BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c10437_g1_i1 len=1077 path=[1:0-1050 2469:1051-1053 2473:1054-1076]

Length=1077
                                                                      Score     E

ref|XP_009799696.1|  PREDICTED: nodulation-signaling pathway 2 pr...    527   0.0      
ref|XP_006351875.1|  PREDICTED: nodulation-signaling pathway 2 pr...    520   1e-179   
ref|XP_007019002.1|  GRAS family transcription factor                   518   4e-179   
ref|XP_006472746.1|  PREDICTED: nodulation-signaling pathway 2 pr...    516   4e-178   
gb|KDO80719.1|  hypothetical protein CISIN_1g011012mg                   516   6e-178   
ref|XP_006434151.1|  hypothetical protein CICLE_v10000940mg             515   8e-178   
ref|XP_009627108.1|  PREDICTED: nodulation-signaling pathway 2 pr...    516   8e-178   
ref|XP_011069635.1|  PREDICTED: nodulation-signaling pathway 2 pr...    514   2e-177   
ref|XP_004250334.1|  PREDICTED: nodulation-signaling pathway 2 pr...    513   5e-177   
ref|XP_002284426.2|  PREDICTED: nodulation-signaling pathway 2 pr...    513   6e-177   Vitis vinifera
ref|XP_002513781.1|  Nodulation signaling pathway 2 protein, puta...    509   2e-175   Ricinus communis
ref|XP_007226747.1|  hypothetical protein PRUPE_ppa018977mg             509   3e-175   
ref|XP_009344104.1|  PREDICTED: nodulation-signaling pathway 2 pr...    508   8e-175   
emb|CAN83568.1|  hypothetical protein VITISV_030382                     506   3e-174   Vitis vinifera
ref|XP_004292683.1|  PREDICTED: nodulation-signaling pathway 2 pr...    505   9e-174   
ref|XP_011013191.1|  PREDICTED: nodulation-signaling pathway 2 pr...    502   1e-172   
ref|XP_002306621.1|  hypothetical protein POPTR_0005s15900g             501   6e-172   Populus trichocarpa [western balsam poplar]
ref|XP_002302249.1|  scarecrow transcription factor family protein      498   5e-171   Populus trichocarpa [western balsam poplar]
ref|XP_010042750.1|  PREDICTED: nodulation-signaling pathway 2 pr...    498   6e-171   
emb|CBI19047.3|  unnamed protein product                                495   4e-170   
ref|XP_011027574.1|  PREDICTED: nodulation-signaling pathway 2 pr...    496   5e-170   
gb|KDP32775.1|  hypothetical protein JCGZ_12067                         494   2e-169   
ref|XP_008219753.1|  PREDICTED: nodulation-signaling pathway 2 pr...    487   2e-166   
ref|XP_004499407.1|  PREDICTED: nodulation-signaling pathway 2 pr...    467   1e-158   
ref|XP_003522584.1|  PREDICTED: nodulation-signaling pathway 2 pr...    466   2e-158   
ref|XP_003601076.1|  Nodulation-signaling pathway 2 protein             463   4e-157   
emb|CAH55769.1|  GRAS family protein                                    459   2e-155   Pisum sativum [garden pea]
gb|ACI14607.1|  GRAS family protein                                     458   3e-155   Pisum sativum [garden pea]
gb|ACI14606.1|  GRAS family protein                                     457   5e-155   Pisum sativum [garden pea]
ref|XP_008350554.1|  PREDICTED: nodulation-signaling pathway 2 pr...    457   9e-155   
ref|XP_010091366.1|  hypothetical protein L484_020168                   457   1e-154   
ref|XP_007137382.1|  hypothetical protein PHAVU_009G122700g             455   4e-154   
gb|ACI14609.1|  mutant GRAS family protein                              453   3e-153   Pisum sativum [garden pea]
ref|XP_003527930.1|  PREDICTED: nodulation-signaling pathway 2 pr...    451   2e-151   
ref|XP_003614758.1|  Nodulation signaling pathway                       447   6e-151   
ref|XP_007141073.1|  hypothetical protein PHAVU_008G165200g             431   4e-145   
dbj|BAE72690.1|  transcription initiator for nodulation                 429   4e-144   Lotus japonicus
ref|XP_003543792.1|  PREDICTED: nodulation-signaling pathway 2 pr...    419   3e-140   
ref|XP_004140976.1|  PREDICTED: nodulation-signaling pathway 2 pr...    417   2e-139   
ref|XP_008445682.1|  PREDICTED: nodulation-signaling pathway 2 pr...    417   2e-139   
ref|XP_010064996.1|  PREDICTED: nodulation-signaling pathway 2 pr...    409   4e-136   
ref|XP_006846636.1|  hypothetical protein AMTR_s00156p00061400          399   4e-132   
ref|XP_010544534.1|  PREDICTED: scarecrow-like protein 26 isoform X1    393   4e-129   
gb|KHN33871.1|  Nodulation-signaling pathway 2 protein                  382   1e-128   
ref|XP_008808173.1|  PREDICTED: LOW QUALITY PROTEIN: nodulation-s...    387   2e-127   
ref|NP_192565.1|  scarecrow-like protein 26                             380   7e-125   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010438468.1|  PREDICTED: scarecrow-like protein 26               379   1e-124   
ref|XP_006290057.1|  hypothetical protein CARUB_v10003692mg             379   3e-124   
ref|XP_010916821.1|  PREDICTED: LOW QUALITY PROTEIN: nodulation-s...    380   3e-124   
ref|XP_002872385.1|  scarecrow transcription factor family protein      378   4e-124   
ref|XP_002468140.1|  hypothetical protein SORBIDRAFT_01g040270          379   2e-123   Sorghum bicolor [broomcorn]
gb|EAY89342.1|  hypothetical protein OsI_10846                          379   2e-123   Oryza sativa Indica Group [Indian rice]
gb|AAP06856.1|  hypothetical protein                                    379   3e-123   Oryza sativa Japonica Group [Japonica rice]
gb|AFP97600.1|  nodulation signaling pathway 2-like protein             374   1e-122   
gb|EAZ26349.1|  hypothetical protein OsJ_10230                          377   1e-122   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006651234.1|  PREDICTED: nodulation-signaling pathway 2 pr...    375   2e-122   
gb|AFP97593.1|  nodulation signaling pathway 2-like protein             372   6e-122   
ref|XP_008782233.1|  PREDICTED: nodulation-signaling pathway 2 pr...    373   8e-122   
ref|XP_004984706.1|  PREDICTED: nodulation-signaling pathway 2 pr...    374   1e-121   
emb|CDY17336.1|  BnaA10g09700D                                          372   2e-121   
gb|AFP97595.1|  nodulation signaling pathway 2-like protein             371   2e-121   
ref|XP_006397321.1|  hypothetical protein EUTSA_v10028622mg             370   4e-121   
emb|CDY45672.1|  BnaC09g32140D                                          370   4e-121   
gb|AFP97591.1|  nodulation signaling pathway 2-like protein             370   4e-121   
gb|AFP97598.1|  nodulation signaling pathway 2-like protein             370   6e-121   
gb|AFP97603.1|  nodulation signaling pathway 2-like protein             369   7e-121   
ref|XP_009120075.1|  PREDICTED: scarecrow-like protein 26 isoform X2    369   8e-121   
gb|AFP97592.1|  nodulation signaling pathway 2-like protein             369   8e-121   
gb|AFP97599.1|  nodulation signaling pathway 2-like protein             369   1e-120   
ref|XP_010421850.1|  PREDICTED: scarecrow-like protein 26               369   2e-120   
ref|XP_009120074.1|  PREDICTED: scarecrow-like protein 26 isoform X1    369   2e-120   
ref|XP_008653941.1|  PREDICTED: nodulation-signaling pathway 2 pr...    370   3e-120   
gb|AFP97602.1|  nodulation signaling pathway 2-like protein             367   5e-120   
ref|XP_009419162.1|  PREDICTED: nodulation-signaling pathway 2 pr...    369   8e-120   
gb|AFP97601.1|  nodulation signaling pathway 2-like protein             366   1e-119   
ref|XP_010455246.1|  PREDICTED: scarecrow-like protein 26               365   3e-119   
gb|AFP97589.1|  nodulation signaling pathway 2-like protein             365   4e-119   
gb|EMS67782.1|  hypothetical protein TRIUR3_13261                       366   2e-118   
gb|AFP97590.1|  nodulation signaling pathway 2-like protein             363   2e-118   
gb|AFP97594.1|  nodulation signaling pathway 2-like protein             363   2e-118   
gb|AFP97588.1|  nodulation signaling pathway 2-like protein             363   3e-118   
gb|AFP97596.1|  nodulation signaling pathway 2-like protein             361   1e-117   
gb|KCW70581.1|  hypothetical protein EUGRSUZ_F03769                     360   3e-117   
ref|XP_010926532.1|  PREDICTED: nodulation-signaling pathway 2 pr...    346   3e-111   
ref|XP_003558300.1|  PREDICTED: nodulation-signaling pathway 2 pr...    336   1e-106   
ref|XP_010065142.1|  PREDICTED: uncharacterized protein LOC104452376    343   2e-104   
ref|XP_002994176.1|  hypothetical protein SELMODRAFT_1984               286   6e-90    
ref|XP_002993042.1|  hypothetical protein SELMODRAFT_136372             283   1e-87    
ref|XP_002965768.1|  GRAS family protein                                284   6e-87    
ref|XP_002972121.1|  GRAS family protein                                272   2e-82    
emb|CDP12781.1|  unnamed protein product                                218   2e-62    
ref|XP_006854562.1|  hypothetical protein AMTR_s00030p00099410          210   2e-59    
gb|KHN29155.1|  Nodulation-signaling pathway 2 protein                  204   3e-58    
ref|XP_011012014.1|  PREDICTED: nodulation-signaling pathway 2 pr...    207   4e-58    
ref|XP_007159815.1|  hypothetical protein PHAVU_002G269800g             206   8e-58    
ref|XP_006371003.1|  hypothetical protein POPTR_0019s02540g             205   2e-57    
ref|XP_004503962.1|  PREDICTED: nodulation-signaling pathway 2 pr...    205   2e-57    
ref|XP_003532857.2|  PREDICTED: nodulation-signaling pathway 2 pr...    204   6e-57    
ref|XP_002276350.1|  PREDICTED: nodulation-signaling pathway 2 pr...    204   6e-57    Vitis vinifera
gb|KFK32147.1|  hypothetical protein AALP_AA6G204300                    199   1e-56    
ref|XP_001763820.1|  predicted protein                                  199   3e-56    
ref|XP_003630217.1|  GRAS family transcription factor                   202   4e-56    
ref|XP_004250446.1|  PREDICTED: nodulation-signaling pathway 2 pr...    199   4e-55    
ref|XP_004308265.1|  PREDICTED: nodulation-signaling pathway 2 pr...    198   5e-55    
ref|XP_010931005.1|  PREDICTED: nodulation-signaling pathway 2 pr...    197   2e-54    
ref|XP_006351042.1|  PREDICTED: nodulation-signaling pathway 2 pr...    196   4e-54    
ref|XP_001773669.1|  predicted protein                                  192   5e-54    
ref|XP_009761269.1|  PREDICTED: nodulation-signaling pathway 2 pr...    196   1e-53    
ref|XP_002992412.1|  hypothetical protein SELMODRAFT_135151             191   3e-53    
ref|XP_009606529.1|  PREDICTED: nodulation-signaling pathway 2 pr...    193   9e-53    
ref|XP_002450783.1|  hypothetical protein SORBIDRAFT_05g018070          196   1e-52    Sorghum bicolor [broomcorn]
ref|XP_004980521.1|  PREDICTED: DELLA protein GAI-like                  196   1e-52    
ref|XP_008810295.1|  PREDICTED: protein SCARECROW-like                  189   2e-52    
ref|XP_008781634.1|  PREDICTED: nodulation-signaling pathway 2 pr...    190   3e-52    
ref|XP_003553957.1|  PREDICTED: protein SCARECROW-like                  194   4e-52    
ref|XP_008680172.1|  PREDICTED: DELLA protein GAI-like                  194   4e-52    
ref|XP_009405522.1|  PREDICTED: DELLA protein GAI-like                  194   5e-52    
ref|XP_008379744.1|  PREDICTED: DELLA protein RGL1-like                 194   6e-52    
gb|ABA93922.1|  GRAS family transcription factor containing protein     194   8e-52    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009346793.1|  PREDICTED: DELLA protein RGL1-like                 192   2e-51    
ref|XP_010935956.1|  PREDICTED: protein SCARECROW-like                  186   2e-51    
ref|XP_002968015.1|  GRAS family protein                                189   2e-51    
ref|XP_002982342.1|  hypothetical protein SELMODRAFT_116328             189   6e-51    
ref|XP_008791129.1|  PREDICTED: DELLA protein RGL3-like                 191   8e-51    
ref|XP_004138798.1|  PREDICTED: DELLA protein GAI1-like                 190   9e-51    
gb|KDO63869.1|  hypothetical protein CISIN_1g045762mg                   184   1e-50    
ref|XP_004171790.1|  PREDICTED: DELLA protein GAI1-like                 190   1e-50    
ref|XP_008441631.1|  PREDICTED: DELLA protein RGL1-like                 190   1e-50    
ref|XP_010237707.1|  PREDICTED: DELLA protein GAI-like                  190   1e-50    
ref|XP_008231070.1|  PREDICTED: DELLA protein GAI-like                  189   2e-50    
ref|XP_003549053.1|  PREDICTED: protein SCARECROW-like                  189   2e-50    
emb|CDP12839.1|  unnamed protein product                                183   2e-50    
ref|XP_002512896.1|  DELLA protein GAI1, putative                       189   2e-50    Ricinus communis
gb|EYU31843.1|  hypothetical protein MIMGU_mgv1a021983mg                189   3e-50    
ref|XP_002966500.1|  GRAS family protein                                189   4e-50    
ref|XP_008341667.1|  PREDICTED: DELLA protein RGL1-like                 188   6e-50    
ref|XP_009378007.1|  PREDICTED: DELLA protein RGL1-like                 188   7e-50    
gb|KCW54273.1|  hypothetical protein EUGRSUZ_I00236                     182   7e-50    
ref|XP_004304540.1|  PREDICTED: DELLA protein GAI1-like                 187   1e-49    
ref|XP_011099005.1|  PREDICTED: DELLA protein RGL2-like                 187   1e-49    
ref|XP_009344215.1|  PREDICTED: DELLA protein RGL1-like                 187   1e-49    
ref|XP_011045749.1|  PREDICTED: DELLA protein RGL1-like                 186   2e-49    
gb|KDP41801.1|  hypothetical protein JCGZ_26819                         186   2e-49    
ref|XP_007031934.1|  GRAS family transcription factor                   186   3e-49    
emb|CDP16713.1|  unnamed protein product                                186   3e-49    
ref|XP_006447014.1|  hypothetical protein CICLE_v10018153mg             186   3e-49    
ref|XP_010917930.1|  PREDICTED: DELLA protein GAI1-like                 181   4e-49    
ref|XP_007217517.1|  hypothetical protein PRUPE_ppa024399mg             186   4e-49    
ref|XP_010315907.1|  PREDICTED: DELLA protein RGL1-like                 185   6e-49    
gb|EAZ17249.1|  hypothetical protein OsJ_32770                          184   7e-49    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009803754.1|  PREDICTED: DELLA protein RGL2-like                 185   8e-49    
ref|XP_009613034.1|  PREDICTED: DELLA protein RGL1-like                 184   9e-49    
gb|KHG10483.1|  Protein SCARECROW -like protein                         185   9e-49    
ref|XP_007161687.1|  hypothetical protein PHAVU_001G089900g             184   1e-48    
dbj|BAD22576.1|  SCARECROW                                              184   1e-48    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002298647.1|  hypothetical protein POPTR_0001s33360g             184   1e-48    Populus trichocarpa [western balsam poplar]
ref|NP_001065617.1|  Os11g0124300                                       184   1e-48    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003622095.1|  Protein SCARECROW                                  183   2e-48    
ref|XP_002274834.2|  PREDICTED: scarecrow-like protein 21               183   2e-48    Vitis vinifera
ref|XP_006853952.1|  hypothetical protein AMTR_s00036p00212000          177   4e-48    
ref|XP_002306689.2|  hypothetical protein POPTR_0005s21260g             179   6e-48    Populus trichocarpa [western balsam poplar]
ref|XP_006338809.1|  PREDICTED: protein SCARECROW-like                  182   7e-48    
gb|ABH85406.1|  SCARECROW                                               182   8e-48    Pinus sylvestris [Scotch pine]
ref|XP_011000401.1|  PREDICTED: scarecrow-like protein 18               177   1e-47    
gb|AJC52489.1|  SCR                                                     182   1e-47    
gb|ACD13207.1|  GRAS protein                                            176   1e-47    
gb|KDO64235.1|  hypothetical protein CISIN_1g014896mg                   177   2e-47    
gb|KHG02698.1|  Protein SCARECROW                                       181   2e-47    
ref|XP_002265645.1|  PREDICTED: scarecrow-like protein 18               177   2e-47    Vitis vinifera
ref|XP_010110925.1|  hypothetical protein L484_005656                   180   2e-47    
ref|XP_004305056.1|  PREDICTED: protein SCARECROW-like                  181   3e-47    
ref|XP_007032248.1|  GRAS family transcription factor isoform 2         179   7e-47    
ref|XP_010529957.1|  PREDICTED: protein SCARECROW-like                  178   8e-47    
emb|CAI30892.1|  SCARECROW                                              180   9e-47    Cucumis sativus [cucumbers]
ref|XP_007032247.1|  GRAS family transcription factor isoform 1         179   1e-46    
ref|XP_008463324.1|  PREDICTED: LOW QUALITY PROTEIN: protein SCAR...    180   1e-46    
ref|XP_004147549.1|  PREDICTED: LOW QUALITY PROTEIN: protein SCAR...    180   1e-46    
ref|XP_004163982.1|  PREDICTED: uncharacterized protein LOC101230653    179   1e-46    
gb|KGN53965.1|  hypothetical protein Csa_4G196810                       179   1e-46    
ref|XP_010036052.1|  PREDICTED: protein SCARECROW                       178   2e-46    
ref|XP_004505671.1|  PREDICTED: scarecrow-like protein 23-like          175   2e-46    
gb|KCW47573.1|  hypothetical protein EUGRSUZ_K01320                     178   2e-46    
tpg|DAA39295.1|  TPA: hypothetical protein ZEAMMB73_760951              178   2e-46    
ref|XP_008788032.1|  PREDICTED: protein SCARECROW 2-like isoform X2     177   3e-46    
ref|XP_011080303.1|  PREDICTED: protein SCARECROW-like                  175   3e-46    
gb|AFK37026.1|  unknown                                                 174   3e-46    
ref|XP_010931426.1|  PREDICTED: protein SCARECROW 2-like                177   4e-46    
ref|XP_008788030.1|  PREDICTED: protein SCARECROW 2-like isoform X1     177   4e-46    
gb|KDP21811.1|  hypothetical protein JCGZ_00598                         178   4e-46    
ref|XP_002994174.1|  hypothetical protein SELMODRAFT_432115             177   4e-46    
gb|KHN40575.1|  Protein SCARECROW                                       176   4e-46    
ref|XP_006475101.1|  PREDICTED: scarecrow-like protein 18-like          174   5e-46    
ref|XP_001783367.1|  predicted protein                                  174   5e-46    
ref|XP_009401608.1|  PREDICTED: protein SCARECROW 2-like                177   7e-46    
ref|XP_004147990.1|  PREDICTED: scarecrow-like protein 18-like          172   7e-46    
ref|XP_008448967.1|  PREDICTED: scarecrow-like protein 18               172   7e-46    
ref|NP_001168484.1|  protein SCARECROW                                  176   8e-46    Zea mays [maize]
ref|XP_004159489.1|  PREDICTED: LOW QUALITY PROTEIN: scarecrow-li...    172   9e-46    
emb|CDP16025.1|  unnamed protein product                                174   1e-45    
ref|XP_002448913.1|  hypothetical protein SORBIDRAFT_05g001500          175   1e-45    Sorghum bicolor [broomcorn]
ref|XP_006481279.1|  PREDICTED: protein SCARECROW-like                  177   1e-45    
ref|XP_006429683.1|  hypothetical protein CICLE_v10011085mg             176   1e-45    
dbj|BAJ91036.1|  predicted protein                                      175   1e-45    
gb|ACQ84011.1|  scarecrow 1                                             176   1e-45    Lupinus albus
ref|XP_008388412.1|  PREDICTED: protein SCARECROW-like                  176   1e-45    
ref|XP_010504220.1|  PREDICTED: protein SCARECROW isoform X2            174   1e-45    
gb|KDO73932.1|  hypothetical protein CISIN_1g048299mg                   172   1e-45    
ref|XP_001782936.1|  PAL1A AtPAT1-like protein                          170   2e-45    
ref|XP_002519983.1|  transcription factor, putative                     176   2e-45    Ricinus communis
ref|XP_001778507.1|  predicted protein                                  171   2e-45    
ref|XP_006452790.1|  hypothetical protein CICLE_v10008226mg             172   2e-45    
ref|XP_004977413.1|  PREDICTED: protein SCARECROW-like                  175   2e-45    
ref|XP_009337846.1|  PREDICTED: protein SCARECROW 2-like                176   2e-45    
ref|XP_009411777.1|  PREDICTED: protein SCARECROW 2-like isoform X1     175   2e-45    
ref|XP_003560068.1|  PREDICTED: scarecrow-like protein 23               172   2e-45    
ref|XP_009384356.1|  PREDICTED: protein SCARECROW 2-like                176   2e-45    
ref|XP_009411779.1|  PREDICTED: protein SCARECROW 2-like isoform X3     175   2e-45    
ref|XP_002321384.1|  hypothetical protein POPTR_0015s01070g             172   2e-45    Populus trichocarpa [western balsam poplar]
ref|XP_007206431.1|  hypothetical protein PRUPE_ppa001546mg             176   2e-45    
ref|XP_009411778.1|  PREDICTED: protein SCARECROW 2-like isoform X2     175   2e-45    
ref|XP_003551631.1|  PREDICTED: protein SCARECROW-like                  176   3e-45    
emb|CBI31126.3|  unnamed protein product                                174   3e-45    
ref|XP_004978490.1|  PREDICTED: protein SCARECROW-like                  174   3e-45    
ref|XP_010113028.1|  hypothetical protein L484_022753                   176   3e-45    
ref|XP_004492611.1|  PREDICTED: protein SCARECROW-like                  175   3e-45    
ref|XP_002323112.2|  hypothetical protein POPTR_0016s15060g             175   3e-45    Populus trichocarpa [western balsam poplar]
gb|ACN28379.1|  unknown                                                 168   4e-45    Zea mays [maize]
ref|XP_011018909.1|  PREDICTED: protein SCARECROW-like                  175   4e-45    
ref|XP_003631733.1|  PREDICTED: scarecrow-like protein 23               171   4e-45    
ref|XP_002264349.1|  PREDICTED: protein SCARECROW                       174   4e-45    Vitis vinifera
ref|XP_010529432.1|  PREDICTED: LOW QUALITY PROTEIN: protein SCAR...    174   4e-45    
ref|XP_006408301.1|  hypothetical protein EUTSA_v10020431mg             173   4e-45    
ref|NP_190990.1|  protein SCARECROW                                     174   5e-45    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010504218.1|  PREDICTED: protein SCARECROW-like                  174   5e-45    
ref|XP_010427091.1|  PREDICTED: protein SCARECROW-like                  174   5e-45    
ref|XP_010922842.1|  PREDICTED: LOW QUALITY PROTEIN: protein SCAR...    174   6e-45    
gb|EPS68254.1|  hypothetical protein M569_06515                         172   6e-45    
ref|XP_008451856.1|  PREDICTED: scarecrow-like protein 23 isoform X1    171   6e-45    
ref|XP_011015033.1|  PREDICTED: protein SCARECROW-like                  174   6e-45    
ref|XP_006443804.1|  hypothetical protein CICLE_v10019735mg             172   6e-45    
ref|XP_002876247.1|  hypothetical protein ARALYDRAFT_485819             173   7e-45    
ref|XP_004147738.1|  PREDICTED: scarecrow-like protein 23-like          171   7e-45    
gb|KFK34677.1|  hypothetical protein AALP_AA5G176900                    173   7e-45    
gb|EYU42066.1|  hypothetical protein MIMGU_mgv1a005350mg                171   7e-45    
ref|XP_011012975.1|  PREDICTED: protein SCARECROW-like                  174   7e-45    
ref|XP_009615228.1|  PREDICTED: protein SCARECROW-like                  174   7e-45    
ref|XP_002318447.1|  LATERAL SUPPRESSOR family protein                  170   7e-45    Populus trichocarpa [western balsam poplar]
ref|XP_010278894.1|  PREDICTED: protein SCARECROW                       174   8e-45    
ref|XP_006290705.1|  hypothetical protein CARUB_v10016802mg             173   8e-45    
ref|XP_006403603.1|  hypothetical protein EUTSA_v10010179mg             173   8e-45    
ref|XP_007206810.1|  hypothetical protein PRUPE_ppa025834mg             169   8e-45    
ref|XP_006381294.1|  hypothetical protein POPTR_0006s11500g             174   1e-44    
gb|AHA85560.1|  lateral                                                 170   1e-44    
ref|XP_010037969.1|  PREDICTED: protein SCARECROW-like                  171   1e-44    
ref|XP_010515939.1|  PREDICTED: protein SCARECROW-like                  172   1e-44    
ref|XP_008370319.1|  PREDICTED: protein SCARECROW-like                  173   2e-44    
ref|XP_009116109.1|  PREDICTED: protein SCARECROW                       172   2e-44    
gb|KHN29457.1|  Protein SCARECROW                                       172   2e-44    
gb|AAB06318.1|  SCARECROW                                               172   2e-44    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010504216.1|  PREDICTED: protein SCARECROW-like                  172   2e-44    
emb|CDX78219.1|  BnaA09g34140D                                          171   2e-44    
ref|XP_008244193.1|  PREDICTED: protein SCARECROW-like                  173   2e-44    
gb|KCW55804.1|  hypothetical protein EUGRSUZ_I01625                     172   3e-44    
ref|XP_010030721.1|  PREDICTED: scarecrow-like protein 21               171   3e-44    
emb|CDX73496.1|  BnaC08g25070D                                          171   3e-44    
sp|Q9AVK4.1|SCR_PEA  RecName: Full=Protein SCARECROW; AltName: Fu...    172   3e-44    Pisum sativum [garden pea]
ref|XP_010691407.1|  PREDICTED: protein SCARECROW                       172   3e-44    
ref|XP_011101980.1|  PREDICTED: protein SCARECROW                       172   3e-44    
ref|XP_007049016.1|  SCL domain class transcription factor              168   4e-44    
ref|XP_003533642.1|  PREDICTED: protein SCARECROW-like                  172   4e-44    
gb|KDP26511.1|  hypothetical protein JCGZ_17669                         169   4e-44    
ref|XP_009780114.1|  PREDICTED: protein SCARECROW-like                  172   4e-44    
ref|NP_199007.1|  GRAS family transcription factor                      167   4e-44    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008246525.1|  PREDICTED: scarecrow-like protein 18               169   5e-44    
ref|XP_007020290.1|  GRAS family transcription factor                   168   5e-44    
gb|KHN47045.1|  Nodulation-signaling pathway 2 protein                  159   5e-44    
ref|XP_004292218.1|  PREDICTED: protein SCARECROW-like                  169   7e-44    
gb|EEC68221.1|  hypothetical protein OsI_36217                          165   7e-44    Oryza sativa Indica Group [Indian rice]
ref|XP_001785259.1|  PAL1B encoding AtPAT1-like protein                 166   7e-44    
ref|XP_001769597.1|  predicted protein                                  166   8e-44    
ref|XP_008804655.1|  PREDICTED: protein SCARECROW 2-like                170   9e-44    
ref|XP_009370922.1|  PREDICTED: protein SCARECROW 1-like                171   1e-43    
ref|XP_009804953.1|  PREDICTED: scarecrow-like protein 23               167   1e-43    
ref|XP_004249012.1|  PREDICTED: protein SCARECROW                       171   1e-43    
ref|XP_011044695.1|  PREDICTED: scarecrow-like protein 18 isoform X1    167   1e-43    
ref|XP_004303941.1|  PREDICTED: scarecrow-like protein 23-like          167   1e-43    
gb|EAY82094.1|  hypothetical protein OsI_37294                          169   1e-43    
gb|KFK38060.1|  hypothetical protein AALP_AA3G064800                    169   1e-43    
ref|XP_009592074.1|  PREDICTED: scarecrow-like protein 23               167   1e-43    
ref|XP_010544911.1|  PREDICTED: scarecrow-like protein 23               166   2e-43    
ref|XP_009387926.1|  PREDICTED: scarecrow-like protein 4                169   2e-43    
ref|NP_001066027.1|  Os12g0122000                                       169   2e-43    
ref|XP_002873832.1|  hypothetical protein ARALYDRAFT_488615             168   2e-43    
ref|XP_010441372.1|  PREDICTED: scarecrow-like protein 23               166   2e-43    
gb|EAY79759.1|  hypothetical protein OsI_34915                          169   2e-43    
ref|XP_007140014.1|  hypothetical protein PHAVU_008G077000g             170   2e-43    
ref|XP_010252869.1|  PREDICTED: scarecrow-like protein 18               168   2e-43    
gb|KEH34625.1|  DELLA domain GRAS family transcription factor GAI       168   2e-43    
ref|XP_003607291.1|  SCARECROW protein-like protein                     166   2e-43    
sp|Q2Z2E9.1|SCR_IPONI  RecName: Full=Protein SCARECROW; Short=PnSCR     169   2e-43    
gb|ACR48080.1|  scarecrow 2                                             169   3e-43    
sp|A2ZAX5.2|SCR1_ORYSI  RecName: Full=Protein SCARECROW 1; AltNam...    168   3e-43    
dbj|BAP05438.1|  GAI1-like E3 ubiquitin ligase protein                  167   3e-43    
ref|XP_010044705.1|  PREDICTED: scarecrow-like protein 23               166   4e-43    
ref|XP_001773672.1|  predicted protein                                  164   5e-43    
ref|XP_011043671.1|  PREDICTED: scarecrow-like protein 18               165   5e-43    
ref|XP_008382900.1|  PREDICTED: protein SCARECROW 1-like                166   5e-43    
ref|XP_001782213.1|  predicted protein                                  164   5e-43    
ref|XP_006299072.1|  hypothetical protein CARUB_v10015212mg             167   6e-43    
ref|XP_010492705.1|  PREDICTED: DELLA protein RGL3-like                 166   6e-43    
ref|XP_003623699.1|  Scarecrow                                          169   7e-43    
ref|XP_011007026.1|  PREDICTED: scarecrow-like protein 18               165   7e-43    
ref|XP_006351691.1|  PREDICTED: protein SCARECROW-like                  166   7e-43    
ref|XP_010436142.1|  PREDICTED: scarecrow-like protein 23               164   7e-43    
emb|CDP16030.1|  unnamed protein product                                167   8e-43    
gb|AGA16543.1|  DELLA protein RGL2                                      166   9e-43    
ref|XP_006842644.1|  hypothetical protein AMTR_s00077p00190160          168   9e-43    
ref|XP_002528186.1|  DELLA protein RGA, putative                        165   9e-43    
ref|XP_008441019.1|  PREDICTED: nodulation-signaling pathway 2 pr...    166   9e-43    
ref|XP_003552980.1|  PREDICTED: DELLA protein GAI-like                  167   1e-42    
ref|XP_010913242.1|  PREDICTED: scarecrow-like protein 18               164   1e-42    
ref|XP_010448131.1|  PREDICTED: scarecrow-like protein 23               163   1e-42    
ref|XP_006853441.1|  hypothetical protein AMTR_s00032p00179410          165   1e-42    
ref|XP_009374432.1|  PREDICTED: scarecrow-like protein 18               164   1e-42    
ref|XP_002870608.1|  scarecrow transcription factor family protein      164   1e-42    
ref|XP_011097451.1|  PREDICTED: DELLA protein GAI-like                  166   1e-42    
ref|XP_006429765.1|  hypothetical protein CICLE_v10011732mg             164   1e-42    
ref|NP_197251.1|  DELLA protein RGL3                                    165   2e-42    
ref|XP_004243643.1|  PREDICTED: scarecrow-like protein 23               164   2e-42    
gb|EAZ04380.1|  hypothetical protein OsI_26522                          164   2e-42    
ref|XP_009398237.1|  PREDICTED: scarecrow-like protein 23               164   2e-42    
gb|KHG05100.1|  Scarecrow-like protein 4                                166   2e-42    
ref|XP_008811155.1|  PREDICTED: scarecrow-like protein 18               163   2e-42    
ref|NP_186995.1|  DELLA protein RGL2                                    165   2e-42    
dbj|BAC42642.1|  putative RGA1                                          165   2e-42    
ref|XP_002312450.2|  hypothetical protein POPTR_0008s13090g             166   2e-42    
ref|XP_010415179.1|  PREDICTED: DELLA protein RGL1-like                 164   3e-42    
ref|XP_002300599.1|  hypothetical protein POPTR_0001s47720g             163   3e-42    
ref|XP_008362563.1|  PREDICTED: LOW QUALITY PROTEIN: DELLA protei...    162   3e-42    
ref|XP_009800520.1|  PREDICTED: protein SCARECROW-like                  164   3e-42    
ref|XP_007131575.1|  hypothetical protein PHAVU_011G024600g             164   3e-42    
ref|XP_009395642.1|  PREDICTED: scarecrow-like protein 4                166   3e-42    
ref|XP_009395940.1|  PREDICTED: protein MONOCULM 1-like                 163   3e-42    
ref|XP_006365320.1|  PREDICTED: protein SCARECROW-like                  167   3e-42    
ref|XP_006405294.1|  hypothetical protein EUTSA_v10027784mg             162   4e-42    
dbj|BAJ96262.1|  predicted protein                                      164   7e-42    
ref|XP_002887024.1|  hypothetical protein ARALYDRAFT_475738             163   8e-42    
ref|XP_001754090.1|  GAI1-like E3 ubiquitin ligase protein              164   8e-42    
ref|XP_001763823.1|  predicted protein                                  161   8e-42    
ref|XP_006282634.1|  hypothetical protein CARUB_v10004949mg             161   9e-42    
dbj|BAJ97549.1|  predicted protein                                      164   9e-42    
ref|XP_011004461.1|  PREDICTED: scarecrow-like protein 23               162   1e-41    
ref|XP_010928164.1|  PREDICTED: scarecrow-like protein 18               161   1e-41    
ref|XP_008372571.1|  PREDICTED: protein SCARECROW-like                  163   1e-41    
ref|XP_002308822.1|  hypothetical protein POPTR_0006s02220g             162   1e-41    
ref|XP_003537749.1|  PREDICTED: scarecrow-like protein 23-like          161   1e-41    
gb|AAY56754.1|  DELLA protein                                           163   1e-41    
ref|XP_004247353.1|  PREDICTED: protein SCARECROW-like                  162   2e-41    
ref|XP_006391387.1|  hypothetical protein EUTSA_v10018436mg             162   2e-41    
gb|AGH06216.1|  lateral suppressor protein                              161   2e-41    
ref|XP_004503135.1|  PREDICTED: DELLA protein GAI-like                  163   2e-41    
gb|KFK41051.1|  hypothetical protein AALP_AA2G079000                    162   2e-41    
ref|XP_006857885.1|  hypothetical protein AMTR_s00069p00112440          163   2e-41    
gb|ACY74341.1|  putative DELLA protein                                  162   2e-41    
ref|XP_009369454.1|  PREDICTED: protein SCARECROW-like                  162   2e-41    
ref|XP_010420475.1|  PREDICTED: DELLA protein RGL3                      162   2e-41    
ref|XP_010480099.1|  PREDICTED: scarecrow-like protein 18               161   2e-41    
ref|XP_007163387.1|  hypothetical protein PHAVU_001G230500g             163   2e-41    
emb|CDP03761.1|  unnamed protein product                                162   2e-41    
ref|XP_008384643.1|  PREDICTED: scarecrow-like protein 18               161   2e-41    
ref|XP_009379077.1|  PREDICTED: scarecrow-like protein 18               161   2e-41    
ref|XP_007225630.1|  hypothetical protein PRUPE_ppa005944mg             160   2e-41    
ref|XP_002529844.1|  DELLA protein GAIP, putative                       162   3e-41    
ref|XP_011023720.1|  PREDICTED: DELLA protein GAIP-B-like               162   3e-41    
ref|XP_009130367.1|  PREDICTED: LOW QUALITY PROTEIN: DELLA protei...    162   3e-41    
ref|XP_008241668.1|  PREDICTED: scarecrow-like protein 4                162   3e-41    
ref|XP_010061376.1|  PREDICTED: scarecrow-like protein 18               161   3e-41    
ref|XP_010463795.1|  PREDICTED: DELLA protein RGL2-like                 162   3e-41    
gb|AHW42471.1|  DPL                                                     163   3e-41    
ref|XP_010690197.1|  PREDICTED: scarecrow-like protein 18               161   4e-41    
ref|XP_009608328.1|  PREDICTED: protein SCARECROW-like                  161   4e-41    
gb|ABU63411.1|  DELLA protein                                           162   5e-41    
ref|XP_010550390.1|  PREDICTED: scarecrow-like protein 4                162   5e-41    
ref|XP_003528281.1|  PREDICTED: DELLA protein SLR1-like                 161   5e-41    
gb|KDP30443.1|  hypothetical protein JCGZ_16682                         160   5e-41    
ref|XP_008221422.1|  PREDICTED: DELLA protein GAIP-B                    162   5e-41    
ref|XP_002306863.2|  hypothetical protein POPTR_0005s24850g             161   5e-41    
ref|XP_010470510.1|  PREDICTED: DELLA protein RGL1 isoform X1           161   6e-41    
ref|XP_008354103.1|  PREDICTED: scarecrow-like protein 18               160   6e-41    
ref|XP_008343960.1|  PREDICTED: LOW QUALITY PROTEIN: DELLA protei...    161   6e-41    
gb|AHW42470.1|  RGA                                                     161   6e-41    
ref|XP_010101954.1|  hypothetical protein L484_011971                   160   7e-41    
ref|XP_010510814.1|  PREDICTED: DELLA protein RGL2 isoform X1           161   7e-41    
ref|XP_002314799.2|  hypothetical protein POPTR_0010s12080g             161   7e-41    
dbj|BAF62637.1|  DELLA protein                                          161   7e-41    
gb|ADL36819.1|  SCL domain class transcription factor                   160   7e-41    
dbj|BAQ20609.1|  GRAS-family protein 1                                  162   8e-41    
ref|XP_008806184.1|  PREDICTED: scarecrow-like protein 18               159   8e-41    
ref|XP_010510942.1|  PREDICTED: DELLA protein RGL2 isoform X3           161   8e-41    
ref|XP_007204097.1|  hypothetical protein PRUPE_ppa003124mg             161   8e-41    
gb|ABI30654.1|  putative gibberellin signaling DELLA protein LA         161   9e-41    
ref|XP_006302161.1|  hypothetical protein CARUB_v10020171mg             160   9e-41    
ref|XP_011100390.1|  PREDICTED: scarecrow-like protein 23               159   1e-40    
ref|NP_176809.1|  DELLA protein RGL1                                    160   1e-40    
ref|XP_010093140.1|  hypothetical protein L484_009332                   159   1e-40    
ref|XP_010453948.1|  PREDICTED: DELLA protein RGL3-like                 160   1e-40    
ref|XP_002272465.2|  PREDICTED: protein SCARECROW-like                  159   1e-40    
ref|XP_009409866.1|  PREDICTED: protein MONOCULM 1-like                 158   1e-40    
ref|XP_001774314.1|  AtGAI1 GRAS E3 ubiquitin ligase protein            160   1e-40    
ref|XP_006482132.1|  PREDICTED: DELLA protein GAI-like                  160   1e-40    
emb|CAN59753.1|  hypothetical protein VITISV_036639                     160   1e-40    
ref|XP_004507626.1|  PREDICTED: DELLA protein RHT-1-like                159   1e-40    
ref|XP_008343058.1|  PREDICTED: DELLA protein GAI-like                  160   2e-40    
ref|XP_007200779.1|  hypothetical protein PRUPE_ppa023981mg             159   2e-40    
ref|XP_009140132.1|  PREDICTED: scarecrow-like protein 23               158   2e-40    
ref|XP_011004025.1|  PREDICTED: protein SCARECROW-like                  159   2e-40    
ref|XP_007144875.1|  hypothetical protein PHAVU_007G191300g             159   2e-40    
ref|XP_002266267.1|  PREDICTED: DELLA protein GAI-like                  160   2e-40    
ref|XP_006430617.1|  hypothetical protein CICLE_v10011367mg             160   2e-40    
gb|AEX97111.1|  spur-type DELLA protein                                 160   2e-40    
gb|AAY56750.1|  DELLA protein                                           160   2e-40    
ref|XP_002884379.1|  hypothetical protein ARALYDRAFT_477591             160   2e-40    
emb|CDY27670.1|  BnaUnng00200D                                          157   2e-40    
ref|XP_004155733.1|  PREDICTED: DELLA protein GAI-like                  160   2e-40    
emb|CAN60709.1|  hypothetical protein VITISV_027284                     159   2e-40    
ref|XP_009334448.1|  PREDICTED: DELLA protein GAI-like                  160   2e-40    
gb|KHN48926.1|  Protein SCARECROW                                       158   2e-40    
ref|XP_008390123.1|  PREDICTED: LOW QUALITY PROTEIN: DELLA protei...    160   2e-40    
ref|XP_002302035.2|  hypothetical protein POPTR_0002s03740g             159   2e-40    
gb|AAY56749.1|  DELLA protein                                           160   2e-40    
emb|CAA12242.1|  RGA-like                                               160   2e-40    
ref|XP_004287380.1|  PREDICTED: DELLA protein GAI-like                  159   3e-40    
ref|XP_010502027.1|  PREDICTED: scarecrow-like protein 18               156   3e-40    
ref|XP_004148670.1|  PREDICTED: nodulation-signaling pathway 2 pr...    159   3e-40    
ref|XP_006594032.1|  PREDICTED: protein SCARECROW-like                  158   3e-40    
ref|XP_008242703.1|  PREDICTED: LOW QUALITY PROTEIN: DELLA protei...    159   3e-40    
gb|AHB17746.1|  GA repressor DELLA                                      159   3e-40    
gb|KGN48376.1|  hypothetical protein Csa_6G484540                       159   3e-40    
gb|AEX97110.1|  spur-type DELLA protein                                 159   3e-40    
ref|XP_010936712.1|  PREDICTED: scarecrow-like protein 23               158   4e-40    
ref|NP_001240948.1|  DELLA protein GAI 1                                159   4e-40    
ref|XP_008453739.1|  PREDICTED: scarecrow-like protein 4                159   4e-40    
ref|XP_010558259.1|  PREDICTED: scarecrow-like protein 4 isoform X1     159   4e-40    
ref|XP_011000635.1|  PREDICTED: scarecrow-like protein 23 isoform X1    157   4e-40    
gb|KHN05867.1|  Protein SCARECROW                                       158   4e-40    
ref|XP_002284648.1|  PREDICTED: DELLA protein GAI1                      159   4e-40    
gb|ACR58455.1|  GAI/RGA protein                                         159   4e-40    
ref|XP_002323179.1|  hypothetical protein POPTR_0016s02030g             157   4e-40    
gb|ABS50250.1|  DELLA protein                                           159   5e-40    
gb|AEK06229.1|  GAI1                                                    159   5e-40    
ref|XP_010276198.1|  PREDICTED: scarecrow-like protein 23               157   5e-40    
gb|KDP38079.1|  hypothetical protein JCGZ_04722                         159   6e-40    
ref|XP_008799890.1|  PREDICTED: LOW QUALITY PROTEIN: scarecrow-li...    157   6e-40    
ref|XP_009336159.1|  PREDICTED: protein SCARECROW-like                  158   7e-40    
gb|EEE59833.1|  hypothetical protein OsJ_12398                          158   7e-40    
ref|NP_001051115.1|  Os03g0723000                                       158   7e-40    
ref|XP_009370101.1|  PREDICTED: DELLA protein GAI-like                  158   7e-40    
gb|EPS64600.1|  lateral suppressor protein                              155   8e-40    
ref|XP_006357876.1|  PREDICTED: scarecrow-like protein 23-like          157   8e-40    
ref|XP_002527794.1|  DELLA protein GAIP-B, putative                     158   8e-40    
gb|ABO61516.1|  GAI1                                                    157   8e-40    
ref|XP_002449036.1|  hypothetical protein SORBIDRAFT_05g003820          157   9e-40    
ref|XP_011085450.1|  PREDICTED: scarecrow-like protein 23               156   9e-40    
ref|XP_003560467.1|  PREDICTED: scarecrow-like protein 4                158   1e-39    
ref|XP_002971092.1|  hypothetical protein SELMODRAFT_95139              155   1e-39    
ref|XP_007050241.1|  GRAS family transcription factor                   157   1e-39    
ref|XP_008460522.1|  PREDICTED: DELLA protein GAI-like                  158   1e-39    
ref|XP_011028840.1|  PREDICTED: protein SCARECROW-like                  157   1e-39    
ref|XP_007046954.1|  Chitin-inducible gibberellin-responsive prot...    158   1e-39    
ref|XP_002306674.2|  SCARECROW-LIKE 1 family protein                    158   1e-39    
dbj|BAG71200.1|  DELLA 1                                                157   1e-39    
ref|XP_003536944.2|  PREDICTED: protein SCARECROW-like                  157   1e-39    
gb|KEH40473.1|  GRAS family transcription factor                        158   1e-39    
ref|XP_011095666.1|  PREDICTED: scarecrow-like protein 18               156   1e-39    
ref|XP_002534030.1|  DELLA protein GAI, putative                        157   1e-39    
ref|XP_004958062.1|  PREDICTED: scarecrow-like protein 23-like          156   1e-39    
ref|XP_010511563.1|  PREDICTED: DELLA protein RGL1-like                 157   1e-39    
gb|AHB17745.1|  GA repressor DELLA                                      157   2e-39    
gb|ACV52014.1|  GAI/RGA-like 3-b                                        157   2e-39    
ref|XP_006650515.1|  PREDICTED: scarecrow-like protein 4-like           157   2e-39    
ref|XP_010049952.1|  PREDICTED: DELLA protein GAI-like                  157   2e-39    
dbj|BAJ84873.1|  predicted protein                                      157   2e-39    
gb|ABG26370.1|  DELLA protein GAI                                       157   2e-39    
ref|XP_003531153.1|  PREDICTED: DELLA protein GAI1-like                 157   2e-39    
gb|EMS61898.1|  hypothetical protein TRIUR3_25879                       157   2e-39    
gb|AHB17742.1|  GA repressor DELLA                                      157   2e-39    
ref|XP_010104285.1|  hypothetical protein L484_005388                   157   2e-39    
ref|NP_001060115.1|  Os07g0583600                                       157   2e-39    
ref|XP_011099949.1|  PREDICTED: LOW QUALITY PROTEIN: DELLA protei...    157   2e-39    
dbj|BAD42666.1|  lateral suppressor-like protein                        155   2e-39    
emb|CDP13626.1|  unnamed protein product                                155   2e-39    
ref|XP_002977371.1|  hypothetical protein SELMODRAFT_106700             155   2e-39    
ref|XP_009396052.1|  PREDICTED: chitin-inducible gibberellin-resp...    156   2e-39    
ref|XP_006289966.1|  hypothetical protein CARUB_v10003592mg             156   2e-39    
ref|XP_006589312.1|  PREDICTED: DELLA protein RGA-like                  156   2e-39    
ref|XP_010032696.1|  PREDICTED: DELLA protein GAI                       157   2e-39    
ref|XP_008786112.1|  PREDICTED: LOW QUALITY PROTEIN: scarecrow-li...    155   3e-39    
emb|CDP01615.1|  unnamed protein product                                156   3e-39    
ref|XP_008229662.1|  PREDICTED: scarecrow-like protein 23               155   3e-39    
ref|XP_003607413.1|  GRAS family transcription factor                   152   3e-39    



>ref|XP_009799696.1| PREDICTED: nodulation-signaling pathway 2 protein [Nicotiana 
sylvestris]
Length=503

 Score =   527 bits (1358),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/346 (77%), Positives = 292/346 (84%), Gaps = 7/346 (2%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGA--GSLHAKSF--PASKDDHPHGDALAAFQLLQDMSPYVKFGHF  169
             RLAA+FTDALQALLDGA  GSLHAKS   P  KD+   GD LAAFQLLQD+SP+VKFGHF
Sbjct  159   RLAAHFTDALQALLDGAASGSLHAKSMFSPNYKDEQQQGDVLAAFQLLQDISPFVKFGHF  218

Query  170   TANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsg  349
             TANQAILEAV HDRRVHIVDYDIMEGIQWASLMQAL+SR+DG P PHLRITALSR G   
Sbjct  219   TANQAILEAVAHDRRVHIVDYDIMEGIQWASLMQALVSRKDGPPTPHLRITALSRSGSGR  278

Query  350   rrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLP  529
             R  F +VQETGRRLTAFA SIGQPFSFH CRLDSDETFKPS LKLVRGEAII+NCMLHLP
Sbjct  279   RS-FGTVQETGRRLTAFAGSIGQPFSFHHCRLDSDETFKPSTLKLVRGEAIIINCMLHLP  337

Query  530   HFSYRSPDSIASFLSGSATLNPRLVTLVEEEAAP-PRDGGFVDRFMDTLHHYSALYDSLE  706
             HF+YR+ DS+ASFLSGS TLNPRLVTLVEEE  P   + GFV RFMD LHHYSALYDSLE
Sbjct  338   HFTYRASDSVASFLSGSKTLNPRLVTLVEEEVQPIGEEEGFVGRFMDILHHYSALYDSLE  397

Query  707   AGFPMQDQARTLVERVFLGPKISVAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISFAN  886
             AGFP+Q +AR LVERVFLGP+I+ ++ R YR RGE+   SWGEW+    G+R   ISFAN
Sbjct  398   AGFPLQSRARALVERVFLGPRITGSLARIYRTRGEDERCSWGEWLSA-VGYRESNISFAN  456

Query  887   RCQAKLLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIWTSVHSD  1024
              CQAKLLLGLFNDGYR+EEIG +KL+LGWKSRRLLSASIWT+  SD
Sbjct  457   HCQAKLLLGLFNDGYRVEEIGTNKLVLGWKSRRLLSASIWTTPDSD  502



>ref|XP_006351875.1| PREDICTED: nodulation-signaling pathway 2 protein-like [Solanum 
tuberosum]
Length=496

 Score =   520 bits (1340),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 265/346 (77%), Positives = 291/346 (84%), Gaps = 7/346 (2%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGA--GSLHAKSF--PASKDDHPHGDALAAFQLLQDMSPYVKFGHF  169
             RLAA+FTDALQALLDGA  G+LHAK    P  KD+H  GD LAAFQLLQDMSP+VKFGHF
Sbjct  152   RLAAHFTDALQALLDGAASGTLHAKLMFSPNYKDEHHQGDVLAAFQLLQDMSPFVKFGHF  211

Query  170   TANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsg  349
             TANQAI E+VTHDRRVHIVDYDIMEGIQWASLMQAL+SR+DG P PHLRITALSR G   
Sbjct  212   TANQAIFESVTHDRRVHIVDYDIMEGIQWASLMQALVSRKDGPPTPHLRITALSRSGSGR  271

Query  350   rrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLP  529
             R  F +VQETGRRLTAFA SIGQPFSFH CRLDSDE FKP+ LKLVRGEA+I+NCMLHLP
Sbjct  272   RS-FGTVQETGRRLTAFATSIGQPFSFHHCRLDSDEIFKPTNLKLVRGEALIINCMLHLP  330

Query  530   HFSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRD-GGFVDRFMDTLHHYSALYDSLE  706
             HFSYR+ DS+ASFLSGS TLNPRLVTLVEEE  P  D  GF+ RFMDTLHHYSALYDSLE
Sbjct  331   HFSYRASDSVASFLSGSKTLNPRLVTLVEEELRPIGDEEGFMGRFMDTLHHYSALYDSLE  390

Query  707   AGFPMQDQARTLVERVFLGPKISVAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISFAN  886
             AGFP+Q +AR LVERVFLGP+I+ ++ R YR RGEE   SWGEW+    GF    ISFAN
Sbjct  391   AGFPLQSRARALVERVFLGPRITGSLARIYRARGEEERCSWGEWLS-GVGFCESNISFAN  449

Query  887   RCQAKLLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIWTSVHSD  1024
              CQAKLLLGLFNDGYR+EEIG +KL+LGWKSRRLLSASIWT++  D
Sbjct  450   HCQAKLLLGLFNDGYRVEEIGTNKLVLGWKSRRLLSASIWTTMDID  495



>ref|XP_007019002.1| GRAS family transcription factor [Theobroma cacao]
 gb|EOY16227.1| GRAS family transcription factor [Theobroma cacao]
Length=487

 Score =   518 bits (1335),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 256/346 (74%), Positives = 291/346 (84%), Gaps = 7/346 (2%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPAS-----KDDHPHGDALAAFQLLQDMSPYVKFGH  166
             RLAAYFT+ALQ LL+G+G  H K F  +     +D+H   D LAAFQLLQDMSPYVKFGH
Sbjct  143   RLAAYFTEALQGLLEGSGGGHGKHFITNGPHYHRDEHHQTDVLAAFQLLQDMSPYVKFGH  202

Query  167   FTANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggs  346
             FTANQAILEAV HDRR+HIVDYDIMEGIQWASLMQAL+SR+DG PAPHLRITALSR G  
Sbjct  203   FTANQAILEAVAHDRRIHIVDYDIMEGIQWASLMQALVSRKDGPPAPHLRITALSRSGSG  262

Query  347   grrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHL  526
              R    ++QETGRRL AFAASIGQPFSFHQ RLDSDETF+PSA+KLVRGEA+++NCMLHL
Sbjct  263   RRS-IGTIQETGRRLVAFAASIGQPFSFHQYRLDSDETFRPSAVKLVRGEALVINCMLHL  321

Query  527   PHFSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLE  706
             PHFSYR+PDS+ASFL+G+ TL+PRLVTLVEEE  P  DGGFV RFMD+LHHYSA+YDSLE
Sbjct  322   PHFSYRAPDSVASFLTGAKTLDPRLVTLVEEEVGPIGDGGFVGRFMDSLHHYSAVYDSLE  381

Query  707   AGFPMQDQARTLVERVFLGPKISVAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISFAN  886
             AGFPMQ +AR LVERVFLGP+I+ ++TR YR RGEE    W EW+    GF+P  ISFAN
Sbjct  382   AGFPMQGRARALVERVFLGPRIAGSLTRIYRTRGEEESCPWSEWLAA-VGFKPVNISFAN  440

Query  887   RCQAKLLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIWTSVHSD  1024
              CQAKLLLGLFNDGY +EE+ N++L+LGWKSRRLLSASIWTS  SD
Sbjct  441   HCQAKLLLGLFNDGYSVEELANNRLVLGWKSRRLLSASIWTSPDSD  486



>ref|XP_006472746.1| PREDICTED: nodulation-signaling pathway 2 protein-like [Citrus 
sinensis]
Length=497

 Score =   516 bits (1329),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 265/343 (77%), Positives = 293/343 (85%), Gaps = 8/343 (2%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKS------FPASKDDHPHGDALAAFQLLQDMSPYVKFG  163
             RLAAYFTDALQ LL+GAG +H  +       P  +DDH H D LAAFQLLQDMSPYVKFG
Sbjct  151   RLAAYFTDALQGLLEGAGGVHGNNKHYTSNGPHHRDDHHHTDVLAAFQLLQDMSPYVKFG  210

Query  164   HFTANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrggg  343
             HFTANQAILEAV +DRRVHIVDYDIMEGIQWASLMQAL+SR+DG PAPHLRITALSRGG 
Sbjct  211   HFTANQAILEAVANDRRVHIVDYDIMEGIQWASLMQALVSRKDGPPAPHLRITALSRGGS  270

Query  344   sgrrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLH  523
               R    +VQETGRRL AFAASIGQPFSFHQCRLDSDETFK SALKLVRGEA+I+NCMLH
Sbjct  271   GRRS-ISTVQETGRRLVAFAASIGQPFSFHQCRLDSDETFKASALKLVRGEALIINCMLH  329

Query  524   LPHFSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSL  703
             LPHFSYR+PDSIASFLSG+ TLNPRLVTLVEEE  P  DGGFV RFMD+LHHYSA+YDSL
Sbjct  330   LPHFSYRAPDSIASFLSGAKTLNPRLVTLVEEETGPIGDGGFVSRFMDSLHHYSAVYDSL  389

Query  704   EAGFPMQDQARTLVERVFLGPKISVAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISFA  883
             EAGFPMQ +AR LVERVFLGP+IS ++ R YR  GEE  +SWG+W+    GF+P  ISFA
Sbjct  390   EAGFPMQSRARALVERVFLGPRISGSLARIYRTCGEEEVYSWGDWLGV-VGFKPVNISFA  448

Query  884   NRCQAKLLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIWTS  1012
             N CQAKLLLGLFNDGYR+EE+ N++L+LGWKSRRLLSAS+WTS
Sbjct  449   NHCQAKLLLGLFNDGYRVEELANNRLVLGWKSRRLLSASVWTS  491



>gb|KDO80719.1| hypothetical protein CISIN_1g011012mg [Citrus sinensis]
Length=495

 Score =   516 bits (1328),  Expect = 6e-178, Method: Compositional matrix adjust.
 Identities = 265/343 (77%), Positives = 293/343 (85%), Gaps = 8/343 (2%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKS------FPASKDDHPHGDALAAFQLLQDMSPYVKFG  163
             RLAAYFTDALQ LL+GAG +H  +       P  +DDH H D LAAFQLLQDMSPYVKFG
Sbjct  149   RLAAYFTDALQGLLEGAGGVHGNNKHYTSNGPHHRDDHHHTDVLAAFQLLQDMSPYVKFG  208

Query  164   HFTANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrggg  343
             HFTANQAILEAV +DRRVHIVDYDIMEGIQWASLMQAL+SR+DG PAPHLRITALSRGG 
Sbjct  209   HFTANQAILEAVANDRRVHIVDYDIMEGIQWASLMQALVSRKDGPPAPHLRITALSRGGS  268

Query  344   sgrrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLH  523
               R    +VQETGRRL AFAASIGQPFSFHQCRLDSDETFK SALKLVRGEA+I+NCMLH
Sbjct  269   GRRS-ISTVQETGRRLVAFAASIGQPFSFHQCRLDSDETFKASALKLVRGEALIINCMLH  327

Query  524   LPHFSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSL  703
             LPHFSYR+PDSIASFLSG+ TLNPRLVTLVEEE  P  DGGFV RFMD+LHHYSA+YDSL
Sbjct  328   LPHFSYRAPDSIASFLSGAKTLNPRLVTLVEEETGPIGDGGFVSRFMDSLHHYSAVYDSL  387

Query  704   EAGFPMQDQARTLVERVFLGPKISVAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISFA  883
             EAGFPMQ +AR LVERVFLGP+IS ++ R YR  GEE  +SWG+W+    GF+P  ISFA
Sbjct  388   EAGFPMQSRARALVERVFLGPRISGSLARIYRTCGEEEVYSWGDWLGV-VGFKPVNISFA  446

Query  884   NRCQAKLLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIWTS  1012
             N CQAKLLLGLFNDGYR+EE+ N++L+LGWKSRRLLSAS+WTS
Sbjct  447   NHCQAKLLLGLFNDGYRVEELANNRLVLGWKSRRLLSASVWTS  489



>ref|XP_006434151.1| hypothetical protein CICLE_v10000940mg [Citrus clementina]
 gb|ESR47391.1| hypothetical protein CICLE_v10000940mg [Citrus clementina]
Length=495

 Score =   515 bits (1327),  Expect = 8e-178, Method: Compositional matrix adjust.
 Identities = 264/343 (77%), Positives = 293/343 (85%), Gaps = 8/343 (2%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKS------FPASKDDHPHGDALAAFQLLQDMSPYVKFG  163
             RLAAYFTDALQ LL+GAG +H  +       P  +DDH H D LAAFQLLQDMSPYVKFG
Sbjct  149   RLAAYFTDALQGLLEGAGGVHGNNKHNTSNGPHHRDDHHHTDVLAAFQLLQDMSPYVKFG  208

Query  164   HFTANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrggg  343
             HFTANQAILEAV +DRRVHIVDYDIMEGIQWASLMQAL+SR+DG PAPHLRITALSRGG 
Sbjct  209   HFTANQAILEAVANDRRVHIVDYDIMEGIQWASLMQALVSRKDGPPAPHLRITALSRGGS  268

Query  344   sgrrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLH  523
               R    +VQETGRRL AFAASIGQPFSFHQCRLDSDETFK SALKLVRGEA+I+NCMLH
Sbjct  269   GRRS-ISTVQETGRRLVAFAASIGQPFSFHQCRLDSDETFKASALKLVRGEALIINCMLH  327

Query  524   LPHFSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSL  703
             LPHFSYR+PDSIASFLSG+ TLNP+LVTLVEEE  P  DGGFV RFMD+LHHYSA+YDSL
Sbjct  328   LPHFSYRAPDSIASFLSGAKTLNPKLVTLVEEETGPIGDGGFVSRFMDSLHHYSAVYDSL  387

Query  704   EAGFPMQDQARTLVERVFLGPKISVAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISFA  883
             EAGFPMQ +AR LVERVFLGP+IS ++ R YR  GEE  +SWG+W+    GF+P  ISFA
Sbjct  388   EAGFPMQSRARALVERVFLGPRISGSLARIYRTCGEEEVYSWGDWLGA-VGFKPVNISFA  446

Query  884   NRCQAKLLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIWTS  1012
             N CQAKLLLGLFNDGYR+EE+ N++L+LGWKSRRLLSAS+WTS
Sbjct  447   NHCQAKLLLGLFNDGYRVEELANNRLVLGWKSRRLLSASVWTS  489



>ref|XP_009627108.1| PREDICTED: nodulation-signaling pathway 2 protein [Nicotiana 
tomentosiformis]
Length=510

 Score =   516 bits (1328),  Expect = 8e-178, Method: Compositional matrix adjust.
 Identities = 268/346 (77%), Positives = 291/346 (84%), Gaps = 7/346 (2%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGA--GSLHAKSF--PASKDDHPHGDALAAFQLLQDMSPYVKFGHF  169
             RLAA+FTDALQALLDGA  GSLHAKS   P  KD+   GD LAAFQLLQDMSP+VKFGHF
Sbjct  166   RLAAHFTDALQALLDGAASGSLHAKSMFSPNYKDEQQQGDVLAAFQLLQDMSPFVKFGHF  225

Query  170   TANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsg  349
             TANQAILEAV HDRRVHIVDYDIMEGIQWASLMQAL+SR+DG P PHLRITALSR G   
Sbjct  226   TANQAILEAVAHDRRVHIVDYDIMEGIQWASLMQALLSRKDGPPTPHLRITALSRSGSGR  285

Query  350   rrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLP  529
             R  F +VQETGRRLTAFAASIGQPFSFH CRLDSDETFKP ALKLVRGEAII+NCMLHLP
Sbjct  286   RS-FGTVQETGRRLTAFAASIGQPFSFHHCRLDSDETFKPPALKLVRGEAIIINCMLHLP  344

Query  530   HFSYRSPDSIASFLSGSATLNPRLVTLV-EEEAAPPRDGGFVDRFMDTLHHYSALYDSLE  706
             HF+YR+ DS+ASFLSGS TLNPRLVTLV EE      + GFV RFMDTLHHYSALYDSLE
Sbjct  345   HFTYRASDSVASFLSGSKTLNPRLVTLVEEEVRPIEEEEGFVGRFMDTLHHYSALYDSLE  404

Query  707   AGFPMQDQARTLVERVFLGPKISVAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISFAN  886
             AGFP+Q +AR LVERVFLGP+I  ++ R+YR RGE+   SWGEW+    G+    ISFAN
Sbjct  405   AGFPLQSRARALVERVFLGPRIIGSLARTYRTRGEDERSSWGEWLSV-VGYHESNISFAN  463

Query  887   RCQAKLLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIWTSVHSD  1024
              CQAKLLLGLFNDGYR+EEIG +KL+LGWKSRRLLSASIWTS  SD
Sbjct  464   HCQAKLLLGLFNDGYRVEEIGTNKLVLGWKSRRLLSASIWTSPDSD  509



>ref|XP_011069635.1| PREDICTED: nodulation-signaling pathway 2 protein [Sesamum indicum]
Length=490

 Score =   514 bits (1325),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 261/347 (75%), Positives = 291/347 (84%), Gaps = 9/347 (3%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPAS------KDDHPHGDALAAFQLLQDMSPYVKFG  163
             RLAAYFTDALQ LLDG  +   K+ P        K++H   + LAAFQLLQDMSPYVKFG
Sbjct  146   RLAAYFTDALQGLLDGT-ACGGKNVPGGGCGHQYKEEHHQTEVLAAFQLLQDMSPYVKFG  204

Query  164   HFTANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrggg  343
             HFTANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQAL+SR+DG P PHLRITALSRGG 
Sbjct  205   HFTANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALVSRKDGPPTPHLRITALSRGGS  264

Query  344   sgrrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLH  523
               R  F ++QETGRRLTAFAASIGQPFSFHQCRLDSDETF+PS+LKLVRGEA+I NCMLH
Sbjct  265   GRRS-FGTIQETGRRLTAFAASIGQPFSFHQCRLDSDETFRPSSLKLVRGEALIFNCMLH  323

Query  524   LPHFSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSL  703
             LPHFSYR+P+SIASFLSGS TLNPRL+TLVEEE   P D GFV RFMD+LHHYSA+YDSL
Sbjct  324   LPHFSYRAPESIASFLSGSKTLNPRLITLVEEEMRSPSDEGFVGRFMDSLHHYSAVYDSL  383

Query  704   EAGFPMQDQARTLVERVFLGPKISVAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISFA  883
             EAGFPMQ +AR LVERVFLGP+I+ ++ R YR  GEE   SWG+W+    GFRP   SFA
Sbjct  384   EAGFPMQGRARALVERVFLGPRIAGSLARIYRACGEEEWCSWGQWLSA-VGFRPVNTSFA  442

Query  884   NRCQAKLLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIWTSVHSD  1024
             N CQAKLLLGL+NDGYR+EE+ ++KL+LGWKSRRLLSASIWTS  SD
Sbjct  443   NHCQAKLLLGLYNDGYRVEELSSNKLVLGWKSRRLLSASIWTSKDSD  489



>ref|XP_004250334.1| PREDICTED: nodulation-signaling pathway 2 protein [Solanum lycopersicum]
Length=487

 Score =   513 bits (1321),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 260/344 (76%), Positives = 288/344 (84%), Gaps = 6/344 (2%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSF--PASKDDHPHGDALAAFQLLQDMSPYVKFGHFTA  175
             RLAAYFTDALQAL+  +G+LH K    P  KD+H  GD LAAFQLLQDMSP+VKFGHFTA
Sbjct  146   RLAAYFTDALQALM-ASGTLHTKHMFSPNYKDEHRQGDVLAAFQLLQDMSPFVKFGHFTA  204

Query  176   NQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrr  355
             NQAI E+VTHDRRVHI+DYDIMEGIQWASLMQAL+SR+DG P PHLRITALSR G   R 
Sbjct  205   NQAIFESVTHDRRVHIIDYDIMEGIQWASLMQALVSRKDGPPTPHLRITALSRSGSGRRS  264

Query  356   sFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHF  535
              F +VQETGRRLTAFAASIGQPFSFH CRLDSDE FKP+ +KLVRGEA+I+NCMLHLPHF
Sbjct  265   -FGTVQETGRRLTAFAASIGQPFSFHHCRLDSDEIFKPTNVKLVRGEALIINCMLHLPHF  323

Query  536   SYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRD-GGFVDRFMDTLHHYSALYDSLEAG  712
             SYR+ DS+ASFLSGS TLNPRLVTLVEEE  P  D  GFV RFMDTLHHYSALYDSLEAG
Sbjct  324   SYRASDSVASFLSGSKTLNPRLVTLVEEELRPIGDEEGFVGRFMDTLHHYSALYDSLEAG  383

Query  713   FPMQDQARTLVERVFLGPKISVAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISFANRC  892
             FP+Q +AR LVERVFLGP+I+ ++ R YR RGE    SWGEW+    GF    ISFAN C
Sbjct  384   FPLQSRARALVERVFLGPRITGSLARIYRARGEGERCSWGEWL-SGVGFCESNISFANHC  442

Query  893   QAKLLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIWTSVHSD  1024
             QAKLLLGLFNDGYR+EEIG +KL+LGWKSRRLLSASIWT++  D
Sbjct  443   QAKLLLGLFNDGYRMEEIGTNKLVLGWKSRRLLSASIWTTMDID  486



>ref|XP_002284426.2| PREDICTED: nodulation-signaling pathway 2 protein [Vitis vinifera]
Length=490

 Score =   513 bits (1321),  Expect = 6e-177, Method: Compositional matrix adjust.
 Identities = 257/345 (74%), Positives = 290/345 (84%), Gaps = 6/345 (2%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLH----AKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHF  169
             RLAAYFTDALQ LL+GAG+ H              H   D LAAFQLLQDMSPYVKFGHF
Sbjct  145   RLAAYFTDALQGLLEGAGAKHMIGNGHHRDDHHHHHHQSDVLAAFQLLQDMSPYVKFGHF  204

Query  170   TANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsg  349
             TANQAILEAV+ +RR+HIVDYDIMEGIQWASLMQAL+SR+DG PAPHLRITALSRGGG  
Sbjct  205   TANQAILEAVSKERRIHIVDYDIMEGIQWASLMQALVSRKDGPPAPHLRITALSRGGGGR  264

Query  350   rrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLP  529
             R    ++QETGRRLTAFAASIGQPFSFHQCRLDSDETF+PSALKLVRGEA+I+NCMLHLP
Sbjct  265   RS-IGTIQETGRRLTAFAASIGQPFSFHQCRLDSDETFRPSALKLVRGEALIINCMLHLP  323

Query  530   HFSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEA  709
             HFSYR+PDS+ASFLSG  TL P+LVTLVEEE  P  DGGFV RFMD+LHHYSA+YDSLEA
Sbjct  324   HFSYRAPDSVASFLSGGKTLKPKLVTLVEEEVGPTGDGGFVGRFMDSLHHYSAVYDSLEA  383

Query  710   GFPMQDQARTLVERVFLGPKISVAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISFANR  889
             GFPMQ +AR LVERVFLGP+I+  + R YR RG + G SWGEW+ + AGFR   ISFAN 
Sbjct  384   GFPMQGRARALVERVFLGPRIAGTLGRIYRGRGGQEGGSWGEWL-DGAGFRGVGISFANH  442

Query  890   CQAKLLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIWTSVHSD  1024
             CQAKLLLGLFNDGYR+EE+ N++++LGWKSRRLLSAS+W++  SD
Sbjct  443   CQAKLLLGLFNDGYRVEELANNRMVLGWKSRRLLSASVWSASDSD  487



>ref|XP_002513781.1| Nodulation signaling pathway 2 protein, putative [Ricinus communis]
 gb|EEF48364.1| Nodulation signaling pathway 2 protein, putative [Ricinus communis]
Length=491

 Score =   509 bits (1311),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 260/346 (75%), Positives = 291/346 (84%), Gaps = 6/346 (2%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGS-----LHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGH  166
             RLAAYFTDALQ LL+G G+     +H          H   D LAAFQLLQDMSPYVKFGH
Sbjct  144   RLAAYFTDALQGLLEGHGTSTKHLIHNSGPYQHHHHHHQADTLAAFQLLQDMSPYVKFGH  203

Query  167   FTANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggs  346
             FTANQAILEAV+ D+R+HIVDYDIMEGIQWASLMQ+L+SR+DG P PHLRITALSRGG S
Sbjct  204   FTANQAILEAVSQDKRIHIVDYDIMEGIQWASLMQSLVSRKDGPPTPHLRITALSRGGNS  263

Query  347   grrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHL  526
             G+RS  +VQETGRRL AFAASIGQPFSFH CRLDSDE+F+PSALKLVRGEA+I+NCMLHL
Sbjct  264   GKRSIGTVQETGRRLVAFAASIGQPFSFHHCRLDSDESFRPSALKLVRGEALIMNCMLHL  323

Query  527   PHFSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLE  706
             PHFSYR+PDS+ASFLSGS TL+PRLVTLVEEE  P  DGGFV RFMD+L+HYSALYDSLE
Sbjct  324   PHFSYRAPDSVASFLSGSKTLSPRLVTLVEEEVGPVGDGGFVGRFMDSLYHYSALYDSLE  383

Query  707   AGFPMQDQARTLVERVFLGPKISVAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISFAN  886
             AGFPMQ +AR LVERVFLGP+I+ ++ R YR  G+E G SWGEW    AGFRP  ISFAN
Sbjct  384   AGFPMQSRARALVERVFLGPRIAGSLDRIYRGYGDEEGSSWGEW-SSGAGFRPVNISFAN  442

Query  887   RCQAKLLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIWTSVHSD  1024
              CQAKLLLGLFNDGYR+EE+G ++L+L WKSRRLLSASIWTS  SD
Sbjct  443   HCQAKLLLGLFNDGYRVEELGCNRLVLSWKSRRLLSASIWTSPSSD  488



>ref|XP_007226747.1| hypothetical protein PRUPE_ppa018977mg [Prunus persica]
 gb|EMJ27946.1| hypothetical protein PRUPE_ppa018977mg [Prunus persica]
Length=506

 Score =   509 bits (1311),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 254/342 (74%), Positives = 286/342 (84%), Gaps = 7/342 (2%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHG----DALAAFQLLQDMSPYVKFGHF  169
             RLAAYFT+ALQ LL+GAG +  K    +     HG    D +AAFQLLQDMSPYVKFGHF
Sbjct  159   RLAAYFTEALQGLLEGAGGVQGKHLIGNGTHRDHGHHPTDVIAAFQLLQDMSPYVKFGHF  218

Query  170   TANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsg  349
             TANQAILEAV HDRRVH++DYDIMEGIQWASLMQAL+SR+DG P PHLRITALSRGG   
Sbjct  219   TANQAILEAVVHDRRVHVLDYDIMEGIQWASLMQALVSRKDGPPTPHLRITALSRGGSGS  278

Query  350   rrs-FCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHL  526
              R    ++QETGRRLTAFAASIGQPFSFHQCRLDSDETF+PSALKLV+GEA+++NCML+L
Sbjct  279   GRRSIGTIQETGRRLTAFAASIGQPFSFHQCRLDSDETFRPSALKLVKGEALVINCMLNL  338

Query  527   PHFSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLE  706
             PHF YRSPDSIASFLSG+ TLNPRLVTLVEEE  P  DGGFV RFMD+L+HYSA+YDSLE
Sbjct  339   PHFGYRSPDSIASFLSGAKTLNPRLVTLVEEEVRPTGDGGFVARFMDSLYHYSAVYDSLE  398

Query  707   AGFPMQDQARTLVERVFLGPKISVAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISFAN  886
             AGFPMQ +AR LVERVFLGP+I+ ++ R YR  G E G SW EW+    GF+P  ISFAN
Sbjct  399   AGFPMQSRARALVERVFLGPRIAGSLARIYRANG-EVGCSWSEWLGA-VGFKPMPISFAN  456

Query  887   RCQAKLLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIWTS  1012
              CQAKLLLGLFNDGYR+EE+ NH+L+LGWKSR LLSASIWTS
Sbjct  457   HCQAKLLLGLFNDGYRVEEVSNHRLVLGWKSRCLLSASIWTS  498



>ref|XP_009344104.1| PREDICTED: nodulation-signaling pathway 2 protein [Pyrus x bretschneideri]
Length=513

 Score =   508 bits (1309),  Expect = 8e-175, Method: Compositional matrix adjust.
 Identities = 258/342 (75%), Positives = 287/342 (84%), Gaps = 8/342 (2%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHG-----DALAAFQLLQDMSPYVKFGH  166
             RLAAYFT+ALQ LL+GAG LH K        H HG     D +AAFQLLQDMSPYVKFGH
Sbjct  167   RLAAYFTEALQGLLEGAGGLHGKHLIGIGAHHDHGHHPTDDVIAAFQLLQDMSPYVKFGH  226

Query  167   FTANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggs  346
             FTANQAILEAV HDRRVH+VDYDIMEGIQWASLMQAL+SR++G P PHLRITALSRGG  
Sbjct  227   FTANQAILEAVAHDRRVHVVDYDIMEGIQWASLMQALVSRKEGPPTPHLRITALSRGGSG  286

Query  347   grrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHL  526
              R    +VQETGRRLTAFAASIGQPFSFHQCRLDSDETF+PSALKLV+GEA+++NCML+L
Sbjct  287   RRS-IGTVQETGRRLTAFAASIGQPFSFHQCRLDSDETFRPSALKLVKGEALVINCMLNL  345

Query  527   PHFSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLE  706
             PHF+YRS DSIASFLSGS TLNPRLVTLVEEE  P  DGGFV RFMD+L+HYSA+YDSLE
Sbjct  346   PHFNYRSQDSIASFLSGSKTLNPRLVTLVEEEVRPAGDGGFVARFMDSLYHYSAVYDSLE  405

Query  707   AGFPMQDQARTLVERVFLGPKISVAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISFAN  886
             AGFPMQ++AR LVERVFLGP+I+ ++ R YR   EE G SW EW+    GF+P  ISFAN
Sbjct  406   AGFPMQNRARALVERVFLGPRIAGSLGRIYRGH-EEVGSSWWEWLGA-VGFKPMPISFAN  463

Query  887   RCQAKLLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIWTS  1012
              CQAKLLLGLFNDGYR EE+ NH+L+LGWKSR LLSASIWTS
Sbjct  464   HCQAKLLLGLFNDGYRAEEVANHRLVLGWKSRCLLSASIWTS  505



>emb|CAN83568.1| hypothetical protein VITISV_030382 [Vitis vinifera]
Length=490

 Score =   506 bits (1303),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 255/345 (74%), Positives = 287/345 (83%), Gaps = 6/345 (2%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLH----AKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHF  169
             RLAAYFTDALQ LL+GAG+ H              H   D LAAFQLLQDMSPYVKFGHF
Sbjct  145   RLAAYFTDALQGLLEGAGAKHMIGNGHHRDDHHHHHHQSDVLAAFQLLQDMSPYVKFGHF  204

Query  170   TANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsg  349
             TANQAILEAV+ +RR+HIVDYDIMEGIQWASLMQAL+SR+DG PAPHLRITALSRGGG  
Sbjct  205   TANQAILEAVSKERRIHIVDYDIMEGIQWASLMQALVSRKDGPPAPHLRITALSRGGGGR  264

Query  350   rrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLP  529
             R    ++QETGRRLTAFAASIGQPFSFHQCRLDSDETF+PSALKLVRGEA+I+NCMLHLP
Sbjct  265   RS-IGTIQETGRRLTAFAASIGQPFSFHQCRLDSDETFRPSALKLVRGEALIINCMLHLP  323

Query  530   HFSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEA  709
             HFSYR+PDS+ASFLSG  TL P+LVTLVEEE  P  D GFV RFMD+LHHYSA+YDSLEA
Sbjct  324   HFSYRAPDSVASFLSGGKTLKPKLVTLVEEEVGPTGDXGFVGRFMDSLHHYSAVYDSLEA  383

Query  710   GFPMQDQARTLVERVFLGPKISVAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISFANR  889
             GFPMQ +AR LVERVFLGP+I+  + R YR RG + G SWG W+ E  GFR   ISFAN 
Sbjct  384   GFPMQGRARALVERVFLGPRIAGTLGRIYRGRGGQEGGSWGXWL-EWGGFRGVGISFANH  442

Query  890   CQAKLLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIWTSVHSD  1024
             CQAKLLLGLFNDGYR+EE+ N++++LGWKSRRLLSAS+W++  SD
Sbjct  443   CQAKLLLGLFNDGYRVEELANNRMVLGWKSRRLLSASVWSASDSD  487



>ref|XP_004292683.1| PREDICTED: nodulation-signaling pathway 2 protein-like [Fragaria 
vesca subsp. vesca]
Length=502

 Score =   505 bits (1301),  Expect = 9e-174, Method: Compositional matrix adjust.
 Identities = 256/342 (75%), Positives = 286/342 (84%), Gaps = 8/342 (2%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSL-HAKSFPASKDDHPHG----DALAAFQLLQDMSPYVKFGH  166
             RLAAYFT+ALQ LL+GAG + H+K    +     HG    D +AAFQLLQDMSPYVKFGH
Sbjct  156   RLAAYFTEALQGLLEGAGGVSHSKHLIGNGSHRDHGHHPTDVIAAFQLLQDMSPYVKFGH  215

Query  167   FTANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggs  346
             FTANQAILEAV HDRRVHIVDYDIMEGIQWASLMQAL+SR+DG P PHLRITALSRGG  
Sbjct  216   FTANQAILEAVVHDRRVHIVDYDIMEGIQWASLMQALVSRKDGPPTPHLRITALSRGGSG  275

Query  347   grrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHL  526
              R    +VQETGRRLTAFA SIGQPFSFHQCRLDSDETF+PSALKLV+GEA+++NCML+L
Sbjct  276   RRS-IGTVQETGRRLTAFATSIGQPFSFHQCRLDSDETFRPSALKLVKGEALVINCMLNL  334

Query  527   PHFSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLE  706
             PHFSYRSPDSIASFLSG+ TLNPRLV LVEEE  P  DGGFV RFMD+L+HYSA+YDSLE
Sbjct  335   PHFSYRSPDSIASFLSGAKTLNPRLVALVEEEVRPAGDGGFVARFMDSLYHYSAVYDSLE  394

Query  707   AGFPMQDQARTLVERVFLGPKISVAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISFAN  886
             AGFPMQ +AR LVERVFLGP+I+ ++ R YR  G E G SW EW+    GF+P  ISFAN
Sbjct  395   AGFPMQSRARALVERVFLGPRIAGSLARIYRAHG-EVGCSWWEWLSAE-GFKPTPISFAN  452

Query  887   RCQAKLLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIWTS  1012
              CQAKLLLGLFNDGYR+EE+  H+L+LGWKSR LLSASIWTS
Sbjct  453   HCQAKLLLGLFNDGYRVEEVAYHRLVLGWKSRSLLSASIWTS  494



>ref|XP_011013191.1| PREDICTED: nodulation-signaling pathway 2 protein-like [Populus 
euphratica]
Length=503

 Score =   502 bits (1293),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 253/351 (72%), Positives = 289/351 (82%), Gaps = 17/351 (5%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPH--------------GDALAAFQLLQD  139
             RLAAYFTDALQ LL+G+GS+H+    ++ ++ P+               D LAAFQLLQD
Sbjct  150   RLAAYFTDALQGLLEGSGSIHSNKHLSATNNGPYHHHHRDDPQHHHHQSDVLAAFQLLQD  209

Query  140   MSPYVKFGHFTANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRI  319
             MSPYVKFGHFTANQAILEAV  DRR+HIVDYDIMEGIQWASLMQAL+SR+DG P PHLRI
Sbjct  210   MSPYVKFGHFTANQAILEAVADDRRIHIVDYDIMEGIQWASLMQALVSRKDGPPTPHLRI  269

Query  320   TALsrgggsgrrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEA  499
             TALSRGG   R    +VQETGRRL AFAASIGQPFSFHQCRLDSDETF+PSALKLVRGEA
Sbjct  270   TALSRGGSGRRS-IGTVQETGRRLVAFAASIGQPFSFHQCRLDSDETFRPSALKLVRGEA  328

Query  500   IIVNCMLHLPHFSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHH  679
             +++NCML LPHFSYR+PDS+ASFLSG+ TLNPRL+ +VEEE  P  DGGFV RFMD+LHH
Sbjct  329   LVMNCMLQLPHFSYRAPDSVASFLSGAKTLNPRLIAMVEEEVGPIGDGGFVSRFMDSLHH  388

Query  680   YSALYDSLEAGFPMQDQARTLVERVFLGPKISVAITRSYRCRGEEYGWSWGEWVPENAGF  859
             YSA YDSLEAGFPMQ +AR LVERVFLGP+I+ ++ R Y  RGEE G SWGE +    GF
Sbjct  389   YSAFYDSLEAGFPMQGRARALVERVFLGPRIAGSLARIYSARGEE-GSSWGERLAA-VGF  446

Query  860   RPKTISFANRCQAKLLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIWTS  1012
             +P  ISFAN CQAKLLLGLFNDGYR+EE+ +++L+LGWKSRRLLSASIWTS
Sbjct  447   QPIKISFANHCQAKLLLGLFNDGYRVEELASNRLVLGWKSRRLLSASIWTS  497



>ref|XP_002306621.1| hypothetical protein POPTR_0005s15900g [Populus trichocarpa]
 gb|EEE93617.1| hypothetical protein POPTR_0005s15900g [Populus trichocarpa]
Length=503

 Score =   501 bits (1289),  Expect = 6e-172, Method: Compositional matrix adjust.
 Identities = 252/351 (72%), Positives = 289/351 (82%), Gaps = 17/351 (5%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPH--------------GDALAAFQLLQD  139
             RLAAYFTDALQ LL+G+GS+H+    +  ++ P+               D LAAFQLLQD
Sbjct  150   RLAAYFTDALQGLLEGSGSIHSNKHLSGTNNGPYHHHHRDDPQHHHHQSDVLAAFQLLQD  209

Query  140   MSPYVKFGHFTANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRI  319
             MSPYVKFGHFTANQAILEAV  DRR+HIVDYDIMEGIQWASLMQAL+SR+DG P PHLRI
Sbjct  210   MSPYVKFGHFTANQAILEAVADDRRIHIVDYDIMEGIQWASLMQALVSRKDGPPTPHLRI  269

Query  320   TALsrgggsgrrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEA  499
             TALSRGG   R    +VQETGRRL AFAASIGQPFSFHQCRLDSD+TF+PSALKLVRGEA
Sbjct  270   TALSRGGSGRRS-IGTVQETGRRLVAFAASIGQPFSFHQCRLDSDDTFRPSALKLVRGEA  328

Query  500   IIVNCMLHLPHFSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHH  679
             +++NCML LPHFSYR+PDS+ASFLSG+ TLNPRL+ +VEEE  P  DGGFV RFMD+LHH
Sbjct  329   LVMNCMLQLPHFSYRAPDSVASFLSGAKTLNPRLIAMVEEEVGPIGDGGFVSRFMDSLHH  388

Query  680   YSALYDSLEAGFPMQDQARTLVERVFLGPKISVAITRSYRCRGEEYGWSWGEWVPENAGF  859
             YSALYDSLEAGFPMQ +AR LVERVFLGP+I+ ++ R Y  RGE+ G SWGE +    GF
Sbjct  389   YSALYDSLEAGFPMQGRARALVERVFLGPRIAGSLARIYSARGED-GCSWGERLAA-VGF  446

Query  860   RPKTISFANRCQAKLLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIWTS  1012
             +P  ISFAN CQAKLLLGLFNDGYR+EE+ +++L+LGWKSRRLLSASIWTS
Sbjct  447   QPIKISFANHCQAKLLLGLFNDGYRVEELASNRLVLGWKSRRLLSASIWTS  497



>ref|XP_002302249.1| scarecrow transcription factor family protein [Populus trichocarpa]
 gb|EEE81522.1| scarecrow transcription factor family protein [Populus trichocarpa]
Length=507

 Score =   498 bits (1283),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 249/351 (71%), Positives = 288/351 (82%), Gaps = 17/351 (5%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPH--------------GDALAAFQLLQD  139
             RLAAYFTDALQ LL+G G +H+    +  ++ P+               DALAAFQLLQD
Sbjct  154   RLAAYFTDALQGLLEGTGGIHSNKHHSVTNNGPYHHHHRDDPQQHRHQNDALAAFQLLQD  213

Query  140   MSPYVKFGHFTANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRI  319
             MSPYVKFGHFTANQAILEAV  DRR+HIVDYDIMEGIQWASLMQAL+SR+DG P PHL+I
Sbjct  214   MSPYVKFGHFTANQAILEAVAEDRRIHIVDYDIMEGIQWASLMQALVSRKDGPPTPHLKI  273

Query  320   TALsrgggsgrrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEA  499
             TA+SRGG S R    +VQETGRRL AFAASIGQPFSFHQCRLDSDETF+PSALKLV+GEA
Sbjct  274   TAMSRGGSSRRS-IGTVQETGRRLVAFAASIGQPFSFHQCRLDSDETFRPSALKLVKGEA  332

Query  500   IIVNCMLHLPHFSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHH  679
             +++NCMLHLPHFSYR+PDS+ASFLSG+ TLNPRL+T+VEEE  P  DGGFV RFMD+LHH
Sbjct  333   LVMNCMLHLPHFSYRAPDSVASFLSGAKTLNPRLITMVEEEVGPIGDGGFVGRFMDSLHH  392

Query  680   YSALYDSLEAGFPMQDQARTLVERVFLGPKISVAITRSYRCRGEEYGWSWGEWVPENAGF  859
             YSA YDS+EAGFPMQ +AR LVERV LGP+IS ++ R YR RGEE    W EW+    GF
Sbjct  393   YSAFYDSMEAGFPMQGRARALVERVILGPRISGSLARIYRARGEEV-CPWWEWLAAR-GF  450

Query  860   RPKTISFANRCQAKLLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIWTS  1012
             +P  +SFAN CQAKLLLG+FNDGYR+EE+ +++L+LGWKSRRLLSASIWTS
Sbjct  451   QPVKVSFANNCQAKLLLGVFNDGYRVEELASNRLVLGWKSRRLLSASIWTS  501



>ref|XP_010042750.1| PREDICTED: nodulation-signaling pathway 2 protein [Eucalyptus 
grandis]
Length=498

 Score =   498 bits (1282),  Expect = 6e-171, Method: Compositional matrix adjust.
 Identities = 255/342 (75%), Positives = 287/342 (84%), Gaps = 7/342 (2%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAK---SFPASKDDHPH--GDALAAFQLLQDMSPYVKFGH  166
             RLAAYFT+ALQ LL+GAG  H K   S    +DDH H   D LAAFQL+QDMSPYVKFGH
Sbjct  153   RLAAYFTEALQGLLEGAGGGHGKHLISGGPQRDDHHHHQTDVLAAFQLMQDMSPYVKFGH  212

Query  167   FTANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggs  346
             FTANQAILEAVT  RRVHIVDYDIMEGIQWASLMQAL+SR++G PAPHLRITALSRGG  
Sbjct  213   FTANQAILEAVTQHRRVHIVDYDIMEGIQWASLMQALVSRKNGPPAPHLRITALSRGGNG  272

Query  347   grrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHL  526
              R    ++QE GRRLTAFA SIGQPFSFHQCRLDSD+TF+PS+LKLVRGEA+I NCMLHL
Sbjct  273   RRS-IGTIQEMGRRLTAFATSIGQPFSFHQCRLDSDKTFRPSSLKLVRGEALIFNCMLHL  331

Query  527   PHFSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLE  706
             PHFSYR+P+S+ASFLSG+ TLNPRLVTLVEEE  P  D GFV RF+D+LHHYSALYDSLE
Sbjct  332   PHFSYRAPESVASFLSGAKTLNPRLVTLVEEELGPIGDQGFVSRFIDSLHHYSALYDSLE  391

Query  707   AGFPMQDQARTLVERVFLGPKISVAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISFAN  886
             AGFPMQ +AR LVERVFLGP+I  ++ R YR RG+E G SW E +    GFRP  ISFAN
Sbjct  392   AGFPMQRRARALVERVFLGPRIVGSLGRIYRTRGDEEGGSWRERLGAT-GFRPVDISFAN  450

Query  887   RCQAKLLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIWTS  1012
              CQAKLLLGLFNDGYR+EE+ +++L+LGWKSRRLLSASIW+S
Sbjct  451   HCQAKLLLGLFNDGYRVEELASNRLVLGWKSRRLLSASIWSS  492



>emb|CBI19047.3| unnamed protein product [Vitis vinifera]
Length=482

 Score =   495 bits (1275),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 249/332 (75%), Positives = 279/332 (84%), Gaps = 6/332 (2%)
 Frame = +2

Query  2    RLAAYFTDALQALLDGAGSLH----AKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHF  169
            RLAAYFTDALQ LL+GAG+ H              H   D LAAFQLLQDMSPYVKFGHF
Sbjct  145  RLAAYFTDALQGLLEGAGAKHMIGNGHHRDDHHHHHHQSDVLAAFQLLQDMSPYVKFGHF  204

Query  170  TANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsg  349
            TANQAILEAV+ +RR+HIVDYDIMEGIQWASLMQAL+SR+DG PAPHLRITALSRGGG  
Sbjct  205  TANQAILEAVSKERRIHIVDYDIMEGIQWASLMQALVSRKDGPPAPHLRITALSRGGGGR  264

Query  350  rrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLP  529
            R    ++QETGRRLTAFAASIGQPFSFHQCRLDSDETF+PSALKLVRGEA+I+NCMLHLP
Sbjct  265  RS-IGTIQETGRRLTAFAASIGQPFSFHQCRLDSDETFRPSALKLVRGEALIINCMLHLP  323

Query  530  HFSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEA  709
            HFSYR+PDS+ASFLSG  TL P+LVTLVEEE  P  DGGFV RFMD+LHHYSA+YDSLEA
Sbjct  324  HFSYRAPDSVASFLSGGKTLKPKLVTLVEEEVGPTGDGGFVGRFMDSLHHYSAVYDSLEA  383

Query  710  GFPMQDQARTLVERVFLGPKISVAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISFANR  889
            GFPMQ +AR LVERVFLGP+I+  + R YR RG + G SWGEW+ + AGFR   ISFAN 
Sbjct  384  GFPMQGRARALVERVFLGPRIAGTLGRIYRGRGGQEGGSWGEWL-DGAGFRGVGISFANH  442

Query  890  CQAKLLLGLFNDGYRIEEIGNHKLILGWKSRR  985
            CQAKLLLGLFNDGYR+EE+ N++++LGWKSRR
Sbjct  443  CQAKLLLGLFNDGYRVEELANNRMVLGWKSRR  474



>ref|XP_011027574.1| PREDICTED: nodulation-signaling pathway 2 protein-like [Populus 
euphratica]
 ref|XP_011027579.1| PREDICTED: nodulation-signaling pathway 2 protein [Populus euphratica]
Length=500

 Score =   496 bits (1276),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 250/347 (72%), Positives = 287/347 (83%), Gaps = 13/347 (4%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLH---AKSFPAS---KDD----HPHGDALAAFQLLQDMSPY  151
             RLAAYFTDALQ LL+G G  H     + P     +DD    H   DALAAFQLLQDMSPY
Sbjct  151   RLAAYFTDALQGLLEGTGGKHHSVTNNGPYHHHHRDDPQQHHHQNDALAAFQLLQDMSPY  210

Query  152   VKFGHFTANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALs  331
             VKFGHFTANQAILEAV  DR++HIVDYDIMEGIQWASLMQAL+SR+DG P PHLRITA+S
Sbjct  211   VKFGHFTANQAILEAVADDRKIHIVDYDIMEGIQWASLMQALVSRKDGPPTPHLRITAMS  270

Query  332   rgggsgrrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVN  511
             RGG + R    +VQETGRRL AFAASIGQPFSFHQCRLDSDETF+PSALKLV+GE +++N
Sbjct  271   RGGSNRRS-IGTVQETGRRLVAFAASIGQPFSFHQCRLDSDETFRPSALKLVKGEPLVMN  329

Query  512   CMLHLPHFSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSAL  691
             CMLHLPHFSYR+PDS+ASFLSG+ TLNPRL+T+VEEE  P  DGGFV RFMD+LHHYSA 
Sbjct  330   CMLHLPHFSYRAPDSVASFLSGAKTLNPRLITMVEEEVGPIGDGGFVGRFMDSLHHYSAF  389

Query  692   YDSLEAGFPMQDQARTLVERVFLGPKISVAITRSYRCRGEEYGWSWGEWVPENAGFRPKT  871
             YDS+EAGFPMQ +AR LVERV LGP+I+ ++ R YR RGEE    WGEW+    GF+P  
Sbjct  390   YDSMEAGFPMQGRARALVERVILGPRIAGSLARIYRARGEEV-CPWGEWLAA-GGFQPVK  447

Query  872   ISFANRCQAKLLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIWTS  1012
             +SFAN CQAKLLLG+FNDGYR+EE+ +++L+LGWKSRRLLSASIWTS
Sbjct  448   VSFANHCQAKLLLGVFNDGYRVEELASNRLVLGWKSRRLLSASIWTS  494



>gb|KDP32775.1| hypothetical protein JCGZ_12067 [Jatropha curcas]
Length=488

 Score =   494 bits (1271),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 252/346 (73%), Positives = 286/346 (83%), Gaps = 11/346 (3%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHA----KSFPASKDDHPH-----GDALAAFQLLQDMSPYV  154
             RLAAYFTDALQ LL+GA         K F  +   H H      D LAAFQLLQDMSPYV
Sbjct  139   RLAAYFTDALQNLLEGAAGSGGGHSNKHFITNGPYHHHHRDDQNDVLAAFQLLQDMSPYV  198

Query  155   KFGHFTANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsr  334
             KFGHFTANQAILEAVT DRR+HIVDYDIMEGIQWASLMQ+L+SR+DG P PHLRITALSR
Sbjct  199   KFGHFTANQAILEAVTQDRRIHIVDYDIMEGIQWASLMQSLVSRKDGPPTPHLRITALSR  258

Query  335   gggsgrrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNC  514
             GG   +    ++QETGRRL AFAASIGQPFSFHQCRLDSDETF+PSALKLVRGEA+I+NC
Sbjct  259   GGSGRKS-IGTIQETGRRLVAFAASIGQPFSFHQCRLDSDETFRPSALKLVRGEALIMNC  317

Query  515   MLHLPHFSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALY  694
             MLHLPHF YR+PDS+ASFL+G+ TLNPRLVTLVEEE  P  DGGFV+RFMD+LHHYSA+Y
Sbjct  318   MLHLPHFIYRAPDSVASFLTGAKTLNPRLVTLVEEEVGPIGDGGFVNRFMDSLHHYSAVY  377

Query  695   DSLEAGFPMQDQARTLVERVFLGPKISVAITRSYRCRGEEYGWSWGEWVPENAGFRPKTI  874
             DSLEAGFPMQ +AR LVERVFLGP+I+ ++ R YR RGE+   S+G+W+    GF+   I
Sbjct  378   DSLEAGFPMQSRARALVERVFLGPRIAGSLARIYRTRGEKDAGSYGDWLGA-VGFKAGNI  436

Query  875   SFANRCQAKLLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIWTS  1012
             SFAN CQAKLLLGLFNDGYR+EE G ++L+LGWKSRR+LSASIWTS
Sbjct  437   SFANHCQAKLLLGLFNDGYRVEESGCNRLVLGWKSRRILSASIWTS  482



>ref|XP_008219753.1| PREDICTED: nodulation-signaling pathway 2 protein [Prunus mume]
Length=513

 Score =   487 bits (1254),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 257/341 (75%), Positives = 287/341 (84%), Gaps = 7/341 (2%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHG----DALAAFQLLQDMSPYVKFGHF  169
             RLAAYFT+ALQ LL+GAG +  K    +     HG    D +AAFQLLQDMSPYVKFGHF
Sbjct  168   RLAAYFTEALQGLLEGAGGVQGKHLIGNGTHRDHGQHPTDVIAAFQLLQDMSPYVKFGHF  227

Query  170   TANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsg  349
             TANQAILEAV HDRRVH+VDYDIMEGIQWASLMQAL+SR+DG P PHLRITALSRGG   
Sbjct  228   TANQAILEAVVHDRRVHVVDYDIMEGIQWASLMQALVSRKDGPPTPHLRITALSRGGSGR  287

Query  350   rrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLP  529
             R    +VQETGRRLTAFAASIGQPFSFHQCRLDSDETF+PSALKLV+GEA+++NCML+LP
Sbjct  288   RS-IGTVQETGRRLTAFAASIGQPFSFHQCRLDSDETFRPSALKLVKGEALVINCMLNLP  346

Query  530   HFSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEA  709
             HFSYRSPDSIASFLSG+ TLNPRLVTLVEEE  P  DGGFV RF D+L+HYSA+YDSLEA
Sbjct  347   HFSYRSPDSIASFLSGAKTLNPRLVTLVEEEVRPVGDGGFVARFTDSLYHYSAVYDSLEA  406

Query  710   GFPMQDQARTLVERVFLGPKISVAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISFANR  889
             GFPMQ +AR LVERVFLGP+I+ ++ R YR  G E G SW EW+    GF+P  ISFAN 
Sbjct  407   GFPMQSRARALVERVFLGPRIAGSLARIYRANG-EVGCSWSEWLGA-VGFKPMPISFANH  464

Query  890   CQAKLLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIWTS  1012
             CQAKLLLGLFNDGYR+EE+GNH+L+LGWKSR LLSASIWTS
Sbjct  465   CQAKLLLGLFNDGYRVEEVGNHRLVLGWKSRCLLSASIWTS  505



>ref|XP_004499407.1| PREDICTED: nodulation-signaling pathway 2 protein-like [Cicer 
arietinum]
 gb|AHB60766.1| nodulation signaling pathway 2 protein [Cicer arietinum]
Length=500

 Score =   467 bits (1201),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 236/340 (69%), Positives = 276/340 (81%), Gaps = 10/340 (3%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSF--PASKDDHPHGDALAAFQLLQDMSPYVKFGHFTA  175
             RLAAYFT+ALQ LL+GAG  H  +   P         D LAAFQLLQDMSPYVKFGHFTA
Sbjct  160   RLAAYFTEALQGLLEGAGGAHNNNHHHPQGGPHDNQNDTLAAFQLLQDMSPYVKFGHFTA  219

Query  176   NQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrr  355
             NQAILEAV H+RRVH++DYDIMEG+QWASL+QAL S ++G   PHLRITALSR G   R 
Sbjct  220   NQAILEAVAHERRVHVIDYDIMEGVQWASLIQALASNKNG---PHLRITALSRTGTGRRS  276

Query  356   sFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHF  535
                +VQETGRRLT+FAAS+GQPFSFH CRLDSDETF+PS+LKLVRGEA++ NCML+LPH 
Sbjct  277   -IATVQETGRRLTSFAASLGQPFSFHHCRLDSDETFRPSSLKLVRGEALVFNCMLNLPHL  335

Query  536   SYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGF  715
             SYR+PDS+ASFL+G+  L PRLVTLVEEE      GGFV+RFMD+LHHYSA++DSLEAGF
Sbjct  336   SYRAPDSVASFLNGAKALKPRLVTLVEEEVGSVV-GGFVERFMDSLHHYSAVFDSLEAGF  394

Query  716   PMQDQARTLVERVFLGPKISVAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISFANRCQ  895
             PMQ++AR LVERVF GP+I+ ++ R YR  GEE   SWGEW+   AGFR   +SFAN CQ
Sbjct  395   PMQNRARALVERVFFGPRIAGSLARIYRTGGEEERRSWGEWLGA-AGFRGVPVSFANHCQ  453

Query  896   AKLLLGLFNDGYRIEE--IGNHKLILGWKSRRLLSASIWT  1009
             AKLLLGLFNDGYR+EE  +G++KL+L WKSRRLLSAS+WT
Sbjct  454   AKLLLGLFNDGYRVEEVGVGSNKLVLDWKSRRLLSASVWT  493



>ref|XP_003522584.1| PREDICTED: nodulation-signaling pathway 2 protein-like [Glycine 
max]
Length=502

 Score =   466 bits (1199),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 243/355 (68%), Positives = 279/355 (79%), Gaps = 19/355 (5%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGA-GSLH------------AKSFPASKDDHPH--GDALAAFQLLQ  136
             RLAAYFTDALQ LL+GA G  H            +   P  +DDH +   + LAAFQLLQ
Sbjct  151   RLAAYFTDALQGLLEGASGGAHNNKRHHHYNIITSSCGPHHRDDHHNHQSNTLAAFQLLQ  210

Query  137   DMSPYVKFGHFTANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLR  316
             DMSPYVKFGHFTANQAILE+V H+RRVHIVDYDIMEG+QWASLMQAL S + G P PHLR
Sbjct  211   DMSPYVKFGHFTANQAILESVAHERRVHIVDYDIMEGVQWASLMQALASNKTGPPGPHLR  270

Query  317   ITALsrgggsgrrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGE  496
             ITALSR G   R    +VQETGRRLTAFAAS+GQPFSFH CRLD DETFKPS+LKLVRGE
Sbjct  271   ITALSRTGSGRRS-IATVQETGRRLTAFAASLGQPFSFHHCRLDPDETFKPSSLKLVRGE  329

Query  497   AIIVNCMLHLPHFSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLH  676
             A++ NCML+LPH SYR+PDS+ASFLSG+  L PRLVTLVEEE      GGFV RFM++LH
Sbjct  330   ALVFNCMLNLPHLSYRAPDSVASFLSGAKALKPRLVTLVEEEVGSSA-GGFVGRFMESLH  388

Query  677   HYSALYDSLEAGFPMQDQARTLVERVFLGPKISVAITRSYRCRGEEYGWSWGEWVPENAG  856
             HYSA++DSLEAGFPMQ +AR LVERVF GP+I  ++ R YR   EE G SWGEW+   AG
Sbjct  389   HYSAVFDSLEAGFPMQGRARALVERVFFGPRIVGSLGRLYRTGEEERG-SWGEWLGA-AG  446

Query  857   FRPKTISFANRCQAKLLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIWTSVHS  1021
             FR   +SFAN CQAKLL+GLFNDGYR+EE+G +KL+L WKSRRLLSAS+WT ++S
Sbjct  447   FRGVPMSFANHCQAKLLIGLFNDGYRVEELGTNKLVLDWKSRRLLSASLWTQINS  501



>ref|XP_003601076.1| Nodulation-signaling pathway 2 protein [Medicago truncatula]
 sp|Q5NE24.1|NSP2_MEDTR RecName: Full=Nodulation-signaling pathway 2 protein [Medicago 
truncatula]
 emb|CAH55768.1| GRAS family protein [Medicago truncatula]
 gb|AES71327.1| GRAS family transcription factor [Medicago truncatula]
 gb|AET75783.1| NSP2 [Cloning vector pHUGE-MtNFS]
 gb|AET75795.1| NSP2 [Cloning vector pHUGE-LjMtNFS]
Length=508

 Score =   463 bits (1191),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 238/352 (68%), Positives = 282/352 (80%), Gaps = 17/352 (5%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDH------PH---GDALAAFQLLQDMSPYV  154
             RLAA+FT+AL  LL+GAG  H      + + H      PH    D LAAFQLLQDMSPYV
Sbjct  160   RLAAHFTEALHGLLEGAGGAHNNHHHHNNNKHYLTTNGPHDNQNDTLAAFQLLQDMSPYV  219

Query  155   KFGHFTANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsr  334
             KFGHFTANQAI+EAV H+RRVH++DYDIMEG+QWASL+Q+L S  +G   PHLRITALSR
Sbjct  220   KFGHFTANQAIIEAVAHERRVHVIDYDIMEGVQWASLIQSLASNNNG---PHLRITALSR  276

Query  335   gggsgrrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNC  514
              G   R    +VQETGRRLT+FAAS+GQPFSFH CRLDSDETF+PSALKLVRGEA++ NC
Sbjct  277   TGTGRRS-IATVQETGRRLTSFAASLGQPFSFHHCRLDSDETFRPSALKLVRGEALVFNC  335

Query  515   MLHLPHFSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALY  694
             ML+LPH SYR+P+S+ASFL+G+ TLNP+LVTLVEEE      GGFV+RFMD+LHHYSA++
Sbjct  336   MLNLPHLSYRAPESVASFLNGAKTLNPKLVTLVEEEVGSVI-GGFVERFMDSLHHYSAVF  394

Query  695   DSLEAGFPMQDQARTLVERVFLGPKISVAITRSYRCRGEEYGWSWGEWVPENAGFRPKTI  874
             DSLEAGFPMQ++ARTLVERVF GP+I+ ++ R YR  GEE   SWGEW+ E  GFR   +
Sbjct  395   DSLEAGFPMQNRARTLVERVFFGPRIAGSLGRIYRTGGEEERRSWGEWLGE-VGFRGVPV  453

Query  875   SFANRCQAKLLLGLFNDGYRIEE--IGNHKLILGWKSRRLLSASIWTSVHSD  1024
             SFAN CQAKLLLGLFNDGYR+EE  +G++KL+L WKSRRLLSAS+WT   SD
Sbjct  454   SFANHCQAKLLLGLFNDGYRVEEVGVGSNKLVLDWKSRRLLSASLWTCSSSD  505



>emb|CAH55769.1| GRAS family protein [Pisum sativum]
Length=503

 Score =   459 bits (1180),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 234/344 (68%), Positives = 278/344 (81%), Gaps = 14/344 (4%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKS----FPASKDDHPHGDALAAFQLLQDMSPYVKFGHF  169
             RLAAYFT+ALQ LL+GAG  H+ +      A+       D LAAFQLLQDMSPYVKFGHF
Sbjct  159   RLAAYFTEALQGLLEGAGGAHSNNNKHYLTANGPHDNQNDTLAAFQLLQDMSPYVKFGHF  218

Query  170   TANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsg  349
             TANQAILE+V H+RRVH++DYDIMEG+QWASL+QAL S  +   +PHLRITALSR G   
Sbjct  219   TANQAILESVAHERRVHVIDYDIMEGVQWASLIQALASSNN---SPHLRITALSRTGTGR  275

Query  350   rrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLP  529
             R    +VQETGRRLT+FAAS+GQPFSFH CRLDSDETF+PS+LKLVRGEA++ NCML+LP
Sbjct  276   RS-IATVQETGRRLTSFAASLGQPFSFHHCRLDSDETFRPSSLKLVRGEALVFNCMLNLP  334

Query  530   HFSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEA  709
             H SYR+PDS+ASFL+G+  LNP+LVTLVEEE      GGFV+RFMD+LHHYSA++DSLEA
Sbjct  335   HLSYRAPDSVASFLNGAKALNPKLVTLVEEENGSVV-GGFVERFMDSLHHYSAVFDSLEA  393

Query  710   GFPMQDQARTLVERVFLGPKISVAITRSYRC--RGEEYGWSWGEWVPENAGFRPKTISFA  883
             GFPMQ++AR LVERVF GP+I+ ++ R YR    GEE   SWGEW+   AGFR   +SFA
Sbjct  394   GFPMQNRARALVERVFFGPRIAGSLGRIYRTGGDGEEERRSWGEWLGA-AGFRGVPVSFA  452

Query  884   NRCQAKLLLGLFNDGYRIEEI--GNHKLILGWKSRRLLSASIWT  1009
             N CQAKLLLGLFNDGYR+EE+  G++KL+L WKSRRLLSAS+WT
Sbjct  453   NHCQAKLLLGLFNDGYRVEEVGLGSNKLVLDWKSRRLLSASVWT  496



>gb|ACI14607.1| GRAS family protein [Pisum sativum]
Length=505

 Score =   458 bits (1179),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 235/344 (68%), Positives = 280/344 (81%), Gaps = 14/344 (4%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHA---KSFPASKDDHPH-GDALAAFQLLQDMSPYVKFGHF  169
             RLAAYFT+ALQ LL+GAG  H+   K +  +   H +  D LAAFQLLQDMSPYVKFGHF
Sbjct  161   RLAAYFTEALQGLLEGAGGAHSNNNKHYLTTNGPHDNQNDTLAAFQLLQDMSPYVKFGHF  220

Query  170   TANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsg  349
             TANQAILE+V H+RRVH++DYDIMEG+QWASL+QAL S  +   +PHLRITALSR G   
Sbjct  221   TANQAILESVAHERRVHVIDYDIMEGVQWASLIQALASSNN---SPHLRITALSRTGTGR  277

Query  350   rrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLP  529
             R    +VQETGRRLT+FAAS+GQPFSFH CRLDSDETF+PS+LKLVRGEA++ NCML+LP
Sbjct  278   RS-IATVQETGRRLTSFAASLGQPFSFHHCRLDSDETFRPSSLKLVRGEALVFNCMLNLP  336

Query  530   HFSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEA  709
             H SYR+PDS+ASFL+G+  LNP+LVTLVEEE      GGFV+RFMD+LHHYSA++DSLEA
Sbjct  337   HLSYRAPDSVASFLNGAKALNPKLVTLVEEENGSVV-GGFVERFMDSLHHYSAVFDSLEA  395

Query  710   GFPMQDQARTLVERVFLGPKISVAITRSYRC--RGEEYGWSWGEWVPENAGFRPKTISFA  883
             GFPMQ++AR LVERVF GP+I+ ++ R YR    GEE   SWGEW+   AGFR   +SFA
Sbjct  396   GFPMQNRARALVERVFFGPRIAGSLGRIYRTGGDGEEERRSWGEWLGA-AGFRGVPVSFA  454

Query  884   NRCQAKLLLGLFNDGYRIEEI--GNHKLILGWKSRRLLSASIWT  1009
             N CQAKLLLGLFNDGYR+EE+  G++KL+L WKSRRLLSAS+WT
Sbjct  455   NHCQAKLLLGLFNDGYRVEEVGLGSNKLVLDWKSRRLLSASVWT  498



>gb|ACI14606.1| GRAS family protein [Pisum sativum]
Length=503

 Score =   457 bits (1177),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 234/344 (68%), Positives = 280/344 (81%), Gaps = 14/344 (4%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHA---KSFPASKDDHPH-GDALAAFQLLQDMSPYVKFGHF  169
             RLAAYFT+ALQ LL+GAG  H+   K +  +   H +  D LAAFQLLQDMSPYVKFGHF
Sbjct  159   RLAAYFTEALQGLLEGAGGAHSNNNKHYLTTNGPHDNQNDTLAAFQLLQDMSPYVKFGHF  218

Query  170   TANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsg  349
             TANQAILE+V H+RRVH++DYDIMEG+QWASL+QAL S  +   +PHLRITALSR G   
Sbjct  219   TANQAILESVAHERRVHVIDYDIMEGVQWASLIQALASSNN---SPHLRITALSRTGTGR  275

Query  350   rrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLP  529
             R    +VQETGRRLT+FAAS+GQPFSFH CRLDSDETF+PS+LKLVRGEA++ NCML+LP
Sbjct  276   RS-IATVQETGRRLTSFAASLGQPFSFHHCRLDSDETFRPSSLKLVRGEALVFNCMLNLP  334

Query  530   HFSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEA  709
             H SYR+PDS+ASFL+G+  LNP+LVT+VEEE      GGFV+RFMD+LHHYSA++DSLEA
Sbjct  335   HLSYRAPDSVASFLNGAKALNPKLVTMVEEENGSVV-GGFVERFMDSLHHYSAVFDSLEA  393

Query  710   GFPMQDQARTLVERVFLGPKISVAITRSYRC--RGEEYGWSWGEWVPENAGFRPKTISFA  883
             GFPMQ++AR LVERVF GP+I+ ++ R YR    GEE   SWGEW+   AGFR   +SFA
Sbjct  394   GFPMQNRARALVERVFFGPRIAGSLGRIYRTGGDGEEERRSWGEWLGA-AGFRGVPVSFA  452

Query  884   NRCQAKLLLGLFNDGYRIEEI--GNHKLILGWKSRRLLSASIWT  1009
             N CQAKLLLGLFNDGYR+EE+  G++KL+L WKSRRLLSAS+WT
Sbjct  453   NHCQAKLLLGLFNDGYRVEEVGLGSNKLVLDWKSRRLLSASVWT  496



>ref|XP_008350554.1| PREDICTED: nodulation-signaling pathway 2 protein-like [Malus 
domestica]
Length=513

 Score =   457 bits (1176),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 242/341 (71%), Positives = 276/341 (81%), Gaps = 7/341 (2%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHG----DALAAFQLLQDMSPYVKFGHF  169
             RLAAY+T+ALQ LL+G G L  K    S     HG    D   AFQLLQDMSPYVKFGHF
Sbjct  168   RLAAYYTEALQGLLEGTGGLLGKHLIGSGAHRNHGHHPMDVTVAFQLLQDMSPYVKFGHF  227

Query  170   TANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsg  349
             TANQAILEAV H+RR+H+VDYDIMEGIQWASLMQAL+SR++G P P LRITALSRGG   
Sbjct  228   TANQAILEAVVHERRIHVVDYDIMEGIQWASLMQALVSRKEGPPTPLLRITALSRGGSRR  287

Query  350   rrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLP  529
             +    +VQETGRRLT FAASIGQPFSFHQCRL SDETF+PSALKL++GE +++NCML+LP
Sbjct  288   QS-IGTVQETGRRLTEFAASIGQPFSFHQCRLGSDETFQPSALKLIKGETLVINCMLNLP  346

Query  530   HFSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEA  709
             HFSYRSPDSIASFLSG+ TL+PRLVTLVEE+     DGGFV RFMD+L+HYSA+YDSLEA
Sbjct  347   HFSYRSPDSIASFLSGAKTLSPRLVTLVEEDVRSTWDGGFVARFMDSLYHYSAVYDSLEA  406

Query  710   GFPMQDQARTLVERVFLGPKISVAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISFANR  889
             GFPMQ +AR LVERVFLGP+I  ++   YR  G E G SW E +    GF+P  ISFAN 
Sbjct  407   GFPMQSRARALVERVFLGPRIVGSLAHIYRAHG-EVGHSWRERLGA-VGFKPIPISFANH  464

Query  890   CQAKLLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIWTS  1012
             CQAKLLLGLFNDGYR+EE+ NH+L+LGWKSR LLSASIWTS
Sbjct  465   CQAKLLLGLFNDGYRVEEVTNHRLVLGWKSRCLLSASIWTS  505



>ref|XP_010091366.1| hypothetical protein L484_020168 [Morus notabilis]
 gb|EXB44356.1| hypothetical protein L484_020168 [Morus notabilis]
Length=525

 Score =   457 bits (1177),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 243/359 (68%), Positives = 283/359 (79%), Gaps = 21/359 (6%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKS-------FPASKDDHPH--GDALAAFQLLQDMSPYV  154
             RLAA+F+DAL +LL+ A +               S D+H H   D +AAFQLLQDMSPYV
Sbjct  165   RLAAHFSDALHSLLECAATGAHAKHHHHNHFIGNSGDNHHHHQNDVVAAFQLLQDMSPYV  224

Query  155   KFGHFTANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsr  334
             KFGHFTANQAILEAV HDRRVHIVDYDIMEGIQWASLMQAL+SR+DG P+PHLRITALSR
Sbjct  225   KFGHFTANQAILEAVAHDRRVHIVDYDIMEGIQWASLMQALVSRKDGPPSPHLRITALSR  284

Query  335   gggsgrrs--FCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIV  508
             G  S        ++QETGRRL AFAASIG PFSFHQCRLDSDE+F+PSA+KLV+GEA+IV
Sbjct  285   GAASAAARRSIGTIQETGRRLAAFAASIGLPFSFHQCRLDSDESFRPSAVKLVKGEALIV  344

Query  509   NCMLHLPHFSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPP------RDGGFVDRFMDT  670
             NCML+LPHF+YRSP+S+ASFLSG+ TLNPRL+ LVEEE+  P        G FV RFMD 
Sbjct  345   NCMLNLPHFTYRSPESVASFLSGAKTLNPRLIALVEEESPLPATTPEGSGGKFVARFMDL  404

Query  671   LHHYSALYDSLEAGFPMQDQARTLVERVFLGPKISVAITRSYRCRGEEYGWSWGEWVPEN  850
             L+ YSA+YDSLEAGFPM  +AR LVERVFLGP+I+ ++ R YR RGEE G SWGEW+   
Sbjct  405   LYQYSAVYDSLEAGFPMHGRARALVERVFLGPRIAGSLGRIYRARGEESG-SWGEWLAA-  462

Query  851   AGFRPKTISFANRCQAKLLLGLFNDGYRIEEIGN--HKLILGWKSRRLLSASIWTSVHS  1021
             AG R   +SFAN CQAKLLLGLFNDGYR+EE+ +  ++L+LGWKSRRLLSAS+WTS  S
Sbjct  463   AGCRAAPVSFANICQAKLLLGLFNDGYRVEEVASNTNRLVLGWKSRRLLSASLWTSSFS  521



>ref|XP_007137382.1| hypothetical protein PHAVU_009G122700g [Phaseolus vulgaris]
 gb|ESW09376.1| hypothetical protein PHAVU_009G122700g [Phaseolus vulgaris]
Length=501

 Score =   455 bits (1171),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 235/337 (70%), Positives = 265/337 (79%), Gaps = 12/337 (4%)
 Frame = +2

Query  2    RLAAYFTDALQALLDGAGSLHAKS---------FPASKDDHPHGDALAAFQLLQDMSPYV  154
            RLAAYFTDALQ LL+GAG  H  S             +DDH   D LAAFQ+LQDMSPYV
Sbjct  153  RLAAYFTDALQGLLEGAGGAHNNSKHHHYITCGSHHPRDDHHQNDTLAAFQMLQDMSPYV  212

Query  155  KFGHFTANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsr  334
            KFGHFTANQAILEAV H+RRVHIVDYDIMEG+QWASLMQAL S + G P PHLRITALSR
Sbjct  213  KFGHFTANQAILEAVAHERRVHIVDYDIMEGVQWASLMQALASNKAGPPGPHLRITALSR  272

Query  335  gggsgrrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNC  514
             G   R    +VQETGRRLTAFAAS+GQPF+FHQCRLD DETFKPS+LKLVRGEA++ NC
Sbjct  273  TGTGRRS-VATVQETGRRLTAFAASLGQPFTFHQCRLDPDETFKPSSLKLVRGEALVFNC  331

Query  515  MLHLPHFSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALY  694
            ML+LPH SYR+PDSIASFLSG+  L PRLVTLVEEE      GGFV RFM+ LHHYSA++
Sbjct  332  MLNLPHLSYRAPDSIASFLSGARELKPRLVTLVEEEVGSSV-GGFVGRFMELLHHYSAVF  390

Query  695  DSLEAGFPMQDQARTLVERVFLGPKISVAITRSYRCRGEEYGWSWGEWVPENAGFRPKTI  874
            DSLEAGFPMQ +AR LVERVFLGP+I  ++ R YR   E    SWGEW+   +GFR   +
Sbjct  391  DSLEAGFPMQGRARALVERVFLGPRIVGSLARIYRTGEELQERSWGEWLGA-SGFRGVPM  449

Query  875  SFANRCQAKLLLGLFNDGYRIEEIGNHKLILGWKSRR  985
            SFAN CQAKLLLGLFNDGYR+EE+G ++L+L WKSRR
Sbjct  450  SFANHCQAKLLLGLFNDGYRVEELGANRLVLDWKSRR  486



>gb|ACI14609.1| mutant GRAS family protein [Pisum sativum]
Length=505

 Score =   453 bits (1166),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 233/344 (68%), Positives = 279/344 (81%), Gaps = 14/344 (4%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHA---KSFPASKDDHPH-GDALAAFQLLQDMSPYVKFGHF  169
             RLAAYFT+ALQ LL+GAG  H+   K +  +   H +  D LAAFQLLQDMSPYVKFGHF
Sbjct  161   RLAAYFTEALQGLLEGAGGAHSNNNKHYLTTNGPHDNQNDTLAAFQLLQDMSPYVKFGHF  220

Query  170   TANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsg  349
             TANQAILE+V H+RRVH++DYDIME +QWASL+QAL S  +   +PHLRITALSR G   
Sbjct  221   TANQAILESVAHERRVHVIDYDIMEEVQWASLIQALASSNN---SPHLRITALSRTGTGR  277

Query  350   rrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLP  529
             R    +VQETGRRLT+FAAS+GQPFSFH CRLDSDETF+PS+LKLVRGEA++ NCML+LP
Sbjct  278   RS-IATVQETGRRLTSFAASLGQPFSFHHCRLDSDETFRPSSLKLVRGEALVFNCMLNLP  336

Query  530   HFSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEA  709
             H SYR+PDS+ASFL+G+  LNP+LVTLVEEE      GGFV+RFMD+LHHYSA++DSLEA
Sbjct  337   HLSYRAPDSVASFLNGAKALNPKLVTLVEEENGSVV-GGFVERFMDSLHHYSAVFDSLEA  395

Query  710   GFPMQDQARTLVERVFLGPKISVAITRSYRC--RGEEYGWSWGEWVPENAGFRPKTISFA  883
             GFP+Q++AR LVERVF GP+I+ ++ R YR    GEE   SWGEW+   AGFR   +SFA
Sbjct  396   GFPVQNRARALVERVFFGPRIAGSLGRIYRTGGDGEEERRSWGEWLGA-AGFRGVPVSFA  454

Query  884   NRCQAKLLLGLFNDGYRIEEI--GNHKLILGWKSRRLLSASIWT  1009
             N CQAKLLLGLFNDGYR+EE+  G++KL+L WKSRRLLSAS+WT
Sbjct  455   NHCQAKLLLGLFNDGYRVEEVGLGSNKLVLDWKSRRLLSASVWT  498



>ref|XP_003527930.1| PREDICTED: nodulation-signaling pathway 2 protein-like [Glycine 
max]
Length=575

 Score =   451 bits (1160),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 243/356 (68%), Positives = 274/356 (77%), Gaps = 21/356 (6%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLH--------------AKSFPASKDDHPHGDALAAFQLLQD  139
             RLAAYFTDALQ LL+GAG  H                      D H   D LAAFQLLQD
Sbjct  226   RLAAYFTDALQGLLEGAGGAHNNNNKHHHHYITSCGPHHHHRDDHHHQNDTLAAFQLLQD  285

Query  140   MSPYVKFGHFTANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRI  319
             MSPYVKFGHFTANQAILEAV HDRRVHIVDYDIMEG+QWASL+QAL S + G P PHLRI
Sbjct  286   MSPYVKFGHFTANQAILEAVAHDRRVHIVDYDIMEGVQWASLIQALASNKTGPPGPHLRI  345

Query  320   TALsrgggsgrrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEA  499
             TALSR G   R    +VQETGRRL AFAAS+GQPFSFH CRL+ DETFKPS+LKLVRGEA
Sbjct  346   TALSRTGSGRRS-IATVQETGRRLAAFAASLGQPFSFHHCRLEPDETFKPSSLKLVRGEA  404

Query  500   IIVNCMLHLPHFSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHH  679
             ++ NCML+LPH SYR+P+S+ASFLSG+  L PRLVTLVEEE A    GGFV RFMD+LHH
Sbjct  405   LVFNCMLNLPHLSYRAPESVASFLSGAKALKPRLVTLVEEEVASIV-GGFVARFMDSLHH  463

Query  680   YSALYDSLEAGFPMQDQARTLVERVFLGPKISVAITRSYRCRGEEYGWSWGEWVPENAGF  859
             YSA++DSLEAGFPMQ +AR LVERVFLGP+I  ++ R      EE   SWGEW+   AGF
Sbjct  464   YSAVFDSLEAGFPMQGRARALVERVFLGPRIVGSLARMGE---EEERGSWGEWLGA-AGF  519

Query  860   RPKTISFANRCQAKLLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIWT-SVHSD  1024
             R   +SFAN CQAKLL+GLFNDGYR+EE+G++KL+L WKSRRLLSAS+WT S HSD
Sbjct  520   RGVPMSFANHCQAKLLIGLFNDGYRVEELGSNKLVLDWKSRRLLSASLWTSSSHSD  575



>ref|XP_003614758.1| Nodulation signaling pathway [Medicago truncatula]
 gb|AES97716.1| GRAS family transcription factor [Medicago truncatula]
Length=506

 Score =   447 bits (1150),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 229/347 (66%), Positives = 267/347 (77%), Gaps = 14/347 (4%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGA--GSLHAKSFPASKDDHPH-GDALAAFQLLQDMSPYVKFGHFT  172
             RLAAYFTDALQ LL+G   G  H           PH  D L+AFQLLQDMSPYVKF HFT
Sbjct  158   RLAAYFTDALQTLLNGTDCGGHHKLCLLTG----PHQTDILSAFQLLQDMSPYVKFAHFT  213

Query  173   ANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggs--  346
             ANQAILEAVTH+RRVHIVD+DIMEG QWASL+Q+L SR++GLP PHLRITALSR      
Sbjct  214   ANQAILEAVTHERRVHIVDFDIMEGAQWASLIQSLSSRKEGLPGPHLRITALSRNKERGN  273

Query  347   --grrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCML  520
                R SF +VQETGRRLT FAAS+GQPF+FHQCRL+SDE F+ S+LKLVRGEA++ NC++
Sbjct  274   GRSRSSFATVQETGRRLTTFAASVGQPFTFHQCRLESDERFRTSSLKLVRGEALVFNCVM  333

Query  521   HLPHFSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDS  700
             HLPH SYR+ DSIASFL+G+  L  +LVTLVEEE  P  D GFV  FMD+LH YSA+YDS
Sbjct  334   HLPHLSYRASDSIASFLNGAKELGTKLVTLVEEEVGPITDAGFVGLFMDSLHRYSAMYDS  393

Query  701   LEAGFPMQDQARTLVERVFLGPKISVAITRSYRCRGEEYG--WSWGEWVPENAGFRPKTI  874
              EAGFPM   AR+LVE+VFLGP+I  ++ + Y    EE     SWGEW+    GFR   I
Sbjct  394   FEAGFPMNKWARSLVEQVFLGPRIMGSVAQLYMTGEEEEQERGSWGEWLGVE-GFRGVNI  452

Query  875   SFANRCQAKLLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIWTSV  1015
             S+ N CQAKLLLGLFNDGYR+EE+GN+KL+LGWKSRRLLSAS+WT +
Sbjct  453   SYGNHCQAKLLLGLFNDGYRVEELGNNKLVLGWKSRRLLSASVWTCM  499



>ref|XP_007141073.1| hypothetical protein PHAVU_008G165200g [Phaseolus vulgaris]
 gb|ESW13067.1| hypothetical protein PHAVU_008G165200g [Phaseolus vulgaris]
Length=455

 Score =   431 bits (1107),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 227/338 (67%), Positives = 267/338 (79%), Gaps = 8/338 (2%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPH-GDALAAFQLLQDMSPYVKFGHFTAN  178
             RLAA+F+ ALQ LLDGAGS H  +     ++ P+  D L AF LLQDMSPYVKF HFTAN
Sbjct  123   RLAAHFSSALQNLLDGAGSSHTIT-----NNTPNPTDTLTAFHLLQDMSPYVKFAHFTAN  177

Query  179   QAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrs  358
             QAILEAV H++RVHIVD+D+ EG QWASLMQ+L SR  G P PHLRITALSRG  SGRRS
Sbjct  178   QAILEAVAHEKRVHIVDFDVTEGAQWASLMQSLSSRSTGPPGPHLRITALSRGSASGRRS  237

Query  359   FCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHFS  538
               +VQETGRRLTAFAAS+ QPFSFHQCRLD  ETF+PS LKL+RGEA++ NCMLHLPH S
Sbjct  238   IATVQETGRRLTAFAASVAQPFSFHQCRLDPGETFRPSLLKLIRGEALVFNCMLHLPHLS  297

Query  539   YRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGFP  718
             +R+  S+ASFL G+  LNPR+V +VEEE A   D GFV  FMD++ HYSA++DSLE GFP
Sbjct  298   FRASGSVASFLKGAKELNPRVVLVVEEEVARGGDAGFVGLFMDSVQHYSAVFDSLEVGFP  357

Query  719   MQDQARTLVERVFLGPKISVAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISFANRCQA  898
             MQ  AR LVERVFLGP+I+ ++   Y+   EE G SW EW+   AGFR   +SFAN CQA
Sbjct  358   MQKWARALVERVFLGPRIANSVGLMYQSGEEERG-SWEEWLGA-AGFRGVPVSFANHCQA  415

Query  899   KLLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIWTS  1012
              LLLGLFNDGYR+EE+GN+KL+LGWKSRRL+SAS+WTS
Sbjct  416   NLLLGLFNDGYRVEELGNNKLVLGWKSRRLISASVWTS  453



>dbj|BAE72690.1| transcription initiator for nodulation [Lotus japonicus]
 dbj|BAE72691.1| transcription initiator for nodulation [Lotus japonicus]
 gb|ABG49438.1| nodulation signaling pathway 2 [Lotus japonicus]
Length=499

 Score =   429 bits (1104),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 225/341 (66%), Positives = 265/341 (78%), Gaps = 11/341 (3%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKS----FPASKDDHPHGDALAAFQLLQDMSPYVKFGHF  169
             RLAAYFT+ALQ LL+GAG  +  S            P  DALAAFQLLQDMSPYVKFGHF
Sbjct  157   RLAAYFTEALQGLLEGAGGAYNSSSKHHVIGGPHHEPQNDALAAFQLLQDMSPYVKFGHF  216

Query  170   TANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsg  349
             TANQAI+EAV H+RRVHIVDYDIMEG+QWASLMQAL S  +G   PHLRITALSR G   
Sbjct  217   TANQAIVEAVAHERRVHIVDYDIMEGVQWASLMQALASNPNG---PHLRITALSRSGVGR  273

Query  350   rrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLP  529
             R    +VQETGRRLTAFA S+GQPFSFH  RL+SDETF+P+ LKLVRGEA++ NCML+LP
Sbjct  274   RS-MATVQETGRRLTAFATSLGQPFSFHHSRLESDETFRPAGLKLVRGEALVFNCMLNLP  332

Query  530   HFSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEA  709
             H +YRSP+S+ASFL+ +  L PRLVT+VEEE      GGFV+RFMD+LHH+SA++DSLEA
Sbjct  333   HLTYRSPNSVASFLTAAKALRPRLVTVVEEEVGSAL-GGFVERFMDSLHHFSAVFDSLEA  391

Query  710   GFPMQDQARTLVERVFLGPKISVAITRSY-RCRGEEYGWSWGEWVPENAGFRPKTISFAN  886
             GFPMQ +AR LVERVFLGP+I  ++ R Y    G E   SW EW+   AGF    +S AN
Sbjct  392   GFPMQGRARALVERVFLGPRIVGSLARIYRTGGGGEERGSWREWL-RAAGFSGVAVSSAN  450

Query  887   RCQAKLLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIWT  1009
              CQ+ LLLGLFNDGYR+EE+G++KL+L WK+RRLLSAS+WT
Sbjct  451   HCQSNLLLGLFNDGYRVEELGSNKLVLHWKTRRLLSASLWT  491



>ref|XP_003543792.1| PREDICTED: nodulation-signaling pathway 2 protein-like [Glycine 
max]
Length=472

 Score =   419 bits (1077),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 222/346 (64%), Positives = 257/346 (74%), Gaps = 22/346 (6%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTANQ  181
             RLAA+F+ AL +LL+G  S H           P  D L AFQLLQDMSPY+KF HFTANQ
Sbjct  138   RLAAHFSHALHSLLNGTASAHT----------PPIDTLTAFQLLQDMSPYIKFAHFTANQ  187

Query  182   AILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrsF  361
             AILEAV H++RVHI+DYDI EG QWASL+QAL S   G P PHLRITALSRGGG G  S 
Sbjct  188   AILEAVAHEKRVHIIDYDITEGAQWASLIQALSSA--GPPGPHLRITALSRGGGGGGNSS  245

Query  362   --------CSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCM  517
                      SVQETGRRLTAFAAS+GQPFSFH  RLD DETF+PS LKLVRGEA++ NCM
Sbjct  246   SASGQRSTASVQETGRRLTAFAASVGQPFSFHHSRLDPDETFRPSNLKLVRGEALVFNCM  305

Query  518   LHLPHFSYRSPDSIASFLSGSATLNPRLVTLVEEE-AAPPRDGGFVDRFMDTLHHYSALY  694
             LHLPH ++R+  S+ SFL G+  LN RLV LVEEE      D GFV  FMD+LHHYSA++
Sbjct  306   LHLPHLNFRASGSVGSFLRGAKELNSRLVVLVEEEMGCVAADSGFVGFFMDSLHHYSAVF  365

Query  695   DSLEAGFPMQDQARTLVERVFLGPKISVAITRSYRCRGEEYGWSWGEWVPENAGFRPKTI  874
             DSLE GFPMQ  AR LVE+VFLGP+I+ ++ R Y    EE   SWGEW+   AGFR   +
Sbjct  366   DSLEVGFPMQTWARALVEKVFLGPRITGSVARMYGSGTEEEKVSWGEWLGA-AGFRGVPL  424

Query  875   SFANRCQAKLLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIWTS  1012
             SFAN CQA LLLGLFNDGYR+EE+ N++L+LGWKSRRLLSAS+W+S
Sbjct  425   SFANHCQANLLLGLFNDGYRVEELENNRLVLGWKSRRLLSASVWSS  470



>ref|XP_004140976.1| PREDICTED: nodulation-signaling pathway 2 protein-like [Cucumis 
sativus]
 ref|XP_004164127.1| PREDICTED: nodulation-signaling pathway 2 protein-like [Cucumis 
sativus]
 gb|KGN45971.1| hypothetical protein Csa_6G040600 [Cucumis sativus]
Length=478

 Score =   417 bits (1072),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 221/340 (65%), Positives = 258/340 (76%), Gaps = 15/340 (4%)
 Frame = +2

Query  2    RLAAYFTDALQALLDGA----GSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHF  169
            RL AY+  A Q LLD A     + H       +DDH   D LAAFQLLQ+MSPYVKFGHF
Sbjct  126  RLTAYYAQAFQDLLDSAPVANKTHHHNHHIHQRDDHTPTDVLAAFQLLQEMSPYVKFGHF  185

Query  170  TANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsg  349
            TANQAILEAV  DRRVHIVDYDIMEGIQWASLMQA +S      APHLRITA+SRG    
Sbjct  186  TANQAILEAVAEDRRVHIVDYDIMEGIQWASLMQAFVSSPS---APHLRITAISRGANGR  242

Query  350  rrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLP  529
            R    +VQETGRRL AFAASIGQPFSFHQC+LDSDE+F+PS LKLV+GEA++VNCMLHLP
Sbjct  243  RS-IGTVQETGRRLVAFAASIGQPFSFHQCKLDSDESFRPSGLKLVKGEALVVNCMLHLP  301

Query  530  HFSYRSPDSIASFLSGSATLNPRLVTLVEEEA--APPRDGGFVDRFMDTLHHYSALYDSL  703
            HFSYRSP+SIASFLSG+ +L+PR+VTLVEEE    P  DG +  +F+D+L  YSA+YDSL
Sbjct  302  HFSYRSPESIASFLSGAKSLSPRIVTLVEEEIGHGPTIDGDYKVQFLDSLERYSAIYDSL  361

Query  704  EAGFPMQDQARTLVERVFLGPKISVAITRSYRCRGE----EYGWSWGEWVPENAGFRPKT  871
            EA  PM+++AR LVERVFLGP+IS  + R  + R      E    WGE + E  G +   
Sbjct  362  EAVIPMKNRARALVERVFLGPRISATLRRIGQRRWSTAEMEDNCLWGEKL-EKMGLKTVK  420

Query  872  ISFANRCQAKLLLGLFNDGYRIEEIGNHKLILGWKSRRLL  991
            ISFAN CQA+LLLGLFNDGYR+EE+GN+KL+LGWKS+RLL
Sbjct  421  ISFANHCQARLLLGLFNDGYRVEELGNNKLVLGWKSKRLL  460



>ref|XP_008445682.1| PREDICTED: nodulation-signaling pathway 2 protein [Cucumis melo]
Length=481

 Score =   417 bits (1071),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 224/345 (65%), Positives = 261/345 (76%), Gaps = 15/345 (4%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGA----GSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHF  169
             RL AY+  A Q LLD A     + H       +DDH   D LAAFQLLQ+MSPYVKFGHF
Sbjct  126   RLTAYYAQAFQDLLDSAPVSNKTHHHNHHIHHRDDHTPTDVLAAFQLLQEMSPYVKFGHF  185

Query  170   TANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsg  349
             TANQAILEAV  DRRVHIVDYDIMEGIQWASLMQA +S      APHLRITA+SRG    
Sbjct  186   TANQAILEAVAEDRRVHIVDYDIMEGIQWASLMQAFVSSPS---APHLRITAISRGANGR  242

Query  350   rrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLP  529
             R    +VQETGRRL AFAASIGQPFSFHQC+LDSDE+F+PS LKLV+GEA++VNCMLHLP
Sbjct  243   RS-IGTVQETGRRLVAFAASIGQPFSFHQCKLDSDESFRPSGLKLVKGEALVVNCMLHLP  301

Query  530   HFSYRSPDSIASFLSGSATLNPRLVTLVEEEA--APPRDGGFVDRFMDTLHHYSALYDSL  703
             HFSYRSP+SIASFLSG+ +L+PR+VTLVEEE    P  DG +  +F+D+L  YSA+YDSL
Sbjct  302   HFSYRSPESIASFLSGAKSLSPRIVTLVEEEIGHGPTIDGDYKVQFLDSLERYSAIYDSL  361

Query  704   EAGFPMQDQARTLVERVFLGPKISVAI----TRSYRCRGEEYGWSWGEWVPENAGFRPKT  871
             EA  PM+++AR LVERVFLGP+IS  +     R +     E    WGE + E  G +   
Sbjct  362   EAVIPMKNRARALVERVFLGPRISATLRRIGQRRWSTAAMEENCLWGEKL-EKMGLKTVK  420

Query  872   ISFANRCQAKLLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIW  1006
             ISFAN CQA+LLLGLFNDGYR+EE+GN+KL+LGWKS+RLLS SIW
Sbjct  421   ISFANHCQARLLLGLFNDGYRVEELGNNKLVLGWKSKRLLSVSIW  465



>ref|XP_010064996.1| PREDICTED: nodulation-signaling pathway 2 protein-like [Eucalyptus 
grandis]
Length=508

 Score =   409 bits (1052),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 225/355 (63%), Positives = 267/355 (75%), Gaps = 20/355 (6%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPH--------GDALAAFQLLQDMSPYVK  157
             RLAA+FTDALQ LL+GAG++       S    PH         D L AFQLLQDMSPYVK
Sbjct  148   RLAAHFTDALQGLLEGAGAVAQGGGKHSIGGRPHRLEGGYNQTDVLVAFQLLQDMSPYVK  207

Query  158   FGHFTANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrg  337
             FGHFTANQAILEAV  +RRVH+VDYDIMEG+QWASLMQAL+S+  G PAPHLRITA+SR 
Sbjct  208   FGHFTANQAILEAVGRERRVHVVDYDIMEGVQWASLMQALVSQDGGRPAPHLRITAVSRA  267

Query  338   ggsgrrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCM  517
                 R    +VQETGRRL A+A S+GQPFSFHQ R+D DETF+P+ALKLV+GEA+  NCM
Sbjct  268   CSGRRS-ITTVQETGRRLAAYAKSVGQPFSFHQYRMDPDETFRPAALKLVQGEALFFNCM  326

Query  518   LHLPHFSYRSPDSIASFLSGSATLNPRLVTLV-EEEAAPPRDGGFVDRFMDTLHHYSALY  694
             LHLPH +Y +P SIASFLSG+  L+P LVTLV EE       GGF+ RFMD+LHHYSA+Y
Sbjct  327   LHLPHSTYHTPASIASFLSGARALSPTLVTLVEEEAGPAGGGGGFMGRFMDSLHHYSAVY  386

Query  695   DSLEAGFPMQDQARTLVERVFLGPKISVAITRSYRCR---------GEEYGWSWGEWVPE  847
             DSLEAGFPM D AR LVE+VFLGP+I+ ++ R YR R         G   G SWGEW+  
Sbjct  387   DSLEAGFPMPDWARALVEKVFLGPRIAGSLVRMYRGRPGEEEEEEEGSGKGGSWGEWLVA  446

Query  848   NAGFRPKTISFANRCQAKLLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIWTS  1012
               GF+P  +S +N CQAKLL+GLF+DGYR+EE+  ++L+LGWKSRRLLSASIWT+
Sbjct  447   E-GFKPGRVSSSNHCQAKLLVGLFDDGYRVEEVAGNRLVLGWKSRRLLSASIWTA  500



>ref|XP_006846636.1| hypothetical protein AMTR_s00156p00061400 [Amborella trichopoda]
 gb|ERN08311.1| hypothetical protein AMTR_s00156p00061400 [Amborella trichopoda]
Length=503

 Score =   399 bits (1025),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 208/336 (62%), Positives = 259/336 (77%), Gaps = 12/336 (4%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTANQ  181
             RLAAYFT+ LQ LL+G G       P S  D P  D + AFQLLQDMSP +KF HFTANQ
Sbjct  167   RLAAYFTEGLQCLLEGHGPK-----PGSWPD-PQADLMGAFQLLQDMSPCIKFAHFTANQ  220

Query  182   AILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDG-LPAPHLRITALsrgggsgrrs  358
             AILEAVT +RRVH++D+DI+EG QWASLMQAL SR  G  P PHLRITA++RGG SGRR+
Sbjct  221   AILEAVTSERRVHVLDFDIIEGAQWASLMQALSSRTQGQAPVPHLRITAVTRGGQSGRRA  280

Query  359   FCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHFS  538
               +VQETGRRL AFAASIGQPFSFHQCRLD DE F+P A+KLV+GEA++ NC+LHLPH +
Sbjct  281   LATVQETGRRLVAFAASIGQPFSFHQCRLDPDEKFRPDAVKLVKGEALVANCVLHLPHST  340

Query  539   YRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGFP  718
             YR+P S+ASFL+G+  L P++VTLVEEE     + GF  RFM+ LHHYSA+YDSLEA FP
Sbjct  341   YRTPGSVASFLNGAKELGPKVVTLVEEEMMSSTE-GFEARFMELLHHYSAVYDSLEASFP  399

Query  719   MQDQARTLVERVFLGPKISVAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISFANRCQA  898
              Q +AR +VERVFLGP+I+ ++   ++  G   G SW EW+  + GF+P  ++F N CQA
Sbjct  400   QQGRARAMVERVFLGPRIAASLAYHHQQHGR--GGSWAEWMG-SVGFKPLPVTFFNHCQA  456

Query  899   KLLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIW  1006
             KLL+GLF+DG+R+EE    +L+LGW SR+L+SAS+W
Sbjct  457   KLLVGLFSDGFRVEE-ARSRLVLGWGSRQLVSASVW  491



>ref|XP_010544534.1| PREDICTED: scarecrow-like protein 26 isoform X1 [Tarenaya hassleriana]
 ref|XP_010544542.1| PREDICTED: scarecrow-like protein 26 isoform X2 [Tarenaya hassleriana]
Length=554

 Score =   393 bits (1010),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 198/344 (58%), Positives = 247/344 (72%), Gaps = 9/344 (3%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDH----PHGDALAAFQLLQDMSPYVKFGHF  169
             RLA +FTD L +LL+ A +   +        H     H D +AAFQL QDMSPYV FG+ 
Sbjct  208   RLAFHFTDGLSSLLERATNTVKRRQGGGSHLHREVRDHVDVVAAFQLFQDMSPYVNFGYL  267

Query  170   TANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsg  349
             TANQAILEAV ++RR+HIVDYDIMEG+QW+S MQAL++R+ G P  HLR+TALS+     
Sbjct  268   TANQAILEAVGYERRIHIVDYDIMEGVQWSSFMQALVTRKAGPPVQHLRVTALSQAINGR  327

Query  350   rrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLP  529
             +    +VQE GRRL +FA S+GQPFSFH C+LDSDETF  S+LKLVRGEA+++NCMLHLP
Sbjct  328   KS-VAAVQEAGRRLASFAESVGQPFSFHHCKLDSDETFNSSSLKLVRGEALVINCMLHLP  386

Query  530   HFSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEA  709
              FSY++P+S+ SFLS + TLNP+LVTLV EE     D GF  RFMD LH +SA++DSLEA
Sbjct  387   RFSYQTPNSLVSFLSETKTLNPKLVTLVHEEVGMSVDQGFTTRFMDLLHQFSAIFDSLEA  446

Query  710   GFPMQDQARTLVERVFLGPKISVAITR---SYRCRGEEYGWSWGEWVPENAGFRPKTISF  880
             GFP+ + AR  VER FLGP IS  +TR   +      E   SW  W+  N GF P  +SF
Sbjct  447   GFPVANPARGFVERAFLGPWISAWLTRIAAATENSEVESFLSWSRWLETN-GFNPVDVSF  505

Query  881   ANRCQAKLLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIWTS  1012
              N CQAKLLL LF+DGY++EE+G + ++LGWKSRRL+SAS W S
Sbjct  506   TNCCQAKLLLSLFSDGYKVEELGRNGIVLGWKSRRLVSASFWAS  549



>gb|KHN33871.1| Nodulation-signaling pathway 2 protein [Glycine soja]
Length=299

 Score =   382 bits (982),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 199/300 (66%), Positives = 231/300 (77%), Gaps = 12/300 (4%)
 Frame = +2

Query  140   MSPYVKFGHFTANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRI  319
             MSPY+KF HFTANQAILEAV H++RVHI+DYDI EG QWASL+QAL S   G P PHLRI
Sbjct  1     MSPYIKFAHFTANQAILEAVAHEKRVHIIDYDITEGAQWASLIQALSS--AGPPGPHLRI  58

Query  320   TALsrgggsgrrsF--------CSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSA  475
             TALSRGGG G  S          SVQETGRRLTAFAAS+GQPFSFH  RLD DETF+PS 
Sbjct  59    TALSRGGGGGGNSSSASGQRSTASVQETGRRLTAFAASVGQPFSFHHSRLDPDETFRPSN  118

Query  476   LKLVRGEAIIVNCMLHLPHFSYRSPDSIASFLSGSATLNPRLVTLVEEE-AAPPRDGGFV  652
             LKLVRGEA++ NCMLHLPH ++R+  S+ SFL G+  LN RLV LVEEE      D GFV
Sbjct  119   LKLVRGEALVFNCMLHLPHLNFRASGSVGSFLRGAKELNSRLVVLVEEEMGCVAADSGFV  178

Query  653   DRFMDTLHHYSALYDSLEAGFPMQDQARTLVERVFLGPKISVAITRSYRCRGEEYGWSWG  832
               FMD+L+HYSA++DSLE GFPMQ  AR LVE+VFLGP+I+ ++ R Y    EE   SWG
Sbjct  179   GFFMDSLYHYSAVFDSLEVGFPMQTWARALVEKVFLGPRITGSVARMYGSGTEEEKVSWG  238

Query  833   EWVPENAGFRPKTISFANRCQAKLLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIWTS  1012
             EW+   AGFR   +SFAN CQA LLLGLFNDGYR+EE+ N++L+LGWKSRRLLSAS+W+S
Sbjct  239   EWLGA-AGFRGVPLSFANHCQANLLLGLFNDGYRVEELENNRLVLGWKSRRLLSASVWSS  297



>ref|XP_008808173.1| PREDICTED: LOW QUALITY PROTEIN: nodulation-signaling pathway 
2 protein-like [Phoenix dactylifera]
Length=516

 Score =   387 bits (995),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 210/339 (62%), Positives = 252/339 (74%), Gaps = 13/339 (4%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTANQ  181
             RLAAYFT+ALQ LLDG+ +       AS  D   GD LAAFQLLQDMSP  KFGHFTANQ
Sbjct  158   RLAAYFTNALQGLLDGSSATACSRQSASHLDGQVGDVLAAFQLLQDMSPCEKFGHFTANQ  217

Query  182   AILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrsF  361
             AILEAV  DRRVHIVDYDI EG+QWASLMQAL+SR+DG P PHLRITA+++     R   
Sbjct  218   AILEAVARDRRVHIVDYDIAEGVQWASLMQALVSRKDGPPPPHLRITAVTQRVSGTR---  274

Query  362   CSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPH---  532
              +VQETGRRL AFAAS+GQPFSF QCRL++DE F+P+ +K+V+GEA+++NC+L  PH   
Sbjct  275   -AVQETGRRLAAFAASLGQPFSFGQCRLEADERFRPAGVKVVKGEAVVLNCVLQPPHAAG  333

Query  533   -FSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEA  709
               + R   S+ASFLSG+ATL  R+V +VEEE     DG FV RFM  LH YSA++DSLEA
Sbjct  334   AATTRGAGSVASFLSGAATLGARVVAVVEEEGV-AEDGNFVGRFMGELHRYSAVWDSLEA  392

Query  710   GFPMQDQARTLVERVFLGPKISVAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISFANR  889
             GFPMQ +AR LVER+ LGP+I+ A+ R+YR  GE     WGEW+    G     IS  N 
Sbjct  393   GFPMQGRARGLVERLILGPRIAGAVRRAYRATGEG---GWGEWMARR-GLEXVGISCFNH  448

Query  890   CQAKLLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIW  1006
             CQA+LLLGLF+DGY++EE G +KL+ GWKSRRL SASIW
Sbjct  449   CQARLLLGLFSDGYQVEEDGPNKLVXGWKSRRLTSASIW  487



>ref|NP_192565.1| scarecrow-like protein 26 [Arabidopsis thaliana]
 sp|Q9SUF5.1|SCL26_ARATH RecName: Full=Scarecrow-like protein 26; Short=AtSCL26; AltName: 
Full=GRAS family protein 23; Short=AtGRAS-23 [Arabidopsis 
thaliana]
 emb|CAB45795.1| putative protein [Arabidopsis thaliana]
 emb|CAB81161.1| putative protein [Arabidopsis thaliana]
 gb|AEE82614.1| scarecrow-like protein 26 [Arabidopsis thaliana]
Length=483

 Score =   380 bits (975),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 195/343 (57%), Positives = 250/343 (73%), Gaps = 8/343 (2%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDD-HPHGDALAAFQLLQDMSPYVKFGHFTAN  178
             RLAA+FT+ L  LL+    L  +     +DD +   D ++AF+LLQ+MSPYV FG+ TA 
Sbjct  146   RLAAHFTNGLSKLLERDSVLCPQQH---RDDVYDQADVISAFELLQNMSPYVNFGYLTAT  202

Query  179   QAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrs  358
             QAILEAV ++RR+HIVDYDI EG+QWASLMQAL+SR  G  A HLRITALSR     +  
Sbjct  203   QAILEAVKYERRIHIVDYDINEGVQWASLMQALVSRNTGPSAQHLRITALSRATNGKKS-  261

Query  359   FCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHFS  538
               +VQETGRRLTAFA SIGQPFS+  C+LD++  F  S+LKLVRGEA+++NCMLHLP FS
Sbjct  262   VAAVQETGRRLTAFADSIGQPFSYQHCKLDTN-AFSTSSLKLVRGEAVVINCMLHLPRFS  320

Query  539   YRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGFP  718
             +++P S+ SFLS + TLNP+LVTLV EE     + GF+ RFMD LH +SA++DSLEAG  
Sbjct  321   HQTPSSVISFLSEAKTLNPKLVTLVHEEVGLMGNQGFLYRFMDLLHQFSAIFDSLEAGLS  380

Query  719   MQDQARTLVERVFLGPKISVAITRSYRCRGE-EYGWSWGEWVPENAGFRPKTISFANRCQ  895
             + + AR  VERVF+GP ++  +TR      E E   SW +W+  N GF+P  +SF NRCQ
Sbjct  381   IANPARGFVERVFIGPWVANWLTRITANDAEVESFASWPQWLETN-GFKPLEVSFTNRCQ  439

Query  896   AKLLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIWTSVHSD  1024
             AKLLL LFNDG+R+EE+G + L+LGWKSRRL+SAS W S  ++
Sbjct  440   AKLLLSLFNDGFRVEELGQNGLVLGWKSRRLVSASFWASCQTN  482



>ref|XP_010438468.1| PREDICTED: scarecrow-like protein 26 [Camelina sativa]
Length=483

 Score =   379 bits (974),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 195/342 (57%), Positives = 244/342 (71%), Gaps = 6/342 (2%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTANQ  181
             RLAA+FTD L  LL+    L         D +   D ++AFQ+LQ+MSPYV FG+ T  Q
Sbjct  146   RLAAHFTDGLSKLLERDNVLRPNQHRG--DVYDQADVISAFQMLQNMSPYVNFGYLTTTQ  203

Query  182   AILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrsF  361
             AILE+V ++RR+HIVDYDI EGIQW SLMQAL+SR  G  A HLRITALSR     +   
Sbjct  204   AILESVKYERRIHIVDYDIAEGIQWPSLMQALLSRNTGTSAQHLRITALSRATNGKKS-V  262

Query  362   CSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHFSY  541
             C+VQE GRRLTAFA SIGQPFSFH C+L++D  FK S+LKLVRGEA+++NCMLHLP FS+
Sbjct  263   CAVQEAGRRLTAFAESIGQPFSFHHCKLEND-AFKSSSLKLVRGEAVVINCMLHLPRFSH  321

Query  542   RSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGFPM  721
             ++P+S+ SFL  + TLNP+LVTLV EE     +  F+ RFMD LH +SA++DSLEAG  +
Sbjct  322   KTPNSVISFLLEARTLNPKLVTLVHEEVGLMGNQCFLYRFMDLLHQFSAIFDSLEAGLSI  381

Query  722   QDQARTLVERVFLGPKISVAITRSYRCRGE-EYGWSWGEWVPENAGFRPKTISFANRCQA  898
              + AR  VERVF+GP ++  +TR      E E   SW +W+  N GF    +SFANRCQA
Sbjct  382   TNPARGFVERVFIGPWVANWLTRITADDSEVESFASWPQWLETN-GFEAMEVSFANRCQA  440

Query  899   KLLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIWTSVHSD  1024
             KLLL LFNDGY +EE+G + L+LGWKSRRL+SAS W S  S+
Sbjct  441   KLLLSLFNDGYSVEELGRNGLVLGWKSRRLMSASFWASHESN  482



>ref|XP_006290057.1| hypothetical protein CARUB_v10003692mg [Capsella rubella]
 gb|EOA22955.1| hypothetical protein CARUB_v10003692mg [Capsella rubella]
Length=483

 Score =   379 bits (972),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 194/343 (57%), Positives = 248/343 (72%), Gaps = 8/343 (2%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDD-HPHGDALAAFQLLQDMSPYVKFGHFTAN  178
             RLAA+FT+ L  LL+    L        +DD +   D ++AF++LQ+MSPYV FG+ T  
Sbjct  146   RLAAHFTNGLSKLLERDNVLRPNQH---RDDVYDQADVISAFEMLQNMSPYVNFGYLTTT  202

Query  179   QAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrs  358
             QAILE+V ++RR+HIVDYDI EG+QWASLMQAL+SR  G  A HLRITALSR     +  
Sbjct  203   QAILESVKYERRIHIVDYDIAEGVQWASLMQALLSRNTGTSAQHLRITALSRATNGKKS-  261

Query  359   FCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHFS  538
               SVQE GRRLT FA SIGQPFSFH C+L++D  F  S+LKLVRGEA+++NCMLHLP FS
Sbjct  262   VASVQEAGRRLTTFAESIGQPFSFHHCKLEND-AFNTSSLKLVRGEAMVINCMLHLPRFS  320

Query  539   YRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGFP  718
             +++P+S+ SFL  + TLNP+LVTLV EE     + GF++RFMD LH +SA++DSLEAG  
Sbjct  321   HQTPNSVISFLLEAKTLNPKLVTLVHEEVGLMGNQGFLNRFMDLLHQFSAIFDSLEAGLS  380

Query  719   MQDQARTLVERVFLGPKISVAITRSYRCRGE-EYGWSWGEWVPENAGFRPKTISFANRCQ  895
             + + AR  VERVF+GP ++  + R      E E   SW +W+  N GF P  +SFANRCQ
Sbjct  381   ITNPARGFVERVFIGPWVANWLKRITADDTEVESFASWPQWLETN-GFEPMEVSFANRCQ  439

Query  896   AKLLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIWTSVHSD  1024
             AKLLL LFNDGYR+EE+G++ L+LGWKSRRL+SAS W S  S+
Sbjct  440   AKLLLSLFNDGYRVEELGHNGLVLGWKSRRLVSASFWASHDSN  482



>ref|XP_010916821.1| PREDICTED: LOW QUALITY PROTEIN: nodulation-signaling pathway 
2 protein-like [Elaeis guineensis]
Length=548

 Score =   380 bits (977),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 215/342 (63%), Positives = 251/342 (73%), Gaps = 14/342 (4%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSF--PASKDDHPHGDALAAFQLLQDMSPYVKFGHFTA  175
             RLAAYF DALQ LLDG+ +         AS  D   GD LAAFQLLQDMSPY KFGHFTA
Sbjct  187   RLAAYFADALQGLLDGSSASAGAGGRQSASHRDDQTGDVLAAFQLLQDMSPYAKFGHFTA  246

Query  176   NQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrr  355
             NQAILEAV  DRRVHIVDYDI EG+QWASLMQAL+S++DG P PHLRITA+++GG   R 
Sbjct  247   NQAILEAVADDRRVHIVDYDIAEGVQWASLMQALVSQKDGPPPPHLRITAVTQGGSGTR-  305

Query  356   sFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLP--  529
                +VQETGRRL AFAAS+GQPFSF QCRLD+DE F+P+ +K+V+GEA++VNC+L LP  
Sbjct  306   ---AVQETGRRLAAFAASLGQPFSFGQCRLDTDERFRPAGVKVVKGEAVVVNCVLQLPPH  362

Query  530   --HFSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSL  703
                 + R  +S+ASFLSG+ATL  R+V +VEEE      G FV RFMD LH YSA++DSL
Sbjct  363   AARATTRGAESVASFLSGAATLGARVVAVVEEEGVEEEXGDFVGRFMDELHRYSAVWDSL  422

Query  704   EAGFPMQDQARTLVERVFLGPKISVAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISFA  883
             EAGFPMQ  AR LVERV LGP I+ A+ R+YR  GE              GF    IS  
Sbjct  423   EAGFPMQGWARGLVERVILGPMIAGAVRRAYRATGEGGWGE----WMGRMGFGRVGISCF  478

Query  884   NRCQAKLLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIWT  1009
             N CQA+LLLGLFNDGYR+EE G +KL+LGWKSRRL SASIW+
Sbjct  479   NHCQARLLLGLFNDGYRVEEDGLNKLVLGWKSRRLTSASIWS  520



>ref|XP_002872385.1| scarecrow transcription factor family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH48644.1| scarecrow transcription factor family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=483

 Score =   378 bits (970),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 195/343 (57%), Positives = 249/343 (73%), Gaps = 8/343 (2%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDD-HPHGDALAAFQLLQDMSPYVKFGHFTAN  178
             RLAA+FT+ L  L +    L  +     +DD +   D ++AF+LLQ+MSPYV FG+ TA 
Sbjct  146   RLAAHFTNGLSKLFERDIVLRPQQH---RDDVYDQADVISAFELLQNMSPYVNFGYLTAT  202

Query  179   QAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrs  358
             QAILEAV ++RR+HIVDYDI EG+QWASLMQAL+S+  G  A HLRITALSR     +  
Sbjct  203   QAILEAVKYERRIHIVDYDITEGVQWASLMQALVSKNTGPSAQHLRITALSRATNGKKS-  261

Query  359   FCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHFS  538
               +VQETGRRLTAFA SIGQPFS+H C+LD++  F  S+LKLVRGEA+++NCMLHLP F 
Sbjct  262   IAAVQETGRRLTAFAESIGQPFSYHHCKLDTN-AFSTSSLKLVRGEAVVINCMLHLPRFR  320

Query  539   YRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGFP  718
              ++P+S+ SFLS + TLNP+LVTLV EE     + GF+ RFMD LH +SA++DSLEAG  
Sbjct  321   NQTPNSVISFLSEAKTLNPKLVTLVHEEVGLMGNQGFLYRFMDLLHQFSAIFDSLEAGLS  380

Query  719   MQDQARTLVERVFLGPKISVAITRSYRCRGE-EYGWSWGEWVPENAGFRPKTISFANRCQ  895
             + + AR  VERVF+GP ++  +TR      E E   SW +W+  N GF+P  +SFANRCQ
Sbjct  381   IANPARGYVERVFIGPWVANWLTRITADDAEVESLASWPQWLETN-GFKPMEVSFANRCQ  439

Query  896   AKLLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIWTSVHSD  1024
             AKLLL LFNDGY +EE+G + L+LGWKSRRL+SAS W S  S+
Sbjct  440   AKLLLSLFNDGYIVEELGQNGLVLGWKSRRLVSASFWASHESN  482



>ref|XP_002468140.1| hypothetical protein SORBIDRAFT_01g040270 [Sorghum bicolor]
 gb|EER95138.1| hypothetical protein SORBIDRAFT_01g040270 [Sorghum bicolor]
Length=564

 Score =   379 bits (973),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 207/351 (59%), Positives = 255/351 (73%), Gaps = 21/351 (6%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGA---GSLHAKSFPASKDDH-PH-GDALAAFQLLQDMSPYVKFGH  166
             RLA +FTDALQ LLDG+   G +  ++  A+   H PH GD L AFQ+LQDMSPY+KFGH
Sbjct  171   RLATHFTDALQGLLDGSHPIGGVGRQAAAAASHGHLPHTGDVLTAFQMLQDMSPYMKFGH  230

Query  167   FTANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggs  346
             FTANQAILEAV  DRRVH+VDYDI EG+QWASLMQA+ SR DG+P PHLRITA+SRGGG 
Sbjct  231   FTANQAILEAVAGDRRVHVVDYDIAEGVQWASLMQAMTSRPDGVPPPHLRITAVSRGGGG  290

Query  347   grrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHL  526
             G R   +VQE GRRL AFAASIGQPFSF QCRLDSDE F+P+ +++V+GE ++ NC+L+ 
Sbjct  291   GAR---AVQEAGRRLAAFAASIGQPFSFGQCRLDSDERFRPATVRMVKGETLVANCVLNQ  347

Query  527   PHFSY---RSPDSIASFLSGSATLNPRLVTLVEEEAAPPRD-----GGFVDRFMDTLHHY  682
                +    R   S+ASFL+G ATL  ++VT+VEE+           GGFV RFM+ LH Y
Sbjct  348   AAATTTVRRPTGSVASFLAGMATLGAKVVTVVEEDQGDAEKDDEEVGGFVARFMEELHRY  407

Query  683   SALYDSLEAGFPMQDQARTLVERVFLGPKISVAITRSYRCR---GEEYGWSWGEWVPENA  853
             SA++DSLEAGFP Q + R LVER  L P I+ A++R+YR     GE     WGEW+  N 
Sbjct  408   SAVWDSLEAGFPTQSRVRGLVERAILAPNIAGAVSRAYRASDGDGEARA-GWGEWMRGN-  465

Query  854   GFRPKTISFANRCQAKLLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIW  1006
             GFR   +S  N  QA+LLLGLFNDGY +EE   +K++LGWK+RRLLSAS+W
Sbjct  466   GFRAVPLSCFNHSQARLLLGLFNDGYTMEETSPNKIVLGWKARRLLSASVW  516



>gb|EAY89342.1| hypothetical protein OsI_10846 [Oryza sativa Indica Group]
Length=579

 Score =   379 bits (974),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 208/355 (59%), Positives = 255/355 (72%), Gaps = 24/355 (7%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSL--HAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTA  175
             RLAA+FTDALQ LLDG+  +    +   A+   H  GD L AFQ+LQDMSPY+KFGHFTA
Sbjct  179   RLAAHFTDALQGLLDGSHPVGGSGRQAAAAASHHHAGDVLTAFQMLQDMSPYMKFGHFTA  238

Query  176   NQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrr  355
             NQAILEAV+ DRRVHIVDYDI EGIQWASLMQA+ SR DG+PAPHLRITA+SR GG G R
Sbjct  239   NQAILEAVSGDRRVHIVDYDIAEGIQWASLMQAMTSRADGVPAPHLRITAVSRSGGGGAR  298

Query  356   sFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHF  535
                +VQE GRRL+AFAASIGQPFSF QCRLDSDE F+P+ +++V+GEA++ NC+LH    
Sbjct  299   ---AVQEAGRRLSAFAASIGQPFSFGQCRLDSDERFRPATVRMVKGEALVANCVLHQAAA  355

Query  536   SY---RSPDSIASFLSGSATLNPRLVTLVEEEAAPPR---------------DGGFVDRF  661
             +    R   S+ASFLSG A L  +LVT+VEEE    +                GGFV RF
Sbjct  356   TTTIRRPTGSVASFLSGMAALGAKLVTVVEEEGEAEKDDDGDSAGDAAAAAAAGGFVRRF  415

Query  662   MDTLHHYSALYDSLEAGFPMQDQARTLVERVFLGPKISVAITRSYRCRGEEYGWSWGEWV  841
             M+ LH YSA++DSLEAGFP Q + R LVERV L P I+ A++R+YR    E    WG+W+
Sbjct  416   MEELHRYSAVWDSLEAGFPTQSRVRGLVERVILAPNIAGAVSRAYRGVDGEGRCGWGQWM  475

Query  842   PENAGFRPKTISFANRCQAKLLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIW  1006
                +GF    +S  N  QA+LLLGLFNDGY +EE G +K++LGWK+RRL+SAS+W
Sbjct  476   -RGSGFTAVPLSCFNHSQARLLLGLFNDGYTVEETGPNKIVLGWKARRLMSASVW  529



>gb|AAP06856.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|ABF95108.1| GRAS family transcription factor containing protein [Oryza sativa 
Japonica Group]
Length=575

 Score =   379 bits (972),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 207/351 (59%), Positives = 255/351 (73%), Gaps = 20/351 (6%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSL--HAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTA  175
             RLAA+FTDALQ LLDG+  +    +   A+   H  GD L AFQ+LQDMSPY+KFGHFTA
Sbjct  179   RLAAHFTDALQGLLDGSHPVGGSGRQAAAAASHHHAGDVLTAFQMLQDMSPYMKFGHFTA  238

Query  176   NQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrr  355
             NQAILEAV+ DRRVHIVDYDI EGIQWASLMQA+ SR DG+PAPHLRITA+SR GG G R
Sbjct  239   NQAILEAVSGDRRVHIVDYDIAEGIQWASLMQAMTSRADGVPAPHLRITAVSRSGGGGAR  298

Query  356   sFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHF  535
                +VQE GRRL+AFAASIGQPFSF QCRLDSDE F+P+ +++V+GEA++ NC+LH    
Sbjct  299   ---AVQEAGRRLSAFAASIGQPFSFGQCRLDSDERFRPATVRMVKGEALVANCVLHQAAA  355

Query  536   SY---RSPDSIASFLSGSATLNPRLVTLVEEEAAPPR-----------DGGFVDRFMDTL  673
             +    R   S+ASFLSG A L  +LVT+VEEE    +            GGFV +FM+ L
Sbjct  356   TTTIRRPTGSVASFLSGMAALGAKLVTVVEEEGEAEKDDDGDSAGDAAAGGFVRQFMEEL  415

Query  674   HHYSALYDSLEAGFPMQDQARTLVERVFLGPKISVAITRSYRCRGEEYGWSWGEWVPENA  853
             H YSA++DSLEAGFP Q + R LVERV L P I+ A++R+YR    E    WG+W+   +
Sbjct  416   HRYSAVWDSLEAGFPTQSRVRGLVERVILAPNIAGAVSRAYRGVDGEGRCGWGQWM-RGS  474

Query  854   GFRPKTISFANRCQAKLLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIW  1006
             GF    +S  N  QA+LLLGLFNDGY +EE G +K++LGWK+RRL+SAS+W
Sbjct  475   GFTAVPLSCFNHSQARLLLGLFNDGYTVEETGPNKIVLGWKARRLMSASVW  525



>gb|AFP97600.1| nodulation signaling pathway 2-like protein [Crambe hispanica 
subsp. abyssinica]
Length=477

 Score =   374 bits (960),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 196/340 (58%), Positives = 239/340 (70%), Gaps = 8/340 (2%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTANQ  181
             RLAA+FT+ L  L   A            D H   D + AFQ+LQ+MSPY+ FG+ TA Q
Sbjct  144   RLAAHFTNGLSKLHKEANVQRQYGPHQHPDVHDRVDVMLAFQMLQNMSPYINFGYLTATQ  203

Query  182   AILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrsF  361
             AILEAV ++RR+HIVDYDI +G+QW SLMQAL+SR  GL A HLRITALSR     +   
Sbjct  204   AILEAVQYERRIHIVDYDITDGVQWPSLMQALVSRNTGLSAQHLRITALSRATNGKKS-V  262

Query  362   CSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHFSY  541
              +VQE GRRLTAFA SIGQPFS+H CR++SD TF PS+LKLVRGEA+++NC+LHLP FS+
Sbjct  263   AAVQEAGRRLTAFAESIGQPFSYHHCRMESD-TFNPSSLKLVRGEAVVINCVLHLPRFSH  321

Query  542   RSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGFPM  721
             + P+SI SFLS + TLNP+LVTLV EE     + GF+ RFMD LH +SA++DSLEAG   
Sbjct  322   QPPNSIISFLSEAKTLNPKLVTLVHEEVGLVGNQGFLYRFMDLLHQFSAIFDSLEAG---  378

Query  722   QDQARTLVERVFLGPKISVAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISFANRCQAK  901
                AR  VERV  GP +S  +TR       E   SW  W+  N GF+P  +SFANRCQAK
Sbjct  379   --PARGFVERVIFGPWVSGWLTRIAITAEVESFASWPLWLATN-GFKPVEVSFANRCQAK  435

Query  902   LLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIWTSVHS  1021
             LLL LFNDGY +EE+G + L+LGWKSRRL+SAS W S  S
Sbjct  436   LLLSLFNDGYGVEELGQNGLVLGWKSRRLVSASFWASCES  475



>gb|EAZ26349.1| hypothetical protein OsJ_10230 [Oryza sativa Japonica Group]
Length=579

 Score =   377 bits (968),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 207/355 (58%), Positives = 255/355 (72%), Gaps = 24/355 (7%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSL--HAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTA  175
             RLAA+FTDALQ LLDG+  +    +   A+   H  GD L AFQ+LQDMSPY+KFGHFTA
Sbjct  179   RLAAHFTDALQGLLDGSHPVGGSGRQAAAAASHHHAGDVLTAFQMLQDMSPYMKFGHFTA  238

Query  176   NQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrr  355
             NQAILEAV+ DRRVHIVDYDI EGIQWASLMQA+ SR DG+PAPHLRITA+SR GG G R
Sbjct  239   NQAILEAVSGDRRVHIVDYDIAEGIQWASLMQAMTSRADGVPAPHLRITAVSRSGGGGAR  298

Query  356   sFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHF  535
                +VQE GRRL+AFAASIGQPFSF QCRLDSDE F+P+ +++V+GEA++ NC+LH    
Sbjct  299   ---AVQEAGRRLSAFAASIGQPFSFGQCRLDSDERFRPATVRMVKGEALVANCVLHQAAA  355

Query  536   SY---RSPDSIASFLSGSATLNPRLVTLVEEEAAPPR---------------DGGFVDRF  661
             +    R   S+ASFLSG A L  +LVT+VEEE    +                GGFV +F
Sbjct  356   TTTIRRPTGSVASFLSGMAALGAKLVTVVEEEGEAEKDDDGDSAGDAAAAAAAGGFVRQF  415

Query  662   MDTLHHYSALYDSLEAGFPMQDQARTLVERVFLGPKISVAITRSYRCRGEEYGWSWGEWV  841
             M+ LH YSA++DSLEAGFP Q + R LVERV L P I+ A++R+YR    E    WG+W+
Sbjct  416   MEELHRYSAVWDSLEAGFPTQSRVRGLVERVILAPNIAGAVSRAYRGVDGEGRCGWGQWM  475

Query  842   PENAGFRPKTISFANRCQAKLLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIW  1006
                +GF    +S  N  QA+LLLGLFNDGY +EE G +K++LGWK+RRL+SAS+W
Sbjct  476   -RGSGFTAVPLSCFNHSQARLLLGLFNDGYTVEETGPNKIVLGWKARRLMSASVW  529



>ref|XP_006651234.1| PREDICTED: nodulation-signaling pathway 2 protein-like [Oryza 
brachyantha]
Length=529

 Score =   375 bits (963),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 197/314 (63%), Positives = 235/314 (75%), Gaps = 14/314 (4%)
 Frame = +2

Query  95    HPHGDALAAFQLLQDMSPYVKFGHFTANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQA  274
             H  GD L AFQ+LQDMSPY+KFGHFTANQAILEAV  DRRVHIVDYDI EGIQWASLMQA
Sbjct  171   HHTGDVLTAFQMLQDMSPYMKFGHFTANQAILEAVAGDRRVHIVDYDIAEGIQWASLMQA  230

Query  275   LISRQDGLPAPHLRITALsrgggsgrrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSD  454
             + SR DG+PAPHLRITA+SR GG G R   +VQE GRRL+AFA SIGQPFSF QCRLDSD
Sbjct  231   MTSRPDGVPAPHLRITAISRSGGGGAR---AVQEAGRRLSAFAVSIGQPFSFGQCRLDSD  287

Query  455   ETFKPSALKLVRGEAIIVNCMLHLPHFSY---RSPDSIASFLSGSATLNPRLVTLVEEEA  625
             E F+P+ +++V+GE ++ NC+LH    +    R   S+ASFLSG A L  RLVT+VEEE 
Sbjct  288   ERFRPTTVRMVKGETLVANCVLHQAAATTTIRRPTGSVASFLSGMAALGARLVTVVEEEG  347

Query  626   APPRD------GGFVDRFMDTLHHYSALYDSLEAGFPMQDQARTLVERVFLGPKISVAIT  787
                +D      GGFV RFM+ LH YSA++DSLEAGFP Q + R LVERV LGP I+ A++
Sbjct  348   EAEKDGDSDAAGGFVRRFMEELHRYSAVWDSLEAGFPTQSRVRGLVERVILGPNIAGAVS  407

Query  788   RSYR-CRGEEYGWSWGEWVPENAGFRPKTISFANRCQAKLLLGLFNDGYRIEEIGNHKLI  964
             R+YR   G E    WGEW+  N GF    +S  N  QA+LLLGLFNDGY +EE G +K++
Sbjct  408   RAYRGVDGGEGRCGWGEWMRGN-GFAAVPLSCFNHSQARLLLGLFNDGYTVEETGPNKIV  466

Query  965   LGWKSRRLLSASIW  1006
             LGWK+RRL+SAS+W
Sbjct  467   LGWKARRLMSASVW  480



>gb|AFP97593.1| nodulation signaling pathway 2-like protein [Brassica ruvo]
Length=475

 Score =   372 bits (955),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 196/340 (58%), Positives = 238/340 (70%), Gaps = 8/340 (2%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTANQ  181
             RLAA+FT+ L  L   A            D H   D + AFQ+LQ+MSPY+ FG+ TA Q
Sbjct  142   RLAAHFTNGLSKLHKEANVQRQYGPHQHPDVHDRVDVMLAFQMLQNMSPYINFGYLTATQ  201

Query  182   AILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrsF  361
             AILEAV ++RR+HIVDYDI +G+QW SLMQAL+SR  G  A HLRITALSR     +   
Sbjct  202   AILEAVQYERRIHIVDYDITDGVQWPSLMQALVSRSTGPSAQHLRITALSRATNGKKS-V  260

Query  362   CSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHFSY  541
              +VQE GRRLTAFA SIGQPFS+H CR+DSD TF PS+LKLVRGEA+++NC+LHLP FS+
Sbjct  261   AAVQEAGRRLTAFAESIGQPFSYHHCRMDSD-TFNPSSLKLVRGEAVVINCVLHLPRFSH  319

Query  542   RSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGFPM  721
             + P+SI SFLS + TLNP+LVTLV EE     + GF+ RFMD LH +SA++DSLEAG   
Sbjct  320   QPPNSIISFLSEAKTLNPKLVTLVHEEVGLVGNQGFLYRFMDLLHQFSAIFDSLEAG---  376

Query  722   QDQARTLVERVFLGPKISVAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISFANRCQAK  901
                AR  VERV  GP +S  +TR       E   SW  W+  N GF+P  +SFANRCQAK
Sbjct  377   --PARGFVERVIFGPWVSGWLTRIAITAEVESFASWPLWLATN-GFKPVEVSFANRCQAK  433

Query  902   LLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIWTSVHS  1021
             LLL LFNDGY +EE+G + L+LGWKSRRL+SAS W S  S
Sbjct  434   LLLSLFNDGYGVEELGQNGLVLGWKSRRLVSASFWASCES  473



>ref|XP_008782233.1| PREDICTED: nodulation-signaling pathway 2 protein-like [Phoenix 
dactylifera]
Length=510

 Score =   373 bits (957),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 211/340 (62%), Positives = 252/340 (74%), Gaps = 13/340 (4%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTANQ  181
             RLAA+FTDALQ LLDG+ +       + +DD P  D LAAFQLLQDMSPYVKFGHFTANQ
Sbjct  151   RLAAHFTDALQGLLDGSSAAVGGQPASHRDDLPC-DVLAAFQLLQDMSPYVKFGHFTANQ  209

Query  182   AILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrsF  361
             AILEAV  DRRVHIVDYDI EG+QWASLMQAL+SR+DG P PH+RITA++RGGG  R   
Sbjct  210   AILEAVAVDRRVHIVDYDIAEGVQWASLMQALVSRKDGPPPPHMRITAVTRGGGGAR---  266

Query  362   CSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHF--  535
              +VQETGRRL AFAAS+G PF+F QCRLD+DE F+P  +K+V+GEA++ NC+L   +   
Sbjct  267   -AVQETGRRLAAFAASLGLPFTFGQCRLDADERFRPGGVKVVKGEAVVANCVLQPLNAAG  325

Query  536   SYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGG--FVDRFMDTLHHYSALYDSLEA  709
             + R P S+ASFLSG+ATL  R+V LVEEE     +G   FV RFM  LH YSAL+DSLEA
Sbjct  326   TRRGPGSVASFLSGAATLGARVVALVEEEEQEEEEGEGDFVGRFMGELHRYSALWDSLEA  385

Query  710   GFPMQDQARTLVERVFLGPKISVAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISFANR  889
             GFP+Q +AR LVERV LGP+I+ A+ R+YR  GE              GF    IS  N 
Sbjct  386   GFPIQGRARGLVERVILGPRIAGAVGRAYRGCGEGGWGE----WMAGRGFGRVGISCFNH  441

Query  890   CQAKLLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIWT  1009
             CQA+LLLGLFNDGYR+EE G +KL+L WKS+RL SASIW+
Sbjct  442   CQARLLLGLFNDGYRVEEDGPNKLVLAWKSQRLTSASIWS  481



>ref|XP_004984706.1| PREDICTED: nodulation-signaling pathway 2 protein-like [Setaria 
italica]
Length=566

 Score =   374 bits (961),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 205/352 (58%), Positives = 251/352 (71%), Gaps = 21/352 (6%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGA-----GSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGH  166
             RLAA+FTDALQ LLDG+         A +          GD L AFQ+LQDMSPY+KFGH
Sbjct  171   RLAAHFTDALQGLLDGSHPAGGAGRQAAAASHGHHHQHAGDVLTAFQMLQDMSPYMKFGH  230

Query  167   FTANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggs  346
             FTANQAILEAV  DRRVH+VDYDI EG+QWASLMQA+ISR DG+P PHLRITA+SRGGG 
Sbjct  231   FTANQAILEAVAGDRRVHVVDYDIAEGVQWASLMQAMISRPDGVPPPHLRITAVSRGGGG  290

Query  347   grrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHL  526
             G R   +VQE GRRL AFAASIGQPFSF QCRLDSDE F+P+ +++V+GE ++ NC+L+ 
Sbjct  291   GAR---AVQEAGRRLAAFAASIGQPFSFGQCRLDSDERFRPATVRMVKGETLVANCVLNQ  347

Query  527   PHFSY---RSPDSIASFLSGSATLNPRLVTLVEEEAAPPRD------GGFVDRFMDTLHH  679
                +    R   S+ASFL+G ATL  ++VT+VEE+   P        GGFV RFM+ LH 
Sbjct  348   AAATTTIRRPTGSVASFLAGMATLGAKVVTVVEEDQGEPEKDDEEAGGGFVARFMEELHR  407

Query  680   YSALYDSLEAGFPMQDQARTLVERVFLGPKISVAITRSYRC---RGEEYGWSWGEWVPEN  850
             YSA++DSLEAGFP Q + R LVER  L P I+ A++R+YR     GE     WGEW+  N
Sbjct  408   YSAVWDSLEAGFPTQSRVRGLVERAILAPNIAGAVSRAYRAVDGDGEAARAGWGEWMRGN  467

Query  851   AGFRPKTISFANRCQAKLLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIW  1006
              GFR   +S  N  QA+LLLGLFNDGY +EE   ++++LGWK+RRLLSAS+W
Sbjct  468   -GFRAVPLSCFNHSQARLLLGLFNDGYTMEETSPNRIVLGWKARRLLSASVW  518



>emb|CDY17336.1| BnaA10g09700D [Brassica napus]
Length=499

 Score =   372 bits (954),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 196/340 (58%), Positives = 238/340 (70%), Gaps = 8/340 (2%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTANQ  181
             RLAA+FT+ L  L   A            D H   D + AFQ+LQ+MSPY+ FG+ TA Q
Sbjct  156   RLAAHFTNGLSKLHKEANVQRQYGPHQHPDVHDRVDVMLAFQMLQNMSPYINFGYLTATQ  215

Query  182   AILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrsF  361
             AILEAV ++RR+HIVDYDI +G+QW SLMQAL+SR  G  A HLRITALSR     +   
Sbjct  216   AILEAVQYERRIHIVDYDITDGVQWPSLMQALVSRSTGPSAQHLRITALSRATNGKKS-V  274

Query  362   CSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHFSY  541
              +VQE GRRLTAFA SIGQPFS+H CR+DSD TF PS+LKLVRGEA+++NC+LHLP FS+
Sbjct  275   AAVQEAGRRLTAFAESIGQPFSYHHCRMDSD-TFNPSSLKLVRGEAVVINCVLHLPRFSH  333

Query  542   RSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGFPM  721
             + P+SI SFLS + TLNP+LVTLV EE     + GF+ RFMD LH +SA++DSLEAG   
Sbjct  334   QPPNSIISFLSEAKTLNPKLVTLVHEEVGLVGNQGFLYRFMDLLHQFSAIFDSLEAG---  390

Query  722   QDQARTLVERVFLGPKISVAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISFANRCQAK  901
                AR  VERV  GP +S  +TR       E   SW  W+  N GF+P  +SFANRCQAK
Sbjct  391   --PARGFVERVIFGPWVSGWLTRIAITAEVESFASWPLWLATN-GFKPVEVSFANRCQAK  447

Query  902   LLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIWTSVHS  1021
             LLL LFNDGY +EE+G + L+LGWKSRRL+SAS W S  S
Sbjct  448   LLLSLFNDGYGVEELGQNGLVLGWKSRRLVSASFWASCES  487



>gb|AFP97595.1| nodulation signaling pathway 2-like protein [Brassica montana]
 gb|AFP97597.1| nodulation signaling pathway 2-like protein [Brassica carinata]
Length=477

 Score =   371 bits (952),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 195/340 (57%), Positives = 238/340 (70%), Gaps = 8/340 (2%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTANQ  181
             RLAA+FT+ L  L   A            D H   D + AFQ+LQ+MSPY+ FG+ TA Q
Sbjct  144   RLAAHFTNGLSKLHKEANVQRQYGPHQHPDVHDRVDVMLAFQMLQNMSPYINFGYLTATQ  203

Query  182   AILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrsF  361
             AILEAV ++RR+HIVDYDI +G+QW SLMQAL+SR  G  A HLRITALSR     +   
Sbjct  204   AILEAVQYERRIHIVDYDITDGVQWPSLMQALVSRNTGPSAQHLRITALSRATNGKKS-V  262

Query  362   CSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHFSY  541
              +VQE GRRLTAFA SIGQPFS+H CR++SD TF PS+LKLVRGEA+++NC+LHLP FS+
Sbjct  263   AAVQEAGRRLTAFAESIGQPFSYHHCRMESD-TFNPSSLKLVRGEAVVINCVLHLPRFSH  321

Query  542   RSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGFPM  721
             + P+SI SFLS + TLNP+LVTLV EE     + GF+ RFMD LH +SA++DSLEAG   
Sbjct  322   QPPNSIISFLSEAKTLNPKLVTLVHEEVGLVGNQGFLYRFMDLLHQFSAIFDSLEAG---  378

Query  722   QDQARTLVERVFLGPKISVAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISFANRCQAK  901
                AR  VERV  GP +S  +TR       E   SW  W+  N GF+P  +SFANRCQAK
Sbjct  379   --PARGFVERVIFGPWVSGWLTRIAITAEVESFASWPLWLATN-GFKPVEVSFANRCQAK  435

Query  902   LLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIWTSVHS  1021
             LLL LFNDGY +EE+G + L+LGWKSRRL+SAS W S  S
Sbjct  436   LLLSLFNDGYGVEELGQNGLVLGWKSRRLVSASFWASCES  475



>ref|XP_006397321.1| hypothetical protein EUTSA_v10028622mg [Eutrema salsugineum]
 gb|ESQ38774.1| hypothetical protein EUTSA_v10028622mg [Eutrema salsugineum]
Length=481

 Score =   370 bits (950),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 193/345 (56%), Positives = 244/345 (71%), Gaps = 21/345 (6%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTANQ  181
             RLA +FTD L  LL+ A      S    +D H   D L+A Q+LQ+MSPYV FG+FTA+Q
Sbjct  144   RLADHFTDGLSKLLERANVQRHSSPHQHRDVHHQVDVLSAIQMLQNMSPYVNFGYFTASQ  203

Query  182   AILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrsF  361
             AILEAV ++RR+HI+DYDI EG+QWASLMQAL+ +  G    HLRITAL     +G++S 
Sbjct  204   AILEAVKYERRIHILDYDITEGVQWASLMQALVCKNTGPLTQHLRITAL-SRATNGKKSI  262

Query  362   CSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHFSY  541
              +VQE GRRLTAFA SIGQPFS+H C+LD+D  F  S+LKLVRGEA+I+NCMLHLP FS+
Sbjct  263   AAVQEAGRRLTAFAESIGQPFSYHHCKLDTD-AFSASSLKLVRGEAVIINCMLHLPRFSH  321

Query  542   RSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGFPM  721
             ++P+S+ SFL+ + TLNP+LVTLV EE     +  ++ RFMD LH +SA++DSLEAG   
Sbjct  322   QTPNSLISFLTEAKTLNPKLVTLVHEEVCLMGNQSYLYRFMDLLHQFSAIFDSLEAG---  378

Query  722   QDQARTLVERVFLGPKISVAITR--------SYRCRGEEYGWSWGEWVPENAGFRPKTIS  877
                 R  VERVF+GP +S  +TR         + C       SW  W+  N GF+P  +S
Sbjct  379   --PTRAFVERVFIGPWVSSWLTRIAITADDVEFECFA-----SWKGWLETN-GFKPVDVS  430

Query  878   FANRCQAKLLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIWTS  1012
             FANRCQAKLLL LFNDGYR+EE+G + L+LGWKSRRL+SAS W S
Sbjct  431   FANRCQAKLLLSLFNDGYRVEELGQNGLVLGWKSRRLVSASFWAS  475



>emb|CDY45672.1| BnaC09g32140D [Brassica napus]
Length=489

 Score =   370 bits (951),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 195/340 (57%), Positives = 238/340 (70%), Gaps = 8/340 (2%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTANQ  181
             RLAA+FT+ L  L   A            D H   D + AFQ+LQ+MSPY+ FG+ TA Q
Sbjct  156   RLAAHFTNGLSKLHKEANVQRQYGPHQHPDVHDRVDVMLAFQMLQNMSPYINFGYLTATQ  215

Query  182   AILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrsF  361
             AILEAV ++RR+HIVDYDI +G+QW SLMQAL+SR  G  A HLRITALSR     +   
Sbjct  216   AILEAVQYERRIHIVDYDITDGVQWPSLMQALVSRNTGPSAQHLRITALSRATNGKKS-V  274

Query  362   CSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHFSY  541
              +VQE GRRLTAFA SIGQPFS+H CR++SD TF PS+LKLVRGEA+++NC+LHLP FS+
Sbjct  275   AAVQEAGRRLTAFAESIGQPFSYHHCRMESD-TFNPSSLKLVRGEAVVINCVLHLPRFSH  333

Query  542   RSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGFPM  721
             + P+SI SFLS + TLNP+LVTLV EE     + GF+ RFMD LH +SA++DSLEAG   
Sbjct  334   QPPNSIISFLSEAKTLNPKLVTLVHEEVGLVGNQGFLYRFMDLLHQFSAIFDSLEAG---  390

Query  722   QDQARTLVERVFLGPKISVAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISFANRCQAK  901
                AR  VERV  GP +S  +TR       E   SW  W+  N GF+P  +SFANRCQAK
Sbjct  391   --PARGFVERVIFGPWVSGWLTRIAITAEVESFASWPLWLATN-GFKPVEVSFANRCQAK  447

Query  902   LLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIWTSVHS  1021
             LLL LFNDGY +EE+G + L+LGWKSRRL+SAS W S  S
Sbjct  448   LLLSLFNDGYGVEELGQNGLVLGWKSRRLVSASFWASCES  487



>gb|AFP97591.1| nodulation signaling pathway 2-like protein [Brassica oleracea]
Length=481

 Score =   370 bits (950),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 195/340 (57%), Positives = 238/340 (70%), Gaps = 8/340 (2%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTANQ  181
             RLAA+FT+ L  L   A            D H   D + AFQ+LQ+MSPY+ FG+ TA Q
Sbjct  148   RLAAHFTNGLSKLHKEANVQRQYGPHQHPDVHDRVDVMLAFQMLQNMSPYINFGYLTATQ  207

Query  182   AILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrsF  361
             AILEAV ++RR+HIVDYDI +G+QW SLMQAL+SR  G  A HLRITALSR     +   
Sbjct  208   AILEAVQYERRIHIVDYDITDGVQWPSLMQALVSRNTGPSAQHLRITALSRATNGKKS-V  266

Query  362   CSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHFSY  541
              +VQE GRRLTAFA SIGQPFS+H CR++SD TF PS+LKLVRGEA+++NC+LHLP FS+
Sbjct  267   AAVQEAGRRLTAFAESIGQPFSYHHCRMESD-TFNPSSLKLVRGEAVVINCVLHLPRFSH  325

Query  542   RSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGFPM  721
             + P+SI SFLS + TLNP+LVTLV EE     + GF+ RFMD LH +SA++DSLEAG   
Sbjct  326   QPPNSIISFLSEAKTLNPKLVTLVHEEVGLVGNQGFLYRFMDLLHQFSAIFDSLEAG---  382

Query  722   QDQARTLVERVFLGPKISVAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISFANRCQAK  901
                AR  VERV  GP +S  +TR       E   SW  W+  N GF+P  +SFANRCQAK
Sbjct  383   --PARGFVERVIFGPWVSDWLTRIAITAEVESFASWPLWLATN-GFKPVEVSFANRCQAK  439

Query  902   LLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIWTSVHS  1021
             LLL LFNDGY +EE+G + L+LGWKSRRL+SAS W S  S
Sbjct  440   LLLSLFNDGYGVEELGQNGLVLGWKSRRLVSASFWASCES  479



>gb|AFP97598.1| nodulation signaling pathway 2-like protein [Brassica oleracea]
Length=480

 Score =   370 bits (949),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 198/342 (58%), Positives = 242/342 (71%), Gaps = 18/342 (5%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTANQ  181
             RLAA+FT+ L  L  GA ++     P   D H   D + AFQ+LQ+MSPY+ FG+ TA Q
Sbjct  147   RLAAHFTNGLSKLHKGA-NVQGHQHP---DVHDQVDVMLAFQMLQNMSPYINFGYLTATQ  202

Query  182   AILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrsF  361
             AILEAV ++RR+HIVDYDI +G+QW SLMQAL+SR  G  A HLRITALSR     +   
Sbjct  203   AILEAVKYERRIHIVDYDITDGVQWPSLMQALVSRNTGPSALHLRITALSRVTNGKKT-V  261

Query  362   CSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHFSY  541
              +VQE GRRLTAFA SIGQPFS+H CR+DSD  F PS+LKLVRGEA+++NCMLHLP FS+
Sbjct  262   AAVQEAGRRLTAFAESIGQPFSYHLCRMDSD-IFNPSSLKLVRGEAVVINCMLHLPRFSH  320

Query  542   RSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGFPM  721
             +SP+SI SFLS + TLNP+LVTLV EE     + GF+ RFMD LH +SA++DSLEA    
Sbjct  321   QSPNSIISFLSEAKTLNPKLVTLVHEEVGLVGNQGFLYRFMDLLHQFSAIFDSLEA----  376

Query  722   QDQARTLVERVFLGPKIS-----VAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISFAN  886
              + AR  VERV  GP +S     +AIT       E    SW  W+  N GF+P  +SFAN
Sbjct  377   -EPARGFVERVIFGPWVSGWLTRIAITADDDAEVESVA-SWPLWLATN-GFKPVEVSFAN  433

Query  887   RCQAKLLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIWTS  1012
             RCQAKLLL LFNDGY +EE+G + L+LGWKSRRL+SAS W S
Sbjct  434   RCQAKLLLSLFNDGYGVEELGQNGLVLGWKSRRLVSASFWAS  475



>gb|AFP97603.1| nodulation signaling pathway 2-like protein [Brassica oxyrrhina]
Length=477

 Score =   369 bits (948),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 194/340 (57%), Positives = 237/340 (70%), Gaps = 8/340 (2%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTANQ  181
             RL A+FT+ L  L   A            D H   D + AFQ+LQ+MSPY+ FG+ TA Q
Sbjct  144   RLTAHFTNGLSKLHKEANVQRQYGPHQHPDVHDRVDVMLAFQMLQNMSPYINFGYLTATQ  203

Query  182   AILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrsF  361
             AILEAV ++RR+HIVDYDI +G+QW SLMQAL+SR  G  A HLRITALSR     +   
Sbjct  204   AILEAVQYERRIHIVDYDITDGVQWPSLMQALVSRNTGPSAQHLRITALSRATNGKKS-V  262

Query  362   CSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHFSY  541
              +VQE GRRLTAFA SIGQPFS+H CR++SD TF PS+LKLVRGEA+++NC+LHLP FS+
Sbjct  263   AAVQEAGRRLTAFAESIGQPFSYHHCRMESD-TFNPSSLKLVRGEAVVINCVLHLPRFSH  321

Query  542   RSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGFPM  721
             + P+SI SFLS + TLNP+LVTLV EE     + GF+ RFMD LH +SA++DSLEAG   
Sbjct  322   QPPNSIISFLSEAKTLNPKLVTLVHEEVGLVGNQGFLYRFMDLLHQFSAIFDSLEAG---  378

Query  722   QDQARTLVERVFLGPKISVAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISFANRCQAK  901
                AR  VERV  GP +S  +TR       E   SW  W+  N GF+P  +SFANRCQAK
Sbjct  379   --PARGFVERVIFGPWVSGWLTRIAITAEVESFASWPLWLATN-GFKPVEVSFANRCQAK  435

Query  902   LLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIWTSVHS  1021
             LLL LFNDGY +EE+G + L+LGWKSRRL+SAS W S  S
Sbjct  436   LLLSLFNDGYGVEELGQNGLVLGWKSRRLVSASFWASCES  475



>ref|XP_009120075.1| PREDICTED: scarecrow-like protein 26 isoform X2 [Brassica rapa]
Length=459

 Score =   369 bits (946),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 195/340 (57%), Positives = 237/340 (70%), Gaps = 8/340 (2%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTANQ  181
             RLAA+FT+ L  L   A            D H   D + AF +LQ+MSPY+ FG+ TA Q
Sbjct  126   RLAAHFTNGLSKLHKEANVQRQYGPHQHPDVHDRVDVMLAFPMLQNMSPYINFGYLTATQ  185

Query  182   AILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrsF  361
             AILEAV ++RR+HIVDYDI +G+QW SLMQAL+SR  G  A HLRITALSR     +   
Sbjct  186   AILEAVQYERRIHIVDYDITDGVQWPSLMQALVSRNTGPSAQHLRITALSRATNGKKS-V  244

Query  362   CSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHFSY  541
              +VQE GRRLTAFA SIGQPFS+H CR+DSD TF PS+LKLVRGEA+++NC+LHLP FS+
Sbjct  245   AAVQEAGRRLTAFAESIGQPFSYHHCRMDSD-TFNPSSLKLVRGEAVVINCVLHLPRFSH  303

Query  542   RSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGFPM  721
             + P+SI SFLS + TLNP+LVTLV EE     + GF+ RFMD LH +SA++DSLEAG   
Sbjct  304   QPPNSIISFLSEAKTLNPKLVTLVHEEVGLVGNQGFLYRFMDLLHQFSAIFDSLEAG---  360

Query  722   QDQARTLVERVFLGPKISVAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISFANRCQAK  901
                AR  VERV  GP +S  +TR       E   SW  W+  N GF+P  +SFANRCQAK
Sbjct  361   --PARGFVERVIFGPWVSGWLTRIAITAEVESFASWPLWLATN-GFKPVEVSFANRCQAK  417

Query  902   LLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIWTSVHS  1021
             LLL LFNDGY +EE+G + L+LGWKSRRL+SAS W S  S
Sbjct  418   LLLSLFNDGYGVEELGQNGLVLGWKSRRLVSASFWASCES  457



>gb|AFP97592.1| nodulation signaling pathway 2-like protein [Brassica rapa]
Length=477

 Score =   369 bits (948),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 195/340 (57%), Positives = 237/340 (70%), Gaps = 8/340 (2%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTANQ  181
             RLAA+FT+ L  L   A            D H   D + AF +LQ+MSPY+ FG+ TA Q
Sbjct  144   RLAAHFTNGLSKLHKEANVQRQYGPHQHPDVHDRVDVMLAFPMLQNMSPYINFGYLTATQ  203

Query  182   AILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrsF  361
             AILEAV ++RR+HIVDYDI +G+QW SLMQAL+SR  G  A HLRITALSR     +   
Sbjct  204   AILEAVQYERRIHIVDYDITDGVQWPSLMQALVSRNTGPSAQHLRITALSRATNGKKS-V  262

Query  362   CSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHFSY  541
              +VQE GRRLTAFA SIGQPFS+H CR+DSD TF PS+LKLVRGEA+++NC+LHLP FS+
Sbjct  263   AAVQEAGRRLTAFAESIGQPFSYHHCRMDSD-TFNPSSLKLVRGEAVVINCVLHLPRFSH  321

Query  542   RSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGFPM  721
             + P+SI SFLS + TLNP+LVTLV EE     + GF+ RFMD LH +SA++DSLEAG   
Sbjct  322   QPPNSIISFLSEAKTLNPKLVTLVHEEVGLVGNQGFLYRFMDLLHQFSAIFDSLEAG---  378

Query  722   QDQARTLVERVFLGPKISVAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISFANRCQAK  901
                AR  VERV  GP +S  +TR       E   SW  W+  N GF+P  +SFANRCQAK
Sbjct  379   --PARGFVERVIFGPWVSGWLTRIAITAEVESFASWPLWLATN-GFKPVEVSFANRCQAK  435

Query  902   LLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIWTSVHS  1021
             LLL LFNDGY +EE+G + L+LGWKSRRL+SAS W S  S
Sbjct  436   LLLSLFNDGYGVEELGQNGLVLGWKSRRLVSASFWASCES  475



>gb|AFP97599.1| nodulation signaling pathway 2-like protein [Matthiola longipetala]
Length=479

 Score =   369 bits (947),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 198/343 (58%), Positives = 242/343 (71%), Gaps = 15/343 (4%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTANQ  181
             RLAA+FT+ L  L  GA ++     P   D H   D + AFQ+LQ+MSPY+ FG+ TA Q
Sbjct  147   RLAAHFTNGLSKLHKGA-NVQGHQHP---DVHDQVDVMLAFQMLQNMSPYINFGYLTATQ  202

Query  182   AILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrsF  361
             AILEAV ++RR+HIVDYDI +G+QW SLMQAL+SR  G  A HLRITALSR     +   
Sbjct  203   AILEAVKYERRIHIVDYDITDGVQWPSLMQALVSRNTGPSALHLRITALSRVTNGKKT-V  261

Query  362   CSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHFSY  541
              +VQE GRRLTAFA SIGQPFS+H CR+DSD  F PS+LKLVRGEA+++NCMLHLP FS+
Sbjct  262   AAVQEAGRRLTAFAESIGQPFSYHLCRMDSD-IFNPSSLKLVRGEAVVINCMLHLPRFSH  320

Query  542   RSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGFPM  721
             +SP+SI SFLS + TLNP+LVTLV EE     + GF+ RF+D LH +SA++DSLEAG   
Sbjct  321   QSPNSIISFLSEAKTLNPKLVTLVHEEVGLVGNQGFLYRFVDLLHQFSAIFDSLEAG---  377

Query  722   QDQARTLVERVFLGPKISVAITRSYRCRGE---EYGWSWGEWVPENAGFRPKTISFANRC  892
                AR  VERV  GP +S  +TR      +   E   SW  W+  N GF+P  +SFANRC
Sbjct  378   --PARGFVERVIFGPWVSGWLTRIAITADDAEVESVASWPLWLATN-GFKPLEVSFANRC  434

Query  893   QAKLLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIWTSVHS  1021
             QAKLLL LFNDGY +EE G + L+LGWKSRRL+SAS W S  S
Sbjct  435   QAKLLLSLFNDGYGVEEFGQNGLVLGWKSRRLVSASFWASCES  477



>ref|XP_010421850.1| PREDICTED: scarecrow-like protein 26 [Camelina sativa]
Length=481

 Score =   369 bits (946),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 189/342 (55%), Positives = 240/342 (70%), Gaps = 6/342 (2%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTANQ  181
             RL A+FT+ L  LL+    L   +     D +   D ++AFQ+LQ+MSPYV FG+ T  Q
Sbjct  144   RLVAHFTNGLSKLLERDNVLRPNNH--CNDVYDQADVISAFQMLQNMSPYVNFGYLTTTQ  201

Query  182   AILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrsF  361
             AILE+V ++RR+HIVDYDI EGIQW SLMQAL+SR  G  A HLRITALSR     +   
Sbjct  202   AILESVKYERRIHIVDYDIAEGIQWPSLMQALLSRNTGTSAQHLRITALSRATNGKKS-V  260

Query  362   CSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHFSY  541
              +VQE GRRLTAFA SIGQPFSFH C+LD+D  F  S+LKLVRGEA+++NCMLHLP FS+
Sbjct  261   AAVQEAGRRLTAFAESIGQPFSFHHCKLDND-AFNTSSLKLVRGEAVVINCMLHLPRFSH  319

Query  542   RSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGFPM  721
             ++P+S+ SFL  + TLNP+LVTLV EE     +  F+ RFMD LH +SA++DSLEA   +
Sbjct  320   KTPNSVISFLLEAKTLNPKLVTLVHEEVGLMGNQCFLYRFMDLLHQFSAIFDSLEASLSI  379

Query  722   QDQARTLVERVFLGPKISVAITRSYRCRGE-EYGWSWGEWVPENAGFRPKTISFANRCQA  898
              +  R  V+RVF+GP ++  +TR      E E   SW +W+  N GF    +SFANRCQA
Sbjct  380   TNPVRGFVDRVFIGPWVANWLTRITADDSEVESFASWPQWLETN-GFEAMEVSFANRCQA  438

Query  899   KLLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIWTSVHSD  1024
             KLLL LFNDGY +EE+G + L+LGWKSRRL+SAS W S  S+
Sbjct  439   KLLLSLFNDGYSVEELGQNGLVLGWKSRRLVSASFWASHESN  480



>ref|XP_009120074.1| PREDICTED: scarecrow-like protein 26 isoform X1 [Brassica rapa]
Length=489

 Score =   369 bits (947),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 195/340 (57%), Positives = 237/340 (70%), Gaps = 8/340 (2%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTANQ  181
             RLAA+FT+ L  L   A            D H   D + AF +LQ+MSPY+ FG+ TA Q
Sbjct  156   RLAAHFTNGLSKLHKEANVQRQYGPHQHPDVHDRVDVMLAFPMLQNMSPYINFGYLTATQ  215

Query  182   AILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrsF  361
             AILEAV ++RR+HIVDYDI +G+QW SLMQAL+SR  G  A HLRITALSR     +   
Sbjct  216   AILEAVQYERRIHIVDYDITDGVQWPSLMQALVSRNTGPSAQHLRITALSRATNGKKS-V  274

Query  362   CSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHFSY  541
              +VQE GRRLTAFA SIGQPFS+H CR+DSD TF PS+LKLVRGEA+++NC+LHLP FS+
Sbjct  275   AAVQEAGRRLTAFAESIGQPFSYHHCRMDSD-TFNPSSLKLVRGEAVVINCVLHLPRFSH  333

Query  542   RSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGFPM  721
             + P+SI SFLS + TLNP+LVTLV EE     + GF+ RFMD LH +SA++DSLEAG   
Sbjct  334   QPPNSIISFLSEAKTLNPKLVTLVHEEVGLVGNQGFLYRFMDLLHQFSAIFDSLEAG---  390

Query  722   QDQARTLVERVFLGPKISVAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISFANRCQAK  901
                AR  VERV  GP +S  +TR       E   SW  W+  N GF+P  +SFANRCQAK
Sbjct  391   --PARGFVERVIFGPWVSGWLTRIAITAEVESFASWPLWLATN-GFKPVEVSFANRCQAK  447

Query  902   LLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIWTSVHS  1021
             LLL LFNDGY +EE+G + L+LGWKSRRL+SAS W S  S
Sbjct  448   LLLSLFNDGYGVEELGQNGLVLGWKSRRLVSASFWASCES  487



>ref|XP_008653941.1| PREDICTED: nodulation-signaling pathway 2 protein-like [Zea mays]
 tpg|DAA44514.1| TPA: hypothetical protein ZEAMMB73_869456 [Zea mays]
 gb|AIB04510.1| GRAS transcription factor, partial [Zea mays]
Length=564

 Score =   370 bits (951),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 202/351 (58%), Positives = 250/351 (71%), Gaps = 21/351 (6%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKD-DHPH----GDALAAFQLLQDMSPYVKFGH  166
             RLA +FTDALQ LLDG+  +      A+    H H    GD L AFQ+LQDMSPY+KFGH
Sbjct  171   RLATHFTDALQGLLDGSHPVGGAGKQAAAAASHGHQQHTGDVLTAFQMLQDMSPYMKFGH  230

Query  167   FTANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggs  346
             FTANQAILEAV  +RRVH+VDYDI EG+QWASLMQA+ SR DG+P PHLRITA+SRGGG 
Sbjct  231   FTANQAILEAVAGERRVHVVDYDIAEGVQWASLMQAMTSRPDGVPPPHLRITAVSRGGGG  290

Query  347   grrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHL  526
               R   +VQE GRRL AFAAS+GQPFSF QCRLDSDE F+P+ +++V+GE ++ NC+L+ 
Sbjct  291   SAR---AVQEAGRRLAAFAASVGQPFSFGQCRLDSDERFRPATVRMVKGETLVANCVLNQ  347

Query  527   PHFSY---RSPDSIASFLSGSATLNPRLVTLVEEEAAPPRD-----GGFVDRFMDTLHHY  682
                +    R   S+ASFL+G ATL  ++VT+VEE+           GGFV RFM+ LH Y
Sbjct  348   AAATTTVRRPTGSVASFLAGMATLGAKVVTVVEEDQGHAEKDDEGAGGFVARFMEELHRY  407

Query  683   SALYDSLEAGFPMQDQARTLVERVFLGPKISVAITRSYRC---RGEEYGWSWGEWVPENA  853
             SA++DSLEAGFP Q + R LVER  L P I+ A++R+YR     GE     WGEW+  N 
Sbjct  408   SAVWDSLEAGFPTQSRVRGLVERAILAPNIAGAVSRAYRAVDGDGEARA-GWGEWMRGN-  465

Query  854   GFRPKTISFANRCQAKLLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIW  1006
             GFR   +S  N  QA+LLLGLFNDGY +EE   +K++LGWK+RRLLSAS+W
Sbjct  466   GFRAVPLSCFNHSQARLLLGLFNDGYTMEETSPNKIVLGWKARRLLSASVW  516



>gb|AFP97602.1| nodulation signaling pathway 2-like protein [Brassica incana]
Length=479

 Score =   367 bits (943),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 194/340 (57%), Positives = 237/340 (70%), Gaps = 8/340 (2%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTANQ  181
             RLAA+FT+ L  L   A            D H   D + AFQ+LQ+MSPY+ FG+ TA Q
Sbjct  146   RLAAHFTNGLSKLHKEANVQRQYGPHQHPDVHDRVDVMLAFQMLQNMSPYINFGYLTATQ  205

Query  182   AILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrsF  361
             AILEAV ++RR+HIVDYDI +G+QW SLMQAL+SR  G  A HLRITALSR     +   
Sbjct  206   AILEAVQYERRIHIVDYDITDGVQWPSLMQALVSRNTGPSAQHLRITALSRATNGKKS-V  264

Query  362   CSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHFSY  541
              +VQE GRRLTAFA SIGQPFS+H  R++SD TF PS+LKLVRGEA+++NC+LHLP FS+
Sbjct  265   AAVQEAGRRLTAFAESIGQPFSYHHGRMESD-TFNPSSLKLVRGEAVVINCVLHLPRFSH  323

Query  542   RSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGFPM  721
             + P+SI SFLS + TLNP+LVTLV EE     + GF+ RFMD LH +SA++DSLEAG   
Sbjct  324   QPPNSIISFLSEAKTLNPKLVTLVHEEVGLVGNQGFLYRFMDLLHQFSAIFDSLEAGL--  381

Query  722   QDQARTLVERVFLGPKISVAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISFANRCQAK  901
                AR  VERV  GP +S  +TR       E   SW  W+  N GF+P  +SFANRCQAK
Sbjct  382   ---ARGFVERVIFGPWVSDWLTRIAITAEVESFASWPLWLATN-GFKPVEVSFANRCQAK  437

Query  902   LLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIWTSVHS  1021
             LLL LFNDGY +EE+G + L+LGWKSRRL+SAS W S  S
Sbjct  438   LLLSLFNDGYGVEELGQNGLVLGWKSRRLVSASFWASCES  477



>ref|XP_009419162.1| PREDICTED: nodulation-signaling pathway 2 protein [Musa acuminata 
subsp. malaccensis]
Length=529

 Score =   369 bits (946),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 199/342 (58%), Positives = 247/342 (72%), Gaps = 14/342 (4%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDH---PHGDALAAFQLLQDMSPYVKFGHFT  172
             RL A+FTDALQ LLDG+ S H     + +D H      D L AFQLLQDMSPY+KFGHFT
Sbjct  158   RLTAHFTDALQGLLDGSTSAHCGGRNSFRDGHLLHHTSDVLTAFQLLQDMSPYIKFGHFT  217

Query  173   ANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgr  352
             ANQAILE    +RR+HI+DYDI EG+QWASL+QAL+SR  G P PHLRITA++RGG    
Sbjct  218   ANQAILEETLGERRIHIIDYDIAEGVQWASLLQALVSRPGGSPPPHLRITAVTRGGSR--  275

Query  353   rsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPH  532
                 +++ETGR L AFAAS+GQPFSF QCRLD+DE F+P+ +K+V+GE +++NC+LH   
Sbjct  276   ----AMRETGRLLAAFAASVGQPFSFSQCRLDADEQFRPAGVKVVKGETLVMNCVLHPTM  331

Query  533   FSYR--SPDSIASFLSGSATLNPRLVTLVEEEAAPPRDG-GFVDRFMDTLHHYSALYDSL  703
              + R  S  S+ASFL G+  L  ++VTLVEEE     +   FV RFM  LH YSA++DSL
Sbjct  332   NNTRSGSASSVASFLRGAVELGAKVVTLVEEEEQEQSEERSFVRRFMGELHRYSAVWDSL  391

Query  704   EAGFPMQDQARTLVERVFLGPKISVAITRSYR-CRGEEYGWSWGEWVPENAGFRPKTISF  880
             EAGFPMQ +AR +VERV L P+I+ A+ R+YR  + EE    WG+W+    GF    IS 
Sbjct  392   EAGFPMQGKARGMVERVILAPRIAGAVGRAYRDSKEEETDGRWGKWMAV-MGFGRVRISC  450

Query  881   ANRCQAKLLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIW  1006
              N CQAKLLLGLFNDGY +EE G++KL LGWKSRRLLSAS+W
Sbjct  451   FNHCQAKLLLGLFNDGYSVEEDGSNKLALGWKSRRLLSASVW  492



>gb|AFP97601.1| nodulation signaling pathway 2-like protein [Brassica incana]
Length=482

 Score =   366 bits (940),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 194/340 (57%), Positives = 237/340 (70%), Gaps = 8/340 (2%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTANQ  181
             RLAA+FT+ L  L   A            D H   D + AFQ+LQ+MSPY+ FG+ TA Q
Sbjct  149   RLAAHFTNGLSKLHKEANVQRQYGPHQHPDVHDRVDVMLAFQMLQNMSPYINFGYLTATQ  208

Query  182   AILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrsF  361
             AILEAV ++RR+HIVDYDI +G+QW SLMQAL+SR  G  A HLRITALSR     +   
Sbjct  209   AILEAVQYERRIHIVDYDITDGVQWPSLMQALVSRNTGPSAQHLRITALSRATNGKKS-V  267

Query  362   CSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHFSY  541
              +VQE GRRLTAFA SIGQPFS+H  R++SD TF PS+LKLVRGEA+++NC+LHLP FS+
Sbjct  268   AAVQEAGRRLTAFAESIGQPFSYHHGRMESD-TFNPSSLKLVRGEAVVINCVLHLPRFSH  326

Query  542   RSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGFPM  721
             + P+SI SFLS + TLNP+LVTLV EE     + GF+ RFMD LH +SA++DSLEAG   
Sbjct  327   QPPNSIISFLSEAKTLNPKLVTLVHEEVGLVGNQGFLYRFMDLLHQFSAIFDSLEAGL--  384

Query  722   QDQARTLVERVFLGPKISVAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISFANRCQAK  901
                AR  VERV  GP +S  +TR       E   SW  W+  N GF+P  +SFANRCQAK
Sbjct  385   ---ARGFVERVIFGPWVSDWLTRIAITAEVESFASWPLWLATN-GFKPVEVSFANRCQAK  440

Query  902   LLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIWTSVHS  1021
             LLL LFNDGY +EE+G + L+LGWKSRRL+SAS W S  S
Sbjct  441   LLLSLFNDGYGVEELGQNGLVLGWKSRRLVSASFWASCES  480



>ref|XP_010455246.1| PREDICTED: scarecrow-like protein 26 [Camelina sativa]
Length=481

 Score =   365 bits (937),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 191/342 (56%), Positives = 241/342 (70%), Gaps = 8/342 (2%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTANQ  181
             RLAA+FTD L  LL+    L   +     D +   D ++AFQ+LQ+MSPYV FG+ T  Q
Sbjct  146   RLAAHFTDGLTKLLERVNVLRPNNH--CSDVYDQADVISAFQMLQNMSPYVNFGYLTTTQ  203

Query  182   AILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrsF  361
             AILE+V ++RR+HIVDYDI EGIQW SLMQAL+SR  G  A HLRITAL     +G++S 
Sbjct  204   AILESVKYERRIHIVDYDIAEGIQWPSLMQALLSRNTGTSAQHLRITAL-SRATNGKKSV  262

Query  362   CSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHFSY  541
              +VQE GRRLTAFA SIGQPFSFH C+LD+D  F  S+LKLVRGEA+++NCMLHLP FS+
Sbjct  263   AAVQEAGRRLTAFAESIGQPFSFHHCKLDND-AFNTSSLKLVRGEAVVINCMLHLPRFSH  321

Query  542   RSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGFPM  721
             ++P+S+ SFL  + TL P+LVTLV EE     +  F+ RFMD LH + A++DSLEAG  +
Sbjct  322   KTPNSVISFLLEAKTLKPKLVTLVHEEVGLMGNQCFLYRFMDLLHQFPAIFDSLEAGISV  381

Query  722   QDQARTLVERVFLGPKISVAITRSYRCRGE-EYGWSWGEWVPENAGFRPKTISFANRCQA  898
                AR  VERVF+GP ++  +TR      E E   SW +W+  N GF    +SFANRCQA
Sbjct  382   --PARGFVERVFIGPWVANWLTRITADDSEVESFASWPQWLETN-GFEAMEVSFANRCQA  438

Query  899   KLLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIWTSVHSD  1024
             KLLL LFNDGY +EE+G + L+ GWKSRRL+SAS W S  S+
Sbjct  439   KLLLSLFNDGYSVEELGQNGLVFGWKSRRLVSASFWASHESN  480



>gb|AFP97589.1| nodulation signaling pathway 2-like protein [Hirschfeldia incana]
Length=476

 Score =   365 bits (937),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 200/346 (58%), Positives = 244/346 (71%), Gaps = 20/346 (6%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHG--DALAAFQLLQDMSPYVKFGHFTA  175
             RLAA+FT+ L  L   A      +      DH H   D + AFQ+LQ+MSPYV FG+ TA
Sbjct  143   RLAAHFTNGLSKLHKEA------NVQRQPPDHVHDQVDVMLAFQMLQNMSPYVNFGYLTA  196

Query  176   NQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrr  355
              QAILEAV H+RR+HIVDYDI +G+QW SLMQAL+SR  GL A HLRITAL     +G++
Sbjct  197   TQAILEAVQHERRIHIVDYDITDGVQWPSLMQALVSRNTGLSAQHLRITAL-SRNTNGKK  255

Query  356   sFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHF  535
             S  +VQE GRRLTAFA SIGQPFSFH CR+DSD TF PS+LKLVRGEA+++NCMLHLP F
Sbjct  256   SVAAVQEAGRRLTAFAESIGQPFSFHHCRMDSD-TFNPSSLKLVRGEAVVINCMLHLPRF  314

Query  536   S-YRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAG  712
               ++ P+SI SFLS + TLNP+LVTLV EE     + GF+ RF+D LH +SA++DSLEAG
Sbjct  315   GRHQPPNSIISFLSEAKTLNPKLVTLVHEEVGLVGNQGFLYRFIDLLHQFSAIFDSLEAG  374

Query  713   FPMQDQARTLVERVFLGPKISVAITRSYRC--RGEEYGW-SWGEWVPENAGFRPKTISFA  883
                   AR  VERV  GP +S  +TR        E  G+ SW  W+  N GF+P  +SFA
Sbjct  375   -----PARGFVERVIFGPWVSGWLTRIAITDDDAEVEGFASWPLWLATN-GFKPVEVSFA  428

Query  884   NRCQAKLLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIWTSVHS  1021
             NRCQAKLLL LFNDGY +EE+G + ++LGWKSRRL+SAS W S  S
Sbjct  429   NRCQAKLLLSLFNDGYVVEELGKNGIVLGWKSRRLVSASFWASCDS  474



>gb|EMS67782.1| hypothetical protein TRIUR3_13261 [Triticum urartu]
Length=561

 Score =   366 bits (940),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 201/350 (57%), Positives = 245/350 (70%), Gaps = 19/350 (5%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPAS---KDDHPHGDALAAFQLLQDMSPYVKFGHFT  172
             RLAA+FTDALQ LLDG+ S+   S  AS      H  GD L AFQ+LQDMSPY+KFGHFT
Sbjct  168   RLAAHFTDALQGLLDGSHSVAGTSRQASMAASHHHSTGDVLTAFQMLQDMSPYMKFGHFT  227

Query  173   ANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgr  352
             ANQAILEAV  DRRVHIVDYD+ EGIQWASLMQA+ SR DG+  PHLRITA++R GG G 
Sbjct  228   ANQAILEAVAGDRRVHIVDYDLAEGIQWASLMQAMTSRPDGVSPPHLRITAITRSGGGGA  287

Query  353   rsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPH  532
             R   +VQE GRRL AFA SIGQPFSF  CRLDSDE F+P+ +++V+GE ++ NC+LH   
Sbjct  288   R---AVQEAGRRLAAFAGSIGQPFSFGHCRLDSDERFRPATVRMVKGETLVANCILHQAA  344

Query  533   FSY---RSPDSIASFLSGSATLNPR---------LVTLVEEEAAPPRDGGFVDRFMDTLH  676
              +    R   S+ASFL+G A+L  +              EEEA+    GGFV RFM+ LH
Sbjct  345   ATTTVRRPTGSVASFLTGMASLGAKVVTVVEEEGEAEKNEEEASDAAAGGFVGRFMEELH  404

Query  677   HYSALYDSLEAGFPMQDQARTLVERVFLGPKISVAITRSYRCRGEEYGWSWGEWVPENAG  856
              YSA++DSLEAGFP Q + R LVERV L P I+ A++R+YR    E    WGEW+   +G
Sbjct  405   RYSAVWDSLEAGFPTQSRVRGLVERVILAPNIAGAVSRAYRGTDGEGRRGWGEWM-RGSG  463

Query  857   FRPKTISFANRCQAKLLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIW  1006
             F    +S  N  QA+LLLGLFNDGY +EE   +K++LGWK+RRLLSAS+W
Sbjct  464   FEMVPLSCFNHSQARLLLGLFNDGYTVEETRPNKIVLGWKARRLLSASVW  513



>gb|AFP97590.1| nodulation signaling pathway 2-like protein [Diplotaxis tenuifolia]
Length=477

 Score =   363 bits (932),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 192/340 (56%), Positives = 232/340 (68%), Gaps = 8/340 (2%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTANQ  181
             RLAA+FT+ L  L   A            D H   D + AFQ+LQ+MSPY+ FG+ TA Q
Sbjct  144   RLAAHFTNGLSKLHKEANVQRQYGPHQHSDVHDQVDVILAFQMLQNMSPYINFGYLTATQ  203

Query  182   AILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrsF  361
             AIL+AV H+RR+HIVD DI +G+QW SLMQAL+SR  GL A HLRITALS      +   
Sbjct  204   AILDAVKHERRIHIVDNDITDGLQWPSLMQALVSRNKGLSAQHLRITALSHATNGKKS-V  262

Query  362   CSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHFSY  541
              +VQE GRRLTAFA S+GQPFS+H CR+DSD TF PS+LKLVRGEA+++NCMLHLP FS 
Sbjct  263   AAVQEAGRRLTAFAESLGQPFSYHPCRVDSD-TFNPSSLKLVRGEAVVINCMLHLPRFSN  321

Query  542   RSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGFPM  721
             + P SI SFLS + TLNP+LVTLV EE     + GF+ RFMD LH +SA++DSLEAG   
Sbjct  322   QPPSSIISFLSEAKTLNPKLVTLVHEEIGLMGNQGFLYRFMDLLHQFSAIFDSLEAG---  378

Query  722   QDQARTLVERVFLGPKISVAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISFANRCQAK  901
                AR  VERV  GP I   +TR       E   SW  W+  N GF+P  +SFANRCQAK
Sbjct  379   --PARGFVERVIFGPWILGWLTRLADDAEVESVASWPMWLAAN-GFKPVEVSFANRCQAK  435

Query  902   LLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIWTSVHS  1021
             L L LFN+GY +EE+  + L+LGWKSRRL+SAS W S  S
Sbjct  436   LFLSLFNNGYEVEELAQNGLVLGWKSRRLVSASFWASCES  475



>gb|AFP97594.1| nodulation signaling pathway 2-like protein [Brassica nigra]
Length=479

 Score =   363 bits (931),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 194/343 (57%), Positives = 237/343 (69%), Gaps = 11/343 (3%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTANQ  181
             RLAA+FT+ L  L   A            D +   D + AFQ+LQ+MSPY+ FG+ TA Q
Sbjct  143   RLAAHFTNGLSKLHREANVQRQCGPHQHPDVYDQVDVMLAFQMLQNMSPYINFGYLTATQ  202

Query  182   AILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrsF  361
             AILEAV H+RR+HIVD DI +G+QW SLMQAL+S   GL A HLRITALSR     +   
Sbjct  203   AILEAVKHERRIHIVDNDIKDGVQWPSLMQALVSGNTGLSAQHLRITALSRATNGKKS-V  261

Query  362   CSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHFSY  541
              +VQE GRRLTAFA SIGQPFS+H CR+DSD TF PS+LKLVRGEA+++NCMLHLP  S+
Sbjct  262   AAVQEAGRRLTAFAESIGQPFSYHHCRMDSD-TFNPSSLKLVRGEAVVINCMLHLPRLSH  320

Query  542   RSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGFPM  721
             + P+SI SFLS + TLNP+LVTLV EE     + GF+ RF+D LH +SA++DSLEA    
Sbjct  321   QPPNSIISFLSEAKTLNPKLVTLVHEEVGLVGNQGFLYRFLDLLHQFSAIFDSLEA----  376

Query  722   QDQARTLVERVFLGPKISVAITRSYRCRGE---EYGWSWGEWVPENAGFRPKTISFANRC  892
              D AR  VERV  GP +S  +TR      +   E   SW  W+  N GF+P  +SFANRC
Sbjct  377   -DPARGFVERVIFGPWVSGWLTRIAVTADDAEVESVASWPMWLATN-GFKPVEVSFANRC  434

Query  893   QAKLLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIWTSVHS  1021
             QAKLLL LFNDGY +EE+G + L+LGWKSRRL+SAS W S  S
Sbjct  435   QAKLLLSLFNDGYGVEELGKNGLVLGWKSRRLVSASFWASCES  477



>gb|AFP97588.1| nodulation signaling pathway 2-like protein [Sinapis alba]
Length=482

 Score =   363 bits (932),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 195/345 (57%), Positives = 241/345 (70%), Gaps = 14/345 (4%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASK--DDHPHGDALAAFQLLQDMSPYVKFGHFTA  175
             RLAA+FT+ L  L     ++  +  P  +  D H   D + AFQ+LQ+MSPY+ FG+ TA
Sbjct  145   RLAAHFTNGLSKL-HKETNVQRQYGPHQQHPDVHDQVDVMLAFQMLQNMSPYINFGYLTA  203

Query  176   NQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrr  355
              QAILEAV ++RR+HIVD DI +G+QW SLMQAL+SR  GL A HLRITALSR     + 
Sbjct  204   TQAILEAVQYERRIHIVDNDIKDGVQWPSLMQALVSRNTGLTAQHLRITALSRATNGKKS  263

Query  356   sFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHF  535
                +VQE GRRLTAFA SIGQPFS+H CR+DSD TF P +LKLVRGEA+++NCMLHLP F
Sbjct  264   -VTAVQEAGRRLTAFAESIGQPFSYHHCRMDSD-TFNPLSLKLVRGEAVVINCMLHLPRF  321

Query  536   SYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGF  715
             S++ P+SI SFLS + TLNP+LVTLV EE     + GF+ RFMD LH +SA++DSLE G 
Sbjct  322   SHQPPNSIISFLSEAKTLNPKLVTLVHEEVGLVGNQGFLYRFMDLLHQFSAIFDSLEEG-  380

Query  716   PMQDQARTLVERVFLGPKISVAITRSYRCRGE---EYGWSWGEWVPENAGFRPKTISFAN  886
                  AR  VERV  GP +S  +TR      +   E   SW  W+  N GF+P  +SFAN
Sbjct  381   ----PARGFVERVIFGPWVSGWLTRIAINADDAEVESVASWPLWLDTN-GFKPVEVSFAN  435

Query  887   RCQAKLLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIWTSVHS  1021
             RCQAKLLL LFNDGY +EE+G + L+LGWKSRRL+SAS W S  S
Sbjct  436   RCQAKLLLSLFNDGYEVEELGKNGLVLGWKSRRLVSASFWASCES  480



>gb|AFP97596.1| nodulation signaling pathway 2-like protein [Brassica juncea]
Length=479

 Score =   361 bits (927),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 194/343 (57%), Positives = 236/343 (69%), Gaps = 11/343 (3%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTANQ  181
             RLAA+FT+ L  L   A            D +   D + AFQLLQ+MSPY+ FG+ TA Q
Sbjct  143   RLAAHFTNGLSKLHREANVQRQCGPHQHPDVYDQVDVMLAFQLLQNMSPYINFGYLTATQ  202

Query  182   AILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrsF  361
             AILEAV H+RR+HIVD DI +G+QW SLMQAL+S   GL A HLRITALSR     +   
Sbjct  203   AILEAVKHERRIHIVDNDIKDGVQWPSLMQALVSGNTGLSAQHLRITALSRATNGKKS-V  261

Query  362   CSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHFSY  541
              +VQE GRRLTAFA SIGQPFS+H CR+DSD TF PS+LKLVRGEA+++NCMLHLP  S+
Sbjct  262   AAVQEAGRRLTAFAESIGQPFSYHHCRMDSD-TFNPSSLKLVRGEAVVINCMLHLPRLSH  320

Query  542   RSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGFPM  721
             + P+SI SFLS + TLNP+LVTLV EE     + GF+ RF+D LH +SA++DSLEA    
Sbjct  321   QPPNSIISFLSEAKTLNPKLVTLVHEEVGLVGNQGFLYRFLDLLHQFSAIFDSLEA----  376

Query  722   QDQARTLVERVFLGPKISVAITRSYRCRGE---EYGWSWGEWVPENAGFRPKTISFANRC  892
              D AR  VERV  GP +S  +TR      +   E   SW  W+  N GF+P  +SFANRC
Sbjct  377   -DPARGFVERVIFGPWVSGWLTRIAVTADDAEVESVASWPMWLATN-GFKPVEVSFANRC  434

Query  893   QAKLLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIWTSVHS  1021
             QAKLLL LFNDGY +EE+G + L+LGWKSRRL+ AS W S  S
Sbjct  435   QAKLLLSLFNDGYGVEELGKNGLVLGWKSRRLVLASFWASCES  477



>gb|KCW70581.1| hypothetical protein EUGRSUZ_F03769, partial [Eucalyptus grandis]
Length=471

 Score =   360 bits (924),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 204/326 (63%), Positives = 240/326 (74%), Gaps = 20/326 (6%)
 Frame = +2

Query  2    RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPH--------GDALAAFQLLQDMSPYVK  157
            RLAA+FTDALQ LL+GAG++       S    PH         D L AFQLLQDMSPYVK
Sbjct  148  RLAAHFTDALQGLLEGAGAVAQGGGKHSIGGRPHRLEGGYNQTDVLVAFQLLQDMSPYVK  207

Query  158  FGHFTANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrg  337
            FGHFTANQAILEAV  +RRVH+VDYDIMEG+QWASLMQAL+S+  G PAPHLRITA+SR 
Sbjct  208  FGHFTANQAILEAVGRERRVHVVDYDIMEGVQWASLMQALVSQDGGRPAPHLRITAVSRA  267

Query  338  ggsgrrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCM  517
                R    +VQETGRRL A+A S+GQPFSFHQ R+D DETF+P+ALKLV+GEA+  NCM
Sbjct  268  CSGRRS-ITTVQETGRRLAAYAKSVGQPFSFHQYRMDPDETFRPAALKLVQGEALFFNCM  326

Query  518  LHLPHFSYRSPDSIASFLSGSATLNPRLVTLV-EEEAAPPRDGGFVDRFMDTLHHYSALY  694
            LHLPH +Y +P SIASFLSG+  L+P LVTLV EE       GGF+ RFMD+LHHYSA+Y
Sbjct  327  LHLPHSTYHTPASIASFLSGARALSPTLVTLVEEEAGPAGGGGGFMGRFMDSLHHYSAVY  386

Query  695  DSLEAGFPMQDQARTLVERVFLGPKISVAITRSYRCR---------GEEYGWSWGEWVPE  847
            DSLEAGFPM D AR LVE+VFLGP+I+ ++ R YR R         G   G SWGEW+  
Sbjct  387  DSLEAGFPMPDWARALVEKVFLGPRIAGSLVRMYRGRPGEEEEEEEGSGKGGSWGEWLVA  446

Query  848  NAGFRPKTISFANRCQAKLLLGLFND  925
              GF+P  +S +N CQAKLL+GLF+D
Sbjct  447  E-GFKPGRVSSSNHCQAKLLVGLFDD  471



>ref|XP_010926532.1| PREDICTED: nodulation-signaling pathway 2 protein-like [Elaeis 
guineensis]
Length=525

 Score =   346 bits (888),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 208/342 (61%), Positives = 248/342 (73%), Gaps = 14/342 (4%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHA---KSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFT  172
             RLA +FTDALQ LLDG+ S  A   +   + +DDH  GD LAAFQLLQDMSPYVKFGHFT
Sbjct  162   RLAVHFTDALQGLLDGSSSAAAGGGRQSASHRDDH-TGDVLAAFQLLQDMSPYVKFGHFT  220

Query  173   ANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgr  352
             ANQAILEAV  DRRVHIVDYDI EG+QWASLMQA +SR+DG   PHLRITA++RGGG G 
Sbjct  221   ANQAILEAVAADRRVHIVDYDIAEGVQWASLMQAFVSREDGPQPPHLRITAVTRGGGGGV  280

Query  353   rsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPH  532
             R    VQETGRRL AFA+SIG PF+F QCRLD+DE F+P  +K+V+GEA++ NC+L  P 
Sbjct  281   R---GVQETGRRLAAFASSIGLPFAFGQCRLDADERFRPGGVKVVKGEAVVANCVLQPPQ  337

Query  533   --FSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGG-FVDRFMDTLHHYSALYDSL  703
                + R   S+ASFLSG+A L  R+V +VEEE       G FV RFM  LH YSA++DSL
Sbjct  338   GAGTRREAGSVASFLSGAAALGARVVAVVEEEEEGLEGEGDFVGRFMGELHRYSAVWDSL  397

Query  704   EAGFPMQDQARTLVERVFLGPKISVAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISFA  883
             +AGFP+Q  AR +VERV LGP+I+ A+ R+YR  GE              GF    IS  
Sbjct  398   DAGFPIQGLARGMVERVILGPRIAGAVGRAYRGIGEGGWGE----WMVGRGFGRVGISCF  453

Query  884   NRCQAKLLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIWT  1009
             N CQA+LLLGLFNDGYR+EE G +KL+L WKS+RL SASIW+
Sbjct  454   NHCQARLLLGLFNDGYRVEEDGPNKLVLAWKSQRLTSASIWS  495



>ref|XP_003558300.1| PREDICTED: nodulation-signaling pathway 2 protein-like [Brachypodium 
distachyon]
Length=580

 Score =   336 bits (862),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 198/361 (55%), Positives = 246/361 (68%), Gaps = 30/361 (8%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKS------------FPASKDDHPHGDALAAFQLLQDMS  145
             RLAA+FTDALQ LLDG+  L                       +   D L AFQ+LQDMS
Sbjct  174   RLAAHFTDALQGLLDGSHPLSGAGKQAAAMAAAASSSSLHHHHYNASDVLTAFQMLQDMS  233

Query  146   PYVKFGHFTANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITA  325
             PY+KFGHFTANQAILEAV  DRRVH+VDYD+ EGIQWASLMQA+ SR DG+  PHLRITA
Sbjct  234   PYMKFGHFTANQAILEAVAGDRRVHVVDYDLAEGIQWASLMQAMTSRPDGVSPPHLRITA  293

Query  326   LsrgggsgrrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAII  505
             ++RGGG G R   +VQE GRRL AFA SIGQPFSF  CRLDSDE F+P+ +++V+GE ++
Sbjct  294   VTRGGGGGAR---AVQEAGRRLAAFAGSIGQPFSFGHCRLDSDERFRPATVRMVKGETLV  350

Query  506   VNCMLHLPHFSY---RSPDSIASFLSGSATLNPRLVTLVEEEAAPPRD-----------G  643
              NC+LH    +    R   S+ASFL+G A L  ++VT+VEEE     +           G
Sbjct  351   ANCILHQAAATTTVRRPTGSVASFLTGMAALGAKVVTVVEEEGEASSEKESDEKEEGAAG  410

Query  644   GFVDRFMDTLHHYSALYDSLEAGFPMQDQARTLVERVFLGPKISVAITRSYRCRGEEYGW  823
             GFV RFM+ LH YSA++DSLEAGFP Q + R LVERV LGP I+ A++R+YR   +    
Sbjct  411   GFVARFMEELHRYSAVWDSLEAGFPTQSRVRGLVERVILGPNIAGAVSRAYRGGMDGGRG  470

Query  824   SWGEWVPENAGFRPKTISFANRCQAKLLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASI  1003
              WGEW+   +GF+   +S  N  QA+LLLGLFNDGY +EE   +K++LGWK+RRLLSAS+
Sbjct  471   GWGEWM-RGSGFKAVPLSCFNHSQARLLLGLFNDGYTVEETRPNKIVLGWKARRLLSASV  529

Query  1004  W  1006
             W
Sbjct  530   W  530



>ref|XP_010065142.1| PREDICTED: uncharacterized protein LOC104452376 [Eucalyptus grandis]
Length=1169

 Score =   343 bits (881),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 174/237 (73%), Positives = 200/237 (84%), Gaps = 2/237 (1%)
 Frame = +2

Query  302   APHLRITALsrgggsgrrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALK  481
             A +LRITALSRGG   R    ++QE GRRLTAFA SIGQPFSFHQCRLDSD+TF+PS+LK
Sbjct  929   ANNLRITALSRGGNGRRS-IGTIQEMGRRLTAFATSIGQPFSFHQCRLDSDKTFRPSSLK  987

Query  482   LVRGEAIIVNCMLHLPHFSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRF  661
             LVRGEA+I NCMLHLPHFSYR+P+S+ASFLSG+ TLNPRLVTLVEEE  P  D GFV RF
Sbjct  988   LVRGEALIFNCMLHLPHFSYRAPESVASFLSGAKTLNPRLVTLVEEELGPIGDQGFVSRF  1047

Query  662   MDTLHHYSALYDSLEAGFPMQDQARTLVERVFLGPKISVAITRSYRCRGEEYGWSWGEWV  841
             +D+LHHYSALYDSLEAGFPMQ +AR LVERVFLGP+I  ++ R YR RG+E G SW E +
Sbjct  1048  IDSLHHYSALYDSLEAGFPMQRRARALVERVFLGPRIVGSLGRIYRTRGDEEGGSWRERL  1107

Query  842   PENAGFRPKTISFANRCQAKLLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIWTS  1012
                 GFRP  ISFAN CQAKLLLGLFNDGYR+EE+ +++L+LGWKSRRLLSASIW+S
Sbjct  1108  GA-TGFRPVDISFANHCQAKLLLGLFNDGYRVEELASNRLVLGWKSRRLLSASIWSS  1163



>ref|XP_002994176.1| hypothetical protein SELMODRAFT_1984, partial [Selaginella moellendorffii]
 gb|EFJ04766.1| hypothetical protein SELMODRAFT_1984, partial [Selaginella moellendorffii]
Length=381

 Score =   286 bits (733),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 165/343 (48%), Positives = 209/343 (61%), Gaps = 22/343 (6%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTANQ  181
             RLA YFT+ALQ+LLDGA         AS     + D++ AFQ L + SPY+KFGH+ ANQ
Sbjct  49    RLALYFTEALQSLLDGARITKV----ASSCSMSYLDSITAFQALHEASPYIKFGHYVANQ  104

Query  182   AILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrsF  361
             AILEA+  D+RVHI+DYD+  GIQW SLMQAL  R+ G   PHLRITA+       R   
Sbjct  105   AILEAIGDDKRVHILDYDVTLGIQWPSLMQALALREGG--TPHLRITAV--YRPHSRHQL  160

Query  362   CSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHFSY  541
              + QET  RL   AA+   PFSFHQ +++ DE  K   LKL++GE +IVNCMLHL H  +
Sbjct  161   ANFQETKERLMECAAAFKIPFSFHQAKVEDDEDSKLVGLKLIKGETLIVNCMLHLLHVPH  220

Query  542   RSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDG-GFVDRFMDTLHHYSALYDSLEAGFP  718
             +SP S+ SFL      +PRLVT VEEE          VD+F   LHHYSA+ DSLEA   
Sbjct  221   KSPSSVLSFLKSVQKFSPRLVTFVEEEVVSCLSAPNTVDKFFQALHHYSAILDSLEASL-  279

Query  719   MQDQARTLVERVFLGPKISVAITRSYRCRGEEYGWSWGEW--VPENAGFRPKTISFANRC  892
              +  A  LVER FL  +I  A+          +  S  EW  +  +AGF   ++S  N C
Sbjct  280   CETTAHILVERAFLATRIKTALI------AHHHAHSKVEWSSLLHSAGFHRVSLSRRNIC  333

Query  893   QAKLLLGLFNDGYRIEEIGN----HKLILGWKSRRLLSASIWT  1009
             QA+LLLGLF DGY+++E  +     KL+L WKSR L++AS WT
Sbjct  334   QARLLLGLFKDGYQLKEHHSDEEIEKLLLSWKSRPLIAASAWT  376



>ref|XP_002993042.1| hypothetical protein SELMODRAFT_136372 [Selaginella moellendorffii]
 gb|EFJ05881.1| hypothetical protein SELMODRAFT_136372 [Selaginella moellendorffii]
Length=437

 Score =   283 bits (723),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 154/338 (46%), Positives = 218/338 (64%), Gaps = 16/338 (5%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTANQ  181
             R+AAYF DAL   L G      K F  ++      D + AF +L ++ PY+KFGHF+ANQ
Sbjct  110   RIAAYFRDALNCRLHGL-----KFFSRTESLF---DTVGAFHVLHEICPYIKFGHFSANQ  161

Query  182   AILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrsF  361
             AILE+V  ++RVHIVD+DI +G+QW SLMQ+L  R  G   P L+ITAL     + + + 
Sbjct  162   AILESVAGEQRVHIVDFDITDGVQWPSLMQSLALRAGG--PPQLKITAL--YRPNAKGAL  217

Query  362   CSVQETGRRLTAFAASIGQPFSFHQCRLDSD-ETFKPSALKLVRGEAIIVNCMLHLPHFS  538
              + QETG+RL A A     PF F+Q R+D + E F+ S+LKL++GEA++VNCMLHLPH S
Sbjct  218   STTQETGKRLAACARQFNVPFVFNQVRVDGESEEFRSSSLKLIQGEALVVNCMLHLPHMS  277

Query  539   YRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGFP  718
               S D++  FL   A + PR++ +VEE+ +      F  RF + L+HYS L+DSLEA   
Sbjct  278   CHSRDAVRFFLGKMAAIRPRVLAIVEEDLSCT-STTFTGRFHEALYHYSTLFDSLEATLA  336

Query  719   MQDQARTLVERVFLGPKISVAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISFANRCQA  898
              +D+ R+LVERVFLGP+I   +T +    G+     W   + E  GF+ ++ S  NRCQA
Sbjct  337   SEDEMRSLVERVFLGPRIKNTVTSAVNFSGKMVKNRWS-GLAEAVGFQQRSFSSYNRCQA  395

Query  899   KLLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIWTS  1012
             +LL+GLF DG++I+E     ++L WKSR L++AS+W+S
Sbjct  396   RLLVGLFQDGHQIQE-DEDTMLLCWKSRPLIAASVWSS  432



>ref|XP_002965768.1| GRAS family protein [Selaginella moellendorffii]
 gb|EFJ33188.1| GRAS family protein [Selaginella moellendorffii]
Length=549

 Score =   284 bits (727),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 165/343 (48%), Positives = 209/343 (61%), Gaps = 22/343 (6%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTANQ  181
             RLA YFT+ALQ+LLDGA         AS     + D++ AFQ L + SPY+KFGH+ ANQ
Sbjct  208   RLALYFTEALQSLLDGARITKV----ASSCSMSYLDSITAFQALHEASPYIKFGHYVANQ  263

Query  182   AILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrsF  361
             AILEA+  D+RVHI+DYD+  GIQW SLMQAL  R+ G   PHLRITA+       R   
Sbjct  264   AILEAIGDDKRVHILDYDVTLGIQWPSLMQALALREGG--TPHLRITAV--YRPHSRHQL  319

Query  362   CSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHFSY  541
              + QET  RL   AA+   PFSFHQ +++ DE  K   LKL++GE +IVNCMLHL H  +
Sbjct  320   ANFQETKERLMECAAAFKIPFSFHQAKVEDDEDSKLVGLKLIKGETLIVNCMLHLLHVPH  379

Query  542   RSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDG-GFVDRFMDTLHHYSALYDSLEAGFP  718
             +SP S+ SFL      +PRLVT VEEE          VD+F   LHHYSA+ DSLEA   
Sbjct  380   KSPSSVLSFLKSVQKFSPRLVTFVEEEVVSCLSAPNTVDKFFQALHHYSAMLDSLEASL-  438

Query  719   MQDQARTLVERVFLGPKISVAITRSYRCRGEEYGWSWGEW--VPENAGFRPKTISFANRC  892
              +  A  LVER FL  +I  A+          +  S  EW  +  +AGF   ++S  N C
Sbjct  439   CETTAHILVERAFLATRIKTALI------AHHHAHSKVEWSSLLHSAGFHRVSLSRRNIC  492

Query  893   QAKLLLGLFNDGYRIEEIGN----HKLILGWKSRRLLSASIWT  1009
             QA+LLLGLF DGY+++E  +     KL+L WKSR L++AS WT
Sbjct  493   QARLLLGLFKDGYQLKEHHSDEEIEKLLLSWKSRPLIAASAWT  535



>ref|XP_002972121.1| GRAS family protein [Selaginella moellendorffii]
 gb|EFJ27038.1| GRAS family protein [Selaginella moellendorffii]
Length=538

 Score =   272 bits (695),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 155/350 (44%), Positives = 219/350 (63%), Gaps = 27/350 (8%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTANQ  181
             R+AAYF DAL   L G      K F  ++      D + AF +L ++ PY+KFGHF+ANQ
Sbjct  198   RIAAYFRDALNCRLHGL-----KFFSRTESQF---DTVGAFHVLHEICPYIKFGHFSANQ  249

Query  182   AILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrsF  361
             AILE+V  ++RVHI D+DI +G+QW SLMQ+L  R  G   P L+ITAL     + + + 
Sbjct  250   AILESVAGEQRVHIFDFDITDGVQWPSLMQSLALRAGG--PPQLKITAL--YRPNSKGAL  305

Query  362   CSVQETGRRLTAFAASIGQPFSFHQCRLDSD-ETFKPSALKLVRGEAIIVNCMLHLPHFS  538
              + QETG+RL A A     PF F+Q R+D + E F  S+LKL++GEA++VNCMLHLPH S
Sbjct  306   STTQETGKRLAACARQFNVPFVFNQVRVDGESEEFLSSSLKLIQGEALVVNCMLHLPHMS  365

Query  539   YRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGFP  718
               S D++  FL   A L PR++ +VEE+ +      F  RF + L+HYS L+DSLEA   
Sbjct  366   CHSRDAVRFFLGKMAALRPRVLAIVEEDLS-CTSTTFTGRFHEALYHYSTLFDSLEATLA  424

Query  719   MQDQARTLVERVFLGPKISVAITRSY-RCRGEEYGWSWGEW-----------VPENAGFR  862
              +D+ R+LVERVFLGP+I   +T +  R   E+   S  ++           + E  GF+
Sbjct  425   SEDEMRSLVERVFLGPRIKNTVTSAVSRSPLEKEAVSHVDFSGKMVKNRWSGLAEAVGFQ  484

Query  863   PKTISFANRCQAKLLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIWTS  1012
              ++ S  NRCQA+LL+GLF DG++I+E     ++L WKSR L++AS+W+S
Sbjct  485   QRSFSSYNRCQARLLVGLFQDGHQIQE-DEDTMLLCWKSRPLIAASVWSS  533



>emb|CDP12781.1| unnamed protein product [Coffea canephora]
Length=491

 Score =   218 bits (556),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 141/346 (41%), Positives = 194/346 (56%), Gaps = 28/346 (8%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTANQ  181
             RLA YFT   Q LLD   SL A   P      P  +A++AFQ+LQ++SPYVKF HFTANQ
Sbjct  157   RLALYFT---QGLLDK--SLTAPELPEDPVS-PQTNAISAFQMLQELSPYVKFAHFTANQ  210

Query  182   AILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrsF  361
             AILEA    + +H++D+D+MEGIQW SLM  L +R+D      LRITA++    S     
Sbjct  211   AILEATEGHQEIHVIDFDVMEGIQWPSLMVDLAAREDA----SLRITAIAGDKRSS----  262

Query  362   CSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHFSY  541
             C++Q+TG RL  FA SI   FSF Q  +  +E F+    ++  G  +I NCM++  H  Y
Sbjct  263   CNIQQTGFRLQDFANSINLSFSFDQVLVTKEEDFE----EIKVGHTLIANCMINQLHMPY  318

Query  542   RSPDSIASFLSGSATLNPRLVTLVEEE-----AAPPRDGGFVDRFMDTLHHYSALYDSLE  706
             R    + +F +G   L+P+++ LV+EE      AP     F + F + L HY+ALYDSL 
Sbjct  319   RESSLVKTFFNGLRKLSPKILVLVQEELFSFSKAP--STSFAEFFCEALDHYTALYDSLR  376

Query  707   AGFPMQDQ-ARTLVERVFLGPKISVAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISFA  883
             +GF    + A  ++E+ FL  +I  ++ + + C       +     P   GFRP   S  
Sbjct  377   SGFCAGYKLALKIIEKEFLRMRILDSV-KHFPCGIMGNESNMLPDYPSMNGFRPIPTSSC  435

Query  884   NRCQAKLLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIWTSVHS  1021
             N  QAK L+ LFN GY ++     KL L WKSR L +ASIW    S
Sbjct  436   NVTQAKHLISLFNGGYWVQN-EQCKLTLCWKSRPLTTASIWVPTAS  480



>ref|XP_006854562.1| hypothetical protein AMTR_s00030p00099410 [Amborella trichopoda]
 gb|ERN16029.1| hypothetical protein AMTR_s00030p00099410 [Amborella trichopoda]
Length=490

 Score =   210 bits (535),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 134/347 (39%), Positives = 188/347 (54%), Gaps = 33/347 (10%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTANQ  181
             RL  YFT +L + +    + H +  P   +      +L AF++LQD++PY+KF HFTANQ
Sbjct  168   RLIFYFTQSLSSRITRMET-HVEPGPIINE------SLQAFEVLQDLTPYIKFAHFTANQ  220

Query  182   AILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrsF  361
             AILE       +HI+D+DIMEGIQW  LM  L  R +      LRITA+        R++
Sbjct  221   AILEGTHGVTGIHIIDFDIMEGIQWPPLMVELALRNEAF----LRITAI-VDSTQVDRNW  275

Query  362   CSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHFSY  541
              S Q TGRRL  FA SIG PF F Q  +     F+     L  GE ++VNCM+H+ H  Y
Sbjct  276   ASNQTTGRRLGEFANSIGLPFRFDQILVGKANGFE----GLETGEVLVVNCMMHMLHMPY  331

Query  542   RSPDSIASFLSGSATLNPRLVTLVEEEA---APPRDGGFVDRFMDTLHHYSALYDSLEAG  712
             R+ +S  +F+ G   L PR+V LV+EE           FVD F++   HY AL++SL  G
Sbjct  332   RNSNSRQTFMEGVRKLKPRMVVLVQEELFSFGKVLSQSFVDFFVEAFQHYHALFESLLNG  391

Query  713   FPMQDQ-ARTLVERVFLGPKIS-----VAITRSYRCRGEEYGWSWGEWVPENAGFRPKTI  874
             FP + +    ++E  FLGP+I        + +  + R  +YG+          GF+   +
Sbjct  392   FPSRSKLGLEMIEAAFLGPRILDCFQWFPLDKRKKGRLLDYGFLM-------QGFQVTPM  444

Query  875   SFANRCQAKLLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIWTSV  1015
             S +N  QAKLL+GLF   Y ++   N +L L WKSR + + SIW  V
Sbjct  445   SASNISQAKLLVGLFTGNYEVQH-ENCRLKLYWKSRPITTVSIWFPV  490



>gb|KHN29155.1| Nodulation-signaling pathway 2 protein [Glycine soja]
Length=376

 Score =   204 bits (519),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 140/342 (41%), Positives = 188/342 (55%), Gaps = 30/342 (9%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTANQ  181
             RLA +FT +L        S +A           H +A   FQ+LQ++SPYVKF HFTANQ
Sbjct  47    RLALFFTQSLYY-----KSTNAPELLQCGAVSTHTNAFCVFQVLQELSPYVKFAHFTANQ  101

Query  182   AILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrsF  361
             AILEA      +HI+D+DIMEGIQW  LM  L  ++       LR+TA++          
Sbjct  102   AILEATEGAEDLHIIDFDIMEGIQWPPLMVDLAMKKS---VNSLRVTAITVNQRGAD---  155

Query  362   CSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLH--LPHF  535
              SVQ+TGRRL  FAASI  PF F Q  ++ +E F+   L    G+ +IVNCM+H  +P+ 
Sbjct  156   -SVQQTGRRLKEFAASINFPFMFDQLMMEREEDFQGIEL----GQTLIVNCMIHQWMPN-  209

Query  536   SYRSPDSIASFLSGSATLNPRLVTLVEEEAAP-PR--DGGFVDRFMDTLHHYSALYDSLE  706
               RS   + +FL G   L+PRLV LVEEE    PR     FV+ F + LHHY+AL DSL 
Sbjct  210   --RSFSLVKTFLDGVTKLSPRLVVLVEEELFNFPRLKSMSFVEFFCEALHHYTALCDSLA  267

Query  707   AG-FPMQDQARTLVERVFLGPKISVAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISFA  883
             +  +       +L+E+  +G +I  ++ R + C  +E    W E      GF+   +S  
Sbjct  268   SNLWGSHKMELSLIEKEVIGLRILDSV-RQFPCERKER-MVWEEGFYSLKGFKRVPMSTC  325

Query  884   NRCQAKLLLGLFNDGYRIE-EIGNHKLILGWKSRRLLSASIW  1006
             N  QAK L+ LF  GY ++ E G  +L L WKSR L  ASIW
Sbjct  326   NISQAKFLVSLFGGGYWVQYEKG--RLALCWKSRPLTVASIW  365



>ref|XP_011012014.1| PREDICTED: nodulation-signaling pathway 2 protein-like [Populus 
euphratica]
Length=480

 Score =   207 bits (526),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 130/345 (38%), Positives = 190/345 (55%), Gaps = 34/345 (10%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHP-----HGDALAAFQLLQDMSPYVKFGH  166
             RLA +FT  L          H KS  A +   P         +++FQ+LQ++SPYVKF H
Sbjct  156   RLALFFTQGL----------HYKSITAPEMLLPRPGQRQQYNMSSFQVLQELSPYVKFAH  205

Query  167   FTANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggs  346
             FTANQAILE+   D+ +HI+D+DIMEGIQW  LM  L  R+D       ++TA+      
Sbjct  206   FTANQAILESTQGDQEIHIIDFDIMEGIQWPPLMVDLTMRKD----VSFKVTAIIGDQQD  261

Query  347   grrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHL  526
                   +VQ+TGRRL  +A SI  PF F Q  + ++E F+   +    G+ ++VNCM+H 
Sbjct  262   V----AAVQQTGRRLKEYADSINLPFVFKQMMMLNEEDFESVEV----GDTLVVNCMIHQ  313

Query  527   PHFSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRD---GGFVDRFMDTLHHYSALYD  697
              H   RS  SI +FL G + L+P+LV LVEEE           +V+ F + +HHY+ L D
Sbjct  314   LHMPNRSFSSIKTFLGGVSRLSPKLVVLVEEELYSFYKFPYMSYVEFFCEAIHHYTTLSD  373

Query  698   SLEAGFPMQDQAR-TLVERVFLGPKISVAITRSYRCRGEEYGWSWGEWVPENAGFRPKTI  874
             SL + F   ++    L+E+ +LG KI  ++++ + C  +E    W E      GF+P  +
Sbjct  374   SLVSSFVSANEMELKLIEKEYLGVKIVDSVSQ-FPCEKKER-LLWEEGFAALKGFKPVPL  431

Query  875   SFANRCQAKLLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIWT  1009
             S +N  QA  L+ LF+  + ++     +L L WKSR L +ASIW 
Sbjct  432   SSSNVSQANFLVSLFSGRFWVQH-EKCRLSLCWKSRPLTTASIWV  475



>ref|XP_007159815.1| hypothetical protein PHAVU_002G269800g [Phaseolus vulgaris]
 gb|ESW31809.1| hypothetical protein PHAVU_002G269800g [Phaseolus vulgaris]
Length=481

 Score =   206 bits (524),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 138/342 (40%), Positives = 184/342 (54%), Gaps = 28/342 (8%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTANQ  181
             RLA +FT  L      A  L  +   ++     H +A   FQ+LQ++SPYVKF HFTANQ
Sbjct  152   RLALFFTQGLYYKSTNAPELLQRGAVST-----HTNAFCVFQILQELSPYVKFAHFTANQ  206

Query  182   AILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrsF  361
             AILEA      VHI+D+DIMEGIQW  LM  L  R+       LR++A++          
Sbjct  207   AILEATEGAENVHIIDFDIMEGIQWPPLMVDLAMRKS---TTSLRVSAITVDQRGAA---  260

Query  362   CSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLH--LPHF  535
              S Q+TGRRL  FAASI  PF F Q  ++ +E  +   L     + +IVNCM+H  +P+ 
Sbjct  261   -SAQQTGRRLKEFAASINFPFVFDQIMMEREEDIQGIELD----QTLIVNCMIHQWMPN-  314

Query  536   SYRSPDSIASFLSGSATLNPRLVTLVEEEA---APPRDGGFVDRFMDTLHHYSALYDSLE  706
               RS   + +FL G   L+PRLV LVEEE    +  +   FV+ F + LHHY+AL DSL 
Sbjct  315   --RSFSLVKTFLDGVTKLSPRLVVLVEEELFNFSRLKSMSFVEFFCEALHHYTALCDSLA  372

Query  707   AG-FPMQDQARTLVERVFLGPKISVAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISFA  883
             +  +       TL+E+  LG +I  ++ R + C  EE    W E      GFR   +S  
Sbjct  373   SSLWGSHKMEMTLIEKEILGLRILDSV-REFPCEREERK-VWEEGFYSLKGFRCVPMSTC  430

Query  884   NRCQAKLLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIWT  1009
             N  QAK L+ LF  GY + +    +L L WKSR L  ASIW 
Sbjct  431   NISQAKFLVSLFGGGYWV-QFEKGRLALCWKSRPLTVASIWV  471



>ref|XP_006371003.1| hypothetical protein POPTR_0019s02540g [Populus trichocarpa]
 gb|ERP48800.1| hypothetical protein POPTR_0019s02540g [Populus trichocarpa]
Length=485

 Score =   205 bits (522),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 127/340 (37%), Positives = 189/340 (56%), Gaps = 24/340 (7%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTANQ  181
             RLA +FT  L        S+ A      +  +     +++FQ+LQ++SP VKF HFTANQ
Sbjct  161   RLALFFTQGLHY-----KSITAPEMLLPRPGYRQQYNMSSFQVLQELSPCVKFAHFTANQ  215

Query  182   AILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrsF  361
             AILE+   D+ +HI+D+DIMEGIQW  LM  L  R+D       ++TA+           
Sbjct  216   AILESTQGDQEIHIIDFDIMEGIQWPPLMVDLTMRKD----VSFKVTAIIGDQQDV----  267

Query  362   CSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHFSY  541
              +VQ+TGRRL  +A SI  PF F Q  + ++E F+   +    G+A++VNCM+H  H   
Sbjct  268   AAVQQTGRRLKEYADSINLPFVFKQMMMLNEEDFESIEM----GQALVVNCMIHQLHMPN  323

Query  542   RSPDSIASFLSGSATLNPRLVTLVEEEAAPPRD---GGFVDRFMDTLHHYSALYDSLEAG  712
             RS  SI +FL G + L+P+LV LVEEE           +V+ F + +HHY+ L DSL + 
Sbjct  324   RSFSSIKTFLGGVSRLSPKLVVLVEEELFSFYKFPYMSYVEFFCEAIHHYTTLSDSLVSS  383

Query  713   FPMQDQART-LVERVFLGPKISVAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISFANR  889
             F   ++    L+E+ +LG KI  ++++ + C+ +E    W E      GF+P  +S  N 
Sbjct  384   FLSANEMELRLIEKEYLGVKIVDSVSQ-FPCKKKER-LLWEEGFASLKGFKPVPLSSCNV  441

Query  890   CQAKLLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIWT  1009
              QA  L+ LF+  + ++     +L L WKSR L +ASIW 
Sbjct  442   SQANFLVSLFSGRFWVQH-EKCRLSLCWKSRPLTTASIWV  480



>ref|XP_004503962.1| PREDICTED: nodulation-signaling pathway 2 protein-like [Cicer 
arietinum]
Length=493

 Score =   205 bits (522),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 139/343 (41%), Positives = 182/343 (53%), Gaps = 33/343 (10%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDH--PHGDALAAFQLLQDMSPYVKFGHFTA  175
             RLA +FT  L      A   H         DH      +   FQ+LQ++SPYVKF HFTA
Sbjct  165   RLAIFFTKGLYYKTTNAPEFHW--------DHVSTQTKSFCVFQILQELSPYVKFAHFTA  216

Query  176   NQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrr  355
             NQAI EA      VH++D+DIMEGIQW SLM  L  R++      LR+TA++    S   
Sbjct  217   NQAIFEATEGVNDVHVIDFDIMEGIQWPSLMVDLAMRKN---TTSLRVTAITGDQQSA--  271

Query  356   sFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLH--LP  529
                SVQ+TGRRL  FA SI  PF F Q  +  +E F+   L    G  +IVNCM+H  +P
Sbjct  272   --ASVQQTGRRLKEFADSINFPFVFDQMMMAGEEDFRGIEL----GHTVIVNCMIHQWMP  325

Query  530   HFSYRSPDSIASFLSGSATLNPRLVTLVEEEA---APPRDGGFVDRFMDTLHHYSALYDS  700
             +   RS   + +F+ G   L+PRLV LVEEE    +  +   FV+ F + LHHY AL DS
Sbjct  326   N---RSFSLVKTFVDGVIKLSPRLVVLVEEELFNFSRLKSMSFVEFFCEALHHYIALSDS  382

Query  701   LEAGFPMQDQAR-TLVERVFLGPKISVAITRSYRCRGEEYGWSWGEWVPENAGFRPKTIS  877
             L +      +    L+E+  LG +I  ++ R + C  EE    W E      G++   +S
Sbjct  383   LVSTLLRSHKMELNLIEKEVLGVRILDSV-RQFPCEREERIL-WEERFYSLKGYKRVGMS  440

Query  878   FANRCQAKLLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIW  1006
               N  QAK L+ LF  GY + +  N KL L WKSR L S SIW
Sbjct  441   TCNISQAKFLISLFGKGYWV-QFENSKLALCWKSRPLTSVSIW  482



>ref|XP_003532857.2| PREDICTED: nodulation-signaling pathway 2 protein-like [Glycine 
max]
Length=487

 Score =   204 bits (518),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 140/342 (41%), Positives = 188/342 (55%), Gaps = 30/342 (9%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTANQ  181
             RLA +FT +L        S +A           H +A   FQ+LQ++SPYVKF HFTANQ
Sbjct  158   RLALFFTQSLYY-----KSTNAPELLQCGAVSTHTNAFCVFQVLQELSPYVKFAHFTANQ  212

Query  182   AILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrsF  361
             AILEA      +HI+D+DIMEGIQW  LM  L  ++       LR+TA++          
Sbjct  213   AILEATEGAEDLHIIDFDIMEGIQWPPLMVDLAMKKS---VNSLRVTAITVNQRGAD---  266

Query  362   CSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLH--LPHF  535
              SVQ+TGRRL  FAASI  PF F Q  ++ +E F+   L    G+ +IVNCM+H  +P+ 
Sbjct  267   -SVQQTGRRLKEFAASINFPFMFDQLMMEREEDFQGIEL----GQTLIVNCMIHQWMPN-  320

Query  536   SYRSPDSIASFLSGSATLNPRLVTLVEEEAAP-PR--DGGFVDRFMDTLHHYSALYDSLE  706
               RS   + +FL G   L+PRLV LVEEE    PR     FV+ F + LHHY+AL DSL 
Sbjct  321   --RSFSLVKTFLDGVTKLSPRLVVLVEEELFNFPRLKSMSFVEFFCEALHHYTALCDSLA  378

Query  707   AG-FPMQDQARTLVERVFLGPKISVAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISFA  883
             +  +       +L+E+  +G +I  ++ R + C  +E    W E      GF+   +S  
Sbjct  379   SNLWGSHKMELSLIEKEVIGLRILDSV-RQFPCERKER-MVWEEGFYSLKGFKRVPMSTC  436

Query  884   NRCQAKLLLGLFNDGYRIE-EIGNHKLILGWKSRRLLSASIW  1006
             N  QAK L+ LF  GY ++ E G  +L L WKSR L  ASIW
Sbjct  437   NISQAKFLVSLFGGGYWVQYEKG--RLALCWKSRPLTVASIW  476



>ref|XP_002276350.1| PREDICTED: nodulation-signaling pathway 2 protein-like [Vitis 
vinifera]
Length=484

 Score =   204 bits (518),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 131/343 (38%), Positives = 185/343 (54%), Gaps = 24/343 (7%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTANQ  181
             RLA +FT  L        S+ A   P  K      + ++AFQ+LQ++SPYVKF HFTANQ
Sbjct  159   RLALFFTQGLYY-----RSISAPEMPLQKPVSRQPNTMSAFQMLQELSPYVKFAHFTANQ  213

Query  182   AILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrsF  361
             AILEA    + VH++D+DIMEGIQW  LM  L  ++D      LRIT++     +     
Sbjct  214   AILEAAEGGQEVHVIDFDIMEGIQWPPLMVDLAVKKD----VSLRITSILSDQENVDI--  267

Query  362   CSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHFSY  541
               +Q+TGRRL  FA SI   F+F Q  +  +E F     ++  G+ +I NCM+H  +   
Sbjct  268   --IQQTGRRLKEFAESISLSFTFDQMVILREEDFD----RIEVGDTLIANCMIHQLYMPN  321

Query  542   RSPDSIASFLSGSATLNPRLVTLVEEEA---APPRDGGFVDRFMDTLHHYSALYDSLEAG  712
             RS   I +FL G + L+P++V LVEE+           FV+ F + LHHY+A  DSL + 
Sbjct  322   RSLSFIKTFLGGVSKLSPKIVVLVEEDLFNFCKIPTMSFVEFFCEALHHYAAFSDSLMSS  381

Query  713   FP-MQDQARTLVERVFLGPKISVAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISFANR  889
             F  +      L+E  FL  +I  ++ R + C  +E    W +       F+P  +S  N 
Sbjct  382   FSGIYKVGLRLIEEEFLRNRIWNSL-RQFPCEKKEKSL-WEDGFASLKRFKPIPLSSCNV  439

Query  890   CQAKLLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIWTSVH  1018
              QAK L+GLF+  Y ++   N +L L WKSR L +ASIW   H
Sbjct  440   AQAKFLVGLFSGEYWVKH-ENCRLALCWKSRPLTTASIWIHAH  481



>gb|KFK32147.1| hypothetical protein AALP_AA6G204300 [Arabis alpina]
Length=349

 Score =   199 bits (507),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 126/170 (74%), Gaps = 2/170 (1%)
 Frame = +2

Query  2    RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTANQ  181
            RLAA+FT+ L  LL+G       S    +D +   D ++AF++LQ+MSPYV FG+ TA Q
Sbjct  155  RLAAHFTNGLSKLLEGPNQQQRSSPQQPRDVYDQSDVISAFEMLQNMSPYVNFGYLTATQ  214

Query  182  AILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrsF  361
            AI+EAV ++RRVHIVDYDI EG QWASLMQAL+S+  G    HLRITAL     +G++S 
Sbjct  215  AIIEAVKYERRVHIVDYDITEGAQWASLMQALVSKNTGSSTQHLRITAL-SRATNGKKSV  273

Query  362  CSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVN  511
             SVQE GRRL AFA SIGQPFS+H C+LDSD TF PS+LKLVRGEA+++N
Sbjct  274  ASVQEAGRRLNAFAESIGQPFSYHHCKLDSD-TFNPSSLKLVRGEAVVIN  322



>ref|XP_001763820.1| predicted protein [Physcomitrella patens]
 gb|EDQ71462.1| predicted protein [Physcomitrella patens]
Length=368

 Score =   199 bits (505),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 130/341 (38%), Positives = 190/341 (56%), Gaps = 25/341 (7%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHG---DALAAFQLLQDMSPYVKFGHFT  172
             R+AA+FT+AL A + G      K  PA K+        D L+AF  L  + PY +FGHFT
Sbjct  47    RIAAFFTEALAARIVG------KDNPAYKNLMLQSHLDDYLSAFTTLYKICPYFQFGHFT  100

Query  173   ANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgr  352
             ANQAILEAV     VHI+D D+M+G QW   +Q+L  R+ G   P L+IT +        
Sbjct  101   ANQAILEAVEGYSVVHIIDMDLMQGFQWPGFIQSLSEREGG--PPKLKITGVGTSCT---  155

Query  353   rsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPH  532
                 S+Q+TGRRL AFA + G PF FH   +   E   P  L    GEA+ VNC++ L H
Sbjct  156   ----SLQDTGRRLAAFAETYGVPFEFHAV-VGELEDLSPMELGAKPGEAVAVNCVMQL-H  209

Query  533   FSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAG  712
                 + D + +F+SG  +++P ++TLVE+E A      F+ RF++ LH+Y+A++DSL++ 
Sbjct  210   RLLNNGDKLQNFISGLRSIHPVMLTLVEQE-ANHNTSSFMGRFVEALHYYAAVFDSLDSS  268

Query  713   FPMQDQARTLVERVFLGPKIS--VAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISFAN  886
              P+  + R  +E+++   +I   VA   + R    E    W + + + AGFR   +S  +
Sbjct  269   LPLASEERAKIEQLYFAQQIKNIVACEGADRIERHETLELWQKRM-KLAGFRQWPLSSHS  327

Query  887   RCQAKLLLGLF-NDGYRIEEIGNHKLILGWKSRRLLSASIW  1006
               QAKLLL L   DGY + +     + L W+ R LL+AS W
Sbjct  328   VTQAKLLLSLSPCDGYCLSQQPGGSISLNWQDRSLLTASTW  368



>ref|XP_003630217.1| GRAS family transcription factor [Medicago truncatula]
 ref|XP_003630229.1| GRAS family transcription factor [Medicago truncatula]
 gb|AET04693.1| GRAS family transcription factor [Medicago truncatula]
Length=507

 Score =   202 bits (514),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 134/342 (39%), Positives = 177/342 (52%), Gaps = 28/342 (8%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTANQ  181
             RL  +FT  L      A   H++                 FQ+LQ++SPYVKF HFTANQ
Sbjct  177   RLCLFFTQGLYYKTTNAPKFHSEHVST------QTSTFCVFQILQELSPYVKFAHFTANQ  230

Query  182   AILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrsF  361
             AI EA      VH++D+DIMEGIQW  LM     R+       LR+TA++    S     
Sbjct  231   AIFEATAGVEDVHVIDFDIMEGIQWPPLMVDFAMRK---KTTSLRVTAITVDLQSEA---  284

Query  362   CSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLH--LPHF  535
              SVQ+TGRRL  FA SI  PF+F    + S+E FK   L    GE  IVNCM+H  +P+ 
Sbjct  285   -SVQQTGRRLKEFADSINFPFTFDTVMMVSEEDFKEIEL----GETFIVNCMIHQWMPN-  338

Query  536   SYRSPDSIASFLSGSATLNPRLVTLVEEEA---APPRDGGFVDRFMDTLHHYSALYDSLE  706
               RS   + +FL      +PRLV LVEEE    +  +   FV+ F + LHHY A+ DSL 
Sbjct  339   --RSFSLVKAFLDCVTKSSPRLVVLVEEELFNFSRLKSMSFVEFFCEALHHYIAVSDSLV  396

Query  707   AGFPMQDQAR-TLVERVFLGPKISVAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISFA  883
             +      +    L+E+  LG +I  ++ R + C  EE     G +     G++   +S  
Sbjct  397   STLSRSHKMELALIEKEVLGNRILDSV-RQFPCEKEERILWEGRFFYSLKGYKRVGMSTC  455

Query  884   NRCQAKLLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIWT  1009
             N  QAKLL+ LF  GY + +  N KL L WKSR L S SIW 
Sbjct  456   NISQAKLLVSLFGKGYWV-QFENCKLALCWKSRPLTSVSIWV  496



>ref|XP_004250446.1| PREDICTED: nodulation-signaling pathway 2 protein-like [Solanum 
lycopersicum]
Length=492

 Score =   199 bits (506),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 134/341 (39%), Positives = 187/341 (55%), Gaps = 20/341 (6%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTANQ  181
             RLA YFT AL  L     +   +    ++       ++ AFQ+LQ++SPYVKF HFTANQ
Sbjct  153   RLALYFTQAL--LCKTLNNSSHELLNLNQYQSEFTSSMTAFQMLQEISPYVKFAHFTANQ  210

Query  182   AILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrsF  361
             AILEA    ++VHI+D+DI+EGIQW  LM  L+ R  G     LRIT+L     +     
Sbjct  211   AILEATKGSQQVHILDFDIIEGIQWPPLMVDLVER--GNTNSSLRITSLVSDHSNS----  264

Query  362   CSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRG-EAIIVNCMLHLPHFS  538
             C V++TG+RL  FA SI  PF F Q  L+  E  +     +V G   +I N M+H  H  
Sbjct  265   CHVEKTGQRLQEFANSINLPFMFDQILLEDLEKLQ----VVVEGHNNLIANVMIHQLHMP  320

Query  539   YRSPDSIASFLSGSATLNPRLVTLVEEE---AAPPRDGGFVDRFMDTLHHYSALYDSLEA  709
              R    + +F +G   L+P+LV LVEEE    +      FV+ F + LHHY+ +YDS+  
Sbjct  321   QRGSSLVKTFFNGLRKLSPKLVVLVEEELFNLSKISSMPFVEFFCEALHHYTTIYDSILG  380

Query  710   GFPMQDQ-ARTLVERVFLGPKISVAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISFAN  886
             GF    + A  ++E+ FL  +I  ++ +    + E   WS G +  +  GFR   +S +N
Sbjct  381   GFGGGYKLALRVIEKEFLRVRILDSLRQFPSDKLERERWSKGLYSLK--GFRQIPMSSSN  438

Query  887   RCQAKLLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIWT  1009
               QAK L+ LF+ GY ++     KL L WKSR L SASIW 
Sbjct  439   VRQAKHLVSLFSGGYWVQN-EQSKLALCWKSRPLTSASIWV  478



>ref|XP_004308265.1| PREDICTED: nodulation-signaling pathway 2 protein-like [Fragaria 
vesca subsp. vesca]
Length=475

 Score =   198 bits (504),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 125/310 (40%), Positives = 175/310 (56%), Gaps = 21/310 (7%)
 Frame = +2

Query  101   HGDALAAFQLLQDMSPYVKFGHFTANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALI  280
             + D +++FQ+LQ++SPYVKF HFTANQAILE+   D  +H++D+DIMEG QW SLM  L 
Sbjct  176   NTDTMSSFQMLQELSPYVKFAHFTANQAILESTQEDEDIHVIDFDIMEGSQWPSLMVDLA  235

Query  281   SRQDGLPAPHLRITALsrgggsgrrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDET  460
              R+ G     LR+TA++    S        Q+TGRRL  F+ SI   F F Q  + ++E 
Sbjct  236   MRK-GRRCASLRVTAVTVDQQSAAL----AQQTGRRLKEFSESINLSFIFDQMMVATEED  290

Query  461   FKPSALKLVRGEAIIVNCMLHLPHFSYRSPDSIASFLSGSATLNPRLVTLVEEE-----A  625
             F       V  +A+I NCM+H  H   RS   + +FL G + L+P+L+ LV+EE      
Sbjct  291   FPKIE---VIDDAVIANCMIHQLHMPNRSISFVKTFLGGMSKLSPKLIVLVQEELFNFYK  347

Query  626   APPRDGGFVDRFMDTLHHYSALYDSLEAGFPMQ-DQARTLVERVFLGPKISVAITRSYRC  802
              P     F + F + LHHY+AL DSL + F  +       +E+  LG KI  ++ R + C
Sbjct  348   MPSM--FFAEFFSEALHHYNALCDSLVSSFSREYKMGLRQIEKEVLGVKILESV-RQFPC  404

Query  803   RGEEYGWSWGEWVPENAGFRPKTISFANRCQAKLLLGLFNDGYRIE-EIGNHKLILGWKS  979
               EE    W +      GF+   +S +N  QAK L+ LF+ GY ++ E G  +L L WKS
Sbjct  405   EKEERML-WEDCFASLKGFKSIPLSSSNVSQAKYLVSLFHRGYWVQHEKG--RLSLCWKS  461

Query  980   RRLLSASIWT  1009
             R L SASIW 
Sbjct  462   RPLTSASIWV  471



>ref|XP_010931005.1| PREDICTED: nodulation-signaling pathway 2 protein-like [Elaeis 
guineensis]
Length=495

 Score =   197 bits (502),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 140/344 (41%), Positives = 185/344 (54%), Gaps = 35/344 (10%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTANQ  181
             +LA YF   L+   +  G+       +   D      ++A+Q+LQ++SPYVKFGHFTANQ
Sbjct  155   QLACYFAQGLRPRTNDLGANGVSPVRSMVSD-----GMSAYQMLQELSPYVKFGHFTANQ  209

Query  182   AILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrsF  361
             AILEA   DR VHIVD+D+MEGIQW  LM    SR        L ITAL   G       
Sbjct  210   AILEATEGDREVHIVDFDVMEGIQWPPLMVDFASRA----GTSLWITALVEAGNVEV---  262

Query  362   CSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGE-AIIVNCMLHLPHFS  538
               V  TGRRL  FA SIG P  F    +D++   +    ++  GE ++I+NCM++     
Sbjct  263   --VHRTGRRLVEFADSIGLPLRFDWLYVDNEGDLE----RVEAGEGSLIINCMVNQLERP  316

Query  539   YRSPDSIASFLSGSATLNPRLVTLVEEE-----AAPPRDGGFVDRFMDTLHHYSALYDSL  703
              RS  S+ + L G   L+P+LV LVEEE      +P +   FV+ F + LHH+SA+ DSL
Sbjct  317   SRSFQSLNALLGGVRKLSPKLVVLVEEELFSFGKSPFKS--FVEFFCEALHHFSAILDSL  374

Query  704   EAGF-PMQDQARTLVERVFLGPKISVAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISF  880
             +  F         LVER  LGP+I  ++    R   E  GW  G    E  GFR   +S 
Sbjct  375   KGSFVGGYRMGLRLVEREMLGPRIMESVGHFLR---EMKGWGGGFRGLE--GFRAIPLSS  429

Query  881   ANRCQAKLLLGLFNDGYRIE-EIGNHKLILGWKSRRLLSASIWT  1009
              N  QAK L+GLF+ GY ++ E G  +L L WKSR L + SIW 
Sbjct  430   CNVSQAKFLVGLFSKGYGVQHERG--RLSLCWKSRPLTTVSIWV  471



>ref|XP_006351042.1| PREDICTED: nodulation-signaling pathway 2 protein-like [Solanum 
tuberosum]
Length=494

 Score =   196 bits (499),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 133/337 (39%), Positives = 181/337 (54%), Gaps = 18/337 (5%)
 Frame = +2

Query  2    RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTANQ  181
            RLA YFT AL        S    +   ++       ++ AFQ+LQ++SPYVKF HFTANQ
Sbjct  153  RLALYFTQALLCKTLNNSSHELLNQNQNQYQSEFTSSMTAFQMLQEISPYVKFAHFTANQ  212

Query  182  AILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrsF  361
            AILEA     +VHI+D+DIMEGIQW  LM  L+ R  G     LRIT+L     +     
Sbjct  213  AILEATKGSEQVHILDFDIMEGIQWPPLMVDLVER--GNTNSSLRITSLVSDHSNS----  266

Query  362  CSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRG-EAIIVNCMLHLPHFS  538
            C VQ+TG+RL  FA SI  PF F Q  L+  E  +     +V G   +I N M+H  H  
Sbjct  267  CHVQKTGKRLQEFANSINLPFMFDQILLEDLEKIQV----VVEGHNNLIANVMIHQLHMP  322

Query  539  YRSPDSIASFLSGSATLNPRLVTLVEEE---AAPPRDGGFVDRFMDTLHHYSALYDSLEA  709
             R    + +F +G   L+P+LV LVEEE    +      FV+ F + LHHY+ +YDS+  
Sbjct  323  QRGSSLVKTFFNGLRKLSPKLVVLVEEELFNLSKISSMSFVEFFCEALHHYTTIYDSILG  382

Query  710  GFPMQDQ-ARTLVERVFLGPKISVAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISFAN  886
            GF      A  ++E+ FL  +I  ++ +    +     WS G +  +  GFR   +S +N
Sbjct  383  GFGGGYMLALRVIEKEFLRVRILDSLRQFPSDKLGREKWSKGLYSLK--GFRQSPMSSSN  440

Query  887  RCQAKLLLGLFNDGYRIEEIGNHKLILGWKSRRLLSA  997
              QAK L+ LF+ GY ++   N KL L WKSR L SA
Sbjct  441  VRQAKHLVSLFSGGYWVQNEQN-KLALCWKSRPLTSA  476



>ref|XP_001773669.1| predicted protein [Physcomitrella patens]
 gb|EDQ61557.1| predicted protein [Physcomitrella patens]
Length=326

 Score =   192 bits (487),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 125/340 (37%), Positives = 187/340 (55%), Gaps = 21/340 (6%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGS-LHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTAN  178
             R+AA+FT+ L A + G    ++      S+ D    D L+AF  L  + PY +FGHF AN
Sbjct  3     RVAAFFTEGLAARMVGKDKPMYKNLMVQSRLD----DYLSAFTTLYKVCPYFQFGHFAAN  58

Query  179   QAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrs  358
             QAILEAV     VHI+D D+M+G+QW   +Q+L  R+DG   P L+IT +          
Sbjct  59    QAILEAVEGRSVVHIIDMDLMQGLQWPGFIQSLSEREDG--PPKLKITGIGTSCN-----  111

Query  359   FCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHFS  538
               S+Q+TGRRL +FA + G PF FH   +   E   P  L    GEA+ VNC++ L H  
Sbjct  112   --SLQDTGRRLASFAETYGVPFEFHAV-VGELEDLTPMELGAKPGEAVAVNCVMQL-HRL  167

Query  539   YRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGFP  718
               + D + +F++G  +L+P ++TLVE+EA       F+ RF++ +H+Y+A++DSL++  P
Sbjct  168   LNNGDKLHNFIAGLRSLHPVMLTLVEQEAN-HNTSSFLGRFVEAVHYYAAVFDSLDSSLP  226

Query  719   MQDQARTLVERVFLGPKIS--VAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISFANRC  892
             +  + R  +E+++   +I   VA     R    E    W + +   AGFR   +S     
Sbjct  227   LASEERAKIEQLYFAQQIKNIVACEGVDRIERHETLDLWQKRMV-TAGFRQLPLSSHAVT  285

Query  893   QAKLLLGLF-NDGYRIEEIGNHKLILGWKSRRLLSASIWT  1009
             QAKLLL L    GYR+ +     + L W+ + LLSAS W 
Sbjct  286   QAKLLLSLSPCGGYRLSQQPGGSISLNWQDQCLLSASSWV  325



>ref|XP_009761269.1| PREDICTED: nodulation-signaling pathway 2 protein-like [Nicotiana 
sylvestris]
Length=500

 Score =   196 bits (497),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 135/345 (39%), Positives = 185/345 (54%), Gaps = 26/345 (8%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDA-LAAFQLLQDMSPYVKFGHFTAN  178
             RLA YFT   Q LL  + S  +          P   + + AFQ+LQ++SPYVKF HFTAN
Sbjct  159   RLALYFT---QGLLYKSLSTSSHELLNQNQFQPESSSSITAFQMLQEISPYVKFAHFTAN  215

Query  179   QAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrs  358
             QAILEA    ++VHI+D+DI+EGIQW  LM  L+ R  G     LRITA+     +    
Sbjct  216   QAILEATKGSQQVHILDFDILEGIQWPPLMVDLVER--GNINSSLRITAVVVDKNNSFL-  272

Query  359   FCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRG----EAIIVNCMLHL  526
                VQ+TG+RL  FA SI  PF F Q  L  DE      L+ ++G      +I N M+H 
Sbjct  273   ---VQKTGKRLQEFADSINLPFMFDQVFLTKDED-----LENIQGVESHNNLIANVMIHQ  324

Query  527   PHFSYRSPDSIASFLSGSATLNPRLVTLVEEE---AAPPRDGGFVDRFMDTLHHYSALYD  697
              H   R    +  F +G   L+P++V LVEEE           FV+ F + LHHY+ + D
Sbjct  325   LHIPQRGSSLVKIFFNGLRRLSPKVVVLVEEELFNLTKIPTMSFVEFFCEALHHYTTISD  384

Query  698   SLEAGFPMQDQ-ARTLVERVFLGPKISVAITRSYRCRGEEYGWSWGEWVPENAGFRPKTI  874
             S+  GF    + A  ++E+ FLG +I   + +    + E   WS G +  +  GFR   +
Sbjct  385   SILGGFGGGYKLALRVIEKEFLGVRILDCVRQFPSEKSEREKWSEGLYSLK--GFRQIPM  442

Query  875   SFANRCQAKLLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIWT  1009
             S +N  QAK L+ LF+ GY ++   + KL L WKSR L +ASIW 
Sbjct  443   SSSNVRQAKHLVSLFSGGYWVQN-EHCKLALCWKSRPLTTASIWV  486



>ref|XP_002992412.1| hypothetical protein SELMODRAFT_135151, partial [Selaginella 
moellendorffii]
 gb|EFJ06562.1| hypothetical protein SELMODRAFT_135151, partial [Selaginella 
moellendorffii]
Length=371

 Score =   191 bits (485),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 129/343 (38%), Positives = 187/343 (55%), Gaps = 24/343 (7%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHG--DALAAFQLLQDMSPYVKFGHFTA  175
             R+A +FTDAL A L+G G    +S+ A +   P    + L A+ +L  + PY+KF HFT+
Sbjct  43    RVATHFTDALYARLNGTGY---RSYTALRAYDPASLEEILGAYHILYQVCPYIKFAHFTS  99

Query  176   NQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrr  355
             NQAI EA   ++ VHI+D +I++G QW + MQAL +RQ G  APHLRIT +         
Sbjct  100   NQAIFEAFEGEQSVHIIDLEILQGYQWPAFMQALAARQGG--APHLRITGVGMPLE----  153

Query  356   sFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHF  535
                +VQETG+RL   AA++  PF +H    +  E  +   L    GEA+ VNC+      
Sbjct  154   ---AVQETGKRLADLAATLRVPFEYHAVG-ERLEDLQSHMLHRRHGEALAVNCIDRFHRL  209

Query  536   ---SYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLE  706
                 +   + +   LS      PR+VTLVE+EA+   +  F+ RF++ +H+YSA++DSLE
Sbjct  210   FTDDHLVVNPVVRILSMIREQAPRIVTLVEQEASHNTN-SFLKRFLEAMHYYSAIFDSLE  268

Query  707   AGFPMQDQARTLVERVFLGPKIS--VAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISF  880
             A  P     R  VE+V    +I   VA   S R    E    W + + E+ GF    +S 
Sbjct  269   ATLPQVSPERAKVEQVVFSSEIMNIVACEGSQRIVRHEKVDKWCK-IMESIGFYNVALSP  327

Query  881   ANRCQAKLLLGLF-NDGYRIEEIGNHKLILGWKSRRLLSASIW  1006
             +   Q+KLLL L+  DGY + E     L+LGW+ R ++ AS W
Sbjct  328   SAVHQSKLLLRLYQTDGYTLVE-DKGCLLLGWQDRAIIGASAW  369



>ref|XP_009606529.1| PREDICTED: nodulation-signaling pathway 2 protein-like [Nicotiana 
tomentosiformis]
Length=500

 Score =   193 bits (490),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 134/345 (39%), Positives = 183/345 (53%), Gaps = 26/345 (8%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGD-ALAAFQLLQDMSPYVKFGHFTAN  178
             RLA YFT   Q LL  + S  +          P    ++  FQ+LQ++SPYVKF HFTAN
Sbjct  159   RLAMYFT---QGLLYKSLSTSSHELLNQNQFQPESSPSITPFQMLQEISPYVKFAHFTAN  215

Query  179   QAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrs  358
             QAILEA    ++VHI+D+DIMEGIQW  LM  L+ R  G     LRITA+     +    
Sbjct  216   QAILEATKGSQQVHILDFDIMEGIQWPPLMVDLVER--GNFNSSLRITAVVVDKNNSF--  271

Query  359   FCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRG----EAIIVNCMLHL  526
                VQ+T +RL  FA SI  PF F Q  L  +E      L+ ++G      +I N M+H 
Sbjct  272   --HVQKTCKRLQEFADSINLPFIFDQVFLTKEED-----LENIQGVESHNNLIANVMIHQ  324

Query  527   PHFSYRSPDSIASFLSGSATLNPRLVTLVEEE---AAPPRDGGFVDRFMDTLHHYSALYD  697
              H   R    + +F +G   L+P++V LVEEE           FV+ F + LHHY+ + D
Sbjct  325   LHIPQRGSSLVKTFFNGLRRLSPKIVVLVEEELFNLTKIPSMSFVEFFCEALHHYTTISD  384

Query  698   SLEAGFPMQDQ-ARTLVERVFLGPKISVAITRSYRCRGEEYGWSWGEWVPENAGFRPKTI  874
             S+  GF    + A  ++E+ FLG +I +   R + C   E    W E +    GFR   +
Sbjct  385   SILGGFGGGYKLALRVIEKEFLGVRI-LDCVRQFPCEKSERE-KWSEGLYSLKGFRQIPM  442

Query  875   SFANRCQAKLLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIWT  1009
             S +N  QAK L+ LF+ GY ++   + KL L WKSR L +ASIW 
Sbjct  443   SSSNVRQAKHLVSLFSGGYWVQN-EHCKLALCWKSRPLTTASIWV  486



>ref|XP_002450783.1| hypothetical protein SORBIDRAFT_05g018070 [Sorghum bicolor]
 gb|EES09771.1| hypothetical protein SORBIDRAFT_05g018070 [Sorghum bicolor]
Length=781

 Score =   196 bits (498),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 139/361 (39%), Positives = 191/361 (53%), Gaps = 49/361 (14%)
 Frame = +2

Query  2     RLAAYFTDALQALL-------------------DGAGSLHAK-SFPASKDDHPHGDALAA  121
             R+A+YF DAL A L                    GAG+  A  +FP      P  D L  
Sbjct  442   RVASYFADALAARLTLSSNPSSCSSSGGVATPRGGAGAGVAPYTFP------PSPDTLKI  495

Query  122   FQLLQDMSPYVKFGHFTANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLP  301
             +Q+L    PYVKF HFTANQAI EA   + RVH+VD DI++G QW + +QAL +R  G  
Sbjct  496   YQILYQACPYVKFAHFTANQAIFEAFHGEDRVHVVDLDILQGYQWPAFLQALAARPGG--  553

Query  302   APHLRITALsrgggsgrrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALK  481
              P LR+T +            +V+ETGR L + AAS+  PF FH    D  E  +P AL+
Sbjct  554   PPTLRLTGVGHPS-------AAVRETGRHLASLAASLRVPFEFHAAVADRLERLRPGALQ  606

Query  482   LVRGEAIIVNCMLHLPHFSYRSPD-SIASFLSGSATLNPRLVTLVEEEAAPPRDGG-FVD  655
                GEA+ VN +  L    +R P   +   LS      P+++TLVE+EA    +G  F+ 
Sbjct  607   RRVGEALAVNAVNRL----HRVPGVHLGPLLSMIRDQAPKIMTLVEQEAG--HNGPYFLG  660

Query  656   RFMDTLHHYSALYDSLEAGFPMQDQARTLVERVFLGPKIS--VAITRSYRCRGEEYGWSW  829
             RF++ LH+YSA++DSL+A FP     R  VE+  L P+I   VA   + R    E    W
Sbjct  661   RFLEALHYYSAIFDSLDATFPADSAPRMKVEQCLLAPEIRNVVACEGAERVARHERLDRW  720

Query  830   GEWVPENAGFRPKTISFANRCQAKLLLGLF--NDGYRIEEIGNHKLILGWKSRRLLSASI  1003
                + E  GF P  +S A   Q+++LLGL+   DGYR+ E     L+LGW+ R +++AS 
Sbjct  721   RRLM-EGRGFEPVPLSPAAVGQSQVLLGLYGAGDGYRLTE-DKGCLLLGWQDRAIIAASA  778

Query  1004  W  1006
             W
Sbjct  779   W  779



>ref|XP_004980521.1| PREDICTED: DELLA protein GAI-like [Setaria italica]
Length=753

 Score =   196 bits (497),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 134/361 (37%), Positives = 191/361 (53%), Gaps = 49/361 (14%)
 Frame = +2

Query  2     RLAAYFTDALQALL--------------------DGAGSLHAKSFPASKDDHPHGDALAA  121
             R+A+YF DAL A L                      A  +   +FP      P  + L  
Sbjct  414   RVASYFADALAARLSLSSNPSSSSSSSGAATPRGGAAAGVAPYTFP------PSPETLKI  467

Query  122   FQLLQDMSPYVKFGHFTANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLP  301
             +Q+L    PY+KF HFTANQAI EA   + RVH+VD DI++G QW + +QAL +R  G  
Sbjct  468   YQILYQACPYIKFAHFTANQAIFEAFAGEDRVHVVDLDILQGYQWPAFLQALAARPGG--  525

Query  302   APHLRITALsrgggsgrrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALK  481
              P LR+T +            +V+ETGR L + AAS+  PF FH    D  E  +P+AL+
Sbjct  526   PPTLRLTGVGHPA-------AAVRETGRHLASLAASLRVPFEFHAAAADRLERLRPAALQ  578

Query  482   LVRGEAIIVNCMLHLPHFSYRSPDS-IASFLSGSATLNPRLVTLVEEEAAPPRDGG-FVD  655
                GEA+ VN +  L    +R P + +   LS      P+++TLVE+EA    +G  F+ 
Sbjct  579   RRVGEALAVNAVNRL----HRVPSAHLGPLLSMIRDQAPKIMTLVEQEAG--HNGPYFLG  632

Query  656   RFMDTLHHYSALYDSLEAGFPMQDQARTLVERVFLGPKIS--VAITRSYRCRGEEYGWSW  829
             RF++ LH+YSA++DSL+A FP     R  VE+  L P+I   VA   + R    E    W
Sbjct  633   RFLEALHYYSAIFDSLDATFPADSAPRMKVEQCLLAPEIRNVVACEGAERVARHERLDRW  692

Query  830   GEWVPENAGFRPKTISFANRCQAKLLLGLF--NDGYRIEEIGNHKLILGWKSRRLLSASI  1003
                + E  GF P  +S A   Q+++LLGL+  +DGYR+ E     L+LGW+ R +++AS 
Sbjct  693   RRLM-EGRGFEPVPLSPAAIGQSQVLLGLYGASDGYRLTE-DKGCLLLGWQDRAIIAASA  750

Query  1004  W  1006
             W
Sbjct  751   W  751



>ref|XP_008810295.1| PREDICTED: protein SCARECROW-like [Phoenix dactylifera]
Length=361

 Score =   189 bits (479),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 128/340 (38%), Positives = 183/340 (54%), Gaps = 26/340 (8%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTANQ  181
             R+ AYFT A+      A  +            PH   L+AFQ   ++SP++KF HFTANQ
Sbjct  41    RVVAYFTKAM------ASRVMNSWLGFCSPLVPHKSILSAFQAFNNISPFIKFSHFTANQ  94

Query  182   AILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrsF  361
             AILEA+    RVHI+D DIM+G+QW +L   L SR +G   PH+R+T L         S 
Sbjct  95    AILEALHQKERVHIIDLDIMQGLQWPALFHILASRANG--PPHVRMTGL-------GASM  145

Query  362   CSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHFSY  541
               ++ETGR+L+ FA  +G  F FH     + +   PS +   RGEA+ V+ + H  + + 
Sbjct  146   AVLEETGRQLSNFARRLGMSFEFHPIAKRAGDV-DPSMVPSQRGEAVAVHWLQHALYDAT  204

Query  542   RSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGFPM  721
                ++    L     L PR++TLVE+E A    G F+DRF+++LH+YS ++DSL    P 
Sbjct  205   GPDNNTMRLLE---LLAPRVITLVEQEMA--HAGSFLDRFVESLHYYSTIFDSLGMSLPF  259

Query  722   QDQARTLVERVFLGPKISVAITRSYRCR-GEEYGWSWGEWVPENAGFRPKTISFANRCQA  898
              D +R  VE   L  +I+  +      R GEE   SW   +    GF    +S  +  QA
Sbjct  260   DDASRHRVEHGLLSREINNILAIGGPARNGEEKFVSWRMELARR-GFMQVPMSGNSMAQA  318

Query  899   KLLLGLF--NDGYRIEEIGNHKLILGWKSRRLLSASIWTS  1012
             +L+L +F  + GY I + G+  L LGWK  RL +AS WTS
Sbjct  319   QLILNMFPPSLGYTIFQ-GDGTLRLGWKDTRLYTASAWTS  357



>ref|XP_008781634.1| PREDICTED: nodulation-signaling pathway 2 protein-like [Phoenix 
dactylifera]
Length=448

 Score =   190 bits (483),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 137/340 (40%), Positives = 182/340 (54%), Gaps = 31/340 (9%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTANQ  181
             +LA YF   L+A  +  G+     FP         D ++A+Q+LQ++SPYVKFGHF ANQ
Sbjct  130   QLAYYFAQGLRARTNDLGA--NDVFPVHS---MASDGMSAYQMLQELSPYVKFGHFAANQ  184

Query  182   AILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrsF  361
             AILEA   DR V IVD D+MEGIQW  LM  L SR        L ITAL   G       
Sbjct  185   AILEATEGDREVRIVDLDVMEGIQWPPLMVDLASR----IGTSLWITALVEAGNVE----  236

Query  362   CSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGE-AIIVNCMLHLPHFS  538
              +V  TGRRL  FA SIG P  F   +++ +   +    ++  GE ++++NCM++     
Sbjct  237   -AVHRTGRRLVEFADSIGLPLRFDCLQVNKEGDLE----RVEAGEGSLVINCMVNQLQRP  291

Query  539   YRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDG---GFVDRFMDTLHHYSALYDSLEA  709
              RS  S+   L G+  L P+LV LVEE+      G    FV+ F + LHH+SA++DSL  
Sbjct  292   SRSFKSLNFLLGGARKLRPKLVVLVEEDLFSFGKGPFKSFVEFFCEALHHFSAIFDSLNC  351

Query  710   GFPMQ-DQARTLVERVFLGPKISVAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISFAN  886
              F         LVER  LGP+I  ++ +  +   E  GW  G    E  GFR   +S  N
Sbjct  352   SFVGDYRMGLRLVEREMLGPRIVDSVGKFLK---EMEGWGGGFSGLE--GFRTIPLSSCN  406

Query  887   RCQAKLLLGLFNDGYRIE-EIGNHKLILGWKSRRLLSASI  1003
               QAK L+GLF  GY ++ E G  +L L WKSR L + SI
Sbjct  407   VSQAKFLVGLFGRGYGVQHEKG--RLALSWKSRPLTTVSI  444



>ref|XP_003553957.1| PREDICTED: protein SCARECROW-like [Glycine max]
Length=681

 Score =   194 bits (492),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 134/342 (39%), Positives = 191/342 (56%), Gaps = 27/342 (8%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHG--DALAAFQLLQDMSPYVKFGHFTA  175
             R+A  FTD+L A L+   +L  K    SK   P    + L  +Q++    PYVKF HFTA
Sbjct  358   RVAVCFTDSLSARLNS--TLTPKPATPSKPLTPSNSLEVLKIYQIVYQACPYVKFAHFTA  415

Query  176   NQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrr  355
             NQAI EAV  + RVH++D DI++G QW + MQAL +R  G  AP LRIT +         
Sbjct  416   NQAIFEAVEIEERVHVIDLDILQGYQWPAFMQALAARPAG--APFLRITGV-------GP  466

Query  356   sFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHF  535
                +V+ETGR LT  A S+  PF FH    +  E  KP  L    GEA+ VN + HL   
Sbjct  467   LLDAVRETGRCLTELAHSLRIPFEFHAVG-EQLEDLKPHMLNRRVGEALAVNAVNHL---  522

Query  536   SYRSP-DSIASFLSGSATLNPRLVTLVEEEAAPPRDGG-FVDRFMDTLHHYSALYDSLEA  709
              +R P + + + L+      P +VTLVE+EA+   +G  F+ RF++ LH+YSA++DSL+A
Sbjct  523   -HRVPGNHLGNLLTMLRDQAPSIVTLVEQEAS--HNGPYFLGRFLEALHYYSAIFDSLDA  579

Query  710   GFPMQDQARTLVERVFLGPKIS--VAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISFA  883
              FP +   R  VE+    P+I   VA   + R    E    W + + E  GF+   +S  
Sbjct  580   TFPAESAQRAKVEQYIFAPEIRNIVACEGAERFERHERLEKWRK-IMEGKGFKGVALSPN  638

Query  884   NRCQAKLLLGLFN-DGYRIEEIGNHKLILGWKSRRLLSASIW  1006
                Q+K+LLGL++ +GYR+ E     L+LGW+ R +++AS W
Sbjct  639   AVTQSKILLGLYSCEGYRLTE-DKGCLLLGWQDRAIIAASAW  679



>ref|XP_008680172.1| PREDICTED: DELLA protein GAI-like [Zea mays]
 gb|AFW60842.1| hypothetical protein ZEAMMB73_473687 [Zea mays]
 gb|AIB04575.1| GRAS transcription factor, partial [Zea mays]
Length=771

 Score =   194 bits (494),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 134/352 (38%), Positives = 186/352 (53%), Gaps = 40/352 (11%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAG-----------SLHAKSFPASKDDHPHGDALAAFQLLQDMSP  148
             R+A+YF DAL A L                +   +FP      P  D L  +Q+L    P
Sbjct  441   RVASYFADALAARLSSNNPSSSAGAGAGAGVAPYTFP------PSPDTLKVYQILYQACP  494

Query  149   YVKFGHFTANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITAL  328
             Y+KF HFTANQAI EA   + RVH+VD DI++G QW + +QAL +R  G P   LR+T +
Sbjct  495   YIKFAHFTANQAIFEAFHGEDRVHVVDLDILQGYQWPAFLQALAARPGGPPT--LRLTGV  552

Query  329   srgggsgrrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIV  508
                         +V+ETGR L + AAS+  PF FH    D  E  +P+AL    GEA+ V
Sbjct  553   GHPA-------AAVRETGRHLASLAASLRVPFEFHAAVADRLERLRPAALHRRVGEALAV  605

Query  509   NCMLHLPHFSYRSPD-SIASFLSGSATLNPRLVTLVEEEAAPPRDGG-FVDRFMDTLHHY  682
             N +  L    +R P   +   LS      P+++TLVE+EA    +G  F+ RF++ LH+Y
Sbjct  606   NAVNRL----HRVPAVHLGPLLSMIRDQAPKIMTLVEQEAG--HNGPYFLGRFLEALHYY  659

Query  683   SALYDSLEAGFPMQDQARTLVERVFLGPKIS--VAITRSYRCRGEEYGWSWGEWVPENAG  856
             SA++DSL+A FP     R  VE+  L P+I   VA   + R    E    W   + E  G
Sbjct  660   SAIFDSLDATFPADSAQRMKVEQCLLAPEIRNVVACEGAERVARHERLDRW-RRIMEGRG  718

Query  857   FRPKTISFANRCQAKLLLGLF--NDGYRIEEIGNHKLILGWKSRRLLSASIW  1006
             F P  +S A   Q+++LLGL+   DGYR+ E     L+LGW+ R  ++AS W
Sbjct  719   FEPVPLSPAAVAQSQVLLGLYGAGDGYRLTE-DRGCLLLGWQDRATIAASAW  769



>ref|XP_009405522.1| PREDICTED: DELLA protein GAI-like [Musa acuminata subsp. malaccensis]
Length=726

 Score =   194 bits (493),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 135/342 (39%), Positives = 186/342 (54%), Gaps = 29/342 (8%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAK--SFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTA  175
             R+A+ FTDAL A L  + S   K   FP      P  D L  +Q++    PY+KF HFTA
Sbjct  405   RVASCFTDALSARLSPSTSSSRKYARFPP-----PAPDVLKIYQIIYQACPYIKFAHFTA  459

Query  176   NQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrr  355
             NQAI EA   +  VH++D DI++G QW + +QAL +R  G PA  LRIT +         
Sbjct  460   NQAIFEAFESEDCVHVIDLDILQGYQWPAFLQALAARPGGAPA--LRITGVGHPAD----  513

Query  356   sFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHF  535
                SV+ETGR L   A S+  PF FH   ++  E  +PS L    GEA+ VN +  L   
Sbjct  514   ---SVRETGRHLAELAHSLRVPFEFHAATVERLEDLRPSMLHRRVGEALAVNSVNRL---  567

Query  536   SYRSPDS-IASFLSGSATLNPRLVTLVEEEAAPPRDGG-FVDRFMDTLHHYSALYDSLEA  709
              +R P + +   L+      P++ TLVE+EA+   +G  F+ RF++ LH+YSA++DSL+A
Sbjct  568   -HRVPGAHLGPLLAMIRDQAPKIFTLVEQEAS--HNGPYFLGRFLEALHYYSAIFDSLDA  624

Query  710   GFPMQDQARTLVERVFLGPKIS--VAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISFA  883
              FP    AR  VE+  L P+I   VA   S R    E    W   V E  GF    +S  
Sbjct  625   TFPSDSAARAKVEQFLLAPEIRNIVACEGSERVARHERLERW-RRVMEGRGFEGVALSAN  683

Query  884   NRCQAKLLLGLFN-DGYRIEEIGNHKLILGWKSRRLLSASIW  1006
                Q+K+LLGL+  DGYR+ E     L+LGW+ R +++AS W
Sbjct  684   AVNQSKILLGLYPCDGYRLTE-DKGCLLLGWQDRPIIAASAW  724



>ref|XP_008379744.1| PREDICTED: DELLA protein RGL1-like [Malus domestica]
Length=704

 Score =   194 bits (492),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 132/343 (38%), Positives = 189/343 (55%), Gaps = 26/343 (8%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAK-SFPASKDDHPHG--DALAAFQLLQDMSPYVKFGHFT  172
             R+A+ FTDAL A L    + + + S P      P    + L  +Q++    PY+KF HFT
Sbjct  378   RVASCFTDALSARLAATLTTNPRASAPQPFSPFPPNSLEILKIYQIVYQACPYIKFAHFT  437

Query  173   ANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgr  352
             ANQAI EA   + RVH++D DI++G QW + MQAL +R  G  AP LRIT +        
Sbjct  438   ANQAIFEAFESEERVHVIDLDILQGYQWPAFMQALAARPSG--APFLRITGVGPCIE---  492

Query  353   rsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPH  532
                 +V+ETGR LT  A S+  PF FH    +  E  KP       GEA+ VN +  L  
Sbjct  493   ----AVKETGRCLTELALSLHVPFEFHAVG-EQLEDLKPHMFNRRIGEALAVNTVNRL--  545

Query  533   FSYRSP-DSIASFLSGSATLNPRLVTLVEEEAAPPRDGG-FVDRFMDTLHHYSALYDSLE  706
               +R P + + + L+      P +VTLVE+EA+   +G  F+ RF++ LH+YSA++DSL+
Sbjct  546   --HRVPVNXLGNLLAMIRDQAPNIVTLVEQEAS--HNGPYFLGRFLEALHYYSAIFDSLD  601

Query  707   AGFPMQDQARTLVERVFLGPKIS--VAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISF  880
             A FP     R  VE+    P+I   VA   + R    E    W + V E+ GF+   +S 
Sbjct  602   ATFPPDSAQRAKVEQYIFAPEIRNIVACEGAERTERHERLEKWRK-VMESKGFKSVALSA  660

Query  881   ANRCQAKLLLGLFN-DGYRIEEIGNHKLILGWKSRRLLSASIW  1006
                 Q+K+LLGL++ DGYR+ E  N  L+LGW+ R +++AS W
Sbjct  661   NAVTQSKILLGLYSCDGYRMTE-DNGCLLLGWQDRSIMAASAW  702



>gb|ABA93922.1| GRAS family transcription factor containing protein [Oryza sativa 
Japonica Group]
Length=772

 Score =   194 bits (492),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 123/306 (40%), Positives = 175/306 (57%), Gaps = 23/306 (8%)
 Frame = +2

Query  107   DALAAFQLLQDMSPYVKFGHFTANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISR  286
             + L  +Q+L    PY+KF HFTANQAI EA   + RVH+VD DI++G QW + +QAL +R
Sbjct  482   ETLKVYQILYQACPYIKFAHFTANQAIFEAFHGEDRVHVVDLDILQGYQWPAFLQALAAR  541

Query  287   QDGLPAPHLRITALsrgggsgrrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFK  466
               G   P LR+T +            +V+ETGR L + AAS+  PF FH    D  E  +
Sbjct  542   PGG--PPTLRLTGVGHPP-------AAVRETGRHLASLAASLRVPFEFHAAAADRLERLR  592

Query  467   PSALKLVRGEAIIVNCMLHLPHFSYRSPDS-IASFLSGSATLNPRLVTLVEEEAAPPRDG  643
             P+AL    GEA+ VN +  L    +R P S +   LS      P+++TLVE+EAA   +G
Sbjct  593   PAALHRRVGEALAVNAVNRL----HRVPSSHLPPLLSMIRDQAPKIITLVEQEAA--HNG  646

Query  644   G-FVDRFMDTLHHYSALYDSLEAGFPMQDQARTLVERVFLGPKIS--VAITRSYRCRGEE  814
               F+ RF++ LH+YSA++DSL+A FP +  AR  VE+  L P+I   VA   + R    E
Sbjct  647   PYFLGRFLEALHYYSAIFDSLDATFPAESTARMKVEQCLLAPEIRNVVACEGAERVARHE  706

Query  815   YGWSWGEWVPENAGFRPKTISFANRCQAKLLLGLF--NDGYRIEEIGNHKLILGWKSRRL  988
                 W   + E  GF    +S A   Q+++LLGL+   DGYR+ E  +  L+LGW+ R +
Sbjct  707   RLERWRRLM-EGRGFEAVPLSAAAVGQSQVLLGLYGAGDGYRLTE-DSGCLLLGWQDRAI  764

Query  989   LSASIW  1006
             ++AS W
Sbjct  765   IAASAW  770



>ref|XP_009346793.1| PREDICTED: DELLA protein RGL1-like [Pyrus x bretschneideri]
Length=704

 Score =   192 bits (489),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 132/343 (38%), Positives = 189/343 (55%), Gaps = 26/343 (8%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAK-SFPASKDDHPHG--DALAAFQLLQDMSPYVKFGHFT  172
             R+A+ FTDAL A L    + + + S P      P    + L  +Q++    PY+KF HFT
Sbjct  378   RVASCFTDALSARLAATLTTNPRASAPQPFSPFPPNSLEILKIYQIVYQACPYIKFAHFT  437

Query  173   ANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgr  352
             ANQAI EA   + RVH++D DI++G QW + MQAL +R  G  AP LRIT +        
Sbjct  438   ANQAIFEAFESEERVHVIDLDILQGYQWPAFMQALAARPGG--APFLRITGVGPCIE---  492

Query  353   rsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPH  532
                 +V+ETGR LT  A S+  PF FH    +  E  KP       GEA+ VN +  L  
Sbjct  493   ----AVKETGRCLTELALSLHVPFEFHAVG-EQLEDLKPHMFNRRIGEALAVNTVNRL--  545

Query  533   FSYRSP-DSIASFLSGSATLNPRLVTLVEEEAAPPRDGG-FVDRFMDTLHHYSALYDSLE  706
               +R P + + + L+      P +VTLVE+EA+   +G  F+ RF++ LH+YSA++DSL+
Sbjct  546   --HRVPVNCLGNLLAMIRDQAPNIVTLVEQEAS--HNGPYFLGRFLEALHYYSAIFDSLD  601

Query  707   AGFPMQDQARTLVERVFLGPKIS--VAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISF  880
             A FP     R  VE+    P+I   VA   + R    E    W + V E+ GF+   +S 
Sbjct  602   ATFPPDSAQRAKVEQYIFAPEIRNIVACEGAERTERHERLDKWRK-VMESKGFKSVALSA  660

Query  881   ANRCQAKLLLGLFN-DGYRIEEIGNHKLILGWKSRRLLSASIW  1006
                 Q+K+LLGL++ DGYR+ E  N  L+LGW+ R +++AS W
Sbjct  661   NAVTQSKILLGLYSCDGYRMTE-DNGCLLLGWQDRSIMAASAW  702



>ref|XP_010935956.1| PREDICTED: protein SCARECROW-like [Elaeis guineensis]
Length=361

 Score =   186 bits (472),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 129/340 (38%), Positives = 182/340 (54%), Gaps = 26/340 (8%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTANQ  181
             R+ AYFT A+      A  +            PH   L+AFQ   ++SP++KF HFTANQ
Sbjct  41    RVVAYFTKAM------ASRVMNSWLGFCSPLVPHKSILSAFQAFNNISPFIKFAHFTANQ  94

Query  182   AILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrsF  361
             AILEA+    RVHI+D DIM+G+QW +L   L +R DG   PH+R+T L         S 
Sbjct  95    AILEALHQKERVHIIDLDIMQGLQWPALFHILATRADG--PPHVRMTGL-------GTSM  145

Query  362   CSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHFSY  541
               ++ETGR+L+ FA  +G  F FH     + +   PS +   RGEA+ V+ + H   +  
Sbjct  146   AMLEETGRQLSNFARRLGMSFEFHPIAKRAGDV-DPSMVPSQRGEAVAVHWLQH-ALYDA  203

Query  542   RSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGFPM  721
               PD     L     L PR++TLVE+E A    G F+DRF+++LH+YSA++DSL    P 
Sbjct  204   TGPDRNTMRL--LELLAPRVITLVEQEMA--HTGSFLDRFVESLHYYSAVFDSLGMSLPF  259

Query  722   QDQARTLVERVFLGPKISVAITRSYRCR-GEEYGWSWGEWVPENAGFRPKTISFANRCQA  898
              +  R  VE   L  +I+  +      R GEE   SW   +    GF    +S  +  QA
Sbjct  260   DNPGRHRVEHGLLSREINNILAIGGPARSGEEKFVSWRMEL-ACRGFVQMPMSGNSMAQA  318

Query  899   KLLLGLF--NDGYRIEEIGNHKLILGWKSRRLLSASIWTS  1012
             +L+L +F  + GY I + G+  L LGWK  RL +AS WT+
Sbjct  319   QLILNMFPPSLGYTIFQ-GDGTLRLGWKETRLYTASAWTT  357



>ref|XP_002968015.1| GRAS family protein, partial [Selaginella moellendorffii]
 gb|EFJ31362.1| GRAS family protein, partial [Selaginella moellendorffii]
Length=504

 Score =   189 bits (480),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 130/344 (38%), Positives = 188/344 (55%), Gaps = 26/344 (8%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHG--DALAAFQLLQDMSPYVKFGHFTA  175
             R+A +FTDAL A L+G G    +S+ A +   P    + L A+ +L  + PY+KF HFT+
Sbjct  176   RVATHFTDALYARLNGTGY---RSYTALRAYDPASLEEILGAYHILYQVCPYIKFAHFTS  232

Query  176   NQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrr  355
             NQAI EA   ++ VHI+D +I++G QW + MQAL +RQ G  APHLRIT +         
Sbjct  233   NQAIFEAFEGEQSVHIIDLEILQGYQWPAFMQALAARQGG--APHLRITGVGMPLE----  286

Query  356   sFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHF  535
                +VQETG+RL   AA++  PF +H    +  E  +   L    GEA+ VNC+      
Sbjct  287   ---AVQETGKRLADLAATLRVPFEYHAVG-ERLEDLQSHMLHRRHGEALAVNCIDRFHRL  342

Query  536   ---SYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLE  706
                 +   + +   LS      PR+VTLVE+EA    +  F+ RF++ +H+YSA++DSLE
Sbjct  343   FTDDHLVVNPVVRILSMIREQAPRIVTLVEQEANHNTN-SFLKRFLEAMHYYSAIFDSLE  401

Query  707   AGFPMQDQARTLVERVFLGPKIS--VAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISF  880
             A  P     R  VE+V    +I   VA   S R    E    W + + E+ GF    +S 
Sbjct  402   ATLPQVSPERAKVEQVVFSSEIMNIVACEGSQRIVRHEKVDKWCK-IMESIGFYNVALSP  460

Query  881   ANRCQAKLLLGLF-NDGYR-IEEIGNHKLILGWKSRRLLSASIW  1006
             +   Q+KLLL L+  DGY  +E+ G   L+LGW+ R ++ AS W
Sbjct  461   SAVHQSKLLLRLYQTDGYTLVEDKGC--LLLGWQDRAIIGASAW  502



>ref|XP_002982342.1| hypothetical protein SELMODRAFT_116328 [Selaginella moellendorffii]
 gb|EFJ16587.1| hypothetical protein SELMODRAFT_116328 [Selaginella moellendorffii]
Length=554

 Score =   189 bits (480),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 130/342 (38%), Positives = 186/342 (54%), Gaps = 25/342 (7%)
 Frame = +2

Query  2     RLAAYFTDALQA-LLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTAN  178
             R+AAYF++A+ A +++    ++A   P         + +AAFQ+   + P VKF HFTAN
Sbjct  232   RMAAYFSEAMNARMVNSCLGVYAPLIP-EMHKVSSKNTIAAFQVFNSLCPLVKFSHFTAN  290

Query  179   QAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrs  358
             QAILEA+  +  VHI+D D+M+G+QW +L   L SR  G   P +R+T L          
Sbjct  291   QAILEALDGEDSVHILDLDVMQGLQWPALFHILASRPRG--PPRVRLTGLGA--------  340

Query  359   FCS--VQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPH  532
              CS  +++TG+RL+ FAAS+G PF FH    D      P  L + R EA+ V+C   L H
Sbjct  341   -CSDTLEQTGKRLSEFAASLGLPFEFHGVA-DKIGNLDPLKLGVRRNEALAVHC---LHH  395

Query  533   FSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAG  712
               Y    S    L+    L P+++T VE++ +    G F+ RF++ LH+YSAL+DSL A 
Sbjct  396   SLYDITGSDVKALALLRQLRPKIITTVEQDLS--HSGSFLHRFVEALHYYSALFDSLGAS  453

Query  713   FPMQDQARTLVERVFLGPKISVAITRSYRCR-GEEYGWSWGEWVPENAGFRPKTISFANR  889
              P  +  R +VE+  L  +I   +      R GEE   SW E   + AGFR   +     
Sbjct  454   LPEDNTERHVVEQQLLSCEIKNILAVGGPARTGEEKFGSWREEF-QRAGFRAVALGGNAS  512

Query  890   CQAKLLLGLF-NDGYRIEEIGNHKLILGWKSRRLLSASIWTS  1012
              QA LLLG+F  +G+ + E G   L L WK   LL+AS W+S
Sbjct  513   AQASLLLGMFPCEGFALVEDG-ELLKLAWKDMCLLTASAWSS  553



>ref|XP_008791129.1| PREDICTED: DELLA protein RGL3-like [Phoenix dactylifera]
Length=717

 Score =   191 bits (484),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 133/340 (39%), Positives = 185/340 (54%), Gaps = 26/340 (8%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTANQ  181
             R+A+ F DAL A +  + S  +   P      P  D L  +Q+L    PY+KF HFTANQ
Sbjct  397   RVASCFADALAARISPSPSSSSSPRPW----FPTLDTLKIYQILYQACPYIKFAHFTANQ  452

Query  182   AILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrsF  361
             AI EA   + RVH+VD DI++G QW + +QAL +R  G PA  LRIT +           
Sbjct  453   AIFEAFESEDRVHVVDLDIVQGYQWPAFLQALAARPGGPPA--LRITGVGHPAE------  504

Query  362   CSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHFSY  541
              SV++TGR L   A S+  PF FH    D  E   P  L    GEA+ VN +  L    +
Sbjct  505   -SVRQTGRHLAELAHSLRVPFEFHAAVADRLEDLLPGMLHRRIGEALAVNAVCRL----H  559

Query  542   RSPDS-IASFLSGSATLNPRLVTLVEEEAAPPRDGG-FVDRFMDTLHHYSALYDSLEAGF  715
             R P + +   LS      P++VTLVE EA+   +G  F+ RF++ LH+YSA++DSL+A F
Sbjct  560   RVPGAHLGQLLSMIRDQAPKIVTLVEHEAS--HNGPYFLGRFLEALHYYSAIFDSLDATF  617

Query  716   PMQDQARTLVERVFLGPKIS--VAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISFANR  889
             P    AR  VE+    P+I   VA   + R    E    W + V E  GF+   +S  + 
Sbjct  618   PADSAARAKVEQYIFAPEIKNIVASEGAERVARHERLGRWRK-VMEGRGFKGVALSANSV  676

Query  890   CQAKLLLGLFN-DGYRIEEIGNHKLILGWKSRRLLSASIW  1006
              Q+++LLGL+  DGYR+ E  N  L+LGW+ R +++AS W
Sbjct  677   NQSRILLGLYACDGYRLTE-DNGCLLLGWQDRAIIAASAW  715



>ref|XP_004138798.1| PREDICTED: DELLA protein GAI1-like [Cucumis sativus]
 gb|KGN63151.1| hypothetical protein Csa_2G405020 [Cucumis sativus]
Length=685

 Score =   190 bits (483),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 132/342 (39%), Positives = 187/342 (55%), Gaps = 27/342 (8%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHG--DALAAFQLLQDMSPYVKFGHFTA  175
             R+A+ FT+AL A L  A +L      +S    P    + L  +Q++    PYVKF HFTA
Sbjct  362   RVASCFTEALTARL--AATLTTSKPSSSIPPFPQNSLEILKIYQIVYQACPYVKFAHFTA  419

Query  176   NQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrr  355
             NQAI EA   + RVH++D DI++G QW + MQAL +R  G  +P LRIT +         
Sbjct  420   NQAIFEAFEAEERVHVIDLDILQGYQWPAFMQALAARPGG--SPFLRITGVGPSID----  473

Query  356   sFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHF  535
                +V+ETGR LT  A S+  PF FH    +  E+ KP+      GEA+ VN +  L   
Sbjct  474   ---AVRETGRCLTELAHSLNVPFEFHAIG-EQLESLKPNMFNRRVGEALAVNAVNRL---  526

Query  536   SYRSP-DSIASFLSGSATLNPRLVTLVEEEAAPPRDGG-FVDRFMDTLHHYSALYDSLEA  709
              +R P  S+ + L       P +VTLVE+EA+   +G  F+ RF++ LH+YSA++DSL+A
Sbjct  527   -HRVPGKSLGNLLGMIRDQAPNIVTLVEQEAS--HNGPYFLGRFLEALHYYSAIFDSLDA  583

Query  710   GFPMQDQARTLVERVFLGPKIS--VAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISFA  883
              FP     R  VE+    P+I   VA     R    E    W + + E  GF+   +S  
Sbjct  584   TFPPDSAQRAKVEQYIFAPEIRNIVACEGPERIERHERLEKWRKLM-EAKGFKGVALSSN  642

Query  884   NRCQAKLLLGLFN-DGYRIEEIGNHKLILGWKSRRLLSASIW  1006
                Q+K+LLGL++ DGYR+ E     L+LGW+ R L++AS W
Sbjct  643   AVTQSKILLGLYSCDGYRLTE-DKGCLLLGWQDRALIAASAW  683



>gb|KDO63869.1| hypothetical protein CISIN_1g045762mg, partial [Citrus sinensis]
Length=373

 Score =   184 bits (468),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 130/343 (38%), Positives = 184/343 (54%), Gaps = 26/343 (8%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALAA---FQLLQDMSPYVKFGHFT  172
             R+A+ FT+AL A L    +    +   +       ++L     +Q++    PYVKF HFT
Sbjct  47    RVASCFTEALSARLAATLTTKPSTSTPTPFSPFPPNSLEVLKIYQIVYQACPYVKFAHFT  106

Query  173   ANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgr  352
             ANQAI EA   + RVH++D DI++G QW + MQAL +R  G  AP LRIT +        
Sbjct  107   ANQAIFEAFEAEERVHVIDLDILQGYQWPAFMQALAARPGG--APFLRITGVGATIE---  161

Query  353   rsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPH  532
                 S +ETGR LT  A S+  PF FH    +  E  KP       GEA+ VN +  L  
Sbjct  162   ----SAKETGRCLTELAHSLHVPFEFHPVG-EQLEDLKPHMFNRRVGEALAVNAVNRL--  214

Query  533   FSYRSP-DSIASFLSGSATLNPRLVTLVEEEAAPPRDGG-FVDRFMDTLHHYSALYDSLE  706
               +R P + + + L+      P +VT+VE+EA+   +G  F+ RF++ LH+YSA++DSL+
Sbjct  215   --HRVPSNCLGNLLAMIRDQAPNIVTIVEQEAS--HNGPYFLGRFLEALHYYSAIFDSLD  270

Query  707   AGFPMQDQARTLVERVFLGPKIS--VAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISF  880
             A FP     R  VE+    P+I   VA     R    E    W + + E  GFR   +S 
Sbjct  271   ATFPPDSAQRAKVEQYIFAPEIRNIVACEGGERTARHERLEKWRK-IMEGKGFRGVPLSA  329

Query  881   ANRCQAKLLLGLFN-DGYRIEEIGNHKLILGWKSRRLLSASIW  1006
                 Q+K+LLGL++ DGYR+ E  N  L+LGW+ R LL+AS W
Sbjct  330   NAVTQSKILLGLYSCDGYRLTE-DNGCLLLGWQDRALLAASAW  371



>ref|XP_004171790.1| PREDICTED: DELLA protein GAI1-like [Cucumis sativus]
Length=688

 Score =   190 bits (482),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 132/342 (39%), Positives = 187/342 (55%), Gaps = 27/342 (8%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHG--DALAAFQLLQDMSPYVKFGHFTA  175
             R+A+ FT+AL A L  A +L      +S    P    + L  +Q++    PYVKF HFTA
Sbjct  365   RVASCFTEALTARL--AATLTTSKPSSSIPPFPQNSLEILKIYQIVYQACPYVKFAHFTA  422

Query  176   NQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrr  355
             NQAI EA   + RVH++D DI++G QW + MQAL +R  G  +P LRIT +         
Sbjct  423   NQAIFEAFEAEERVHVIDLDILQGYQWPAFMQALAARPGG--SPFLRITGVGPSID----  476

Query  356   sFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHF  535
                +V+ETGR LT  A S+  PF FH    +  E+ KP+      GEA+ VN +  L   
Sbjct  477   ---AVRETGRCLTELAHSLNVPFEFHAIG-EQLESLKPNMFNRRVGEALAVNAVNRL---  529

Query  536   SYRSP-DSIASFLSGSATLNPRLVTLVEEEAAPPRDGG-FVDRFMDTLHHYSALYDSLEA  709
              +R P  S+ + L       P +VTLVE+EA+   +G  F+ RF++ LH+YSA++DSL+A
Sbjct  530   -HRVPGKSLGNLLGMIRDQAPNIVTLVEQEAS--HNGPYFLGRFLEALHYYSAIFDSLDA  586

Query  710   GFPMQDQARTLVERVFLGPKIS--VAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISFA  883
              FP     R  VE+    P+I   VA     R    E    W + + E  GF+   +S  
Sbjct  587   TFPPDSAQRAKVEQYIFAPEIRNIVACEGPERIERHERLEKWRKLM-EAKGFKGVALSSN  645

Query  884   NRCQAKLLLGLFN-DGYRIEEIGNHKLILGWKSRRLLSASIW  1006
                Q+K+LLGL++ DGYR+ E     L+LGW+ R L++AS W
Sbjct  646   AVTQSKILLGLYSCDGYRLTE-DKGCLLLGWQDRALIAASAW  686



>ref|XP_008441631.1| PREDICTED: DELLA protein RGL1-like [Cucumis melo]
Length=685

 Score =   190 bits (482),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 132/342 (39%), Positives = 187/342 (55%), Gaps = 27/342 (8%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHG--DALAAFQLLQDMSPYVKFGHFTA  175
             R+A+ FT+AL A L  A +L      +S    P    + L  +Q++    PYVKF HFTA
Sbjct  362   RVASCFTEALTARL--AATLTTSKPSSSIPPFPQNSLEILKIYQIVYQACPYVKFAHFTA  419

Query  176   NQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrr  355
             NQAI EA   + RVH++D DI++G QW + MQAL +R  G  +P LRIT +         
Sbjct  420   NQAIFEAFEAEERVHVIDLDILQGYQWPAFMQALAARPGG--SPFLRITGVGPSID----  473

Query  356   sFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHF  535
                +V+ETGR LT  A S+  PF FH    +  E+ KP+      GEA+ VN +  L   
Sbjct  474   ---AVRETGRCLTELAHSLNVPFEFHAIG-EQLESLKPNMFNRRVGEALAVNAVNRL---  526

Query  536   SYRSP-DSIASFLSGSATLNPRLVTLVEEEAAPPRDGG-FVDRFMDTLHHYSALYDSLEA  709
              +R P  S+ + L       P +VTLVE+EA+   +G  F+ RF++ LH+YSA++DSL+A
Sbjct  527   -HRVPGKSLGNLLGMIRDQAPNIVTLVEQEAS--HNGPYFLGRFLEALHYYSAIFDSLDA  583

Query  710   GFPMQDQARTLVERVFLGPKIS--VAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISFA  883
              FP     R  VE+    P+I   VA     R    E    W + + E  GF+   +S  
Sbjct  584   TFPPDSAQRAKVEQYIFAPEIRNIVACEGPERIERHERLEKWRKLM-EAKGFKGVALSSN  642

Query  884   NRCQAKLLLGLFN-DGYRIEEIGNHKLILGWKSRRLLSASIW  1006
                Q+K+LLGL++ DGYR+ E     L+LGW+ R L++AS W
Sbjct  643   AVTQSKILLGLYSCDGYRLTE-DKGCLLLGWQDRALIAASAW  683



>ref|XP_010237707.1| PREDICTED: DELLA protein GAI-like [Brachypodium distachyon]
Length=738

 Score =   190 bits (483),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 122/306 (40%), Positives = 172/306 (56%), Gaps = 23/306 (8%)
 Frame = +2

Query  107   DALAAFQLLQDMSPYVKFGHFTANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISR  286
             D L  +Q+L    PY+KF HFTANQAI EA   + RVH+VD DI++G QW + +QAL +R
Sbjct  448   DTLKIYQILYQACPYIKFAHFTANQAIFEAFQGEDRVHVVDLDILQGYQWPAFLQALAAR  507

Query  287   QDGLPAPHLRITALsrgggsgrrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFK  466
               G   P LR+T +            +V+ETGR L + AAS+  PF FH    D  E  +
Sbjct  508   PGG--PPTLRLTGVGHPA-------AAVRETGRHLASLAASLRVPFEFHAAVADKLERLR  558

Query  467   PSALKLVRGEAIIVNCMLHLPHFSYRSPDS-IASFLSGSATLNPRLVTLVEEEAAPPRDG  643
             P+AL+   GEA+ VN +  L    +R P + +A  LS      P+++TLVE+EA    +G
Sbjct  559   PAALQRRVGEALAVNAVNRL----HRVPGAHLAPLLSMIRDQAPKIMTLVEQEAG--HNG  612

Query  644   G-FVDRFMDTLHHYSALYDSLEAGFPMQDQARTLVERVFLGPKIS--VAITRSYRCRGEE  814
               F+ RF++ LH+YSA++DSL+A FP     R  VE+  L P+I   VA   + R    E
Sbjct  613   PYFLGRFLEALHYYSAIFDSLDATFPADSAPRMKVEQCLLAPEIRNVVACEGAERVARHE  672

Query  815   YGWSWGEWVPENAGFRPKTISFANRCQAKLLLGLF--NDGYRIEEIGNHKLILGWKSRRL  988
                 W   + E  GF    +S A   Q+++LLGL+   DGYR+ E     L+LGW+ R +
Sbjct  673   RLDRW-RRIMEGRGFEAVPLSPAAVGQSQVLLGLYGAGDGYRLNE-DKGCLLLGWQDRAI  730

Query  989   LSASIW  1006
             + AS W
Sbjct  731   IGASAW  736



>ref|XP_008231070.1| PREDICTED: DELLA protein GAI-like [Prunus mume]
Length=712

 Score =   189 bits (481),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 131/343 (38%), Positives = 188/343 (55%), Gaps = 26/343 (8%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLH-AKSFPASKDDHPHG--DALAAFQLLQDMSPYVKFGHFT  172
             R+A+ FT+AL A L    + + A S P      P    + L  +Q++    PY+KF HFT
Sbjct  386   RVASCFTEALSARLTATLTTNPAASAPKPFSPFPPNSLEILKIYQIVYQACPYIKFAHFT  445

Query  173   ANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgr  352
             ANQAI EA   + RVH++D DI++G QW + MQAL +R  G  AP LRIT +        
Sbjct  446   ANQAIFEAFESEERVHVIDLDILQGYQWPAFMQALAARPGG--APFLRITGVGPCIE---  500

Query  353   rsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPH  532
                 +V+ETGR LT  A S+  PF FH    +  E  KP       GEA+ VN +  L  
Sbjct  501   ----AVKETGRCLTELALSLHVPFEFHAVG-EQLEDLKPHMFNRRIGEALAVNTVNRL--  553

Query  533   FSYRSP-DSIASFLSGSATLNPRLVTLVEEEAAPPRDGG-FVDRFMDTLHHYSALYDSLE  706
               +R P + + + L+      P +VTLVE+EA+   +G  F+ RF++ LH+YSA++DSL+
Sbjct  554   --HRVPGNYLGNVLAMIRDQAPNIVTLVEQEAS--HNGPYFLGRFLEALHYYSAIFDSLD  609

Query  707   AGFPMQDQARTLVERVFLGPKIS--VAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISF  880
             A FP     R  VE+    P+I   VA   + R    E    W + V E+ GF+   +S 
Sbjct  610   ATFPPDSAQRAKVEQYIFAPEIRNIVACEGAERTERHERLEKWRK-VMESKGFKSVALSA  668

Query  881   ANRCQAKLLLGLFN-DGYRIEEIGNHKLILGWKSRRLLSASIW  1006
                 Q+K+LLGL++ DGYR+ E     L+LGW+ R +++AS W
Sbjct  669   NAVTQSKILLGLYSCDGYRMTE-DKGCLLLGWQDRSIMAASAW  710



>ref|XP_003549053.1| PREDICTED: protein SCARECROW-like [Glycine max]
Length=687

 Score =   189 bits (480),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 132/342 (39%), Positives = 188/342 (55%), Gaps = 27/342 (8%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHG--DALAAFQLLQDMSPYVKFGHFTA  175
             R+AA FTD+L   L+   +L  K    SK   P    + L  +Q++    PYVKF HFTA
Sbjct  364   RVAACFTDSLSVRLNS--TLTPKPTTPSKPLTPSNSLEVLKIYQIVYQACPYVKFAHFTA  421

Query  176   NQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrr  355
             NQAI EA   + RVH++D DI++G QW + MQAL +R  G  AP LRIT +         
Sbjct  422   NQAIFEAFETEERVHVIDLDILQGYQWPAFMQALAARPAG--APFLRITGVGPSID----  475

Query  356   sFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHF  535
                +V+ETGR LT  A S+  PF FH    +  E  KP  L    GEA+ VN +  L   
Sbjct  476   ---TVRETGRCLTELAHSLRIPFEFHAVG-EQLEDLKPHMLNRRVGEALAVNAVNRL---  528

Query  536   SYRSP-DSIASFLSGSATLNPRLVTLVEEEAAPPRDGG-FVDRFMDTLHHYSALYDSLEA  709
              +R P + + + L+      P +VTLVE+EA+   +G  F+ RF++ LH+YSA++DSL+A
Sbjct  529   -HRVPGNHLGNLLTMLRDQAPSIVTLVEQEAS--HNGPYFLGRFLEALHYYSAIFDSLDA  585

Query  710   GFPMQDQARTLVERVFLGPKIS--VAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISFA  883
              FP +   R  VE+    P+I   VA     R    E    W + + E  GF+   +S  
Sbjct  586   TFPAESAQRAKVEQYIFAPEIRNIVACEGPERFERHERLEKWRKMM-EGKGFKGVVLSPN  644

Query  884   NRCQAKLLLGLFN-DGYRIEEIGNHKLILGWKSRRLLSASIW  1006
                Q+K+LLGL++ +GYR+ E     L+LGW+ R +++AS W
Sbjct  645   AVTQSKILLGLYSCEGYRLTE-DKGCLLLGWQDRAIVAASAW  685



>emb|CDP12839.1| unnamed protein product [Coffea canephora]
Length=347

 Score =   183 bits (464),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 124/319 (39%), Positives = 174/319 (55%), Gaps = 27/319 (8%)
 Frame = +2

Query  2    RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTANQ  181
            RLA YFT   Q LLD   SL A   P +       +A++AFQ+LQ++SPYVKF HFTANQ
Sbjct  48   RLALYFT---QGLLDK--SLTAPEHPENPVSR-QTNAISAFQMLQELSPYVKFAHFTANQ  101

Query  182  AILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrsF  361
            AILEA    R +H++D+D MEGIQW SLM  L +R+D      LRITA+    GS     
Sbjct  102  AILEATEGHREIHVIDFDFMEGIQWPSLMVDLAAREDA----SLRITAIVGDKGSS----  153

Query  362  CSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHFSY  541
            C++Q+TG RL  FA SI   FS  Q  +  +E F+    ++  G  +I NCM++  H  +
Sbjct  154  CNIQQTGFRLQDFANSINLSFSSDQVLIKKEEDFE----EIKVGHTLIANCMINQLHMPH  209

Query  542  RSPDSIASFLSGSATLNPRLVTLVEEE-----AAPPRDGGFVDRFMDTLHHYSALYDSLE  706
            R    + +F +G   L+P+++  V+EE      AP     F   F + L HY+AL DSL 
Sbjct  210  RESSLVETFFNGLRKLSPKILVFVQEELFSFSKAP--STSFAGFFCEALDHYTALSDSLR  267

Query  707  AG-FPMQDQARTLVERVFLGPKISVAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISFA  883
            +G F     A  ++ER FL  +I  ++ + + C       +     P   GFRP  ++  
Sbjct  268  SGFFGGYKLALKIIEREFLRMQILDSV-KHFPCGIMGNESNMLPDYPSMNGFRPIPMNSC  326

Query  884  NRCQAKLLLGLFNDGYRIE  940
            N  QAK L+ LFN  Y ++
Sbjct  327  NVIQAKHLISLFNGSYWVQ  345



>ref|XP_002512896.1| DELLA protein GAI1, putative [Ricinus communis]
 gb|EEF49399.1| DELLA protein GAI1, putative [Ricinus communis]
Length=686

 Score =   189 bits (480),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 128/342 (37%), Positives = 184/342 (54%), Gaps = 24/342 (7%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLH-AKSFPASKDDHPHG--DALAAFQLLQDMSPYVKFGHFT  172
             R+A+ FT+AL A L    +   + + P     +P    + L  +Q++    PY+KF HFT
Sbjct  360   RVASCFTEALSARLAATLTTQPSNTAPKPYSSYPSNSMEILKIYQIVYQACPYIKFAHFT  419

Query  173   ANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgr  352
             ANQAI EA   + RVH++D DI++G QW + MQAL +R  G  AP LRIT +        
Sbjct  420   ANQAIFEAFEAEERVHVIDLDILQGYQWPAFMQALAARPGG--APFLRITGVGSCIE---  474

Query  353   rsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPH  532
                 SV+ETGR LT  A S+  PF FH    +  E  KP       GEA+ VN +  L H
Sbjct  475   ----SVRETGRCLTELAHSLHVPFEFHPV-AEELEDLKPHMFNRRVGEALAVNSVNRLHH  529

Query  533   FSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGG-FVDRFMDTLHHYSALYDSLEA  709
                    ++ + +   A   P +VT+VE+EA+   +G  F+ RF++ LH+YSA++DSL+A
Sbjct  530   VPGNCLPNLLAMIRDQA---PNIVTIVEKEAS--HNGPYFLGRFLEALHYYSAIFDSLDA  584

Query  710   GFPMQDQARTLVERVFLGPKIS--VAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISFA  883
              FP     R  VE+    P+I   VA     R    E    W + + E  GF+   +S  
Sbjct  585   TFPPDSTQRAKVEQYIFAPEIRNIVACEGPERTERHERLEKWRKLM-EGKGFKGVPLSAN  643

Query  884   NRCQAKLLLGLFN-DGYRIEEIGNHKLILGWKSRRLLSASIW  1006
                Q+K+LLGL++ DGYR+ E     L+LGW+ R +L+AS W
Sbjct  644   AVTQSKILLGLYSCDGYRLTE-DKGCLLLGWQDRAILAASAW  684



>gb|EYU31843.1| hypothetical protein MIMGU_mgv1a021983mg [Erythranthe guttata]
Length=694

 Score =   189 bits (479),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 134/347 (39%), Positives = 192/347 (55%), Gaps = 34/347 (10%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHG-------DALAAFQLLQDMSPYVKF  160
             R+AA FT+AL A L  A +L  K  P++    P         + L  +Q+L    PY+KF
Sbjct  368   RVAACFTEALTARL--AATLTNK--PSTSKLIPFNPFPPDNLEILKIYQILYQACPYIKF  423

Query  161   GHFTANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgg  340
              HFTANQAI EA   + RVH++D DI++G QW + MQAL +R  G  AP LRIT +    
Sbjct  424   AHFTANQAIFEAFESEGRVHVIDLDILQGYQWPAFMQALAARPGG--APFLRITGVGPSP  481

Query  341   gsgrrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCML  520
                     SV+ETGR L+  A S+  PF FH    +  E  KP       GEA+ VN + 
Sbjct  482   E-------SVRETGRCLSELAHSLHVPFEFHPVG-EELEDLKPHMFNRRVGEALAVNSVN  533

Query  521   HLPHFSYRSP-DSIASFLSGSATLNPRLVTLVEEEAAPPRDGG-FVDRFMDTLHHYSALY  694
              L    +R P +++ + L+      P +VT+VE+EA+   +G  F+ RF++ LH+YSA++
Sbjct  534   RL----HRVPGNALGNLLTMIRDQAPNIVTIVEQEAS--HNGPYFLGRFLEALHYYSAIF  587

Query  695   DSLEAGFPMQDQARTLVERVFLGPKIS--VAITRSYRCRGEEYGWSWGEWVPENAGFRPK  868
             DSL+A FP + + RT VE+    P+I   VA     R    E    W + + E  GF+  
Sbjct  588   DSLDATFPSESEQRTKVEQNIFAPEIKNIVAHEGPERVMRHERLEKWRKIM-EGKGFQGV  646

Query  869   TISFANRCQAKLLLGLFN-DGYRIEEIGNHKLILGWKSRRLLSASIW  1006
              +S     Q+K+LLGL++ DGYR+ E     L+LGW+ R +L+AS W
Sbjct  647   PLSSNAVTQSKILLGLYSCDGYRLTE-DRGCLLLGWQDRSILAASAW  692



>ref|XP_002966500.1| GRAS family protein [Selaginella moellendorffii]
 gb|EFJ32527.1| GRAS family protein [Selaginella moellendorffii]
Length=734

 Score =   189 bits (479),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 131/342 (38%), Positives = 187/342 (55%), Gaps = 25/342 (7%)
 Frame = +2

Query  2     RLAAYFTDALQA-LLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTAN  178
             R+AAYF++A+ A +++    ++A   P         + +AAFQ+   + P VKF HFTAN
Sbjct  412   RMAAYFSEAMNARMVNSCLGVYAPLIPEMHKVSSK-NTIAAFQVFNSLCPLVKFSHFTAN  470

Query  179   QAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrs  358
             QAILEA+  +  VHI+D D+M+G+QW +L   L SR  G   P +R+T L          
Sbjct  471   QAILEALDGEDSVHILDLDVMQGLQWPALFHILASRPRG--PPRVRLTGLGA--------  520

Query  359   FCS--VQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPH  532
              CS  +++TG+RL+ FAAS+G PF FH    D      P  L + R EA+ V+C LH  H
Sbjct  521   -CSDTLEQTGKRLSEFAASLGLPFEFHGVA-DKIGNLDPLKLGVRRNEALAVHC-LH--H  575

Query  533   FSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAG  712
               Y    S    L+    L P+++T VE++ +    G F+ RF++ LH+YSAL+DSL A 
Sbjct  576   SLYDITGSDVKALALLRQLRPKIITTVEQDLS--HSGSFLHRFVEALHYYSALFDSLGAS  633

Query  713   FPMQDQARTLVERVFLGPKISVAITRSYRCR-GEEYGWSWGEWVPENAGFRPKTISFANR  889
              P  +  R +VE+  L  +I   +      R GEE   SW E   + AGFR   +     
Sbjct  634   LPEDNTERHVVEQQLLSCEIKNILAVGGPARTGEEKFGSWREEF-QGAGFRAVALGGNAS  692

Query  890   CQAKLLLGLFN-DGYRIEEIGNHKLILGWKSRRLLSASIWTS  1012
              QA LLLG+F  +G+ + E G   L L WK   LL+AS W+S
Sbjct  693   AQASLLLGMFPCEGFALVEDG-ELLKLAWKDMCLLTASAWSS  733



>ref|XP_008341667.1| PREDICTED: DELLA protein RGL1-like [Malus domestica]
Length=705

 Score =   188 bits (477),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 132/343 (38%), Positives = 184/343 (54%), Gaps = 26/343 (8%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHG----DALAAFQLLQDMSPYVKFGHF  169
             R+A+ FT+AL A L  A      S  ASK   P      + L  +Q++    PY+KF HF
Sbjct  379   RVASCFTEALSARL-AATLTTTPSXSASKPFSPFPPNSFEILKIYQIVYQACPYIKFAHF  437

Query  170   TANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsg  349
             TANQAI EA   + RVH++D DI++G QW + MQAL +R  G  AP LRIT +       
Sbjct  438   TANQAIFEAFESEERVHVIDLDILQGYQWPAFMQALAARPGG--APFLRITGVGPCIE--  493

Query  350   rrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLP  529
                   V+ETGR LT  A S+  PF FH    +  E  KP       GEA+ VN +  L 
Sbjct  494   -----GVKETGRCLTELALSLHVPFEFHAVG-EQLEDLKPHMFNRRIGEALAVNTVNRLH  547

Query  530   HFSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGG-FVDRFMDTLHHYSALYDSLE  706
               S     ++ + +   A   P +VTLVE+EA+   +G  F+ RF++ LH+YSA++DSL+
Sbjct  548   RVSVNCLGNLLAMIRDQA---PNIVTLVEQEAS--HNGPYFLGRFLEALHYYSAIFDSLD  602

Query  707   AGFPMQDQARTLVERVFLGPKIS--VAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISF  880
             A FP     R  VE+    P+I   VA     R    E    W + V E+ GF+   +S 
Sbjct  603   ATFPPDSAQRAKVEQYIFAPEIRNIVACEGVERTERHERLEKWRK-VMESKGFKSVPLSA  661

Query  881   ANRCQAKLLLGLFN-DGYRIEEIGNHKLILGWKSRRLLSASIW  1006
                 Q+K+LLGL++ DGYR+ E     L+LGW+ R +++AS W
Sbjct  662   NAVTQSKILLGLYSCDGYRMTE-DKGCLLLGWQDRSIMAASAW  703



>ref|XP_009378007.1| PREDICTED: DELLA protein RGL1-like [Pyrus x bretschneideri]
 ref|XP_009350709.1| PREDICTED: DELLA protein RGL1-like [Pyrus x bretschneideri]
Length=701

 Score =   188 bits (477),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 130/343 (38%), Positives = 187/343 (55%), Gaps = 26/343 (8%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGA-GSLHAKSFPASKDDHPHG--DALAAFQLLQDMSPYVKFGHFT  172
             R+A+ FT+AL A L     +  + S P      P    + L  +Q++    PY+KF HFT
Sbjct  375   RVASCFTEALSARLAATLTTTPSGSAPKPFSPFPPNSFEILKIYQIVYQACPYIKFAHFT  434

Query  173   ANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgr  352
             ANQAI EA   + RVH++D DI++G QW + MQAL +R  G  AP LRIT +        
Sbjct  435   ANQAIFEAFESEERVHVIDLDILQGYQWPAFMQALAARPGG--APFLRITGVGPCIE---  489

Query  353   rsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPH  532
                 +V+ETGR LT  A S+  PF FH    +  E  KP       GEA+ VN +  L  
Sbjct  490   ----AVKETGRCLTELALSLHVPFEFHAVG-EQLEDLKPHMFNRRIGEALAVNTVNRL--  542

Query  533   FSYRSP-DSIASFLSGSATLNPRLVTLVEEEAAPPRDGG-FVDRFMDTLHHYSALYDSLE  706
               +R P + + + L+      P +VTLVE+EA+   +G  F+ RF++ LH+YSA++DSL+
Sbjct  543   --HRVPVNCLGNLLAMIRDQAPNIVTLVEQEAS--HNGPYFLGRFLEALHYYSAIFDSLD  598

Query  707   AGFPMQDQARTLVERVFLGPKIS--VAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISF  880
             A FP     R  VE+    P+I   VA   + R    E    W + V E+ GF+   +S 
Sbjct  599   ATFPPDSAQRAKVEQYIFAPEIRNIVACEGAERTERHERLEKWRK-VMESKGFKSVPLSA  657

Query  881   ANRCQAKLLLGLFN-DGYRIEEIGNHKLILGWKSRRLLSASIW  1006
                 Q+K+LLGL++ DGYR+ E     L+LGW+ R +++AS W
Sbjct  658   NAVTQSKILLGLYSCDGYRMTE-DKGCLLLGWQDRSIMAASAW  699



>gb|KCW54273.1| hypothetical protein EUGRSUZ_I00236 [Eucalyptus grandis]
Length=360

 Score =   182 bits (461),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 117/311 (38%), Positives = 163/311 (52%), Gaps = 40/311 (13%)
 Frame = +2

Query  107   DALAAFQLLQDMSPYVKFGHFTANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISR  286
             + ++A Q++Q++SPY+KF HFTANQAILEA   DR VH+VD+DIMEGIQW  LM  L   
Sbjct  78    NTISAIQMIQELSPYIKFAHFTANQAILEATLADRDVHVVDFDIMEGIQWPPLMVDLARH  137

Query  287   QDGLPAPHLRITALsrgggsgrrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFK  466
              D      LRITA+     +      S+Q TGRRL  FA SI   F+F Q  +  +E F+
Sbjct  138   DDT----SLRITAIVTDQETE----ASIQHTGRRLKEFANSIDLRFTFDQLLMQEEEDFR  189

Query  467   PSALKLVRGEAIIVNCMLHLPHFSYRSPDSIASFLSGSATLNPRLVTLVEEE----AAPP  634
                     G  +I NCM++ PH   +    + +FL G   L+P++V  VEEE    A   
Sbjct  190   TIHQA---GHTVIANCMINQPHMPSKCLSMVRTFLGGMTALSPKIVVQVEEELLNFAKAS  246

Query  635   RDGGFVDRFMDTLHHYSALYDSL--EAGFPMQDQARTLVERVFLGPKISVAITRSYRCRG  808
                 FV+ F + LH+Y AL DSL   +GF               G ++ + +        
Sbjct  247   SSLSFVEFFCEALHYYMALSDSLVNVSGFTG-------------GYEMCLKVI-------  286

Query  809   EEYGWSWGEWVPENA--GFRPKTISFANRCQAKLLLGLFNDGYRIEEIGNHKLILGWKSR  982
             E+  W    W       GFRP  +S +N  QAK L+ +F+  YR+ +   ++L L WKSR
Sbjct  287   EQEEWERKLWRDGLCLKGFRPVPLSSSNVAQAKYLVSVFSGEYRV-QYEKYRLALCWKSR  345

Query  983   RLLSASIWTSV  1015
              L +ASIW  +
Sbjct  346   PLTTASIWAPI  356



>ref|XP_004304540.1| PREDICTED: DELLA protein GAI1-like [Fragaria vesca subsp. vesca]
Length=709

 Score =   187 bits (475),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 129/343 (38%), Positives = 186/343 (54%), Gaps = 26/343 (8%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSF-PASKDDHPHG--DALAAFQLLQDMSPYVKFGHFT  172
             R+AA FT+AL A L    + ++ +  P      P    + L  +Q++    PY+KF HFT
Sbjct  383   RVAACFTEALSARLAATLTTNSSALAPKPFSPFPPNSLEILKIYQIVYQACPYIKFAHFT  442

Query  173   ANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgr  352
             ANQAI EA   + RVH++D DI++G QW + MQAL +R  G  AP LRIT +        
Sbjct  443   ANQAIFEAFESEERVHVIDLDILQGYQWPAFMQALAARSGG--APFLRITGVGPCIE---  497

Query  353   rsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPH  532
                 +V+ETGR L   A S+  PF FH    +  E  KP       GEA+ VN +  L  
Sbjct  498   ----AVKETGRCLMELAISLHVPFEFHAVG-EQLEDLKPHMFNRRIGEALAVNTVNRL--  550

Query  533   FSYRSP-DSIASFLSGSATLNPRLVTLVEEEAAPPRDGG-FVDRFMDTLHHYSALYDSLE  706
               +R P + + + L+      P +VTLVE+EA+   +G  F+ RF++ LH+YSA++DSL+
Sbjct  551   --HRVPGNCLGNLLAMIRDQAPNIVTLVEQEAS--HNGPYFLGRFLEALHYYSAIFDSLD  606

Query  707   AGFPMQDQARTLVERVFLGPKIS--VAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISF  880
             A FP     R  VE+    P+I   VA   + R    E    W + V E  GF+   +S 
Sbjct  607   ATFPPDSAQRAKVEQYIFAPEIRNIVAFEGAERTERHERLEKWRK-VMEGKGFKSVPLSA  665

Query  881   ANRCQAKLLLGLFN-DGYRIEEIGNHKLILGWKSRRLLSASIW  1006
                 Q+K+LLGL++ DGYR+ E     L+LGW+ R +++AS W
Sbjct  666   NAVTQSKILLGLYSCDGYRMME-DKGCLLLGWQDRSIMAASAW  707



>ref|XP_011099005.1| PREDICTED: DELLA protein RGL2-like [Sesamum indicum]
Length=708

 Score =   187 bits (474),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 135/346 (39%), Positives = 188/346 (54%), Gaps = 32/346 (9%)
 Frame = +2

Query  2     RLAAYFTDALQA-----LLDGAGSLHAKSF-PASKDDHPHGDALAAFQLLQDMSPYVKFG  163
             R+AA FT+AL A     L +   + + K F P   D+    + L  +Q+L    PY+KF 
Sbjct  382   RVAACFTEALSARLAATLTNKPSTSNLKRFNPIPPDNL---EILKIYQILYQACPYIKFA  438

Query  164   HFTANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrggg  343
             HFTANQAI EA   + RVHI+D DI++G QW + MQAL +R  G  AP LRIT +     
Sbjct  439   HFTANQAIFEAFEAEERVHIIDLDILQGYQWPAFMQALAARPGG--APFLRITGVGPSPE  496

Query  344   sgrrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLH  523
                    SV+ETGR LT  A S+  PF FH    +  E  KP       GEA+ VN +  
Sbjct  497   -------SVRETGRCLTELAHSLHVPFEFHPVG-EELEDLKPHMFNRRVGEALAVNSVNR  548

Query  524   LPHFSYRSP-DSIASFLSGSATLNPRLVTLVEEEAAPPRDGG-FVDRFMDTLHHYSALYD  697
             L    +R P + + + L+      P +VT+VE+EA+   +G  F+ RF++ LH+YSA++D
Sbjct  549   L----HRVPGNCLGNLLAMIRDQAPNIVTIVEQEAS--HNGPYFLGRFLEALHYYSAIFD  602

Query  698   SLEAGFPMQDQARTLVERVFLGPKIS--VAITRSYRCRGEEYGWSWGEWVPENAGFRPKT  871
             SL+A FP     R  VE+    P+I   VA     R    E    W + V E  GF+   
Sbjct  603   SLDATFPPDSAQRAKVEQHIFAPEIRNIVAQEGPERTMRHERLEKWRK-VMEGKGFQGVP  661

Query  872   ISFANRCQAKLLLGLFN-DGYRIEEIGNHKLILGWKSRRLLSASIW  1006
             +S     Q+K+LLGL++ DGYR+ E     L+LGW+ R +L+AS W
Sbjct  662   LSSNAVTQSKILLGLYSCDGYRLTE-DKGCLLLGWQDRSILAASAW  706



>ref|XP_009344215.1| PREDICTED: DELLA protein RGL1-like [Pyrus x bretschneideri]
Length=699

 Score =   187 bits (474),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 130/343 (38%), Positives = 186/343 (54%), Gaps = 26/343 (8%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGA-GSLHAKSFPASKDDHPHG--DALAAFQLLQDMSPYVKFGHFT  172
             R+A+ FT+AL A L     +  + S P      P    + L  +Q++    PY+KF HFT
Sbjct  373   RVASCFTEALSARLAATLTTTPSGSAPKPFSPFPPNSFEILKIYQIVYQACPYIKFAHFT  432

Query  173   ANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgr  352
             ANQAI EA   + RVH++D DI++G QW + MQAL +R  G  AP LRIT +        
Sbjct  433   ANQAIFEAFESEERVHVIDLDILQGYQWPAFMQALAARPGG--APFLRITGVGPFIE---  487

Query  353   rsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPH  532
                  V+ETGR LT  A S+  PF FH    +  E  KP       GEA+ VN +  L  
Sbjct  488   ----GVKETGRCLTELALSLHVPFEFHAVG-EQLEDLKPHMFNRRIGEALAVNTVNRL--  540

Query  533   FSYRSP-DSIASFLSGSATLNPRLVTLVEEEAAPPRDGG-FVDRFMDTLHHYSALYDSLE  706
               +R P + + + L+      P +VTLVE+EA+   +G  F+ RF++ LH+YSA++DSL+
Sbjct  541   --HRVPVNCLGNLLAMIRDQAPNIVTLVEQEAS--HNGPYFLGRFLEALHYYSAIFDSLD  596

Query  707   AGFPMQDQARTLVERVFLGPKIS--VAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISF  880
             A FP     R  VE+    P+I   VA   + R    E    W + V E+ GF+   +S 
Sbjct  597   ATFPPDSAQRAKVEQYIFAPEIRNIVACEGAERTERHERLEKWRK-VMESKGFKSVPLSA  655

Query  881   ANRCQAKLLLGLFN-DGYRIEEIGNHKLILGWKSRRLLSASIW  1006
                 Q+K+LLGL++ DGYR+ E     L+LGW+ R +++AS W
Sbjct  656   NAVTQSKILLGLYSCDGYRMTE-DKGCLLLGWQDRSIMAASAW  697



>ref|XP_011045749.1| PREDICTED: DELLA protein RGL1-like [Populus euphratica]
Length=679

 Score =   186 bits (473),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 133/345 (39%), Positives = 189/345 (55%), Gaps = 30/345 (9%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAK-SFPASKDDHPHG----DALAAFQLLQDMSPYVKFGH  166
             R+A+ FT+AL A L  A +L  K S  +SK   P      + L  +Q+L    PYVKF H
Sbjct  353   RVASCFTEALSARL--AATLTTKPSTSSSKAFSPFPPNSMEILKIYQILYQACPYVKFAH  410

Query  167   FTANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggs  346
             FTANQAI EA   + RVH++D DI++G QW + MQAL +R  G  AP LRIT +      
Sbjct  411   FTANQAIFEAFETEERVHVIDLDILQGYQWPAFMQALAARPGG--APFLRITGVGSSME-  467

Query  347   grrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHL  526
                   +V+ETGR LT  A S+  PF +H    +  E  KP       GEA+ VN +  L
Sbjct  468   ------NVRETGRCLTELAHSLHVPFEYHPV-AEELEDLKPHMFNRRVGEALAVNSVNRL  520

Query  527   PHFSYRSP-DSIASFLSGSATLNPRLVTLVEEEAAPPRDGG-FVDRFMDTLHHYSALYDS  700
                 +R P + + +  +      P +VT+VE+EA+   +G  F+ RF++ LH+YSA++DS
Sbjct  521   ----HRVPGNCLGNLFAMIRDQAPNIVTVVEQEAS--HNGPYFLGRFLEALHYYSAIFDS  574

Query  701   LEAGFPMQDQARTLVERVFLGPKIS--VAITRSYRCRGEEYGWSWGEWVPENAGFRPKTI  874
             L+A FP     R  VE+    P+I   VA   + R    E    W + + E  GF+   +
Sbjct  575   LDATFPPDSSQRAKVEQYIFAPEIRNIVACEGAERFERHERLEKWRKLM-EGKGFKGVPL  633

Query  875   SFANRCQAKLLLGLFN-DGYRIEEIGNHKLILGWKSRRLLSASIW  1006
             S     Q+K+LLGL++ DGYR+ E     L+LGW+ R +L+AS W
Sbjct  634   SANAVTQSKILLGLYSCDGYRLTE-DKGCLLLGWQDRAILAASAW  677



>gb|KDP41801.1| hypothetical protein JCGZ_26819 [Jatropha curcas]
Length=674

 Score =   186 bits (472),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 133/350 (38%), Positives = 188/350 (54%), Gaps = 35/350 (10%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSF----------PASKDDHPHGDALAAFQLLQDMSPY  151
             R+A++FT+AL A L  A +L AK            P S       + L  +Q+L    PY
Sbjct  343   RVASFFTEALSARL--AATLTAKPNTNTNSTSSTKPFSPYPPNSLEILKIYQILYQACPY  400

Query  152   VKFGHFTANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALs  331
             VKF HFTANQAI EA   + RVH++D DI++G QW + MQAL +R  G  AP LRIT + 
Sbjct  401   VKFAHFTANQAIFEAFEAEERVHVIDLDILQGYQWPAFMQALAARPGG--APFLRITGVG  458

Query  332   rgggsgrrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVN  511
                        SV+ETGR LT  A S+  PF +H    + D   KP       GEA+ VN
Sbjct  459   SSIE-------SVRETGRCLTELAHSLHVPFEYHPVAEELD-NLKPHMFNRRVGEALAVN  510

Query  512   CMLHLPHFSYRSP-DSIASFLSGSATLNPRLVTLVEEEAAPPRDGG-FVDRFMDTLHHYS  685
              +  L    +R P + + + L+      P +VTLVE EA+   +G  F+ RF++ LH+YS
Sbjct  511   SVNRL----HRVPANCLGNLLAMIRDQAPNIVTLVEREAS--HNGPYFLGRFLEALHYYS  564

Query  686   ALYDSLEAGFPMQDQARTLVERVFLGPKIS--VAITRSYRCRGEEYGWSWGEWVPENAGF  859
             A++DSL+A FP     R  +E+    P+I   VA   + R    E    W + + E  GF
Sbjct  565   AIFDSLDATFPPDSAQRAKLEQYIFAPEIRNIVACEGAERTERHERLEKWRKLM-EGKGF  623

Query  860   RPKTISFANRCQAKLLLGLFN-DGYRIEEIGNHKLILGWKSRRLLSASIW  1006
             +   +S     Q+++LLGL++ DGYR+ E     L+LGW+ R L++AS W
Sbjct  624   KGVPLSANAVTQSRILLGLYSCDGYRLTE-DKGCLLLGWQDRALVAASAW  672



>ref|XP_007031934.1| GRAS family transcription factor [Theobroma cacao]
 gb|EOY02860.1| GRAS family transcription factor [Theobroma cacao]
Length=654

 Score =   186 bits (471),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 129/344 (38%), Positives = 186/344 (54%), Gaps = 27/344 (8%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHG----DALAAFQLLQDMSPYVKFGHF  169
             R+A+ FT+AL A L    + +  +  A K   P      + L  +Q++    PY+KF HF
Sbjct  327   RVASCFTEALSARLAATITTNPGTSNAPKPFAPFPSNSLEVLKIYQIVYQACPYIKFAHF  386

Query  170   TANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsg  349
             TANQAI EA   + RVH++D DI++G QW + MQAL +R +G  AP LRIT +       
Sbjct  387   TANQAIFEAFEAEERVHVIDLDILQGYQWPAFMQALAARPNG--APFLRITGVGPSLEY-  443

Query  350   rrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLP  529
                   ++ETGR LT  A S+  PF FH    +  E  KP       GEA+ VN +  L 
Sbjct  444   ------IKETGRCLTELAHSLHIPFEFHPIG-EQLEDIKPHMFNRRVGEALAVNAVNRL-  495

Query  530   HFSYRSP-DSIASFLSGSATLNPRLVTLVEEEAAPPRDGG-FVDRFMDTLHHYSALYDSL  703
                +R P + + + L+      P +VTLVE+EA+   +G  F+ RF++ LH+YSA++DSL
Sbjct  496   ---HRVPGNCLGNLLAMIRDQAPNIVTLVEQEAS--HNGPYFLGRFLEALHYYSAIFDSL  550

Query  704   EAGFPMQDQARTLVERVFLGPKIS--VAITRSYRCRGEEYGWSWGEWVPENAGFRPKTIS  877
             +A F      R  VE+    P+I   VA   S R    E    W + + E  GF+   +S
Sbjct  551   DATFSPDSAQRAKVEQYIFAPEIRNIVACEGSERTARHERLEKWRKLM-EGKGFKGVPLS  609

Query  878   FANRCQAKLLLGLFN-DGYRIEEIGNHKLILGWKSRRLLSASIW  1006
                  Q+K+LLGL++ DGYR+ E     L+LGW+ R +L+AS W
Sbjct  610   ANAVTQSKILLGLYSCDGYRLTE-DKGCLLLGWQDRAILAASAW  652



>emb|CDP16713.1| unnamed protein product [Coffea canephora]
Length=707

 Score =   186 bits (472),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 131/346 (38%), Positives = 189/346 (55%), Gaps = 32/346 (9%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHG-------DALAAFQLLQDMSPYVKF  160
             R+A+ F +AL A L  A +L AK  PA+    P         + L  +Q+L    PY+KF
Sbjct  381   RVASCFAEALGARL--AATLTAK--PATAASRPFNPFPPNSLEILKIYQILYQACPYIKF  436

Query  161   GHFTANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgg  340
              HFTANQAI EA   + RVH++D DI++G QW + MQAL +R  G  AP LRIT +    
Sbjct  437   AHFTANQAIFEAFEAEERVHVIDLDILQGYQWPAFMQALAARPGG--APFLRITGVGPYP  494

Query  341   gsgrrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCML  520
                     +V+ETGR LT  A S+  PF FH    +  E  KP  L    GEA+ VN + 
Sbjct  495   E-------AVRETGRCLTELAHSLHIPFEFHPVG-EQLEDLKPHMLNRRVGEALAVNSVN  546

Query  521   HLPHFSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGG-FVDRFMDTLHHYSALYD  697
              L    +   +S+ + L       P +VT+VE+EA+   +G  F+ RF++ LH+YSA++D
Sbjct  547   RL---HWVPGNSLGNLLGMIRDQAPNIVTIVEQEAS--HNGPYFLGRFLEALHYYSAIFD  601

Query  698   SLEAGFPMQDQARTLVERVFLGPKIS--VAITRSYRCRGEEYGWSWGEWVPENAGFRPKT  871
             SL+A FP +   R  VE+    P+I   VA     R R  E    W + + E  G++   
Sbjct  602   SLDATFPAESAQRAKVEQYIFAPEIRNIVAEEGRERVRRHERLEKWRKIM-EGKGYKGVG  660

Query  872   ISFANRCQAKLLLGLFN-DGYRIEEIGNHKLILGWKSRRLLSASIW  1006
             +S     Q+K+LLGL++ +GYR+ E     L+LGW+ R +++AS W
Sbjct  661   LSTNAVTQSKILLGLYSCEGYRLTE-DKGCLLLGWQDRAIVAASAW  705



>ref|XP_006447014.1| hypothetical protein CICLE_v10018153mg [Citrus clementina]
 ref|XP_006470106.1| PREDICTED: protein SCARECROW-like [Citrus sinensis]
 gb|ESR60254.1| hypothetical protein CICLE_v10018153mg [Citrus clementina]
Length=680

 Score =   186 bits (471),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 130/343 (38%), Positives = 184/343 (54%), Gaps = 26/343 (8%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALAA---FQLLQDMSPYVKFGHFT  172
             R+A+ FT+AL A L    +    +   +       ++L     +Q++    PYVKF HFT
Sbjct  354   RVASCFTEALSARLAATLTTKPSTSTPTPFSPFPPNSLEVLKIYQIVYQACPYVKFAHFT  413

Query  173   ANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgr  352
             ANQAI EA   + RVH++D DI++G QW + MQAL +R  G  AP LRIT +        
Sbjct  414   ANQAIFEAFEAEERVHVIDLDILQGYQWPAFMQALAARPGG--APFLRITGVGATIE---  468

Query  353   rsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPH  532
                 S +ETGR LT  A S+  PF FH    +  E  KP       GEA+ VN +  L  
Sbjct  469   ----SAKETGRCLTELAHSLHVPFEFHPVG-EQLEDLKPHMFNRRVGEALAVNAVNRL--  521

Query  533   FSYRSP-DSIASFLSGSATLNPRLVTLVEEEAAPPRDGG-FVDRFMDTLHHYSALYDSLE  706
               +R P + + + L+      P +VT+VE+EA+   +G  F+ RF++ LH+YSA++DSL+
Sbjct  522   --HRVPSNCLGNLLAMIRDQAPNIVTIVEQEAS--HNGPYFLGRFLEALHYYSAIFDSLD  577

Query  707   AGFPMQDQARTLVERVFLGPKIS--VAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISF  880
             A FP     R  VE+    P+I   VA     R    E    W + + E  GFR   +S 
Sbjct  578   ATFPPDSAQRAKVEQYIFAPEIRNIVACEGGERTARHERLEKWRKIM-EGKGFRGVPLSA  636

Query  881   ANRCQAKLLLGLFN-DGYRIEEIGNHKLILGWKSRRLLSASIW  1006
                 Q+K+LLGL++ DGYR+ E  N  L+LGW+ R LL+AS W
Sbjct  637   NAVTQSKILLGLYSCDGYRLTE-DNGCLLLGWQDRALLAASAW  678



>ref|XP_010917930.1| PREDICTED: DELLA protein GAI1-like [Elaeis guineensis]
Length=409

 Score =   181 bits (459),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 130/347 (37%), Positives = 180/347 (52%), Gaps = 43/347 (12%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAG--------SLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVK  157
             R+A+ F DAL A L            SLH   F               + +L    PY K
Sbjct  92    RVASCFADALAARLSPPPAPKPYPAPSLHTFKF---------------YHILYQACPYFK  136

Query  158   FGHFTANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrg  337
             F HFTANQAILEA   + RVH+VD +I++G QW + +QAL +R  G PA  LRIT +   
Sbjct  137   FAHFTANQAILEAFESEDRVHVVDLNILQGHQWPAFLQALATRPGGPPA--LRITGVGHP  194

Query  338   ggsgrrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCM  517
                      SV +TGR L   A S+  PF FH    D  E  +PS L    GEA+ VN +
Sbjct  195   AE-------SVHQTGRHLAELAHSLHVPFEFHPAIADRLEDLRPSMLHRRVGEALAVNAV  247

Query  518   LHLPHFSYRSPD-SIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALY  694
               L    +R PD  +   LS      P++VTLVE EA+   D  F+ RF++ L +++AL+
Sbjct  248   CRL----HRVPDIHLDWLLSTIRDQAPKIVTLVEIEAS-HNDPHFLGRFLEALPYFAALF  302

Query  695   DSLEAGFPMQDQARTLVERVFLGPKISVAITR--SYRCRGEEYGWSWGEWVPENAGFRPK  868
             DSL+A FP    AR  VE+    P+I   + R  + R    E    W + V E  GF+  
Sbjct  303   DSLDATFPADSAARAKVEQYIFAPEIKNIVAREGAERVARHEKLDRWRK-VMEGRGFKGV  361

Query  869   TISFANRCQAKLLLGLFN-DGYRIEEIGNHKLILGWKSRRLLSASIW  1006
              +S  +  Q+++LLGL+  DGYR+ E  N  + LGW+ +R+++AS W
Sbjct  362   ALSANSVDQSRILLGLYACDGYRLTE-ENGCMFLGWRDQRMIAASAW  407



>ref|XP_007217517.1| hypothetical protein PRUPE_ppa024399mg [Prunus persica]
 gb|EMJ18716.1| hypothetical protein PRUPE_ppa024399mg [Prunus persica]
Length=708

 Score =   186 bits (471),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 130/343 (38%), Positives = 187/343 (55%), Gaps = 26/343 (8%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLH-AKSFPASKDDHPHG--DALAAFQLLQDMSPYVKFGHFT  172
             R+A+ FT+AL A L    + + A S P      P    + L  +Q++    PY+KF HFT
Sbjct  382   RVASCFTEALSARLAATLTTNPAASAPKPFSPFPPNSLEILKIYQIVYQACPYIKFAHFT  441

Query  173   ANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgr  352
             ANQAI EA   + RVH++D DI++G QW + MQAL +R  G  AP LRIT +        
Sbjct  442   ANQAIFEAFESEERVHVIDLDILQGYQWPAFMQALAARTGG--APFLRITGVGPCIE---  496

Query  353   rsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPH  532
                 +V+ETGR LT  A S+  PF FH    +  E  KP       GEA+ VN +  L  
Sbjct  497   ----AVKETGRCLTELALSLHVPFEFHAVG-EQLEDLKPHMFNRRIGEALAVNTVNRL--  549

Query  533   FSYRSP-DSIASFLSGSATLNPRLVTLVEEEAAPPRDGG-FVDRFMDTLHHYSALYDSLE  706
               +R P + + + L+      P +VTLVE+EA+   +G  F+ RF++ LH+YSA++DSL+
Sbjct  550   --HRVPGNYLGNVLAMIRDQAPNIVTLVEQEAS--HNGPYFLGRFLEALHYYSAIFDSLD  605

Query  707   AGFPMQDQARTLVERVFLGPKIS--VAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISF  880
             A FP     R  VE+     +I   VA   + R    E    W + V E+ GF+   +S 
Sbjct  606   ATFPPDSAQRAKVEQYIFAQEIRNIVACEGAERTERHERLEKWRK-VMESKGFKSVALSA  664

Query  881   ANRCQAKLLLGLFN-DGYRIEEIGNHKLILGWKSRRLLSASIW  1006
                 Q+K+LLGL++ DGYR+ E     L+LGW+ R +++AS W
Sbjct  665   NAVTQSKILLGLYSCDGYRMTE-DKGCLLLGWQDRSIMAASAW  706



>ref|XP_010315907.1| PREDICTED: DELLA protein RGL1-like [Solanum lycopersicum]
Length=680

 Score =   185 bits (469),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 132/348 (38%), Positives = 187/348 (54%), Gaps = 36/348 (10%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHG-----DALAAFQLLQDMSPYVKFGH  166
             R+A+ FT+AL A L  A +L  K   +             + L  +Q+L    PYVKF H
Sbjct  354   RVASCFTEALTARL--AATLATKPSTSVPKPFNPFPPNSLEILKIYQILYQACPYVKFAH  411

Query  167   FTANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggs  346
             FTANQAI EA   + RVH++D DI++G QW + MQAL +R  G  AP LRIT +      
Sbjct  412   FTANQAIFEAFEAEERVHVIDLDILQGYQWPAFMQALAARPGG--APFLRITGVGSYPE-  468

Query  347   grrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHL  526
                   +V+ETGR LT  A S+  PF FH    +  E  KP       GEA+ VN +  L
Sbjct  469   ------AVRETGRCLTELAQSLHVPFEFHPVG-EQLEDLKPHMFNRRIGEALAVNSVNRL  521

Query  527   PHFSYRSP-DSIASFLSGSATLNPRLVTLVEEEAAPPRDGG-FVDRFMDTLHHYSALYDS  700
                 +R P + I + L       P +VT+VE+EA+   +G  F+ RF++ LH+YSA++DS
Sbjct  522   ----HRVPGNCIGNLLGMIRDQAPNIVTIVEQEAS--HNGPYFLGRFLEALHYYSAIFDS  575

Query  701   LEAGFPMQDQARTLVERVFLGPKISVAITRSYRCRGEEYGW---SWGEW--VPENAGFRP  865
             L+A FP     R  +E+   GP+I   ++    C G E         +W  V E  GF+ 
Sbjct  576   LDATFPGDSSQRAKLEQYIFGPEIMNIVS----CEGMERMVRHERLEKWRRVMEGKGFKG  631

Query  866   KTISFANRCQAKLLLGLFN-DGYRIEEIGNHKLILGWKSRRLLSASIW  1006
               +S     Q+K+LLGL++ DGY++ E  N  L+LGW+ R +L+AS W
Sbjct  632   VALSANAVTQSKILLGLYSCDGYKLTE-DNGCLLLGWQDRAILAASAW  678



>gb|EAZ17249.1| hypothetical protein OsJ_32770 [Oryza sativa Japonica Group]
Length=593

 Score =   184 bits (467),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 132/347 (38%), Positives = 193/347 (56%), Gaps = 27/347 (8%)
 Frame = +2

Query  2     RLAAYFTDALQA-LLDGAGSLHAK-SFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTA  175
             R+AAYF +A+ A L+     L+A    P+      HG   AAFQ+   +SP+VKF HFTA
Sbjct  264   RVAAYFAEAMSARLVSSCLGLYAPLPNPSPAAARLHGRVAAAFQVFNGISPFVKFSHFTA  323

Query  176   NQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrr  355
             NQAI EA   + RVHI+D DIM+G+QW  L   L SR  G   P +R+T L         
Sbjct  324   NQAIQEAFEREERVHIIDLDIMQGLQWPGLFHILASRPGG--PPRVRLTGLGASME----  377

Query  356   sFCSVQETGRRLTAFAASIGQPFSFHQCRL-DSDETFKPSALKLVRGEAIIVNCMLHLPH  532
                +++ TG+RL+ FA ++G PF F  C + D      P  L + R EA+ V+    L H
Sbjct  378   ---ALEATGKRLSDFADTLGLPFEF--CPVADKAGNLDPEKLGVTRREAVAVHW---LRH  429

Query  533   FSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAG  712
               Y    S ++ L     L P++VT+VE++ +    G F+ RF++ +H+YSAL+DSL+A 
Sbjct  430   SLYDVTGSDSNTLWLIQRLAPKVVTMVEQDLS--HSGSFLARFVEAIHYYSALFDSLDAS  487

Query  713   FPMQDQARTLVERVFLGPKIS--VAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISFAN  886
             +      R +VE+  L  +I   +A+    R    ++G SW E + ++ GFR  +++ + 
Sbjct  488   YSEDSPERHVVEQQLLSREIRNVLAVGGPARTGDVKFG-SWREKLAQS-GFRVSSLAGSA  545

Query  887   RCQAKLLLGLF-NDGYR-IEEIGNHKLILGWKSRRLLSASIWTSVHS  1021
               QA LLLG+F +DGY  IEE  N  L LGWK   LL+AS W  + +
Sbjct  546   AAQAVLLLGMFPSDGYTLIEE--NGALKLGWKDLCLLTASAWRPIQA  590



>ref|XP_009803754.1| PREDICTED: DELLA protein RGL2-like [Nicotiana sylvestris]
Length=713

 Score =   185 bits (469),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 131/346 (38%), Positives = 188/346 (54%), Gaps = 31/346 (9%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHG------DALAAFQLLQDMSPYVKFG  163
             R+A+ FT+AL A L  A +L  K   +S     +       + L  +Q+L    PYVKF 
Sbjct  386   RVASCFTEALTARL--AATLATKPSTSSAPKPFNPFPPNSLEILKIYQILYQACPYVKFA  443

Query  164   HFTANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrggg  343
             HFTANQAI EA   + RVH++D DI++G QW + MQAL +R  G  AP LRIT +     
Sbjct  444   HFTANQAIFEAFEAEERVHVIDLDILQGYQWPAFMQALAARPGG--APFLRITGVGPSPE  501

Query  344   sgrrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLH  523
                    +V+ETGR LT  A S+  PF FH    +  E  KP       GEA+ VN +  
Sbjct  502   -------AVRETGRCLTELAHSLHVPFEFHPVG-EQLEDLKPHMFNRRIGEALAVNSVNR  553

Query  524   LPHFSYRSP-DSIASFLSGSATLNPRLVTLVEEEAAPPRDGG-FVDRFMDTLHHYSALYD  697
             L    +R P + I + L+      P +VT+VE+EA+   +G  F+ RF++ LH+YSA++D
Sbjct  554   L----HRVPVNCIGNLLAMIRDQAPNIVTIVEQEAS--HNGPYFLGRFLEALHYYSAIFD  607

Query  698   SLEAGFPMQDQARTLVERVFLGPKIS--VAITRSYRCRGEEYGWSWGEWVPENAGFRPKT  871
             SL+A FP     R  +E+    P+I   V+   + R    E    W   + E  GF+   
Sbjct  608   SLDATFPADSSQRAKLEQYIFAPEIMNIVSCEGAERVVRHERLEKWRRLM-EGKGFKGVP  666

Query  872   ISFANRCQAKLLLGLFN-DGYRIEEIGNHKLILGWKSRRLLSASIW  1006
             +S     Q+K+LLGL++ DGY++ E  N  L+LGW+ R +L+AS W
Sbjct  667   LSANAVTQSKILLGLYSCDGYKLTE-DNGCLLLGWQDRAILAASAW  711



>ref|XP_009613034.1| PREDICTED: DELLA protein RGL1-like [Nicotiana tomentosiformis]
Length=707

 Score =   184 bits (468),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 130/344 (38%), Positives = 187/344 (54%), Gaps = 27/344 (8%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHG----DALAAFQLLQDMSPYVKFGHF  169
             R+A+ FT+AL A L    +    +  A K  +P      + L  +Q+L    PYVKF HF
Sbjct  380   RVASCFTEALTARLTATLATKPNTSSAPKPFNPFPPNSLEILKIYQILYQACPYVKFAHF  439

Query  170   TANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsg  349
             TANQAI EA   + RVH++D DI++G QW + MQAL +R  G  AP LRIT +       
Sbjct  440   TANQAIFEAFEAEERVHVIDLDILQGYQWPAFMQALAARPGG--APFLRITGVGPSPE--  495

Query  350   rrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLP  529
                  +V+ETGR LT  A S+  PF FH    +  E  KP       GEA+ VN +  L 
Sbjct  496   -----AVKETGRCLTELAHSLHVPFEFHPVG-EQLEDLKPHMFNRRIGEALAVNSVNRL-  548

Query  530   HFSYRSP-DSIASFLSGSATLNPRLVTLVEEEAAPPRDGG-FVDRFMDTLHHYSALYDSL  703
                +R P + I + L+      P +VT+VE+EA+   +G  F+ RF++ LH+YSA++DSL
Sbjct  549   ---HRVPVNCIGNLLAMIRDQAPNIVTIVEQEAS--HNGPYFLGRFLEALHYYSAIFDSL  603

Query  704   EAGFPMQDQARTLVERVFLGPKIS--VAITRSYRCRGEEYGWSWGEWVPENAGFRPKTIS  877
             +A FP     R  +E+    P+I   V+   + R    E    W   + E  GF+   +S
Sbjct  604   DATFPADSSQRAKLEQYIFAPEIMNIVSCEGAERVVRHERLEKWRRLM-EGKGFKGVALS  662

Query  878   FANRCQAKLLLGLFN-DGYRIEEIGNHKLILGWKSRRLLSASIW  1006
                  Q+K+LLGL++ DGY++ E  N  L+LGW+ R +L+AS W
Sbjct  663   ANAVTQSKILLGLYSCDGYKLTE-DNGCLLLGWQDRAILAASAW  705



>gb|KHG10483.1| Protein SCARECROW -like protein [Gossypium arboreum]
Length=758

 Score =   185 bits (469),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 126/344 (37%), Positives = 189/344 (55%), Gaps = 23/344 (7%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTANQ  181
             R+AAYF++A+ A L  +        P+    H     ++AFQ+   +SP+VKF HFTANQ
Sbjct  426   RVAAYFSEAISARLVSSCLGICGGLPSIPPSHTQ-KMVSAFQVFNGISPFVKFSHFTANQ  484

Query  182   AILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrsF  361
             AI EA   + RVHI+D DIM+G+QW  L   L SR  G   PH+R+T L           
Sbjct  485   AIQEAFEREERVHIIDLDIMQGLQWPGLFHILASRPGG--PPHVRLTGLGTSLE------  536

Query  362   CSVQETGRRLTAFAASIGQPFSFHQCRL-DSDETFKPSALKLVRGEAIIVNCMLHLPHFS  538
              +++ TG+RL+ FA  +G PF F  C + D     +P  L + + EA+ V+    L H  
Sbjct  537   -ALEATGKRLSDFADKLGIPFEF--CPVADKVGNLEPERLNVSKTEAVAVHW---LQHSL  590

Query  539   YRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGFP  718
             Y    S  + L     L P++VT+VE++ +    G F+ RF++ +H+YSAL+DSL A + 
Sbjct  591   YDVTGSDTNTLWLLQRLAPKVVTVVEQDLS--HGGSFLGRFVEAIHYYSALFDSLGASYG  648

Query  719   MQDQARTLVERVFLGPKIS--VAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISFANRC  892
              + + R +VE+  L  +I   +A+    R   E    +W E + + +GF+P +++     
Sbjct  649   EESEERHVVEQQLLSKEIRNVLALGGPSRSSEEVKFHNWREKL-QQSGFKPISLAGNAAT  707

Query  893   QAKLLLGLF-NDGYRIEEIGNHKLILGWKSRRLLSASIWTSVHS  1021
             QA LLLG+F +DGY + E  N  L LGWK   LL+AS W   H+
Sbjct  708   QATLLLGMFPSDGYTLVE-DNGALKLGWKDLCLLTASAWRPFHA  750



>ref|XP_007161687.1| hypothetical protein PHAVU_001G089900g [Phaseolus vulgaris]
 gb|ESW33681.1| hypothetical protein PHAVU_001G089900g [Phaseolus vulgaris]
Length=663

 Score =   184 bits (467),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 131/341 (38%), Positives = 189/341 (55%), Gaps = 28/341 (8%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAK-SFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTAN  178
             R+AA FTD+L A L+   +L  K S P S  +    + L  +Q++    PYVKF HFTAN
Sbjct  343   RVAACFTDSLSARLNA--TLTPKPSKPLSPSNS--MEVLKIYQIVYQACPYVKFAHFTAN  398

Query  179   QAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrs  358
             QAI EA   + RVH++D DI++G QW + MQAL +R     AP LRIT +          
Sbjct  399   QAIFEAFETEERVHVIDLDILQGYQWPAFMQALAARPTA--APFLRITGVGPSLD-----  451

Query  359   FCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHFS  538
               +V+ETGR LT  A S+  PF FH    +  E  +P  L    GEA+ VN +  L    
Sbjct  452   --AVRETGRCLTELAHSLRIPFEFHAVG-EQLEDLRPHMLHRRVGEALAVNAVNRL----  504

Query  539   YRSP-DSIASFLSGSATLNPRLVTLVEEEAAPPRDGG-FVDRFMDTLHHYSALYDSLEAG  712
             +R P + + + L+      P +VTLVE+EA+   +G  F+ RF++ LH+YSA++DSL+A 
Sbjct  505   HRVPGNHLGNLLAMIRDQAPNIVTLVEQEAS--HNGPYFLGRFLEALHYYSAIFDSLDAT  562

Query  713   FPMQDQARTLVERVFLGPKIS--VAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISFAN  886
             FP     R  VE+    P+I   VA   + R    E    W + + E  GF+   +S   
Sbjct  563   FPADSAQRAKVEQYIFAPEIRNIVACEGAERFERHERLEKWRK-IMEGKGFKGVALSPNA  621

Query  887   RCQAKLLLGLFN-DGYRIEEIGNHKLILGWKSRRLLSASIW  1006
               Q+K+LLGL++ DGYR+ +     L+LGW+ R +++AS W
Sbjct  622   VTQSKILLGLYSCDGYRLTD-DKGCLLLGWQDRAIVAASAW  661



>dbj|BAD22576.1| SCARECROW [Oryza sativa Japonica Group]
Length=660

 Score =   184 bits (466),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 132/347 (38%), Positives = 193/347 (56%), Gaps = 27/347 (8%)
 Frame = +2

Query  2     RLAAYFTDALQA-LLDGAGSLHAK-SFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTA  175
             R+AAYF +A+ A L+     L+A    P+      HG   AAFQ+   +SP+VKF HFTA
Sbjct  331   RVAAYFAEAMSARLVSSCLGLYAPLPNPSPAAARLHGRVAAAFQVFNGISPFVKFSHFTA  390

Query  176   NQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrr  355
             NQAI EA   + RVHI+D DIM+G+QW  L   L SR  G   P +R+T L         
Sbjct  391   NQAIQEAFEREERVHIIDLDIMQGLQWPGLFHILASRPGG--PPRVRLTGLGASME----  444

Query  356   sFCSVQETGRRLTAFAASIGQPFSFHQCRL-DSDETFKPSALKLVRGEAIIVNCMLHLPH  532
                +++ TG+RL+ FA ++G PF F  C + D      P  L + R EA+ V+    L H
Sbjct  445   ---ALEATGKRLSDFADTLGLPFEF--CPVADKAGNLDPEKLGVTRREAVAVHW---LRH  496

Query  533   FSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAG  712
               Y    S ++ L     L P++VT+VE++ +    G F+ RF++ +H+YSAL+DSL+A 
Sbjct  497   SLYDVTGSDSNTLWLIQRLAPKVVTMVEQDLS--HSGSFLARFVEAIHYYSALFDSLDAS  554

Query  713   FPMQDQARTLVERVFLGPKIS--VAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISFAN  886
             +      R +VE+  L  +I   +A+    R    ++G SW E + ++ GFR  +++ + 
Sbjct  555   YSEDSPERHVVEQQLLSREIRNVLAVGGPARTGDVKFG-SWREKLAQS-GFRVSSLAGSA  612

Query  887   RCQAKLLLGLF-NDGYR-IEEIGNHKLILGWKSRRLLSASIWTSVHS  1021
               QA LLLG+F +DGY  IEE  N  L LGWK   LL+AS W  + +
Sbjct  613   AAQAVLLLGMFPSDGYTLIEE--NGALKLGWKDLCLLTASAWRPIQA  657



>ref|XP_002298647.1| hypothetical protein POPTR_0001s33360g [Populus trichocarpa]
 gb|EEE83452.1| hypothetical protein POPTR_0001s33360g [Populus trichocarpa]
Length=679

 Score =   184 bits (467),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 132/345 (38%), Positives = 190/345 (55%), Gaps = 30/345 (9%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAK-SFPASKDDHPHG----DALAAFQLLQDMSPYVKFGH  166
             R+A+ FT+AL A L  A +L  K S  +SK   P      + L  +Q+L    PYVKF H
Sbjct  353   RVASCFTEALSARL--AATLTTKPSTSSSKAFSPFPPNSMEILKIYQILYQACPYVKFAH  410

Query  167   FTANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggs  346
             FTANQAI EA   + RVH++D DI++G QW + MQAL +R  G  AP LRIT +      
Sbjct  411   FTANQAIFEAFETEERVHVIDLDILQGYQWPAFMQALAARPGG--APFLRITGVGSSME-  467

Query  347   grrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHL  526
                   +V+ETGR LT  A S+  PF +H    +  +  KP       GEA+ VN +  L
Sbjct  468   ------NVRETGRCLTELAHSLHVPFEYHPVAEELVD-LKPHMFNRRVGEALAVNSVNRL  520

Query  527   PHFSYRSP-DSIASFLSGSATLNPRLVTLVEEEAAPPRDGG-FVDRFMDTLHHYSALYDS  700
                 +R P + + + L+      P +VT+VE+EA+   +G  F+ RF++ LH+YSA++DS
Sbjct  521   ----HRVPGNCLGNLLAMIRDQAPNIVTVVEQEAS--HNGPYFLGRFLEALHYYSAIFDS  574

Query  701   LEAGFPMQDQARTLVERVFLGPKIS--VAITRSYRCRGEEYGWSWGEWVPENAGFRPKTI  874
             L++ FP     R  VE+    P+I   VA   + R    E    W + + E  GF+   +
Sbjct  575   LDSTFPPDSSQRAKVEQYIFAPEIRNIVACEGAERFERHERLEKWRKLM-EGKGFKGVPL  633

Query  875   SFANRCQAKLLLGLFN-DGYRIEEIGNHKLILGWKSRRLLSASIW  1006
             S     Q+K+LLGL++ DGYR+ E     L+LGW+ R +L+AS W
Sbjct  634   SANAVTQSKILLGLYSCDGYRLTE-DKGCLLLGWQDRAILAASAW  677



>ref|NP_001065617.1| Os11g0124300 [Oryza sativa Japonica Group]
 sp|Q2RB59.1|SCR1_ORYSJ RecName: Full=Protein SCARECROW 1; AltName: Full=OsSCR1 [Oryza 
sativa Japonica Group]
 gb|ABA91267.1| GRAS family transcription factor containing protein, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF27462.1| Os11g0124300 [Oryza sativa Japonica Group]
Length=651

 Score =   184 bits (466),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 132/347 (38%), Positives = 193/347 (56%), Gaps = 27/347 (8%)
 Frame = +2

Query  2     RLAAYFTDALQA-LLDGAGSLHAK-SFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTA  175
             R+AAYF +A+ A L+     L+A    P+      HG   AAFQ+   +SP+VKF HFTA
Sbjct  322   RVAAYFAEAMSARLVSSCLGLYAPLPNPSPAAARLHGRVAAAFQVFNGISPFVKFSHFTA  381

Query  176   NQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrr  355
             NQAI EA   + RVHI+D DIM+G+QW  L   L SR  G   P +R+T L         
Sbjct  382   NQAIQEAFEREERVHIIDLDIMQGLQWPGLFHILASRPGG--PPRVRLTGLGASME----  435

Query  356   sFCSVQETGRRLTAFAASIGQPFSFHQCRL-DSDETFKPSALKLVRGEAIIVNCMLHLPH  532
                +++ TG+RL+ FA ++G PF F  C + D      P  L + R EA+ V+    L H
Sbjct  436   ---ALEATGKRLSDFADTLGLPFEF--CPVADKAGNLDPEKLGVTRREAVAVHW---LRH  487

Query  533   FSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAG  712
               Y    S ++ L     L P++VT+VE++ +    G F+ RF++ +H+YSAL+DSL+A 
Sbjct  488   SLYDVTGSDSNTLWLIQRLAPKVVTMVEQDLS--HSGSFLARFVEAIHYYSALFDSLDAS  545

Query  713   FPMQDQARTLVERVFLGPKIS--VAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISFAN  886
             +      R +VE+  L  +I   +A+    R    ++G SW E + ++ GFR  +++ + 
Sbjct  546   YSEDSPERHVVEQQLLSREIRNVLAVGGPARTGDVKFG-SWREKLAQS-GFRVSSLAGSA  603

Query  887   RCQAKLLLGLF-NDGYR-IEEIGNHKLILGWKSRRLLSASIWTSVHS  1021
               QA LLLG+F +DGY  IEE  N  L LGWK   LL+AS W  + +
Sbjct  604   AAQAVLLLGMFPSDGYTLIEE--NGALKLGWKDLCLLTASAWRPIQA  648



>ref|XP_003622095.1| Protein SCARECROW [Medicago truncatula]
 ref|XP_003622098.1| Protein SCARECROW [Medicago truncatula]
 gb|AES78313.1| GRAS family transcription factor [Medicago truncatula]
 gb|AFK81971.2| required for arbuscular mycorrhization 1 [Medicago truncatula]
Length=674

 Score =   183 bits (465),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 132/358 (37%), Positives = 190/358 (53%), Gaps = 44/358 (12%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASK------------------DDHPHGDALAAFQ  127
             R+A+ FT++L A L  A +L  KS    K                    +P  + L  +Q
Sbjct  336   RVASCFTESLSARL--AATLTTKSSSTKKLAPSSLSSSSSSSCLSTFPSNPM-EVLKIYQ  392

Query  128   LLQDMSPYVKFGHFTANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAP  307
             ++    PY+KF HFTANQAI EA   + RVH++D DI++G QW + MQAL +R  G  AP
Sbjct  393   IVYQACPYIKFAHFTANQAIFEAFEAEERVHVIDLDILQGYQWPAFMQALAARPGG--AP  450

Query  308   HLRITALsrgggsgrrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLV  487
              LRIT +            SV+ETGR LT  A S+  PF FH    +  E  KP      
Sbjct  451   FLRITGVGPCIE-------SVRETGRCLTELAHSLRIPFEFHPVG-EQLEDLKPHMFNRR  502

Query  488   RGEAIIVNCMLHLPHFSYRSP-DSIASFLSGSATLNPRLVTLVEEEAAPPRDGG-FVDRF  661
              GEA+ VN +  L    +R P + + + LS      P +VTLVE+EA+   +G  F+ RF
Sbjct  503   VGEALAVNTVNRL----HRVPGNHLGNLLSMIRDQAPNIVTLVEQEAS--HNGPYFLGRF  556

Query  662   MDTLHHYSALYDSLEAGFPMQDQARTLVERVFLGPKIS--VAITRSYRCRGEEYGWSWGE  835
             ++ LH+YSA++DSL+A FP++   R  VE+    P+I   VA     R    E    W +
Sbjct  557   LEALHYYSAIFDSLDATFPVESAPRAKVEQYIFAPEIRNIVACEGEERIERHERLEKWRK  616

Query  836   WVPENAGFRPKTISFANRCQAKLLLGLFN-DGYRIEEIGNHKLILGWKSRRLLSASIW  1006
              + E  GF+   +S     Q+++LLGL++ DGYR+ E     L+LGW+ R +++AS W
Sbjct  617   -IMEGKGFKGVPLSPNAVTQSRILLGLYSCDGYRLTE-DKGCLLLGWQDRAIIAASAW  672



>ref|XP_002274834.2| PREDICTED: scarecrow-like protein 21 [Vitis vinifera]
 emb|CBI21318.3| unnamed protein product [Vitis vinifera]
Length=668

 Score =   183 bits (465),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 131/347 (38%), Positives = 187/347 (54%), Gaps = 34/347 (10%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHG-------DALAAFQLLQDMSPYVKF  160
             R+A+ FT+AL A L  A +L  K  P++    P         + L  +Q+L    PY+KF
Sbjct  342   RVASCFTEALSARL--AATLTPK--PSTSTTKPFNPFPPNSLEILKIYQILYQACPYIKF  397

Query  161   GHFTANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgg  340
              HFTANQAI EA   + RVH++D DI++G QW + +QAL +R  G  AP LRIT +    
Sbjct  398   AHFTANQAIFEAFEAEERVHVIDLDILQGYQWPAFIQALAARPGG--APFLRITGVGCSP  455

Query  341   gsgrrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCML  520
                     SV+ETGR LT  A S+  PF FH    +  E  KP       GEA+ VN   
Sbjct  456   E-------SVRETGRCLTELAHSLHVPFEFHPVG-EELEDLKPHMFNRRVGEALAVNSAN  507

Query  521   HLPHFSYRSPDS-IASFLSGSATLNPRLVTLVEEEAAPPRDGG-FVDRFMDTLHHYSALY  694
              L    +R P + + + L+      P +VT+VE+EA+   +G  F+ RF++ LH+YSA++
Sbjct  508   RL----HRVPTNFLGNLLAMIRDQAPNIVTIVEQEAS--HNGPYFLGRFLEALHYYSAIF  561

Query  695   DSLEAGFPMQDQARTLVERVFLGPKIS--VAITRSYRCRGEEYGWSWGEWVPENAGFRPK  868
             DSL+A FP     R  +E+    P I   VA   + R    E    W + + E  GF+  
Sbjct  562   DSLDATFPPDSAQRAKLEQYIFAPVIRNIVACEGAERVMRHERLEKWRKLM-EGKGFQGV  620

Query  869   TISFANRCQAKLLLGLFN-DGYRIEEIGNHKLILGWKSRRLLSASIW  1006
              +S     Q+K+LLGL++ DGYR+ E     L+LGW+ R +L+AS W
Sbjct  621   PLSANAVTQSKILLGLYSCDGYRLTE-DKGCLLLGWQDRAILAASAW  666



>ref|XP_006853952.1| hypothetical protein AMTR_s00036p00212000 [Amborella trichopoda]
 gb|ERN15419.1| hypothetical protein AMTR_s00036p00212000 [Amborella trichopoda]
Length=355

 Score =   177 bits (449),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 124/338 (37%), Positives = 180/338 (53%), Gaps = 17/338 (5%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTANQ  181
             R+AAYF+DALQ+ L  +        P+   +      L AFQ    + P VKF HFTANQ
Sbjct  27    RVAAYFSDALQSRLMSSWLGMYAPLPSYALEPFSQRLLNAFQAYNAILPLVKFSHFTANQ  86

Query  182   AILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrsF  361
             AI++AV+   RVHI+D DIM+G+QW  L   L+S     P P +RIT             
Sbjct  87    AIVQAVSQVSRVHIIDLDIMQGLQWPGLFH-LLSTCSTSP-PSVRITGFGSCAR------  138

Query  362   CSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHFSY  541
               +  TG RL+ F+AS+G  F +      + E    + LKL  GE +IVN    + H+ Y
Sbjct  139   -ELAATGERLSVFSASLGLAFEYTGLVCRAGEVRDLARLKLQGGETVIVNW---VHHYMY  194

Query  542   RSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGFPM  721
                 S A  L    ++ PRL+T+VE++ +    GGF+ RF++ LH+YSAL+D+L +    
Sbjct  195   DVTGSDAGLLKLLHSVKPRLITMVEQDVSHGDGGGFLRRFVNALHYYSALFDALGSMQDS  254

Query  722   QDQARTLVERVFLGPKISVAITRSYRCR-GEEYGWSWGEWVPENAGFRPKTISFANRCQA  898
              +Q R + E+  LG +I   +    R R GE     WG  + +  GFR  ++  +   QA
Sbjct  255   MNQDRNIAEQQVLGREIKNIVGGGGRKRSGEMVVERWGAELGK-LGFRGVSLRGSAADQA  313

Query  899   KLLLGLF--NDGYRIEEIGNHKLILGWKSRRLLSASIW  1006
             +LLLG++   +GY + E G   L +GWK   LL+AS W
Sbjct  314   RLLLGMYPWQEGYSVVEEGG-CLRVGWKDLALLTASAW  350



>ref|XP_002306689.2| hypothetical protein POPTR_0005s21260g [Populus trichocarpa]
 gb|EEE93685.2| hypothetical protein POPTR_0005s21260g [Populus trichocarpa]
Length=462

 Score =   179 bits (454),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 124/317 (39%), Positives = 171/317 (54%), Gaps = 30/317 (9%)
 Frame = +2

Query  95    HPHGDALAAFQLLQDMSPYVKFGHFTANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQA  274
             H   + ++ FQ+L+++SPYV+F  FTANQAILEA   +  VHI+D DIM+GIQW  LM  
Sbjct  163   HAQNETMSHFQMLKELSPYVRFAQFTANQAILEATREENEVHILDLDIMDGIQWPPLMAD  222

Query  275   LISRQDGLPAPHLRITALsrgggsgrrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSD  454
             L  R +      LRITA+             VQ TGRRL  FA S+GQ F F Q  ++ +
Sbjct  223   LAQRNN----VSLRITAIVGDPEKAAL----VQHTGRRLVEFAESVGQTFKFDQMTIEKE  274

Query  455   ETFKPSALKLVRGEAIIVNCMLHLPHFSYRSPDSIASFLSGSATLNPRLVTLVEEEAA--  628
             E F+    K+  G  +I NCM+H  H + R+   + +FLSG + L+P+LV LVEEE    
Sbjct  275   EDFE----KIEGGHTLIANCMIHQLHMTDRNLLVVKNFLSGVSRLSPKLVVLVEEELLNF  330

Query  629   -PPRDGGFVDRFMDTLHHYSALYDSLE-----AGFPMQDQARTLVERVFLGPKISVAITR  790
                    FV+ F + + HY+AL DSL+      GF        L ++  +G +I  ++ R
Sbjct  331   LKVSSVSFVEFFREAIQHYTALSDSLQYSYGRVGFE-------LFQKETMGLRIMDSV-R  382

Query  791   SYRCRGEEYGWSWGEWVPENAGFRPKTISFANRCQAKLLLGLFNDGYRIEEIGNHKLILG  970
             S+   G E   SW E       F+P  +S  N  QAK L GL   GY ++   N +L L 
Sbjct  383   SFPI-GREEKMSWEESFSLLKNFKPIPMSATNVSQAKQLSGLLGIGYWVQN-ENSRLSLC  440

Query  971   WKSRRLLSASIWTSVHS  1021
             WKSR L +AS W   H+
Sbjct  441   WKSRPLTTASSWIPRHA  457



>ref|XP_006338809.1| PREDICTED: protein SCARECROW-like [Solanum tuberosum]
Length=689

 Score =   182 bits (462),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 131/348 (38%), Positives = 186/348 (53%), Gaps = 36/348 (10%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHG-----DALAAFQLLQDMSPYVKFGH  166
             R+A+ FT+AL A L  A +L  K   +             + L  +Q+L    PYVKF H
Sbjct  363   RVASCFTEALTARL--AATLATKPSTSVPKPFNPFPPNSLEILKIYQILYQACPYVKFAH  420

Query  167   FTANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggs  346
             FTANQAI EA   + RVH++D DI++G QW + MQAL +R  G  AP LRIT +      
Sbjct  421   FTANQAIFEAFEAEERVHVIDLDILQGYQWPAFMQALAARPGG--APFLRITGVGSSPE-  477

Query  347   grrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHL  526
                   +V+ETGR LT  A S+  PF FH    +  E  K        GEA+ VN +  L
Sbjct  478   ------AVRETGRCLTELAQSLHVPFEFHPVG-EQLEDLKAHMFNRRIGEALAVNSVNRL  530

Query  527   PHFSYRSP-DSIASFLSGSATLNPRLVTLVEEEAAPPRDGG-FVDRFMDTLHHYSALYDS  700
                 +R P + I + L       P +VT+VE+EA+   +G  F+ RF++ LH+YSA++DS
Sbjct  531   ----HRVPGNCIGNLLGMIRDQAPNIVTIVEQEAS--HNGPYFLGRFLEALHYYSAIFDS  584

Query  701   LEAGFPMQDQARTLVERVFLGPKISVAITRSYRCRGEE---YGWSWGEW--VPENAGFRP  865
             L+A FP     R  +E+   GP+I   ++    C G E         +W  V E  GF+ 
Sbjct  585   LDATFPGDSSQRAKLEQYIFGPEIMNIVS----CEGMERMVRHERLEKWRRVMEGKGFKG  640

Query  866   KTISFANRCQAKLLLGLFN-DGYRIEEIGNHKLILGWKSRRLLSASIW  1006
               +S     Q+K+LLGL++ DGY++ E  N  L+LGW+ R +L+AS W
Sbjct  641   VALSANAVTQSKILLGLYSCDGYKLTE-DNGCLLLGWQDRAILAASAW  687



>gb|ABH85406.1| SCARECROW [Pinus sylvestris]
Length=842

 Score =   182 bits (463),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 126/341 (37%), Positives = 182/341 (53%), Gaps = 20/341 (6%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTANQ  181
             R+AAYF +A+ A L  +        P           + AFQ+   +SP+VKF HFTANQ
Sbjct  515   RVAAYFAEAMSARLVSSCIGMYSPLPPIHMSQSQ-KIVNAFQVFNGISPFVKFSHFTANQ  573

Query  182   AILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrsF  361
             AI EA   ++RVHI+D DIM+G+QW  L   L SR  G   PH+RIT L         S 
Sbjct  574   AIQEAFEREQRVHIIDLDIMQGLQWPGLFHILASRPGG--PPHVRITGL-------GTSL  624

Query  362   CSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHFSY  541
              +++ TG+RL+ FA ++  PF FH    D      P  LK+ RG+A+ V+    L H  Y
Sbjct  625   EALEATGKRLSDFAHTLNLPFEFHPV-ADKVGKLDPERLKVNRGDALAVHW---LHHSLY  680

Query  542   RSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGFPM  721
                 S  + L     L+P+++T+VE++ +    G F+ RF++ +H+YSAL+DSL A +P 
Sbjct  681   DVTGSDTNTLRLLQRLSPKVITVVEQDLS--HGGSFLSRFVEAIHYYSALFDSLGASYPE  738

Query  722   QDQARTLVERVFLGPKISVAITRSYRCRGEEYGW-SWGEWVPENAGFRPKTISFANRCQA  898
                 R LVE+  L  +I   +      R  E  + +W + + +  GF+P +++     QA
Sbjct  739   DSHDRHLVEQQLLSREIKNILAVGGPARTGEIKFDNWRDQLKQ-TGFKPISLAGNAATQA  797

Query  899   KLLLGLFN-DGYRIEEIGNHKLILGWKSRRLLSASIWTSVH  1018
              LLLG+F   GY + E  N  L LGWK   LL+AS W   H
Sbjct  798   TLLLGMFPCQGYTLME-ENGTLKLGWKGLCLLTASAWRPAH  837



>ref|XP_011000401.1| PREDICTED: scarecrow-like protein 18 [Populus euphratica]
Length=420

 Score =   177 bits (450),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 116/304 (38%), Positives = 169/304 (56%), Gaps = 22/304 (7%)
 Frame = +2

Query  131   LQDMSPYVKFGHFTANQAILEAVTHDRR-VHIVDYDIMEGIQWASLMQALISRQDGL--P  301
             L  ++P+++F H TANQAILEA+   ++ +HI+D+DIM G+QW  LMQAL  R +    P
Sbjct  126   LNQITPFIRFCHLTANQAILEAIQVGQQAIHIIDFDIMHGVQWPPLMQALADRSNNTLHP  185

Query  302   APHLRITALsrgggsgrrsFCSVQETGRRLTAFAASIGQPFSFHQCRL-DSDETFK----  466
              P LRIT               +Q TG RL  FA S+G  F FH   L ++D TF     
Sbjct  186   PPMLRITG-------TGHDLNILQRTGDRLLKFAHSLGLGFQFHPLLLLNNDPTFLALHL  238

Query  467   PSALKLVRGEAIIVNCMLHLPHFSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGG  646
             PSA+ L+  EA+ VNC+L+L  F       +  FL     LNP++VT+ E EA+   +  
Sbjct  239   PSAITLLPDEALAVNCVLYLHRFLKDDSRELLLFLHKIKALNPKVVTVAEREASH-NNPL  297

Query  647   FVDRFMDTLHHYSALYDSLEAGFPMQDQARTLVERVFLGPKISVAITRSYRCRGEEYG--  820
             F+ RF++ L HY+AL+DSLEA  P  ++ R  VE+++ G +I   +      R E +   
Sbjct  298   FLQRFLEALDHYTALFDSLEATLPPNNRERLAVEQIWFGREIMDIVAAEGEVRRERHQRF  357

Query  821   WSWGEWVPENAGFRPKTISFANRCQAKLLLGLF--NDGYRIEEIGNHKLILGWKSRRLLS  994
              +W E + ++ GF    +S     QAKLLL L   ++GY++  I N+   LGW++  L S
Sbjct  358   ETW-EMLLKSVGFSSVPLSPFALSQAKLLLRLHYPSEGYQL-RILNNSFFLGWQNHSLFS  415

Query  995   ASIW  1006
              S W
Sbjct  416   VSSW  419



>gb|AJC52489.1| SCR [Pinus radiata]
Length=844

 Score =   182 bits (463),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 126/341 (37%), Positives = 182/341 (53%), Gaps = 20/341 (6%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTANQ  181
             R+AAYF +A+ A L  +        P           + AFQ+   +SP+VKF HFTANQ
Sbjct  517   RVAAYFAEAMSARLVSSCIGMYSPLPPIHMSQSQ-KIVNAFQVFNGISPFVKFSHFTANQ  575

Query  182   AILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrsF  361
             AI EA   ++RVHI+D DIM+G+QW  L   L SR  G   PH+RIT L         S 
Sbjct  576   AIQEAFEREQRVHIIDLDIMQGLQWPGLFHILASRPGG--PPHVRITGL-------GTSL  626

Query  362   CSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHFSY  541
              +++ TG+RL+ FA ++  PF FH    D      P  LK+ RG+A+ V+    L H  Y
Sbjct  627   EALEATGKRLSDFAHTLNLPFEFHPV-ADKVGKLDPERLKVNRGDALAVHW---LHHSLY  682

Query  542   RSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGFPM  721
                 S  + L     L+P+++T+VE++ +    G F+ RF++ +H+YSAL+DSL A +P 
Sbjct  683   DVTGSDTNTLRLLQRLSPKVITVVEQDLS--HGGSFLSRFVEAIHYYSALFDSLGASYPE  740

Query  722   QDQARTLVERVFLGPKISVAITRSYRCRGEEYGW-SWGEWVPENAGFRPKTISFANRCQA  898
                 R LVE+  L  +I   +      R  E  + +W + + +  GF+P +++     QA
Sbjct  741   DSHDRHLVEQQLLSREIKNILAVGGPARTGEVKFDNWRDQLKQ-TGFKPISLAGNAATQA  799

Query  899   KLLLGLFN-DGYRIEEIGNHKLILGWKSRRLLSASIWTSVH  1018
              LLLG+F   GY + E  N  L LGWK   LL+AS W   H
Sbjct  800   TLLLGMFPCQGYTLME-ENGTLKLGWKGLCLLTASAWRPAH  839



>gb|ACD13207.1| GRAS protein [Cucumis sativus]
Length=393

 Score =   176 bits (447),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 110/299 (37%), Positives = 164/299 (55%), Gaps = 19/299 (6%)
 Frame = +2

Query  131   LQDMSPYVKFGHFTANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPH  310
             L  ++P+++F H TANQAILE +     +H++D+DIM G+QW  LMQAL  R    P+P 
Sbjct  106   LNQITPFIRFTHLTANQAILEGIEESGMIHVLDFDIMHGVQWPPLMQALADR---FPSPM  162

Query  311   LRITALsrgggsgrrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFK---PSALK  481
             LRITA              + +TG RL+ FA S+G  F FH   L  D       P+AL 
Sbjct  163   LRITA-------TGVDLNFLHKTGDRLSRFAQSLGLRFQFHPLLLLHDRDHHRVIPAALT  215

Query  482   LVRGEAIIVNCMLHLPHFSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRF  661
             L   EA+ VNC+L+L  F     D +   L+    LNP++VT+ E+EA       F+ RF
Sbjct  216   LFPDEALAVNCVLYLHRFYRLMKDDVRVLLNKIKALNPKVVTIAEKEAN-FNHPLFMQRF  274

Query  662   MDTLHHYSALYDSLEAGFPMQDQARTLVERVFLGPKISVAITRSYRCRGEEYGWSWGEW-  838
             ++ L+HY+ L+DSLEA  P   + R  VE+V+ G +I+  ++     + + Y   +  W 
Sbjct  275   VEALNHYTLLFDSLEATLPPNSRERLAVEQVWFGREINDIVSGEVNKKKQHYAERYESWE  334

Query  839   -VPENAGFRPKTISFANRCQAKLLLGLF--NDGYRIEEIGNHKLILGWKSRRLLSASIW  1006
              + ++ GF    +S     QAKLLL L   ++GY + +I +  L LGW+++ L S S W
Sbjct  335   TMLKSLGFSNIPLSPFALSQAKLLLRLHYPSEGYHL-QILHDSLFLGWQNQPLFSVSSW  392



>gb|KDO64235.1| hypothetical protein CISIN_1g014896mg [Citrus sinensis]
Length=416

 Score =   177 bits (448),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 121/338 (36%), Positives = 185/338 (55%), Gaps = 22/338 (7%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTANQ  181
             R+AAYF++A+ A L  +      + P+    H     ++AFQ+   +SP+VKF HFTANQ
Sbjct  78    RVAAYFSEAMSARLVSSCLGIYAALPSLPQTHTQ-KMVSAFQVFNGISPFVKFSHFTANQ  136

Query  182   AILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrsF  361
             AI EA   + RVHI+D DIM+G+QW  L   L SR  G   P++R+T L           
Sbjct  137   AIQEAFEREDRVHIIDLDIMQGLQWPGLFHILASRPGG--PPYVRLTGLGTSME------  188

Query  362   CSVQETGRRLTAFAASIGQPFSFHQCRL-DSDETFKPSALKLVRGEAIIVNCMLHLPHFS  538
              +++ TG+RL+ FA  +G PF F  C + +      P  L + + EA+ V+    L H  
Sbjct  189   -ALEATGKRLSDFAEKLGLPFEF--CPVAEKVGNLDPERLNISKREAVAVHW---LQHSL  242

Query  539   YRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGFP  718
             Y    S  + L     L P++VT+VE++ +P   G F+ RF++ +H+YSAL+DSL A + 
Sbjct  243   YDVTGSDTNTLCLLQRLAPKVVTVVEQDLSPA--GSFLGRFVEAIHYYSALFDSLGASYG  300

Query  719   MQDQARTLVERVFLGPKISVAITRSYRCRGEEYGW-SWGEWVPENAGFRPKTISFANRCQ  895
              + + R +VE+  L  +I   +      R  +  + +W E + + +GF+  +++     Q
Sbjct  301   EESEERHVVEQQLLSREIRNVLAVGGPSRSGDVKFHNWREKL-QRSGFKGISLAGNAATQ  359

Query  896   AKLLLGLF-NDGYRIEEIGNHKLILGWKSRRLLSASIW  1006
             A LLLG+F  DGY + E  N  L LGWK   LL+AS W
Sbjct  360   ATLLLGMFPCDGYTLVE-DNGTLKLGWKDLCLLTASAW  396



>gb|KHG02698.1| Protein SCARECROW [Gossypium arboreum]
Length=643

 Score =   181 bits (458),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 118/305 (39%), Positives = 169/305 (55%), Gaps = 23/305 (8%)
 Frame = +2

Query  107   DALAAFQLLQDMSPYVKFGHFTANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISR  286
             + L  +Q++    PY+KF HFTANQAI EA   + RVH++D DI++G QW + MQAL +R
Sbjct  355   EVLKIYQIVYQACPYIKFAHFTANQAIFEAFETEERVHVIDLDILQGYQWPAFMQALAAR  414

Query  287   QDGLPAPHLRITALsrgggsgrrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFK  466
               G  AP LRIT +            +++ETGR LT  A S+  PF FH    +  E  K
Sbjct  415   PSG--APFLRITGVGPSIE-------AIKETGRCLTELAHSLHIPFEFHPIG-EKLENIK  464

Query  467   PSALKLVRGEAIIVNCMLHLPHFSYRSP-DSIASFLSGSATLNPRLVTLVEEEAAPPRDG  643
                     GEA+ VN +  L    +R P + + + L+      P +VTLVE+EA+   +G
Sbjct  465   AHMFNRRVGEALAVNAVNTL----HRVPGNCLGNLLAMIRNQAPNIVTLVEQEAS--HNG  518

Query  644   G-FVDRFMDTLHHYSALYDSLEAGFPMQDQARTLVERVFLGPKIS--VAITRSYRCRGEE  814
               F+ RF++ LH+YSA++DSL+A FP     R  VE+    P+I   VA   S R    E
Sbjct  519   PYFLGRFLEALHYYSAIFDSLDATFPPDSAQRAKVEQYIFAPEIRNIVACEGSERIERHE  578

Query  815   YGWSWGEWVPENAGFRPKTISFANRCQAKLLLGLFN-DGYRIEEIGNHKLILGWKSRRLL  991
                 W + + E  GF+   +S     Q+K+LLGL++ DGYR+ E     L+LGW+ R +L
Sbjct  579   RLEKWRKLM-EGKGFKGVPLSANAVTQSKILLGLYSCDGYRLTE-DKGCLLLGWQDRAIL  636

Query  992   SASIW  1006
             +AS W
Sbjct  637   AASAW  641



>ref|XP_002265645.1| PREDICTED: scarecrow-like protein 18 [Vitis vinifera]
 emb|CBI39870.3| unnamed protein product [Vitis vinifera]
Length=413

 Score =   177 bits (448),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 125/345 (36%), Positives = 181/345 (52%), Gaps = 29/345 (8%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHP-HGDALAAFQLLQDMSPYVKFGHFTAN  178
             RL+ Y T A       +G++ A +  A+ D    H   L+    L  ++P+++F   TAN
Sbjct  87    RLSRYATPA-----TSSGAMSASANTAAADSEAFHSTYLS----LNQITPFIRFSQLTAN  137

Query  179   QAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGL-PAPHLRITALsrgggsgrr  355
             QAILEA+   R +HI+D+DIM G+QW  LMQA+  R   L P P +RIT           
Sbjct  138   QAILEAIEGQRAIHILDFDIMHGVQWPPLMQAIAERCGNLHPPPMIRITG-------TGE  190

Query  356   sFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDET----FKPSALKLVRGEAIIVNCMLH  523
                 +Q TG RL  FA S+G  F FH   L +D T    + PSAL+L+  E + VNC+L+
Sbjct  191   DLGILQRTGDRLLKFAQSLGLKFQFHPLLLRNDPTSVPLYLPSALQLLPDETLAVNCVLY  250

Query  524   LPHFSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSL  703
             L          +  FL     + P++VT+ E EA       F+ RF++ L HY+A++DSL
Sbjct  251   LHRLLKDDSRDLRLFLHKIKAMEPKVVTIAEREAN-HNHPLFLQRFVEALDHYTAVFDSL  309

Query  704   EAGFPMQDQARTLVERVFLGPKISVAITRSYRCRGE--EYGWSWGEWVPENAGFRPKTIS  877
             EA  P   + R  VER++ G +I   ++     R E  E   SW E +  ++GF    +S
Sbjct  310   EATLPPTSRERLAVERIWFGREIVDIVSAEGDNRRERHERFESW-EVMLRSSGFSNVPLS  368

Query  878   FANRCQAKLLLGLF--NDGYRIEEIGNHKLILGWKSRRLLSASIW  1006
                  QAKLLL L   ++GYR+ +I N    LGW+++ L S S W
Sbjct  369   PFALSQAKLLLRLHYPSEGYRL-QIINDSFFLGWQNQALFSVSSW  412



>ref|XP_010110925.1| hypothetical protein L484_005656 [Morus notabilis]
 gb|EXC29148.1| hypothetical protein L484_005656 [Morus notabilis]
Length=687

 Score =   180 bits (457),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 122/306 (40%), Positives = 171/306 (56%), Gaps = 25/306 (8%)
 Frame = +2

Query  107   DALAAFQLLQDMSPYVKFGHFTANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISR  286
             + L  +Q++    PY+KF HFTANQAI EA   + RVH++D DI++G QW + MQAL +R
Sbjct  399   EILKIYQIVYQACPYIKFAHFTANQAIFEAFEAEDRVHVIDLDILQGYQWPAFMQALSAR  458

Query  287   QDGLPAPHLRITALsrgggsgrrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFK  466
               G  AP LRIT +            SV+ETGR L   A S+  PF FH    +  E  K
Sbjct  459   PSG--APFLRITGVGPSID-------SVEETGRCLAELAHSLHVPFEFHAVG-EQLEDLK  508

Query  467   PSALKLVRGEAIIVNCMLHLPHFSYRSP-DSIASFLSGSATLNPRLVTLVEEEAAPPRDG  643
             P       GEA+ VN +  L    +R P + + + LS      P ++TLVE+EA+   +G
Sbjct  509   PHMFNRRVGEALAVNSVNRL----HRVPANCLGNILSMIRDQAPNILTLVEQEAS--HNG  562

Query  644   G-FVDRFMDTLHHYSALYDSLEAGFPMQDQARTLVERVFLGPKIS--VAITRSYRCRGEE  814
               F+ RF++ LH+YSA++DSL+A FP+    R  VE+    P+I   VA     R    E
Sbjct  563   PYFLGRFLEALHYYSAIFDSLDATFPVDSVQRAKVEQYIFAPEIRNIVACEGPERTARHE  622

Query  815   YGWSWGEWVPENAGFRPKTISFANRCQAKLLLGLFN-DGYRI-EEIGNHKLILGWKSRRL  988
                 W + V E  GFR   +S     Q+K+LLGL++ DGYR+ EE G   L+LGW+ R +
Sbjct  623   RLEKWRK-VMEGKGFRGVPLSANAVTQSKILLGLYSCDGYRLTEEKGC--LLLGWQDRAI  679

Query  989   LSASIW  1006
             ++AS W
Sbjct  680   IAASAW  685



>ref|XP_004305056.1| PREDICTED: protein SCARECROW-like [Fragaria vesca subsp. vesca]
Length=791

 Score =   181 bits (458),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 127/338 (38%), Positives = 184/338 (54%), Gaps = 20/338 (6%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDAL-AAFQLLQDMSPYVKFGHFTAN  178
             R+AAYF++A+ A L  +      S P S     H   L +AFQ+   +SP+VKF HFTAN
Sbjct  457   RVAAYFSEAMSARLVSSCLGIYASLPVSAAPVTHSQKLVSAFQVFNGISPFVKFSHFTAN  516

Query  179   QAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrs  358
             QAI EA   + RVHIVD DIM+G+QW  L   L SR  G   P++R+T L          
Sbjct  517   QAIQEAFEREDRVHIVDLDIMQGLQWPGLFHILASRPGG--PPYVRLTGLGTSVE-----  569

Query  359   FCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHFS  538
               +++ TG+RLT FA  +G PF F     +   +  P  L + + EA+ V+    L H  
Sbjct  570   --ALEATGKRLTDFADKLGLPFEFFPV-AEKVGSLDPDRLNISKREAVAVHW---LQHSL  623

Query  539   YRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGFP  718
             Y    S A+ L     L P++VT+VE++ +    G F+ RF++ +H+YSAL+DSL A + 
Sbjct  624   YDVTGSDANTLWLLQRLAPKVVTVVEQDLS--HAGSFLGRFVEAIHYYSALFDSLGASYG  681

Query  719   MQDQARTLVERVFLGPKISVAITRSYRCRGEEYGW-SWGEWVPENAGFRPKTISFANRCQ  895
              + + R +VE+  L  +I   +      R  E  + +W E   + +GFR  +++     Q
Sbjct  682   EESEERHVVEQQLLSREIRNVLAVGGPSRSGEVKFHNWREKF-QQSGFRGISLAGNAATQ  740

Query  896   AKLLLGLF-NDGYRIEEIGNHKLILGWKSRRLLSASIW  1006
             A LLLG+F +DGY + E  N  L LGWK   LL+AS W
Sbjct  741   ATLLLGMFPSDGYTLVE-DNGTLKLGWKDLCLLTASAW  777



>ref|XP_007032248.1| GRAS family transcription factor isoform 2 [Theobroma cacao]
 gb|EOY03174.1| GRAS family transcription factor isoform 2 [Theobroma cacao]
Length=777

 Score =   179 bits (455),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 122/338 (36%), Positives = 186/338 (55%), Gaps = 22/338 (7%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTANQ  181
             R+AAYF++A+ A L  +    +   P+    H     ++AFQ+   +SP+VKF HFTANQ
Sbjct  441   RVAAYFSEAMSARLVSSCLGISAELPSIPQSHTQ-KMVSAFQVFNGISPFVKFSHFTANQ  499

Query  182   AILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrsF  361
             AI EA   + RVHI+D DIM+G+QW  L   L SR  G   PH+R+T L           
Sbjct  500   AIQEAFEREERVHIIDLDIMQGLQWPGLFHILASRPGG--PPHVRLTGLGTSLE------  551

Query  362   CSVQETGRRLTAFAASIGQPFSFHQCRL-DSDETFKPSALKLVRGEAIIVNCMLHLPHFS  538
              +++ TG+RL+ FA  +G PF F  C + +     +P  L + + EA+ V+    L H  
Sbjct  552   -ALEATGKRLSDFADKLGLPFEF--CPVAEKVGNLEPERLNVSKREAVAVHW---LQHSL  605

Query  539   YRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGFP  718
             Y    S  + L     L P++VT+VE++ +    G F+  F++ +H+YSAL+DSL A + 
Sbjct  606   YDVTGSDTNTLWLLQRLAPKVVTVVEQDLS--HAGSFLGTFVEAIHYYSALFDSLGASYG  663

Query  719   MQDQARTLVERVFLGPKISVAITRSYRCRGEEYGW-SWGEWVPENAGFRPKTISFANRCQ  895
              + + R +VE+  L  +I   +      R EE  + +W E + + +GF+  +++     Q
Sbjct  664   EESEERHVVEQQLLSKEIRNVLALGGPSRSEEVKFHNWREKL-QQSGFKGISLAGNAATQ  722

Query  896   AKLLLGLF-NDGYRIEEIGNHKLILGWKSRRLLSASIW  1006
             A LLLG+F +DGY + E  N  L LGWK   LL+AS W
Sbjct  723   ATLLLGMFPSDGYTLVE-DNGALKLGWKDLCLLTASAW  759



>ref|XP_010529957.1| PREDICTED: protein SCARECROW-like [Tarenaya hassleriana]
Length=561

 Score =   178 bits (451),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 126/340 (37%), Positives = 186/340 (55%), Gaps = 28/340 (8%)
 Frame = +2

Query  2     RLAAYFTDALQA-LLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTAN  178
             R+AAYF++A+ A +L+     +A + P+          ++AFQ+   +SP VKF HFTAN
Sbjct  239   RVAAYFSEAMSARMLNSCLGTYA-ALPSHS-----LKMVSAFQVFNGISPLVKFSHFTAN  292

Query  179   QAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrs  358
             QAI EA   ++ VHI+D DIM+G+QW  L   L SR  G   PH+R+T L          
Sbjct  293   QAIQEAFESEKSVHIIDLDIMQGLQWPGLFHILASRPGG--PPHVRLTGLGTSME-----  345

Query  359   FCSVQETGRRLTAFAASIGQPFSFHQCRL-DSDETFKPSALKLVRGEAIIVNCMLHLPHF  535
               ++Q T +RL+ FA  +G PF F  C L +      P  L + + EA+ V+    L H 
Sbjct  346   --ALQATRKRLSDFAEKLGLPFEF--CPLAEKVGNLDPEGLNISKREAVAVHW---LQHS  398

Query  536   SYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGF  715
              Y    S    L     L P++VT+VE++ +  + G F+ RF++ +H+YSAL+DSL A +
Sbjct  399   LYDVTGSDTHTLWLLQRLAPKVVTIVEQDMS--QAGSFLGRFVEAIHYYSALFDSLGASY  456

Query  716   PMQDQARTLVERVFLGPKISVAITRSYRCR-GEEYGWSWGEWVPENAGFRPKTISFANRC  892
               + + R +VE+  L  +I   +     CR GE    SW E + +  GF+  ++S     
Sbjct  457   GEESEQRHVVEQHLLSKEIRNILAVGGPCRSGEVKFQSWREKL-QQCGFKGISLSGKAAT  515

Query  893   QAKLLLGLF-NDGYRIEEIGNHKLILGWKSRRLLSASIWT  1009
             QA LLLG+F +DGY + +  N  L LGWK   LL+AS WT
Sbjct  516   QATLLLGMFPSDGYTLVD-DNGTLKLGWKDLSLLTASAWT  554



>emb|CAI30892.1| SCARECROW [Cucumis sativus]
 emb|CAI30893.1| SCARECROW [Cucumis sativus]
Length=858

 Score =   180 bits (456),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 125/338 (37%), Positives = 182/338 (54%), Gaps = 20/338 (6%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALA-AFQLLQDMSPYVKFGHFTAN  178
             R+AAYF++A+ A L  +      + P S   H H   +A AFQ+   +SP+VKF HFTAN
Sbjct  514   RVAAYFSEAMSARLVSSCLGIYAALPPSLVPHTHSQKIASAFQIFNGISPFVKFSHFTAN  573

Query  179   QAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrs  358
             QAI EA   + RVHI+D DIM+G+QW  L   L SR  G   P++R+T L          
Sbjct  574   QAIQEAFEREERVHIIDLDIMQGLQWPGLFHILASRPGG--PPYVRLTGLGTSQEV----  627

Query  359   FCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHFS  538
                ++ TG+RLT FA  +G PF F     D         L + + EA+ V+ M    H  
Sbjct  628   ---LEATGKRLTEFAEKLGLPFDFFPVA-DKIGNLDLERLNVSKREAVAVHWMQ---HSL  680

Query  539   YRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGFP  718
             Y    S ++ L     L P++VT+VE++ +    G F+ RF++ +H+YSAL+DSL   + 
Sbjct  681   YEVTGSDSNTLWLLQRLAPKVVTVVEQDLS--HTGSFLGRFVEAIHYYSALFDSLGVSYG  738

Query  719   MQDQARTLVERVFLGPKISVAITRSYRCR-GEEYGWSWGEWVPENAGFRPKTISFANRCQ  895
              + + R LVE+  L  +I   +      R GE    +W E + + +GF+  +++     Q
Sbjct  739   EESEERHLVEQQLLSREIRNVLAVGGPSRSGEVKFQNWREKL-QQSGFKGISLAGNAATQ  797

Query  896   AKLLLGLF-NDGYRIEEIGNHKLILGWKSRRLLSASIW  1006
             A LLLG+F +DGY + E  N  L LGWK   LL+AS W
Sbjct  798   ATLLLGMFPSDGYTLVE-DNGTLKLGWKDLCLLTASAW  834



>ref|XP_007032247.1| GRAS family transcription factor isoform 1 [Theobroma cacao]
 gb|EOY03173.1| GRAS family transcription factor isoform 1 [Theobroma cacao]
Length=795

 Score =   179 bits (455),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 122/338 (36%), Positives = 186/338 (55%), Gaps = 22/338 (7%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTANQ  181
             R+AAYF++A+ A L  +    +   P+    H     ++AFQ+   +SP+VKF HFTANQ
Sbjct  459   RVAAYFSEAMSARLVSSCLGISAELPSIPQSHTQ-KMVSAFQVFNGISPFVKFSHFTANQ  517

Query  182   AILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrsF  361
             AI EA   + RVHI+D DIM+G+QW  L   L SR  G   PH+R+T L           
Sbjct  518   AIQEAFEREERVHIIDLDIMQGLQWPGLFHILASRPGG--PPHVRLTGLGTSLE------  569

Query  362   CSVQETGRRLTAFAASIGQPFSFHQCRL-DSDETFKPSALKLVRGEAIIVNCMLHLPHFS  538
              +++ TG+RL+ FA  +G PF F  C + +     +P  L + + EA+ V+    L H  
Sbjct  570   -ALEATGKRLSDFADKLGLPFEF--CPVAEKVGNLEPERLNVSKREAVAVHW---LQHSL  623

Query  539   YRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGFP  718
             Y    S  + L     L P++VT+VE++ +    G F+  F++ +H+YSAL+DSL A + 
Sbjct  624   YDVTGSDTNTLWLLQRLAPKVVTVVEQDLS--HAGSFLGTFVEAIHYYSALFDSLGASYG  681

Query  719   MQDQARTLVERVFLGPKISVAITRSYRCRGEEYGW-SWGEWVPENAGFRPKTISFANRCQ  895
              + + R +VE+  L  +I   +      R EE  + +W E + + +GF+  +++     Q
Sbjct  682   EESEERHVVEQQLLSKEIRNVLALGGPSRSEEVKFHNWREKL-QQSGFKGISLAGNAATQ  740

Query  896   AKLLLGLF-NDGYRIEEIGNHKLILGWKSRRLLSASIW  1006
             A LLLG+F +DGY + E  N  L LGWK   LL+AS W
Sbjct  741   ATLLLGMFPSDGYTLVE-DNGALKLGWKDLCLLTASAW  777



>ref|XP_008463324.1| PREDICTED: LOW QUALITY PROTEIN: protein SCARECROW-like [Cucumis 
melo]
Length=857

 Score =   180 bits (456),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 125/338 (37%), Positives = 182/338 (54%), Gaps = 20/338 (6%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALA-AFQLLQDMSPYVKFGHFTAN  178
             R+AAYF++A+ A L  +      + P S   H H   +A AFQ+   +SP+VKF HFTAN
Sbjct  515   RVAAYFSEAMSARLVSSCLGIYAALPPSLVPHTHSQKIASAFQIFNGISPFVKFSHFTAN  574

Query  179   QAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrs  358
             QAI EA   + RVHI+D DIM+G+QW  L   L SR  G   P++R+T L          
Sbjct  575   QAIQEAFEREERVHIIDLDIMQGLQWPGLFHILASRPGG--PPYVRLTGLGTSQEV----  628

Query  359   FCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHFS  538
                ++ TG+RLT FA  +G PF F     D         L + + EA+ V+ M    H  
Sbjct  629   ---LEATGKRLTEFAEKLGLPFDFFPVA-DKIGNLDLERLNVSKREAVAVHWMQ---HSL  681

Query  539   YRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGFP  718
             Y    S ++ L     L P++VT+VE++ +    G F+ RF++ +H+YSAL+DSL   + 
Sbjct  682   YEVTGSDSNTLWLLQRLAPKVVTVVEQDLS--HTGSFLGRFVEAIHYYSALFDSLGVSYG  739

Query  719   MQDQARTLVERVFLGPKISVAITRSYRCR-GEEYGWSWGEWVPENAGFRPKTISFANRCQ  895
              + + R LVE+  L  +I   +      R GE    +W E + + +GF+  +++     Q
Sbjct  740   EESEERHLVEQQLLSREIRNVLAVGGPSRSGEVKFQNWREKL-QQSGFKGISLAGNAATQ  798

Query  896   AKLLLGLF-NDGYRIEEIGNHKLILGWKSRRLLSASIW  1006
             A LLLG+F +DGY + E  N  L LGWK   LL+AS W
Sbjct  799   ATLLLGMFPSDGYTLVE-DNGTLKLGWKDLCLLTASAW  835



>ref|XP_004147549.1| PREDICTED: LOW QUALITY PROTEIN: protein SCARECROW-like [Cucumis 
sativus]
Length=859

 Score =   180 bits (456),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 125/338 (37%), Positives = 182/338 (54%), Gaps = 20/338 (6%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALA-AFQLLQDMSPYVKFGHFTAN  178
             R+AAYF++A+ A L  +      + P S   H H   +A AFQ+   +SP+VKF HFTAN
Sbjct  514   RVAAYFSEAMSARLVSSCLGIYAALPPSLVPHTHSQKIASAFQIFNGISPFVKFSHFTAN  573

Query  179   QAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrs  358
             QAI EA   + RVHI+D DIM+G+QW  L   L SR  G   P++R+T L          
Sbjct  574   QAIQEAFEREERVHIIDLDIMQGLQWPGLFHILASRPGG--PPYVRLTGLGTSQEV----  627

Query  359   FCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHFS  538
                ++ TG+RLT FA  +G PF F     D         L + + EA+ V+ M    H  
Sbjct  628   ---LEATGKRLTEFAEKLGLPFDFFPVA-DKIGNLDLERLNVSKREAVAVHWMQ---HSL  680

Query  539   YRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGFP  718
             Y    S ++ L     L P++VT+VE++ +    G F+ RF++ +H+YSAL+DSL   + 
Sbjct  681   YEVTGSDSNTLWLLQRLAPKVVTVVEQDLS--HTGSFLGRFVEAIHYYSALFDSLGVSYG  738

Query  719   MQDQARTLVERVFLGPKISVAITRSYRCR-GEEYGWSWGEWVPENAGFRPKTISFANRCQ  895
              + + R LVE+  L  +I   +      R GE    +W E + + +GF+  +++     Q
Sbjct  739   EESEERHLVEQQLLSREIRNVLAVGGPSRSGEVKFQNWREKL-QQSGFKGISLAGNAATQ  797

Query  896   AKLLLGLF-NDGYRIEEIGNHKLILGWKSRRLLSASIW  1006
             A LLLG+F +DGY + E  N  L LGWK   LL+AS W
Sbjct  798   ATLLLGMFPSDGYTLVE-DNGTLKLGWKDLCLLTASAW  834



>ref|XP_004163982.1| PREDICTED: uncharacterized protein LOC101230653 [Cucumis sativus]
Length=858

 Score =   179 bits (455),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 125/338 (37%), Positives = 182/338 (54%), Gaps = 20/338 (6%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALA-AFQLLQDMSPYVKFGHFTAN  178
             R+AAYF++A+ A L  +      + P S   H H   +A AFQ+   +SP+VKF HFTAN
Sbjct  514   RVAAYFSEAMSARLVSSCLGIYAALPPSLVPHTHSQKIASAFQIFNGISPFVKFSHFTAN  573

Query  179   QAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrs  358
             QAI EA   + RVHI+D DIM+G+QW  L   L SR  G   P++R+T L          
Sbjct  574   QAIQEAFEREERVHIIDLDIMQGLQWPGLFHILASRPGG--PPYVRLTGLGTSQEV----  627

Query  359   FCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHFS  538
                ++ TG+RLT FA  +G PF F     D         L + + EA+ V+ M    H  
Sbjct  628   ---LEATGKRLTEFAEKLGLPFDFFPVA-DKIGNLDLERLNVSKREAVAVHWMQ---HSL  680

Query  539   YRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGFP  718
             Y    S ++ L     L P++VT+VE++ +    G F+ RF++ +H+YSAL+DSL   + 
Sbjct  681   YEVTGSDSNTLWLLQRLAPKVVTVVEQDLS--HTGSFLGRFVEAIHYYSALFDSLGVSYG  738

Query  719   MQDQARTLVERVFLGPKISVAITRSYRCR-GEEYGWSWGEWVPENAGFRPKTISFANRCQ  895
              + + R LVE+  L  +I   +      R GE    +W E + + +GF+  +++     Q
Sbjct  739   EESEERHLVEQQLLSREIRNVLAVGGPSRSGEVKFQNWREKL-QQSGFKGISLAGNAATQ  797

Query  896   AKLLLGLF-NDGYRIEEIGNHKLILGWKSRRLLSASIW  1006
             A LLLG+F +DGY + E  N  L LGWK   LL+AS W
Sbjct  798   ATLLLGMFPSDGYTLVE-DNGTLKLGWKDLCLLTASAW  834



>gb|KGN53965.1| hypothetical protein Csa_4G196810 [Cucumis sativus]
Length=857

 Score =   179 bits (455),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 125/338 (37%), Positives = 182/338 (54%), Gaps = 20/338 (6%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALA-AFQLLQDMSPYVKFGHFTAN  178
             R+AAYF++A+ A L  +      + P S   H H   +A AFQ+   +SP+VKF HFTAN
Sbjct  514   RVAAYFSEAMSARLVSSCLGIYAALPPSLVPHTHSQKIASAFQIFNGISPFVKFSHFTAN  573

Query  179   QAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrs  358
             QAI EA   + RVHI+D DIM+G+QW  L   L SR  G   P++R+T L          
Sbjct  574   QAIQEAFEREERVHIIDLDIMQGLQWPGLFHILASRPGG--PPYVRLTGLGTSQEV----  627

Query  359   FCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHFS  538
                ++ TG+RLT FA  +G PF F     D         L + + EA+ V+ M    H  
Sbjct  628   ---LEATGKRLTEFAEKLGLPFDFFPV-ADKIGNLDLERLNVSKREAVAVHWMQ---HSL  680

Query  539   YRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGFP  718
             Y    S ++ L     L P++VT+VE++ +    G F+ RF++ +H+YSAL+DSL   + 
Sbjct  681   YEVTGSDSNTLWLLQRLAPKVVTVVEQDLS--HTGSFLGRFVEAIHYYSALFDSLGVSYG  738

Query  719   MQDQARTLVERVFLGPKISVAITRSYRCR-GEEYGWSWGEWVPENAGFRPKTISFANRCQ  895
              + + R LVE+  L  +I   +      R GE    +W E + + +GF+  +++     Q
Sbjct  739   EESEERHLVEQQLLSREIRNVLAVGGPSRSGEVKFQNWREKL-QQSGFKGISLAGNAATQ  797

Query  896   AKLLLGLF-NDGYRIEEIGNHKLILGWKSRRLLSASIW  1006
             A LLLG+F +DGY + E  N  L LGWK   LL+AS W
Sbjct  798   ATLLLGMFPSDGYTLVE-DNGTLKLGWKDLCLLTASAW  834



>ref|XP_010036052.1| PREDICTED: protein SCARECROW [Eucalyptus grandis]
Length=764

 Score =   178 bits (452),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 126/342 (37%), Positives = 186/342 (54%), Gaps = 24/342 (7%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALA-AFQLLQDMSPYVKFGHFTAN  178
             R+AAYF++A+ A L  +      + P+     PH   ++ AFQ+   +SP+VKF HFTAN
Sbjct  430   RVAAYFSEAISARLVNSCLGIDMTLPSV----PHSHKISSAFQVFNGISPFVKFSHFTAN  485

Query  179   QAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrs  358
             QAI EA   + RVHI+D DIM+G+QW  L   L SR  G   PH+R+T L          
Sbjct  486   QAIQEAFEREERVHIIDLDIMQGLQWPGLFHILASRPGG--PPHVRLTGLGTSVE-----  538

Query  359   FCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHFS  538
               +++ TG+RL  FA  +G PF F     +      P  L + + EA+ V+    L H  
Sbjct  539   --ALEATGKRLGDFADKLGLPFEFIPV-AEKVGNLDPERLNVSKREAVAVHL---LQHSL  592

Query  539   YRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGFP  718
             Y    S  + L     L P++VT+VE++ +    G F+ RF++ +H+YSAL+DSL A + 
Sbjct  593   YDVTGSDTNTLWLLQRLAPKVVTVVEQDLS--HAGSFLGRFVEAIHYYSALFDSLGASYG  650

Query  719   MQDQARTLVERVFLGPKISVAITRSYRCR-GEEYGWSWGEWVPENAGFRPKTISFANRCQ  895
              + + R +VE+  L  +I   +      R GE    SW E + + AGFR  +++     Q
Sbjct  651   EESEERHVVEQQLLSREIRNVLAFGGPSRSGEAKFTSWREKL-QQAGFRGVSLAGNAATQ  709

Query  896   AKLLLGLFN-DGYRIEEIGNHKLILGWKSRRLLSASIWTSVH  1018
             A LLLG+F+ DGY + E  N  L LGWK   LL+AS W+ ++
Sbjct  710   ATLLLGMFSCDGYTLVE-DNGALKLGWKDLCLLTASAWSPLN  750



>ref|XP_004505671.1| PREDICTED: scarecrow-like protein 23-like [Cicer arietinum]
Length=446

 Score =   175 bits (443),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 130/343 (38%), Positives = 174/343 (51%), Gaps = 29/343 (8%)
 Frame = +2

Query  2     RLAAYFTDALQA-----LLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGH  166
             R+ AYF  ALQA      L     L AKS   ++          AFQ    +SP VKF H
Sbjct  115   RVGAYFAQALQARVVSSCLSSYSPLTAKSVTLTQSQR----IFNAFQSYNSVSPLVKFSH  170

Query  167   FTANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggs  346
             FTANQAI +AV  + RVHI+D DIM+G+QW  L   L SR   + +  +RIT        
Sbjct  171   FTANQAIFQAVDGEDRVHIIDLDIMQGLQWPGLFHILASRSKKIRS--VRITGFGSSSEL  228

Query  347   grrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHL  526
                    ++ TGRRL  FA+S+G PF FH          +PS L +   EAI+V+ M H 
Sbjct  229   -------LESTGRRLADFASSLGLPFEFHPVEGKIGSVTEPSQLGVRPNEAIVVHWMHHC  281

Query  527   PHFSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLE  706
              +    S       LS    L P+L+T VE++ +    G F+ RF++ LH+YSAL+D+L 
Sbjct  282   LYDITGSDLGTLRLLS---QLRPKLITTVEQDLS--HAGSFLARFVEALHYYSALFDALG  336

Query  707   AGFPMQDQARTLVERVFLGPKIS--VAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISF  880
              G       R LVE+  LG +I   +A+    R  GE     WG+ + +  GF+P ++  
Sbjct  337   DGLGADSVERHLVEQQLLGCEIRNIIAVGGPKRT-GEVKVERWGDEL-KRVGFQPVSLRG  394

Query  881   ANRCQAKLLLGLFN-DGYRIEEIGNHKLILGWKSRRLLSASIW  1006
                 QA LLLG+F   GY + E  N  L LGWK   LL AS W
Sbjct  395   NPASQASLLLGMFPWRGYTLVE-ENGSLKLGWKDLSLLIASAW  436



>gb|KCW47573.1| hypothetical protein EUGRSUZ_K01320 [Eucalyptus grandis]
Length=781

 Score =   178 bits (452),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 126/342 (37%), Positives = 186/342 (54%), Gaps = 24/342 (7%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALA-AFQLLQDMSPYVKFGHFTAN  178
             R+AAYF++A+ A L  +      + P+     PH   ++ AFQ+   +SP+VKF HFTAN
Sbjct  447   RVAAYFSEAISARLVNSCLGIDMTLPSV----PHSHKISSAFQVFNGISPFVKFSHFTAN  502

Query  179   QAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrs  358
             QAI EA   + RVHI+D DIM+G+QW  L   L SR  G   PH+R+T L          
Sbjct  503   QAIQEAFEREERVHIIDLDIMQGLQWPGLFHILASRPGG--PPHVRLTGLGTSVE-----  555

Query  359   FCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHFS  538
               +++ TG+RL  FA  +G PF F     +      P  L + + EA+ V+    L H  
Sbjct  556   --ALEATGKRLGDFADKLGLPFEFIPV-AEKVGNLDPERLNVSKREAVAVHL---LQHSL  609

Query  539   YRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGFP  718
             Y    S  + L     L P++VT+VE++ +    G F+ RF++ +H+YSAL+DSL A + 
Sbjct  610   YDVTGSDTNTLWLLQRLAPKVVTVVEQDLS--HAGSFLGRFVEAIHYYSALFDSLGASYG  667

Query  719   MQDQARTLVERVFLGPKISVAITRSYRCR-GEEYGWSWGEWVPENAGFRPKTISFANRCQ  895
              + + R +VE+  L  +I   +      R GE    SW E + + AGFR  +++     Q
Sbjct  668   EESEERHVVEQQLLSREIRNVLAFGGPSRSGEAKFTSWREKL-QQAGFRGVSLAGNAATQ  726

Query  896   AKLLLGLFN-DGYRIEEIGNHKLILGWKSRRLLSASIWTSVH  1018
             A LLLG+F+ DGY + E  N  L LGWK   LL+AS W+ ++
Sbjct  727   ATLLLGMFSCDGYTLVE-DNGALKLGWKDLCLLTASAWSPLN  767



>tpg|DAA39295.1| TPA: hypothetical protein ZEAMMB73_760951 [Zea mays]
Length=678

 Score =   178 bits (451),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 133/347 (38%), Positives = 189/347 (54%), Gaps = 25/347 (7%)
 Frame = +2

Query  2     RLAAYFTDALQA-LLDGAGSLHAKSFPASKDD-HPHGDALAAFQLLQDMSPYVKFGHFTA  175
             R+AAYF +A+ A ++     L+A   P S      HG   AAFQ+   +SP+VKF HFTA
Sbjct  346   RVAAYFAEAMSARVVSSCLGLYAPLPPGSPAAARLHGRVAAAFQVFNGISPFVKFSHFTA  405

Query  176   NQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrr  355
             NQAI EA   + RVHI+D DIM+G+QW  L   L SR  G   P +R+T L         
Sbjct  406   NQAIQEAFEREERVHIIDLDIMQGLQWPGLFHILASRPGG--PPRVRLTGLGASME----  459

Query  356   sFCSVQETGRRLTAFAASIGQPFSFHQCRLDSD-ETFKPSALKLVRGEAIIVNCMLHLPH  532
                +++ TG+RL+ FA ++G PF F  C +D       P  L + R EA+ V+  LH  H
Sbjct  460   ---ALEATGKRLSDFADTLGLPFEF--CAVDEKVGNVDPQKLGVTRREAVAVH-WLH--H  511

Query  533   FSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAG  712
               Y    S ++ L     L P++VT+VE++ +  + G F+ RF+D +H+YSAL+DSL+A 
Sbjct  512   SLYDVTGSDSNTLRLIQRLAPKVVTMVEQDLS--QSGSFLARFVDAIHYYSALFDSLDAS  569

Query  713   FPMQDQARTLVERVFLGPKISVAITRSYRCRGEEYGWSWGEWVPE--NAGFRPKTISFAN  886
             +      R +VE+  L  +I   +      R    G  +G W  E   +GFR  +++   
Sbjct  570   YGEDSPERHVVEQQLLAREIRNVLAVGGPARAGAGGARFGSWREELARSGFRAASLAGGA  629

Query  887   RCQAKLLLGLF-NDGYR-IEEIGNHKLILGWKSRRLLSASIWTSVHS  1021
               QA LLLG+F +DGY  +EE G   L LGWK   LL+AS W  V +
Sbjct  630   AAQASLLLGMFPSDGYTLVEEKG--ALRLGWKDLCLLTASAWRPVQT  674



>ref|XP_008788032.1| PREDICTED: protein SCARECROW 2-like isoform X2 [Phoenix dactylifera]
Length=676

 Score =   177 bits (449),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 131/344 (38%), Positives = 191/344 (56%), Gaps = 28/344 (8%)
 Frame = +2

Query  2     RLAAYFTDALQA-LLDGAGSLHAKSFPASKDDHPHGDAL-AAFQLLQDMSPYVKFGHFTA  175
             R+AAYF++A+ A L+     L+A   P+     PH   L +AFQ+   +SP+VKF HFTA
Sbjct  334   RVAAYFSEAMSARLVSSCLGLYAP-LPSV----PHRARLVSAFQVFNGISPFVKFSHFTA  388

Query  176   NQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrr  355
             NQAI EA   + RVHI+D DIM+G+QW  L   L SR  G   P +R+T L         
Sbjct  389   NQAIQEAFEREDRVHIIDLDIMQGLQWPGLFHILASRPGG--PPRVRLTGLGSSME----  442

Query  356   sFCSVQETGRRLTAFAASIGQPFSFHQCRL-DSDETFKPSALKLVRGEAIIVNCMLHLPH  532
                +++ TG+RL+ FA ++G PF F  C + +      P  L + R EA+ V+  LH  H
Sbjct  443   ---ALEATGKRLSDFAQTLGLPFEF--CPVAEKVGNLDPDRLGVNRREALAVH-WLH--H  494

Query  533   FSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAG  712
               Y    S  + L     L P++VT+VE++ +  + G F+ RF++ +H+YSAL+DSL A 
Sbjct  495   SLYDVTGSDTNTLWLLQRLAPKVVTMVEQDLS--QTGSFLSRFVEAIHYYSALFDSLGAS  552

Query  713   FPMQDQARTLVERVFLGPKISVAITRSYRCR-GEEYGWSWGEWVPENAGFRPKTISFANR  889
             +    Q R +VE+  L  +I   ++     R GE    +W E +   +GFR  +++    
Sbjct  553   YGEDSQERHIVEQQLLSREIRNVLSVGGPARTGEVKFGNWREKL-SQSGFRVISLAGNAA  611

Query  890   CQAKLLLGLF-NDGYRIEEIGNHKLILGWKSRRLLSASIWTSVH  1018
              QA LLLG+F +DGY + E  N  L LGWK   LL+AS W  +H
Sbjct  612   AQATLLLGMFPSDGYTLVE-ENGTLKLGWKDLCLLTASAWRPIH  654



>ref|XP_011080303.1| PREDICTED: protein SCARECROW-like [Sesamum indicum]
Length=506

 Score =   175 bits (444),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 116/307 (38%), Positives = 168/307 (55%), Gaps = 22/307 (7%)
 Frame = +2

Query  116   AAFQLLQDMSPYVKFGHFTANQAILEAV-THDRRVHIVDYDIMEGIQWASLMQALISRQD  292
             AAFQ+  ++SP++KF HFT+NQAILEA   HD R+HI+D DIM+G+QW +L   L +R +
Sbjct  214   AAFQVYNNVSPFIKFAHFTSNQAILEAFHRHDHRIHIIDLDIMQGLQWPALFHILATRAE  273

Query  293   GLPAPHLRITALsrgggsgrrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPS  472
             G   PH+R+T L             + ETG++L+ FA  +G  F FH       +    S
Sbjct  274   G--PPHVRMTGLGSSMEL-------LAETGKQLSNFARRLGLCFEFHPVDKKCGDIVDIS  324

Query  473   ALKLVRGEAIIVNCMLHLPHFSYRSPD-SIASFLSGSATLNPRLVTLVEEEAAPPRDGGF  649
              L +  GE + V+ M H   +    PD      L G   L+PR++TLVE+E A    G F
Sbjct  325   LLHVRTGETLAVHWMQH-SLYDATGPDWKTMRLLQG---LSPRVITLVEQEIA--HGGSF  378

Query  650   VDRFMDTLHHYSALYDSLEAGFPMQDQARTLVERVFLGPKISVAITRSYRCR-GEEYGWS  826
             +DRF+ +LH+YS L+DS+ A  P  D  R  VE   L  +I+  +      R GE+    
Sbjct  379   LDRFVSSLHYYSTLFDSVGAFLPGDDPGRHRVEHCLLQREITNVLAIGGPARSGEDKLRH  438

Query  827   WGEWVPENAGFRPKTISFANRCQAKLLLGLF--NDGYRIEEIGNHKLILGWKSRRLLSAS  1000
             W   +  N GF    +S  +  QA+L+L +F   +GY + + G+  L LGWK   L +AS
Sbjct  439   WRSQLSRN-GFVQLPMSTNSMAQAQLILNMFPPANGYSLVQ-GDGTLRLGWKDTSLYTAS  496

Query  1001  IWTSVHS  1021
              WTS+ +
Sbjct  497   AWTSLQT  503



>gb|AFK37026.1| unknown [Medicago truncatula]
Length=451

 Score =   174 bits (441),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 129/343 (38%), Positives = 174/343 (51%), Gaps = 29/343 (8%)
 Frame = +2

Query  2     RLAAYFTDALQA-----LLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGH  166
             R+ AYF  ALQA      L     L AKS   ++          AFQ    +SP VKF H
Sbjct  120   RVGAYFAQALQARVVSSCLGSYSPLTAKSVTLNQSQR----IFNAFQSYNSVSPLVKFSH  175

Query  167   FTANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggs  346
             FTANQAI +A+  + RVHI+D DIM+G+QW  L   L SR   + +  +RIT        
Sbjct  176   FTANQAIFQALDGEDRVHIIDLDIMQGLQWPGLFHILASRSKKIRS--VRITGFGSSSEL  233

Query  347   grrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHL  526
                    ++ TGRRL  FA+S+G PF FH          +P  L +   EAI+V+ M H 
Sbjct  234   -------LESTGRRLADFASSLGLPFEFHPVEGKIGSVTEPGQLGVRPNEAIVVHWMHHC  286

Query  527   PHFSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLE  706
                 Y    S    L     L P+L+T VE++ +    G F+ RF++ LH+YSAL+D+L 
Sbjct  287   ---LYDITGSDLGTLRLLTQLRPKLITTVEQDLS--HAGSFLARFVEALHYYSALFDALG  341

Query  707   AGFPMQDQARTLVERVFLGPKIS--VAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISF  880
              G  +    R +VE+  LG +I   +A+    R  GE     WG+ + + AGFRP ++  
Sbjct  342   DGLGVDSVERHMVEQQLLGCEIRNIIAVGGPKRT-GEVKVERWGDEL-KRAGFRPVSLRG  399

Query  881   ANRCQAKLLLGLFN-DGYRIEEIGNHKLILGWKSRRLLSASIW  1006
                 QA LLLG+F   GY + E  N  L LGWK   LL AS W
Sbjct  400   NPASQASLLLGMFPWRGYTLVE-ENGSLKLGWKDLSLLIASAW  441



>ref|XP_010931426.1| PREDICTED: protein SCARECROW 2-like [Elaeis guineensis]
Length=765

 Score =   177 bits (450),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 131/344 (38%), Positives = 190/344 (55%), Gaps = 28/344 (8%)
 Frame = +2

Query  2     RLAAYFTDALQA-LLDGAGSLHAKSFPASKDDHPHGDAL-AAFQLLQDMSPYVKFGHFTA  175
             R+AAYF++A+ A L+     L+A   P+     PH   L +AFQ+   +SP+VKF HFTA
Sbjct  430   RVAAYFSEAMSARLVSSCLGLYAP-LPSV----PHRSRLVSAFQVFNGISPFVKFSHFTA  484

Query  176   NQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrr  355
             NQAI EA   + RVHI+D DIM+G+QW  L   L SR  G   P +R+T L         
Sbjct  485   NQAIQEAFEREDRVHIIDLDIMQGLQWPGLFHILASRPGG--PPRVRLTGLGSSIE----  538

Query  356   sFCSVQETGRRLTAFAASIGQPFSFHQCRL-DSDETFKPSALKLVRGEAIIVNCMLHLPH  532
                +++ TG+RL+ FA ++G PF F  C + +      P  L + R EA+ V+  LH  H
Sbjct  539   ---ALEATGKRLSDFAQTLGLPFEF--CPVAEKVGNLDPDRLGVNRREALAVH-WLH--H  590

Query  533   FSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAG  712
               Y    S  + L     L P++VT+VE++ +  + G F+ RF++ +H+YSAL+DSL A 
Sbjct  591   SLYDVTGSDTNTLWLLQRLAPKVVTMVEQDLS--QTGSFLSRFVEAIHYYSALFDSLGAS  648

Query  713   FPMQDQARTLVERVFLGPKISVAITRSYRCR-GEEYGWSWGEWVPENAGFRPKTISFANR  889
             +    Q R +VE+  L  +I   +      R GE    +W E +   +GFR  +++    
Sbjct  649   YGEDSQERHIVEQQLLSREIRNVLAVGGPARTGEVKFGNWREKL-SQSGFRVISLAGNAA  707

Query  890   CQAKLLLGLF-NDGYRIEEIGNHKLILGWKSRRLLSASIWTSVH  1018
              QA LLLG+F +DGY + E  N  L LGWK   LL+AS W  +H
Sbjct  708   AQATLLLGMFPSDGYTLVE-ENGTLKLGWKDLCLLTASAWRPIH  750



>ref|XP_008788030.1| PREDICTED: protein SCARECROW 2-like isoform X1 [Phoenix dactylifera]
Length=740

 Score =   177 bits (449),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 129/343 (38%), Positives = 189/343 (55%), Gaps = 26/343 (8%)
 Frame = +2

Query  2     RLAAYFTDALQA-LLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTAN  178
             R+AAYF++A+ A L+     L+A   P     H     ++AFQ+   +SP+VKF HFTAN
Sbjct  398   RVAAYFSEAMSARLVSSCLGLYA---PLPSVPH-RARLVSAFQVFNGISPFVKFSHFTAN  453

Query  179   QAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrs  358
             QAI EA   + RVHI+D DIM+G+QW  L   L SR  G   P +R+T L          
Sbjct  454   QAIQEAFEREDRVHIIDLDIMQGLQWPGLFHILASRPGG--PPRVRLTGLGSSME-----  506

Query  359   FCSVQETGRRLTAFAASIGQPFSFHQCRL-DSDETFKPSALKLVRGEAIIVNCMLHLPHF  535
               +++ TG+RL+ FA ++G PF F  C + +      P  L + R EA+ V+  LH  H 
Sbjct  507   --ALEATGKRLSDFAQTLGLPFEF--CPVAEKVGNLDPDRLGVNRREALAVH-WLH--HS  559

Query  536   SYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGF  715
              Y    S  + L     L P++VT+VE++ +  + G F+ RF++ +H+YSAL+DSL A +
Sbjct  560   LYDVTGSDTNTLWLLQRLAPKVVTMVEQDLS--QTGSFLSRFVEAIHYYSALFDSLGASY  617

Query  716   PMQDQARTLVERVFLGPKISVAITRSYRCR-GEEYGWSWGEWVPENAGFRPKTISFANRC  892
                 Q R +VE+  L  +I   ++     R GE    +W E +   +GFR  +++     
Sbjct  618   GEDSQERHIVEQQLLSREIRNVLSVGGPARTGEVKFGNWREKL-SQSGFRVISLAGNAAA  676

Query  893   QAKLLLGLF-NDGYRIEEIGNHKLILGWKSRRLLSASIWTSVH  1018
             QA LLLG+F +DGY + E  N  L LGWK   LL+AS W  +H
Sbjct  677   QATLLLGMFPSDGYTLVE-ENGTLKLGWKDLCLLTASAWRPIH  718



>gb|KDP21811.1| hypothetical protein JCGZ_00598 [Jatropha curcas]
Length=840

 Score =   178 bits (451),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 125/343 (36%), Positives = 188/343 (55%), Gaps = 22/343 (6%)
 Frame = +2

Query  2     RLAAYFTDALQA-LLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTAN  178
             R+AAYF++A+ A L++    ++A + P+    H    A +AFQ+   +SP+VKF HFTAN
Sbjct  494   RVAAYFSEAMSARLVNSCLGIYA-TLPSMPISHTQKMA-SAFQVFNGISPFVKFSHFTAN  551

Query  179   QAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrs  358
             QAI EA   + RVHI+D DIM+G+QW  L   L SR  G   P++R+T L          
Sbjct  552   QAIQEAFEREDRVHIIDLDIMQGLQWPGLFHILASRPGG--PPYVRLTGLGTSME-----  604

Query  359   FCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHFS  538
               +++ TG+RL+ FA  +G PF F     D      P  L + + EA+ V+    L H  
Sbjct  605   --ALEATGKRLSDFAQKLGLPFEFFPV-ADKVGNLDPERLNVSKREAVAVHW---LQHSL  658

Query  539   YRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGFP  718
             Y    S  + L     L P++VT+VE++ +    G F+ RF++ +H+YSAL+DSL A + 
Sbjct  659   YDVTGSDTNTLWLLQRLAPKVVTVVEQDLS--HAGSFLGRFVEAIHYYSALFDSLGASYG  716

Query  719   MQDQARTLVERVFLGPKISVAITRSYRCRGEEYGW-SWGEWVPENAGFRPKTISFANRCQ  895
              + + R +VE+  L  +I   + R    R  +  + +W E +   +GF+  ++S     Q
Sbjct  717   EESEERHVVEQQLLSREIRNVLARGGPSRTGDLKFHNWREKL-RQSGFKGISLSGNAATQ  775

Query  896   AKLLLGLFN-DGYRIEEIGNHKLILGWKSRRLLSASIWTSVHS  1021
             A LLLG+F  DGY + E  N  L LGWK   LL+AS W   H+
Sbjct  776   ATLLLGMFPCDGYTLVE-DNGTLKLGWKDLCLLTASAWRPFHA  817



>ref|XP_002994174.1| hypothetical protein SELMODRAFT_432115 [Selaginella moellendorffii]
 gb|EFJ04764.1| hypothetical protein SELMODRAFT_432115 [Selaginella moellendorffii]
Length=768

 Score =   177 bits (449),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 121/299 (40%), Positives = 168/299 (56%), Gaps = 19/299 (6%)
 Frame = +2

Query  116   AAFQLLQDMSPYVKFGHFTANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDG  295
             AAFQ+   M P VKF HFTANQAILEA   ++ VHIVD DIM+G+QW +L   L SR  G
Sbjct  484   AAFQIFNGMCPLVKFSHFTANQAILEAFEGEQSVHIVDIDIMQGLQWPALFHILASRPGG  543

Query  296   LPAPHLRITALsrgggsgrrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSA  475
                P++RIT L            +++ TG+RL+ FA+S+G PF F     D       + 
Sbjct  544   --PPNVRITGLGTSAE-------ALEATGKRLSDFASSLGLPFEFFAVA-DKIGHCDAAT  593

Query  476   LKLVRGEAIIVNCMLHLPHFSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVD  655
             LK+  G+A+ V+  LH   +     DS    L GS  L P++VT+VE++ +    G F++
Sbjct  594   LKVRPGDALAVH-WLHHSLYDVTGSDSKTLKLLGS--LEPKVVTMVEQDLS--HAGSFLN  648

Query  656   RFMDTLHHYSALYDSLEAGFPMQDQARTLVERVFLGPKISVAITRSYRCR-GEEYGWSWG  832
             RF++ LH+YSAL+DSL A FP     R +VE+  L  +I   +      R GE     W 
Sbjct  649   RFVEALHYYSALFDSLGASFPEDSPDRHMVEQQLLSCEIKNILAVGGPARTGEVKFEQWR  708

Query  833   EWVPENAGFRPKTISFANRCQAKLLLGLFN-DGYRIEEIGNHKLILGWKSRRLLSASIW  1006
             + + + +GFRP +++     QA LLLG+F   GY + E  N  L LGWK   LL+AS W
Sbjct  709   DQL-KQSGFRPISLAGNAATQATLLLGMFPLQGYTLVE-DNGTLKLGWKDLCLLTASAW  765



>gb|KHN40575.1| Protein SCARECROW [Glycine soja]
Length=572

 Score =   176 bits (446),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 121/337 (36%), Positives = 182/337 (54%), Gaps = 22/337 (7%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTANQ  181
             R+AAYF++A+ A L  +      + P +   H      +AFQ+   +SP+VKF HFTANQ
Sbjct  244   RVAAYFSEAISARLVSSCLGIYATLPHTHQSH---KVASAFQVFNGISPFVKFSHFTANQ  300

Query  182   AILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrsF  361
             AI EA   + RVHI+D DIM+G+QW  L   L SR  G  AP++R+T L           
Sbjct  301   AIQEAFEREERVHIIDLDIMQGLQWPGLFHILASRPGG--APYVRLTGLGTSME------  352

Query  362   CSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHFSY  541
              +++ TG+RL+ FA  +G PF F     +      P  L + + EA+ V+    L H  Y
Sbjct  353   -ALEATGKRLSDFANKLGLPFEFFPVA-EKVGNLDPERLNVCKTEAVAVHW---LQHSLY  407

Query  542   RSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGFPM  721
                 S  + L     L P++VT+VE++ +    G F+ RF++ +H+YSAL+DSL + +  
Sbjct  408   DVTGSDTNTLWLLQRLAPKVVTVVEQDLS--NTGSFLGRFVEAIHYYSALFDSLGSSYGE  465

Query  722   QDQARTLVERVFLGPKISVAITRSYRCR-GEEYGWSWGEWVPENAGFRPKTISFANRCQA  898
             + + R +VE+  L  +I   +      R GE    +W E + +  GFR  +++     QA
Sbjct  466   ESEERHVVEQQLLSREIRNVLAVGGPSRTGEPKFHNWREKL-QQCGFRGISLAGNAATQA  524

Query  899   KLLLGLF-NDGYRIEEIGNHKLILGWKSRRLLSASIW  1006
              LLLG+F ++GY + E  N  L LGWK   LL+AS W
Sbjct  525   SLLLGMFPSEGYTLVE-DNGILKLGWKDLCLLTASAW  560



>ref|XP_006475101.1| PREDICTED: scarecrow-like protein 18-like [Citrus sinensis]
Length=457

 Score =   174 bits (441),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 124/352 (35%), Positives = 186/352 (53%), Gaps = 28/352 (8%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALAAFQL-LQDMSPYVKFGHFTAN  178
             RL  +  +A   +++   +  A + P +   +   +AL +  L L  ++P+++F H TAN
Sbjct  116   RLNLHHANATLLMMNITTTTTATTLPYNTTTYNDRNALQSCYLSLNQITPFIRFSHLTAN  175

Query  179   QAILEAV-THDRRVHIVDYDIMEGIQWASLMQALISRQDG----LPAPHLRITALsrggg  343
             QAILE++    + +HI+D+DIM G+QW  LMQAL+ R        P P LRIT       
Sbjct  176   QAILESLQVGQQSIHILDFDIMHGVQWPPLMQALVERFKNSNMLQPPPMLRITGTGHDIE  235

Query  344   sgrrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFK-----PSALKLVRGEAIIV  508
                     +Q TG RL  FA S+G  F FH   L +D+        PSAL ++ GE + +
Sbjct  236   I-------LQRTGERLLKFAQSLGLRFQFHPLLLMNDDPTSVAFCLPSALTILPGETLAI  288

Query  509   NCMLHLPHFSYRSPDS--IASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHY  682
             NCML L H   +  D+  +  FL     LNPR+VT+ E EA+      F+ RF++ + HY
Sbjct  289   NCMLFL-HKLLKDHDTRDLRLFLHKIKALNPRVVTIAEREASH-NHPVFLQRFVEAVDHY  346

Query  683   SALYDSLEAGFPMQDQARTLVERVFLGPKISVAITRSYRCRGEEYGW--SWGEWVPENAG  856
              A++DSLEA  P   + R  VE+V+ G +I   +      R E +    SW E +  + G
Sbjct  347   GAIFDSLEATLPPNSRERLAVEQVWFGREIVEIVATEGENRKERHERFDSW-EMILRSCG  405

Query  857   FRPKTISFANRCQAKLLLGLF--NDGYRIEEIGNHKLILGWKSRRLLSASIW  1006
             +    +S     QAKLLL L   ++GY++ +I N+ L LGW++R L S S W
Sbjct  406   YSNVPLSGYALSQAKLLLRLHYPSEGYQL-QILNNSLFLGWQNRALFSVSSW  456



>ref|XP_001783367.1| predicted protein [Physcomitrella patens]
 gb|EDQ51812.1| predicted protein [Physcomitrella patens]
Length=449

 Score =   174 bits (440),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 124/339 (37%), Positives = 167/339 (49%), Gaps = 13/339 (4%)
 Frame = +2

Query  2     RLAAYFTDAL-QALLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTAN  178
             R+AAYF DAL + +  G G        A     PH ++  A Q+L +  PY+KF H TAN
Sbjct  117   RVAAYFCDALTKRIARGKGEADPGVLEA-----PH-NSPKACQVLNEACPYMKFAHLTAN  170

Query  179   QAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrs  358
             QAILEAV     VHI+D+ I  GIQWA+L+QA  S     P P +RIT +S    +   +
Sbjct  171   QAILEAVKGCESVHILDFGITHGIQWAALLQAFASLPKKQPPPKVRITGISVNNPASESA  230

Query  359   FCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHL-PHF  535
               SV  TG+RL +FA  +   F F    L S E F P +++L   E  + N ML L    
Sbjct  231   SLSVLATGKRLQSFAEHLNVEFEFCPVILVSMEDFTPESIQLNPDEKTVANFMLQLHEML  290

Query  536   SYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGF  715
                   SI   L    +L+P LVTL E +AA  R   F  RFMD LH Y AL+DSL++  
Sbjct  291   DEEGSPSILRLLRSVISLSPALVTLTEHDAALNR-PEFRPRFMDALHFYCALFDSLDSTM  349

Query  716   PMQDQARTLVERVFLGPKISVAITRSYRCRGEEYGWSWGEWVP--ENAGFRPKTISFANR  889
             P     R  VE  +   +I   +      R E Y  +   W+   E  GF    +S    
Sbjct  350   PRDCHDRLNVENNYFAKQIENIVANEGVDRTERYECT-ETWIRIMETVGFTLVPLSHYAY  408

Query  890   CQAKLLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIW  1006
              QA+ LL  F D +R++      + L W+ R L++ S W
Sbjct  409   SQAQQLLWQFCDSFRLQRPSG-CIALAWQDRSLITVSAW  446



>ref|XP_009401608.1| PREDICTED: protein SCARECROW 2-like [Musa acuminata subsp. malaccensis]
Length=802

 Score =   177 bits (448),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 130/342 (38%), Positives = 189/342 (55%), Gaps = 24/342 (7%)
 Frame = +2

Query  2     RLAAYFTDALQA-LLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTAN  178
             R+AAYF++A+ A L+     L+A   P     H H  A +AFQ+   +SP+VKF HFTAN
Sbjct  467   RVAAYFSEAMSARLVSSCLGLYA---PLPTVPHRHRLA-SAFQVFNGISPFVKFSHFTAN  522

Query  179   QAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrs  358
             QAI EA   + RVHI+D+DIM+G+QW  L   L SR  G   P +R+T L         S
Sbjct  523   QAIQEAFEREDRVHIIDFDIMQGLQWPGLFHILASRPGG--PPRVRLTGL-------GSS  573

Query  359   FCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHFS  538
               +++ TG+RL+ FA ++G PF F     +      P  L + R EA+ V+  LH  H  
Sbjct  574   MDALEATGKRLSDFAETLGLPFEFVPV-AEKVGNLDPERLGVSRREALAVH-WLH--HSL  629

Query  539   YRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGFP  718
             Y    S  + L     L P++VT+VE++ +  + G F+ RF++ +H+YSAL+DSL A + 
Sbjct  630   YDVTGSDTNTLWLLQRLAPKIVTMVEQDLS--QAGSFLARFVEAIHYYSALFDSLGASYG  687

Query  719   MQDQARTLVERVFLGPKISVAITRSYRCRGEEYGWS-WGEWVPENAGFRPKTISFANRCQ  895
                Q R +VE+  L  +I   +      R  E  +S W E +   +GFR  +++     Q
Sbjct  688   EDSQERHIVEQQLLSREIRNVLAVGGPARTGEVKFSNWREKL-SQSGFRGVSLAGNAAAQ  746

Query  896   AKLLLGLF-NDGYRIEEIGNHKLILGWKSRRLLSASIWTSVH  1018
             A LLLG+F +DGY + E  N  L LGWK   LL+AS W  ++
Sbjct  747   ATLLLGMFPSDGYTLVE-ENGTLKLGWKDLCLLTASAWRPIN  787



>ref|XP_004147990.1| PREDICTED: scarecrow-like protein 18-like [Cucumis sativus]
 gb|KGN55959.1| hypothetical protein Csa_3G039300 [Cucumis sativus]
Length=388

 Score =   172 bits (435),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 109/299 (36%), Positives = 163/299 (55%), Gaps = 22/299 (7%)
 Frame = +2

Query  131   LQDMSPYVKFGHFTANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPH  310
             L  ++P+++F H TANQAILE +     +H++D+DIM G+QW  LMQAL  R    P+P 
Sbjct  104   LNQITPFIRFTHLTANQAILEGIEESGMIHVLDFDIMHGVQWPPLMQALADR---FPSPM  160

Query  311   LRITALsrgggsgrrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFK---PSALK  481
             LRITA              + +TG RL+ FA S+G  F FH   L  D       P+AL 
Sbjct  161   LRITA-------TGVDLNFLHKTGDRLSKFAQSLGLRFQFHPLLLLHDRDHHRVIPAALT  213

Query  482   LVRGEAIIVNCMLHLPHFSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRF  661
             L   EA+ VNC+L+L        D +   L+    LNP++VT+ E+EA       F+ RF
Sbjct  214   LFPDEALAVNCVLYLHRL---MKDDVRVLLNKIKALNPKVVTIAEKEAN-FNHPLFMQRF  269

Query  662   MDTLHHYSALYDSLEAGFPMQDQARTLVERVFLGPKISVAITRSYRCRGEEYGWSWGEW-  838
             ++ L+HY+ L+DSLEA  P   + R  VE+V+ G +I+  ++     + + Y   +  W 
Sbjct  270   VEALNHYTLLFDSLEATLPPNSRERLAVEQVWFGREINDIVSGEVNKKKQHYAERYESWE  329

Query  839   -VPENAGFRPKTISFANRCQAKLLLGLF--NDGYRIEEIGNHKLILGWKSRRLLSASIW  1006
              + ++ GF    +S     QAKLLL L   ++GY + +I +  L LGW+++ L S S W
Sbjct  330   TMLKSLGFSNIPLSPFALSQAKLLLRLHYPSEGYHL-QILHDSLFLGWQNQPLFSVSSW  387



>ref|XP_008448967.1| PREDICTED: scarecrow-like protein 18 [Cucumis melo]
Length=393

 Score =   172 bits (436),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 108/299 (36%), Positives = 165/299 (55%), Gaps = 22/299 (7%)
 Frame = +2

Query  131   LQDMSPYVKFGHFTANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPH  310
             L  ++P+++F H TANQAILE +     +H++D+DIM G+QW  LMQAL  R    P+P 
Sbjct  109   LNQITPFIRFTHLTANQAILEGIEESGMIHVLDFDIMHGVQWPPLMQALADR---FPSPM  165

Query  311   LRITALsrgggsgrrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFK---PSALK  481
             LRITA              + +TG RL+ FA S+G  F FH   L  D       P+AL 
Sbjct  166   LRITA-------TGLDLNFLHKTGDRLSKFAQSLGLRFQFHPLLLLHDRDHHRVIPAALT  218

Query  482   LVRGEAIIVNCMLHLPHFSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRF  661
             L   EA+ VNC+L+L        D + + L+    LNP++VT+ E+EA       F+ RF
Sbjct  219   LFPDEALAVNCVLYLHRL---MKDEVRALLNKIKALNPKVVTIAEKEAN-FNHPLFMQRF  274

Query  662   MDTLHHYSALYDSLEAGFPMQDQARTLVERVFLGPKISVAITRSYRCRGEEYGWSWGEW-  838
             ++ L+HY++++DSLEA  P   + R  VE+V+ G +I+  ++     + + Y   +  W 
Sbjct  275   VEALNHYTSIFDSLEATLPPNSRERLAVEQVWFGREINDIVSGEANKKKQHYAERYESWE  334

Query  839   -VPENAGFRPKTISFANRCQAKLLLGLF--NDGYRIEEIGNHKLILGWKSRRLLSASIW  1006
              + ++ GF    +S     QAKLLL L   ++GY + +I +  L LGW+++ L S S W
Sbjct  335   IMLKSLGFSNIPLSPFALSQAKLLLRLHYPSEGYHL-QILHDSLFLGWQNQPLFSVSSW  392



>ref|NP_001168484.1| protein SCARECROW [Zea mays]
 sp|Q9FUZ7.1|SCR_MAIZE RecName: Full=Protein SCARECROW; AltName: Full=ZmSCR [Zea mays]
 gb|AAG13663.1|AF263457_1 SCARECROW [Zea mays]
 gb|AFW64662.1| protein SCARECROW [Zea mays]
Length=668

 Score =   176 bits (446),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 131/345 (38%), Positives = 192/345 (56%), Gaps = 25/345 (7%)
 Frame = +2

Query  2     RLAAYFTDALQA-LLDGAGSLHAKSFPASKDD-HPHGDALAAFQLLQDMSPYVKFGHFTA  175
             R+AAYF +A+ A L+     L+A   P S      HG   AAFQ+   +SP+VKF HFTA
Sbjct  338   RVAAYFAEAMSARLVSSCLGLYAPLPPGSPAAARLHGRVAAAFQVFNGISPFVKFSHFTA  397

Query  176   NQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrr  355
             NQAI EA   + RVHI+D DIM+G+QW  L   L SR  G   P +R+T L         
Sbjct  398   NQAIQEAFEREERVHIIDLDIMQGLQWPGLFHILASRPGG--PPRVRLTGLGASME----  451

Query  356   sFCSVQETGRRLTAFAASIGQPFSFHQCRL-DSDETFKPSALKLVRGEAIIVNCMLHLPH  532
                +++ TG+RL+ FA ++G PF F  C + +      P  L + R EA+ V+  LH  H
Sbjct  452   ---ALEATGKRLSDFADTLGLPFEF--CAVAEKAGNVDPEKLGVTRREAVAVH-WLH--H  503

Query  533   FSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAG  712
               Y    S ++ L     L P++VT+VE++ +    G F+ RF++ +H+YSAL+DSL+A 
Sbjct  504   SLYDVTGSDSNTLWLIQRLAPKVVTMVEQDLS--HSGSFLARFVEAIHYYSALFDSLDAS  561

Query  713   FPMQDQARTLVERVFLGPKIS--VAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISFAN  886
             +      R +VE+  L  +I   +A+    R    ++G SW E + ++ GFR  +++ + 
Sbjct  562   YGEDSPERHVVEQQLLSREIRNVLAVGGPARTGDVKFG-SWREKLAQS-GFRAASLAGSA  619

Query  887   RCQAKLLLGLF-NDGYRIEEIGNHKLILGWKSRRLLSASIWTSVH  1018
               QA LLLG+F +DGY + E  N  L LGWK   LL+AS W  + 
Sbjct  620   AAQASLLLGMFPSDGYTLVE-ENGALKLGWKDLCLLTASAWRPIQ  663



>ref|XP_004159489.1| PREDICTED: LOW QUALITY PROTEIN: scarecrow-like protein 18-like 
[Cucumis sativus]
Length=396

 Score =   172 bits (435),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 111/302 (37%), Positives = 165/302 (55%), Gaps = 22/302 (7%)
 Frame = +2

Query  131   LQDMSPYVKFGHFTANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPH  310
             L  ++P+++F H TANQAILE +     +H++D+DIM G+QW  LMQAL  R    P+P 
Sbjct  106   LNQITPFIRFTHLTANQAILEGIEESGMIHVLDFDIMHGVQWPPLMQALADR---FPSPM  162

Query  311   LRITALsrgggsgrrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFK---PSALK  481
             LRITA              + +TG RL+ FA S+G  F FH   L  D       P+AL 
Sbjct  163   LRITA-------TGVDLNFLHKTGDRLSKFAQSLGLRFQFHPLLLLHDRDHHRVIPAALT  215

Query  482   LVRGEAIIVNCMLHLPHFS--YR-SPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFV  652
             L   EA+ VNC+L+L      YR   D +   L+    LNP++VT+ E+EA       F+
Sbjct  216   LFPDEALAVNCVLYLHRLRXIYRLMKDDVRVLLNKIKALNPKVVTIAEKEAN-FNHPLFM  274

Query  653   DRFMDTLHHYSALYDSLEAGFPMQDQARTLVERVFLGPKISVAITRSYRCRGEEYGWSWG  832
              RF++ L+HY+ L+DSLEA  P   + R  VE+V+ G +I+  ++     + + Y   + 
Sbjct  275   QRFVEALNHYTLLFDSLEATLPPNSRERLAVEQVWFGREINDIVSGEVNKKKQHYAERYE  334

Query  833   EW--VPENAGFRPKTISFANRCQAKLLLGLF--NDGYRIEEIGNHKLILGWKSRRLLSAS  1000
              W  + ++ GF    +S     QAKLLL L   ++GY + +I +  L LGW+++ L S S
Sbjct  335   SWETMLKSLGFSNIPLSPFALSQAKLLLRLHYPSEGYHL-QILHDSLFLGWQNQPLFSVS  393

Query  1001  IW  1006
              W
Sbjct  394   SW  395



>emb|CDP16025.1| unnamed protein product [Coffea canephora]
Length=539

 Score =   174 bits (442),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 122/338 (36%), Positives = 184/338 (54%), Gaps = 24/338 (7%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDAL-AAFQLLQDMSPYVKFGHFTAN  178
             R+AAYF++A+ A L  +      S PA     PH   + +AFQ+   +SP++KF HFTAN
Sbjct  220   RVAAYFSEAMSARLVSSCLGIYASLPAV----PHSQKMVSAFQVFNGISPFIKFSHFTAN  275

Query  179   QAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrs  358
             QAI EA   + RVHI+D DIM+G+QW  L   L SR  G   P +R+T L          
Sbjct  276   QAIQEAFDREERVHIIDLDIMQGLQWPGLFHILASRPGG--PPFVRMTGLGTSME-----  328

Query  359   FCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHFS  538
               +++ TG+RL+ FA  +G PF F+    D      P  LK+ + EA+ V+    L H  
Sbjct  329   --ALEATGKRLSDFAEKLGLPFEFNAV-ADKVGNLDPGRLKVSKREAVAVHW---LQHCL  382

Query  539   YRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGFP  718
             Y    S  S L     L P++VT+VE++ +    G F+ RF++ +H+YSAL+DSL A + 
Sbjct  383   YDVSGSDTSTLWLLQRLAPKVVTVVEQDLS--HAGSFLGRFVEAIHYYSALFDSLGACYG  440

Query  719   MQDQARTLVERVFLGPKISVAITRSYRCRGEEYGW-SWGEWVPENAGFRPKTISFANRCQ  895
              + + R +VE+  L  +I   +      R  +  + +W + + + +GF+  ++      Q
Sbjct  441   EESEERHVVEQQLLSREIRNVLAVGGPSRSSDVKFNNWRQKLLQ-SGFKGISLGGNAAAQ  499

Query  896   AKLLLGLF-NDGYRIEEIGNHKLILGWKSRRLLSASIW  1006
             A LLLG+F +DGY + E  N  L LGW+   LL+AS W
Sbjct  500   ATLLLGMFPSDGYTLVE-DNGTLKLGWRDLCLLTASAW  536



>ref|XP_002448913.1| hypothetical protein SORBIDRAFT_05g001500 [Sorghum bicolor]
 gb|EES07901.1| hypothetical protein SORBIDRAFT_05g001500 [Sorghum bicolor]
Length=591

 Score =   175 bits (444),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 130/345 (38%), Positives = 192/345 (56%), Gaps = 25/345 (7%)
 Frame = +2

Query  2     RLAAYFTDALQA-LLDGAGSLHAKSFPAS-KDDHPHGDALAAFQLLQDMSPYVKFGHFTA  175
             R+AAYF +A+ A L+     L+A   P +      HG   AAFQ+   +SP+VKF HFTA
Sbjct  261   RVAAYFAEAMSARLVSSCLGLYAPLPPGTPAAARLHGRVAAAFQVFNGISPFVKFSHFTA  320

Query  176   NQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrr  355
             NQAI EA   + RVHI+D DIM+G+QW  L   L SR  G   P +R+T L         
Sbjct  321   NQAIQEAFEREERVHIIDLDIMQGLQWPGLFHILASRPGG--PPRVRLTGLGASME----  374

Query  356   sFCSVQETGRRLTAFAASIGQPFSFHQCRL-DSDETFKPSALKLVRGEAIIVNCMLHLPH  532
                +++ TG+RL+ FA ++G PF F  C + +      P  L + R EA+ V+  LH  H
Sbjct  375   ---ALEATGKRLSDFADTLGLPFEF--CAVAEKAGNVDPEKLGVTRREAVAVH-WLH--H  426

Query  533   FSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAG  712
               Y    S ++ L     L P++VT+VE++ +    G F+ RF++ +H+YSAL+DSL+A 
Sbjct  427   SLYDVTGSDSNTLWLIQRLAPKVVTMVEQDLS--HSGSFLARFVEAIHYYSALFDSLDAS  484

Query  713   FPMQDQARTLVERVFLGPKIS--VAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISFAN  886
             +      R +VE+  L  +I   +A+    R    ++G SW E + ++ GFR  +++ + 
Sbjct  485   YGEDSPERHVVEQQLLSREIRNVLAVGGPARTGDVKFG-SWREKLAQS-GFRAASLAGSA  542

Query  887   RCQAKLLLGLF-NDGYRIEEIGNHKLILGWKSRRLLSASIWTSVH  1018
               QA LLLG+F +DGY + E  N  L LGWK   LL+AS W  + 
Sbjct  543   AAQASLLLGMFPSDGYTLVE-ENGALKLGWKDLCLLTASAWRPIQ  586



>ref|XP_006481279.1| PREDICTED: protein SCARECROW-like [Citrus sinensis]
Length=824

 Score =   177 bits (448),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 121/338 (36%), Positives = 185/338 (55%), Gaps = 22/338 (7%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTANQ  181
             R+AAYF++A+ A L  +      + P+    H     ++AFQ+   +SP+VKF HFTANQ
Sbjct  486   RVAAYFSEAMSARLVSSCLGIYAALPSLPQTHTQ-KMVSAFQVFNGISPFVKFSHFTANQ  544

Query  182   AILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrsF  361
             AI EA   + RVHI+D DIM+G+QW  L   L SR  G   P++R+T L           
Sbjct  545   AIQEAFEREDRVHIIDLDIMQGLQWPGLFHILASRPGG--PPYVRLTGLGTSME------  596

Query  362   CSVQETGRRLTAFAASIGQPFSFHQCRL-DSDETFKPSALKLVRGEAIIVNCMLHLPHFS  538
              +++ TG+RL+ FA  +G PF F  C + +      P  L + + EA+ V+    L H  
Sbjct  597   -ALEATGKRLSDFAEKLGLPFEF--CPVAEKVGNLDPERLNISKREAVAVHW---LQHSL  650

Query  539   YRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGFP  718
             Y    S  + L     L P++VT+VE++ +P   G F+ RF++ +H+YSAL+DSL A + 
Sbjct  651   YDVTGSDTNTLCLLQRLAPKVVTVVEQDLSPA--GSFLGRFVEAIHYYSALFDSLGASYG  708

Query  719   MQDQARTLVERVFLGPKISVAITRSYRCRGEEYGW-SWGEWVPENAGFRPKTISFANRCQ  895
              + + R +VE+  L  +I   +      R  +  + +W E + + +GF+  +++     Q
Sbjct  709   EESEERHVVEQQLLSREIRNVLAVGGPSRSGDVKFHNWREKL-QRSGFKGISLAGNAATQ  767

Query  896   AKLLLGLFN-DGYRIEEIGNHKLILGWKSRRLLSASIW  1006
             A LLLG+F  DGY + E  N  L LGWK   LL+AS W
Sbjct  768   ATLLLGMFPCDGYTLVE-DNGTLKLGWKDLCLLTASAW  804



>ref|XP_006429683.1| hypothetical protein CICLE_v10011085mg [Citrus clementina]
 gb|ESR42923.1| hypothetical protein CICLE_v10011085mg [Citrus clementina]
Length=822

 Score =   176 bits (447),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 121/338 (36%), Positives = 185/338 (55%), Gaps = 22/338 (7%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTANQ  181
             R+AAYF++A+ A L  +      + P+    H     ++AFQ+   +SP+VKF HFTANQ
Sbjct  484   RVAAYFSEAMSARLVSSCLGIYAALPSLPQTHTQ-KMVSAFQVFNGISPFVKFSHFTANQ  542

Query  182   AILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrsF  361
             AI EA   + RVHI+D DIM+G+QW  L   L SR  G   P++R+T L           
Sbjct  543   AIQEAFEREDRVHIIDLDIMQGLQWPGLFHILASRPGG--PPYVRLTGLGTSME------  594

Query  362   CSVQETGRRLTAFAASIGQPFSFHQCRL-DSDETFKPSALKLVRGEAIIVNCMLHLPHFS  538
              +++ TG+RL+ FA  +G PF F  C + +      P  L + + EA+ V+    L H  
Sbjct  595   -ALEATGKRLSDFAEKLGLPFEF--CPVAEKVGNLDPERLNISKREAVAVHW---LQHSL  648

Query  539   YRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGFP  718
             Y    S  + L     L P++VT+VE++ +P   G F+ RF++ +H+YSAL+DSL A + 
Sbjct  649   YDVTGSDTNTLCLLQRLAPKVVTVVEQDLSPA--GSFLGRFVEAIHYYSALFDSLGASYG  706

Query  719   MQDQARTLVERVFLGPKISVAITRSYRCRGEEYGW-SWGEWVPENAGFRPKTISFANRCQ  895
              + + R +VE+  L  +I   +      R  +  + +W E + + +GF+  +++     Q
Sbjct  707   EESEERHVVEQQLLSREIRNVLAVGGPSRSGDVKFHNWREKL-QRSGFKGISLAGNAATQ  765

Query  896   AKLLLGLFN-DGYRIEEIGNHKLILGWKSRRLLSASIW  1006
             A LLLG+F  DGY + E  N  L LGWK   LL+AS W
Sbjct  766   ATLLLGMFPCDGYTLVE-DNGTLKLGWKDLCLLTASAW  802



>dbj|BAJ91036.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=664

 Score =   175 bits (444),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 130/347 (37%), Positives = 189/347 (54%), Gaps = 26/347 (7%)
 Frame = +2

Query  2     RLAAYFTDALQA-LLDGAGSLHAKSFPASKDDH--PHGDALAAFQLLQDMSPYVKFGHFT  172
             R+AAYF +A+ A L+     L+A    AS       +G   AAFQ+   +SP VKF HFT
Sbjct  333   RVAAYFAEAVSARLVSSCLGLYAPLPHASPAASRLVNGRVAAAFQVFNGISPLVKFSHFT  392

Query  173   ANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgr  352
             ANQAI EA   + RVHI+D DIM+G+QW  L   L SR  G   P +R+T L        
Sbjct  393   ANQAIQEAFEREERVHIIDLDIMQGLQWPGLFHILASRPGG--PPRVRLTGLGASMD---  447

Query  353   rsFCSVQETGRRLTAFAASIGQPFSFHQCRL-DSDETFKPSALKLVRGEAIIVNCMLHLP  529
                 +++ TG+RL+ FA ++G PF F  C + D      P  L + R EA+ V+  LH  
Sbjct  448   ----ALEATGKRLSDFADTLGLPFEF--CPVADKAGNLDPEKLGVTRREAVAVH-WLH--  498

Query  530   HFSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEA  709
             H  Y    S ++ L     L P++VT+VE++      G F+ RF+D +H+YSAL+DSL+A
Sbjct  499   HSLYDVTGSDSNTLCLIKRLAPKVVTMVEQDLR--HTGSFLARFVDAIHYYSALFDSLDA  556

Query  710   GFPMQDQARTLVERVFLGPKIS--VAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISFA  883
              +      R +VE+  L  +I   +A+    R    ++G  W + +   +GF   +++ +
Sbjct  557   SYGEDSPERHVVEQQLLSREIRNVLAVGGPSRTGDVKFG-CWRDRL-ARSGFGAASLAGS  614

Query  884   NRCQAKLLLGLF-NDGYRIEEIGNHKLILGWKSRRLLSASIWTSVHS  1021
                QA LLLG+F +DGY + E  N  L LGWK   LL+AS W  +H+
Sbjct  615   ATAQAALLLGMFPSDGYTLLE-ENGALKLGWKDLTLLTASAWRPMHT  660



>gb|ACQ84011.1| scarecrow 1 [Lupinus albus]
 gb|ACQ84012.1| scarecrow 1 [Lupinus albus]
Length=776

 Score =   176 bits (446),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 120/337 (36%), Positives = 182/337 (54%), Gaps = 19/337 (6%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTANQ  181
             R+AAYF++A+ A L  +      + P++   H      +A+Q+   +SP+VKF HFTANQ
Sbjct  442   RVAAYFSEAISARLVSSCLGIYATLPSTLVSHSSHKVASAYQVFNGISPFVKFSHFTANQ  501

Query  182   AILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrsF  361
             AI EA   + RVHI+D DIM+G+QW  L   L SR  G   P++R+T L           
Sbjct  502   AIQEAFEREERVHIIDLDIMQGLQWPGLFHILASRPGG--PPYVRLTGLGTSME------  553

Query  362   CSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHFSY  541
              +++ TG+RL+ FA  +G PF F     D      P  L + + EA+ V+    L H  Y
Sbjct  554   -ALEATGKRLSDFANKLGLPFEFSPV-ADKVGNLDPQRLNVTKTEAVAVHW---LQHSLY  608

Query  542   RSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGFPM  721
                 S  + L     L+P++VT+VE++ +    G F+ RF++ +H+YSAL+DSL + +  
Sbjct  609   DVTGSDTNTLWLLQRLSPKVVTVVEQDMS--NAGSFLGRFVEAIHYYSALFDSLGSSYGE  666

Query  722   QDQARTLVERVFLGPKISVAITRSYRCR-GEEYGWSWGEWVPENAGFRPKTISFANRCQA  898
             + + R +VE+  L  +I   +      R G+    +W E   +  GFR  ++S     QA
Sbjct  667   ESEERHVVEQQLLSREIRNVLAIGGPSRTGDLKFHNWREKF-QQCGFRGISLSGNAATQA  725

Query  899   KLLLGLF-NDGYRIEEIGNHKLILGWKSRRLLSASIW  1006
              LLLG+F ++GY + E  N  L LGWK   LL+AS W
Sbjct  726   SLLLGMFPSEGYTLVE-DNGILKLGWKDLCLLTASAW  761



>ref|XP_008388412.1| PREDICTED: protein SCARECROW-like [Malus domestica]
Length=824

 Score =   176 bits (447),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 125/338 (37%), Positives = 182/338 (54%), Gaps = 20/338 (6%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDAL-AAFQLLQDMSPYVKFGHFTAN  178
             R+AAYF++A+ A L  +      S P S     H   + +AFQ+   +SP+VKF HFTAN
Sbjct  490   RVAAYFSEAMSARLVSSCLGIYASLPRSSVPTTHTQKMVSAFQVFNGISPFVKFSHFTAN  549

Query  179   QAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrs  358
             QAI EA   + RVHIVD DIM+G+QW  L   L SR  G   P++R+T L          
Sbjct  550   QAIQEAFEREDRVHIVDLDIMQGLQWPGLFHILASRPGG--PPYVRLTGLGTSME-----  602

Query  359   FCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHFS  538
               +++ TG+RL+ FA  +G PF F     +      P  L + + EA+ V+    L H  
Sbjct  603   --ALEATGKRLSDFADKLGLPFEFFPV-AEKVANLDPERLNISKREAVAVHW---LQHSL  656

Query  539   YRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGFP  718
             Y    S +S L     L P++VT+VE++ +    G F+ RF++ +H+YSAL+DSL A + 
Sbjct  657   YDVTGSDSSTLWLLQRLAPKVVTVVEQDLS--HAGSFLGRFVEAIHYYSALFDSLGASYG  714

Query  719   MQDQARTLVERVFLGPKISVAITRSYRCRGEEYGW-SWGEWVPENAGFRPKTISFANRCQ  895
              + + R +VE+  L  +I   +      R  E  + +W E   +  GFR  +++     Q
Sbjct  715   EESEERHVVEQQLLSREIRNVLAVGGPSRSGEVKFHNWREKF-QQTGFRGISLAGNAANQ  773

Query  896   AKLLLGLF-NDGYRIEEIGNHKLILGWKSRRLLSASIW  1006
             A LLLG+F +DGY + E  N  L LGWK   LL+AS W
Sbjct  774   AALLLGMFPSDGYTLVE-DNGTLKLGWKDLCLLTASAW  810



>ref|XP_010504220.1| PREDICTED: protein SCARECROW isoform X2 [Camelina sativa]
Length=542

 Score =   174 bits (441),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 126/341 (37%), Positives = 186/341 (55%), Gaps = 24/341 (7%)
 Frame = +2

Query  2     RLAAYFTDALQA-LLDGAGSLHAKSFPASKDDHPHG-DALAAFQLLQDMSPYVKFGHFTA  175
             R+AAYF++A+ A LL+    ++A + P+      H    ++AFQ+   +SP VKF HFTA
Sbjct  218   RVAAYFSEAMSARLLNSCLGIYA-ALPSRWMPQTHSLKMVSAFQVFNGISPLVKFSHFTA  276

Query  176   NQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrr  355
             NQAI EA   +  VHI+D DIM+G+QW  L   L SR  G   PH+R+T L         
Sbjct  277   NQAIQEAFEKEDSVHIIDLDIMQGLQWPGLFHILASRPGG--PPHVRLTGLGTSME----  330

Query  356   sFCSVQETGRRLTAFAASIGQPFSFHQCRL-DSDETFKPSALKLVRGEAIIVNCMLHLPH  532
                ++Q TG+RL+ FA  +G PF F  C L +         L + + EA+ V+    L H
Sbjct  331   ---ALQATGKRLSDFADKLGLPFEF--CPLAEKVGNLDTERLNVRKREAVAVHW---LQH  382

Query  533   FSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAG  712
               Y    S A  L     L P++VT+VE++ +    G F+ RF++ +H+YSAL+DSL A 
Sbjct  383   SLYDVTGSDAHTLWLLQRLAPKVVTVVEQDLS--HAGSFLGRFVEAIHYYSALFDSLGAS  440

Query  713   FPMQDQARTLVERVFLGPKISVAITRSYRCRGEEYGW-SWGEWVPENAGFRPKTISFANR  889
             +  + + R +VE+  L  +I   +      R  E  + SW E + +  GF+  +++    
Sbjct  441   YGEESEERHVVEQQLLSKEIRNVLAVGGPSRSGEVKFESWREKM-QQCGFKGISLAGNAA  499

Query  890   CQAKLLLGLF-NDGYRIEEIGNHKLILGWKSRRLLSASIWT  1009
              QA LLLG+F +DGY + +  N  L LGWK   LL+AS WT
Sbjct  500   TQATLLLGMFPSDGYTLVD-DNGTLKLGWKDLSLLTASAWT  539



>gb|KDO73932.1| hypothetical protein CISIN_1g048299mg [Citrus sinensis]
Length=459

 Score =   172 bits (437),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 123/352 (35%), Positives = 186/352 (53%), Gaps = 28/352 (8%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALAAFQL-LQDMSPYVKFGHFTAN  178
             RL  +  +A   +++   +  A + P +   +   +AL +  L L  ++P+++F H TAN
Sbjct  118   RLNLHHANATLLMMNITTTTTATTLPYNTTTYNDRNALQSCYLSLNQITPFIRFSHLTAN  177

Query  179   QAILEAV-THDRRVHIVDYDIMEGIQWASLMQALISRQDG----LPAPHLRITALsrggg  343
             QAILE++    + +HI+D+DIM G+QW  LMQAL+ R        P P LRIT       
Sbjct  178   QAILESLQVGQQSIHILDFDIMHGVQWPPLMQALVERFKNSNMLQPPPMLRITGTGNDIE  237

Query  344   sgrrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDET-----FKPSALKLVRGEAIIV  508
                     +Q TG RL  FA S+G  F FH   L +D+      + PSAL ++  E + V
Sbjct  238   I-------LQRTGERLLKFAQSLGLRFQFHPLLLMNDDPTSVAFYLPSALTILPDETLAV  290

Query  509   NCMLHLPHFSYRSPDS--IASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHY  682
             NCML L H   +  D+  +  FL     LNPR+VT+ E EA+      F+ RF++ + HY
Sbjct  291   NCMLFL-HKLLKDHDTRDLRLFLHKIKALNPRVVTIAEREASH-NHPLFLQRFVEAVDHY  348

Query  683   SALYDSLEAGFPMQDQARTLVERVFLGPKISVAITRSYRCRGEEYGW--SWGEWVPENAG  856
              A++DSLEA  P   + R  VE+V+ G +I   +      R E +    SW E +  + G
Sbjct  349   GAIFDSLEATLPPNSRERLAVEQVWFGREIVEIVATEGENRKERHERFDSW-EMILRSCG  407

Query  857   FRPKTISFANRCQAKLLLGLF--NDGYRIEEIGNHKLILGWKSRRLLSASIW  1006
             +    +S     QAKLLL L   ++GY++ ++ N+ L LGW++R L S S W
Sbjct  408   YSNVPLSGYALSQAKLLLRLHYPSEGYQL-QVLNNSLFLGWQNRALFSVSSW  458



>ref|XP_001782936.1| PAL1A AtPAT1-like protein [Physcomitrella patens]
 gb|EDQ52234.1| PAL1A AtPAT1-like protein [Physcomitrella patens]
Length=355

 Score =   170 bits (431),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 119/343 (35%), Positives = 175/343 (51%), Gaps = 20/343 (6%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTANQ  181
             RLAAY  + L A +  +G    +S      D P  D L+A Q+L ++ PY KFG+  AN 
Sbjct  24    RLAAYMVEGLVARVAASGKGIYRSLKCK--DPPTRDLLSAMQILYEVCPYFKFGYMAANG  81

Query  182   AILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrsF  361
             +I EA  ++ RVHI+D+ I +G QW +L+QAL +R  G   PHLRIT +         + 
Sbjct  82    SIAEAFQNESRVHIIDFQIAQGTQWTTLIQALAARPGG--PPHLRITGIDDPMPGPNSN-  138

Query  362   CSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHF--  535
               V+  G+RL   A ++G PF FH       E  +   L+   GEA+ VN  LHL H   
Sbjct  139   AGVEMVGKRLAKLAEAVGVPFDFHPVAKKGPEV-EAWMLERQPGEALAVNFALHLHHMPD  197

Query  536   -SYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAG  712
              S  + +     L     LNP++VTLVE+E+       F  RF++ +++Y+A+++SL+  
Sbjct  198   ESVCTSNPRDRILHMVKALNPKVVTLVEQESN-TNTAPFFPRFLEAMNYYAAIFESLDIT  256

Query  713   FPMQDQARTLVERVFLGPKISVAITRSYRCRG---EEYGWSWGEWVPE--NAGFRPKTIS  877
                + + R  VE+  L   I   I     C G    E     G+W      AGFRP  +S
Sbjct  257   LARESKERVNVEQQCLARDIVNIIA----CEGIDRVERHEMMGKWRARLTMAGFRPYPLS  312

Query  878   FANRCQAKLLLGLFNDGYRIEEIGNHKLILGWKSRRLLSASIW  1006
                    K LL  ++D YR+++ G   L LGWK+R L+ +S W
Sbjct  313   QTVNNTIKTLLESYSDKYRLKDEGG-ALYLGWKNRSLIVSSAW  354



>ref|XP_002519983.1| transcription factor, putative [Ricinus communis]
 gb|EEF42307.1| transcription factor, putative [Ricinus communis]
Length=843

 Score =   176 bits (447),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 124/342 (36%), Positives = 188/342 (55%), Gaps = 22/342 (6%)
 Frame = +2

Query  2     RLAAYFTDALQA-LLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTAN  178
             R+AAYF++A+ A L++    ++A + P+    H    A +AFQ+   +SP+VKF HFTAN
Sbjct  493   RVAAYFSEAMSARLINSCLGIYA-TLPSMPLTHTQKMA-SAFQVFNGISPFVKFSHFTAN  550

Query  179   QAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrs  358
             QAI EA   + RVHI+D DIM+G+QW  L   L SR  G   P++R+T L          
Sbjct  551   QAIQEAFEREDRVHIIDLDIMQGLQWPGLFHILASRPGG--PPYVRLTGLGTSIE-----  603

Query  359   FCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHFS  538
               +++ TG+RL+ FA  +G PF F     D      P  L + + EA+ V+    L H  
Sbjct  604   --ALEATGKRLSDFAQKLGLPFEFFPV-ADKVGNLDPDRLNVSKREAVAVHW---LQHSL  657

Query  539   YRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGFP  718
             Y    S ++ L     L P++VT+VE++ +    G F+ RF++ +H+YSAL+DSL A + 
Sbjct  658   YDVTGSDSNTLWLLQRLAPKVVTVVEQDLS--HAGSFLGRFVEAIHYYSALFDSLGASYG  715

Query  719   MQDQARTLVERVFLGPKISVAITRSYRCRGEEYGW-SWGEWVPENAGFRPKTISFANRCQ  895
              + + R +VE+  L  +I   +      R  E  + +W E +   +GF+  +++     Q
Sbjct  716   EESEERHVVEQQLLSREIRNVLAVGGPSRSGEVKFHNWREKL-RQSGFKGISLAGNAATQ  774

Query  896   AKLLLGLF-NDGYRIEEIGNHKLILGWKSRRLLSASIWTSVH  1018
             A LLLG+F +DGY + E  N  L LGWK   LL+AS W   H
Sbjct  775   ATLLLGMFPSDGYTLVE-DNGTLKLGWKDLCLLTASAWRPFH  815



>ref|XP_001778507.1| predicted protein [Physcomitrella patens]
 gb|EDQ56680.1| predicted protein [Physcomitrella patens]
Length=404

 Score =   171 bits (434),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 118/307 (38%), Positives = 162/307 (53%), Gaps = 17/307 (6%)
 Frame = +2

Query  107   DALAAFQLLQDMSPYVKFGHFTANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQAL--I  280
             + L+AF  L  ++P+++F H TANQA+LEA+T +  VHIVD DI  G+QW   MQAL  I
Sbjct  103   EILSAFLALNQVTPFMRFAHLTANQALLEALTGEDFVHIVDLDIGHGVQWPPFMQALADI  162

Query  281   SRQDGLPAPHLRITALsrgggsgrrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDET  460
               ++G    HLRIT + +           +  TG RL  FA SI  PF F    + + E 
Sbjct  163   RGEEGHTIQHLRITGVGKDREM-------LDRTGTRLAEFAQSIQLPFEFTPL-VQAPEN  214

Query  461   FKPSALKLVRGEAIIVNCMLHLPHFSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRD  640
               PS   L  GEA+  NCML L     +  + + SFL    +L PR+VTL E EA+    
Sbjct  215   LIPSMFGLRIGEAVAFNCMLQLHQLLAKGSEKLTSFLYMLESLTPRVVTLAELEAS-HNQ  273

Query  641   GGFVDRFMDTLHHYSALYDSLEAGFPMQDQARTLVERVFLGPKI--SVAITRSYRCRGEE  814
               F+DRF + L+HYS L+DSL+A  P     R  VE+ +   +I   VA   + R    +
Sbjct  274   PHFLDRFAEALNHYSTLFDSLDATLPPTSPERIRVEQTWYKMEIINIVACDGTERTVRHQ  333

Query  815   YGWSWGEWVPENAGFRPKTISFANRCQAKLLLGLF--NDGYR-IEEIGNHKLILGWKSRR  985
                 W  +  E AGF+    S     QA+LLL L    DGYR +E++ +  L+LGW+ R 
Sbjct  334   RCEQWRRFF-ERAGFQLLPTSRFATSQARLLLRLHYPCDGYRLVEDVEDGCLLLGWQDRP  392

Query  986   LLSASIW  1006
             L   S W
Sbjct  393   LFCVSSW  399



>ref|XP_006452790.1| hypothetical protein CICLE_v10008226mg [Citrus clementina]
 gb|ESR66030.1| hypothetical protein CICLE_v10008226mg [Citrus clementina]
Length=459

 Score =   172 bits (437),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 123/352 (35%), Positives = 186/352 (53%), Gaps = 28/352 (8%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALAAFQL-LQDMSPYVKFGHFTAN  178
             RL  +  +A   +++   +  A + P +   +   +AL +  L L  ++P+++F H TAN
Sbjct  118   RLNLHHANATLLMMNITTTTTATTLPYNTTTYNDRNALQSCYLSLNQITPFIRFSHLTAN  177

Query  179   QAILEAV-THDRRVHIVDYDIMEGIQWASLMQALISRQDG----LPAPHLRITALsrggg  343
             QAILE++    + +HI+D+DIM G+QW  LMQAL+ R        P P LRIT       
Sbjct  178   QAILESLQVGQQSIHILDFDIMHGVQWPPLMQALVERFKNSNMLQPPPMLRITGTGNDIE  237

Query  344   sgrrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDET-----FKPSALKLVRGEAIIV  508
                     +Q TG RL  FA S+G  F FH   L +D+      + PSAL ++  E + V
Sbjct  238   I-------LQRTGERLLKFAQSLGLRFQFHPLLLMNDDPTSVAFYLPSALTILPDETLAV  290

Query  509   NCMLHLPHFSYRSPDS--IASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHY  682
             NCML L H   +  D+  +  FL     LNPR+VT+ E EA+      F+ RF++ + HY
Sbjct  291   NCMLFL-HKLLKDHDTRDLRLFLHKIKALNPRVVTIAEREASH-NHPLFLQRFVEAVDHY  348

Query  683   SALYDSLEAGFPMQDQARTLVERVFLGPKISVAITRSYRCRGEEYGW--SWGEWVPENAG  856
              A++DSLEA  P   + R  VE+V+ G +I   +      R E +    SW E +  + G
Sbjct  349   GAIFDSLEATLPPNSRERLAVEQVWFGREIVEIVATEGENRKERHERFDSW-EMILRSCG  407

Query  857   FRPKTISFANRCQAKLLLGLF--NDGYRIEEIGNHKLILGWKSRRLLSASIW  1006
             +    +S     QAKLLL L   ++GY++ ++ N+ L LGW++R L S S W
Sbjct  408   YSNVPLSGYALSQAKLLLRLHYPSEGYQL-QVLNNSLFLGWQNRALFSVSSW  458



>ref|XP_004977413.1| PREDICTED: protein SCARECROW-like [Setaria italica]
Length=671

 Score =   175 bits (443),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 129/346 (37%), Positives = 190/346 (55%), Gaps = 25/346 (7%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGA--GSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTA  175
             R+AAYF +A+ A L  +  G        +      HG   AAFQ+   +SP+VKF HFTA
Sbjct  342   RVAAYFAEAMSARLVSSCLGLYAPLPPASPAAARLHGRVAAAFQVFNGISPFVKFSHFTA  401

Query  176   NQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrr  355
             NQAI EA   + RVHI+D DIM+G+QW  L   L SR  G   P +R+T L         
Sbjct  402   NQAIQEAFEREERVHIIDLDIMQGLQWPGLFHILASRPGG--PPRVRLTGLGASME----  455

Query  356   sFCSVQETGRRLTAFAASIGQPFSFHQCRL-DSDETFKPSALKLVRGEAIIVNCMLHLPH  532
                ++Q TG+RL+ FA ++G PF F  C + +      P  L + R EA+ V+  LH  H
Sbjct  456   ---ALQATGKRLSDFADTLGLPFEF--CAVAEKAGNVDPEKLGVTRREAVAVH-WLH--H  507

Query  533   FSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAG  712
               Y    S ++ L     L P++VT+VE++ +    G F+ RF++ +H+YSAL+DSL+A 
Sbjct  508   SLYDVTGSDSNTLWLIQRLAPKVVTMVEQDLS--HSGSFLARFVEAIHYYSALFDSLDAS  565

Query  713   FPMQDQARTLVERVFLGPKIS--VAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISFAN  886
             +      R +VE+  L  +I   +A+    R    ++G SW E + ++ GFR  +++ + 
Sbjct  566   YGEDSPERHVVEQQLLSREIRNVLAVGGPARTGDVKFG-SWREKLAQS-GFRSASLAGSA  623

Query  887   RCQAKLLLGLF-NDGYRIEEIGNHKLILGWKSRRLLSASIWTSVHS  1021
               QA LLLG+F +DGY + E  N  L LGWK   LL+AS W  + +
Sbjct  624   AAQASLLLGMFPSDGYTLVE-ENGALKLGWKDLCLLTASAWRPIQT  668



>ref|XP_009337846.1| PREDICTED: protein SCARECROW 2-like [Pyrus x bretschneideri]
Length=824

 Score =   176 bits (446),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 124/338 (37%), Positives = 182/338 (54%), Gaps = 20/338 (6%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDAL-AAFQLLQDMSPYVKFGHFTAN  178
             R+AAYF++A+ A L  +      S P S     H   + +AFQ+   +SP++KF HFTAN
Sbjct  490   RVAAYFSEAMSARLVSSCLGIYASLPRSSVPTTHTQKMVSAFQVFNGISPFIKFSHFTAN  549

Query  179   QAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrs  358
             QAI EA   + RVHIVD DIM+G+QW  L   L SR  G   P++R+T L          
Sbjct  550   QAIQEAFEREDRVHIVDLDIMQGLQWPGLFHILASRPGG--PPYVRLTGLGTSME-----  602

Query  359   FCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHFS  538
               +++ TG+RL+ FA  +G PF F     +      P  L + + EA+ V+    L H  
Sbjct  603   --ALEATGKRLSDFADKLGLPFEFFPV-AEKVANLDPERLNVSKREAVAVHW---LQHSL  656

Query  539   YRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGFP  718
             Y    S +S L     L P++VT+VE++ +    G F+ RF++ +H+YSAL+DSL A + 
Sbjct  657   YDVTGSDSSTLWLLQRLAPKVVTVVEQDLS--HAGSFLGRFVEAIHYYSALFDSLGASYG  714

Query  719   MQDQARTLVERVFLGPKISVAITRSYRCRGEEYGW-SWGEWVPENAGFRPKTISFANRCQ  895
              + + R +VE+  L  +I   +      R  E  + +W E   +  GFR  +++     Q
Sbjct  715   EESEERHVVEQQLLSREIRNVLAVGGPSRSGEVKFHNWREKF-QQTGFRGISLAGNAANQ  773

Query  896   AKLLLGLF-NDGYRIEEIGNHKLILGWKSRRLLSASIW  1006
             A LLLG+F +DGY + E  N  L LGWK   LL+AS W
Sbjct  774   ASLLLGMFPSDGYTLVE-DNGTLKLGWKDLCLLTASAW  810



>ref|XP_009411777.1| PREDICTED: protein SCARECROW 2-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=712

 Score =   175 bits (444),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 125/337 (37%), Positives = 184/337 (55%), Gaps = 22/337 (7%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTANQ  181
             R+AAYF++A+ A L    S      P     H H  A +AFQ+   +SP+VKF HFTANQ
Sbjct  363   RVAAYFSEAMSARL--VSSCLGLYSPLRTVPHRHRLA-SAFQVFNGISPFVKFSHFTANQ  419

Query  182   AILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrsF  361
              I EA   + RVHI+D+DIM+G+QW  L   L SR +G   PH+R+T +           
Sbjct  420   VIQEAFELEDRVHIIDFDIMQGLQWPGLFHILASRPNG--PPHVRLTGVGSSME------  471

Query  362   CSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHFSY  541
              +++ TG+RL+ FA ++G PF F    ++      P  L + R EA+ V+    L H  Y
Sbjct  472   -ALEATGKRLSDFADTLGLPFDFVPV-VEKVGNLNPERLGVSRQEALAVHW---LRHSLY  526

Query  542   RSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGFPM  721
                 S  + L     L P++VT+VE++ +  + G F+ RF++ +H+YSAL+DSL A +  
Sbjct  527   DVTGSDTNTLWLLQRLAPKVVTMVEQDLS--QAGSFLARFVEAIHYYSALFDSLGASYGE  584

Query  722   QDQARTLVERVFLGPKISVAITRSYRCRGEEYGWS-WGEWVPENAGFRPKTISFANRCQA  898
               Q R +VE+  L  +I   +      R  +  +S W E +   +GFR  +++     QA
Sbjct  585   DSQERHIVEQQLLSREIRNVLAVGGPARTGQVKFSNWREKL-SQSGFRGVSLAGNAAAQA  643

Query  899   KLLLGLF-NDGYRIEEIGNHKLILGWKSRRLLSASIW  1006
              LLLG+F +DGY + E  N  L LGWK   LL+AS W
Sbjct  644   TLLLGMFPSDGYTLVE-ENGTLKLGWKDLCLLTASAW  679



>ref|XP_003560068.1| PREDICTED: scarecrow-like protein 23 [Brachypodium distachyon]
Length=465

 Score =   172 bits (437),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 138/350 (39%), Positives = 182/350 (52%), Gaps = 26/350 (7%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTANQ  181
             R+AAYF DAL A +  +  L A S  A           +AFQ    +SP VKF HFTAN+
Sbjct  114   RVAAYFGDALCARVLSS-YLGAYSPLALASAQQSRRVASAFQAYNALSPLVKFSHFTANK  172

Query  182   AILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrsF  361
             AIL+A+  + RVH+VD DIM+G+QW  L   L S +   P   LRIT L           
Sbjct  173   AILQALDGEDRVHVVDLDIMQGLQWPGLFHMLASSRPSKPLLSLRITGLGASLEV-----  227

Query  362   CSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVR--GEAIIVNCMLHLPHF  535
               ++ TGRRL  FA S+G PF F               L L R  GEA +V+ M    H 
Sbjct  228   --LEATGRRLADFAGSLGLPFEFRPIEGKIGHVADTDVLLLGRDEGEATVVHWM---HHC  282

Query  536   SYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGF  715
              Y    S A  +    +L P+LVT+VE++      G F+ RF++ LH+YSAL+D+L  G 
Sbjct  283   LYDVTGSDAGTVRVLRSLRPKLVTIVEQDLG--HGGDFLGRFVEALHYYSALFDALGDGA  340

Query  716   -PMQDQA--RTLVERVFLGPKIS--VAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISF  880
              P +++A  R  VER  LG +I   VA+    R  GE     WG+ +   AGFRP ++S 
Sbjct  341   GPEEEEAQQRHAVERQLLGAEIRNIVAVGGPKRT-GEVRVERWGDEL-RRAGFRPVSLSG  398

Query  881   ANRCQAKLLLGLFN-DGYR-IEEIGNHKLILGWKSRRLLSASIWTSVHSD  1024
                 QA+LLLG+    GY  +EE G  K  LGWK   LL+AS W    +D
Sbjct  399   GPAAQARLLLGMCPWKGYTLVEEDGCLK--LGWKDLSLLTASSWEPTTTD  446



>ref|XP_009384356.1| PREDICTED: protein SCARECROW 2-like [Musa acuminata subsp. malaccensis]
Length=783

 Score =   176 bits (445),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 128/341 (38%), Positives = 186/341 (55%), Gaps = 24/341 (7%)
 Frame = +2

Query  2     RLAAYFTDALQA-LLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTAN  178
             R+AAYF++A+ A L+     L+A   P     H H  A +AFQ+   +SP+VKF HFTAN
Sbjct  454   RVAAYFSEAMSARLVSSCLGLYA---PLPTVPHRHRLA-SAFQVFNGISPFVKFSHFTAN  509

Query  179   QAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrs  358
             QAI EA   + RVHI+D+DIM+G+QW  L   L SR  G   P +R+T L          
Sbjct  510   QAIQEAFEREDRVHIIDFDIMQGLQWPGLFHILASRPGG--PPRVRLTGLGYSME-----  562

Query  359   FCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHFS  538
               +++ TG+RL+ FA ++G PF F     +      P  L + R EA+ V+    L H  
Sbjct  563   --ALEATGKRLSDFAETLGLPFEFIPI-AEKVGNLDPERLGVSRREALAVHW---LQHSL  616

Query  539   YRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGFP  718
             Y    S  + L     L P++VT+VE++ +  + G F+ RF++ +H+YSAL+DSL A + 
Sbjct  617   YDVTGSDTNTLWLLQRLAPKVVTMVEQDLS--QAGSFLARFVEAIHYYSALFDSLGASYS  674

Query  719   MQDQARTLVERVFLGPKISVAITRSYRCRGEEYGWS-WGEWVPENAGFRPKTISFANRCQ  895
                Q R +VE+  L  +I   +      R  E  +S W E +   +GFR  +++     Q
Sbjct  675   EDSQERHIVEQQLLSREIRNVLAVGGPARTGEVKFSNWREKL-GQSGFRGVSLAGNAAAQ  733

Query  896   AKLLLGLF-NDGYRIEEIGNHKLILGWKSRRLLSASIWTSV  1015
             A LLLG+F +DGY + E  N  L LGWK   LL+AS W  +
Sbjct  734   ATLLLGMFPSDGYTLVE-ENGTLKLGWKDLCLLTASAWRPI  773



>ref|XP_009411779.1| PREDICTED: protein SCARECROW 2-like isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=699

 Score =   175 bits (443),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 125/337 (37%), Positives = 184/337 (55%), Gaps = 22/337 (7%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTANQ  181
             R+AAYF++A+ A L    S      P     H H  A +AFQ+   +SP+VKF HFTANQ
Sbjct  363   RVAAYFSEAMSARL--VSSCLGLYSPLRTVPHRHRLA-SAFQVFNGISPFVKFSHFTANQ  419

Query  182   AILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrsF  361
              I EA   + RVHI+D+DIM+G+QW  L   L SR +G   PH+R+T +           
Sbjct  420   VIQEAFELEDRVHIIDFDIMQGLQWPGLFHILASRPNG--PPHVRLTGVGSSME------  471

Query  362   CSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHFSY  541
              +++ TG+RL+ FA ++G PF F    ++      P  L + R EA+ V+    L H  Y
Sbjct  472   -ALEATGKRLSDFADTLGLPFDFVPV-VEKVGNLNPERLGVSRQEALAVHW---LRHSLY  526

Query  542   RSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGFPM  721
                 S  + L     L P++VT+VE++ +  + G F+ RF++ +H+YSAL+DSL A +  
Sbjct  527   DVTGSDTNTLWLLQRLAPKVVTMVEQDLS--QAGSFLARFVEAIHYYSALFDSLGASYGE  584

Query  722   QDQARTLVERVFLGPKISVAITRSYRCRGEEYGWS-WGEWVPENAGFRPKTISFANRCQA  898
               Q R +VE+  L  +I   +      R  +  +S W E +   +GFR  +++     QA
Sbjct  585   DSQERHIVEQQLLSREIRNVLAVGGPARTGQVKFSNWREKL-SQSGFRGVSLAGNAAAQA  643

Query  899   KLLLGLF-NDGYRIEEIGNHKLILGWKSRRLLSASIW  1006
              LLLG+F +DGY + E  N  L LGWK   LL+AS W
Sbjct  644   TLLLGMFPSDGYTLVE-ENGTLKLGWKDLCLLTASAW  679



>ref|XP_002321384.1| hypothetical protein POPTR_0015s01070g [Populus trichocarpa]
 gb|EEF05511.1| hypothetical protein POPTR_0015s01070g [Populus trichocarpa]
Length=434

 Score =   172 bits (435),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 113/303 (37%), Positives = 164/303 (54%), Gaps = 20/303 (7%)
 Frame = +2

Query  131   LQDMSPYVKFGHFTANQAILEAVTHDRR-VHIVDYDIMEGIQWASLMQALISRQDGL--P  301
             L  ++P+++F H TANQAILEAV   ++ +HI+D+DIM G+QW  LMQAL  R +    P
Sbjct  140   LNQITPFIRFSHLTANQAILEAVQGGQQAIHIIDFDIMHGVQWPPLMQALADRPNNTLHP  199

Query  302   APHLRITALsrgggsgrrsFCSVQETGRRLTAFAASIGQPFSFHQCRL-DSDET----FK  466
              P LRIT               +  TG RL  FA S+G  F FH   L ++D T    + 
Sbjct  200   PPMLRITG-------TGHDLNILHRTGDRLLKFAQSLGLRFQFHPLLLLNNDPTTLALYL  252

Query  467   PSALKLVRGEAIIVNCMLHLPHFSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGG  646
             PSA+ L+  EA+ VNC+L+L  F       +  FL     LNP++VT+ E EA       
Sbjct  253   PSAITLLPDEALAVNCVLYLHRFLKDDSRELLLFLHKIKALNPKVVTVAEREANH-NQPL  311

Query  647   FVDRFMDTLHHYSALYDSLEAGFPMQDQARTLVERVFLGPKISVAITRSYRCRGEEY-GW  823
             F+ RF++ L HY AL+DSLEA  P  ++ R  VE+++ G +I   +      R E +  +
Sbjct  312   FLQRFLEALDHYKALFDSLEATLPPNNRERLAVEQIWFGREILDIVAAEGEGRRERHQKF  371

Query  824   SWGEWVPENAGFRPKTISFANRCQAKLLLGLF--NDGYRIEEIGNHKLILGWKSRRLLSA  997
                E + ++ GF    +S     QAKLLL L   ++GY+++ + N    LGW++  L S 
Sbjct  372   ETWEMMLKSVGFNKVPLSPFALSQAKLLLRLHYPSEGYQLQILKN-SFFLGWQNHSLFSI  430

Query  998   SIW  1006
             S W
Sbjct  431   SSW  433



>ref|XP_007206431.1| hypothetical protein PRUPE_ppa001546mg [Prunus persica]
 gb|EMJ07630.1| hypothetical protein PRUPE_ppa001546mg [Prunus persica]
Length=804

 Score =   176 bits (445),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 124/338 (37%), Positives = 184/338 (54%), Gaps = 20/338 (6%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDAL-AAFQLLQDMSPYVKFGHFTAN  178
             R+AAYF++A+ A L  +      S P S     H   + +AFQ+   +SP+VKF HFTAN
Sbjct  470   RVAAYFSEAMSARLVSSCLGIYASLPPSYVPISHTQKMVSAFQVFNGISPFVKFSHFTAN  529

Query  179   QAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrs  358
             QAI EA   + RVHIVD DIM+G+QW  L   L SR  G   P++R+T L          
Sbjct  530   QAIQEAFEREDRVHIVDLDIMQGLQWPGLFHILASRPGG--PPYVRLTGLGTSME-----  582

Query  359   FCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHFS  538
               +++ TG+RL+ FA  +G PF F     +   +  P  L + + EA+ V+    L H  
Sbjct  583   --ALEATGKRLSDFADKLGLPFEFFPV-AEKVGSLDPERLNISKREAVAVHW---LQHSL  636

Query  539   YRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGFP  718
             Y    S ++ L     L P++VT+VE++ +    G F+ RF++ +H+YSAL+DSL A + 
Sbjct  637   YDVTGSDSNTLWLLQRLAPKVVTVVEQDLS--HAGSFLGRFVEAIHYYSALFDSLGASYG  694

Query  719   MQDQARTLVERVFLGPKISVAITRSYRCRGEEYGW-SWGEWVPENAGFRPKTISFANRCQ  895
              + + R +VE+  L  +I   +      R  E  + +W E   + +GFR  +++     Q
Sbjct  695   EESEERHVVEQQLLSREIRNVLAVGGPSRSGEVKFHNWREKF-QQSGFRGISLAGNAATQ  753

Query  896   AKLLLGLF-NDGYRIEEIGNHKLILGWKSRRLLSASIW  1006
             A LLLG+F +DGY + E  N  L LGWK   LL+AS W
Sbjct  754   ATLLLGMFPSDGYTLVE-DNGTLKLGWKDLCLLTASAW  790



>ref|XP_009411778.1| PREDICTED: protein SCARECROW 2-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=710

 Score =   175 bits (443),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 125/337 (37%), Positives = 184/337 (55%), Gaps = 22/337 (7%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTANQ  181
             R+AAYF++A+ A L    S      P     H H  A +AFQ+   +SP+VKF HFTANQ
Sbjct  363   RVAAYFSEAMSARL--VSSCLGLYSPLRTVPHRHRLA-SAFQVFNGISPFVKFSHFTANQ  419

Query  182   AILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrsF  361
              I EA   + RVHI+D+DIM+G+QW  L   L SR +G   PH+R+T +           
Sbjct  420   VIQEAFELEDRVHIIDFDIMQGLQWPGLFHILASRPNG--PPHVRLTGVGSSME------  471

Query  362   CSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHFSY  541
              +++ TG+RL+ FA ++G PF F    ++      P  L + R EA+ V+    L H  Y
Sbjct  472   -ALEATGKRLSDFADTLGLPFDFVPV-VEKVGNLNPERLGVSRQEALAVHW---LRHSLY  526

Query  542   RSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGFPM  721
                 S  + L     L P++VT+VE++ +  + G F+ RF++ +H+YSAL+DSL A +  
Sbjct  527   DVTGSDTNTLWLLQRLAPKVVTMVEQDLS--QAGSFLARFVEAIHYYSALFDSLGASYGE  584

Query  722   QDQARTLVERVFLGPKISVAITRSYRCRGEEYGWS-WGEWVPENAGFRPKTISFANRCQA  898
               Q R +VE+  L  +I   +      R  +  +S W E +   +GFR  +++     QA
Sbjct  585   DSQERHIVEQQLLSREIRNVLAVGGPARTGQVKFSNWREKL-SQSGFRGVSLAGNAAAQA  643

Query  899   KLLLGLF-NDGYRIEEIGNHKLILGWKSRRLLSASIW  1006
              LLLG+F +DGY + E  N  L LGWK   LL+AS W
Sbjct  644   TLLLGMFPSDGYTLVE-ENGTLKLGWKDLCLLTASAW  679



>ref|XP_003551631.1| PREDICTED: protein SCARECROW-like [Glycine max]
Length=842

 Score =   176 bits (445),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 121/337 (36%), Positives = 182/337 (54%), Gaps = 22/337 (7%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTANQ  181
             R+AAYF++A+ A L  +      + P +   H      +AFQ+   +SP+VKF HFTANQ
Sbjct  514   RVAAYFSEAISARLVSSCLGIYATLPHTHQSH---KVASAFQVFNGISPFVKFSHFTANQ  570

Query  182   AILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrsF  361
             AI EA   + RVHI+D DIM+G+QW  L   L SR  G  AP++R+T L           
Sbjct  571   AIQEAFEREERVHIIDLDIMQGLQWPGLFHILASRPGG--APYVRLTGLGTSME------  622

Query  362   CSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHFSY  541
              +++ TG+RL+ FA  +G PF F     +      P  L + + EA+ V+    L H  Y
Sbjct  623   -ALEATGKRLSDFANKLGLPFEFFPV-AEKVGNLDPERLNVCKTEAVAVHW---LQHSLY  677

Query  542   RSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGFPM  721
                 S  + L     L P++VT+VE++ +    G F+ RF++ +H+YSAL+DSL + +  
Sbjct  678   DVTGSDTNTLWLLQRLAPKVVTVVEQDLS--NTGSFLGRFVEAIHYYSALFDSLGSSYGE  735

Query  722   QDQARTLVERVFLGPKISVAITRSYRCR-GEEYGWSWGEWVPENAGFRPKTISFANRCQA  898
             + + R +VE+  L  +I   +      R GE    +W E + +  GFR  +++     QA
Sbjct  736   ESEERHVVEQQLLSREIRNVLAVGGPSRTGEPKFHNWREKL-QQCGFRGISLAGNAATQA  794

Query  899   KLLLGLF-NDGYRIEEIGNHKLILGWKSRRLLSASIW  1006
              LLLG+F ++GY + E  N  L LGWK   LL+AS W
Sbjct  795   SLLLGMFPSEGYTLVE-DNGILKLGWKDLCLLTASAW  830



>emb|CBI31126.3| unnamed protein product [Vitis vinifera]
Length=664

 Score =   174 bits (442),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 124/343 (36%), Positives = 183/343 (53%), Gaps = 24/343 (7%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDAL-AAFQLLQDMSPYVKFGHFTAN  178
             R+AAYF++A+ A L  +      + P      PH   L +AFQ+   +SP+VKF HFTAN
Sbjct  331   RVAAYFSEAMSARLVSSCLGIYATLPTV----PHSQKLVSAFQVFNGISPFVKFSHFTAN  386

Query  179   QAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrs  358
             QAI EA   + RVHI+D DIM+G+QW  L   L SR  G   P +R+T L          
Sbjct  387   QAIQEAFEREERVHIIDLDIMQGLQWPGLFHILASRPGG--PPFVRLTGLGTSME-----  439

Query  359   FCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHFS  538
               +++ TG+RLT FA  +G PF F     +      P  L + + EA+ V+    L H  
Sbjct  440   --ALEATGKRLTDFAEKLGLPFEFFPV-AEKVGNLDPERLNVSKREAVAVHW---LQHSL  493

Query  539   YRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGFP  718
             Y    S  + L     L P++VT+VE++ +    G F+ RF++ +H+YSAL+DSL A + 
Sbjct  494   YDVTGSDTNTLWLLQRLAPKVVTVVEQDLS--HAGSFLGRFVEAIHYYSALFDSLGASYG  551

Query  719   MQDQARTLVERVFLGPKISVAITRSYRCRGEEYGW-SWGEWVPENAGFRPKTISFANRCQ  895
              + + R  VE+  L  +I   +      R  +  + +W E + + +GFR  +++     Q
Sbjct  552   EESEQRHAVEQQLLSREIRNVLAVGGPSRSGDVKFNNWREKL-QQSGFRVVSLAGNAATQ  610

Query  896   AKLLLGLF-NDGYRIEEIGNHKLILGWKSRRLLSASIWTSVHS  1021
             A LLLG+F +DGY + E  N  L LGWK   LL+AS W   H+
Sbjct  611   ATLLLGMFPSDGYTLVE-DNGTLKLGWKDLCLLTASAWRPFHA  652



>ref|XP_004978490.1| PREDICTED: protein SCARECROW-like [Setaria italica]
Length=666

 Score =   174 bits (442),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 129/346 (37%), Positives = 190/346 (55%), Gaps = 25/346 (7%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGA--GSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTA  175
             R+AAYF +A+ A L  +  G        +      HG   AAFQ+   +SP+VKF HFTA
Sbjct  337   RVAAYFAEAMSARLVSSCLGLYAPLPPASPAAARLHGRVAAAFQVFNGISPFVKFSHFTA  396

Query  176   NQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrr  355
             NQAI EA   + RVHI+D DIM+G+QW  L   L SR  G   P +R+T L         
Sbjct  397   NQAIQEAFEREERVHIIDLDIMQGLQWPGLFHILASRPGG--PPRVRLTGLGASME----  450

Query  356   sFCSVQETGRRLTAFAASIGQPFSFHQCRL-DSDETFKPSALKLVRGEAIIVNCMLHLPH  532
                ++Q TG+RL+ FA ++G PF F  C + +      P  L + R EA+ V+  LH  H
Sbjct  451   ---ALQATGKRLSDFADTLGLPFEF--CAVAEKAGNVDPEKLGVTRREAVAVH-WLH--H  502

Query  533   FSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAG  712
               Y    S ++ L     L P++VT+VE++ +    G F+ RF++ +H+YSAL+DSL+A 
Sbjct  503   SLYDVTGSDSNTLWLIQRLAPKVVTMVEQDLS--HSGSFLARFVEAIHYYSALFDSLDAS  560

Query  713   FPMQDQARTLVERVFLGPKIS--VAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISFAN  886
             +      R +VE+  L  +I   +A+    R    ++G SW E + ++ GFR  +++ + 
Sbjct  561   YGEDSPERHVVEQQLLSREIRNVLAVGGPARTGDVKFG-SWREKLAQS-GFRSASLAGSA  618

Query  887   RCQAKLLLGLF-NDGYRIEEIGNHKLILGWKSRRLLSASIWTSVHS  1021
               QA LLLG+F +DGY + E  N  L LGWK   LL+AS W  + +
Sbjct  619   AAQASLLLGMFPSDGYTLVE-ENGVLKLGWKDLCLLTASAWRPIQT  663



>ref|XP_010113028.1| hypothetical protein L484_022753 [Morus notabilis]
 gb|EXC35199.1| hypothetical protein L484_022753 [Morus notabilis]
Length=836

 Score =   176 bits (445),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 122/338 (36%), Positives = 184/338 (54%), Gaps = 20/338 (6%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALA-AFQLLQDMSPYVKFGHFTAN  178
             R+AAYF++A+ A L  +      + PA+     H   +A AFQ+   +SP+VKF HFTAN
Sbjct  502   RVAAYFSEAMSARLVSSCLGIYAALPATSIPIIHTQKMASAFQVFNGISPFVKFSHFTAN  561

Query  179   QAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrs  358
             QAI EA   + RVHI+D DIM+G+QW  L   L SR  G   P++R+T L          
Sbjct  562   QAIQEAFEREERVHIIDLDIMQGLQWPGLFHILASRPGG--PPYVRLTGLGTSME-----  614

Query  359   FCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHFS  538
               +++ TG+RL+ FA  +G PF F     +      P  L + + EA+ V+    L H  
Sbjct  615   --ALEATGKRLSDFADKLGLPFEFFPVA-EKVGNLDPERLNVSKREAVAVHW---LQHSL  668

Query  539   YRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGFP  718
             Y    S  + L     L P++VT+VE++ +    G F+ RF++ +H+YSAL+DSL A + 
Sbjct  669   YDVTGSDTNTLWLLQRLAPKVVTVVEQDLS--HAGSFLGRFVEAIHYYSALFDSLGASYG  726

Query  719   MQDQARTLVERVFLGPKISVAITRSYRCRGEEYGW-SWGEWVPENAGFRPKTISFANRCQ  895
              + + R +VE+  L  +I   +      R  +  + +W E + + +GFR  +++     Q
Sbjct  727   EESEERHVVEQQLLSREIRNVLAVGGPARSGDVKFHNWREKL-QQSGFRGISLAGNAATQ  785

Query  896   AKLLLGLF-NDGYRIEEIGNHKLILGWKSRRLLSASIW  1006
             A LLLG+F +DGY + E  N  L LGWK   LL+AS W
Sbjct  786   ATLLLGMFPSDGYTLVE-DNGTLKLGWKDLCLLTASAW  822



>ref|XP_004492611.1| PREDICTED: protein SCARECROW-like [Cicer arietinum]
Length=794

 Score =   175 bits (443),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 123/338 (36%), Positives = 183/338 (54%), Gaps = 24/338 (7%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALA-AFQLLQDMSPYVKFGHFTAN  178
             R+AAYF++A+ A L  +         A+  + PH   +A AFQ+   +SP+VKF HFTAN
Sbjct  464   RVAAYFSEAISARLVSS----CLGIYATLPNTPHSQKVASAFQVFNGISPFVKFSHFTAN  519

Query  179   QAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrs  358
             QAI EA   + RVHI+D DIM+G+QW  L   L SR  G   P++R+T L          
Sbjct  520   QAIQEAFDREDRVHIIDLDIMQGLQWPGLFHILASRPGG--PPYVRLTGLGTSME-----  572

Query  359   FCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHFS  538
               +++ TG+RL+ FA  +G PF F     +      P  L + + EA+ V+    L H  
Sbjct  573   --TLEATGKRLSDFACKLGLPFEFFPVA-EKVGNVDPDKLNVSKSEAVAVHW---LQHSL  626

Query  539   YRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGFP  718
             Y    S  + L     L P++VT+VE++ +    G F+ RF++ +H+YSAL+DSL   + 
Sbjct  627   YDVTGSDTNTLWLLQRLAPKVVTVVEQDLS--NAGSFLGRFVEAIHYYSALFDSLGCSYG  684

Query  719   MQDQARTLVERVFLGPKI-SVAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISFANRCQ  895
              + + R +VE+  L  +I +V   R     GE    +W E + +  GFR  +++     Q
Sbjct  685   EESEERHVVEQQLLSREIRNVLAVRGPSRSGEIKFHNWREKL-QQCGFRGISLAGNAATQ  743

Query  896   AKLLLGLF-NDGYRIEEIGNHKLILGWKSRRLLSASIW  1006
             A LLLG+F ++GY + E  N  L LGWK   LL+AS W
Sbjct  744   ASLLLGMFPSEGYTLVE-DNGILKLGWKDLCLLTASAW  780



>ref|XP_002323112.2| hypothetical protein POPTR_0016s15060g [Populus trichocarpa]
 gb|EEF04873.2| hypothetical protein POPTR_0016s15060g [Populus trichocarpa]
Length=803

 Score =   175 bits (444),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 119/341 (35%), Positives = 184/341 (54%), Gaps = 20/341 (6%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTANQ  181
             R+AAYF++A+ A L  +      + P+    H    A +AFQ+   + P+VKF HFTANQ
Sbjct  451   RVAAYFSEAMSARLVSSCLGIYATLPSMPQSHTQKMA-SAFQVFNGIGPFVKFSHFTANQ  509

Query  182   AILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrsF  361
             AI EA   + RVHI+D D+M+G+QW  L   L SR  G   P++R+T L           
Sbjct  510   AIQEAFEREERVHIIDLDVMQGLQWPGLFHILASRPGG--PPYVRLTGLGTSLE------  561

Query  362   CSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHFSY  541
              +++ TG+RL+ FA  +G PF F     +     +P  L + + EA+ V+    L H  Y
Sbjct  562   -ALEATGKRLSDFAHKLGLPFEFIPVA-EKVGNLEPERLNVSKREAVAVHW---LQHSLY  616

Query  542   RSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGFPM  721
                 S  + L     L P++VT+VE++ +    G F+ RF++ +H+YSAL+DSL A +  
Sbjct  617   DVTGSDTNMLCLLQRLAPKVVTVVEQDLS--HAGSFLGRFVEAIHYYSALFDSLGASYGE  674

Query  722   QDQARTLVERVFLGPKISVAITRSYRCRGEEYGW-SWGEWVPENAGFRPKTISFANRCQA  898
             + + R +VE+  L  +I   +      R  +  + +W E + + +GF+  +++     QA
Sbjct  675   ESEERHVVEQQLLSREIRNVLAVGGPSRSGDVKFHNWREKL-QQSGFKGISLAGNAATQA  733

Query  899   KLLLGLF-NDGYRIEEIGNHKLILGWKSRRLLSASIWTSVH  1018
              LLLG+F +DGY + E  N  L LGWK   LL+AS W   H
Sbjct  734   TLLLGMFPSDGYTLVE-DNGTLKLGWKDLCLLTASAWRPFH  773



>gb|ACN28379.1| unknown [Zea mays]
Length=322

 Score =   168 bits (426),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 119/310 (38%), Positives = 175/310 (56%), Gaps = 23/310 (7%)
 Frame = +2

Query  101   HGDALAAFQLLQDMSPYVKFGHFTANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALI  280
             HG   AAFQ+   +SP+VKF HFTANQAI EA   + RVHI+D DIM+G+QW  L   L 
Sbjct  27    HGRVAAAFQVFNGISPFVKFSHFTANQAIQEAFEREERVHIIDLDIMQGLQWPGLFHILA  86

Query  281   SRQDGLPAPHLRITALsrgggsgrrsFCSVQETGRRLTAFAASIGQPFSFHQCRL-DSDE  457
             SR  G   P +R+T L            +++ TG+RL+ FA ++G PF F  C + +   
Sbjct  87    SRPGG--PPRVRLTGLGASME-------ALEATGKRLSDFADTLGLPFEF--CAVAEKAG  135

Query  458   TFKPSALKLVRGEAIIVNCMLHLPHFSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPR  637
                P  L + R EA+ V+  LH  H  Y    S ++ L     L P++VT+VE++ +   
Sbjct  136   NVDPEKLGVTRREAVAVH-WLH--HSLYDVTGSDSNTLWLIQRLAPKVVTMVEQDLS--H  190

Query  638   DGGFVDRFMDTLHHYSALYDSLEAGFPMQDQARTLVERVFLGPKIS--VAITRSYRCRGE  811
              G F+ RF++ +H+YSAL+DSL+A +      R +VE+  L  +I   +A+    R    
Sbjct  191   SGSFLARFVEAIHYYSALFDSLDASYGEDSPERHVVEQQLLSREIRNVLAVGGPARTGDV  250

Query  812   EYGWSWGEWVPENAGFRPKTISFANRCQAKLLLGLF-NDGYRIEEIGNHKLILGWKSRRL  988
             ++G SW E + ++ GFR  +++ +   QA LLLG+F +DGY + E  N  L LGWK   L
Sbjct  251   KFG-SWREKLAQS-GFRAASLAGSAAAQASLLLGMFPSDGYTLVE-ENGALKLGWKDLCL  307

Query  989   LSASIWTSVH  1018
             L+AS W  + 
Sbjct  308   LTASAWRPIQ  317



>ref|XP_011018909.1| PREDICTED: protein SCARECROW-like [Populus euphratica]
Length=845

 Score =   175 bits (444),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 124/343 (36%), Positives = 183/343 (53%), Gaps = 24/343 (7%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTANQ  181
             R+AAYF++A+ A L  +      + P+    H    A +AFQ+   +SP+VKF HFTANQ
Sbjct  501   RVAAYFSEAMSARLVSSCLGIYATLPSMPQSHTQKMA-SAFQVFNGISPFVKFSHFTANQ  559

Query  182   AILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrsF  361
             AI EA   + RVHI+D DIM+G+QW  L   L SR  G   P++R+T L           
Sbjct  560   AIQEAFEREERVHIIDLDIMQGLQWPGLFHILASRPGG--PPYVRLTGLGTSTE------  611

Query  362   CSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHFSY  541
              +++ TG+RL+ FA  +G PF F     +      P  L + + EA+ V+    L H  Y
Sbjct  612   -ALEATGKRLSDFANKLGLPFEFIPV-AEKVGNLNPERLNVSKSEAVAVHW---LQHSLY  666

Query  542   RSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGFPM  721
                 S  + L     L P++VT+VE++ +    G F+ RF++ +H+YSAL+DSL A +  
Sbjct  667   DVTGSDTNMLYLLQRLAPKVVTVVEQDLS--HAGSFLGRFVEAVHYYSALFDSLGASYGE  724

Query  722   QDQARTLVERVFLGPKISVAITRSYRCRGEEYGW-SWGEWVPENAGFRPKTISFANRC--  892
             + + R +VE+  L  +I   +      R  +  + +W E + + +GF  K IS A     
Sbjct  725   ESEERHVVEQQLLSREIRNVLAVGGPSRSGDVKFHNWREKL-QQSGF--KCISLAGNAAN  781

Query  893   QAKLLLGLF-NDGYRIEEIGNHKLILGWKSRRLLSASIWTSVH  1018
             QA LLLG+F +DGY + E     L LGWK   LL+AS W   H
Sbjct  782   QANLLLGMFPSDGYTLAE-DKGTLKLGWKDLCLLTASAWRPFH  823



>ref|XP_003631733.1| PREDICTED: scarecrow-like protein 23 [Vitis vinifera]
Length=442

 Score =   171 bits (433),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 126/343 (37%), Positives = 174/343 (51%), Gaps = 29/343 (8%)
 Frame = +2

Query  2     RLAAYFTDALQA-----LLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGH  166
             R+AAYF DALQA      L     L  K+   S++         A Q    +SP +KF H
Sbjct  117   RVAAYFADALQARIISSCLGTYSPLAIKALTLSQNQR----ICNALQSYNSISPLIKFSH  172

Query  167   FTANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggs  346
             FTANQAI +A+  + RVH++D DIM+G+QW  L   L SR   + +  +R+T +      
Sbjct  173   FTANQAIFQALDGEDRVHVIDLDIMQGLQWPGLFHILASRSRKIKS--VRVTGVGSSIEL  230

Query  347   grrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHL  526
                    ++ TGRRL  FA+S+G PF FH           PS L +   EA +V+ M H 
Sbjct  231   -------LEATGRRLADFASSLGLPFEFHALEGKVGNITDPSQLGVRPSEATVVHWMHHC  283

Query  527   PHFSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLE  706
                 Y    S    L     L P+L+T+VE++ +    G F+ RF++ LH+YSAL+D+L 
Sbjct  284   ---LYDITGSDLGTLRLLTLLRPKLITIVEQDLS--HGGSFLGRFVEALHYYSALFDALG  338

Query  707   AGFPMQDQARTLVERVFLGPKIS--VAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISF  880
              G  +    R  VE+  LG +I   VA+    R  GE     WG+ +    GFRP ++  
Sbjct  339   DGLGVDSLERHTVEQQLLGSEIRNIVAVGGPKRT-GEVKVDRWGDEL-SRIGFRPVSLGG  396

Query  881   ANRCQAKLLLGLFN-DGYRIEEIGNHKLILGWKSRRLLSASIW  1006
                 QA LLLG+F   GY + E  N  L LGWK   LL+AS W
Sbjct  397   NPAAQASLLLGMFPWKGYTLVE-ENGSLKLGWKDLSLLTASAW  438



>ref|XP_002264349.1| PREDICTED: protein SCARECROW [Vitis vinifera]
Length=782

 Score =   174 bits (442),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 124/343 (36%), Positives = 183/343 (53%), Gaps = 24/343 (7%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDAL-AAFQLLQDMSPYVKFGHFTAN  178
             R+AAYF++A+ A L  +      + P      PH   L +AFQ+   +SP+VKF HFTAN
Sbjct  449   RVAAYFSEAMSARLVSSCLGIYATLPTV----PHSQKLVSAFQVFNGISPFVKFSHFTAN  504

Query  179   QAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrs  358
             QAI EA   + RVHI+D DIM+G+QW  L   L SR  G   P +R+T L          
Sbjct  505   QAIQEAFEREERVHIIDLDIMQGLQWPGLFHILASRPGG--PPFVRLTGLGTSME-----  557

Query  359   FCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHFS  538
               +++ TG+RLT FA  +G PF F     +      P  L + + EA+ V+    L H  
Sbjct  558   --ALEATGKRLTDFAEKLGLPFEFFPV-AEKVGNLDPERLNVSKREAVAVHW---LQHSL  611

Query  539   YRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGFP  718
             Y    S  + L     L P++VT+VE++ +    G F+ RF++ +H+YSAL+DSL A + 
Sbjct  612   YDVTGSDTNTLWLLQRLAPKVVTVVEQDLS--HAGSFLGRFVEAIHYYSALFDSLGASYG  669

Query  719   MQDQARTLVERVFLGPKISVAITRSYRCRGEEYGW-SWGEWVPENAGFRPKTISFANRCQ  895
              + + R  VE+  L  +I   +      R  +  + +W E + + +GFR  +++     Q
Sbjct  670   EESEQRHAVEQQLLSREIRNVLAVGGPSRSGDVKFNNWREKL-QQSGFRVVSLAGNAATQ  728

Query  896   AKLLLGLF-NDGYRIEEIGNHKLILGWKSRRLLSASIWTSVHS  1021
             A LLLG+F +DGY + E  N  L LGWK   LL+AS W   H+
Sbjct  729   ATLLLGMFPSDGYTLVE-DNGTLKLGWKDLCLLTASAWRPFHA  770



>ref|XP_010529432.1| PREDICTED: LOW QUALITY PROTEIN: protein SCARECROW [Tarenaya hassleriana]
Length=662

 Score =   174 bits (440),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 129/344 (38%), Positives = 187/344 (54%), Gaps = 27/344 (8%)
 Frame = +2

Query  2     RLAAYFTDALQA-LLDGAGSLHAKSFPASKDDHPHG-DALAAFQLLQDMSPYVKFGHFTA  175
             R+AAYF++A+ A L++    ++A + P+      H    ++AFQ+   +SP VKF HFTA
Sbjct  330   RVAAYFSEAMSARLVNSCLGIYA-ALPSRWIPQTHSLKMVSAFQVFNGISPLVKFSHFTA  388

Query  176   NQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrr  355
             NQAI EA   +  VHI+D DIM+G+QW  L   L SR  G   PH+R+T L         
Sbjct  389   NQAIQEAFEREESVHIIDLDIMQGLQWPGLFHILASRPGG--PPHVRLTGLGTSME----  442

Query  356   sFCSVQETGRRLTAFAASIGQPFSFHQCRL-DSDETFKPSALKLVRG--EAIIVNCMLHL  526
                ++Q TG+RL+ FA  +G PF F  C L +      P  L L  G  EAI V+    L
Sbjct  443   ---ALQATGKRLSDFADKLGLPFEF--CPLAEKAGNLDPDRLNLSTGKREAIAVHW---L  494

Query  527   PHFSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLE  706
              H  Y    S    L     L P++VT+VE++ +    G F+ RF++ +H+YSAL+DSL 
Sbjct  495   QHSLYDVTGSDTHTLWLLQRLEPKVVTIVEQDLS--HAGSFLGRFVEAIHYYSALFDSLG  552

Query  707   AGFPMQDQARTLVERVFLGPKIS--VAITRSYRCRGEEYGW-SWGEWVPENAGFRPKTIS  877
             A +  + + R +VE+  L  +I   +A+    R  G E  + SW E + +   F+  ++S
Sbjct  553   ASYGEESEERNVVEQQLLSREIRNVLAVGGPSRNGGGEVRFESWREKLKQCGFFKGISLS  612

Query  878   FANRCQAKLLLGLF-NDGYRIEEIGNHKLILGWKSRRLLSASIW  1006
                  QA LLLG+F +DGY + +  N  L LGWK   LL+AS W
Sbjct  613   GNAATQATLLLGMFPSDGYTLVD-DNGSLKLGWKDLSLLTASAW  655



>ref|XP_006408301.1| hypothetical protein EUTSA_v10020431mg [Eutrema salsugineum]
 gb|ESQ49754.1| hypothetical protein EUTSA_v10020431mg [Eutrema salsugineum]
Length=554

 Score =   173 bits (438),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 116/299 (39%), Positives = 165/299 (55%), Gaps = 17/299 (6%)
 Frame = +2

Query  146   PYVKFGHFTANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITA  325
             PY+KF HFTANQAILEA+T  RRVH++D  + +G+QW +LMQAL  R  G   P  R+T 
Sbjct  262   PYLKFAHFTANQAILEAITTARRVHVIDLGLNQGMQWPALMQALAVRSGG--PPSFRLTG  319

Query  326   LsrgggsgrrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKL-VRGEAI  502
             +            S+Q+ G +L  FA +IG  F F     +S    KP   +     E +
Sbjct  320   IGPPQTENSD---SLQQLGWKLAQFAQAIGVEFEFKGLAAESLSDLKPEMFETRPESETV  376

Query  503   IVNCMLHLPHFSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDG-GFVDRFMDTLHH  679
             +VN +  L H    SP SI   L+    + P +VT+VE+EA    +G  F+DRF + LH+
Sbjct  377   VVNSVFEL-HRLLASPGSIDKLLATVKAVKPSIVTVVEQEAN--HNGIVFLDRFNEALHY  433

Query  680   YSALYDSLEAGFPMQDQARTLVERVFLGPKI--SVAITRSYRCRGEEYGWSWGEWVPENA  853
             YS+L+DSLE  + +  Q R + E V+LG +I   VA   S R    E    W   +  +A
Sbjct  434   YSSLFDSLEDSYSLPSQDRVMSE-VYLGRQILNVVAAEGSDRVERHETLAQWRIRMG-SA  491

Query  854   GFRPKTISFANRCQAKLLLGLF--NDGYRIEEIGNHKLILGWKSRRLLSASIWTSVHSD  1024
             GF P ++  +   QA +LL LF   DGYR+EE  +  L+LGW++R L++ S W    +D
Sbjct  492   GFDPVSLGSSAFKQASMLLSLFAGGDGYRVEE-KDGCLMLGWQTRPLITTSAWKLAGAD  549



>ref|NP_190990.1| protein SCARECROW [Arabidopsis thaliana]
 sp|Q9M384.1|SCR_ARATH RecName: Full=Protein SCARECROW; Short=AtSCR; AltName: Full=GRAS 
family protein 20; Short=AtGRAS-20; AltName: Full=Protein 
SHOOT GRAVITROPISM 1 [Arabidopsis thaliana]
 emb|CAB70996.1| SCARECROW1 [Arabidopsis thaliana]
 gb|AAL07164.1| putative SCARECROW1 protein [Arabidopsis thaliana]
 gb|AAL87315.1| putative SCARECROW1 protein [Arabidopsis thaliana]
 gb|AAM45039.1| putative SCARECROW1 protein [Arabidopsis thaliana]
 gb|AEE79200.1| protein scarecrow [Arabidopsis thaliana]
Length=653

 Score =   174 bits (440),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 126/341 (37%), Positives = 186/341 (55%), Gaps = 24/341 (7%)
 Frame = +2

Query  2     RLAAYFTDALQA-LLDGAGSLHAKSFPASKDDHPHG-DALAAFQLLQDMSPYVKFGHFTA  175
             R+AAYF++A+ A LL+    ++A + P+      H    ++AFQ+   +SP VKF HFTA
Sbjct  329   RVAAYFSEAMSARLLNSCLGIYA-ALPSRWMPQTHSLKMVSAFQVFNGISPLVKFSHFTA  387

Query  176   NQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrr  355
             NQAI EA   +  VHI+D DIM+G+QW  L   L SR  G   PH+R+T L         
Sbjct  388   NQAIQEAFEKEDSVHIIDLDIMQGLQWPGLFHILASRPGG--PPHVRLTGLGTSME----  441

Query  356   sFCSVQETGRRLTAFAASIGQPFSFHQCRL-DSDETFKPSALKLVRGEAIIVNCMLHLPH  532
                ++Q TG+RL+ FA  +G PF F  C L +         L + + EA+ V+    L H
Sbjct  442   ---ALQATGKRLSDFADKLGLPFEF--CPLAEKVGNLDTERLNVRKREAVAVHW---LQH  493

Query  533   FSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAG  712
               Y    S A  L     L P++VT+VE++ +    G F+ RF++ +H+YSAL+DSL A 
Sbjct  494   SLYDVTGSDAHTLWLLQRLAPKVVTVVEQDLS--HAGSFLGRFVEAIHYYSALFDSLGAS  551

Query  713   FPMQDQARTLVERVFLGPKISVAITRSYRCRGEEYGW-SWGEWVPENAGFRPKTISFANR  889
             +  + + R +VE+  L  +I   +      R  E  + SW E + +  GF+  +++    
Sbjct  552   YGEESEERHVVEQQLLSKEIRNVLAVGGPSRSGEVKFESWREKM-QQCGFKGISLAGNAA  610

Query  890   CQAKLLLGLF-NDGYRIEEIGNHKLILGWKSRRLLSASIWT  1009
              QA LLLG+F +DGY + +  N  L LGWK   LL+AS WT
Sbjct  611   TQATLLLGMFPSDGYTLVD-DNGTLKLGWKDLSLLTASAWT  650



>ref|XP_010504218.1| PREDICTED: protein SCARECROW-like [Camelina sativa]
 ref|XP_010504219.1| PREDICTED: protein SCARECROW isoform X1 [Camelina sativa]
Length=663

 Score =   174 bits (440),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 126/341 (37%), Positives = 186/341 (55%), Gaps = 24/341 (7%)
 Frame = +2

Query  2     RLAAYFTDALQA-LLDGAGSLHAKSFPASKDDHPHG-DALAAFQLLQDMSPYVKFGHFTA  175
             R+AAYF++A+ A LL+    ++A + P+      H    ++AFQ+   +SP VKF HFTA
Sbjct  339   RVAAYFSEAMSARLLNSCLGIYA-ALPSRWMPQTHSLKMVSAFQVFNGISPLVKFSHFTA  397

Query  176   NQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrr  355
             NQAI EA   +  VHI+D DIM+G+QW  L   L SR  G   PH+R+T L         
Sbjct  398   NQAIQEAFEKEDSVHIIDLDIMQGLQWPGLFHILASRPGG--PPHVRLTGLGTSME----  451

Query  356   sFCSVQETGRRLTAFAASIGQPFSFHQCRL-DSDETFKPSALKLVRGEAIIVNCMLHLPH  532
                ++Q TG+RL+ FA  +G PF F  C L +         L + + EA+ V+    L H
Sbjct  452   ---ALQATGKRLSDFADKLGLPFEF--CPLAEKVGNLDTERLNVRKREAVAVHW---LQH  503

Query  533   FSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAG  712
               Y    S A  L     L P++VT+VE++ +    G F+ RF++ +H+YSAL+DSL A 
Sbjct  504   SLYDVTGSDAHTLWLLQRLAPKVVTVVEQDLS--HAGSFLGRFVEAIHYYSALFDSLGAS  561

Query  713   FPMQDQARTLVERVFLGPKISVAITRSYRCRGEEYGW-SWGEWVPENAGFRPKTISFANR  889
             +  + + R +VE+  L  +I   +      R  E  + SW E + +  GF+  +++    
Sbjct  562   YGEESEERHVVEQQLLSKEIRNVLAVGGPSRSGEVKFESWREKM-QQCGFKGISLAGNAA  620

Query  890   CQAKLLLGLF-NDGYRIEEIGNHKLILGWKSRRLLSASIWT  1009
              QA LLLG+F +DGY + +  N  L LGWK   LL+AS WT
Sbjct  621   TQATLLLGMFPSDGYTLVD-DNGTLKLGWKDLSLLTASAWT  660



>ref|XP_010427091.1| PREDICTED: protein SCARECROW-like [Camelina sativa]
Length=662

 Score =   174 bits (440),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 126/341 (37%), Positives = 186/341 (55%), Gaps = 24/341 (7%)
 Frame = +2

Query  2     RLAAYFTDALQA-LLDGAGSLHAKSFPASKDDHPHG-DALAAFQLLQDMSPYVKFGHFTA  175
             R+AAYF++A+ A LL+    ++A + P+      H    ++AFQ+   +SP VKF HFTA
Sbjct  338   RVAAYFSEAMSARLLNSCLGIYA-ALPSRWMPQTHSLKMVSAFQVFNGISPLVKFSHFTA  396

Query  176   NQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrr  355
             NQAI EA   +  VHI+D DIM+G+QW  L   L SR  G   PH+R+T L         
Sbjct  397   NQAIQEAFEKEDSVHIIDLDIMQGLQWPGLFHILASRPGG--PPHVRLTGLGTSME----  450

Query  356   sFCSVQETGRRLTAFAASIGQPFSFHQCRL-DSDETFKPSALKLVRGEAIIVNCMLHLPH  532
                ++Q TG+RL+ FA  +G PF F  C L +         L + + EA+ V+    L H
Sbjct  451   ---ALQATGKRLSDFADKLGLPFEF--CPLAEKVGNLDTERLNVRKREAVAVHW---LQH  502

Query  533   FSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAG  712
               Y    S A  L     L P++VT+VE++ +    G F+ RF++ +H+YSAL+DSL A 
Sbjct  503   SLYDVTGSDAHTLWLLQRLAPKVVTVVEQDLS--HAGSFLGRFVEAIHYYSALFDSLGAS  560

Query  713   FPMQDQARTLVERVFLGPKISVAITRSYRCRGEEYGW-SWGEWVPENAGFRPKTISFANR  889
             +  + + R +VE+  L  +I   +      R  E  + SW E + +  GF+  +++    
Sbjct  561   YGEESEERHVVEQQLLSKEIRNVLAVGGPSRSGEVKFESWREKM-QQCGFKGISLAGNAA  619

Query  890   CQAKLLLGLF-NDGYRIEEIGNHKLILGWKSRRLLSASIWT  1009
              QA LLLG+F +DGY + +  N  L LGWK   LL+AS WT
Sbjct  620   TQATLLLGMFPSDGYTLVD-DNGTLKLGWKDLSLLTASAWT  659



>ref|XP_010922842.1| PREDICTED: LOW QUALITY PROTEIN: protein SCARECROW 2-like [Elaeis 
guineensis]
Length=761

 Score =   174 bits (441),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 133/342 (39%), Positives = 193/342 (56%), Gaps = 32/342 (9%)
 Frame = +2

Query  2     RLAAYFTDALQA-LLDGAGSLHAKSFPASKDDHPHGDALA-AFQLLQDMSPYVKFGHFTA  175
             R+AAYF++A+ A ++     L+A   P++    PH   LA AFQ+   +SP+VKF HFTA
Sbjct  431   RVAAYFSEAMSARIVSSCLGLYAP-LPSA----PHRIRLASAFQVFNGISPFVKFSHFTA  485

Query  176   NQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrr  355
             NQAI EA   + RVHI+D DIM+G+QW  L   L SR  G   P +R+T L         
Sbjct  486   NQAIQEAFEREDRVHIIDLDIMQGLQWPGLFHILASRPGG--PPRVRLTGLGSSME----  539

Query  356   sFCSVQETGRRLTAFAASIGQPFSFHQCRL-DSDETFKPSALKLVRGEAIIVNCMLHLPH  532
                +++ TG+RL+ FA ++G PF F  C L +      P  L + R EA+ V+  LH  H
Sbjct  540   ---ALEATGKRLSDFAQTLGLPFEF--CPLAEKVGNLDPDRLGVNRREALAVH-WLH--H  591

Query  533   FSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAG  712
               Y    S  + L     L P++VT+VE++ +  + G F+ RF++ +H+YSAL+DSL A 
Sbjct  592   SLYDVTGSDTNTLWLLQRLAPKVVTIVEQDLS--QAGSFLARFVEAIHYYSALFDSLGAS  649

Query  713   FPMQDQARTLVERVFLGPKIS--VAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISFAN  886
             +    Q R +VE+  L  +I   +A+    R    ++G +W E +   +GFR  +++   
Sbjct  650   YGEDSQERHIVEQQLLSREIRNVLAVGGPARTGDVKFG-NWREKL-SQSGFRGVSLAGNA  707

Query  887   RCQAKLLLGLF-NDGYR-IEEIGNHKLILGWKSRRLLSASIW  1006
               QA LLLG+F +DGY  IEE  N  L LGWK   LL+AS W
Sbjct  708   AAQATLLLGMFPSDGYTLIEE--NGALKLGWKDLCLLTASAW  747



>gb|EPS68254.1| hypothetical protein M569_06515 [Genlisea aurea]
Length=525

 Score =   172 bits (436),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 126/339 (37%), Positives = 183/339 (54%), Gaps = 25/339 (7%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDAL-AAFQLLQDMSPYVKFGHFTAN  178
             R+AAYF++A+ A +  +      S PA     PH   L AAFQ+   +SP+VKF HFTAN
Sbjct  193   RVAAYFSEAMSARIVSSCLGIYASLPAV----PHSHKLSAAFQIFNGISPFVKFSHFTAN  248

Query  179   QAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrs  358
             QAI EA   + RVHI+D DIM+G+QW  L   L +R  G   P +R+T L          
Sbjct  249   QAIQEAFEREERVHIIDLDIMQGLQWPGLFHILATRPGG--PPSVRLTGLGNSQE-----  301

Query  359   FCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKL-VRGEAIIVNCMLHLPHF  535
               +++ TG+RL+ FA  +G PF F     +      P  L +  + EA+ V+    L H 
Sbjct  302   --ALEATGKRLSDFADRLGLPFEFLPLA-EKVGNLDPERLTVATKREAVAVHW---LQHS  355

Query  536   SYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGF  715
              Y    S A+ L     L+P++VT+VE++ +    G F+ RF++ +H+YSAL+DSL A +
Sbjct  356   LYDVTGSDANTLWFLQRLSPKVVTVVEQDLS--HAGSFLGRFVEAIHYYSALFDSLGACY  413

Query  716   PMQDQARTLVERVFLGPKISVAITRSYRCRGEEYGWS-WGEWVPENAGFRPKTISFANRC  892
               + + R +VE+  L  +I   +      R  E  +S W E + +  GFR  +++     
Sbjct  414   GEESEERHVVEQQLLSREIRNVLAVGGPSRSGEVKFSNWREKL-QQCGFRSISLAGNAAA  472

Query  893   QAKLLLGLF-NDGYRIEEIGNHKLILGWKSRRLLSASIW  1006
             QA LLLG+F  DGY + E  N  L LGWK   LL+AS W
Sbjct  473   QATLLLGMFPADGYTLVE-DNGALKLGWKDLCLLTASAW  510



>ref|XP_008451856.1| PREDICTED: scarecrow-like protein 23 isoform X1 [Cucumis melo]
Length=443

 Score =   171 bits (432),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 121/343 (35%), Positives = 172/343 (50%), Gaps = 29/343 (8%)
 Frame = +2

Query  2     RLAAYFTDALQA-----LLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGH  166
             R+ AYF  ALQA      L     L  ++   ++          A Q    +SP +KF H
Sbjct  119   RVGAYFAHALQARVISSCLGTYSPLTIRTLNQTQSQR----IFNALQSYNSISPLIKFSH  174

Query  167   FTANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggs  346
             FTANQAI +A+  + RVH++D D+M+G+QW  L   L SR   + +  LRI+        
Sbjct  175   FTANQAIFQALDGEDRVHVIDLDVMQGLQWPGLFHILASRPKKIQS--LRISGFGSSSDL  232

Query  347   grrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHL  526
                    +Q TGRRL  FA S+G PF FH           P  L+L  GEA++V+ M H 
Sbjct  233   -------LQSTGRRLADFATSLGLPFEFHPVEGKIGNITNPGQLELRSGEAVVVHWMHHC  285

Query  527   PHFSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLE  706
              +    S       LS    L P+L+T+VE++ +    G F+ RF++ LH+YSAL+D+L 
Sbjct  286   LYDVTGSDIGTLRLLS---NLKPKLITIVEQDLS--HGGSFLGRFVEALHYYSALFDALG  340

Query  707   AGFPMQDQARTLVERVFLGPKIS--VAITRSYRCRGEEYGWSWGEWVPENAGFRPKTISF  880
                 M    R +VE+   G +I   +A+    R  GE     WG+ + +  GF+P ++  
Sbjct  341   DSLGMDSVERHVVEQQLFGCEIRNIIAVGGPKRT-GEVKVERWGDEL-KRVGFKPLSLRG  398

Query  881   ANRCQAKLLLGLFN-DGYRIEEIGNHKLILGWKSRRLLSASIW  1006
                 QA LLLG+F   GY + E  N  L LGWK   LL+AS W
Sbjct  399   NPAAQASLLLGMFPWKGYTLVE-ENGCLKLGWKDLSLLTASAW  440



>ref|XP_011015033.1| PREDICTED: protein SCARECROW-like [Populus euphratica]
Length=826

 Score =   174 bits (442),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 118/341 (35%), Positives = 184/341 (54%), Gaps = 20/341 (6%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTANQ  181
             R+AAYF++A+ A L  +      + P+    H    A +AFQ+   + P++KF HFTANQ
Sbjct  472   RVAAYFSEAMSARLVSSCLGIYATLPSLPQSHTQKMA-SAFQVFNGIGPFIKFSHFTANQ  530

Query  182   AILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrsF  361
             AI EA   + RVHI+D D+M+G+QW  L   L SR  G   P++R+T L           
Sbjct  531   AIQEAFEREERVHIIDLDVMQGLQWPGLFHILASRPGG--PPYVRLTGLGTSLE------  582

Query  362   CSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHFSY  541
              +++ TG+RL+ FA  +G PF F     +     +P  L + + EA+ V+    L H  Y
Sbjct  583   -ALEATGKRLSDFADKLGLPFEFIPVA-EKVGNLEPERLNVSKREAVAVHW---LQHSLY  637

Query  542   RSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGFPM  721
                 S  + L     L P++VT+VE++ +    G F+ RF++ +H+YSAL+DSL A +  
Sbjct  638   DVTGSDTNMLCLLQRLAPKVVTVVEQDLS--HAGSFLGRFVEAIHYYSALFDSLGASYGE  695

Query  722   QDQARTLVERVFLGPKISVAITRSYRCRGEEYGW-SWGEWVPENAGFRPKTISFANRCQA  898
             + + R +VE+  L  +I   +      R  +  + +W E + + +GF+  +++     QA
Sbjct  696   ESEERHVVEQQLLSREIRNVLAVGGPSRSGDVKFHNWREKL-QQSGFKGISLAGNAATQA  754

Query  899   KLLLGLF-NDGYRIEEIGNHKLILGWKSRRLLSASIWTSVH  1018
              LLLG+F +DGY + E  N  L LGWK   LL+AS W   H
Sbjct  755   TLLLGMFPSDGYTLVE-DNGTLKLGWKDLCLLTASAWRPFH  794



>ref|XP_006443804.1| hypothetical protein CICLE_v10019735mg [Citrus clementina]
 ref|XP_006479507.1| PREDICTED: protein SCARECROW-like [Citrus sinensis]
 gb|ESR57044.1| hypothetical protein CICLE_v10019735mg [Citrus clementina]
Length=518

 Score =   172 bits (435),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 122/339 (36%), Positives = 173/339 (51%), Gaps = 23/339 (7%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTANQ  181
             R+ AYF  A+ + +    S      P +     H     AFQ+  ++SP++KF HFT+NQ
Sbjct  197   RVVAYFAKAMASRV--LNSWLGICSPLTN----HKSVHCAFQVFNNVSPFIKFAHFTSNQ  250

Query  182   AILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrsF  361
             AILEA     RVHI+D DIM+G+QW +L   L +R +G   PHLR+T +           
Sbjct  251   AILEAFHRRDRVHIIDLDIMQGLQWPALFHILATRNEG--PPHLRMTGMGTSMEV-----  303

Query  362   CSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHFSY  541
               + ETG++L  FA  +G  F FH       +    S L+L RGE + V+    L H  Y
Sbjct  304   --LLETGKQLFNFAKRLGLSFEFHPIAKKFGD-IDASMLQLRRGETLAVHW---LQHSLY  357

Query  542   RSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGFPM  721
              +       L     L+PR+VTLVE+E +    G F+DRF+ +LH+YS L+DSL A FP 
Sbjct  358   DATGPDWKTLRLLEELSPRVVTLVEQEIS--HGGSFLDRFVGSLHYYSTLFDSLGAYFPS  415

Query  722   QDQARTLVERVFLGPKISVAITRSYRCR-GEEYGWSWGEWVPENAGFRPKTISFANRCQA  898
              D  R  VE   L  +I+  +      R GE+    W   +    GF    +S  +  QA
Sbjct  416   DDPNRHRVEHCLLYREINNILAIGGPARSGEDKFKHWRSELARCNGFAQVPMSGNSMAQA  475

Query  899   KLLLGLFNDGYRIEEI-GNHKLILGWKSRRLLSASIWTS  1012
             +L+L +F   +    I G+  L+LGWK   L +AS WTS
Sbjct  476   QLILNMFPPAHGYSLIPGDGTLMLGWKGTSLFTASSWTS  514



>ref|XP_002876247.1| hypothetical protein ARALYDRAFT_485819 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52506.1| hypothetical protein ARALYDRAFT_485819 [Arabidopsis lyrata subsp. 
lyrata]
Length=646

 Score =   173 bits (439),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 126/341 (37%), Positives = 186/341 (55%), Gaps = 24/341 (7%)
 Frame = +2

Query  2     RLAAYFTDALQA-LLDGAGSLHAKSFPASKDDHPHG-DALAAFQLLQDMSPYVKFGHFTA  175
             R+AAYF++A+ A LL+    ++A + P+      H    ++AFQ+   +SP VKF HFTA
Sbjct  322   RVAAYFSEAMSARLLNSCLGIYA-ALPSRWMPQTHSLKMVSAFQVFNGISPLVKFSHFTA  380

Query  176   NQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrr  355
             NQAI EA   +  VHI+D DIM+G+QW  L   L SR  G   PH+R+T L         
Sbjct  381   NQAIQEAFEKEDSVHIIDLDIMQGLQWPGLFHILASRPGG--PPHVRLTGLGTSME----  434

Query  356   sFCSVQETGRRLTAFAASIGQPFSFHQCRL-DSDETFKPSALKLVRGEAIIVNCMLHLPH  532
                ++Q TG+RL+ FA  +G PF F  C L +         L + + EA+ V+    L H
Sbjct  435   ---ALQATGKRLSDFADKLGLPFEF--CPLAEKVGNLDTERLNVRKREAVAVHW---LQH  486

Query  533   FSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAG  712
               Y    S A  L     L P++VT+VE++ +    G F+ RF++ +H+YSAL+DSL A 
Sbjct  487   SLYDVTGSDAHTLWLLQRLAPKVVTVVEQDLS--HAGSFLGRFVEAIHYYSALFDSLGAS  544

Query  713   FPMQDQARTLVERVFLGPKISVAITRSYRCRGEEYGW-SWGEWVPENAGFRPKTISFANR  889
             +  + + R +VE+  L  +I   +      R  E  + SW E + +  GF+  +++    
Sbjct  545   YGEESEERHVVEQQLLSKEIRNVLAVGGPSRSGEVKFESWREKM-QQCGFKGISLAGNAA  603

Query  890   CQAKLLLGLF-NDGYRIEEIGNHKLILGWKSRRLLSASIWT  1009
              QA LLLG+F +DGY + +  N  L LGWK   LL+AS WT
Sbjct  604   TQATLLLGMFPSDGYTLVD-DNGTLKLGWKDLSLLTASAWT  643



>ref|XP_004147738.1| PREDICTED: scarecrow-like protein 23-like [Cucumis sativus]
 ref|XP_004166797.1| PREDICTED: scarecrow-like protein 23-like [Cucumis sativus]
 gb|KGN53498.1| hypothetical protein Csa_4G061850 [Cucumis sativus]
Length=444

 Score =   171 bits (432),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 121/342 (35%), Positives = 171/342 (50%), Gaps = 27/342 (8%)
 Frame = +2

Query  2     RLAAYFTDALQA-----LLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGH  166
             R+ AYF  ALQA      L     L  ++   ++          A Q    +SP +KF H
Sbjct  120   RVGAYFAHALQARVISSCLGTYSPLTIRTLNQTQSQR----IFNALQSYNSISPLIKFSH  175

Query  167   FTANQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggs  346
             FTANQAI +A+  + RVH++D D+M+G+QW  L   L SR   + +  LRI+        
Sbjct  176   FTANQAIFQALDGEDRVHVIDLDVMQGLQWPGLFHILASRPKKIQS--LRISGFGSSSDL  233

Query  347   grrsFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHL  526
                    +Q TGRRL  FA S+G PF FH           P  L+L  GEA++V+ M H 
Sbjct  234   -------LQSTGRRLADFATSLGLPFEFHPVEGKIGNLTNPGQLELRSGEAVVVHWMHHC  286

Query  527   PHFSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLE  706
              +    S       LS   TL P+++T+VE++ +    G F+ RF++ LH+YSAL+D+L 
Sbjct  287   LYDVTGSDIGTLRLLS---TLKPKIITIVEQDLS--HGGSFLGRFVEALHYYSALFDALG  341

Query  707   AGFPMQDQARTLVERVFLGPKISVAITRSYRCR-GEEYGWSWGEWVPENAGFRPKTISFA  883
                 M    R +VE+   G +I   I      R GE     WG+ + +  GF+P ++   
Sbjct  342   DSLGMDSIERHVVEQQLFGCEIRNIIAVGGPKRTGEVKVERWGDEL-KRLGFKPLSLRGN  400

Query  884   NRCQAKLLLGLFN-DGYRIEEIGNHKLILGWKSRRLLSASIW  1006
                QA LLLG+F   GY + E  N  L LGWK   LL+AS W
Sbjct  401   PAAQASLLLGMFPWKGYTLVE-ENGCLKLGWKDLSLLTASAW  441



>gb|KFK34677.1| hypothetical protein AALP_AA5G176900 [Arabis alpina]
Length=631

 Score =   173 bits (438),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 125/341 (37%), Positives = 185/341 (54%), Gaps = 24/341 (7%)
 Frame = +2

Query  2     RLAAYFTDALQA-LLDGAGSLHAKSFPASKDDHPHG-DALAAFQLLQDMSPYVKFGHFTA  175
             R+AAYF++A+ A LL+    ++A + P+      H    ++AFQ+   +SP VKF HFTA
Sbjct  307   RVAAYFSEAMSARLLNSCLGIYA-ALPSRWMPQTHSLKMVSAFQVFNGISPLVKFSHFTA  365

Query  176   NQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrr  355
             NQAI EA   +  VHI+D DIM+G+QW  L   L SR  G   PH+R+T L         
Sbjct  366   NQAIQEAFEKEESVHIIDLDIMQGLQWPGLFHILASRPGG--PPHVRLTGLGTSME----  419

Query  356   sFCSVQETGRRLTAFAASIGQPFSFHQCRL-DSDETFKPSALKLVRGEAIIVNCMLHLPH  532
                ++Q TG+RL+ FA  +G PF F  C L +         L + + EA+ V+    L H
Sbjct  420   ---ALQATGKRLSDFADKLGLPFEF--CPLAEKVGNLDAERLNVRKREAVAVHW---LQH  471

Query  533   FSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAG  712
               Y    S    L     L P++VT+VE++ +    G F+ RF++ +H+YSAL+DSL A 
Sbjct  472   SLYDVTGSDTHTLWLLQRLAPKVVTVVEQDLS--HAGSFLGRFVEAIHYYSALFDSLGAS  529

Query  713   FPMQDQARTLVERVFLGPKISVAITRSYRCRGEEYGW-SWGEWVPENAGFRPKTISFANR  889
             +  + + R +VE+  L  +I   +      R  E  + SW E + +  GF+  +++    
Sbjct  530   YGEESEERHVVEQQLLSKEIRNVLAVGGPSRSGEVKFESWREKM-QQCGFKGISLAGNAA  588

Query  890   CQAKLLLGLF-NDGYRIEEIGNHKLILGWKSRRLLSASIWT  1009
              QA LLLG+F +DGY + +  N  L LGWK   LL+AS WT
Sbjct  589   TQATLLLGMFPSDGYTLVD-DNGTLKLGWKDLSLLTASAWT  628



>gb|EYU42066.1| hypothetical protein MIMGU_mgv1a005350mg [Erythranthe guttata]
Length=487

 Score =   171 bits (434),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 123/342 (36%), Positives = 183/342 (54%), Gaps = 28/342 (8%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALA-AFQLLQDMSPYVKFGHFTAN  178
             R+AAYF++A+ A L  +      + P      PH   +A AFQ+   +SP+VKF HFTAN
Sbjct  154   RVAAYFSEAMSARLVSSCLGIYTALPTV----PHSQKMASAFQVFNGISPFVKFSHFTAN  209

Query  179   QAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrs  358
             QAI EA   + RVHI+D DIM+G+QW  L   L SR  G   P +R+T L          
Sbjct  210   QAIQEAFEREDRVHIIDLDIMQGLQWPGLFHILASRPGG--PPFVRLTGLGNSTD-----  262

Query  359   FCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHFS  538
               +++ TG+RL+ FA  +G PF F     +      P  L + + EA+ V+    L H  
Sbjct  263   --ALEATGKRLSDFAEKLGLPFEFSPV-AERVGNLNPERLNVSKREAVAVHW---LQHSL  316

Query  539   YRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGFP  718
             Y    S  + LS    L P++VT+VE++ +    G F+ RF++ +H+YSA++DSL A + 
Sbjct  317   YDVTGSDTNTLSLLQRLCPKVVTVVEQDLS--HAGSFLGRFVEAIHYYSAMFDSLGACYG  374

Query  719   MQDQARTLVERVFLGPKISVAI-----TRSYRCRGEEYGWSWGEWVPENAGFRPKTISFA  883
              + + R +VE+  L  +I   +     +RS          +W E + E +GF+  +++  
Sbjct  375   EESEERHIVEQQLLSREIRNVLGVGGPSRSSTSISMVKFNNWREKL-EQSGFKGISLAGN  433

Query  884   NRCQAKLLLGLF-NDGYRIEEIGNHKLILGWKSRRLLSASIW  1006
                QA LLLG+F +DGY + E  N  L LGWK   LL+AS W
Sbjct  434   AAAQATLLLGMFPSDGYTLVE-DNGALKLGWKDLCLLTASAW  474



>ref|XP_011012975.1| PREDICTED: protein SCARECROW-like [Populus euphratica]
Length=823

 Score =   174 bits (442),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 119/341 (35%), Positives = 185/341 (54%), Gaps = 20/341 (6%)
 Frame = +2

Query  2     RLAAYFTDALQALLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTANQ  181
             R+AAYF++A+ A L  +      + P+    H    A +AFQ+   + P++KF HFTANQ
Sbjct  472   RVAAYFSEAMSARLVSSCLGIYATLPSLPQSHTQKMA-SAFQVFNGIGPFIKFSHFTANQ  530

Query  182   AILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrsF  361
             AI EA   + RVHI+D D+M+G+QW  L   L SR  G   P++R+T L         S 
Sbjct  531   AIQEAFEREERVHIIDLDVMQGLQWPGLFHILASRPGG--PPYVRLTGL-------GTSL  581

Query  362   CSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHFSY  541
              +++ TG+RL+ FA  +G PF F     +     +P  L + + EA+ V+    L H  Y
Sbjct  582   EALEATGKRLSDFADKLGLPFEFIPVA-EKVGNLEPERLNVSKREAVAVHW---LQHSLY  637

Query  542   RSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGFPM  721
                 S  + L     L P++VT+VE++ +    G F+ RF++ +H+YSAL+DSL A +  
Sbjct  638   DVTGSDTNMLCLLQRLAPKVVTVVEQDLS--HAGSFLGRFVEAIHYYSALFDSLGASYGE  695

Query  722   QDQARTLVERVFLGPKISVAITRSYRCRGEEYGW-SWGEWVPENAGFRPKTISFANRCQA  898
             + + R +VE+  L  +I   +      R  +  + +W E + + +GF+  +++     QA
Sbjct  696   ESEERHVVEQQLLSREIRNVLAVGGPSRSGDVKFHNWREKL-QQSGFKGISLAGNAATQA  754

Query  899   KLLLGLF-NDGYRIEEIGNHKLILGWKSRRLLSASIWTSVH  1018
              LLLG+F +DGY + E  N  L LGWK   LL+AS W   H
Sbjct  755   TLLLGMFPSDGYTLVE-DNGTLKLGWKDLCLLTASAWRPFH  794



>ref|XP_009615228.1| PREDICTED: protein SCARECROW-like [Nicotiana tomentosiformis]
Length=813

 Score =   174 bits (441),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 123/339 (36%), Positives = 187/339 (55%), Gaps = 22/339 (6%)
 Frame = +2

Query  2     RLAAYFTDALQA-LLDGAGSLHAKSFPASKDDHPHGDALA-AFQLLQDMSPYVKFGHFTA  175
             R+AAYF++A+ A LL+    ++A + P S     +   +A AFQ+   +SP++KF HFTA
Sbjct  473   RVAAYFSEAISARLLNSCLGIYA-ALPVSSIPVLYTQKMASAFQVFNGISPFIKFSHFTA  531

Query  176   NQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrr  355
             NQAI EA   + RVHI+D DIM+G+QW  L   L SR  G   P +R+T L         
Sbjct  532   NQAIQEAFEREDRVHIIDLDIMQGLQWPGLFHILASRPGG--PPFVRLTGLGTSMD----  585

Query  356   sFCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHF  535
                +++ TG+RL+ FA  +G PF F     D     +P  L + + EA+ V+    L H 
Sbjct  586   ---ALEATGKRLSDFAERLGLPFEFLPV-ADKVGNLQPEKLNVSKREAVAVHW---LQHS  638

Query  536   SYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGF  715
              Y    S ++ LS    L P++VT+VE++ +    G F+ RF++ +H+YSAL+DSL A +
Sbjct  639   LYDVTGSDSNTLSLLQRLAPKVVTVVEQDLS--HAGSFLGRFVEAIHYYSALFDSLGACY  696

Query  716   PMQDQARTLVERVFLGPKISVAITRSYRCRGEEYGW-SWGEWVPENAGFRPKTISFANRC  892
               + + R +VE+  L  +I   +      R  E  + +W E + + +GFR  +++     
Sbjct  697   GEESEERHVVEQQLLSKEIRNVLAVGGPSRSGEVKFNNWREKL-QQSGFRSISLAGNAAA  755

Query  893   QAKLLLGLF-NDGYRIEEIGNHKLILGWKSRRLLSASIW  1006
             QA LLLG+F + GY + E  N  L LGWK   L +AS W
Sbjct  756   QATLLLGMFPSHGYTLVE-DNGTLKLGWKDLCLFTASAW  793



>ref|XP_002318447.1| LATERAL SUPPRESSOR family protein [Populus trichocarpa]
 gb|EEE96667.1| LATERAL SUPPRESSOR family protein [Populus trichocarpa]
Length=435

 Score =   170 bits (431),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 114/305 (37%), Positives = 165/305 (54%), Gaps = 22/305 (7%)
 Frame = +2

Query  131   LQDMSPYVKFGHFTANQAILEAVTHDRR-VHIVDYDIMEGIQWASLMQALISRQDGL--P  301
             L  ++P+++F H TANQAILEA+   ++ +HI+D+DIM G+QW  LMQAL  R +    P
Sbjct  141   LNKITPFIRFCHLTANQAILEAIQVGQQAIHIIDFDIMHGVQWPPLMQALAERSNNTLHP  200

Query  302   APHLRITALsrgggsgrrsFCSVQETGRRLTAFAASIGQPFSFHQCRL-DSDET----FK  466
              P LRIT               +  TG RL  FA S+G  F FH   L ++D T    + 
Sbjct  201   PPMLRITG-------TGHDLNVLHRTGDRLLKFAQSLGLRFHFHPLLLLNNDPTSLAHYL  253

Query  467   PSALKLVRGEAIIVNCMLHLPHFSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGG  646
             PSA+ L+  EA+ VNC+ +L  F       +  FL     LNP++VT+ E EA       
Sbjct  254   PSAITLLPDEALAVNCVSYLHRFLKDDSRELLLFLHKIKALNPKVVTVAEREANH-NHPL  312

Query  647   FVDRFMDTLHHYSALYDSLEAGFPMQDQARTLVERVFLGPKISVAITRSYRCRGEEYG--  820
             F+ RF++ L HY+AL+DSLEA  P   + R  VE+++ G +I   +      R E +   
Sbjct  313   FLQRFLEALDHYTALFDSLEATLPPNSRERLAVEQIWFGREIMDIVAAEGEGRRERHQRF  372

Query  821   WSWGEWVPENAGFRPKTISFANRCQAKLLLGLF--NDGYRIEEIGNHKLILGWKSRRLLS  994
              +W E + ++ GF    +S     QAKLLL L   +DGY++ +I N+   LGW++  L S
Sbjct  373   ETW-EMMLKSVGFIKVPLSPFALSQAKLLLRLHYPSDGYQL-QILNNSFFLGWRNHSLFS  430

Query  995   ASIWT  1009
              S W 
Sbjct  431   VSSWN  435



>ref|XP_010278894.1| PREDICTED: protein SCARECROW [Nelumbo nucifera]
Length=784

 Score =   174 bits (440),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 122/344 (35%), Positives = 187/344 (54%), Gaps = 25/344 (7%)
 Frame = +2

Query  2     RLAAYFTDALQA-LLDGAGSLHAKSFPASKDDHPHGDALAAFQLLQDMSPYVKFGHFTAN  178
             R+AAYF++A+ A L+     ++A   P       +   ++AFQ+   +SP+VKF HFTAN
Sbjct  459   RVAAYFSEAMSARLVSSCLGIYA---PLPNAPAHNQKIVSAFQVFNGISPFVKFSHFTAN  515

Query  179   QAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrrs  358
             QAI EA   + RVHI+D DIM+G+QW  L   L SR  G   P +R+T L          
Sbjct  516   QAIQEAFEREERVHIIDLDIMQGLQWPGLFHILASRPGG--PPFVRLTGLGTSME-----  568

Query  359   FCSVQETGRRLTAFAASIGQPFSFHQCRLDSDETFKPSALKLVRGEAIIVNCMLHLPHFS  538
               +++ TG+RL+ FA ++G PF F     D      P  L + + EA+ V+ + H  +  
Sbjct  569   --ALEATGKRLSDFAETLGLPFEFFPV-ADKVGNLDPERLNVSKREAVAVHWLHHSLYDV  625

Query  539   YRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAGFP  718
               S ++    L     L P++VT+VE++ +    G F+ RF++ +H+YSAL+DSL A + 
Sbjct  626   TGSDNNTLWLLQ---RLAPKVVTIVEQDLS--HAGSFLGRFVEAIHYYSALFDSLGASYG  680

Query  719   MQDQARTLVERVFLGPKISVAITRSYRCRGEEYGW-SWGEWVPENAGFRPKTISFANRCQ  895
              + + R +VE+  L  +I   +      R  E  + +W E + + +GFR  +++     Q
Sbjct  681   EESEERHIVEQQLLSREIRNVLAVGGPARSGEVKFHNWREKL-KQSGFRGISLAGNAATQ  739

Query  896   AKLLLGLFN-DGYRIEEIGNHKLILGWKSRRLLSASIW--TSVH  1018
             A LLLG+F  DGY + E  N  L LGWK   LL+AS W  T+ H
Sbjct  740   ATLLLGMFPCDGYTLVE-DNGTLKLGWKDLSLLTASAWRPTNTH  782



>ref|XP_006290705.1| hypothetical protein CARUB_v10016802mg [Capsella rubella]
 gb|EOA23603.1| hypothetical protein CARUB_v10016802mg [Capsella rubella]
Length=657

 Score =   173 bits (438),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 126/341 (37%), Positives = 186/341 (55%), Gaps = 24/341 (7%)
 Frame = +2

Query  2     RLAAYFTDALQA-LLDGAGSLHAKSFPASKDDHPHG-DALAAFQLLQDMSPYVKFGHFTA  175
             R+AAYF++A+ A LL+    ++A + P+      H    ++AFQ+   +SP VKF HFTA
Sbjct  333   RVAAYFSEAMSARLLNSCLGIYA-ALPSRWMPQTHSLKMVSAFQVFNGISPLVKFSHFTA  391

Query  176   NQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrr  355
             NQAI EA   +  VHI+D DIM+G+QW  L   L SR  G   PH+R+T L         
Sbjct  392   NQAIQEAFEKEDSVHIIDLDIMQGLQWPGLFHILASRPGG--PPHVRLTGLGTSME----  445

Query  356   sFCSVQETGRRLTAFAASIGQPFSFHQCRL-DSDETFKPSALKLVRGEAIIVNCMLHLPH  532
                ++Q TG+RL+ FA  +G PF F  C L +         L + + EA+ V+    L H
Sbjct  446   ---ALQATGKRLSDFADKLGLPFEF--CPLAEKVGNLDTERLNVRKREAVAVHW---LQH  497

Query  533   FSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAG  712
               Y    S A  L     L P++VT+VE++ +    G F+ RF++ +H+YSAL+DSL A 
Sbjct  498   SLYDVTGSDAHTLWLLQRLAPKVVTVVEQDLS--HAGSFLGRFVEAIHYYSALFDSLGAS  555

Query  713   FPMQDQARTLVERVFLGPKISVAITRSYRCRGEEYGW-SWGEWVPENAGFRPKTISFANR  889
             +  + + R +VE+  L  +I   +      R  E  + SW E + +  GF+  +++    
Sbjct  556   YGEESEERHVVEQQLLSKEIRNVLAVGGPSRSGEVKFESWREKM-QQCGFKGISLAGNAA  614

Query  890   CQAKLLLGLF-NDGYRIEEIGNHKLILGWKSRRLLSASIWT  1009
              QA LLLG+F +DGY + +  N  L LGWK   LL+AS WT
Sbjct  615   TQATLLLGMFPSDGYTLVD-DNGTLKLGWKDLSLLTASAWT  654



>ref|XP_006403603.1| hypothetical protein EUTSA_v10010179mg [Eutrema salsugineum]
 gb|ESQ45056.1| hypothetical protein EUTSA_v10010179mg [Eutrema salsugineum]
Length=656

 Score =   173 bits (438),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 125/341 (37%), Positives = 185/341 (54%), Gaps = 24/341 (7%)
 Frame = +2

Query  2     RLAAYFTDALQA-LLDGAGSLHAKSFPASKDDHPHG-DALAAFQLLQDMSPYVKFGHFTA  175
             R+AAYF++A+ A LL+    ++A + P+      H    ++AFQ+   +SP VKF HFTA
Sbjct  332   RVAAYFSEAMSARLLNSCLGIYA-ALPSRWMPQTHSLKMVSAFQVFNGISPLVKFSHFTA  390

Query  176   NQAILEAVTHDRRVHIVDYDIMEGIQWASLMQALISRQDGLPAPHLRITALsrgggsgrr  355
             NQAI EA   +  VHI+D DIM+G+QW  L   L SR  G   PH+R+T L         
Sbjct  391   NQAIQEAFEKEESVHIIDLDIMQGLQWPGLFHILASRPGG--PPHVRLTGLGTSME----  444

Query  356   sFCSVQETGRRLTAFAASIGQPFSFHQCRL-DSDETFKPSALKLVRGEAIIVNCMLHLPH  532
                ++Q TG+RL+ FA  +G PF F  C L +         L + + EA+ V+    L H
Sbjct  445   ---ALQATGKRLSDFADKLGLPFEF--CPLAEKVGNLDAERLNVRKREAVAVHW---LQH  496

Query  533   FSYRSPDSIASFLSGSATLNPRLVTLVEEEAAPPRDGGFVDRFMDTLHHYSALYDSLEAG  712
               Y    S    L     L P++VT+VE++ +    G F+ RF++ +H+YSAL+DSL A 
Sbjct  497   SLYDVTGSDTHTLWLLQRLAPKVVTVVEQDLS--HAGSFLGRFVEAIHYYSALFDSLGAS  554

Query  713   FPMQDQARTLVERVFLGPKISVAITRSYRCRGEEYGW-SWGEWVPENAGFRPKTISFANR  889
             +  + + R +VE+  L  +I   +      R  E  + SW E + +  GF+  +++    
Sbjct  555   YGEESEERHVVEQQLLSKEIRNVLAVGGPSRSGEVKFESWREKM-QQCGFKGISLAGNAA  613

Query  890   CQAKLLLGLF-NDGYRIEEIGNHKLILGWKSRRLLSASIWT  1009
              QA LLLG+F +DGY + +  N  L LGWK   LL+AS WT
Sbjct  614   TQATLLLGMFPSDGYTLVD-DNGTLKLGWKDLSLLTASAWT  653



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2521031146656