL  65

Query  224  LESTDGDSAQAAIIRS  177
            L + D +S  A I+RS
Sbjct  66   LATMDTNSPHAEIVRS  81



>ref|XP_009413611.1| PREDICTED: transcription factor ILI3-like [Musa acuminata subsp. 
malaccensis]
Length=87

 Score = 96.3 bits (238),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 63/79 (80%), Gaps = 0/79 (0%)
 Frame = -1

Query  413  AESSRISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRL  234
              SSRI+D++I +LVSKLQ L+PE R R   + SASK+L+ETC+YI+SLHR+VDDLSDRL
Sbjct  5    GSSSRITDEEINELVSKLQSLLPESRRRNIGRASASKLLKETCSYIKSLHRDVDDLSDRL  64

Query  233  SQLLESTDGDSAQAAIIRS  177
            S L+ + D +S QA IIRS
Sbjct  65   SALMATMDANSPQADIIRS  83



>ref|XP_010503380.1| PREDICTED: transcription factor PRE4-like [Camelina sativa]
Length=93

 Score = 95.9 bits (237),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 52/75 (69%), Positives = 64/75 (85%), Gaps = 3/75 (4%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEI-RGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLL  222
            I+++QI DLV +L RL+PE+   R S KVSAS+VLQETC+YIR+L +EVDDLS+RLSQLL
Sbjct  17   ITEEQINDLVLQLHRLLPELGNNRSSGKVSASRVLQETCSYIRNLSKEVDDLSERLSQLL  76

Query  221  ESTDGDSAQAAIIRS  177
            EST  DSAQAA+IRS
Sbjct  77   EST--DSAQAALIRS  89



>ref|XP_010917019.1| PREDICTED: transcription factor ILI5-like [Elaeis guineensis]
Length=85

 Score = 95.9 bits (237),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = -1

Query  404  SRISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQL  225
            +RISD++I +L+SKLQ L+PE R R   + SASK+L+ETC+YI+SLHREVDDLSDRLS L
Sbjct  6    NRISDEEINELISKLQSLLPESRRRNIGRASASKLLKETCSYIKSLHREVDDLSDRLSDL  65

Query  224  LESTDGDSAQAAIIRS  177
            + + D +S QA IIRS
Sbjct  66   IATMDSNSPQAEIIRS  81



>ref|XP_008784341.1| PREDICTED: transcription factor ILI5-like [Phoenix dactylifera]
Length=85

 Score = 95.5 bits (236),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = -1

Query  404  SRISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQL  225
            SRI++++I++L+SKLQ  +PE R R + + SASK+L+ETCNYI+SLHREVDDLSDRLS L
Sbjct  6    SRITEEEISELISKLQSALPEARRRGASRASASKLLKETCNYIKSLHREVDDLSDRLSDL  65

Query  224  LESTDGDSAQAAIIR  180
            + S D +S QA I+R
Sbjct  66   VASLDTNSPQAEIVR  80



>gb|KFK34072.1| hypothetical protein AALP_AA5G098800 [Arabis alpina]
Length=204

 Score = 98.2 bits (243),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 73/98 (74%), Gaps = 9/98 (9%)
 Frame = -1

Query  407  SSRISDDQIADLVSKLQRLIPEIRGRR--SDKVSASKVLQETCNYIRSLHREVDDLSDRL  234
            +S IS+DQI DLV +L RL+PE+   R  S +VSAS+VLQETC+YIR+L++EVDDLS+RL
Sbjct  13   ASMISEDQINDLVVQLHRLLPELANNRRLSGEVSASRVLQETCSYIRNLNKEVDDLSERL  72

Query  233  SQLLESTDGDSAQAAIIRSllm**lLIFFTYYDIRYFH  120
            SQLLEST  DSAQAA+IR LL          YD+ Y H
Sbjct  73   SQLLEST--DSAQAALIRKLLKDNKA-----YDLIYRH  103



>ref|XP_008804467.1| PREDICTED: transcription factor ILI6-like [Phoenix dactylifera]
Length=92

 Score = 95.1 bits (235),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLE  219
            ++DDQI DLVSKLQ L+PE   R +D+ SA+KVLQ+  NYIRSLH+EVDDLS+RL++LL 
Sbjct  16   MTDDQITDLVSKLQALLPEAPTRSTDRESATKVLQDAWNYIRSLHQEVDDLSERLAELLA  75

Query  218  STDGDSAQAAIIRS  177
            +TD    QAAIIRS
Sbjct  76   TTDITGDQAAIIRS  89



>ref|XP_004983139.1| PREDICTED: transcription factor bHLH135-like [Setaria italica]
Length=88

 Score = 94.4 bits (233),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 63/78 (81%), Gaps = 1/78 (1%)
 Frame = -1

Query  407  SSRISDDQIADLVSKLQRLIPEIRGRRS-DKVSASKVLQETCNYIRSLHREVDDLSDRLS  231
            + RI+DD+I +L+SKLQ ++PE   R +  + SASK+LQETC YIR LHREVDDL++RLS
Sbjct  6    AGRINDDEINELISKLQSVLPESSRRGAAGRSSASKLLQETCQYIRRLHREVDDLNNRLS  65

Query  230  QLLESTDGDSAQAAIIRS  177
            +L+E+ DGDS QA IIRS
Sbjct  66   ELMETMDGDSPQADIIRS  83



>ref|XP_008808055.1| PREDICTED: transcription factor ILI5-like isoform X1 [Phoenix 
dactylifera]
Length=86

 Score = 94.0 bits (232),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 63/77 (82%), Gaps = 1/77 (1%)
 Frame = -1

Query  404  SRISDDQIADLVSKLQRLIPEIRGR-RSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQ  228
            SRI++++I +L+SKLQ ++PE R R  S + SASK+L+ETCNYI+SLHREVDDLSDRLS 
Sbjct  6    SRITEEEINELISKLQSILPESRRRGTSRQASASKLLKETCNYIKSLHREVDDLSDRLSD  65

Query  227  LLESTDGDSAQAAIIRS  177
            LL + D +SA A I+RS
Sbjct  66   LLATMDTNSAHAEIVRS  82



>ref|XP_009401191.1| PREDICTED: transcription factor ILI3-like [Musa acuminata subsp. 
malaccensis]
Length=85

 Score = 94.0 bits (232),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 60/75 (80%), Gaps = 0/75 (0%)
 Frame = -1

Query  401  RISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLL  222
            RI+D++I +LVSKLQ L+PE R R   + SASK+L+ETC+YI+SLHREVD LSDRLS L+
Sbjct  7    RITDEEINELVSKLQSLLPESRRRNIGRASASKLLKETCSYIKSLHREVDGLSDRLSGLM  66

Query  221  ESTDGDSAQAAIIRS  177
             + D DS QA IIRS
Sbjct  67   ATMDSDSPQADIIRS  81



>gb|EPS59766.1| protein banquo 3, partial [Genlisea aurea]
Length=78

 Score = 93.6 bits (231),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 61/77 (79%), Gaps = 3/77 (4%)
 Frame = -1

Query  404  SRISDDQIADLVSKLQRLIPEIR-GRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQ  228
            SR++ DQI DL+SKL  L+PEI   RR+ KVSA KVLQETC+YIR L REVDDLS RLS 
Sbjct  1    SRLTHDQIVDLISKLTLLVPEIHPHRRTHKVSAEKVLQETCDYIRRLKREVDDLSARLSD  60

Query  227  LLESTDGDSAQAAIIRS  177
            +++STD D  QAA+IRS
Sbjct  61   IIQSTDAD--QAAVIRS  75



>ref|XP_010926541.1| PREDICTED: transcription factor ILI3-like [Elaeis guineensis]
Length=85

 Score = 92.8 bits (229),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 61/76 (80%), Gaps = 0/76 (0%)
 Frame = -1

Query  404  SRISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQL  225
            SRISD++I +L+SKLQ L+PE R   + + SASK+L+ETC+YI+SL REVDDLSDRLS L
Sbjct  6    SRISDEEINELISKLQALLPESRRPSTSRASASKLLKETCSYIKSLRREVDDLSDRLSDL  65

Query  224  LESTDGDSAQAAIIRS  177
            L + D +S QA IIRS
Sbjct  66   LATMDSNSPQAEIIRS  81



>ref|XP_008803188.1| PREDICTED: transcription factor ILI3 [Phoenix dactylifera]
Length=85

 Score = 92.8 bits (229),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = -1

Query  401  RISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLL  222
            RI+D++I +L+SKLQ L+PE R R   + SASK+L+ETC+YI+SLH+EVDDLSDRLS L+
Sbjct  7    RITDEEINELISKLQTLLPESRRRNIGRASASKLLKETCSYIKSLHQEVDDLSDRLSDLI  66

Query  221  ESTDGDSAQAAIIRS  177
             + D +S QA IIRS
Sbjct  67   ATMDSNSPQAEIIRS  81



>ref|XP_009390918.1| PREDICTED: transcription factor ILI6-like [Musa acuminata subsp. 
malaccensis]
Length=92

 Score = 92.8 bits (229),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLE  219
            I+D+QI DL++KLQ ++PE R   + +VSA++VLQETC+Y+RSLHREVDDLS+RLS+LL 
Sbjct  16   ITDEQINDLMAKLQAVLPEARLGINHRVSAARVLQETCSYLRSLHREVDDLSERLSELLA  75

Query  218  STDGDSAQAAIIRS  177
              D   A+AAIIRS
Sbjct  76   MADISGAEAAIIRS  89



>ref|XP_009393721.1| PREDICTED: transcription factor ILI5-like [Musa acuminata subsp. 
malaccensis]
Length=85

 Score = 92.8 bits (229),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = -1

Query  404  SRISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQL  225
            SR+S+++I  LVSKLQ L+PE R R + + SA+K+L+ETCNYIRSL+R+VDDLSDRLS +
Sbjct  6    SRVSEEEINRLVSKLQSLLPETRQRGAGRASAAKLLKETCNYIRSLNRDVDDLSDRLSAI  65

Query  224  LESTDGDSAQAAIIRS  177
            + + D  SA+A ++RS
Sbjct  66   MATMDSSSAEAEMVRS  81



>emb|CDY63469.1| BnaCnng42180D [Brassica napus]
Length=93

 Score = 92.4 bits (228),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 70/82 (85%), Gaps = 1/82 (1%)
 Frame = -1

Query  419  QPAESSRISDDQIADLVSKLQRLIPEIRGRR-SDKVSASKVLQETCNYIRSLHREVDDLS  243
            Q + ++RISDDQ+ DLV KL++ +PEIR RR SDKVSASKVLQ+TCNYIR LHREVD+LS
Sbjct  9    QSSSATRISDDQMIDLVGKLRQFLPEIRERRRSDKVSASKVLQDTCNYIRKLHREVDNLS  68

Query  242  DRLSQLLESTDGDSAQAAIIRS  177
            DRLS LL+S D DS +AA+IR+
Sbjct  69   DRLSLLLDSVDEDSQEAAVIRN  90



>ref|XP_009589864.1| PREDICTED: transcription factor PRE3-like [Nicotiana tomentosiformis]
Length=91

 Score = 91.7 bits (226),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 63/75 (84%), Gaps = 2/75 (3%)
 Frame = -1

Query  404  SRISDDQIADLVSKLQRLIPEIRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQL  225
            SRI++DQI DLVSKLQ+L+PE+R R  DKVSA++VLQET N IR+L  EVDDLS++LSQL
Sbjct  14   SRITEDQINDLVSKLQQLLPELRNRSYDKVSAARVLQETSNNIRNLLGEVDDLSEQLSQL  73

Query  224  LESTDGDSAQAAIIR  180
            L ++  D+ QAA++R
Sbjct  74   LGTS--DTTQAALLR  86



>gb|EYU34661.1| hypothetical protein MIMGU_mgv1a018243mg [Erythranthe guttata]
Length=99

 Score = 91.7 bits (226),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 61/79 (77%), Gaps = 5/79 (6%)
 Frame = -1

Query  398  ISDDQIADLVSKLQRLIPEIRGRR-----SDKVSASKVLQETCNYIRSLHREVDDLSDRL  234
            I+DD+I +LVSKLQ+L+P+ R        S+K SA+KVLQETCNYI+ L +E+DDLS RL
Sbjct  19   ITDDEIIELVSKLQQLLPQTRNTSNTTPASNKASANKVLQETCNYIKKLQKEMDDLSVRL  78

Query  233  SQLLESTDGDSAQAAIIRS  177
             QLL + D DSA+AA+IR+
Sbjct  79   CQLLSTVDADSAEAAVIRA  97



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 531920664320