BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c104339_g1_i1 len=614 path=[592:0-613]

Length=614
                                                                      Score     E

ref|XP_004972302.1|  PREDICTED: uncharacterized protein LOC101778040    161   3e-43   
ref|XP_010539104.1|  PREDICTED: uncharacterized protein LOC104813235    151   4e-40   
ref|XP_010531095.1|  PREDICTED: retrovirus-related Pol polyprotei...    151   1e-39   
emb|CAN83506.1|  hypothetical protein VITISV_027576                     155   2e-39   Vitis vinifera
ref|XP_008680471.1|  PREDICTED: uncharacterized protein LOC103655505    147   5e-39   
ref|XP_008365969.1|  PREDICTED: uncharacterized protein LOC103429605    154   6e-39   
ref|XP_010531643.1|  PREDICTED: uncharacterized protein LOC104807900    153   8e-39   
gb|AAB82754.1|  retrofit                                                152   2e-38   Oryza longistaminata [long-staminate rice]
dbj|BAB90546.1|  putative rice retrotransposon retrofit gag/pol p...    151   6e-38   Oryza sativa Japonica Group [Japonica rice]
gb|ABA98049.1|  retrotransposon protein, putative, Ty1-copia subc...    151   6e-38   Oryza sativa Japonica Group [Japonica rice]
emb|CAH67225.1|  OSIGBa0145M07.7                                        150   7e-38   Oryza sativa [red rice]
gb|AAX96193.1|  retrotransposon protein, putative, Ty1-copia sub-...    151   7e-38   Oryza sativa Japonica Group [Japonica rice]
gb|ACV42639.1|  gag/pol                                                 150   8e-38   
gb|AFP55537.1|  retrotransposon polyprotein                             150   9e-38   
gb|ABA98286.2|  retrotransposon protein, putative, Ty1-copia subc...    150   1e-37   Oryza sativa Japonica Group [Japonica rice]
emb|CAN83392.1|  hypothetical protein VITISV_041406                     150   1e-37   Vitis vinifera
emb|CAN83798.1|  hypothetical protein VITISV_039072                     149   1e-37   Vitis vinifera
gb|AAX95627.1|  Reverse transcriptase (RNA-dependent DNA polymera...    144   1e-37   Oryza sativa Japonica Group [Japonica rice]
gb|AAU90288.2|  Polyprotein, putative                                   149   3e-37   Solanum demissum
gb|AAV44026.1|  hypothetical protein                                    147   3e-37   Oryza sativa Japonica Group [Japonica rice]
emb|CAN71108.1|  hypothetical protein VITISV_001478                     149   3e-37   Vitis vinifera
ref|XP_010240794.1|  PREDICTED: uncharacterized protein LOC104585563    142   3e-37   
gb|AAK02020.2|AC074283_1  Putative gag-pol polyprotein                  147   6e-37   Oryza sativa [red rice]
ref|XP_010273170.1|  PREDICTED: uncharacterized protein LOC104608783    145   6e-37   
emb|CAN78448.1|  hypothetical protein VITISV_026811                     144   7e-37   Vitis vinifera
ref|XP_004972082.1|  PREDICTED: uncharacterized protein LOC101752886    145   8e-37   
emb|CAN78451.1|  hypothetical protein VITISV_005945                     145   1e-36   Vitis vinifera
ref|XP_009359358.1|  PREDICTED: uncharacterized protein LOC103949948    147   1e-36   
ref|XP_008222569.1|  PREDICTED: uncharacterized protein LOC103322432    143   1e-36   
gb|AAW56918.1|  putative polyprotein                                    146   2e-36   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008240661.1|  PREDICTED: uncharacterized protein LOC103339149    146   2e-36   
emb|CAN66999.1|  hypothetical protein VITISV_019171                     146   2e-36   Vitis vinifera
emb|CAN79148.1|  hypothetical protein VITISV_004343                     146   3e-36   Vitis vinifera
ref|XP_008385226.1|  PREDICTED: uncharacterized protein LOC103447800    145   3e-36   
ref|NP_001175678.1|  Os08g0544300                                       145   3e-36   
emb|CAN82610.1|  hypothetical protein VITISV_021745                     144   3e-36   Vitis vinifera
emb|CAN73924.1|  hypothetical protein VITISV_041509                     146   3e-36   Vitis vinifera
gb|AAN06870.1|  Putative gag-pol polyprotein                            145   4e-36   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002442174.1|  hypothetical protein SORBIDRAFT_08g015513          144   5e-36   Sorghum bicolor [broomcorn]
ref|XP_008341155.1|  PREDICTED: uncharacterized protein LOC103404078    145   5e-36   
gb|ABA97008.1|  retrotransposon protein, putative, Ty1-copia subc...    145   6e-36   Oryza sativa Japonica Group [Japonica rice]
gb|ABF95616.1|  retrotransposon protein, putative, Ty1-copia subc...    145   7e-36   Oryza sativa Japonica Group [Japonica rice]
emb|CAN71250.1|  hypothetical protein VITISV_027849                     140   1e-35   Vitis vinifera
gb|AAR88589.1|  putative copia-like retrotransposon protein             144   1e-35   Oryza sativa Japonica Group [Japonica rice]
gb|AAT07563.1|  putative polyprotein                                    144   1e-35   Oryza sativa Japonica Group [Japonica rice]
emb|CAE04381.1|  OSJNBa0027G07.23                                       140   1e-35   Oryza sativa Japonica Group [Japonica rice]
gb|KFK29449.1|  hypothetical protein AALP_AA7G135900                    141   1e-35   
gb|ACY72569.1|  unknown                                                 144   2e-35   Oryza sativa Japonica Group [Japonica rice]
emb|CAH66819.1|  OSIGBa0093K19.6                                        140   2e-35   Oryza sativa [red rice]
emb|CAN67403.1|  hypothetical protein VITISV_025614                     144   2e-35   Vitis vinifera
gb|AAU43956.1|  unknown protein                                         144   2e-35   Oryza sativa Japonica Group [Japonica rice]
emb|CAN70817.1|  hypothetical protein VITISV_029336                     143   2e-35   Vitis vinifera
gb|AAK53852.1|AC016781_6  Putative retroelement                         142   3e-35   Oryza sativa Japonica Group [Japonica rice]
gb|AAK55460.1|AC069300_15  putative gag-pol polyprotein                 142   4e-35   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008351324.1|  PREDICTED: uncharacterized protein LOC103414737    142   5e-35   
gb|ABA95721.1|  retrotransposon protein, putative, Ty1-copia subc...    142   5e-35   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008364575.1|  PREDICTED: uncharacterized protein LOC103428257    137   8e-35   
emb|CAN66863.1|  hypothetical protein VITISV_013500                     141   8e-35   Vitis vinifera
ref|XP_008361413.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    140   9e-35   
gb|ABA94335.1|  retrotransposon protein, putative, Ty1-copia subc...    137   9e-35   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008369089.1|  PREDICTED: uncharacterized protein LOC103432662    142   9e-35   
emb|CAN59963.1|  hypothetical protein VITISV_022756                     138   1e-34   Vitis vinifera
gb|ABA99232.1|  retrotransposon protein, putative, Ty1-copia subc...    135   1e-34   Oryza sativa Japonica Group [Japonica rice]
gb|AAL31076.1|AC091749_5  putaive copia-like retrotransposon poly...    137   1e-34   Oryza sativa [red rice]
emb|CAN64509.1|  hypothetical protein VITISV_041217                     141   1e-34   Vitis vinifera
emb|CAN63649.1|  hypothetical protein VITISV_037657                     141   1e-34   Vitis vinifera
emb|CAN71553.1|  hypothetical protein VITISV_034738                     141   1e-34   Vitis vinifera
ref|XP_006663342.1|  PREDICTED: uncharacterized protein LOC102709321    137   2e-34   
gb|KHN21230.1|  Retrovirus-related Pol polyprotein from transposo...    141   2e-34   
emb|CAN68480.1|  hypothetical protein VITISV_007280                     138   2e-34   Vitis vinifera
gb|AAP94600.1|  putative copia-like retrotransposon Hopscotch pol...    140   2e-34   Zea mays [maize]
gb|ABG00000.1|  retrotransposon protein, putative, Ty1-copia subc...    141   2e-34   Oryza sativa Japonica Group [Japonica rice]
gb|ABF96081.1|  retrotransposon protein, putative, Ty1-copia subc...    140   3e-34   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008342970.1|  PREDICTED: uncharacterized protein LOC103405720    139   3e-34   
emb|CCH50966.1|  T4.5                                                   140   3e-34   
emb|CAN76947.1|  hypothetical protein VITISV_017166                     137   4e-34   Vitis vinifera
ref|XP_008357860.1|  PREDICTED: uncharacterized protein LOC103421593    139   4e-34   
emb|CAN79733.1|  hypothetical protein VITISV_016615                     139   4e-34   Vitis vinifera
gb|AAL66754.1|AF464738_5  putative copia-like retrotransposon Hop...    140   4e-34   Zea mays [maize]
ref|XP_006579236.1|  PREDICTED: uncharacterized protein LOC102665202    139   5e-34   
gb|AAP53968.1|  retrotransposon protein, putative, Ty1-copia subc...    139   5e-34   Oryza sativa Japonica Group [Japonica rice]
emb|CAN82221.1|  hypothetical protein VITISV_015226                     139   6e-34   Vitis vinifera
emb|CAN67819.1|  hypothetical protein VITISV_041315                     139   7e-34   Vitis vinifera
emb|CAN77529.1|  hypothetical protein VITISV_041425                     138   9e-34   Vitis vinifera
gb|AAN04167.1|  Putative copia-like retrotransposon polyprotein         138   1e-33   Oryza sativa Japonica Group [Japonica rice]
emb|CAN68496.1|  hypothetical protein VITISV_010947                     139   1e-33   Vitis vinifera
ref|XP_008387250.1|  PREDICTED: uncharacterized protein LOC103449699    138   1e-33   
gb|AAT85031.1|  putative polyprotein                                    138   2e-33   Oryza sativa Japonica Group [Japonica rice]
ref|YP_514636.1|  hypothetical protein OrsaiPp07                        134   2e-33   Oryza sativa Indica Group [Indian rice]
ref|YP_002000554.1|  orf490                                             134   2e-33   Oryza sativa Japonica Group [Japonica rice]
emb|CAN61640.1|  hypothetical protein VITISV_021909                     138   2e-33   Vitis vinifera
ref|XP_008347066.1|  PREDICTED: uncharacterized protein LOC103410073    137   2e-33   
ref|XP_010655188.1|  PREDICTED: uncharacterized protein LOC104880403    137   2e-33   
ref|XP_006596648.1|  PREDICTED: uncharacterized protein DDB_G0271...    134   2e-33   
ref|XP_004295979.1|  PREDICTED: uncharacterized mitochondrial pro...    132   2e-33   
gb|KFL89552.1|  hypothetical protein AmDm5_1575                         137   3e-33   
ref|XP_010525654.1|  PREDICTED: uncharacterized protein LOC104803422    134   3e-33   
gb|EMT19664.1|  Putative LRR receptor-like serine/threonine-prote...    136   4e-33   
emb|CAN67963.1|  hypothetical protein VITISV_027812                     132   5e-33   Vitis vinifera
gb|KHN17953.1|  Retrovirus-related Pol polyprotein from transposo...    137   5e-33   
ref|XP_008375643.1|  PREDICTED: uncharacterized protein LOC103438878    134   5e-33   
emb|CAN65591.1|  hypothetical protein VITISV_042091                     136   6e-33   Vitis vinifera
emb|CAN75478.1|  hypothetical protein VITISV_020209                     136   6e-33   Vitis vinifera
ref|XP_010661279.1|  PREDICTED: uncharacterized protein LOC104881770    135   7e-33   
gb|AAT69582.1|  putative polyprotein                                    136   7e-33   Oryza sativa Japonica Group [Japonica rice]
emb|CAE04319.3|  OSJNBb0016D16.10                                       135   8e-33   Oryza sativa [red rice]
ref|XP_009378158.1|  PREDICTED: uncharacterized protein LOC103966690    136   8e-33   
gb|AAT38797.2|  Polyprotein, putative                                   136   9e-33   Solanum demissum
ref|XP_008657522.1|  PREDICTED: F-box protein At1g70590-like            130   1e-32   
ref|XP_008352218.1|  PREDICTED: uncharacterized protein LOC103415694    134   1e-32   
ref|XP_008340360.1|  PREDICTED: uncharacterized protein LOC103403325    135   1e-32   
ref|XP_008228040.1|  PREDICTED: uncharacterized protein LOC103327479    135   1e-32   
ref|XP_008356535.1|  PREDICTED: uncharacterized protein LOC103420252    135   1e-32   
emb|CAN76078.1|  hypothetical protein VITISV_008973                     135   1e-32   Vitis vinifera
gb|ABA98728.2|  retrotransposon protein, putative, Ty1-copia subc...    135   1e-32   Oryza sativa Japonica Group [Japonica rice]
emb|CAN74695.1|  hypothetical protein VITISV_024648                     135   2e-32   Vitis vinifera
ref|XP_010650252.1|  PREDICTED: uncharacterized protein LOC104879339    132   3e-32   
emb|CAN63482.1|  hypothetical protein VITISV_011510                     134   3e-32   Vitis vinifera
ref|XP_010236748.1|  PREDICTED: uncharacterized protein LOC104584242    134   3e-32   
ref|XP_008390439.1|  PREDICTED: uncharacterized protein LOC103452682    134   3e-32   
ref|XP_009623362.1|  PREDICTED: uncharacterized protein LOC104114592    128   3e-32   
gb|AAU10819.1|  putative polyprotein                                    134   3e-32   Oryza sativa Japonica Group [Japonica rice]
emb|CAN74381.1|  hypothetical protein VITISV_007944                     134   3e-32   Vitis vinifera
ref|XP_008389560.1|  PREDICTED: uncharacterized protein LOC103451895    134   3e-32   
emb|CAN61827.1|  hypothetical protein VITISV_027629                     132   4e-32   Vitis vinifera
ref|XP_010038745.1|  PREDICTED: uncharacterized protein LOC104427339    133   4e-32   
ref|XP_008360633.1|  PREDICTED: uncharacterized protein LOC103424318    133   4e-32   
emb|CAH67061.1|  H0112G12.6                                             133   5e-32   Oryza sativa [red rice]
emb|CAN59952.1|  hypothetical protein VITISV_006720                     134   5e-32   Vitis vinifera
emb|CAN79182.1|  hypothetical protein VITISV_024133                     130   6e-32   Vitis vinifera
emb|CAN74561.1|  hypothetical protein VITISV_017064                     132   7e-32   Vitis vinifera
emb|CAN61420.1|  hypothetical protein VITISV_023544                     133   9e-32   Vitis vinifera
ref|XP_008378632.1|  PREDICTED: uncharacterized protein LOC103441708    133   9e-32   
ref|XP_010659203.1|  PREDICTED: uncharacterized protein LOC104881291    129   9e-32   
ref|XP_007019438.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...    130   1e-31   
emb|CAN73795.1|  hypothetical protein VITISV_036649                     132   1e-31   Vitis vinifera
ref|XP_008361163.1|  PREDICTED: uncharacterized protein LOC103424851    132   1e-31   
ref|XP_008379771.1|  PREDICTED: uncharacterized protein LOC103442736    132   1e-31   
emb|CAN82769.1|  hypothetical protein VITISV_037882                     132   2e-31   Vitis vinifera
ref|XP_010541762.1|  PREDICTED: retrovirus-related Pol polyprotei...    131   2e-31   
ref|XP_004974413.1|  PREDICTED: uncharacterized mitochondrial pro...    123   2e-31   
ref|XP_010227141.1|  PREDICTED: uncharacterized protein LOC104581367    132   2e-31   
ref|XP_008665822.1|  PREDICTED: uncharacterized protein LOC103644390    131   2e-31   
ref|XP_008229480.1|  PREDICTED: uncharacterized protein LOC103328856    132   2e-31   
ref|XP_009604767.1|  PREDICTED: uncharacterized protein LOC104099466    129   2e-31   
ref|XP_010526684.1|  PREDICTED: retrovirus-related Pol polyprotei...    130   2e-31   
ref|XP_011081378.1|  PREDICTED: uncharacterized protein LOC105164425    130   3e-31   
ref|XP_008350549.1|  PREDICTED: uncharacterized protein LOC103413885    132   3e-31   
ref|XP_008349120.1|  PREDICTED: uncharacterized protein LOC103412315    132   3e-31   
gb|EMT21953.1|  ABC transporter C family member 10                      132   3e-31   
ref|XP_010069795.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    131   3e-31   
emb|CAN64288.1|  hypothetical protein VITISV_022326                     131   3e-31   Vitis vinifera
ref|XP_010526683.1|  PREDICTED: retrovirus-related Pol polyprotei...    130   3e-31   
emb|CAN62863.1|  hypothetical protein VITISV_030334                     131   4e-31   Vitis vinifera
gb|ABA99152.1|  retrotransposon protein, putative, unclassified         130   4e-31   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010526682.1|  PREDICTED: retrovirus-related Pol polyprotei...    130   4e-31   
ref|XP_008350712.1|  PREDICTED: uncharacterized protein LOC103414077    124   4e-31   
emb|CAN81355.1|  hypothetical protein VITISV_039158                     131   4e-31   Vitis vinifera
emb|CAN68489.1|  hypothetical protein VITISV_037543                     131   4e-31   Vitis vinifera
ref|XP_007024404.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...    125   5e-31   
emb|CAN76151.1|  hypothetical protein VITISV_012673                     130   5e-31   Vitis vinifera
ref|XP_010526681.1|  PREDICTED: retrovirus-related Pol polyprotei...    130   5e-31   
gb|EPS73343.1|  hypothetical protein M569_01413                         130   5e-31   
ref|XP_010526678.1|  PREDICTED: retrovirus-related Pol polyprotei...    130   6e-31   
ref|XP_010659200.1|  PREDICTED: uncharacterized protein LOC104881290    127   6e-31   
emb|CAN65942.1|  hypothetical protein VITISV_001716                     130   6e-31   Vitis vinifera
ref|XP_010526680.1|  PREDICTED: retrovirus-related Pol polyprotei...    130   6e-31   
emb|CAN59941.1|  hypothetical protein VITISV_017227                     127   6e-31   Vitis vinifera
emb|CAN64882.1|  hypothetical protein VITISV_027289                     125   8e-31   Vitis vinifera
emb|CAN61322.1|  hypothetical protein VITISV_012106                     130   9e-31   Vitis vinifera
emb|CAN80930.1|  hypothetical protein VITISV_005279                     130   1e-30   Vitis vinifera
emb|CAN73071.1|  hypothetical protein VITISV_032383                     130   1e-30   Vitis vinifera
ref|XP_008352732.1|  PREDICTED: uncharacterized protein LOC103416253    129   1e-30   
ref|XP_008364216.1|  PREDICTED: uncharacterized protein LOC103427909    129   1e-30   
emb|CAN72201.1|  hypothetical protein VITISV_014985                     125   1e-30   Vitis vinifera
emb|CAN81099.1|  hypothetical protein VITISV_017741                     129   2e-30   Vitis vinifera
emb|CAN77122.1|  hypothetical protein VITISV_013624                     129   2e-30   Vitis vinifera
emb|CAN78022.1|  hypothetical protein VITISV_015518                     129   2e-30   Vitis vinifera
emb|CAN68235.1|  hypothetical protein VITISV_037104                     129   2e-30   Vitis vinifera
emb|CAN74767.1|  hypothetical protein VITISV_041860                     129   2e-30   Vitis vinifera
ref|XP_004958843.1|  PREDICTED: uncharacterized protein LOC101772504    126   2e-30   
ref|XP_009342325.1|  PREDICTED: uncharacterized protein LOC103934297    122   2e-30   
ref|XP_008365257.1|  PREDICTED: uncharacterized protein LOC103428904    128   2e-30   
ref|XP_004963727.1|  PREDICTED: uncharacterized protein LOC101777694    129   2e-30   
ref|XP_010473832.1|  PREDICTED: uncharacterized protein LOC104753254    125   2e-30   
ref|XP_008376990.1|  PREDICTED: uncharacterized protein LOC103440084    129   2e-30   
ref|XP_004980642.1|  PREDICTED: uncharacterized protein LOC101772525    125   2e-30   
emb|CAN75149.1|  hypothetical protein VITISV_027193                     126   3e-30   Vitis vinifera
ref|XP_008392161.1|  PREDICTED: uncharacterized protein LOC103454341    125   3e-30   
gb|AAK62788.1|AC027036_9  polyprotein, putative                         129   3e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010058987.1|  PREDICTED: uncharacterized protein LOC104446890    129   3e-30   
ref|XP_009614297.1|  PREDICTED: uncharacterized protein LOC104107258    123   3e-30   
ref|XP_004966833.1|  PREDICTED: uncharacterized protein LOC101766505    128   3e-30   
emb|CAN83877.1|  hypothetical protein VITISV_014760                     127   3e-30   Vitis vinifera
ref|XP_008393396.1|  PREDICTED: uncharacterized protein LOC103455594    125   4e-30   
emb|CAN77085.1|  hypothetical protein VITISV_044282                     128   4e-30   Vitis vinifera
emb|CAN71823.1|  hypothetical protein VITISV_007329                     126   6e-30   Vitis vinifera
ref|XP_009587426.1|  PREDICTED: uncharacterized protein LOC104085156    125   6e-30   
emb|CAN67546.1|  hypothetical protein VITISV_027734                     127   7e-30   Vitis vinifera
dbj|BAA78423.1|  polyprotein                                            127   7e-30   Arabidopsis thaliana [mouse-ear cress]
gb|AAK62793.1|AC027036_14  polyprotein, putative                        127   8e-30   Arabidopsis thaliana [mouse-ear cress]
dbj|BAA78425.1|  polyprotein                                            127   8e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008340383.1|  PREDICTED: uncharacterized protein LOC103403351    127   8e-30   
dbj|BAK41507.1|  polyprotein                                            127   8e-30   
ref|XP_010051209.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    127   9e-30   
emb|CAN75319.1|  hypothetical protein VITISV_034031                     126   9e-30   Vitis vinifera
dbj|BAM42649.1|  Polyprotein                                            127   1e-29   
dbj|BAM42646.1|  polyprotein                                            127   1e-29   
gb|AAC79110.1|  putative polyprotein of LTR transposon                  127   1e-29   Arabidopsis thaliana [mouse-ear cress]
dbj|BAK41511.1|  polyprotein                                            127   1e-29   
dbj|BAM42650.1|  Polyprotein                                            127   1e-29   
dbj|BAM42647.1|  polyprotein                                            127   1e-29   
dbj|BAA78427.1|  polyprotein                                            127   1e-29   Arabidopsis thaliana [mouse-ear cress]
dbj|BAM44531.1|  polyprotein                                            127   1e-29   
dbj|BAA78424.1|  polyprotein                                            127   1e-29   Arabidopsis thaliana [mouse-ear cress]
dbj|BAM44529.1|  polyprotein                                            127   1e-29   
dbj|BAM44532.1|  polyprotein                                            127   1e-29   
dbj|BAM44530.1|  polyprotein                                            127   1e-29   
pir||T02087  gag/pol polyprotein - maize retrotransposon Hopscotch      127   1e-29
emb|CAN72675.1|  hypothetical protein VITISV_020405                     127   1e-29   Vitis vinifera
ref|XP_008345130.1|  PREDICTED: uncharacterized protein LOC103408038    127   1e-29   
ref|XP_007024187.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...    127   1e-29   
emb|CAN76473.1|  hypothetical protein VITISV_016007                     126   2e-29   Vitis vinifera
ref|XP_006596772.1|  PREDICTED: uncharacterized mitochondrial pro...    117   2e-29   
emb|CAN62421.1|  hypothetical protein VITISV_020606                     127   2e-29   Vitis vinifera
ref|XP_008460736.1|  PREDICTED: uncharacterized protein LOC103499498    125   2e-29   
emb|CAN80123.1|  hypothetical protein VITISV_009646                     123   2e-29   Vitis vinifera
emb|CAN60276.1|  hypothetical protein VITISV_028253                     124   2e-29   Vitis vinifera
gb|KFK24418.1|  hypothetical protein AALP_AAs62447U000100               117   2e-29   
gb|KFK33814.1|  hypothetical protein AALP_AA5G063400                    123   3e-29   
emb|CAN81140.1|  hypothetical protein VITISV_007978                     125   3e-29   Vitis vinifera
emb|CAN71996.1|  hypothetical protein VITISV_023485                     125   3e-29   Vitis vinifera
ref|XP_011093964.1|  PREDICTED: uncharacterized protein LOC105173784    119   4e-29   
ref|XP_006606948.1|  PREDICTED: uncharacterized protein LOC102661023    123   4e-29   
emb|CAN60188.1|  hypothetical protein VITISV_002117                     125   4e-29   Vitis vinifera
dbj|BAA78426.1|  polyprotein                                            125   4e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008390627.1|  PREDICTED: uncharacterized protein LOC103452871    125   4e-29   
ref|XP_008357464.1|  PREDICTED: uncharacterized protein LOC103421211    120   4e-29   
ref|XP_004509218.1|  PREDICTED: uncharacterized protein LOC101501009    124   4e-29   
emb|CAN72527.1|  hypothetical protein VITISV_009255                     125   4e-29   Vitis vinifera
ref|XP_002444548.1|  hypothetical protein SORBIDRAFT_07g023610          124   4e-29   Sorghum bicolor [broomcorn]
ref|XP_006494841.1|  PREDICTED: uncharacterized protein LOC102608996    125   5e-29   
emb|CAB46043.1|  retrotransposon like protein                           125   5e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009629549.1|  PREDICTED: uncharacterized protein LOC104119680    120   7e-29   
ref|XP_011016404.1|  PREDICTED: uncharacterized protein LOC105119910    124   7e-29   
ref|XP_008351905.1|  PREDICTED: uncharacterized protein LOC103415342    120   8e-29   
ref|XP_008377446.1|  PREDICTED: uncharacterized protein LOC103440529    124   8e-29   
emb|CAN74166.1|  hypothetical protein VITISV_007721                     122   9e-29   Vitis vinifera
ref|XP_008380799.1|  PREDICTED: uncharacterized protein LOC103443689    124   9e-29   
ref|XP_010068882.1|  PREDICTED: uncharacterized protein LOC104455862    124   1e-28   
ref|XP_007014689.1|  Uncharacterized protein TCM_040047                 122   1e-28   
ref|XP_006493639.1|  PREDICTED: LRR receptor-like serine/threonin...    124   1e-28   
gb|ABF99203.1|  retrotransposon protein, putative, Ty1-copia subc...    124   1e-28   Oryza sativa Japonica Group [Japonica rice]
emb|CAN82452.1|  hypothetical protein VITISV_003326                     124   1e-28   Vitis vinifera
gb|AAK09230.1|AC084320_17  putative copia-like retrotransposon Ho...    124   1e-28   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004487252.1|  PREDICTED: uncharacterized protein LOC101509015    119   1e-28   
ref|XP_008675247.1|  PREDICTED: uncharacterized protein LOC103651...    124   2e-28   
emb|CAN80291.1|  hypothetical protein VITISV_020000                     120   2e-28   Vitis vinifera
ref|XP_008342448.1|  PREDICTED: uncharacterized protein LOC103405249    123   2e-28   
dbj|BAM44534.1|  polyprotein                                            123   2e-28   
dbj|BAM44535.1|  polyprotein                                            123   2e-28   
ref|XP_006595312.1|  PREDICTED: uncharacterized protein LOC102668660    120   2e-28   
emb|CAN64816.1|  hypothetical protein VITISV_010668                     123   2e-28   Vitis vinifera
gb|ABA98073.1|  retrotransposon protein, putative, unclassified         122   3e-28   Oryza sativa Japonica Group [Japonica rice]
emb|CAN78696.1|  hypothetical protein VITISV_035269                     122   3e-28   Vitis vinifera
ref|XP_004515732.1|  PREDICTED: uncharacterized protein LOC101515217    122   3e-28   
gb|AAK43485.1|AC084807_10  polyprotein, putative                        123   3e-28   Arabidopsis thaliana [mouse-ear cress]
gb|AAT38758.1|  Putative gag-pol polyprotein, identical                 123   3e-28   Solanum demissum
emb|CAN67588.1|  hypothetical protein VITISV_036280                     123   3e-28   Vitis vinifera
emb|CAN83990.1|  hypothetical protein VITISV_018454                     122   3e-28   Vitis vinifera
ref|XP_008347011.1|  PREDICTED: uncharacterized protein LOC103410016    123   3e-28   
ref|XP_007043089.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...    121   3e-28   
ref|XP_010684978.1|  PREDICTED: uncharacterized protein LOC104899479    122   3e-28   
emb|CAN83340.1|  hypothetical protein VITISV_021483                     120   4e-28   Vitis vinifera
ref|XP_010644735.1|  PREDICTED: uncharacterized protein LOC104877663    118   4e-28   
emb|CAN75274.1|  hypothetical protein VITISV_043735                     121   5e-28   Vitis vinifera
emb|CAN67580.1|  hypothetical protein VITISV_022637                     121   5e-28   Vitis vinifera
emb|CAN75776.1|  hypothetical protein VITISV_027125                     117   5e-28   Vitis vinifera
ref|XP_002438095.1|  hypothetical protein SORBIDRAFT_10g007953          122   5e-28   Sorghum bicolor [broomcorn]
dbj|BAB10876.1|  polyprotein                                            122   5e-28   
ref|XP_010321174.1|  PREDICTED: uncharacterized protein LOC104647460    121   6e-28   
ref|XP_010656738.1|  PREDICTED: uncharacterized protein LOC104880761    118   6e-28   
ref|XP_008369700.1|  PREDICTED: uncharacterized protein LOC103433244    121   6e-28   
ref|XP_008354245.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    121   6e-28   
emb|CAN83839.1|  hypothetical protein VITISV_023230                     120   7e-28   
ref|XP_008348842.1|  PREDICTED: uncharacterized protein LOC103412011    122   8e-28   
gb|AAX96308.1|  retrotransposon protein, putative, Ty1-copia sub-...    121   9e-28   
ref|XP_008356672.1|  PREDICTED: uncharacterized protein LOC103420386    121   9e-28   
ref|XP_009760373.1|  PREDICTED: uncharacterized protein LOC104212719    120   1e-27   
ref|XP_010445567.1|  PREDICTED: uncharacterized protein LOC104728255    120   1e-27   
ref|XP_002453623.1|  hypothetical protein SORBIDRAFT_04g009135          120   1e-27   
ref|XP_011070687.1|  PREDICTED: uncharacterized protein LOC105156289    120   1e-27   
emb|CAN72398.1|  hypothetical protein VITISV_041202                     121   1e-27   
ref|XP_010661465.1|  PREDICTED: uncharacterized protein LOC104881837    120   2e-27   
ref|XP_010495906.1|  PREDICTED: uncharacterized protein LOC104773055    119   2e-27   
emb|CAN67073.1|  hypothetical protein VITISV_011746                     120   2e-27   
emb|CAN76631.1|  hypothetical protein VITISV_032335                     118   2e-27   
emb|CAN71037.1|  hypothetical protein VITISV_011061                     120   2e-27   
ref|XP_008372631.1|  PREDICTED: uncharacterized protein LOC103435981    120   2e-27   
ref|XP_010321266.1|  PREDICTED: uncharacterized protein LOC104647537    120   2e-27   
ref|XP_010065142.1|  PREDICTED: uncharacterized protein LOC104452376    120   2e-27   
emb|CAN83285.1|  hypothetical protein VITISV_004139                     120   2e-27   
emb|CAN66823.1|  hypothetical protein VITISV_003499                     119   2e-27   
ref|XP_010683797.1|  PREDICTED: uncharacterized protein LOC104898410    120   2e-27   
emb|CAE05127.3|  OSJNBa0079F16.14                                       116   2e-27   
ref|XP_009344163.1|  PREDICTED: uncharacterized protein LOC103936058    114   2e-27   
emb|CAN67986.1|  hypothetical protein VITISV_010770                     119   2e-27   
ref|XP_009357571.1|  PREDICTED: uncharacterized protein LOC103948287    120   2e-27   
ref|XP_002456118.1|  hypothetical protein SORBIDRAFT_03g030787          120   2e-27   
ref|XP_008778072.1|  PREDICTED: uncharacterized protein LOC103697909    119   3e-27   
emb|CAN75273.1|  hypothetical protein VITISV_043734                     120   3e-27   
gb|AAG46116.1|AC073166_14  putative copia-like retrotransposon po...    120   3e-27   
ref|XP_010319957.1|  PREDICTED: uncharacterized protein LOC104647082    120   3e-27   
ref|XP_008385012.1|  PREDICTED: uncharacterized protein LOC103447594    119   3e-27   
ref|XP_010662484.1|  PREDICTED: uncharacterized protein LOC104882143    120   3e-27   
ref|XP_002451986.1|  hypothetical protein SORBIDRAFT_04g012210          119   3e-27   
gb|AAD21687.1|  Strong similarity to gi|3600044 T12H20.12 proteas...    120   3e-27   
gb|ABB47941.2|  retrotransposon protein, putative, unclassified         120   3e-27   
gb|ABD32333.1|  polyprotein-like, putative                              118   3e-27   
ref|XP_006601648.1|  PREDICTED: uncharacterized mitochondrial pro...    111   4e-27   
emb|CAN60203.1|  hypothetical protein VITISV_036059                     120   4e-27   
emb|CAN71595.1|  hypothetical protein VITISV_010143                     120   4e-27   
ref|XP_010430787.1|  PREDICTED: uncharacterized protein LOC104715028    119   4e-27   
gb|AAG13591.2|AC051633_7  putative gag/pol polyprotein                  119   4e-27   
emb|CAN71684.1|  hypothetical protein VITISV_013362                     118   4e-27   
ref|XP_010064294.1|  PREDICTED: uncharacterized protein LOC104451296    116   4e-27   
ref|XP_002450808.1|  hypothetical protein SORBIDRAFT_05g018905          116   5e-27   
ref|XP_008656328.1|  PREDICTED: uncharacterized protein LOC103635721    115   5e-27   
emb|CAN77295.1|  hypothetical protein VITISV_005638                     119   5e-27   
ref|XP_009145096.1|  PREDICTED: uncharacterized protein LOC103868780    120   5e-27   
ref|XP_008229790.1|  PREDICTED: uncharacterized protein LOC103329135    118   5e-27   
ref|XP_002489126.1|  hypothetical protein SORBIDRAFT_0019s003280        118   5e-27   
ref|XP_006357458.1|  PREDICTED: uncharacterized protein LOC102585642    119   5e-27   
ref|XP_008343016.1|  PREDICTED: uncharacterized protein LOC103405779    115   6e-27   
gb|KFK44388.1|  hypothetical protein AALP_AA1G251100                    119   6e-27   
ref|XP_006465491.1|  PREDICTED: uncharacterized protein LOC102624640    119   6e-27   
dbj|BAK41512.1|  C-end truncated polyprotein                            119   6e-27   
ref|XP_010468503.1|  PREDICTED: uncharacterized protein LOC104748585    117   6e-27   
gb|AEJ07956.1|  putative polyprotein                                    116   7e-27   
ref|XP_006603194.1|  PREDICTED: uncharacterized protein LOC102665260    118   7e-27   
emb|CAN71258.1|  hypothetical protein VITISV_043225                     118   7e-27   
ref|XP_008809371.1|  PREDICTED: uncharacterized protein LOC103721098    114   7e-27   
emb|CAN75363.1|  hypothetical protein VITISV_026292                     119   8e-27   
ref|XP_008646486.1|  PREDICTED: uncharacterized protein LOC103627967    118   8e-27   
ref|XP_008350165.1|  PREDICTED: uncharacterized protein LOC103413482    118   8e-27   
emb|CAN69367.1|  hypothetical protein VITISV_035520                     118   8e-27   
emb|CAN71759.1|  hypothetical protein VITISV_020777                     119   9e-27   
ref|XP_004305316.1|  PREDICTED: uncharacterized protein LOC101302857    115   9e-27   
gb|AAK51235.1|AF287471_1  polyprotein                                   118   1e-26   
gb|AAM08751.1|AC025098_18  Putative copia-type polyprotein              119   1e-26   
emb|CAB10380.1|  reverse transcriptase like protein                     119   1e-26   
gb|ABA95677.1|  retrotransposon protein, putative, Ty1-copia subc...    115   1e-26   
ref|XP_008223145.1|  PREDICTED: uncharacterized protein LOC103322965    118   1e-26   
gb|ABA97658.1|  retrotransposon protein, putative, Ty1-copia subc...    118   1e-26   
ref|XP_009787930.1|  PREDICTED: uncharacterized protein LOC104235804    113   1e-26   
ref|XP_004231364.1|  PREDICTED: uncharacterized protein LOC101245809    117   1e-26   
ref|XP_010059409.1|  PREDICTED: uncharacterized protein LOC104447361    117   1e-26   
ref|XP_008374297.1|  PREDICTED: uncharacterized protein LOC103437591    118   2e-26   
gb|AAD14478.1|  Strong similarity to gb|AF039376 Evelknievel retr...    117   2e-26   
gb|KHN05285.1|  Retrovirus-related Pol polyprotein from transposo...    118   2e-26   
emb|CAN60238.1|  hypothetical protein VITISV_032906                     118   2e-26   
gb|AAC02664.1|  polyprotein                                             118   2e-26   
gb|AAC02666.1|  polyprotein                                             117   2e-26   
ref|XP_008358376.1|  PREDICTED: uncharacterized protein LOC103422119    117   2e-26   
emb|CAN65820.1|  hypothetical protein VITISV_042324                     117   2e-26   
ref|XP_002446435.1|  hypothetical protein SORBIDRAFT_06g016046          117   2e-26   
gb|KFK36578.1|  hypothetical protein AALP_AA4G141700                    114   2e-26   
gb|ACB45081.1|  putative polyprotein                                    115   2e-26   
ref|XP_010314100.1|  PREDICTED: uncharacterized protein LOC104644925    117   2e-26   
ref|XP_008344228.1|  PREDICTED: uncharacterized protein LOC103407048    114   2e-26   
emb|CAN74229.1|  hypothetical protein VITISV_000584                     117   2e-26   
emb|CAN60829.1|  hypothetical protein VITISV_012059                     117   2e-26   
ref|XP_004499697.1|  PREDICTED: uncharacterized mitochondrial pro...    110   2e-26   
gb|KHN36156.1|  Retrovirus-related Pol polyprotein from transposo...    117   2e-26   
gb|KHN22040.1|  Retrovirus-related Pol polyprotein from transposo...    117   3e-26   
ref|XP_010444961.1|  PREDICTED: uncharacterized protein LOC104727565    117   3e-26   
gb|AAC02669.1|  polyprotein                                             117   3e-26   
emb|CAN73437.1|  hypothetical protein VITISV_031733                     117   3e-26   
ref|XP_007022140.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...    115   3e-26   
ref|XP_009338880.1|  PREDICTED: uncharacterized protein LOC103931184    117   3e-26   
gb|AAT38052.1|  unknown protein                                         111   3e-26   
ref|XP_008349844.1|  PREDICTED: uncharacterized protein LOC103413131    113   4e-26   
ref|XP_009767591.1|  PREDICTED: uncharacterized protein LOC104218727    115   4e-26   
ref|XP_010322961.1|  PREDICTED: uncharacterized protein LOC104648099    116   4e-26   
ref|XP_004963982.1|  PREDICTED: uncharacterized protein LOC101777276    116   4e-26   
emb|CAN81016.1|  hypothetical protein VITISV_025518                     117   4e-26   
ref|XP_002460196.1|  hypothetical protein SORBIDRAFT_02g024427          117   4e-26   
emb|CAN70473.1|  hypothetical protein VITISV_037490                     115   4e-26   
ref|XP_002489074.1|  hypothetical protein SORBIDRAFT_0139s002040        117   5e-26   
emb|CAN77726.1|  hypothetical protein VITISV_024317                     113   5e-26   
ref|XP_006653153.1|  PREDICTED: uncharacterized protein LOC102713624    116   6e-26   
ref|XP_010669336.1|  PREDICTED: copia protein isoform X2                115   6e-26   
emb|CAN61340.1|  hypothetical protein VITISV_007301                     115   6e-26   
ref|XP_008360651.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    115   6e-26   
ref|XP_010669333.1|  PREDICTED: copia protein isoform X1                115   6e-26   
ref|XP_004966848.1|  PREDICTED: uncharacterized protein LOC101777861    116   6e-26   
ref|XP_011073063.1|  PREDICTED: uncharacterized protein LOC105158123    112   6e-26   
ref|XP_008674202.1|  PREDICTED: retrovirus-related Pol polyprotei...    115   7e-26   
ref|XP_010419217.1|  PREDICTED: uncharacterized protein LOC104704907    115   7e-26   
ref|XP_008674201.1|  PREDICTED: uncharacterized protein LOC100279...    116   7e-26   
ref|XP_006589931.1|  PREDICTED: uncharacterized protein LOC102669127    114   8e-26   
ref|XP_008647645.1|  PREDICTED: uncharacterized protein LOC100502...    115   8e-26   
ref|XP_008359393.1|  PREDICTED: uncharacterized protein LOC103423104    115   9e-26   
emb|CAN78924.1|  hypothetical protein VITISV_007386                     111   9e-26   
ref|XP_008651726.1|  PREDICTED: hypothetical protein isoform X1         115   1e-25   
ref|XP_008381548.1|  PREDICTED: uncharacterized protein LOC103444402    115   1e-25   
ref|XP_006367551.1|  PREDICTED: uncharacterized protein LOC102604059    115   1e-25   
ref|XP_006359791.1|  PREDICTED: uncharacterized protein LOC102577647    115   1e-25   
gb|ADB85383.1|  putative retrotransposon protein                        115   1e-25   
ref|XP_007048694.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...    109   1e-25   
ref|XP_006574082.1|  PREDICTED: uncharacterized protein LOC102670255    113   1e-25   
ref|XP_004300921.1|  PREDICTED: uncharacterized protein LOC101301876    115   1e-25   
emb|CAN63098.1|  hypothetical protein VITISV_009456                     111   1e-25   
gb|KFK27502.1|  hypothetical protein AALP_AA8G391300                    115   1e-25   
emb|CAB40067.1|  putative retrotransposon polyprotein                   115   1e-25   
ref|XP_002440449.1|  hypothetical protein SORBIDRAFT_09g001135          112   1e-25   
ref|XP_006365584.1|  PREDICTED: uncharacterized protein LOC102598606    115   1e-25   
gb|AAC02672.1|  polyprotein                                             115   1e-25   
ref|XP_008390461.1|  PREDICTED: uncharacterized protein LOC103452707    114   1e-25   
emb|CAN69815.1|  hypothetical protein VITISV_010421                     113   1e-25   
gb|AAC33963.1|  contains similarity to reverse transcriptases (Pf...    115   1e-25   
gb|KFK36577.1|  hypothetical protein AALP_AA4G141700                    114   2e-25   
emb|CAN76546.1|  hypothetical protein VITISV_010420                     115   2e-25   
gb|ABB47203.2|  retrotransposon protein, putative, unclassified         114   2e-25   
gb|AAN34944.1|  Putative retroelement                                   114   2e-25   
emb|CAN78042.1|  hypothetical protein VITISV_041808                     113   2e-25   
ref|XP_010908910.1|  PREDICTED: uncharacterized protein LOC105035160    115   2e-25   
ref|XP_004986808.1|  PREDICTED: uncharacterized protein LOC101773259    114   3e-25   
gb|AAG10817.1|AC011808_5  Putative retroelement polyprotein             114   3e-25   
gb|AAM74347.1|AC115686_14  Putative retroelement                        114   3e-25   
ref|XP_008777490.1|  PREDICTED: uncharacterized protein LOC103697418    110   3e-25   
emb|CAN74921.1|  hypothetical protein VITISV_022027                     112   3e-25   
ref|XP_008356540.1|  PREDICTED: uncharacterized protein LOC103420257    109   3e-25   
ref|XP_008345536.1|  PREDICTED: uncharacterized protein LOC103408463    113   4e-25   
emb|CAN81839.1|  hypothetical protein VITISV_033739                     114   4e-25   
ref|XP_004986594.1|  PREDICTED: uncharacterized protein LOC101753122    112   4e-25   
ref|XP_004149623.1|  PREDICTED: uncharacterized protein LOC101211618    114   4e-25   
gb|AAC95173.1|  putative retroelement pol polyprotein                   114   4e-25   
ref|XP_008382407.1|  PREDICTED: uncharacterized protein LOC103445199    113   4e-25   
emb|CAN75292.1|  hypothetical protein VITISV_014745                     114   4e-25   
ref|XP_011010893.1|  PREDICTED: uncharacterized protein LOC105115645    114   4e-25   
gb|AAF99727.1|AC004557_6  F17L21.7                                      114   4e-25   
emb|CAE01741.2|  OSJNBb0056F09.4                                        112   4e-25   
emb|CAN79196.1|  hypothetical protein VITISV_000238                     113   4e-25   
ref|XP_008341769.1|  PREDICTED: uncharacterized protein LOC103404622    108   4e-25   
gb|AAM00978.1|AC090482_7  Putative retrovirus-related pol polypro...    111   5e-25   
gb|AAD26943.1|  putative retroelement pol polyprotein                   113   5e-25   
gb|AAM94928.1|  putative polyprotein                                    112   6e-25   
ref|XP_008228903.1|  PREDICTED: uncharacterized protein LOC103328294    113   6e-25   
ref|XP_010264152.1|  PREDICTED: uncharacterized protein LOC104602236    110   6e-25   
emb|CAN81001.1|  hypothetical protein VITISV_006992                     113   6e-25   
ref|XP_006485859.1|  PREDICTED: uncharacterized protein LOC102626627    113   7e-25   
gb|AAM22635.1|AF434192_2  Gag and Pol                                   113   7e-25   
emb|CAA19714.1|  putative protein                                       112   7e-25   
ref|XP_006591635.1|  PREDICTED: uncharacterized protein LOC102659900    108   7e-25   
ref|XP_007029159.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...    110   7e-25   
emb|CAN75777.1|  hypothetical protein VITISV_031053                     112   7e-25   
ref|XP_008238703.1|  PREDICTED: uncharacterized protein LOC103337320    108   7e-25   
ref|XP_009605462.1|  PREDICTED: uncharacterized protein LOC104100012    112   8e-25   
gb|ABB47331.1|  retrotransposon protein, putative, Ty1-copia subc...    112   8e-25   
ref|XP_008380342.1|  PREDICTED: uncharacterized protein LOC103443301    110   9e-25   
ref|XP_002489193.1|  hypothetical protein SORBIDRAFT_0013s009070        112   9e-25   
emb|CAN79529.1|  hypothetical protein VITISV_026262                     112   9e-25   
ref|XP_009611318.1|  PREDICTED: uncharacterized protein LOC104104835    112   1e-24   
emb|CAN68148.1|  hypothetical protein VITISV_035665                     113   1e-24   
gb|EPS67678.1|  hypothetical protein M569_07096                         112   1e-24   
gb|ABH07899.1|  putative polyprotein                                    112   1e-24   
emb|CAN74901.1|  hypothetical protein VITISV_010116                     112   1e-24   
ref|XP_002445301.1|  hypothetical protein SORBIDRAFT_07g008525          111   1e-24   
gb|ABA94365.1|  retrotransposon protein, putative, unclassified         112   1e-24   
ref|XP_002489303.1|  hypothetical protein SORBIDRAFT_0010s005460        111   1e-24   
ref|XP_011070841.1|  PREDICTED: uncharacterized protein LOC105156417    112   1e-24   
ref|XP_008358877.1|  PREDICTED: uncharacterized protein LOC103422594    107   1e-24   
ref|XP_008463248.1|  PREDICTED: uncharacterized protein LOC103501452    110   1e-24   
ref|XP_008353911.1|  PREDICTED: aspartic proteinase-like protein 2      111   1e-24   
emb|CAN63908.1|  hypothetical protein VITISV_044218                     112   1e-24   
gb|AIA87533.1|  RVT_2                                                   103   1e-24   
emb|CAN78269.1|  hypothetical protein VITISV_006711                     108   2e-24   
emb|CAA19715.1|  putative protein                                       112   2e-24   
ref|XP_008350379.1|  PREDICTED: uncharacterized protein LOC103413717    107   2e-24   
emb|CAN66496.1|  hypothetical protein VITISV_036886                     112   2e-24   
gb|AAK39592.1|AC025296_27  putative retrotransposon polyprotein         111   2e-24   
emb|CAN74819.1|  hypothetical protein VITISV_034590                     111   2e-24   
emb|CAN76111.1|  hypothetical protein VITISV_005526                     111   2e-24   
emb|CAN63182.1|  hypothetical protein VITISV_029266                     108   2e-24   
ref|XP_002445564.1|  hypothetical protein SORBIDRAFT_07g021665          110   2e-24   
gb|AAL31653.1|AC079179_8  Putative polyprotein from transposon TNT      112   2e-24   
emb|CAN67566.1|  hypothetical protein VITISV_020485                     108   2e-24   
ref|XP_004310176.1|  PREDICTED: uncharacterized protein LOC101315202    111   2e-24   
ref|XP_008356279.1|  PREDICTED: uncharacterized protein LOC103419980    110   2e-24   
gb|ABA96637.2|  retrotransposon protein, putative, Ty1-copia subc...    111   2e-24   
gb|AAF25964.2|AC017118_1  F6N18.1                                       111   2e-24   
gb|EEE67150.1|  hypothetical protein OsJ_24213                          111   2e-24   
gb|AAF02855.1|AC009324_4  Similar to retrotransposon proteins           111   2e-24   
ref|XP_010068106.1|  PREDICTED: uncharacterized protein LOC104454933    110   3e-24   
gb|AAR01692.1|  putative gag and pol polyprotein                        111   3e-24   
emb|CAN73022.1|  hypothetical protein VITISV_004050                     110   3e-24   
gb|AAM19019.1|AC084748_9  putative polyprotein                          111   3e-24   
gb|AAM95676.1|  putative polyprotein                                    111   3e-24   
gb|AAG13538.1|AC023240_11  putative gag-pol polyprotein                 111   3e-24   



>ref|XP_004972302.1| PREDICTED: uncharacterized protein LOC101778040 [Setaria italica]
Length=446

 Score =   161 bits (407),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 81/175 (46%), Positives = 108/175 (62%), Gaps = 2/175 (1%)
 Frame = +2

Query  62   PHEPSVKPAKRPHGRPR--GKSVKSTVRTHEMSTRSRSQAPPSALTVQVCPSDPTCYIQA  235
            P  P       P G P        + ++ H    + R+    +   V+    +P  +I A
Sbjct  121  PASPGQPETTTPQGAPHVPAHQYGTRLQNHIRRPKIRTDGTVTYSVVRTSDDEPVSHITA  180

Query  236  VKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVA  415
            +K+  WR AM+ EF AL++N+TWHLVP  AG+N+I CKW F+ KRKADGSI R+KARLVA
Sbjct  181  MKHPLWRSAMNDEFQALVKNKTWHLVPPHAGLNVINCKWIFKLKRKADGSIDRYKARLVA  240

Query  416  KGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ**AYLGQIHSN  580
            KGF Q  G D  DTFSPVVKPTT+R+LL LA+S GW +RQ+D+Q     G +H +
Sbjct  241  KGFKQQYGIDYDDTFSPVVKPTTIRVLLSLAVSHGWSLRQIDIQNAFLHGYLHED  295



>ref|XP_010539104.1| PREDICTED: uncharacterized protein LOC104813235 [Tarenaya hassleriana]
Length=363

 Score =   151 bits (381),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 75/136 (55%), Positives = 100/136 (74%), Gaps = 7/136 (5%)
 Frame = +2

Query  140  THEMSTRSRSQA----PPSALTVQVCPS---DPTCYIQAVKYLEWREAMDQEFNALLQNQ  298
            TH M TRS++      P  +LT  + P+   +PTC  QA+K  +WR+AM +EFNALL+N 
Sbjct  40   THPMVTRSKNNITKPHPKLSLTSALHPTHDVEPTCVSQALKDPKWRDAMAEEFNALLRNG  99

Query  299  TWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKP  478
            TW LVPS++  N++GCKW FRTKR +DGSI R+KARLVAKGF+Q PG D  DTFSPV+K 
Sbjct  100  TWTLVPSRSSYNVVGCKWVFRTKRHSDGSIDRYKARLVAKGFHQRPGIDYTDTFSPVIKH  159

Query  479  TTVRLLLYLALSSGWI  526
             T+R++L +A+S G+I
Sbjct  160  ATIRVVLSIAVSKGFI  175



>ref|XP_010531095.1| PREDICTED: retrovirus-related Pol polyprotein from transposon 
TNT 1-94 isoform X1 [Tarenaya hassleriana]
Length=435

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 87/188 (46%), Positives = 112/188 (60%), Gaps = 9/188 (5%)
 Frame = +2

Query  5    APSSLLHTANEPASLPEQEPHEPSVKPAKRPHGRPRGKSVKSTVRT-HEMSTRSRSQA--  175
            APS L H    P + P+  P   +  P+          S+ S  R  H M TR ++    
Sbjct  41   APSPLEHEDTSPMAPPDPVPATCAELPSDV--SLDAVSSIASPSRNRHHMMTRGKNNITK  98

Query  176  PPSALTVQVCPSD----PTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIG  343
            P S LT+     D    P+C  QA+K   WR+AM +EF+AL++N TW LVPS    N +G
Sbjct  99   PISKLTLVASVVDSNREPSCVSQALKDPRWRQAMSEEFDALVRNGTWELVPSVTASNTVG  158

Query  344  CKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGW  523
            CKW FR K+  DG+I R KARLVAKGF+Q PG D  +TFSPVVKPTT+R++L LA+S  W
Sbjct  159  CKWVFRIKKNPDGTIDRFKARLVAKGFHQRPGIDFHETFSPVVKPTTIRVVLSLAVSRNW  218

Query  524  IVRQLDVQ  547
             +RQLDV 
Sbjct  219  PIRQLDVN  226



>emb|CAN83506.1| hypothetical protein VITISV_027576 [Vitis vinifera]
Length=1172

 Score =   155 bits (392),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 77/147 (52%), Positives = 104/147 (71%), Gaps = 7/147 (5%)
 Frame = +2

Query  128  STVRTHEMSTRSRS--QAPPSALTVQVCPS-----DPTCYIQAVKYLEWREAMDQEFNAL  286
            +T   H M TR+++  + P   L + +  S     +PT   QA+K  +WR+AM +E++AL
Sbjct  620  TTNSNHSMQTRAKNNIRKPIQKLNLHIQLSKPLDLEPTTPTQALKDPKWRKAMSEEYDAL  679

Query  287  LQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSP  466
            ++N TW LVPS    N++GCKW FRTKR +DGSI R KARLVAKGF+Q P  D +DTFSP
Sbjct  680  VRNGTWELVPSNPSQNVVGCKWIFRTKRNSDGSIDRFKARLVAKGFHQRPDIDYYDTFSP  739

Query  467  VVKPTTVRLLLYLALSSGWIVRQLDVQ  547
            VVKPTT+ L+L +A+S+GWI+RQLDV 
Sbjct  740  VVKPTTIMLVLSVAVSNGWILRQLDVN  766



>ref|XP_008680471.1| PREDICTED: uncharacterized protein LOC103655505 [Zea mays]
Length=347

 Score =   147 bits (372),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 87/113 (77%), Gaps = 0/113 (0%)
 Frame = +2

Query  209  SDPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSI  388
            S+P  Y+ A+K   WR+ +D E  ALL+N TWHLVP +AG+NII CKW F+ K+K+ GS+
Sbjct  173  SEPNSYVVALKDPLWRQELDAEICALLKNDTWHLVPPRAGLNIIDCKWVFKIKQKSYGSV  232

Query  389  GRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
             R+KARLVAKGF Q  G D   TFSPVVKPTT+RLLL LA+S GW++RQ+D++
Sbjct  233  DRYKARLVAKGFKQQYGVDYDATFSPVVKPTTIRLLLSLAVSRGWVIRQIDIE  285



>ref|XP_008365969.1| PREDICTED: uncharacterized protein LOC103429605 [Malus domestica]
Length=1188

 Score =   154 bits (388),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 103/150 (69%), Gaps = 6/150 (4%)
 Frame = +2

Query  143  HEMSTRSRSQA----PPSALTVQVCPS--DPTCYIQAVKYLEWREAMDQEFNALLQNQTW  304
            H M+TRS+S      P  A+ V V  S  +PTC+ QAVK+ EWREAM QEFNAL +  TW
Sbjct  634  HSMTTRSQSGVLKPNPKYAMHVAVNNSLVEPTCFSQAVKHQEWREAMVQEFNALQRCGTW  693

Query  305  HLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKPTT  484
             LVP  + MN++  KW F+ KR+ADG+I RHKARLVA GF+Q  G D  +TFSPVVK +T
Sbjct  694  SLVPYSSQMNVLPNKWVFKIKRRADGTIERHKARLVANGFHQKAGVDYTETFSPVVKHST  753

Query  485  VRLLLYLALSSGWIVRQLDVQ**AYLGQIH  574
            +RL+L LA+S  W VRQLDVQ     G +H
Sbjct  754  IRLVLSLAVSKKWXVRQLDVQNAFLHGYLH  783



>ref|XP_010531643.1| PREDICTED: uncharacterized protein LOC104807900 [Tarenaya hassleriana]
Length=1047

 Score =   153 bits (386),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 96/143 (67%), Gaps = 7/143 (5%)
 Frame = +2

Query  140  THEMSTRSRSQA----PPSALTVQVCPS---DPTCYIQAVKYLEWREAMDQEFNALLQNQ  298
            TH M TRS++      P   L   V  +   +P+   QA+K   WR AM +EF AL +N 
Sbjct  561  THPMQTRSKNNILMPNPRYTLMASVADTSDIEPSSVTQAIKDPNWRAAMTEEFQALCRNN  620

Query  299  TWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKP  478
            TW LVPS    N++GC+W FR KRK DGS+ R+KARLVAKGF+Q PG D  +TFSPVVKP
Sbjct  621  TWDLVPSSDASNVVGCRWVFRIKRKPDGSVDRYKARLVAKGFHQRPGVDYHETFSPVVKP  680

Query  479  TTVRLLLYLALSSGWIVRQLDVQ  547
            TT+R++L LA+S GW +RQLDV 
Sbjct  681  TTIRVVLSLAVSRGWTLRQLDVN  703



>gb|AAB82754.1| retrofit [Oryza longistaminata]
Length=1445

 Score =   152 bits (384),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/158 (49%), Positives = 103/158 (65%), Gaps = 10/158 (6%)
 Frame = +2

Query  74    SVKPAKRPHGRPRGKSVKSTVRTHEMSTRSRSQAPPSALTVQVCPSDPTCYIQAVKYLEW  253
             +V PA RPH R R     S +R  ++ T    +    + T      +P    +A+    W
Sbjct  900   TVAPASRPHTRLR-----SGIRKEKVYTDGTVKYGCFSST-----GEPQNDKEALGDKNW  949

Query  254   REAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQV  433
             R+AM+ E+NAL++N TWHLVP + G NIIGCKW ++ KRKADG++ R+KARLVAKGF Q 
Sbjct  950   RDAMETEYNALIKNDTWHLVPYEKGQNIIGCKWVYKIKRKADGTLDRYKARLVAKGFKQR  1009

Query  434   PGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
              G D  DTFSPVVK  T+R++L +A+S GW +RQLDVQ
Sbjct  1010  YGIDYEDTFSPVVKAATIRIILSIAVSRGWSLRQLDVQ  1047



>dbj|BAB90546.1| putative rice retrotransposon retrofit gag/pol polyprotein [Oryza 
sativa Japonica Group]
Length=1448

 Score =   151 bits (381),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 102/158 (65%), Gaps = 10/158 (6%)
 Frame = +2

Query  74    SVKPAKRPHGRPRGKSVKSTVRTHEMSTRSRSQAPPSALTVQVCPSDPTCYIQAVKYLEW  253
             +V PA RPH R R     S +R  ++ T    +    + T      +P    +A+    W
Sbjct  903   TVAPASRPHTRLR-----SGIRKEKVYTNGTVKYGCFSST-----GEPQNDKEALGDKNW  952

Query  254   REAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQV  433
             R+AM+ E+NAL++N TWHLVP + G NIIGCKW ++ KRKADG++ R+K RL+AKGF Q 
Sbjct  953   RDAMETEYNALIKNDTWHLVPYEKGQNIIGCKWVYKVKRKADGTLDRYKTRLIAKGFKQR  1012

Query  434   PGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
              G D  DTFSPVVK  T+R++L +A+S GW +RQLDVQ
Sbjct  1013  YGIDYEDTFSPVVKAATIRIILSIAVSRGWSLRQLDVQ  1050



>gb|ABA98049.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1460

 Score =   151 bits (381),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 76/147 (52%), Positives = 102/147 (69%), Gaps = 4/147 (3%)
 Frame = +2

Query  107   PRGKSVKSTVRTHEMSTRSRSQAPPSALTVQVCPSDPTCYIQAVKYLEWREAMDQEFNAL  286
             PR + ++S VR  ++ T    +   S  T      +PT  ++A+K   W+ AMD E++AL
Sbjct  913   PRTR-LQSGVRKEKVYTDGTIKYKHSWFTAS---GEPTNDLEALKDKNWKLAMDSEYDAL  968

Query  287   LQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSP  466
             ++N+TWHLVP Q G NIIGCKW ++ KRKADG++ R+KARLVAKGF Q  G D  DTFSP
Sbjct  969   VKNKTWHLVPPQRGRNIIGCKWVYKIKRKADGTLDRYKARLVAKGFKQRYGIDYEDTFSP  1028

Query  467   VVKPTTVRLLLYLALSSGWIVRQLDVQ  547
             VVK  T+R++L LA+S GW +RQLDVQ
Sbjct  1029  VVKAATIRIILSLAVSKGWSLRQLDVQ  1055



>emb|CAH67225.1| OSIGBa0145M07.7 [Oryza sativa Indica Group]
Length=1087

 Score =   150 bits (379),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 87/112 (78%), Gaps = 0/112 (0%)
 Frame = +2

Query  212  DPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIG  391
            +PTC+  A+    W++AMD+E+NAL++N TWHLVP+  G  II CKW F+ KRK+DG+I 
Sbjct  637  EPTCFDDALADENWKKAMDEEYNALIKNNTWHLVPAPIGKYIIDCKWVFKIKRKSDGTID  696

Query  392  RHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
            R+KARLVAKGF Q  G D  DTFSPVVK +T+RL+L LA+S GW +RQLDV+
Sbjct  697  RYKARLVAKGFKQRYGIDYEDTFSPVVKISTIRLVLSLAVSKGWSIRQLDVK  748



>gb|AAX96193.1| retrotransposon protein, putative, Ty1-copia sub-class [Oryza 
sativa Japonica Group]
Length=1621

 Score =   151 bits (381),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 76/147 (52%), Positives = 102/147 (69%), Gaps = 4/147 (3%)
 Frame = +2

Query  107  PRGKSVKSTVRTHEMSTRSRSQAPPSALTVQVCPSDPTCYIQAVKYLEWREAMDQEFNAL  286
            PR + ++S VR  ++ T    +   S  T      +PT  ++A+K   W+ AMD E++AL
Sbjct  635  PRTR-LQSGVRKEKVYTDGTIKYKHSWFT---ASGEPTNDLEALKDKNWKLAMDSEYDAL  690

Query  287  LQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSP  466
            ++N+TWHLVP Q G NIIGCKW ++ KRKADG++ R+KARLVAKGF Q  G D  DTFSP
Sbjct  691  VKNKTWHLVPPQRGRNIIGCKWVYKIKRKADGTLDRYKARLVAKGFKQRYGIDYEDTFSP  750

Query  467  VVKPTTVRLLLYLALSSGWIVRQLDVQ  547
            VVK  T+R++L LA+S GW +RQLDVQ
Sbjct  751  VVKAATIRIILSLAVSKGWSLRQLDVQ  777



>gb|ACV42639.1| gag/pol [Oryza sativa Japonica Group]
Length=1448

 Score =   150 bits (380),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 102/158 (65%), Gaps = 10/158 (6%)
 Frame = +2

Query  74    SVKPAKRPHGRPRGKSVKSTVRTHEMSTRSRSQAPPSALTVQVCPSDPTCYIQAVKYLEW  253
             +V PA RPH R R     S +R  ++ T    +    + T      +P    +A+    W
Sbjct  903   TVAPASRPHTRLR-----SGIRKEKVYTNGTVKYGCFSST-----GEPQNDKEALGDKNW  952

Query  254   REAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQV  433
             R+AM+ E+NAL++N TWHLVP + G NIIGCKW ++ KRKADG++ R+K RL+AKGF Q 
Sbjct  953   RDAMETEYNALIKNDTWHLVPYEKGQNIIGCKWVYKVKRKADGTLDRYKTRLIAKGFKQR  1012

Query  434   PGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
              G D  DTFSPVVK  T+R++L +A+S GW +RQLDVQ
Sbjct  1013  YGIDYEDTFSPVVKAATIRIILSIAVSRGWNLRQLDVQ  1050



>gb|AFP55537.1| retrotransposon polyprotein [Rosa rugosa]
Length=1384

 Score =   150 bits (379),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 83/174 (48%), Positives = 108/174 (62%), Gaps = 7/174 (4%)
 Frame = +2

Query  47   LPEQEPHEPSVKPAKRPHGRPRGKSVKSTVRTH-EMSTRSRSQA----PPSAL--TVQVC  205
            +   +PH  +  P   P        + S V+ H ++ TRS+       P  A+  T+   
Sbjct  811  ITHTDPHSSTSLPTNNPIPPLLSSPLVSQVQNHGDIVTRSKHGISKPNPKYAMHSTLLAL  870

Query  206  PSDPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGS  385
            P +PTCY QA KY EWREAMD EF AL Q  TW LVP  + MNI+  KW FR K+++DGS
Sbjct  871  PLEPTCYTQAAKYPEWREAMDHEFKALQQAGTWFLVPPSSLMNILPNKWVFRIKKRSDGS  930

Query  386  IGRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
            + R+KARLVA GF+Q  G D  +TFSPVVK +T+RL+L LA+S  W +RQLDVQ
Sbjct  931  VERYKARLVANGFHQQEGLDYTETFSPVVKHSTIRLVLALAVSHRWPIRQLDVQ  984



>gb|ABA98286.2| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1478

 Score =   150 bits (379),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 88/112 (79%), Gaps = 0/112 (0%)
 Frame = +2

Query  212   DPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIG  391
             +PT  ++A+K   W+ AMD E++AL++N+TWHLVP Q G NIIGCKW ++ KRKADG++ 
Sbjct  937   EPTNDLEALKDKNWKLAMDSEYDALVKNKTWHLVPPQRGRNIIGCKWVYKIKRKADGTLD  996

Query  392   RHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
             R+KARLVAKGF Q  G D  DTFSPVVK  T+R++L LA+S GW +RQLDVQ
Sbjct  997   RYKARLVAKGFKQRYGIDYEDTFSPVVKAATIRIILSLAVSKGWSLRQLDVQ  1048



>emb|CAN83392.1| hypothetical protein VITISV_041406 [Vitis vinifera]
Length=1262

 Score =   150 bits (378),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 74/172 (43%), Positives = 108/172 (63%), Gaps = 10/172 (6%)
 Frame = +2

Query  38   PASLP-EQEPHEPSVKPAKRPHGRPRGKSVKSTVRTHEMSTRSRSQA-PPSALTVQVCPS  211
            P ++P      EP+     RP   P+        + H M TRS++    P   TV +   
Sbjct  694  PGTIPLSTNSDEPNESINTRPVTXPQ--------QPHHMVTRSKNGIFKPXVYTVDLNVE  745

Query  212  DPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIG  391
            +P  + +A+ + +W+EAMD+EF AL++N+TW LV        +GC+W F+ KR  DGS+ 
Sbjct  746  EPNTFQEAISHPKWKEAMDEEFRALMKNKTWSLVSLPTNRTSVGCRWVFKLKRNPDGSVS  805

Query  392  RHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
            R+KARLVAKG++QVPG D ++TFSPVVKPTT+R++L +A+S  W +RQLDV 
Sbjct  806  RYKARLVAKGYSQVPGFDFYETFSPVVKPTTIRVVLAIAVSQSWCIRQLDVN  857



>emb|CAN83798.1| hypothetical protein VITISV_039072 [Vitis vinifera]
Length=787

 Score =   149 bits (375),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 98/157 (62%), Gaps = 7/157 (4%)
 Frame = +2

Query  98   HGRPRGKSVKSTVRTHEMSTRSRSQA-PPSALTVQVCPS------DPTCYIQAVKYLEWR  256
            H R    + K  V TH M TRS+++   P  L      S      +PT Y QA ++  WR
Sbjct  399  HNRLGHPAPKGPVNTHPMVTRSKARIYKPKLLLADYGASSELDLFEPTTYHQAARHAHWR  458

Query  257  EAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVP  436
            +AMD EF ALL N TW LVP   G  +IGCKW F+ K K DGS+  +KARLVAKGF+Q  
Sbjct  459  QAMDTEFYALLNNNTWTLVPPTLGQKVIGCKWVFKIKLKPDGSVECYKARLVAKGFHQTH  518

Query  437  GQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
            G D F+TFSP+VKPTT+R++L LAL+  W ++ LDV 
Sbjct  519  GLDYFETFSPIVKPTTIRIVLSLALTFYWSLKHLDVH  555



>gb|AAX95627.1| Reverse transcriptase (RNA-dependent DNA polymerase), putative 
[Oryza sativa Japonica Group]
 gb|ABF97135.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=330

 Score =   144 bits (362),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 90/126 (71%), Gaps = 0/126 (0%)
 Frame = +2

Query  212  DPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIG  391
            +P    +A+    W+EAMD E++A+++N+TWHLVP + G+N+I CKW ++ KRKADGS+ 
Sbjct  44   EPQTLDEALGDKHWKEAMDSEYHAVMKNKTWHLVPPKRGLNVIDCKWVYKIKRKADGSLD  103

Query  392  RHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ**AYLGQI  571
            R+KARLVAKGF Q  G D  DTFSP+VK  T+R +L +A+S GW +RQLDVQ   + G +
Sbjct  104  RYKARLVAKGFKQRYGIDYEDTFSPIVKAATIRTILSIAVSRGWTLRQLDVQNAFFHGIL  163

Query  572  HSNFQI  589
               F +
Sbjct  164  EEEFYM  169



>gb|AAU90288.2| Polyprotein, putative [Solanum demissum]
Length=1017

 Score =   149 bits (375),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 85/111 (77%), Gaps = 0/111 (0%)
 Frame = +2

Query  212  DPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIG  391
            +P+C+ +A+K + WR AM +E+NAL+QN TW LVP     NIIGCKW F+ K K+DGS+ 
Sbjct  635  EPSCHSRAIKDVHWRHAMSEEYNALIQNGTWELVPLSPSQNIIGCKWVFKRKLKSDGSLD  694

Query  392  RHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDV  544
            R+KARLVAKG++Q PG D  DTFSPVVKP T+RLLL LA+S  W V QLD+
Sbjct  695  RYKARLVAKGYHQRPGLDFADTFSPVVKPATIRLLLSLAVSHQWHVTQLDI  745



>gb|AAV44026.1| hypothetical protein [Oryza sativa Japonica Group]
Length=760

 Score =   147 bits (371),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 84/116 (72%), Gaps = 0/116 (0%)
 Frame = +2

Query  200  VCPSDPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKAD  379
            V  S+PT    A+    W+  MD EFNAL +N+TWHLVPS +G NII CKW ++ K+KAD
Sbjct  537  VTTSEPTSLYDAMNNSNWKATMDSEFNALQKNKTWHLVPSTSGKNIIDCKWVYKIKKKAD  596

Query  380  GSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
            GSI R+KARLVAKGF Q  G D  DTFSPVVK  T+R++L + +S GW +RQLDVQ
Sbjct  597  GSIDRYKARLVAKGFKQRYGIDYEDTFSPVVKVATIRVILSIVVSKGWSLRQLDVQ  652



>emb|CAN71108.1| hypothetical protein VITISV_001478 [Vitis vinifera]
Length=1354

 Score =   149 bits (375),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 98/142 (69%), Gaps = 7/142 (5%)
 Frame = +2

Query  143  HEMSTRSRSQA--PPSALTVQVC-----PSDPTCYIQAVKYLEWREAMDQEFNALLQNQT  301
            H M+TR+++    P   L +         + PT   QA+K   WR+AM  E++AL++N T
Sbjct  815  HRMTTRAKNNITKPIQKLNLHTHKPTFQTTTPTSISQALKDQNWRQAMSDEYDALVRNGT  874

Query  302  WHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKPT  481
            W LVP +   N++GCKW FR KR +DGSI R+KARLVAKGF+Q PG D  +TFSPVVKPT
Sbjct  875  WELVPPEDITNLVGCKWIFRIKRNSDGSIDRYKARLVAKGFHQRPGVDYHETFSPVVKPT  934

Query  482  TVRLLLYLALSSGWIVRQLDVQ  547
            TVRL+L +A+S+GW +RQLDV 
Sbjct  935  TVRLVLSIAVSNGWSLRQLDVN  956



>ref|XP_010240794.1| PREDICTED: uncharacterized protein LOC104585563 [Brachypodium 
distachyon]
Length=295

 Score =   142 bits (357),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 88/117 (75%), Gaps = 1/117 (1%)
 Frame = +2

Query  200  VCPS-DPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKA  376
            VC + +P     A++   W++AMD+E++AL++N+TWHLVP+  G NII CKW +R KRKA
Sbjct  167  VCNACEPDGLQDALEDENWKKAMDEEYDALMRNKTWHLVPTNQGKNIIDCKWVYRIKRKA  226

Query  377  DGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
            +G+I R+KARLVAKGF Q  G D  DTFSPV K  T+RL++ +A+S GW +RQLDVQ
Sbjct  227  NGTIDRYKARLVAKGFKQRYGIDYEDTFSPVGKAATIRLVIAIAVSKGWDLRQLDVQ  283



>gb|AAK02020.2|AC074283_1 Putative gag-pol polyprotein [Oryza sativa]
 gb|AAP52036.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1058

 Score =   147 bits (372),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 85/116 (73%), Gaps = 0/116 (0%)
 Frame = +2

Query  200  VCPSDPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKAD  379
            V   +P    +A+K   W+ AMD+EF AL+ N+TWHLVP Q G+NII CKW ++ KRKAD
Sbjct  569  VSTEEPGNLHEALKNKHWKLAMDKEFEALVHNKTWHLVPPQKGVNIIDCKWVYKVKRKAD  628

Query  380  GSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
             SI R+KARLVAKGF Q  G D  DTFSP+VK  T+RL+L LA+S GW +RQLDVQ
Sbjct  629  ESIDRYKARLVAKGFKQRYGIDYEDTFSPIVKAATIRLVLSLAVSQGWSLRQLDVQ  684



>ref|XP_010273170.1| PREDICTED: uncharacterized protein LOC104608783 [Nelumbo nucifera]
Length=602

 Score =   145 bits (365),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 75/168 (45%), Positives = 107/168 (64%), Gaps = 10/168 (6%)
 Frame = +2

Query  74   SVKPAKRPHGRPRGKSVK-----STVRTHEMSTRSRSQA-PPSALTVQVCP----SDPTC  223
            ++ P++   G     SV+     S++ T+ M TRS++    P +      P     +PT 
Sbjct  315  TLMPSQAADGSLSSSSVRYAAPPSSLNTYPMVTRSKAGIFKPISYIASAHPLPPDVEPTH  374

Query  224  YIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKA  403
            +  A K+ +WR+AM  EF+AL +N TW LVP Q+ MN++GCKW FR K   +GSI R+KA
Sbjct  375  FSSAYKHPKWRDAMHAEFDALKKNDTWVLVPRQSYMNLVGCKWVFRLKHNPNGSISRYKA  434

Query  404  RLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
            RLVAKGFNQ  G D  +TFSPVVKPTT+R++L + +S  W ++QLD+Q
Sbjct  435  RLVAKGFNQREGLDYHETFSPVVKPTTIRVILSVVVSKNWDIKQLDIQ  482



>emb|CAN78448.1| hypothetical protein VITISV_026811 [Vitis vinifera]
Length=447

 Score =   144 bits (362),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 64/134 (48%), Positives = 94/134 (70%), Gaps = 1/134 (1%)
 Frame = +2

Query  149  MSTRSRSQA-PPSALTVQVCPSDPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQA  325
            M TRS++    P   TV +   +P  + +A+ + +W+EAM++EF AL++N+TW LV    
Sbjct  1    MVTRSKNGIFKPKVYTVDLNVEEPNTFQEAISHPKWKEAMNEEFRALMKNKTWSLVSFPT  60

Query  326  GMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYL  505
                +GCKW F+ KR  DGS+ R+KARLVAK ++QVPG D ++TFSP+VKPTT+R++L +
Sbjct  61   NRTSVGCKWVFKLKRNLDGSVSRYKARLVAKSYSQVPGFDFYETFSPIVKPTTIRVVLAI  120

Query  506  ALSSGWIVRQLDVQ  547
            A+S  W +RQLDV 
Sbjct  121  AVSQSWSIRQLDVN  134



>ref|XP_004972082.1| PREDICTED: uncharacterized protein LOC101752886 [Setaria italica]
Length=687

 Score =   145 bits (366),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 84/112 (75%), Gaps = 0/112 (0%)
 Frame = +2

Query  212  DPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIG  391
            +P    +A+   EW+ AMD E+ AL++NQTWHLVP + G+NII CKW ++ KRKADGS+ 
Sbjct  455  EPQNLDEALNNKEWKSAMDAEYEALIRNQTWHLVPPRKGINIIDCKWVYKIKRKADGSLD  514

Query  392  RHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
            R+KARLVAKGF Q  G D  DTFSPV+K  T+R +L +A+S GW +RQLDVQ
Sbjct  515  RYKARLVAKGFKQRYGVDYEDTFSPVIKHATIRTILSIAVSRGWSLRQLDVQ  566



>emb|CAN78451.1| hypothetical protein VITISV_005945 [Vitis vinifera]
Length=773

 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 71/136 (52%), Positives = 92/136 (68%), Gaps = 0/136 (0%)
 Frame = +2

Query  140  THEMSTRSRSQAPPSALTVQVCPSDPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPS  319
            TH M TR++S        +    ++P  Y QA K   W +AM+ E+ ALL+N TW LVP 
Sbjct  181  THPMVTRAKSGIHKKRSFIVQHTTEPRTYSQAFKNDSWVQAMNSEYQALLRNNTWSLVPP  240

Query  320  QAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLL  499
             +  +I+GC+W ++ K + DGSI RHKARLVA+GF Q PG D FDTFSPVVKP T+RL+L
Sbjct  241  PSSAHIVGCRWIYKLKYRPDGSIDRHKARLVAQGFTQTPGIDYFDTFSPVVKPCTIRLIL  300

Query  500  YLALSSGWIVRQLDVQ  547
             LA+S  W VRQLDV+
Sbjct  301  ALAVSFQWSVRQLDVE  316



>ref|XP_009359358.1| PREDICTED: uncharacterized protein LOC103949948 [Pyrus x bretschneideri]
Length=1243

 Score =   147 bits (371),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 101/148 (68%), Gaps = 6/148 (4%)
 Frame = +2

Query  122  VKSTVRTHEMSTRSRS---QAPPSA---LTVQVCPSDPTCYIQAVKYLEWREAMDQEFNA  283
            V ++   H ++TRS+S   +  P     LTV   P +PTC+ QA+K  EWR AM QEFNA
Sbjct  491  VAASGSQHVITTRSKSGIHKPNPKYVMHLTVDKFPVEPTCFSQAIKSQEWRNAMVQEFNA  550

Query  284  LLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFS  463
            L +  TW LVP  + MN++  KW F+ KR+ADGS+ RHKARLVA GF+Q  G D  +TFS
Sbjct  551  LQKCGTWTLVPYHSKMNLLPNKWVFKVKRRADGSVERHKARLVANGFHQQAGVDYGETFS  610

Query  464  PVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
            PVVK +T+RL+L LA+S  W VRQLDVQ
Sbjct  611  PVVKHSTIRLVLSLAVSHRWPVRQLDVQ  638



>ref|XP_008222569.1| PREDICTED: uncharacterized protein LOC103322432 [Prunus mume]
Length=465

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 85/112 (76%), Gaps = 0/112 (0%)
 Frame = +2

Query  212  DPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIG  391
            +PT + QA +   WR AM  E++AL++NQTW LVP+ + MNI+GCKW F+ KRKADGSI 
Sbjct  330  EPTSFTQASQSTHWRAAMKDEYDALMRNQTWSLVPATSSMNIVGCKWVFKVKRKADGSID  389

Query  392  RHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
            R+KA L+AK FNQ  G D  +TFSPVVKP T+R +L +A+S  W+++QLDV+
Sbjct  390  RYKALLIAKRFNQKEGFDYEETFSPVVKPATIRTILSIAVSYNWLLQQLDVR  441



>gb|AAW56918.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1018

 Score =   146 bits (369),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = +2

Query  251  WREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQ  430
            WREAMD E+ AL++NQTWHLVP Q G NII CKW ++ KRKADGS+ R+KARLVAKGF Q
Sbjct  570  WREAMDAEYQALMKNQTWHLVPPQQGRNIIDCKWVYKVKRKADGSLDRYKARLVAKGFKQ  629

Query  431  VPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
              G D  DTFSPVVK TT+R +L + +S GW +RQLDVQ
Sbjct  630  RYGIDYEDTFSPVVKATTIRTILSITVSRGWSLRQLDVQ  668



>ref|XP_008240661.1| PREDICTED: uncharacterized protein LOC103339149 [Prunus mume]
Length=934

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 81/156 (52%), Positives = 105/156 (67%), Gaps = 8/156 (5%)
 Frame = +2

Query  98   HGRPRGKSVKSTVRTHEMSTRSRS----QAPPSALTVQVCPS--DPTCYIQAVKYLEWRE  259
            HG P   S + +++   M+TRS+S    + P  AL V +  S  +PTCY QA K+ EWR 
Sbjct  533  HGAP--SSNQQSIQPPRMTTRSQSGIHKRNPKYALHVNIDHSLVEPTCYSQAFKHHEWRN  590

Query  260  AMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPG  439
            AM  EFNAL +  TW LVP    MN++  KW F+ K++ADGSI R+KARLVA GF+Q PG
Sbjct  591  AMVHEFNALQRCGTWKLVPYHPQMNLLPNKWVFKLKQRADGSIERYKARLVANGFHQKPG  650

Query  440  QDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
             D  +TFSPVVK +T+RL+L LA+S  W +RQLDVQ
Sbjct  651  IDYTETFSPVVKHSTIRLVLSLAVSKRWPIRQLDVQ  686



>emb|CAN66999.1| hypothetical protein VITISV_019171 [Vitis vinifera]
Length=955

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/136 (48%), Positives = 94/136 (69%), Gaps = 1/136 (1%)
 Frame = +2

Query  143  HEMSTRSRSQA-PPSALTVQVCPSDPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPS  319
            H M TRS++    P   TV +   +P  + +A+ + +W+EAMD+EF AL++N+TW LV  
Sbjct  513  HHMVTRSKNGIFKPKVYTVDLNVEEPNTFQEAISHPKWKEAMDEEFRALMKNKTWSLVSL  572

Query  320  QAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLL  499
                  +GC+W F+ KR  DGS+ R+KARLVAKG++QVPG D ++TFS VVKPTT+R++L
Sbjct  573  PTNRTSVGCRWVFKLKRNPDGSVSRYKARLVAKGYSQVPGFDFYETFSXVVKPTTIRVVL  632

Query  500  YLALSSGWIVRQLDVQ  547
             + +S  W +RQLDV 
Sbjct  633  XIVVSQSWFIRQLDVN  648



>emb|CAN79148.1| hypothetical protein VITISV_004343 [Vitis vinifera]
Length=1334

 Score =   146 bits (368),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 71/137 (52%), Positives = 92/137 (67%), Gaps = 0/137 (0%)
 Frame = +2

Query  137  RTHEMSTRSRSQAPPSALTVQVCPSDPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVP  316
             TH M TR++S        +    ++P  Y QA K   W +AM+ E+ ALL+N TW LVP
Sbjct  833  NTHPMVTRAKSGIHKKRSFIVQHTTEPRTYSQAXKNDSWVQAMNSEYQALLRNNTWSLVP  892

Query  317  SQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLL  496
              +  +I+GC+W ++ K + DGSI RHKARLVA+GF Q PG D FDTFSPVVKP T+RL+
Sbjct  893  PPSSAHIVGCRWIYKLKYRPDGSIDRHKARLVAQGFTQTPGIDYFDTFSPVVKPCTIRLI  952

Query  497  LYLALSSGWIVRQLDVQ  547
            L LA+S  W VRQLDV+
Sbjct  953  LALAVSFQWSVRQLDVE  969



>ref|XP_008385226.1| PREDICTED: uncharacterized protein LOC103447800 [Malus domestica]
Length=1042

 Score =   145 bits (367),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 74/146 (51%), Positives = 93/146 (64%), Gaps = 7/146 (5%)
 Frame = +2

Query  128  STVRTHEMSTRSRSQA-PPSALTVQ------VCPSDPTCYIQAVKYLEWREAMDQEFNAL  286
            S V  H M TRS++    P A T        V  S P+ Y+QA K+  WR AM  E+NAL
Sbjct  682  SMVNIHPMVTRSKAGIYKPKAYTATKHPLSVVMDSVPSTYLQASKFPHWRAAMQDEYNAL  741

Query  287  LQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSP  466
            L   TW LVPS +  NI+GCKW FR K+K DG++ R+KARLVAKGF+Q  G D  +TFSP
Sbjct  742  LSTGTWSLVPSNSSQNIVGCKWVFRVKQKPDGTVDRYKARLVAKGFHQQQGIDFQETFSP  801

Query  467  VVKPTTVRLLLYLALSSGWIVRQLDV  544
            V KP T+R+LL LA+   W + QLD+
Sbjct  802  VAKPVTIRILLSLAVQHNWFLNQLDI  827



>ref|NP_001175678.1| Os08g0544300 [Oryza sativa Japonica Group]
 dbj|BAH94406.1| Os08g0544300 [Oryza sativa Japonica Group]
Length=821

 Score =   145 bits (365),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 84/112 (75%), Gaps = 0/112 (0%)
 Frame = +2

Query  212  DPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIG  391
            +P    +AV    W+EAMD E+ AL++N+TWHLVP Q G N+I CKW ++ KRKADGS+ 
Sbjct  306  EPQSLEEAVNNKHWKEAMDAEYMALIENKTWHLVPPQKGRNVIDCKWVYKVKRKADGSLD  365

Query  392  RHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
            R+KARLVAKGF Q  G D  DTFSPVVK  T+R++L LA+S GW +RQLDV+
Sbjct  366  RYKARLVAKGFKQRYGIDYEDTFSPVVKAATIRIVLSLAVSRGWSLRQLDVK  417



>emb|CAN82610.1| hypothetical protein VITISV_021745 [Vitis vinifera]
Length=751

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 93/137 (68%), Gaps = 0/137 (0%)
 Frame = +2

Query  137  RTHEMSTRSRSQAPPSALTVQVCPSDPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVP  316
             TH M TR++S        +    ++P  Y QA K   W +AM++E+ ALL+N TW LVP
Sbjct  506  NTHPMVTRAKSGIHKKRSFIVQHTTEPRTYSQASKNDSWVQAMNREYQALLRNNTWSLVP  565

Query  317  SQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLL  496
              +  +I+GC+W ++ K + +GSI RHKARLVA+GF Q PG D FDTFSPVVKP T+RL+
Sbjct  566  PPSSAHIVGCRWIYKLKYRPNGSIDRHKARLVAQGFTQTPGIDYFDTFSPVVKPCTIRLI  625

Query  497  LYLALSSGWIVRQLDVQ  547
            L LA+S  W VRQLDV+
Sbjct  626  LALAVSFQWSVRQLDVE  642



>emb|CAN73924.1| hypothetical protein VITISV_041509 [Vitis vinifera]
Length=1434

 Score =   146 bits (368),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 71/136 (52%), Positives = 92/136 (68%), Gaps = 0/136 (0%)
 Frame = +2

Query  140  THEMSTRSRSQAPPSALTVQVCPSDPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPS  319
            TH M TR++S        +    ++P  Y QA K   W +AM+ E+ ALL+N TW LVP 
Sbjct  834  THPMVTRAKSGIHKKRSFIVQHTTEPRTYSQASKNDSWVQAMNSEYQALLRNNTWSLVPP  893

Query  320  QAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLL  499
             +  +I+GC+W ++ K + DGSI RHKARLVA+GF Q PG D FDTFSPVVKP T+RL+L
Sbjct  894  PSSAHIVGCRWIYKLKYRPDGSIDRHKARLVAQGFTQTPGIDYFDTFSPVVKPCTIRLIL  953

Query  500  YLALSSGWIVRQLDVQ  547
             LA+S  W VRQLDV+
Sbjct  954  ALAVSFQWSVRQLDVE  969



>gb|AAN06870.1| Putative gag-pol polyprotein [Oryza sativa Japonica Group]
 gb|ABF94109.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1247

 Score =   145 bits (367),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 79/180 (44%), Positives = 107/180 (59%), Gaps = 12/180 (7%)
 Frame = +2

Query  8    PSSLLHTANEPASLPEQEPHEPSVKPAKRPHGRPRGKSVKSTVRTHEMSTRSRSQAPPSA  187
            PS+ L  +       +Q+ H    +PA R         ++S +R  ++ T    +   + 
Sbjct  682  PSTSLDASVAGEVDTQQQQHHVISRPATR---------LQSGIRKEKVYTDGTVKYRTTF  732

Query  188  LTVQVCPSDPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTK  367
            LTV     +P     A+K   W++AMD EF AL  N+TWHLVP Q G N+I CKW ++ K
Sbjct  733  LTV---TGEPENLDDALKDNNWKKAMDAEFMALQNNKTWHLVPPQKGRNVIDCKWVYKIK  789

Query  368  RKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
            RK DGS+ R+KARLVAKGF Q  G D  DTFSPVVK  T+R++L +A+S GW +RQLDVQ
Sbjct  790  RKQDGSLDRYKARLVAKGFKQRYGIDYEDTFSPVVKAATIRIILSIAVSKGWCMRQLDVQ  849



>ref|XP_002442174.1| hypothetical protein SORBIDRAFT_08g015513 [Sorghum bicolor]
 gb|EES16012.1| hypothetical protein SORBIDRAFT_08g015513 [Sorghum bicolor]
Length=757

 Score =   144 bits (363),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 88/121 (73%), Gaps = 0/121 (0%)
 Frame = +2

Query  185  ALTVQVCPSDPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRT  364
             +      ++PT   +A+   +W EAMD E +ALL+N+TW LVP   G NIIGCKW ++ 
Sbjct  247  GMLANTADTEPTTVERALSDPKWVEAMDVEHDALLRNKTWKLVPRPRGENIIGCKWLYKV  306

Query  365  KRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDV  544
            KR+ADGS+ R+KARLVAKGF Q  G D  DTFSPVVK  T+RL+L +A+S+GW++RQLDV
Sbjct  307  KRRADGSVDRYKARLVAKGFKQRYGIDYEDTFSPVVKAATIRLILSIAVSNGWLLRQLDV  366

Query  545  Q  547
            Q
Sbjct  367  Q  367



>ref|XP_008341155.1| PREDICTED: uncharacterized protein LOC103404078 [Malus domestica]
Length=986

 Score =   145 bits (365),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 78/175 (45%), Positives = 105/175 (60%), Gaps = 2/175 (1%)
 Frame = +2

Query  26   TANEPASLPEQEPHEPSVK-PA-KRPHGRPRGKSVKSTVRTHEMSTRSRSQAPPSALTVQ  199
             A+  A+ P+  P  PSV  PA    + +P     K+ +   ++ T ++   P S  ++ 
Sbjct  103  NASTAATSPQSTPCLPSVTVPAPALSNSQPMITRAKAGIHKPKVFTATKHSLPASVDSIA  162

Query  200  VCPSDPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKAD  379
              PS PT ++QA K   W +AM  EF AL    TW LVP Q+ +N++GCKW FR K K D
Sbjct  163  CLPSTPTTFLQASKNPNWMQAMKDEFQALKSTGTWXLVPFQSHLNLVGCKWVFRLKHKPD  222

Query  380  GSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDV  544
            GSI R+KARLVAKGF+Q  G D  +TFSP  KPTT+ +LL +A+S  W V QLDV
Sbjct  223  GSIERYKARLVAKGFHQQEGLDFSETFSPXAKPTTIHILLSIAVSYDWFVHQLDV  277



>gb|ABA97008.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1202

 Score =   145 bits (365),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 84/112 (75%), Gaps = 0/112 (0%)
 Frame = +2

Query  212  DPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIG  391
            +P    +A+    W+EAMD E+ AL++N+TWHLVPS+ G NII CKW ++ K+KADGS+ 
Sbjct  785  EPQTLHEALGDKNWKEAMDSEYQALMKNKTWHLVPSKKGQNIIDCKWVYKVKQKADGSLD  844

Query  392  RHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
            R+KARLVAKGF Q  G D  DTFSPVVK  T+R +L +A+S GW +RQLDVQ
Sbjct  845  RYKARLVAKGFKQRYGIDYEDTFSPVVKAATIRTILSIAISRGWTLRQLDVQ  896



>gb|ABF95616.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1241

 Score =   145 bits (365),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +2

Query  230  QAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARL  409
            +AV    W+EAMD E+ AL++N+TWHLVP Q G N+I CKW ++ KRKADGS+ R+KARL
Sbjct  836  EAVNNKHWKEAMDAEYMALIENKTWHLVPPQKGRNVIDCKWVYKVKRKADGSLDRYKARL  895

Query  410  VAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
            VAKGF Q  G D  DTFSPVVK  T+R++L LA+S GW +RQLDV+
Sbjct  896  VAKGFKQRYGIDYEDTFSPVVKAATIRIVLSLAVSRGWSLRQLDVK  941



>emb|CAN71250.1| hypothetical protein VITISV_027849 [Vitis vinifera]
Length=445

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +2

Query  230  QAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARL  409
            QA+K  +WR+AM +E++AL++N TW LVPS +  NI+GCKW FRTKR +DGS+ RHKA L
Sbjct  3    QALKDPKWRQAMFEEYDALVRNGTWELVPSBSSHNIVGCKWIFRTKRHSDGSVDRHKAXL  62

Query  410  VAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
            VAKGF+Q P  D  DTFSPVVKPT  RL+L L +S GW +RQLDV 
Sbjct  63   VAKGFHQRPXIDYHDTFSPVVKPTXXRLVLSLVVSRGWSLRQLDVN  108



>gb|AAR88589.1| putative copia-like retrotransposon protein [Oryza sativa Japonica 
Group]
Length=1399

 Score =   144 bits (364),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +2

Query  230  QAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARL  409
            +AV    W+EAMD E+ AL++N+TWHLVP Q G N+I CKW ++ KRKADGS+ R+KARL
Sbjct  890  EAVNNKHWKEAMDAEYMALIENKTWHLVPPQKGRNVIDCKWVYKVKRKADGSLDRYKARL  949

Query  410  VAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
            VAKGF Q  G D  DTFSPVVK  T+R++L LA+S GW +RQLDV+
Sbjct  950  VAKGFKQRYGIDYEDTFSPVVKAATIRIVLSLAVSRGWSLRQLDVK  995



>gb|AAT07563.1| putative polyprotein [Oryza sativa Japonica Group]
 gb|AAT07631.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1431

 Score =   144 bits (363),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 84/112 (75%), Gaps = 0/112 (0%)
 Frame = +2

Query  212   DPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIG  391
             +P    +A+    W+EAMD E+ AL++N+TWHLVPS+ G NII CKW ++ KRKADGS+ 
Sbjct  923   EPQTLHEALGDKNWKEAMDSEYQALMKNKTWHLVPSKKGQNIIDCKWVYKVKRKADGSLD  982

Query  392   RHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
             R+KAR+VAKGF Q  G D  DTF+PVVK  T+R +L +A+S GW +RQLDVQ
Sbjct  983   RYKARVVAKGFKQRYGIDYEDTFNPVVKAATIRTILSIAISRGWTLRQLDVQ  1034



>emb|CAE04381.1| OSJNBa0027G07.23 [Oryza sativa Japonica Group]
 emb|CAE02562.2| OSJNBa0006M15.5 [Oryza sativa Japonica Group]
Length=472

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 80/112 (71%), Gaps = 0/112 (0%)
 Frame = +2

Query  212  DPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIG  391
            +P    +A     WREAMD E+ AL++NQTWHLVP Q G NII CKW ++ KRKA GS+ 
Sbjct  125  EPQSLDEAFATNHWREAMDAEYQALMKNQTWHLVPLQQGRNIIDCKWVYKVKRKAYGSLD  184

Query  392  RHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
            R+KARLVAKGF Q  G D  DTFS VVK TT+R +L +A+S GW  RQLDVQ
Sbjct  185  RYKARLVAKGFKQRYGIDYEDTFSHVVKATTIRTILSIAVSRGWSFRQLDVQ  236



>gb|KFK29449.1| hypothetical protein AALP_AA7G135900 [Arabis alpina]
Length=605

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 77/185 (42%), Positives = 107/185 (58%), Gaps = 8/185 (4%)
 Frame = +2

Query  2    FAPSSLLHTANEPASLPEQEPHE---PSVKPAKRPHGRPRGKSVKSTVRTHEMSTRSRSQ  172
            F   +  HT    A L  + P     PS+ P  R   + RGK+     R  +M+  + ++
Sbjct  58   FGAETAEHTTTARADLRAKRPKRARVPSIAPVNRHLMKTRGKNKIFKPRV-KMTLVAVAK  116

Query  173  APPSALTVQVCPSDPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKW  352
                + T      +P  Y QA+K   W   M +EF++LLQ+ TW L P     N++GC+W
Sbjct  117  NKAKSFT----DIEPNTYQQALKDPNWNGGMSEEFDSLLQHHTWDLTPRPKDHNVVGCRW  172

Query  353  AFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVR  532
             FR KR  +G+I R+KARLVAKGF+Q PG D FDTFSPV+KP ++RL+L LA+S  W +R
Sbjct  173  VFRLKRLPNGAIHRYKARLVAKGFHQRPGIDYFDTFSPVIKPPSIRLVLSLAVSRNWTLR  232

Query  533  QLDVQ  547
            QLDV 
Sbjct  233  QLDVN  237



>gb|ACY72569.1| unknown [Oryza sativa Japonica Group]
Length=1436

 Score =   144 bits (363),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 73/155 (47%), Positives = 99/155 (64%), Gaps = 10/155 (6%)
 Frame = +2

Query  83    PAKRPHGRPRGKSVKSTVRTHEMSTRSRSQAPPSALTVQVCPSDPTCYIQAVKYLEWREA  262
             PA RPH R R     S +R  ++ T    +      T      +P    +A+    W+ A
Sbjct  894   PAPRPHTRLR-----SGIRKEKVYTDGTVKYGCFTST-----GEPQNDKEALGDKNWKAA  943

Query  263   MDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQ  442
             M+ E++AL++N TWHLVP + G N+IGCKW ++ KRKADG++ R+KARLVAKGF Q  G 
Sbjct  944   MEAEYDALIKNDTWHLVPYEKGQNVIGCKWVYKIKRKADGTLDRYKARLVAKGFKQRYGI  1003

Query  443   DIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
             D  DTFSPVVK  T+R++L +A+S GW +RQLDVQ
Sbjct  1004  DYEDTFSPVVKAATIRIILSIAVSRGWSLRQLDVQ  1038



>emb|CAH66819.1| OSIGBa0093K19.6 [Oryza sativa Indica Group]
Length=472

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 80/112 (71%), Gaps = 0/112 (0%)
 Frame = +2

Query  212  DPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIG  391
            +P    +A     WREAMD E+ AL++NQTWHLVP Q G NII CKW ++ KRKA GS+ 
Sbjct  125  EPQSLDEAFATNHWREAMDAEYQALMKNQTWHLVPLQQGRNIIDCKWVYKVKRKAYGSLD  184

Query  392  RHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
            R+KARLVAKGF Q  G D  DTFS VVK TT+R +L +A+S GW  RQLDVQ
Sbjct  185  RYKARLVAKGFKQRYGIDYEDTFSHVVKATTIRTILSIAVSRGWSFRQLDVQ  236



>emb|CAN67403.1| hypothetical protein VITISV_025614 [Vitis vinifera]
Length=1271

 Score =   144 bits (362),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 92/135 (68%), Gaps = 0/135 (0%)
 Frame = +2

Query  143  HEMSTRSRSQAPPSALTVQVCPSDPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQ  322
            H M TR+++      +      S+PT + QAVK   W  AM++EF+AL +N TWHLVP  
Sbjct  688  HPMVTRAKNGISKKKVYFSSHISEPTTFTQAVKDSNWVLAMEKEFSALQRNNTWHLVPPP  747

Query  323  AGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLY  502
            +  NIIGCKW ++ K K DG++ R+KARLVA+GF Q  G + F+TFSPVVK +T+R++L 
Sbjct  748  SNGNIIGCKWVYKLKYKPDGTVDRYKARLVAQGFTQTLGLBYFETFSPVVKASTIRIILA  807

Query  503  LALSSGWIVRQLDVQ  547
            +ALS  W V QLDVQ
Sbjct  808  VALSFNWSVHQLDVQ  822



>gb|AAU43956.1| unknown protein [Oryza sativa Japonica Group]
 gb|AAU44069.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1447

 Score =   144 bits (362),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 77/174 (44%), Positives = 108/174 (62%), Gaps = 13/174 (7%)
 Frame = +2

Query  26    TANEPASLPEQEPHEPSVKPAKRPHGRPRGKSVKSTVRTHEMSTRSRSQAPPSALTVQVC  205
             +A+EP +  E+    PS     RP  R     ++  +R  ++ T    +   + LTV   
Sbjct  889   SASEPFATGEEVTQAPS-----RPTTR-----LQRGIRKEKVYTDGTVKYKNTFLTVTGE  938

Query  206   PSDPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGS  385
             P + T    A++   W++AMD E+ AL+ N+TWHLVP + G N+I CKW ++ KRK DGS
Sbjct  939   PKNLT---DALQNTNWKKAMDIEYEALMNNKTWHLVPPKQGRNVIDCKWVYKIKRKQDGS  995

Query  386   IGRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
             + R+KARLVAKGF Q  G D  DTFSPVVK  T+R++L +A+S GW +RQLDVQ
Sbjct  996   LDRYKARLVAKGFKQRYGIDYEDTFSPVVKAATIRIVLSIAVSRGWCMRQLDVQ  1049



>emb|CAN70817.1| hypothetical protein VITISV_029336 [Vitis vinifera]
Length=1044

 Score =   143 bits (360),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/143 (50%), Positives = 93/143 (65%), Gaps = 6/143 (4%)
 Frame = +2

Query  137  RTHEMSTRSRSQA--PPSALTVQV----CPSDPTCYIQAVKYLEWREAMDQEFNALLQNQ  298
            RTH M+TRS +    P    TV       P +PTC  QAV + EW EAM  E  AL+++ 
Sbjct  490  RTHSMTTRSMNNIFKPKQLHTVSKHYLPLPLEPTCVTQAVSHPEWXEAMSSELTALMRHG  549

Query  299  TWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKP  478
            TW L+P     + +GCKW FR KRK DGS+ + KARLVAKG+NQ PG D  +TFSPVVKP
Sbjct  550  TWDLIPPPINCHPVGCKWVFRVKRKVDGSVDKFKARLVAKGYNQQPGVDYNETFSPVVKP  609

Query  479  TTVRLLLYLALSSGWIVRQLDVQ  547
             T+R +L +A+ +GW ++Q+DV 
Sbjct  610  ATIRTMLSIAIMNGWPLKQMDVN  632



>gb|AAK53852.1|AC016781_6 Putative retroelement [Oryza sativa Japonica Group]
Length=920

 Score =   142 bits (359),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 90/126 (71%), Gaps = 0/126 (0%)
 Frame = +2

Query  212  DPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIG  391
            +P    +A+    W+EAMD E++A+++N+TWHLVP + G+N+I CKW ++ KRKADGS+ 
Sbjct  605  EPQTLDEALGDKHWKEAMDSEYHAVMKNKTWHLVPPKRGLNVIDCKWVYKIKRKADGSLD  664

Query  392  RHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ**AYLGQI  571
            R+KARLVAKGF Q  G D  DTFSP+VK  T+R +L +A+S GW +RQLDVQ   + G +
Sbjct  665  RYKARLVAKGFKQRYGIDYEDTFSPIVKAATIRTILSIAVSRGWTLRQLDVQNAFFHGIL  724

Query  572  HSNFQI  589
               F +
Sbjct  725  EEEFYM  730



>gb|AAK55460.1|AC069300_15 putative gag-pol polyprotein [Oryza sativa Japonica Group]
 gb|AAP54977.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1031

 Score =   142 bits (358),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 82/112 (73%), Gaps = 0/112 (0%)
 Frame = +2

Query  212  DPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIG  391
            +P    +A+    W+EAMD E+ AL++N+TWH VPS+ G NII CKW ++ KRKADGS+ 
Sbjct  523  EPQTLHEALGDKNWKEAMDSEYQALMKNKTWHRVPSKKGQNIIDCKWVYKVKRKADGSLD  582

Query  392  RHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
            R+KARLVAKGF Q  G D  DTF PVVK  T+R +L +A+S GW +RQLDVQ
Sbjct  583  RYKARLVAKGFKQRYGIDYEDTFRPVVKAATIRTILSIAISRGWTLRQLDVQ  634



>ref|XP_008351324.1| PREDICTED: uncharacterized protein LOC103414737 [Malus domestica]
Length=1269

 Score =   142 bits (359),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 70/142 (49%), Positives = 96/142 (68%), Gaps = 4/142 (3%)
 Frame = +2

Query  128   STVRTHEMSTRSRS----QAPPSALTVQVCPSDPTCYIQAVKYLEWREAMDQEFNALLQN  295
             + V +H + TRS+S    +    ++ VQ    +P  Y  A K  EWR AM++E +ALLQ 
Sbjct  1062  AAVNSHPIQTRSKSGIFKKKQAFSVEVQSGAQEPQSYSAACKLSEWRGAMEEEMDALLQQ  1121

Query  296   QTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVK  475
              TW LVP     N++GCKW ++ K+  DG++ R+KARLVAKGF+Q  G D ++TFSPVVK
Sbjct  1122  NTWTLVPLPPDKNLVGCKWIYKIKKHPDGTVARYKARLVAKGFSQEAGLDYYETFSPVVK  1181

Query  476   PTTVRLLLYLALSSGWIVRQLD  541
             PTT+RLLL LA S+GW ++QLD
Sbjct  1182  PTTMRLLLSLAASNGWKLKQLD  1203



>gb|ABA95721.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=900

 Score =   142 bits (357),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 84/112 (75%), Gaps = 0/112 (0%)
 Frame = +2

Query  212  DPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIG  391
            +P+   +A+    W++AMD+EF+ALL N+TWHLVP   G NII  KW ++ K+KADG+I 
Sbjct  383  EPSSLQEALSSANWKQAMDKEFSALLHNKTWHLVPPVKGKNIIDSKWVYKIKKKADGTID  442

Query  392  RHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
            R+KARLVAKGF Q  G D  DTFSPVVK  T+RL+L +A+S GW +RQLDVQ
Sbjct  443  RYKARLVAKGFKQRYGIDYEDTFSPVVKAATIRLVLSIAMSQGWSLRQLDVQ  494



>ref|XP_008364575.1| PREDICTED: uncharacterized protein LOC103428257 [Malus domestica]
Length=387

 Score =   137 bits (345),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 92/144 (64%), Gaps = 6/144 (4%)
 Frame = +2

Query  134  VRTHEMSTRSRSQA-PPSALTVQVCPS-----DPTCYIQAVKYLEWREAMDQEFNALLQN  295
            +  H M TRS+S      A   Q C       +P+ +    K ++W+ AM  E +ALLQ 
Sbjct  204  LNCHPMQTRSKSGIYKKKAFVAQQCSDSVFLKEPSTFQAXSKSVQWQAAMKDEMDALLQQ  263

Query  296  QTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVK  475
             TW LVP  + MN +GCKW ++ K+  DGS+ R KARLVAKGF+Q  G D ++TFSPVVK
Sbjct  264  HTWTLVPLPSHMNCVGCKWIYKLKKSPDGSVARFKARLVAKGFSQEAGLDYYETFSPVVK  323

Query  476  PTTVRLLLYLALSSGWIVRQLDVQ  547
            PTTV+L+L LA S GW ++QLDV+
Sbjct  324  PTTVQLILALAASYGWKLKQLDVK  347



>emb|CAN66863.1| hypothetical protein VITISV_013500 [Vitis vinifera]
Length=1112

 Score =   141 bits (356),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 82/110 (75%), Gaps = 0/110 (0%)
 Frame = +2

Query  212  DPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIG  391
            +PT   QA+K  +WR+AM  EF+ALL+N TW LVPS    N+ GCKW FRTK   +GSI 
Sbjct  617  EPTTVTQALKDPKWRQAMSAEFDALLRNGTWDLVPSHPXQNLXGCKWIFRTKYLPNGSID  676

Query  392  RHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLD  541
            R+KARLVAKGF+Q PG    +TFSPV+KPTTVRL+L LA+  GW +RQLD
Sbjct  677  RYKARLVAKGFHQXPGXXYSETFSPVIKPTTVRLVLSLAVXQGWSLRQLD  726



>ref|XP_008361413.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103425118 
[Malus domestica]
Length=785

 Score =   140 bits (354),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 78/110 (71%), Gaps = 0/110 (0%)
 Frame = +2

Query  215  PTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGR  394
            P  Y+QA KY  WR+AM  E+NALL   TW LVPS    NI+GCKW FR K+K +G++ R
Sbjct  359  PNTYLQASKYAHWRQAMQDEYNALLTTGTWSLVPSHHSQNIVGCKWVFRIKKKPNGTVDR  418

Query  395  HKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDV  544
            +KARLVAKGF+Q  G D  +TFSPV KP T+R+LL LA+   W + QLD+
Sbjct  419  YKARLVAKGFHQQEGIDFQETFSPVAKPVTIRILLTLAVQYNWFLNQLDI  468



>gb|ABA94335.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=404

 Score =   137 bits (345),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 77/106 (73%), Gaps = 0/106 (0%)
 Frame = +2

Query  230  QAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARL  409
            +A+    W+ AMD E+NAL+ N+TWHLVP   G NIIGCKW +  KRK+DG++ R+KARL
Sbjct  114  EALSNHNWKNAMDLEYNALMNNKTWHLVPPCKGHNIIGCKWVYEIKRKSDGTLDRYKARL  173

Query  410  VAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
            VAKGF Q  G D  DTFSPVVK   +R +L +A+S GW  RQLDVQ
Sbjct  174  VAKGFKQRYGIDYVDTFSPVVKAAIIRTILSIAVSRGWSFRQLDVQ  219



>ref|XP_008369089.1| PREDICTED: uncharacterized protein LOC103432662 [Malus domestica]
Length=1318

 Score =   142 bits (357),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 97/144 (67%), Gaps = 5/144 (3%)
 Frame = +2

Query  131  TVRTHEMSTRSRSQA--PPSALTVQV-CPS--DPTCYIQAVKYLEWREAMDQEFNALLQN  295
            +  +H M TRS+S+     +A   QV C S  +P+ Y  A K  EW++AM +E  AL Q 
Sbjct  839  SYNSHPMQTRSKSRIFKNKTAFPAQVQCDSIKEPSSYSVASKSPEWQQAMHEEMAALTQQ  898

Query  296  QTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVK  475
            QTW LVP     N++GCKW ++ KR  DGS+ R+KARLVAKGF+Q  G D ++TFSPVVK
Sbjct  899  QTWTLVPLPQNKNLVGCKWIYKVKRHPDGSVARYKARLVAKGFSQAAGLDYYETFSPVVK  958

Query  476  PTTVRLLLYLALSSGWIVRQLDVQ  547
            PTTVRLL  LA + GW ++QLDV+
Sbjct  959  PTTVRLLFSLAATYGWQLKQLDVK  982



>emb|CAN59963.1| hypothetical protein VITISV_022756 [Vitis vinifera]
Length=530

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 89/133 (67%), Gaps = 0/133 (0%)
 Frame = +2

Query  149  MSTRSRSQAPPSALTVQVCPSDPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAG  328
            M TR++S        +    ++   Y QA K   W +AM++E+ ALL+N TW LVP  + 
Sbjct  1    MVTRAKSGIHKKRSFIVQYTTELRTYSQASKNDSWVQAMNREYQALLRNNTWSLVPPPSS  60

Query  329  MNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLA  508
             +I+GC+W ++ K + DGSI RHKARLVA+GF Q PG D FDTFSPVVKP  +RL+L LA
Sbjct  61   AHIVGCRWIYKLKYRPDGSIDRHKARLVAQGFTQTPGIDYFDTFSPVVKPCIIRLILALA  120

Query  509  LSSGWIVRQLDVQ  547
            +S  W VRQLDV+
Sbjct  121  ISFQWXVRQLDVE  133



>gb|ABA99232.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=308

 Score =   135 bits (340),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 76/95 (80%), Gaps = 0/95 (0%)
 Frame = +2

Query  263  MDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQ  442
            MD+E+ AL++N TWHLVP+  G N+I CKW ++ KRKADG+I R+KARLVAKGF Q  G 
Sbjct  1    MDEEYGALMRNNTWHLVPATQGRNLIDCKWVYKIKRKADGTIDRYKARLVAKGFKQRYGI  60

Query  443  DIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
            D  +TFSPVVK  T+RL+L LA+S+GW +RQLDVQ
Sbjct  61   DYEETFSPVVKAATIRLILSLAVSNGWSLRQLDVQ  95



>gb|AAL31076.1|AC091749_5 putaive copia-like retrotransposon polyprotein, 5'-partial [Oryza 
sativa Japonica Group]
Length=491

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 72/175 (41%), Positives = 104/175 (59%), Gaps = 14/175 (8%)
 Frame = +2

Query  20   LHTANEPASLPEQEPHEPSVKPAKRPHGRPRGKSVKSTVRTHEMSTRSRSQAPPSALTVQ  199
            +H   E A+   ++    + KP  R         ++S +R  ++ T        S  T  
Sbjct  166  MHFGGEAATHATEDQSMVAAKPRTR---------LQSGIRKEKVYTDG--TVKYSCFT--  212

Query  200  VCPSDPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKAD  379
                +P    +A+    W+ AMD E+ AL++N+TWHLVP+++  N+I CKW ++ KRKAD
Sbjct  213  -SSGEPQNLHEALNDKNWKHAMDSEYTALMKNKTWHLVPAKSDRNVIDCKWVYKIKRKAD  271

Query  380  GSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDV  544
            GS+ R+KARLVAKGF Q  G D  DTFSPVVK  T+R++L +A+S GW +RQLDV
Sbjct  272  GSLDRYKARLVAKGFKQRYGIDYEDTFSPVVKAATIRVILSIAVSRGWSLRQLDV  326



>emb|CAN64509.1| hypothetical protein VITISV_041217 [Vitis vinifera]
Length=1269

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 82/112 (73%), Gaps = 0/112 (0%)
 Frame = +2

Query  212  DPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIG  391
            +PT   QA+K  +WR+A   EF+ LL+N TW LVPS    N++GCKW FRTK   +GSI 
Sbjct  812  EPTTVTQALKDPKWRQAXSAEFDXLLRNGTWDLVPSHPTQNLVGCKWIFRTKYLPNGSID  871

Query  392  RHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
            R+KARLVAKGF+Q PG D  +TFSP +KPTTVRL L LA+S GW +RQLDV 
Sbjct  872  RYKARLVAKGFHQRPGVDYSETFSPXIKPTTVRLXLSLAVSQGWSLRQLDVN  923



>emb|CAN63649.1| hypothetical protein VITISV_037657 [Vitis vinifera]
Length=1131

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/143 (49%), Positives = 95/143 (66%), Gaps = 10/143 (7%)
 Frame = +2

Query  143  HEMSTRSRSQ--------APPSALTVQVCPSDPTCYIQAVKYLEWREAMDQEFNALLQNQ  298
            H M+TR+++         +P   +   +C  +P  + +AVK  EW++AM  EF AL+ N+
Sbjct  728  HPMTTRAKNGIFKPKIFLSPTKTIFHPLC--EPNSFKEAVKVPEWQQAMHLEFEALMSNK  785

Query  299  TWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKP  478
            TW LVP     NIIGC W ++ K K DG++ R+KARLVAKGF+Q P  D F+TFSPVVKP
Sbjct  786  TWVLVPPPPNQNIIGCHWVYKLKYKPDGTVERYKARLVAKGFHQTPSFDYFETFSPVVKP  845

Query  479  TTVRLLLYLALSSGWIVRQLDVQ  547
            TT+R++L LALS  W +RQLDV 
Sbjct  846  TTIRVVLSLALSKNWSIRQLDVH  868



>emb|CAN71553.1| hypothetical protein VITISV_034738 [Vitis vinifera]
Length=1312

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 91/135 (67%), Gaps = 0/135 (0%)
 Frame = +2

Query  143  HEMSTRSRSQAPPSALTVQVCPSDPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQ  322
            H M TRS+S        +     +P    QA++   W+ AM+QE+ ALL+NQTW LVP  
Sbjct  775  HPMITRSKSGICKKKTYLTSLTIEPRTVKQALQDPNWKVAMEQEYQALLKNQTWSLVPPP  834

Query  323  AGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLY  502
            +   IIGCKW F+ K K +GSI R+KARLVA+GF+Q  G D F+TFSPVVKP T+RL+L 
Sbjct  835  SNAKIIGCKWVFKLKHKPNGSIDRYKARLVAQGFHQTYGIDFFETFSPVVKPCTIRLVLS  894

Query  503  LALSSGWIVRQLDVQ  547
            +A+SS W ++QLDV 
Sbjct  895  IAVSSNWPIKQLDVH  909



>ref|XP_006663342.1| PREDICTED: uncharacterized protein LOC102709321 [Oryza brachyantha]
Length=488

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/149 (47%), Positives = 94/149 (63%), Gaps = 4/149 (3%)
 Frame = +2

Query  101  GRPRGKSVKSTVRTHEMSTRSRSQAPPSALTVQVCPSDPTCYIQAVKYLEWREAMDQEFN  280
            G P  + ++S +R  ++      +   + LTV     +P      +K   W++AMD EF 
Sbjct  16   GEPENR-LQSGIRKEKIYMDGTVKYKTTFLTVT---GEPENLDDTLKDDNWKKAMDVEFM  71

Query  281  ALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTF  460
            AL  N+TWHLV  Q G N+I CKW ++ KRK DGS+ R+KARLVAKGF Q  G D  DTF
Sbjct  72   ALQNNKTWHLVQPQKGRNVIDCKWVYKIKRKQDGSLDRYKARLVAKGFKQRYGIDYEDTF  131

Query  461  SPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
            SPVVK  T+R++L +A+S GW +RQLDVQ
Sbjct  132  SPVVKAATIRIILSVAVSKGWCMRQLDVQ  160



>gb|KHN21230.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, 
partial [Glycine soja]
Length=1429

 Score =   141 bits (355),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/148 (50%), Positives = 94/148 (64%), Gaps = 2/148 (1%)
 Frame = +2

Query  143   HEMSTRSRSQ--APPSALTVQVCPSDPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVP  316
             H M TRS++    PP   T+ +  ++PT   QA+  + W EAM QE+ AL  N+TW LVP
Sbjct  890   HHMLTRSKTGHLKPPLFPTINLTTTEPTTVQQALSSIHWTEAMQQEYQALQANKTWSLVP  949

Query  317   SQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLL  496
                    IGCKW FR K   DG+I ++KARLVAKGFNQ  GQD  DT+SPVVKP TVR +
Sbjct  950   LPPHKRAIGCKWIFRIKENPDGTINKYKARLVAKGFNQKYGQDYSDTYSPVVKPITVRTV  1009

Query  497   LYLALSSGWIVRQLDVQ**AYLGQIHSN  580
             L +AL+S W + QLDV      GQ+H +
Sbjct  1010  LTIALTSKWPLIQLDVNNAFLNGQLHED  1037



>emb|CAN68480.1| hypothetical protein VITISV_007280 [Vitis vinifera]
Length=619

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 75/171 (44%), Positives = 106/171 (62%), Gaps = 15/171 (9%)
 Frame = +2

Query  62   PHE--PSVKPAKRPHGRPRGKSVKSTVRTHEMSTRSRSQA--PPSALTVQVC-----PSD  214
            PH+  P+++P       P  + V +    H M+TR+++    P   L +         S+
Sbjct  86   PHQLGPTLQP------EPASQQVSTPAPHHSMTTRAKNHITKPIQKLNLHTHLASFPSSE  139

Query  215  PTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGR  394
            PT   QA+K   W +AM +E++AL++N TW LV      N++GCKW FR KR +DGSI R
Sbjct  140  PTSVAQALKDSNWCKAMSEEYDALVRNGTWELVSPTGITNLVGCKWVFRIKRNSDGSIDR  199

Query  395  HKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
             KA LVAKGF+Q PG D  +TFSPV+KPTT+ L+L +A+S+GW +RQLDV 
Sbjct  200  FKACLVAKGFHQRPGVDYLETFSPVIKPTTMILVLSIAVSNGWSLRQLDVN  250



>gb|AAP94600.1| putative copia-like retrotransposon Hopscotch polyprotein [Zea 
mays]
Length=969

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 86/112 (77%), Gaps = 0/112 (0%)
 Frame = +2

Query  212  DPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIG  391
            +P    +A+  + W++AMD E++AL++N+TWHLVP + G N+IGCKW ++ KRKADGS+ 
Sbjct  804  EPYDLNEALGDVNWKDAMDIEYSALMKNKTWHLVPPKKGRNVIGCKWVYKIKRKADGSLD  863

Query  392  RHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
            R+KARLVAKG+ Q  G D  DTFSPVVK  T+R++L +A+S GW + QLDVQ
Sbjct  864  RYKARLVAKGYKQQYGIDYDDTFSPVVKHATIRIILSIAVSRGWSLCQLDVQ  915



>gb|ABG00000.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=2074

 Score =   141 bits (355),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 87/129 (67%), Gaps = 0/129 (0%)
 Frame = +2

Query  212   DPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIG  391
             +P    +A+    W++AMD EF ALL+N+TWHL+P   G N+I CKW ++ KRK+DGS+ 
Sbjct  1685  EPQNLDEALTDKNWKDAMDAEFTALLENKTWHLIPPSHGKNVIDCKWVYKIKRKSDGSLD  1744

Query  392   RHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ**AYLGQI  571
             R+KARLVAKGF Q  G D  DTFSPVVK  T+R +L +A+S GW +RQLDVQ     G +
Sbjct  1745  RYKARLVAKGFKQRYGIDYEDTFSPVVKAATIRTVLSIAVSRGWCLRQLDVQNAFLHGYL  1804

Query  572   HSNFQISYC  598
                 + S C
Sbjct  1805  EEEIEGSIC  1813



>gb|ABF96081.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1180

 Score =   140 bits (353),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 73/173 (42%), Positives = 98/173 (57%), Gaps = 18/173 (10%)
 Frame = +2

Query  35   EPASLPEQEPHEPSVKPAKRPHGRPRGKSV--KSTVRTHEMSTRSRSQAPPSALTVQVCP  208
            + +S P  EP  P+ +P  R     R + +    TV+   ++T                 
Sbjct  520  QGSSAPGGEPQRPATRPVTRLQKGIRKEKIYTDDTVKYGFLTT----------------T  563

Query  209  SDPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSI  388
             +P    +A+    W+ AMD EF ALL N+TWHLVP Q G N++ CKW ++ KRK DGS+
Sbjct  564  GEPRDLAEALHDTNWKHAMDAEFTALLHNKTWHLVPPQKGKNVMDCKWVYKIKRKQDGSL  623

Query  389  GRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
             R+K RLVAKG  Q  G D  DTFSPVVK  T+RL+L +A+S GW +RQLDV 
Sbjct  624  DRYKVRLVAKGIKQRYGIDYEDTFSPVVKAATIRLVLSIAVSRGWTLRQLDVH  676



>ref|XP_008342970.1| PREDICTED: uncharacterized protein LOC103405720 [Malus domestica]
Length=887

 Score =   139 bits (351),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 89/144 (62%), Gaps = 7/144 (5%)
 Frame = +2

Query  134  VRTHEMSTRSRSQA-PPSAL--TVQVCPSD----PTCYIQAVKYLEWREAMDQEFNALLQ  292
            + TH M TRS++    P A   T    P +    P+ Y+QA+KY  WR  M +EFNAL  
Sbjct  655  INTHXMLTRSKADIFKPKAYSATKHPLPIBVDFVPSTYLQALKYAHWRTXMQEEFNALQL  714

Query  293  NQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVV  472
              TW LVP     NI+GCKW FR KRK DG++ R+KA LVAKGF+Q  G +  DTFSPV 
Sbjct  715  TGTWTLVPPSQSQNIVGCKWVFRIKRKPDGTVDRYKAHLVAKGFHQQKGINYQDTFSPVA  774

Query  473  KPTTVRLLLYLALSSGWIVRQLDV  544
            KP T+RLLL L +   W + QLD+
Sbjct  775  KPVTIRLLLSLVVQFDWFLNQLDI  798



>emb|CCH50966.1| T4.5 [Malus x robusta]
Length=1670

 Score =   140 bits (353),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 70/150 (47%), Positives = 92/150 (61%), Gaps = 13/150 (9%)
 Frame = +2

Query  134   VRTHEMSTRSRS-------------QAPPSALTVQVCPSDPTCYIQAVKYLEWREAMDQE  274
             V TH M TR+++             Q P +  ++   P  P+ ++QA K   W EAM  E
Sbjct  1109  VNTHTMITRAKAGIHKPKVFTATKHQLPSTVDSLTALPPTPSTFLQASKSSHWMEAMQFE  1168

Query  275   FNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFD  454
             F AL    TW LVP+ +  NI+GCKW F+ K K DG+I R+KARLVAKGF+Q  G D  +
Sbjct  1169  FQALQSTGTWELVPNHSTYNIVGCKWVFKVKHKPDGTIERYKARLVAKGFHQQEGLDFSE  1228

Query  455   TFSPVVKPTTVRLLLYLALSSGWIVRQLDV  544
             TFSPV KPTT+R+LL +A+S  W + QLDV
Sbjct  1229  TFSPVAKPTTIRILLSIAVSYYWFIHQLDV  1258



>emb|CAN76947.1| hypothetical protein VITISV_017166 [Vitis vinifera]
Length=548

 Score =   137 bits (344),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 84/118 (71%), Gaps = 0/118 (0%)
 Frame = +2

Query  191  TVQVCPSDPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKR  370
            T+Q    +PTCY   VK+   REAM++EF+ALL N TW LVP     N++ CKW ++ KR
Sbjct  3    TIQPPEKEPTCYSTTVKHSNXREAMNKEFDALLANGTWTLVPKPXYANLVDCKWVYKIKR  62

Query  371  KADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDV  544
            K DG I R KA LVAKGF+Q  G D  +TFSPVVKPTT+R++L LA+S GW +RQ+D+
Sbjct  63   KXDGGIERFKACLVAKGFHQHEGVDFGETFSPVVKPTTIRMVLSLAVSRGWHLRQIDI  120



>ref|XP_008357860.1| PREDICTED: uncharacterized protein LOC103421593 [Malus domestica]
Length=1018

 Score =   139 bits (351),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 80/183 (44%), Positives = 102/183 (56%), Gaps = 11/183 (6%)
 Frame = +2

Query  62   PHEPSVKPAKRPHGRPRGKSVKSTVRTHEMSTRSRSQAPPSALTVQVCPS------DPTC  223
            P +P  +P   P   P       TV  H M TRS+S        V    S      +P+ 
Sbjct  531  PADPDFQPENLPIVLP-----VPTVSLHPMQTRSKSGIIKKKAFVASISSVGQSDVEPST  585

Query  224  YIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKA  403
            +  A K +EW+ AM  E +AL    TW LVP  +G N++GCKW +R K+  DGSI R+KA
Sbjct  586  FKAASKIVEWQSAMQDEIDALHAQHTWDLVPLPSGKNLVGCKWVYRVKKNPDGSIARYKA  645

Query  404  RLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ**AYLGQIHSNF  583
            RLVAKG+NQ  G D  +TFSPVVKPTTVRL+L LA    W +RQLDV+     G +H   
Sbjct  646  RLVAKGYNQEEGIDYGETFSPVVKPTTVRLILALAAQFRWSLRQLDVKNAFLHGDLHEEV  705

Query  584  QIS  592
             +S
Sbjct  706  YMS  708



>emb|CAN79733.1| hypothetical protein VITISV_016615 [Vitis vinifera]
Length=807

 Score =   139 bits (349),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 71/155 (46%), Positives = 99/155 (64%), Gaps = 7/155 (5%)
 Frame = +2

Query  104  RPRGKSVKSTVRTHEMSTRSRSQA--PPSALTVQV----CPS-DPTCYIQAVKYLEWREA  262
             P  + V +    H M+TR+++    P   L +       PS +PT   Q +K   WR+A
Sbjct  344  EPASQQVSTPAPRHSMTTRAKNHITKPIQKLNIHTHLASSPSFEPTSLAQVLKDSNWRKA  403

Query  263  MDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQ  442
            + +E++AL++N TW LV      N++GCKW F  KR +DGSI R KARLVAKGF+Q PG 
Sbjct  404  ISEEYDALVRNGTWELVSPTGITNLVGCKWVFCIKRNSDGSIERFKARLVAKGFHQRPGV  463

Query  443  DIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
            D  +TF+PV+KPTTVRL+L +A+S+GW + QLDV 
Sbjct  464  DYLETFNPVIKPTTVRLVLSIAISNGWSLHQLDVN  498



>gb|AAL66754.1|AF464738_5 putative copia-like retrotransposon Hopscotch polyprotein [Zea 
mays]
Length=1313

 Score =   140 bits (352),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 84/106 (79%), Gaps = 0/106 (0%)
 Frame = +2

Query  230  QAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARL  409
            +A+  + W++AMD E++AL++N+TWHLVP + G N+IGCKW ++ KRKADGS+ R+KARL
Sbjct  810  EALGDVNWKDAMDIEYSALMKNKTWHLVPPKKGRNVIGCKWVYKIKRKADGSLDRYKARL  869

Query  410  VAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
            VAKG+ Q  G D  DTFSPVVK  T+R++L +A+S GW + QLDVQ
Sbjct  870  VAKGYKQQYGIDYDDTFSPVVKHATIRIILSIAVSRGWSLCQLDVQ  915



>ref|XP_006579236.1| PREDICTED: uncharacterized protein LOC102665202 [Glycine max]
Length=1364

 Score =   139 bits (351),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 74/148 (50%), Positives = 94/148 (64%), Gaps = 2/148 (1%)
 Frame = +2

Query  143  HEMSTRSRSQ--APPSALTVQVCPSDPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVP  316
            H M TRS++    PP   T+ +  ++PT   QA+  + W EAM QE+ AL  N+TW LVP
Sbjct  133  HHMLTRSKTGHLKPPLFPTINLTTTEPTTVQQALSSIHWTEAMQQEYQALQANKTWSLVP  192

Query  317  SQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLL  496
                   IGCKW FR K   DG+I ++KARLVAKGFNQ  GQD  DT+SPVVKP TVR +
Sbjct  193  LPPHKRAIGCKWIFRIKENPDGTINKYKARLVAKGFNQKYGQDYSDTYSPVVKPITVRTV  252

Query  497  LYLALSSGWIVRQLDVQ**AYLGQIHSN  580
            L +AL+S W + QLDV      GQ+H +
Sbjct  253  LTIALTSKWPLIQLDVNNVFLNGQLHED  280



>gb|AAP53968.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=932

 Score =   139 bits (349),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 81/112 (72%), Gaps = 0/112 (0%)
 Frame = +2

Query  212  DPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIG  391
            +P    +A+    WR AM+QE++A + N+TWHLVP   G NII CKW ++ KRKADGSI 
Sbjct  425  EPENLREAMANSNWRLAMEQEYSAFMSNKTWHLVPPTQGKNIIDCKWMYKIKRKADGSID  484

Query  392  RHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
            R+KARLVAKGF Q  G D  DTFS VVK  T+RL+L +A+S GW +RQLDVQ
Sbjct  485  RYKARLVAKGFKQRYGIDYEDTFSLVVKAATIRLILSIAVSKGWSLRQLDVQ  536



>emb|CAN82221.1| hypothetical protein VITISV_015226 [Vitis vinifera]
Length=1007

 Score =   139 bits (350),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 66/135 (49%), Positives = 90/135 (67%), Gaps = 0/135 (0%)
 Frame = +2

Query  143  HEMSTRSRSQAPPSALTVQVCPSDPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQ  322
            H M TR+++      +      S+PT +  AVK   W  AM++EF+AL +N TWHLVP  
Sbjct  446  HPMVTRAKNGISKKKVYFSSHISEPTTFTXAVKDSNWVLAMEKEFSALQRNNTWHLVPPP  505

Query  323  AGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLY  502
            +  NII CKW ++ K K DG++ R+KARLVA+GF Q  G D F+TFSP+VK +T+R++L 
Sbjct  506  SNGNIIXCKWVYKLKYKPDGTVDRYKARLVAQGFTQTLGLDYFETFSPIVKASTIRIILV  565

Query  503  LALSSGWIVRQLDVQ  547
            +ALS  W V QLDVQ
Sbjct  566  VALSFNWSVHQLDVQ  580



>emb|CAN67819.1| hypothetical protein VITISV_041315 [Vitis vinifera]
Length=1242

 Score =   139 bits (350),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 63/136 (46%), Positives = 90/136 (66%), Gaps = 1/136 (1%)
 Frame = +2

Query  143   HEMSTRSRSQA-PPSALTVQVCPSDPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPS  319
             H M TRS++    P   T  +   +P  + +A+ + +W+EAMD+EF AL++N+TW  V  
Sbjct  968   HHMVTRSKNGIFKPKVYTFDLNVEEPNTFQEAISHPKWKEAMDEEFRALMKNKTWSFVSL  1027

Query  320   QAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLL  499
                   +GC+W F+ K   DGS+ RHKARLVAK ++QVPG D  +TFSPVVKPTT+R++L
Sbjct  1028  LTNRTYVGCRWVFKLKMYPDGSVSRHKARLVAKDYSQVPGFDFSETFSPVVKPTTIRVVL  1087

Query  500   YLALSSGWIVRQLDVQ  547
              + +S  W +RQLDV 
Sbjct  1088  AIVVSQSWSIRQLDVN  1103



>emb|CAN77529.1| hypothetical protein VITISV_041425 [Vitis vinifera]
Length=1047

 Score =   138 bits (348),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 66/138 (48%), Positives = 89/138 (64%), Gaps = 0/138 (0%)
 Frame = +2

Query  134  VRTHEMSTRSRSQAPPSALTVQVCPSDPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLV  313
            + TH M TR++S        +    S+P  Y QA K   W +AM  ++ AL  N TW LV
Sbjct  725  LNTHPMVTRAKSGIHKKKSFLMQTTSEPHTYSQAFKSEPWVQAMQHQYQALRHNHTWSLV  784

Query  314  PSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRL  493
            P     +I+GC+W ++ K  ++GS+ RHKARLVA+GF Q PG D FDTF+PVVKP T+RL
Sbjct  785  PPPPSAHIVGCRWIYKLKYLSNGSVERHKARLVAQGFTQTPGVDYFDTFNPVVKPCTIRL  844

Query  494  LLYLALSSGWIVRQLDVQ  547
            +L LA+S  W +RQLDV+
Sbjct  845  ILALAVSFQWPIRQLDVE  862



>gb|AAN04167.1| Putative copia-like retrotransposon polyprotein [Oryza sativa 
Japonica Group]
 gb|AAP53032.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1042

 Score =   138 bits (347),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 83/111 (75%), Gaps = 0/111 (0%)
 Frame = +2

Query  212  DPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIG  391
            +P    +A+    W+ AMD E+ AL++N+TWHLVP+++  N+I CKW ++ KRKADGS+ 
Sbjct  767  EPQNLHEALNDKNWKHAMDSEYTALMKNKTWHLVPAKSDRNVIDCKWVYKIKRKADGSLD  826

Query  392  RHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDV  544
            R+KARLVAKGF Q  G D  DTFSPVVK  T+R++L +A+S GW +RQLDV
Sbjct  827  RYKARLVAKGFKQRYGIDYEDTFSPVVKAATIRVILSIAVSRGWSLRQLDV  877



>emb|CAN68496.1| hypothetical protein VITISV_010947 [Vitis vinifera]
Length=1539

 Score =   139 bits (349),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/138 (49%), Positives = 89/138 (64%), Gaps = 0/138 (0%)
 Frame = +2

Query  134   VRTHEMSTRSRSQAPPSALTVQVCPSDPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLV  313
             + TH M TR +S        +    S+P  Y QA K   W +AM  E+ ALL+N TW LV
Sbjct  1007  LNTHPMVTRVKSGIHKKKSFLMQTTSEPHTYNQASKSEPWDQAMQHEYQALLRNHTWSLV  1066

Query  314   PSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRL  493
             P     +I+GC+W ++ K   +GS+ RHKARLVA+GF + PG D FDTFSP+VKP T+RL
Sbjct  1067  PPPPSAHIVGCRWIYKLKYLPNGSVERHKARLVAQGFTKTPGVDYFDTFSPIVKPCTIRL  1126

Query  494   LLYLALSSGWIVRQLDVQ  547
             +L LA+S  W +RQLDV+
Sbjct  1127  ILTLAVSFQWPIRQLDVE  1144



>ref|XP_008387250.1| PREDICTED: uncharacterized protein LOC103449699 [Malus domestica]
Length=1313

 Score =   138 bits (348),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 73/147 (50%), Positives = 90/147 (61%), Gaps = 9/147 (6%)
 Frame = +2

Query  134  VRTHEMSTRSRS---------QAPPSALTVQVCPSDPTCYIQAVKYLEWREAMDQEFNAL  286
            V  H M TRS+S          A  ++  V +  ++P  Y  A+K   W  AM +E NAL
Sbjct  764  VNLHPMQTRSKSGIVKKKVFFAAAHTSTVVDLTTTEPATYKSALKVPVWLNAMQEELNAL  823

Query  287  LQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSP  466
               +TW LV      N++GCKW F+ KR ADGSI RHKARLVAKGF+Q  G D  +TFSP
Sbjct  824  YSQKTWSLVDLPPNKNLVGCKWIFKVKRHADGSIARHKARLVAKGFSQEAGLDYGETFSP  883

Query  467  VVKPTTVRLLLYLALSSGWIVRQLDVQ  547
            VVKPTTVRL+L LA    W +RQLDV+
Sbjct  884  VVKPTTVRLILALAAHYNWPLRQLDVK  910



>gb|AAT85031.1| putative polyprotein [Oryza sativa Japonica Group]
 gb|ABF96679.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1437

 Score =   138 bits (347),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/168 (43%), Positives = 103/168 (61%), Gaps = 7/168 (4%)
 Frame = +2

Query  44    SLPEQEPHEPSVKPAKRPHGRPRGKSVKSTVRTHEMSTRSRSQAPPSALTVQVCPSDPTC  223
             S+   +PH P+     +   RPR + ++S +R  ++ T    +       +     +P  
Sbjct  873   SVAIDDPH-PATTVTGQEAQRPRTR-LQSGIRKEKVYTDGTVK-----WGMLTSTGEPEN  925

Query  224   YIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKA  403
                A++   W+ AMD E+ AL++N TWHLVP Q G N+I CKW ++ KRK DGS+ R+KA
Sbjct  926   LQDALQNNNWKCAMDAEYMALIKNNTWHLVPPQQGRNVIDCKWVYKIKRKQDGSLDRYKA  985

Query  404   RLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
             RLVAKGF Q  G D  DTFSPVVK  T+R++L +A+S GW +RQLDVQ
Sbjct  986   RLVAKGFKQRYGIDYEDTFSPVVKAATIRIILSIAVSRGWCLRQLDVQ  1033



>ref|YP_514636.1| hypothetical protein OrsaiPp07 [Oryza sativa Indica Group]
 ref|YP_003433855.1| hypothetical protein OrrupM_p18 [Oryza rufipogon]
 gb|AAZ99275.1| hypothetical protein (mitochondrion) [Oryza sativa Indica Group]
 gb|AAZ99329.1| hypothetical protein (mitochondrion) [Oryza sativa Japonica Group]
 gb|AAZ99382.1| hypothetical protein (mitochondrion) [Oryza sativa Japonica Group]
 dbj|BAI67959.1| hypothetical protein [Oryza rufipogon]
 dbj|BAI67987.1| hypothetical protein [Oryza sativa Indica Group]
 gb|AER12982.1| hypothetical protein (mitochondrion) [Oryza sativa Indica Group]
 gb|AER13050.1| hypothetical protein (mitochondrion) [Oryza sativa Indica Group]
 gb|AEZ03755.1| hypothetical protein (mitochondrion) [Oryza sativa Indica Group]
 gb|AEZ03764.1| hypothetical protein (mitochondrion) [Oryza sativa Indica Group]
 dbj|BAN67511.1| hypothetical protein (mitochondrion) [Oryza rufipogon]
 dbj|BAN67513.1| hypothetical protein (mitochondrion) [Oryza rufipogon]
Length=490

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 76/95 (80%), Gaps = 0/95 (0%)
 Frame = +2

Query  263  MDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQ  442
            MD+E+ AL++N TWHLVP+  G N+I CKW ++ KRKADG+I R+KARLVAKGF Q  G 
Sbjct  1    MDEEYGALMRNNTWHLVPATQGRNLIDCKWVYKIKRKADGTIDRYKARLVAKGFKQRYGI  60

Query  443  DIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
            D  +TFSPVVK  T+RL+L LA+S+GW +RQLDVQ
Sbjct  61   DYEETFSPVVKAATIRLILSLAVSNGWSLRQLDVQ  95



>ref|YP_002000554.1| orf490 [Oryza sativa Japonica Group]
 dbj|BAC19858.1| orf490 [Oryza sativa Japonica Group]
Length=490

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 76/95 (80%), Gaps = 0/95 (0%)
 Frame = +2

Query  263  MDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQ  442
            MD+E+ AL++N TWHLVP+  G N+I CKW ++ KRKADG+I R+KARLVAKGF Q  G 
Sbjct  1    MDEEYGALMRNNTWHLVPATQGRNLIDCKWVYKIKRKADGTIDRYKARLVAKGFKQRYGI  60

Query  443  DIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
            D  +TFSPVVK  T+RL+L LA+S+GW +RQLDVQ
Sbjct  61   DYEETFSPVVKAATIRLILSLAVSNGWSLRQLDVQ  95



>emb|CAN61640.1| hypothetical protein VITISV_021909 [Vitis vinifera]
Length=1361

 Score =   138 bits (347),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 91/135 (67%), Gaps = 4/135 (3%)
 Frame = +2

Query  143  HEMSTRSRSQAPPSALTVQVCPSDPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQ  322
            H M   S SQ   + L ++    +P  +  A K+ EW  AMD E +AL +N TW LVP  
Sbjct  820  HAMHISSSSQLFQAFLALK----EPRGFKSAAKHPEWLSAMDDEIHALKKNDTWVLVPRP  875

Query  323  AGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLY  502
               N++GC+W F+TK  +DGSI RHKARLVA+GF+QV G D  DTFSPVV+P TVR++L 
Sbjct  876  QHHNVVGCRWIFKTKLHSDGSIERHKARLVAQGFSQVHGLDFGDTFSPVVRPATVRIILS  935

Query  503  LALSSGWIVRQLDVQ  547
            LA++SGW + QLDV+
Sbjct  936  LAVTSGWRLHQLDVK  950



>ref|XP_008347066.1| PREDICTED: uncharacterized protein LOC103410073 [Malus domestica]
Length=923

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 84/127 (66%), Gaps = 5/127 (4%)
 Frame = +2

Query  179  PSALTVQVCPSD-----PTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIG  343
            P AL+    P D     PT Y+QA K+  W +AM +EF AL    TW LVPS    N++G
Sbjct  424  PKALSATKHPIDIDTFMPTTYLQASKHAYWVQAMSEEFEALRHTGTWTLVPSSPHQNLVG  483

Query  344  CKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGW  523
            CKW FR KRK DG+I R+KARLVAKGF+Q  G D  +TFSPV KP T+R+LL LA+ + W
Sbjct  484  CKWVFRIKRKPDGTIDRYKARLVAKGFHQQAGIDFTETFSPVAKPVTIRILLTLAVHNDW  543

Query  524  IVRQLDV  544
             + QLD+
Sbjct  544  FLNQLDI  550



>ref|XP_010655188.1| PREDICTED: uncharacterized protein LOC104880403 [Vitis vinifera]
Length=1040

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 81/112 (72%), Gaps = 0/112 (0%)
 Frame = +2

Query  212  DPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIG  391
            +P  + +AVK  EW++AM  EF AL+ N+TW LVP     NIIGC+W ++ K K DG++ 
Sbjct  521  EPNSFKEAVKVPEWQQAMHLEFEALMSNKTWVLVPPPPNQNIIGCRWVYKLKYKLDGTVE  580

Query  392  RHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
             +KARLVAKGF+Q PG D F+TFS VVKPTT+R++L LAL   W +RQLDV 
Sbjct  581  HYKARLVAKGFHQTPGFDYFETFSHVVKPTTIRVVLSLALCKNWSIRQLDVH  632



>ref|XP_006596648.1| PREDICTED: uncharacterized protein DDB_G0271670-like [Glycine 
max]
Length=444

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/136 (51%), Positives = 90/136 (66%), Gaps = 2/136 (1%)
 Frame = +2

Query  134  VRTHEMSTRSRSQAPPSAL--TVQVCPSDPTCYIQAVKYLEWREAMDQEFNALLQNQTWH  307
            + TH M TRS+S      L  ++    S+P    QA++  EW  AM +E+NAL++N+TW 
Sbjct  195  INTHPMQTRSKSGIHNLRLHPSLFFTDSEPKSVKQALESSEWFAAMQEEYNALMRNRTWD  254

Query  308  LVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTV  487
            LVP  AG   IG KW FR K  ADGSI R+KARLVAKGF+ V G D  +TFSPVVKP T+
Sbjct  255  LVPLPAGRQAIGYKWVFRIKENADGSINRYKARLVAKGFHLVHGFDFHETFSPVVKPITI  314

Query  488  RLLLYLALSSGWIVRQ  535
            R++L LALS G+ V +
Sbjct  315  RVVLTLALSQGFEVEE  330



>ref|XP_004295979.1| PREDICTED: uncharacterized mitochondrial protein AtMg00810-like 
[Fragaria vesca subsp. vesca]
Length=297

 Score =   132 bits (331),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 84/122 (69%), Gaps = 2/122 (2%)
 Frame = +2

Query  188  LTVQVCPS--DPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFR  361
            +   V P+  +PTC+ QA+K +EWREAM  EFNAL  + TW LVP +A MN++  KW F 
Sbjct  1    MVTSVVPTIIEPTCFSQAIKQVEWREAMATEFNALQVSGTWSLVPPKASMNVLPNKWVFC  60

Query  362  TKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLD  541
             KRK+DGSI  +KARLVA GF+Q  G D   TFSPVVK TT+R ++ LA    W +RQLD
Sbjct  61   IKRKSDGSIEWYKARLVANGFHQQEGIDYAKTFSPVVKHTTIRTVIALATHFNWPIRQLD  120

Query  542  VQ  547
            VQ
Sbjct  121  VQ  122



>gb|KFL89552.1| hypothetical protein AmDm5_1575 [Acetobacter malorum]
Length=1375

 Score =   137 bits (345),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 81/192 (42%), Positives = 107/192 (56%), Gaps = 10/192 (5%)
 Frame = +2

Query  44    SLPEQEPHEPSVKPAKRPHGRPRGKSVK---STVRTHEMSTRSRSQAPPSALTVQVCPS-  211
             ++P   P   S  PA  P  +P   ++     +V  H M TRS+S        V    S 
Sbjct  944   TVPASSPSTQSPVPAD-PDFQPENLTIVLPVHSVSLHPMQTRSKSGIIKKKAFVASISSV  1002

Query  212   -----DPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKA  376
                  +P+ +  A K +EW+ AM  E +AL    TW LVP  +G N++GCKW +R K+  
Sbjct  1003  GQSDVEPSTFKAASKIVEWQSAMQDEIDALHAQHTWDLVPLPSGKNLVGCKWVYRVKKNP  1062

Query  377   DGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ**A  556
             DGSI R+KARLVAKG+NQ  G D  +TFSPVVKPTTVRL+L LA    W +RQLDV+   
Sbjct  1063  DGSIARYKARLVAKGYNQEEGIDYGETFSPVVKPTTVRLILALAAQFRWSLRQLDVKNAF  1122

Query  557   YLGQIHSNFQIS  592
               G +H    +S
Sbjct  1123  LHGDLHEEMYMS  1134



>ref|XP_010525654.1| PREDICTED: uncharacterized protein LOC104803422 [Tarenaya hassleriana]
Length=580

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 77/105 (73%), Gaps = 0/105 (0%)
 Frame = +2

Query  233  AVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLV  412
            A+K L WR AM  E+NALL+N TW LVP+    N++GC+W FR K K DGS+ R K RLV
Sbjct  157  ALKDLRWRAAMSDEYNALLRNGTWTLVPATDAANVVGCRWVFRIKHKPDGSVDRFKVRLV  216

Query  413  AKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
            AKGF+Q P  D  +TFSPVVKPTT +++L LA+S GW +RQLDV 
Sbjct  217  AKGFHQRPDIDFHETFSPVVKPTTNQVVLSLAISRGWPLRQLDVN  261



>gb|EMT19664.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops 
tauschii]
Length=963

 Score =   136 bits (343),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 79/99 (80%), Gaps = 0/99 (0%)
 Frame = +2

Query  251  WREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQ  430
            WR AM+QE++AL++N+TW LVP  + +NII  KW F+ K+ ADGSI R+KARLVAKGF Q
Sbjct  6    WRAAMEQEYHALMKNKTWTLVPPPSRVNIIDSKWVFKVKKHADGSIERYKARLVAKGFKQ  65

Query  431  VPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
              G D  DTFSPVVKPTT+RLLL LA+S GW +RQLDVQ
Sbjct  66   RQGLDYEDTFSPVVKPTTIRLLLSLAVSRGWSLRQLDVQ  104



>emb|CAN67963.1| hypothetical protein VITISV_027812 [Vitis vinifera]
Length=396

 Score =   132 bits (333),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 61/150 (41%), Positives = 92/150 (61%), Gaps = 10/150 (7%)
 Frame = +2

Query  98   HGRPRGKSVKSTVRTHEMSTRSRSQAPPSALTVQVCPSDPTCYIQAVKYLEWREAMDQEF  277
            HGR +G           ++ + R  A  + L+    P +P C  QA+ Y  W+ +M++E+
Sbjct  90   HGRGKGN----------LNPQGRVYAALNPLSFSHGPIEPMCVKQALAYPNWKISMEEEY  139

Query  278  NALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDT  457
             AL++N TW LVP Q   N++G KW F+ K   DG++ +HKAR VAK F+Q PG D   T
Sbjct  140  KALMRNHTWDLVPYQPQYNVVGNKWVFKLKFHPDGTLNKHKARFVAKKFHQTPGVDFSIT  199

Query  458  FSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
            +SPV+KP T+R++L L ++ GW +RQLD+ 
Sbjct  200  YSPVIKPATIRVVLTLTIAQGWEIRQLDIN  229



>gb|KHN17953.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Glycine 
soja]
Length=1294

 Score =   137 bits (344),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 69/136 (51%), Positives = 88/136 (65%), Gaps = 5/136 (4%)
 Frame = +2

Query  155  TRSRSQA--PPSALTVQV---CPSDPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPS  319
            TRS++    P   L + V    P +P    QA++  +WR AM  EF+AL  N TW LV  
Sbjct  751  TRSKNNIIKPIQKLNLHVQASSPIEPNTITQALRDPDWRSAMQAEFDALHHNNTWDLVSR  810

Query  320  QAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLL  499
             +  N++GCKW FR KR  DGSI R+KARLVAKGF+Q  G D  +TFSPVVKP T+R++L
Sbjct  811  SSDQNLVGCKWVFRIKRNPDGSIDRYKARLVAKGFHQRSGWDYTETFSPVVKPVTIRIVL  870

Query  500  YLALSSGWIVRQLDVQ  547
             LA+  GW +RQLDV 
Sbjct  871  TLAVRQGWPIRQLDVN  886



>ref|XP_008375643.1| PREDICTED: uncharacterized protein LOC103438878 [Malus domestica]
Length=634

 Score =   134 bits (338),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 93/140 (66%), Gaps = 2/140 (1%)
 Frame = +2

Query  134  VRTHEMSTRSRSQAPPSALTVQVCPS--DPTCYIQAVKYLEWREAMDQEFNALLQNQTWH  307
            +  H M TRS+S    ++   +V  S  +P  Y  A+K   W +A+++E  AL   QTW 
Sbjct  286  LNLHPMQTRSKSGIAMASENAEVDLSQIEPVFYKSALKSPVWFKAIEEEIQALHSQQTWS  345

Query  308  LVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTV  487
            LVP  +  N++GCKW F+ K+ ADG+I R+KARLVAKGFNQ  G D  +TFSP+VKPTT+
Sbjct  346  LVPLPSNRNLVGCKWVFKIKKHADGTISRYKARLVAKGFNQEVGIDYGETFSPMVKPTTM  405

Query  488  RLLLYLALSSGWIVRQLDVQ  547
            RL+L LA   GW +RQLDV+
Sbjct  406  RLVLALAAQFGWGLRQLDVK  425



>emb|CAN65591.1| hypothetical protein VITISV_042091 [Vitis vinifera]
Length=1427

 Score =   136 bits (343),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 80/112 (71%), Gaps = 0/112 (0%)
 Frame = +2

Query  212   DPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIG  391
             +PT   QA+K  +W   MD E  AL +N TW LVP  +  NI+GCKW FR KR  DGSI 
Sbjct  896   EPTTASQALKDPKWCAXMDDELAALARNCTWVLVPPPSNHNIVGCKWVFRIKRNPDGSIS  955

Query  392   RHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
             R+KARLVAKGF+Q PG D  DTFSPVVKPTT+R++L +ALS+ W + QLDV 
Sbjct  956   RYKARLVAKGFHQRPGVDYHDTFSPVVKPTTIRVVLSIALSNXWXISQLDVN  1007



>emb|CAN75478.1| hypothetical protein VITISV_020209 [Vitis vinifera]
Length=1074

 Score =   136 bits (342),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 67/135 (50%), Positives = 89/135 (66%), Gaps = 0/135 (0%)
 Frame = +2

Query  143  HEMSTRSRSQAPPSALTVQVCPSDPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQ  322
            H M TRS+S        +     +P    Q ++   W+ AM+QE+ ALL+NQTW LVP  
Sbjct  521  HPMITRSKSGICKKKTYLTSLTIEPRTVKQTLQDPNWKLAMEQEYQALLKNQTWSLVPPP  580

Query  323  AGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLY  502
            +   II CKW F+ K K +GSI R+KARLVA+GF+Q  G D F+TFSPVVKP T+RL+L 
Sbjct  581  SNAKIIRCKWVFKLKHKPNGSIDRYKARLVAQGFHQTYGIDFFETFSPVVKPCTIRLVLS  640

Query  503  LALSSGWIVRQLDVQ  547
            +A+SS W ++QLDV 
Sbjct  641  IAVSSNWPIKQLDVH  655



>ref|XP_010661279.1| PREDICTED: uncharacterized protein LOC104881770 [Vitis vinifera]
Length=853

 Score =   135 bits (341),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 90/135 (67%), Gaps = 4/135 (3%)
 Frame = +2

Query  143  HEMSTRSRSQAPPSALTVQVCPSDPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQ  322
            H M+  S SQ   + L ++    +P  +  A K+ EW  AMD E +AL +N TW LVP  
Sbjct  711  HAMNISSSSQLFQALLALK----EPRGFTSAAKHPEWLSAMDDEIHALKKNDTWVLVPRP  766

Query  323  AGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLY  502
               N++GC+W F+TK  +DGSI RHKA LVA+GF+QV G D  DTFSPVV P TVR++L 
Sbjct  767  QHHNVVGCRWIFKTKLHSDGSIERHKACLVAQGFSQVHGLDFGDTFSPVVCPATVRIILS  826

Query  503  LALSSGWIVRQLDVQ  547
            LA++SGW + QLDV+
Sbjct  827  LAVTSGWRLHQLDVK  841



>gb|AAT69582.1| putative polyprotein [Oryza sativa Japonica Group]
 gb|AAU44112.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1256

 Score =   136 bits (342),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 75/99 (76%), Gaps = 0/99 (0%)
 Frame = +2

Query  251  WREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQ  430
            W+ AMD +F ALL N+TWHLVP Q G NII  KW ++ KRK DGS+ R+KARLVAKGF Q
Sbjct  760  WKHAMDAKFTALLHNKTWHLVPPQKGRNIIDYKWVYKIKRKQDGSLDRYKARLVAKGFKQ  819

Query  431  VPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
              G D  DTFSPVVK  T+R++L +A+S GW +RQLDVQ
Sbjct  820  RYGIDYEDTFSPVVKAATIRIILSIAVSRGWTLRQLDVQ  858



>emb|CAE04319.3| OSJNBb0016D16.10 [Oryza sativa Japonica Group]
Length=950

 Score =   135 bits (341),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 76/99 (77%), Gaps = 0/99 (0%)
 Frame = +2

Query  251  WREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQ  430
            W  AM  E++AL++N TWHLVP + G NIIGCKW ++ KRKADG++ R+KARLVAKGF Q
Sbjct  17   WIAAMQAEYDALIKNNTWHLVPYEKGQNIIGCKWVYKIKRKADGTLDRYKARLVAKGFKQ  76

Query  431  VPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
              G D  DTFS VVK  T+R++L +A+S GW +RQLDVQ
Sbjct  77   RYGIDYEDTFSSVVKAATIRIILSIAISRGWSLRQLDVQ  115



>ref|XP_009378158.1| PREDICTED: uncharacterized protein LOC103966690 [Pyrus x bretschneideri]
Length=1459

 Score =   136 bits (342),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 72/147 (49%), Positives = 89/147 (61%), Gaps = 9/147 (6%)
 Frame = +2

Query  134  VRTHEMSTRSRS---------QAPPSALTVQVCPSDPTCYIQAVKYLEWREAMDQEFNAL  286
            V  H M TRS+S          A  ++  V +  ++P  Y  A+K   W  AM +E NAL
Sbjct  626  VNLHPMQTRSKSGIVKKKVFFAAAHTSTVVDLTTTEPATYKSALKVPVWLNAMKEELNAL  685

Query  287  LQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSP  466
               +TW L       N++GCKW F+ KR ADGSI RHKARLVAKGF+Q  G D  +TFSP
Sbjct  686  YSQKTWSLAALPPNKNLVGCKWIFKVKRHADGSIARHKARLVAKGFSQEAGLDYGETFSP  745

Query  467  VVKPTTVRLLLYLALSSGWIVRQLDVQ  547
            VVKPTTVRL+L LA    W +RQLDV+
Sbjct  746  VVKPTTVRLILALAAHYNWPLRQLDVK  772



>gb|AAT38797.2| Polyprotein, putative [Solanum demissum]
Length=1793

 Score =   136 bits (342),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 81/116 (70%), Gaps = 2/116 (2%)
 Frame = +2

Query  200   VCPSDPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKAD  379
             VC  D + + QA K++EW+ AM  EF+AL +N TW LVP     N+I CKW ++  RK D
Sbjct  1383  VC--DTSTFNQASKHIEWQNAMQAEFDALRKNHTWELVPPDPSNNVIACKWLYKIMRKVD  1440

Query  380   GSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
             GSI R+KARLVAKGF Q PG D+ DTFSP+VKPTT+R++L +     W +RQLDV 
Sbjct  1441  GSIDRYKARLVAKGFTQRPGVDLHDTFSPIVKPTTIRVVLSITTKFDWPLRQLDVN  1496



>ref|XP_008657522.1| PREDICTED: F-box protein At1g70590-like [Zea mays]
Length=308

 Score =   130 bits (327),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 73/95 (77%), Gaps = 0/95 (0%)
 Frame = +2

Query  263  MDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQ  442
            MD E  ALL+N TWHLVP +A +NII CKW F+ KRK DGS+ R++ARLVAK F Q  G 
Sbjct  1    MDAEICALLKNDTWHLVPPRADLNIIDCKWVFKIKRKPDGSVDRYEARLVAKWFKQQYGV  60

Query  443  DIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
            D   TFSPVVKPTT+RLLL L +S GW++RQ+D++
Sbjct  61   DYDATFSPVVKPTTIRLLLSLVVSRGWVIRQIDIE  95



>ref|XP_008352218.1| PREDICTED: uncharacterized protein LOC103415694 [Malus domestica]
Length=664

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 72/147 (49%), Positives = 92/147 (63%), Gaps = 9/147 (6%)
 Frame = +2

Query  134  VRTHEMSTR-----SRSQAPPSAL----TVQVCPSDPTCYIQAVKYLEWREAMDQEFNAL  286
            + TH M TR     S+ +A  S +    +V +   +P  Y  A+K   W  AM++E  AL
Sbjct  179  MNTHSMQTRPKNGISKKKAFLSVVQDADSVNLSQMEPATYKSALKSPLWLSAMEEELAAL  238

Query  287  LQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSP  466
                TW LVP     N++GCKW F+ KR ADG+I R+KARLVAKGFNQ  G D  +TFSP
Sbjct  239  KTQHTWSLVPLPHNKNLVGCKWVFKLKRXADGTISRYKARLVAKGFNQEEGIDYGETFSP  298

Query  467  VVKPTTVRLLLYLALSSGWIVRQLDVQ  547
            VVKPTTVRL++ LA   GW +RQLDV+
Sbjct  299  VVKPTTVRLVIALAAHFGWSLRQLDVK  325



>ref|XP_008340360.1| PREDICTED: uncharacterized protein LOC103403325 [Malus domestica]
Length=925

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 74/147 (50%), Positives = 92/147 (63%), Gaps = 9/147 (6%)
 Frame = +2

Query  134  VRTHEMSTRSRSQAPPS-ALT--------VQVCPSDPTCYIQAVKYLEWREAMDQEFNAL  286
            +  H M TRS+S    + AL         V +   +P  Y  A+K   W EAM  E +AL
Sbjct  698  LNLHPMQTRSKSGISKAIALLAAVHEHGGVDLSQVEPATYKSALKSPVWYEAMQDEISAL  757

Query  287  LQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSP  466
             +  TW LVP     N++GCKW F+ K+ ADGSIGR+KARLVAKGFNQ  G D  +TFSP
Sbjct  758  HKQGTWSLVPLPKHKNLVGCKWVFKIKKNADGSIGRYKARLVAKGFNQEEGIDYGETFSP  817

Query  467  VVKPTTVRLLLYLALSSGWIVRQLDVQ  547
            VVKPTTVRL+L L+   GW +RQLDV+
Sbjct  818  VVKPTTVRLVLALSAHFGWSLRQLDVK  844



>ref|XP_008228040.1| PREDICTED: uncharacterized protein LOC103327479 [Prunus mume]
Length=1047

 Score =   135 bits (341),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 89/144 (62%), Gaps = 9/144 (6%)
 Frame = +2

Query  143  HEMSTRSRSQAPPSAL---------TVQVCPSDPTCYIQAVKYLEWREAMDQEFNALLQN  295
            H M TRS+S      +          V +   +P  Y  A+K   W  AM +E +AL   
Sbjct  576  HPMQTRSKSGIVKKKVFLTTLQESGGVDLSLVEPATYKSALKVPVWLTAMKEEVDALHSQ  635

Query  296  QTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVK  475
             TW LVP     N++GCKW F+ K+ ADGSI RHKARLVAKGF+Q PGQD  +TFSPVVK
Sbjct  636  GTWSLVPLPPDKNLVGCKWIFKIKKHADGSIARHKARLVAKGFSQEPGQDYGETFSPVVK  695

Query  476  PTTVRLLLYLALSSGWIVRQLDVQ  547
            PTTVR++L LA   GW +RQLDV+
Sbjct  696  PTTVRIVLALAAHFGWPLRQLDVK  719



>ref|XP_008356535.1| PREDICTED: uncharacterized protein LOC103420252 [Malus domestica]
Length=1312

 Score =   135 bits (341),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/143 (48%), Positives = 88/143 (62%), Gaps = 7/143 (5%)
 Frame = +2

Query  137  RTHEMSTRSRSQ-APPSALTVQVCP------SDPTCYIQAVKYLEWREAMDQEFNALLQN  295
             TH M TRS++  + P A +    P        PT Y+QA K++ WR AM  E NAL   
Sbjct  760  NTHPMITRSKAGISKPKAYSATKHPLPDTVXIIPTTYLQASKHIHWRSAMQDEINALQST  819

Query  296  QTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVK  475
             TW L P  +  NI+GCKW FR K+  DG+I R+KARLVAKGF+Q  G D  +TFSPV K
Sbjct  820  GTWSLXPFTSQQNIVGCKWVFRVKKHPDGTIDRYKARLVAKGFHQQAGLDYXETFSPVAK  879

Query  476  PTTVRLLLYLALSSGWIVRQLDV  544
            P T+R+LL LA+   W + QLD+
Sbjct  880  PXTIRILLSLAVQHDWFLNQLDI  902



>emb|CAN76078.1| hypothetical protein VITISV_008973 [Vitis vinifera]
Length=1146

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 83/113 (73%), Gaps = 0/113 (0%)
 Frame = +2

Query  209  SDPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSI  388
            ++P  Y QA K   W +AM++E+ ALL+N TW LVP  +  +I+GC+W ++ K + DGSI
Sbjct  700  TEPRTYSQASKTDSWVQAMNREYQALLRNNTWSLVPPPSSAHIVGCRWIYKLKYRPDGSI  759

Query  389  GRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
             RHKARLVA+GF Q PG D FDTF+PVVKP T+RL+L LA+S    VRQLDV+
Sbjct  760  DRHKARLVAQGFTQTPGIDYFDTFNPVVKPYTIRLILALAVSFQCPVRQLDVE  812



>gb|ABA98728.2| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1016

 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 78/112 (70%), Gaps = 0/112 (0%)
 Frame = +2

Query  212  DPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIG  391
            +P    +A+    W+ AMD EF ALL N+TWHLVP  +  NII CKW ++ KRK+DGS+ 
Sbjct  526  EPNNLAEALADNNWKHAMDAEFTALLDNKTWHLVPPSSDKNIIDCKWVYKIKRKSDGSLD  585

Query  392  RHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
            R+KARLVAKGF Q  G D  D FSPVVK  T+R +L + +S GW +RQLDVQ
Sbjct  586  RYKARLVAKGFKQRYGIDYEDMFSPVVKAATIRTILSIVVSRGWCLRQLDVQ  637



>emb|CAN74695.1| hypothetical protein VITISV_024648 [Vitis vinifera]
Length=1424

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 74/174 (43%), Positives = 101/174 (58%), Gaps = 6/174 (3%)
 Frame = +2

Query  68    EPSVKPAKRPH--GRPRGKSVKSTVRTHEMSTRSRSQA-PPSALTVQVCPSDPTCYIQAV  238
              PS+ PA   H        S      +H M TRS+     P A  +    + PT   +A+
Sbjct  834   NPSIFPATSNHNVASQXPPSSAPPFPSHHMITRSKXGIFKPKAYLIS---TTPTSVPEAL  890

Query  239   KYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAK  418
             +   W++AM  E+ ALL+N TW LVP      +IGCKW F+ K   DG+I ++KARLVAK
Sbjct  891   QLSHWKQAMTDEYLALLRNNTWDLVPPPTDRKLIGCKWVFKVKENXDGTINKYKARLVAK  950

Query  419   GFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ**AYLGQIHSN  580
             GF+Q+ G D  +TFSPVVKPTT+R++L +AL+  W VRQLDV      G +H +
Sbjct  951   GFHQIAGFDFNETFSPVVKPTTIRIVLTIALNLQWKVRQLDVNNAFLNGDLHED  1004



>ref|XP_010650252.1| PREDICTED: uncharacterized protein LOC104879339 [Vitis vinifera]
Length=648

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 74/170 (44%), Positives = 100/170 (59%), Gaps = 17/170 (10%)
 Frame = +2

Query  38   PASLPEQEPHEPSVKPAKRPHGRPRGKSVKSTVRTHEMSTRSRSQAPPSALTVQVCPSDP  217
            P ++ E +P  PS  P             + T R     T+ ++    SA+ +    S+P
Sbjct  489  PEAIHEDQPPSPSPAP-------------RMTTRLMRGITKKKTILDLSAVKI----SEP  531

Query  218  TCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRH  397
                QA+K   W +AMD E  AL +NQTW LV   + +N+IGCKW ++ K K DGSI R+
Sbjct  532  YTLKQALKDPNWIQAMDLEIAALHRNQTWDLVEQPSEVNLIGCKWVYKLKHKPDGSIERY  591

Query  398  KARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
            KARLVAKG+NQ  G D F+TFSPVVK  T+R++L +ALS  W +RQLDV 
Sbjct  592  KARLVAKGYNQTHGLDYFETFSPVVKAATIRIILIVALSFQWEIRQLDVH  641



>emb|CAN63482.1| hypothetical protein VITISV_011510 [Vitis vinifera]
Length=1124

 Score =   134 bits (338),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/136 (46%), Positives = 90/136 (66%), Gaps = 1/136 (1%)
 Frame = +2

Query  143  HEMSTRSRSQA-PPSALTVQVCPSDPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPS  319
            H M TRS++    P   T+ +   +P  + + + + +W+EAMD+EF AL++N+TW LV  
Sbjct  475  HHMVTRSKNGIFKPKVYTIDLNVEEPNTFQETISHPKWKEAMDEEFRALMKNKTWSLVSL  534

Query  320  QAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLL  499
             +    +GCKW F+ KR  DGS+ R+KARLVAKG+ QVP  D   TFS VVKPTT+R++L
Sbjct  535  PSNRTSVGCKWVFKLKRNPDGSVSRYKARLVAKGYFQVPSFDFSKTFSLVVKPTTIRVVL  594

Query  500  YLALSSGWIVRQLDVQ  547
             +A+S  W +R LDV 
Sbjct  595  AVAVSQSWSIRXLDVN  610



>ref|XP_010236748.1| PREDICTED: uncharacterized protein LOC104584242 [Brachypodium 
distachyon]
Length=868

 Score =   134 bits (336),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 82/117 (70%), Gaps = 0/117 (0%)
 Frame = +2

Query  197  QVCPSDPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKA  376
             +  S+P  +I+A     WR AMD+E  ALL N+TWHLVP  A  N+I  KW F+ K ++
Sbjct  529  NIAISEPHDHIEAASDTNWRRAMDEEHQALLDNRTWHLVPRPAHCNLIDSKWVFKLKYRS  588

Query  377  DGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
            DGSI R+KARLVAKGF Q  G D  +TFSPV+K TT+RL+L +A+S  W +RQLDV+
Sbjct  589  DGSIDRYKARLVAKGFKQRYGVDYEETFSPVIKHTTIRLILSIAVSQDWCLRQLDVK  645



>ref|XP_008390439.1| PREDICTED: uncharacterized protein LOC103452682 [Malus domestica]
Length=1098

 Score =   134 bits (338),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 92/142 (65%), Gaps = 6/142 (4%)
 Frame = +2

Query  140  THEMSTRSRSQA--PP----SALTVQVCPSDPTCYIQAVKYLEWREAMDQEFNALLQNQT  301
            +H M TRS++ +  PP    SA        +PTC+ QA  + EWR AM  EFNAL +  T
Sbjct  607  SHGMLTRSKTASLKPPKYVFSAAISSTGXIEPTCFSQANTFPEWRTAMADEFNALQRAGT  666

Query  302  WHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKPT  481
            W LVP  A MNI+  KW FR K+ +DGSI R+KARLVA GF+Q PG D  +T SPVV  +
Sbjct  667  WTLVPRTASMNILPNKWVFRIKQNSDGSIQRYKARLVANGFHQQPGLDYGETXSPVVNHS  726

Query  482  TVRLLLYLALSSGWIVRQLDVQ  547
            T+RL+L L++   W VRQLDVQ
Sbjct  727  TIRLILALSVQFQWPVRQLDVQ  748



>ref|XP_009623362.1| PREDICTED: uncharacterized protein LOC104114592 [Nicotiana tomentosiformis]
Length=285

 Score =   128 bits (322),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 80/111 (72%), Gaps = 0/111 (0%)
 Frame = +2

Query  206  PSDPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGS  385
            P +PTC+  A K   W+ AM +EFNALL NQTW LVP  +G+N++GCKW +R K+K+D S
Sbjct  7    PVEPTCFSSADKDARWQSAMTEEFNALLANQTWSLVPRPSGINVVGCKWVYRVKQKSDDS  66

Query  386  IGRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQL  538
            +   KA LVAKG+ Q  G D  +TFSP+V+PTT+RL+L ++LS G  V +L
Sbjct  67   LDHCKASLVAKGYTQELGVDYGETFSPIVRPTTIRLVLSISLSRGIRVTRL  117



>gb|AAU10819.1| putative polyprotein [Oryza sativa Japonica Group]
 gb|AAV24907.1| hypothetical protein [Oryza sativa Japonica Group]
Length=1679

 Score =   134 bits (338),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 77/169 (46%), Positives = 99/169 (59%), Gaps = 7/169 (4%)
 Frame = +2

Query  62    PHEPSVKPAKRPHGRP---RGKSVKSTVRTHEMSTRSRS--QAPPSALTVQVCPSD--PT  220
             PH P    + R  G P    G  +   V  H M+TR++S    P   L +   P    P 
Sbjct  1117  PHVPRRLRSVRATGAPTPLSGLEISPVVNDHVMTTRAKSGHHKPVHRLNLHAAPLSLVPK  1176

Query  221   CYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHK  400
              Y  A+    WR AM++E+NALL N+TW LVP  AG+N++  KW F+ K  ADGS+ R+K
Sbjct  1177  TYRAALADPLWRAAMEEEYNALLANRTWDLVPRPAGVNVVTGKWIFKHKFHADGSLDRYK  1236

Query  401   ARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
             AR V +GF Q PG D  +TFSPVVKP TVR +L LA+S  W V QLDV+
Sbjct  1237  ARWVLRGFTQRPGVDFDETFSPVVKPATVRTVLSLAVSRDWPVHQLDVK  1285



>emb|CAN74381.1| hypothetical protein VITISV_007944 [Vitis vinifera]
Length=1884

 Score =   134 bits (338),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 70/143 (49%), Positives = 94/143 (66%), Gaps = 8/143 (6%)
 Frame = +2

Query  140   THEMSTRSRSQAPPSALTVQVC-------PSDPTCYIQAVKYLEWREAMDQEFNALLQNQ  298
             TH M TRS+ +  PS  +  V         S+P  Y  A+K   W +AM +E  AL+QN+
Sbjct  890   TH-MITRSKLKNDPSLKSQMVTFAXXRSDISEPKTYRTALKIPHWLKAMQEEIKALIQNR  948

Query  299   TWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKP  478
             TW LVP     NI+G KW F+TK K DG+I R+KARLVA+GF+Q+PG D  +TFSPV+K 
Sbjct  949   TWDLVPRPPTTNIVGSKWVFKTKLKEDGTIDRYKARLVARGFSQIPGLDFGETFSPVIKH  1008

Query  479   TTVRLLLYLALSSGWIVRQLDVQ  547
             TT+R++  LA+  GW +RQLDV+
Sbjct  1009  TTIRMIFSLAVILGWKMRQLDVK  1031



>ref|XP_008389560.1| PREDICTED: uncharacterized protein LOC103451895 [Malus domestica]
Length=1300

 Score =   134 bits (337),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 73/163 (45%), Positives = 98/163 (60%), Gaps = 11/163 (7%)
 Frame = +2

Query  134  VRTHEMSTRSR----------SQAPPSALTVQVCPSDPTCYIQAVKYLEWREAMDQEFNA  283
            +  H M TRS+          +Q P S+  V +   +P  Y  A+K   W +AM +E +A
Sbjct  745  LNMHPMQTRSKNGIIKKKAFFTQLPESS-EVDLTLVEPATYTSAMKVPVWYKAMHEEVDA  803

Query  284  LLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFS  463
            LL+  TW LV      N++GCKW F+ K+ +DG++ RHKARLVAKGF+Q PG D  +TFS
Sbjct  804  LLKQHTWSLVHLPPHKNLVGCKWVFKLKKNSDGTVARHKARLVAKGFSQEPGLDYGETFS  863

Query  464  PVVKPTTVRLLLYLALSSGWIVRQLDVQ**AYLGQIHSNFQIS  592
            PVVKPTTVRL+L LA    W +RQLDV+     G +H    +S
Sbjct  864  PVVKPTTVRLVLALAAHFNWTLRQLDVKNAFLHGVLHEEVYMS  906



>emb|CAN61827.1| hypothetical protein VITISV_027629 [Vitis vinifera]
Length=638

 Score =   132 bits (332),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 87/133 (65%), Gaps = 4/133 (3%)
 Frame = +2

Query  149  MSTRSRSQAPPSALTVQVCPSDPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAG  328
            M   S SQ   + L ++    +P  +  A K+ EW  AMD E + L +N TW LVP    
Sbjct  153  MHISSSSQLFQALLALK----EPRSFKSAAKHPEWLSAMDDEIHTLKKNDTWVLVPRPXH  208

Query  329  MNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLA  508
             N++GC+W F+TK  +DGSI RHKARLVA+GF+QV G D  DTFSPVV P  VR++L LA
Sbjct  209  HNVVGCRWIFKTKLHSDGSIERHKARLVAQGFSQVHGLDFGDTFSPVVHPAIVRIILSLA  268

Query  509  LSSGWIVRQLDVQ  547
            ++SGW + QLDV+
Sbjct  269  VTSGWRLHQLDVK  281



>ref|XP_010038745.1| PREDICTED: uncharacterized protein LOC104427339 [Eucalyptus grandis]
Length=878

 Score =   133 bits (335),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 72/148 (49%), Positives = 90/148 (61%), Gaps = 5/148 (3%)
 Frame = +2

Query  119  SVKSTVRTHEMSTRSRSQA----PPSALTVQV-CPSDPTCYIQAVKYLEWREAMDQEFNA  283
            SV+ T  TH M TRS+S      P  A   Q   P +P     A+  L W +AM +E NA
Sbjct  641  SVQGTQPTHHMQTRSKSSIVKVNPQYACLAQYQVPPEPKSIKSALADLGWYQAMQEEMNA  700

Query  284  LLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFS  463
            L  NQTW LVP    MN+IGCKW F+ K  + GS+ R KARLVAKGF+Q  G D  +TFS
Sbjct  701  LHHNQTWLLVPRTNNMNVIGCKWVFKAKLTSTGSLDRLKARLVAKGFHQEEGIDFTETFS  760

Query  464  PVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
            PV+K  TVRL+L +A+   W + QLDV+
Sbjct  761  PVIKHATVRLILSIAMVKHWSIHQLDVK  788



>ref|XP_008360633.1| PREDICTED: uncharacterized protein LOC103424318 [Malus domestica]
Length=747

 Score =   133 bits (334),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 89/145 (61%), Gaps = 9/145 (6%)
 Frame = +2

Query  137  RTHEMSTRSRSQA-PPSAL--TVQVCPSD------PTCYIQAVKYLEWREAMDQEFNALL  289
             TH   TRS+S    P AL  T     SD       + Y+QA K+  WR+AM +EFNAL+
Sbjct  592  NTHTXHTRSKSGIFKPKALLATKYXISSDLSXDYTXSTYLQASKHHHWRQAMQEEFNALI  651

Query  290  QNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPV  469
            Q  TW LVP+    N++G KW FR KRK  G+I  +KARLVAKGF+Q  G D  +TFSPV
Sbjct  652  QTGTWSLVPANPTQNLVGAKWVFRIKRKPYGTIDXYKARLVAKGFHQQHGIDYTETFSPV  711

Query  470  VKPTTVRLLLYLALSSGWIVRQLDV  544
             KP T+RLLL LA    W + QLDV
Sbjct  712  AKPVTIRLLLTLAAKFDWFLNQLDV  736



>emb|CAH67061.1| H0112G12.6 [Oryza sativa Indica Group]
Length=811

 Score =   133 bits (334),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 76/169 (45%), Positives = 98/169 (58%), Gaps = 7/169 (4%)
 Frame = +2

Query  62   PHEPSVKPAKRPHGRP---RGKSVKSTVRTHEMSTRSRS--QAPPSALTVQVCPSD--PT  220
            PH P    + R  G P    G  +   V  H M+TR++S    P   L +   P    P 
Sbjct  249  PHVPRRLRSVRATGAPTPLSGLGISPVVNDHVMTTRAKSGHHKPVHRLNLHAAPLSLVPK  308

Query  221  CYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHK  400
             Y  A+    WR AM++E+NALL N+TW LVP  A +N++  KW F+ K  ADGS+ R+K
Sbjct  309  TYRAALADPLWRAAMEEEYNALLANRTWDLVPRPASVNVVAGKWIFKHKFHADGSLDRYK  368

Query  401  ARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
            AR V +GF Q PG D  +TFSPVVKP TVR +L LA+S  W V QLDV+
Sbjct  369  ARWVLRGFTQRPGVDFDETFSPVVKPATVRTVLSLAVSRDWPVHQLDVK  417



>emb|CAN59952.1| hypothetical protein VITISV_006720 [Vitis vinifera]
Length=1365

 Score =   134 bits (336),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 80/113 (71%), Gaps = 0/113 (0%)
 Frame = +2

Query  209  SDPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSI  388
            S+PT   QA+K   W EAM  E  AL +NQTW LV     +NIIGCKW ++ K K DGS+
Sbjct  829  SEPTTLKQAIKDPNWAEAMQTEIAALHKNQTWDLVDPPKDVNIIGCKWVYKLKYKPDGSV  888

Query  389  GRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
             R+KARLVA+GFNQ  G D F+TFSPVVK  T+R++L +ALS  W +RQLDVQ
Sbjct  889  DRYKARLVARGFNQTFGLDYFETFSPVVKAATIRIVLTIALSYRWELRQLDVQ  941



>emb|CAN79182.1| hypothetical protein VITISV_024133 [Vitis vinifera]
Length=555

 Score =   130 bits (328),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 80/113 (71%), Gaps = 0/113 (0%)
 Frame = +2

Query  209  SDPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSI  388
            + PT   QA+K   WR+AM +E+ AL+ N TW LVP +   N +GCKW F  KR + GSI
Sbjct  257  TTPTSISQALKDHNWRQAMSEEYGALVCNGTWELVPPKDITNQVGCKWIFCIKRNSYGSI  316

Query  389  GRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
             R+KA LVAKGF+Q PG D  +TFS VVKPTTVRL+L + +S+GW +RQLDV 
Sbjct  317  DRYKAHLVAKGFHQRPGVDYHETFSLVVKPTTVRLVLSIVVSNGWSLRQLDVN  369



>emb|CAN74561.1| hypothetical protein VITISV_017064 [Vitis vinifera]
Length=801

 Score =   132 bits (333),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 89/138 (64%), Gaps = 0/138 (0%)
 Frame = +2

Query  134  VRTHEMSTRSRSQAPPSALTVQVCPSDPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLV  313
            +  H M T+++S        +    S+P  Y QA K   W +AM  E+ ALL+N+TW LV
Sbjct  183  LNIHPMVTKAKSGIHKKKSFLMQTTSEPHTYSQASKSEPWVQAMQHEYQALLRNRTWSLV  242

Query  314  PSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRL  493
            P     +I+GC+W ++ K   +GS+ +HK R+VA+GF Q PG D FDTF+PVVKP T+RL
Sbjct  243  PHPPSAHIVGCRWIYKLKYLPNGSVEKHKDRVVAQGFTQTPGVDYFDTFNPVVKPYTIRL  302

Query  494  LLYLALSSGWIVRQLDVQ  547
            +L L +S  W++RQLDV+
Sbjct  303  ILDLVVSFQWLIRQLDVE  320



>emb|CAN61420.1| hypothetical protein VITISV_023544 [Vitis vinifera]
Length=1289

 Score =   133 bits (334),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 67/140 (48%), Positives = 92/140 (66%), Gaps = 7/140 (5%)
 Frame = +2

Query  149  MSTRSRSQAPPSALTVQVC-------PSDPTCYIQAVKYLEWREAMDQEFNALLQNQTWH  307
            M TRS+ +  PS  +  V         S+P  Y   +K   W +AM +E  AL+QN+TW 
Sbjct  268  MITRSKLKNYPSLKSQMVTFAATRSDISEPKIYRTTLKIPHWLKAMQKEIKALIQNRTWD  327

Query  308  LVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTV  487
            LVP     NI+G KW F+TK K DG+I R+KARLVA+GF+Q+PG D  +TFSPV+K TT+
Sbjct  328  LVPRPPTTNIVGSKWVFKTKLKEDGTIDRYKARLVARGFSQIPGLDFGETFSPVIKHTTI  387

Query  488  RLLLYLALSSGWIVRQLDVQ  547
            +L+  LA++ GW +RQLDV+
Sbjct  388  KLIFSLAVTLGWKMRQLDVK  407



>ref|XP_008378632.1| PREDICTED: uncharacterized protein LOC103441708 [Malus domestica]
Length=1328

 Score =   133 bits (334),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 91/151 (60%), Gaps = 17/151 (11%)
 Frame = +2

Query  134  VRTHEMSTRSRS-------------QAPPSALTVQVCPSDPTCYIQAVKYLEWREAMDQE  274
            +  H M TRS+S             ++PP  L++     +P  Y  A+K   W  AM +E
Sbjct  796  LNLHPMQTRSKSGIVKKKALLTTFDESPPVDLSL----VEPATYKSALKVPVWFNAMTEE  851

Query  275  FNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFD  454
             +AL +  TW LVP     N++GCKW F+ K+ +DGSI RHKARLVAKGF+Q PG D  +
Sbjct  852  LDALYKQGTWSLVPLPPQXNLVGCKWVFKVKKHSDGSIARHKARLVAKGFSQEPGLDYGE  911

Query  455  TFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
            TFSPVVKPT VRL+L LA    W  RQLDV+
Sbjct  912  TFSPVVKPTXVRLVLALAAQFDWPJRQLDVK  942



>ref|XP_010659203.1| PREDICTED: uncharacterized protein LOC104881291 [Vitis vinifera]
Length=409

 Score =   129 bits (324),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 79/112 (71%), Gaps = 0/112 (0%)
 Frame = +2

Query  212  DPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIG  391
            +PT   QA++  +W  AMD E   L +N+TW LVP  +  NI+GCKW FR KR  DGSI 
Sbjct  283  EPTNASQALQDPKWCAAMDDERATLARNRTWVLVPPPSNHNIVGCKWVFRIKRNLDGSIS  342

Query  392  RHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
            R+KAR VAKGF+Q P  D  DTFSP+VKPTT+R++L +ALS+ W + QLDV 
Sbjct  343  RYKARFVAKGFHQRPRVDYHDTFSPIVKPTTIRVVLSIALSNSWPISQLDVN  394



>ref|XP_007019438.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 8 [Theobroma 
cacao]
 gb|EOY16663.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 8 [Theobroma 
cacao]
Length=579

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 77/112 (69%), Gaps = 0/112 (0%)
 Frame = +2

Query  212  DPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIG  391
            +PTC +QA+++  W++AM  E+  L  N+TW LVP      I+G KW F  KR  DGSI 
Sbjct  28   EPTCALQAIRHPHWKQAMLDEYTTLTNNETWELVPPLPDKTIVGYKWIFCIKRHLDGSIS  87

Query  392  RHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
            R+KARLVAKGF Q PG D  +TFSPVVKP T+RL+L L +S+ W + QLDV 
Sbjct  88   RYKARLVAKGFTQRPGLDFTETFSPVVKPVTIRLVLCLTVSNNWRLHQLDVN  139



>emb|CAN73795.1| hypothetical protein VITISV_036649 [Vitis vinifera]
Length=828

 Score =   132 bits (332),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 91/138 (66%), Gaps = 0/138 (0%)
 Frame = +2

Query  134  VRTHEMSTRSRSQAPPSALTVQVCPSDPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLV  313
            + +H M TRS+S        +    ++P    QA++   W+ AM+ E+ ALL+NQTW LV
Sbjct  387  IXSHPMITRSKSGICKKKTYLTSLIAEPHTVKQALQDPNWKLAMEXEYQALLKNQTWSLV  446

Query  314  PSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRL  493
            P  + + IIGCKW F+ K K DG+I R+KARLVA+GF+Q  G D F+TFS VVKP T+RL
Sbjct  447  PPPSNVKIIGCKWVFKLKHKXDGNIDRYKARLVAQGFHQTYGIDFFETFSXVVKPCTIRL  506

Query  494  LLYLALSSGWIVRQLDVQ  547
            ++ + +SS   ++QLDV 
Sbjct  507  VISIVVSSNRPIKQLDVH  524



>ref|XP_008361163.1| PREDICTED: uncharacterized protein LOC103424851 [Malus domestica]
Length=1091

 Score =   132 bits (332),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 71/147 (48%), Positives = 87/147 (59%), Gaps = 9/147 (6%)
 Frame = +2

Query  134  VRTHEMSTRSRS---------QAPPSALTVQVCPSDPTCYIQAVKYLEWREAMDQEFNAL  286
            V  H M TRS+S          A  ++  V +   +P  Y  A+K   W  AM +E NAL
Sbjct  738  VNXHPMQTRSKSGIVKKXVFFAAAHTSTXVDLTTXEPATYKSALKVPVWLNAMKEELNAL  797

Query  287  LQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSP  466
               +TW LV      N++GCKW F+ KR ADGSI RHKARLVA GF+Q  G    +TFSP
Sbjct  798  YSQKTWSLVALPPNKNLVGCKWIFKVKRHADGSIARHKARLVAXGFSQEAGLXYGETFSP  857

Query  467  VVKPTTVRLLLYLALSSGWIVRQLDVQ  547
            VVKPTTVRL+L LA    W +RQLDV+
Sbjct  858  VVKPTTVRLILALAAHYNWPLRQLDVK  884



>ref|XP_008379771.1| PREDICTED: uncharacterized protein LOC103442736 [Malus domestica]
Length=1017

 Score =   132 bits (332),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 73/147 (50%), Positives = 91/147 (62%), Gaps = 9/147 (6%)
 Frame = +2

Query  134   VRTHEMSTRSRSQAPPS-ALTVQVCPSD--------PTCYIQAVKYLEWREAMDQEFNAL  286
             +  H M TRS+S      AL   V  S+        PT Y  A K   W +AM +E + L
Sbjct  863   INLHPMQTRSKSGIIKKIALLATVQESEGTDLSLIEPTSYKSAFKNPIWFKAMQEEISVL  922

Query  287   LQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSP  466
                 TW+LV   +  N++GCKW F+ KR +DG+I RHKARLVAKGF+Q PG D  +TFSP
Sbjct  923   HTQGTWNLVVIPSSKNLVGCKWIFKIKRHSDGTIARHKARLVAKGFSQEPGIDYGETFSP  982

Query  467   VVKPTTVRLLLYLALSSGWIVRQLDVQ  547
             VVKPTTVRL+L LA   GW +RQLDV+
Sbjct  983   VVKPTTVRLVLALAAQFGWSLRQLDVK  1009



>emb|CAN82769.1| hypothetical protein VITISV_037882 [Vitis vinifera]
Length=2220

 Score =   132 bits (333),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 74/170 (44%), Positives = 100/170 (59%), Gaps = 17/170 (10%)
 Frame = +2

Query  38    PASLPEQEPHEPSVKPAKRPHGRPRGKSVKSTVRTHEMSTRSRSQAPPSALTVQVCPSDP  217
             P ++ E +P  PS  P             + T R     T+ ++    SA+ +    S+P
Sbjct  1566  PEAIHEDQPPSPSPAP-------------RMTTRLMRGITKKKTILDLSAVKI----SEP  1608

Query  218   TCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRH  397
                 QA+K   W +AMD E  AL +NQTW LV   + +N+IGCKW ++ K K DGSI R+
Sbjct  1609  YTLKQALKDPNWIQAMDLEIAALHRNQTWDLVEQPSEVNLIGCKWVYKLKHKPDGSIERY  1668

Query  398   KARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
             KARLVAKG+NQ  G D F+TFSPVVK  T+R++L +ALS  W +RQLDV 
Sbjct  1669  KARLVAKGYNQTHGLDYFETFSPVVKAATIRIILTVALSFQWEIRQLDVH  1718



>ref|XP_010541762.1| PREDICTED: retrovirus-related Pol polyprotein from transposon 
TNT 1-94 [Tarenaya hassleriana]
Length=813

 Score =   131 bits (330),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 79/110 (72%), Gaps = 0/110 (0%)
 Frame = +2

Query  263  MDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQ  442
            M +EFNALL+N TW LVP     N++GCKW FRTKR +DGSI R+KARLVAKGF+Q PG 
Sbjct  1    MSEEFNALLRNDTWSLVPPDFASNVVGCKWVFRTKRLSDGSIDRYKARLVAKGFHQRPGV  60

Query  443  DIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ**AYLGQIHSNFQIS  592
            D  +TFSPVVK  TVR++L +A+S  W +RQLDV      G +H +  ++
Sbjct  61   DYTETFSPVVKHATVRVILSIAVSRNWSLRQLDVNNAFLQGSLHEDVYVA  110



>ref|XP_004974413.1| PREDICTED: uncharacterized mitochondrial protein AtMg00820-like 
[Setaria italica]
Length=165

 Score =   123 bits (309),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/159 (43%), Positives = 94/159 (59%), Gaps = 20/159 (13%)
 Frame = +2

Query  86   AKRPHGRPRG-----KSVKSTVRTHEMSTRSRSQAPPSALTVQVCPSDPTCYIQAVKYLE  250
            A+RPH R +      KS   +   +++ST S   A P  L             +A+  + 
Sbjct  8    ARRPHTRAQNGIRKPKSYTDSTIRYDLSTIS---AEPHNLD------------EAMGDVN  52

Query  251  WREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQ  430
            W+ AMD E+ AL+  +TWHLVP + G NII CKW ++ K+K++ S+ R+KARLVAKGF  
Sbjct  53   WKGAMDVEYMALVNKKTWHLVPLEQGRNIIDCKWVYKVKKKSNVSLDRYKARLVAKGFKH  112

Query  431  VPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
                D  DTFS VVK  T+RL+L LA+S GW + QLDVQ
Sbjct  113  HYSIDYDDTFSRVVKAATIRLMLSLAVSYGWSLCQLDVQ  151



>ref|XP_010227141.1| PREDICTED: uncharacterized protein LOC104581367 [Brachypodium 
distachyon]
Length=957

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 81/117 (69%), Gaps = 0/117 (0%)
 Frame = +2

Query  197  QVCPSDPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKA  376
             +  S+P  +I+A     WR AMD+E  ALL N+TWHLVP  A  N+I  KW F+ K ++
Sbjct  542  NIAISEPHDHIEAASDTNWRRAMDEEHQALLDNRTWHLVPRPAHCNLIDSKWVFKLKYRS  601

Query  377  DGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
            DGSI R+KARLVA GF Q  G D  +TFSPV+K TT+RL+L +A+S  W +RQLDV+
Sbjct  602  DGSIDRYKARLVATGFKQRYGVDYEETFSPVIKHTTIRLILSIAVSQDWCLRQLDVK  658



>ref|XP_008665822.1| PREDICTED: uncharacterized protein LOC103644390 [Zea mays]
Length=908

 Score =   131 bits (330),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 78/112 (70%), Gaps = 0/112 (0%)
 Frame = +2

Query  212  DPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIG  391
            +PT   +A+    W+ AM+ E  AL +N+TWHLVP     N+I CKW ++ KR  DGSI 
Sbjct  534  EPTSLREALSNNNWKHAMESEIAALQRNKTWHLVPPDKNRNLIDCKWVYKIKRHPDGSID  593

Query  392  RHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
            R+KARLVAKGF Q  G D  DTFSPVVK  T+RL+L +A+S GW +RQLDVQ
Sbjct  594  RYKARLVAKGFKQRYGIDYDDTFSPVVKFATIRLVLSIAVSKGWSLRQLDVQ  645



>ref|XP_008229480.1| PREDICTED: uncharacterized protein LOC103328856 [Prunus mume]
Length=1392

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 78/112 (70%), Gaps = 0/112 (0%)
 Frame = +2

Query  212  DPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIG  391
            +P CY  A+K   W +AM +E NAL    TW LV   A  N++GCKW F+ KR + GSI 
Sbjct  5    EPVCYKSAIKVPVWLQAMKEEVNALHTQGTWSLVQLPANKNLVGCKWIFKIKRHSYGSIA  64

Query  392  RHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
            RHKA++VAKGF+Q PG D  +TFSPVVKPT VRL+L LA    W++RQLDVQ
Sbjct  65   RHKAQIVAKGFSQEPGLDYGETFSPVVKPTIVRLVLALAAHFNWLLRQLDVQ  116



>ref|XP_009604767.1| PREDICTED: uncharacterized protein LOC104099466 [Nicotiana tomentosiformis]
Length=569

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 72/153 (47%), Positives = 95/153 (62%), Gaps = 11/153 (7%)
 Frame = +2

Query  95   PHGRPRGKSVKSTVRT--HEMSTRSRSQA--PPSALTV-------QVCPSDPTCYIQAVK  241
            PH   R + + S V    H M TR +++A   P A TV          PS+PT + QA K
Sbjct  413  PHSGARTQPILSQVIHPPHHMITRRKAKALPQPQANTVTKYPLPPSSFPSEPTYFSQANK  472

Query  242  YLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKG  421
             L WR+AM +E+N+L+ N TW LVPS    NI+GCK  F+ K + +GSI R+K RL+ KG
Sbjct  473  DLSWRKAMQEEYNSLIHNGTWSLVPSSIAKNIVGCKCIFKLKLRPNGSIERYKERLMEKG  532

Query  422  FNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSG  520
            FNQ    D  DTFSPV+KPTT+R++L +ALS G
Sbjct  533  FNQEFRVDYHDTFSPVIKPTTIRVILTIALSRG  565



>ref|XP_010526684.1| PREDICTED: retrovirus-related Pol polyprotein from transposon 
TNT 1-94 isoform X6 [Tarenaya hassleriana]
Length=789

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 78/120 (65%), Gaps = 1/120 (1%)
 Frame = +2

Query  185  ALTVQVCPSDPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRT  364
            AL +   P +P  Y QA K+  WR+AM  E  AL++  TW +     G N +GCKW F+T
Sbjct  498  ALNITTAP-EPQSYTQAAKFESWRQAMKLELEALIRTNTWSICTLPDGKNAVGCKWVFKT  556

Query  365  KRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDV  544
            K  ADGSI RHKARLVAKG+ Q+ G D  +TFSPV K TTVR+LL LA    W++ Q+DV
Sbjct  557  KYNADGSIERHKARLVAKGYTQLEGVDFSETFSPVAKMTTVRVLLALAAKYNWLINQMDV  616



>ref|XP_011081378.1| PREDICTED: uncharacterized protein LOC105164425 [Sesamum indicum]
Length=767

 Score =   130 bits (328),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 76/112 (68%), Gaps = 0/112 (0%)
 Frame = +2

Query  212  DPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIG  391
            +P  +++A++Y EWR AMD E  AL  NQTW L P   G   IG KW F+ K +ADGSI 
Sbjct  613  EPRSFVEAMQYPEWRAAMDDEIKALESNQTWTLTPLPPGKRAIGSKWVFKVKLRADGSIE  672

Query  392  RHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
            R+KARLVAKGFNQ+ G D  ++FSPV K   VRL L LA ++GW + QLDV 
Sbjct  673  RYKARLVAKGFNQIEGVDYTESFSPVAKAVIVRLFLSLAAANGWALHQLDVN  724



>ref|XP_008350549.1| PREDICTED: uncharacterized protein LOC103413885 [Malus domestica]
Length=1668

 Score =   132 bits (331),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 95/145 (66%), Gaps = 6/145 (4%)
 Frame = +2

Query  131   TVRTHEMSTRSRS-----QAPPSALTVQVCP-SDPTCYIQAVKYLEWREAMDQEFNALLQ  292
             +V  H M TRS+S     +A  +++T  V   ++P+ Y  A K  EW+ AM  E +AL  
Sbjct  1109  SVSFHPMQTRSKSGISKRKAFSASVTSSVVQLTEPSSYKTASKIPEWQVAMQDEIHALEA  1168

Query  293   NQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVV  472
              QTW LVP   G N++GCKW +R K+  +GSI R+KARLVAKG++Q  G D  +TFSPVV
Sbjct  1169  QQTWTLVPLPVGKNLVGCKWVYRLKKNPNGSIARYKARLVAKGYSQEEGIDYTETFSPVV  1228

Query  473   KPTTVRLLLYLALSSGWIVRQLDVQ  547
             KPTTVRL+L LA    W ++QLDV+
Sbjct  1229  KPTTVRLILALAAQFNWSLKQLDVR  1253



>ref|XP_008349120.1| PREDICTED: uncharacterized protein LOC103412315 [Malus domestica]
Length=1326

 Score =   132 bits (331),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 70/147 (48%), Positives = 90/147 (61%), Gaps = 9/147 (6%)
 Frame = +2

Query  134  VRTHEMSTRSRS---------QAPPSALTVQVCPSDPTCYIQAVKYLEWREAMDQEFNAL  286
            +  H M TRS+S          A  ++  V +   +P+ Y  A+K   W +AM +E +AL
Sbjct  778  INLHPMQTRSKSGISKKKVFLSALAASTDVDLSICEPSTYKSALKSSIWFQAMQEEISAL  837

Query  287  LQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSP  466
                TW LV      N++GCKW F+ KR +DGSI RHKARLVAKGF+Q PG D  DTFS 
Sbjct  838  HGQGTWSLVSLPVNKNLVGCKWVFKIKRHSDGSIARHKARLVAKGFSQEPGIDYSDTFSH  897

Query  467  VVKPTTVRLLLYLALSSGWIVRQLDVQ  547
            VVKPTTVR++L LA    W +RQLDV+
Sbjct  898  VVKPTTVRIVLALAAHFHWSLRQLDVK  924



>gb|EMT21953.1| ABC transporter C family member 10 [Aegilops tauschii]
Length=3041

 Score =   132 bits (332),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 82/112 (73%), Gaps = 0/112 (0%)
 Frame = +2

Query  212   DPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIG  391
             +P    +A+    W++AM++E+  L +N+TWHLV  + G N+I CKW +R KRK+DG+I 
Sbjct  2274  EPGTLDEALGDTRWKKAMEEEYMTLQKNKTWHLVSPRRGKNLIDCKWVYRIKRKSDGTID  2333

Query  392   RHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
             R+KARLVAKGF Q  G D  DTFSPVVK  T+RL+L +A+S GW +RQLDVQ
Sbjct  2334  RYKARLVAKGFKQRYGIDYEDTFSPVVKAATIRLVLSIAVSRGWSLRQLDVQ  2385



>ref|XP_010069795.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104456640 
[Eucalyptus grandis]
Length=1324

 Score =   131 bits (330),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 73/169 (43%), Positives = 98/169 (58%), Gaps = 5/169 (3%)
 Frame = +2

Query  56   QEPHEPSVKPAKRPHGRPRGKSVKSTVRTHEMSTRSRS----QAPPSALTVQV-CPSDPT  220
            QE    S    ++P   P  +  + T+ TH M TR RS      P  A  V+   P +P 
Sbjct  328  QESDSTSPANIEQPQISPISEVTQGTLSTHPMQTRLRSGIIKANPKYACLVEYQVPIEPK  387

Query  221  CYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHK  400
                A+ +  W +AM +E +AL QN+TW LVP    MN+IGCKW F+TK   DGS+ R K
Sbjct  388  SVKFALAHTGWCQAMHEEMDALYQNKTWELVPRNDQMNVIGCKWVFKTKLAPDGSLDRLK  447

Query  401  ARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
            ARLVAKGF+Q  G D  +T+SPVVK  T R++L +A+   W + QLDV+
Sbjct  448  ARLVAKGFHQEEGLDFTETYSPVVKHATTRIILSVAMVKQWPIHQLDVK  496



>emb|CAN64288.1| hypothetical protein VITISV_022326 [Vitis vinifera]
Length=1508

 Score =   131 bits (330),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 79/113 (70%), Gaps = 0/113 (0%)
 Frame = +2

Query  209   SDPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSI  388
             S+P  Y QA K   W +AM  E+ ALL+N TW LVP     +I+GC+W ++ K   +GS+
Sbjct  1008  SEPHTYNQAXKSEPWVQAMQHEYQALLRNHTWSLVPPPPLAHIVGCRWIYKLKYLPNGSV  1067

Query  389   GRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
              RHKARLVA+GF Q  G D FDTFSP+VKP T+RL+L LA+S  W +RQLDV+
Sbjct  1068  ERHKARLVAQGFTQTLGVDYFDTFSPIVKPCTIRLILTLAVSFQWXIRQLDVE  1120



>ref|XP_010526683.1| PREDICTED: retrovirus-related Pol polyprotein from transposon 
TNT 1-94 isoform X5 [Tarenaya hassleriana]
Length=886

 Score =   130 bits (328),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 78/120 (65%), Gaps = 1/120 (1%)
 Frame = +2

Query  185  ALTVQVCPSDPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRT  364
            AL +   P +P  Y QA K+  WR+AM  E  AL++  TW +     G N +GCKW F+T
Sbjct  595  ALNITTAP-EPQSYTQAAKFESWRQAMKLELEALIRTNTWSICTLPDGKNAVGCKWVFKT  653

Query  365  KRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDV  544
            K  ADGSI RHKARLVAKG+ Q+ G D  +TFSPV K TTVR+LL LA    W++ Q+DV
Sbjct  654  KYNADGSIERHKARLVAKGYTQLEGVDFSETFSPVAKMTTVRVLLALAAKYNWLINQMDV  713



>emb|CAN62863.1| hypothetical protein VITISV_030334 [Vitis vinifera]
Length=1442

 Score =   131 bits (330),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 66/143 (46%), Positives = 90/143 (63%), Gaps = 6/143 (4%)
 Frame = +2

Query  137  RTHEMSTRSRSQA--PPSALTVQVCPS----DPTCYIQAVKYLEWREAMDQEFNALLQNQ  298
            R H+M+TRS +    P     V   P     +PTC  QAV + +WR+AM  E  AL+++ 
Sbjct  834  RLHKMTTRSMNNIFKPKQLHLVSKHPIPLAIEPTCATQAVNHPQWRDAMSTELTALMKHG  893

Query  299  TWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKP  478
            TW LVP       +GCKW FR KRKADGS+ + K RLVAK + Q PG D  +TFSPVV+P
Sbjct  894  TWDLVPPLPNCTPVGCKWVFRVKRKADGSVDKFKTRLVAKDYTQRPGLDYKETFSPVVRP  953

Query  479  TTVRLLLYLALSSGWIVRQLDVQ  547
             T+R +L +A+ +GW +RQ+D+ 
Sbjct  954  ATIRCVLTIAVMNGWPLRQMDIN  976



>gb|ABA99152.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=989

 Score =   130 bits (328),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 73/154 (47%), Positives = 94/154 (61%), Gaps = 5/154 (3%)
 Frame = +2

Query  101  GRPRGKSVKSTVR----THEMSTRSRS-QAPPSALTVQVCPSDPTCYIQAVKYLEWREAM  265
            GRPR   V S ++     H+M+TR+++    PS          P  +  A+    WR A+
Sbjct  427  GRPRPLLVYSRLQPITNNHDMTTRAKAGHRFPSVYNSTTLSPVPCTFRGALADPNWRAAL  486

Query  266  DQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQD  445
            ++EF+ALLQN TW LVP    +NI+  KW F+ K +ADGS+ R+KAR V  GF Q PG D
Sbjct  487  EEEFSALLQNNTWELVPRPTQVNIVTGKWIFKHKFRADGSLERYKARWVLGGFTQRPGID  546

Query  446  IFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
               TFSPVVKP TVR +L LALS GW V QLDV+
Sbjct  547  FDGTFSPVVKPATVRTVLSLALSRGWPVHQLDVK  580



>ref|XP_010526682.1| PREDICTED: retrovirus-related Pol polyprotein from transposon 
TNT 1-94 isoform X4 [Tarenaya hassleriana]
Length=940

 Score =   130 bits (328),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 78/120 (65%), Gaps = 1/120 (1%)
 Frame = +2

Query  185  ALTVQVCPSDPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRT  364
            AL +   P +P  Y QA K+  WR+AM  E  AL++  TW +     G N +GCKW F+T
Sbjct  649  ALNITTAP-EPQSYTQAAKFESWRQAMKLELEALIRTNTWSICTLPDGKNAVGCKWVFKT  707

Query  365  KRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDV  544
            K  ADGSI RHKARLVAKG+ Q+ G D  +TFSPV K TTVR+LL LA    W++ Q+DV
Sbjct  708  KYNADGSIERHKARLVAKGYTQLEGVDFSETFSPVAKMTTVRVLLALAAKYNWLINQMDV  767



>ref|XP_008350712.1| PREDICTED: uncharacterized protein LOC103414077 [Malus domestica]
Length=255

 Score =   124 bits (312),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 66/147 (45%), Positives = 86/147 (59%), Gaps = 9/147 (6%)
 Frame = +2

Query  134  VRTHEMSTRSRSQAPPSALTVQVCPS---------DPTCYIQAVKYLEWREAMDQEFNAL  286
            +  H M TRS+S        + +            +PT Y  A+K   W EAM  E + L
Sbjct  94   LNLHPMQTRSKSGVIKRMALLSIVHEIGGIDLIIVEPTTYKSALKSSVWVEAMKLELSTL  153

Query  287  LQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSP  466
                TW L+P     N++GCKW F+ K+ ADG++GR+KARLVAKGF+Q  G D  +TFS 
Sbjct  154  HFQGTWSLLPLPHHKNLVGCKWVFKIKKNADGTVGRYKARLVAKGFSQEEGIDYGETFSL  213

Query  467  VVKPTTVRLLLYLALSSGWIVRQLDVQ  547
            VVKPTTVRL+L L    GW +RQLDV+
Sbjct  214  VVKPTTVRLVLALTAHYGWSLRQLDVK  240



>emb|CAN81355.1| hypothetical protein VITISV_039158 [Vitis vinifera]
Length=1402

 Score =   131 bits (329),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 78/112 (70%), Gaps = 0/112 (0%)
 Frame = +2

Query  209  SDPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSI  388
            S+PT   QA+K   W EAM  E  AL +NQTW LV     +NIIGCKW ++ K K DGS+
Sbjct  879  SEPTTLKQAIKDPNWAEAMHTEIAALHKNQTWDLVDPPKDVNIIGCKWVYKLKYKXDGSV  938

Query  389  GRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDV  544
             R+KARLVA+GFNQ  G D F+TFSPVVK  T+R++L + LS  W +RQLDV
Sbjct  939  DRYKARLVARGFNQTFGLDYFETFSPVVKAATIRIVLTIXLSYRWELRQLDV  990



>emb|CAN68489.1| hypothetical protein VITISV_037543 [Vitis vinifera]
Length=1449

 Score =   131 bits (329),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 62/127 (49%), Positives = 85/127 (67%), Gaps = 0/127 (0%)
 Frame = +2

Query  143   HEMSTRSRSQAPPSALTVQVCPSDPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQ  322
             H M TR+++      +      S+PT + QAVK   W  AM++EF+AL +N TWHLVP  
Sbjct  879   HPMVTRAKNGISKKKVYFSSHISEPTTFTQAVKDSNWVLAMEKEFSALQRNNTWHLVPPP  938

Query  323   AGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLY  502
             +  NIIGCKW ++ K K DG++ R+KARLVA+GF Q  G D F+TFSPVVK + +R++L 
Sbjct  939   SNGNIIGCKWVYKLKYKPDGTVDRYKARLVAQGFTQTLGLDYFETFSPVVKASXIRIILA  998

Query  503   LALSSGW  523
             +ALS  W
Sbjct  999   VALSFNW  1005



>ref|XP_007024404.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 8 [Theobroma 
cacao]
 gb|EOY27026.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 8 [Theobroma 
cacao]
Length=267

 Score =   125 bits (313),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 62/136 (46%), Positives = 84/136 (62%), Gaps = 0/136 (0%)
 Frame = +2

Query  140  THEMSTRSRSQAPPSALTVQVCPSDPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPS  319
            T  +ST+  S A  +         +P    QA+ Y  WREAMD E  AL  N TW +VP 
Sbjct  110  TKNLSTKQLSPAHKAFAIALSHIHEPNSCHQAINYCHWREAMDLELKALQDNGTWTIVPL  169

Query  320  QAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLL  499
             +  ++IGCKW ++ K KA+G I R+KARLVAKG++QV G D  +TFSPV K +TVR+  
Sbjct  170  PSNPHVIGCKWVYKIKMKANGEIERYKARLVAKGYSQVVGFDYQETFSPVAKQSTVRVFF  229

Query  500  YLALSSGWIVRQLDVQ  547
             LA ++GW + QLD+ 
Sbjct  230  ALAAANGWSLSQLDIN  245



>emb|CAN76151.1| hypothetical protein VITISV_012673 [Vitis vinifera]
Length=979

 Score =   130 bits (328),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 80/121 (66%), Gaps = 0/121 (0%)
 Frame = +2

Query  185  ALTVQVCPSDPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRT  364
            +L VQ    +P+ + +A+ + +W+ AM  E+   L N TW LVP      IIGCKW ++ 
Sbjct  581  SLVVQTIVVEPSSFKEAMLHXDWQAAMKIEYVVFLTNSTWKLVPKPVNKRIIGCKWIYKL  640

Query  365  KRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDV  544
            K KADG + R KARLVAKGFNQ  G D F+TF  VVKPTT+R++  LA+S  W+V+QLDV
Sbjct  641  KLKADGLVDRFKARLVAKGFNQTYGIDYFETFCLVVKPTTIRIIFSLAISHXWLVKQLDV  700

Query  545  Q  547
             
Sbjct  701  N  701



>ref|XP_010526681.1| PREDICTED: retrovirus-related Pol polyprotein from transposon 
TNT 1-94 isoform X3 [Tarenaya hassleriana]
Length=1238

 Score =   130 bits (328),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 78/120 (65%), Gaps = 1/120 (1%)
 Frame = +2

Query  185   ALTVQVCPSDPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRT  364
             AL +   P +P  Y QA K+  WR+AM  E  AL++  TW +     G N +GCKW F+T
Sbjct  984   ALNITTAP-EPQSYTQAAKFESWRQAMKLELEALIRTNTWSICTLPDGKNAVGCKWVFKT  1042

Query  365   KRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDV  544
             K  ADGSI RHKARLVAKG+ Q+ G D  +TFSPV K TTVR+LL LA    W++ Q+DV
Sbjct  1043  KYNADGSIERHKARLVAKGYTQLEGVDFSETFSPVAKMTTVRVLLALAAKYNWLINQMDV  1102



>gb|EPS73343.1| hypothetical protein M569_01413 [Genlisea aurea]
Length=776

 Score =   130 bits (326),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 64/139 (46%), Positives = 90/139 (65%), Gaps = 9/139 (6%)
 Frame = +2

Query  158  RSRSQA------PPSALTV---QVCPSDPTCYIQAVKYLEWREAMDQEFNALLQNQTWHL  310
            R+RSQ+      P  AL +      P +P    +A+ +  W+ AM++E  AL  N+TW L
Sbjct  608  RTRSQSGIVKPNPKYALYISHFDSIPLEPKTVKEAISHPGWKAAMEEELAALHHNETWLL  667

Query  311  VPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVR  490
            VP     + IGCKW F+TK + DGS+ R KARLVAKG+NQ+ G D  +TFSPV++P T+R
Sbjct  668  VPRDEASHTIGCKWVFKTKLRPDGSLDRLKARLVAKGYNQIDGVDYTETFSPVIRPGTIR  727

Query  491  LLLYLALSSGWIVRQLDVQ  547
            L+L +AL+  W +RQLDV+
Sbjct  728  LVLSIALTRNWDIRQLDVK  746



>ref|XP_010526678.1| PREDICTED: retrovirus-related Pol polyprotein from transposon 
TNT 1-94 isoform X1 [Tarenaya hassleriana]
Length=1275

 Score =   130 bits (328),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 78/120 (65%), Gaps = 1/120 (1%)
 Frame = +2

Query  185   ALTVQVCPSDPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRT  364
             AL +   P +P  Y QA K+  WR+AM  E  AL++  TW +     G N +GCKW F+T
Sbjct  984   ALNITTAP-EPQSYTQAAKFESWRQAMKLELEALIRTNTWSICTLPDGKNAVGCKWVFKT  1042

Query  365   KRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDV  544
             K  ADGSI RHKARLVAKG+ Q+ G D  +TFSPV K TTVR+LL LA    W++ Q+DV
Sbjct  1043  KYNADGSIERHKARLVAKGYTQLEGVDFSETFSPVAKMTTVRVLLALAAKYNWLINQMDV  1102



>ref|XP_010659200.1| PREDICTED: uncharacterized protein LOC104881290 [Vitis vinifera]
Length=496

 Score =   127 bits (320),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 77/112 (69%), Gaps = 0/112 (0%)
 Frame = +2

Query  212  DPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIG  391
            +PT   QA++  +W  AMD E   L  N+TW LVP  +  NI+GCKW F  KR  DGSI 
Sbjct  277  EPTNASQALQDPKWCAAMDDELATLACNRTWVLVPPPSNHNIVGCKWVFHIKRNLDGSIS  336

Query  392  RHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
            R+KAR VAKGF+Q P  D  DTFSP+VKPTT+R++L +ALS+ W + QLDV 
Sbjct  337  RYKARFVAKGFHQRPRVDYNDTFSPIVKPTTIRVVLSIALSNSWPISQLDVN  388



>emb|CAN65942.1| hypothetical protein VITISV_001716 [Vitis vinifera]
Length=1319

 Score =   130 bits (328),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 78/171 (46%), Positives = 102/171 (60%), Gaps = 19/171 (11%)
 Frame = +2

Query  38   PASLPEQEPHEPSVKPAKRPHGR-PRGKSVKSTVRTHEMSTRSRSQAPPSALTVQVCPSD  214
            P ++ E +P  PS  PA R   R  RG + K T+                 L+V V  S+
Sbjct  778  PEAIYEDQP--PSPSPAPRMTTRLMRGITKKKTILN---------------LSV-VKISE  819

Query  215  PTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGR  394
            P    QA+K   W +AMD E  AL +NQTW LV   + +N+IGCKW ++ K K DGSI R
Sbjct  820  PYTLKQALKDPNWIQAMDLEIAALHRNQTWDLVEQPSEVNLIGCKWVYKLKHKPDGSIER  879

Query  395  HKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
            +KA+LVAKG+NQ  G D F+TFSPVVK  T+R++L +ALS  W +RQLDV 
Sbjct  880  YKAQLVAKGYNQTHGLDYFETFSPVVKAATIRIILTMALSFQWEIRQLDVH  930



>ref|XP_010526680.1| PREDICTED: retrovirus-related Pol polyprotein from transposon 
TNT 1-94 isoform X2 [Tarenaya hassleriana]
Length=1244

 Score =   130 bits (328),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 78/120 (65%), Gaps = 1/120 (1%)
 Frame = +2

Query  185   ALTVQVCPSDPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRT  364
             AL +   P +P  Y QA K+  WR+AM  E  AL++  TW +     G N +GCKW F+T
Sbjct  953   ALNITTAP-EPQSYTQAAKFESWRQAMKLELEALIRTNTWSICTLPDGKNAVGCKWVFKT  1011

Query  365   KRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDV  544
             K  ADGSI RHKARLVAKG+ Q+ G D  +TFSPV K TTVR+LL LA    W++ Q+DV
Sbjct  1012  KYNADGSIERHKARLVAKGYTQLEGVDFSETFSPVAKMTTVRVLLALAAKYNWLINQMDV  1071



>emb|CAN59941.1| hypothetical protein VITISV_017227 [Vitis vinifera]
Length=479

 Score =   127 bits (319),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 80/122 (66%), Gaps = 2/122 (2%)
 Frame = +2

Query  188  LTVQVCPSD--PTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFR  361
            L+  V PSD  PT   QA+K   W  AM +E+ AL+QN TW LVP    MN+I  KW FR
Sbjct  132  LSTSVSPSDQLPTIVSQALKNPNWHTAMVEEYQALVQNNTWTLVPFHPSMNVIXSKWIFR  191

Query  362  TKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLD  541
             K  +DG+I R+KARLVAKGF Q  G +  DTF+PV+K +T+R++  LA++  W +RQ+D
Sbjct  192  VKYNSDGTIQRYKARLVAKGFQQYAGVEFTDTFNPVIKASTIRVVFTLAVTYNWEIRQID  251

Query  542  VQ  547
              
Sbjct  252  FN  253



>emb|CAN64882.1| hypothetical protein VITISV_027289 [Vitis vinifera]
Length=318

 Score =   125 bits (314),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 91/140 (65%), Gaps = 7/140 (5%)
 Frame = +2

Query  149  MSTRSRSQAPPSA-------LTVQVCPSDPTCYIQAVKYLEWREAMDQEFNALLQNQTWH  307
            M TRS+ +  P+        +  +   S+P  Y + +K   W +AM ++  AL+QNQTW 
Sbjct  137  MITRSKLKNDPNLKSQMATFVATRSNISEPKTYCKTLKIPHWFKAMQEKIKALIQNQTWD  196

Query  308  LVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTV  487
            LVP     NI+G K  F+TK K DG++ R++A+LVA+GF+Q+PG D  +TFSPV+K TT+
Sbjct  197  LVPRPTIENIVGSKGVFKTKLKEDGTVDRYEAQLVARGFSQIPGLDFGETFSPVIKHTTI  256

Query  488  RLLLYLALSSGWIVRQLDVQ  547
            RL++ L  + GW +RQLDV+
Sbjct  257  RLIISLTATLGWTIRQLDVK  276



>emb|CAN61322.1| hypothetical protein VITISV_012106 [Vitis vinifera]
Length=1432

 Score =   130 bits (327),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 67/141 (48%), Positives = 90/141 (64%), Gaps = 4/141 (3%)
 Frame = +2

Query  125  KSTVRTHEMSTRSRSQAPPSALTVQVCPSDPTCYIQAVKYLEWREAMDQEFNALLQNQTW  304
            + T R+    T+ ++    SA+ V    S+P+   QA K   W +AM+ E  AL +N TW
Sbjct  862  RMTTRSMRGITKKKTILDLSAIKV----SEPSTLKQAFKDPNWTKAMEMEIAALHRNHTW  917

Query  305  HLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKPTT  484
             LV     +N+IGCKW ++ K K DGSI R+KARLVAKG+NQ  G D F+TFSPVVK  T
Sbjct  918  DLVEQPPNVNVIGCKWVYKLKHKPDGSIERYKARLVAKGYNQTHGLDYFETFSPVVKAAT  977

Query  485  VRLLLYLALSSGWIVRQLDVQ  547
            +R++L +ALS  W +RQLDV 
Sbjct  978  IRIILTVALSFKWEIRQLDVH  998



>emb|CAN80930.1| hypothetical protein VITISV_005279 [Vitis vinifera]
Length=1291

 Score =   130 bits (326),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 75/113 (66%), Gaps = 0/113 (0%)
 Frame = +2

Query  209  SDPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSI  388
            ++PTCY +A ++LEW EAM  E +A+ +N TW L       N IG KW FRTK  +DGSI
Sbjct  788  AEPTCYTEAARFLEWIEAMKAEIDAIERNGTWKLTELPEAKNAIGVKWVFRTKFNSDGSI  847

Query  389  GRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
             RHKARLV KGF QV G D  DTF+PV +  T+RLLL LA   GW V  LDV+
Sbjct  848  FRHKARLVVKGFAQVAGVDYGDTFAPVARHDTIRLLLALAGQRGWKVYHLDVK  900



>emb|CAN73071.1| hypothetical protein VITISV_032383 [Vitis vinifera]
Length=1239

 Score =   130 bits (326),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 75/167 (45%), Positives = 96/167 (57%), Gaps = 13/167 (8%)
 Frame = +2

Query  86   AKRPHGRPRGKSVKSTVRTHEMSTRSRSQA----PPSALTVQVCP---------SDPTCY  226
            A  PH         S++ +H M TR+++       P+ L V             ++P  +
Sbjct  651  ASSPHSIEHAADSSSSLGSHPMITRAKAGIFKTRHPANLGVLGSSGLLSALLSSTEPKGF  710

Query  227  IQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKAR  406
              A K   W  AMD+E  AL QN TW LVP     NI+G KW FRTK   DGS+ R KAR
Sbjct  711  KSAAKNPAWLAAMDEEVQALQQNGTWILVPRPVNTNIVGSKWVFRTKYFPDGSVERLKAR  770

Query  407  LVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
            LVAKG+ QVPG D  DTFSPVVK TTVR++L LA+++ W +RQLDV+
Sbjct  771  LVAKGYTQVPGLDYTDTFSPVVKATTVRVVLSLAVTNKWPLRQLDVK  817



>ref|XP_008352732.1| PREDICTED: uncharacterized protein LOC103416253 [Malus domestica]
Length=1059

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 68/147 (46%), Positives = 90/147 (61%), Gaps = 9/147 (6%)
 Frame = +2

Query  134  VRTHEMSTRSRS---------QAPPSALTVQVCPSDPTCYIQAVKYLEWREAMDQEFNAL  286
            + TH M TR+++              A +V +   +P  Y  A+K   W  A ++E  AL
Sbjct  620  MNTHXMQTRAKNGILKKKACLSVVQDAESVDLSQMEPATYKSALKPPLWFSAREEELVAL  679

Query  287  LQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSP  466
                TW LVP     N++GCKW F+ KR ADG+I R+KA+LVAKGFNQ  G D  +TFSP
Sbjct  680  KTQHTWSLVPLPHNKNLVGCKWVFKIKRHADGTISRYKAKLVAKGFNQEEGIDYGETFSP  739

Query  467  VVKPTTVRLLLYLALSSGWIVRQLDVQ  547
            VVKPTTVRL++ LA + GW +RQLDV+
Sbjct  740  VVKPTTVRLVIALAANFGWSLRQLDVK  766



>ref|XP_008364216.1| PREDICTED: uncharacterized protein LOC103427909 [Malus domestica]
Length=917

 Score =   129 bits (324),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 73/146 (50%), Positives = 87/146 (60%), Gaps = 8/146 (5%)
 Frame = +2

Query  134  VRTHEMSTRSRSQAPPS-ALTVQV-------CPSDPTCYIQAVKYLEWREAMDQEFNALL  289
            V  H M TRS+S      AL  QV          +P  Y  A+K   W  AM  E  AL 
Sbjct  755  VNLHPMQTRSKSGIIKKLALLAQVQHGGVXLTQVEPATYKSALKSPVWFTAMQDEILALH  814

Query  290  QNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPV  469
               TW LVP     N+IGCKW ++ K+  DGSIGR+KARLVAKGFNQ  G D  +TFSPV
Sbjct  815  NQGTWLLVPLPCHKNLIGCKWVYKIKKNDDGSIGRYKARLVAKGFNQEEGIDYGETFSPV  874

Query  470  VKPTTVRLLLYLALSSGWIVRQLDVQ  547
            VKPTTVR++L L+   GW +RQLDV+
Sbjct  875  VKPTTVRIVLALSAHFGWTLRQLDVK  900



>emb|CAN72201.1| hypothetical protein VITISV_014985 [Vitis vinifera]
Length=398

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 72/95 (76%), Gaps = 0/95 (0%)
 Frame = +2

Query  263  MDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQ  442
            M+ EF+AL+QN TW LVPS +  N++GCKW FR KR  DGSI R+KA+LVAK F+Q P  
Sbjct  1    MNDEFDALVQNGTWELVPSTSMQNLVGCKWVFRIKRLPDGSIDRYKAKLVAKCFHQRPDV  60

Query  443  DIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
            D  DTFS VVKPTT+RL+L LA+S  W +RQLDV 
Sbjct  61   DYHDTFSLVVKPTTIRLVLSLAISKDWQLRQLDVN  95



>emb|CAN81099.1| hypothetical protein VITISV_017741 [Vitis vinifera]
Length=1455

 Score =   129 bits (325),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 70/171 (41%), Positives = 99/171 (58%), Gaps = 6/171 (4%)
 Frame = +2

Query  50    PEQEPHEPSVKPAKRPHGRPRGKSVKSTV-----RTHEMSTRSRSQAPPSALTVQVCPSD  214
             P Q    P   P +         SV  T+      TH M TR++S      + +     +
Sbjct  878   PAQVVSNPVATPVQHVVSSIADASVTRTIAKDADNTHPMITRAKSGIVKPKIFIAAI-RE  936

Query  215   PTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGR  394
             P+    A++  EW++AM  E++AL +N TW LVP  AG   IGCKW ++TK   DG++ +
Sbjct  937   PSSVSAALQQDEWKKAMVAEYDALQRNNTWSLVPLPAGRQAIGCKWVYKTKENPDGTVQK  996

Query  395   HKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
             +KARLVAKGF+Q  G D  +TFSPVVKP+TVR++  +ALS  W ++QLDV 
Sbjct  997   YKARLVAKGFHQQAGFDFTETFSPVVKPSTVRVVFTIALSRNWAIKQLDVN  1047



>emb|CAN77122.1| hypothetical protein VITISV_013624 [Vitis vinifera]
Length=1269

 Score =   129 bits (324),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 74/112 (66%), Gaps = 0/112 (0%)
 Frame = +2

Query  212  DPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIG  391
            +PTCY +A ++LEW EAM  E +A+ +N TW L       N IG KW FRTK  +DGSI 
Sbjct  772  EPTCYTEAARFLEWIEAMKAEIDAIERNGTWKLTELPEAKNAIGVKWVFRTKFNSDGSIF  831

Query  392  RHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
            RHKARLV KGF QV G D  DTF+PV +  T+RLLL LA   GW V  LDV+
Sbjct  832  RHKARLVVKGFAQVAGVDYGDTFAPVARHDTIRLLLALAGQMGWKVYHLDVK  883



>emb|CAN78022.1| hypothetical protein VITISV_015518 [Vitis vinifera]
Length=1501

 Score =   129 bits (325),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 72/167 (43%), Positives = 93/167 (56%), Gaps = 13/167 (8%)
 Frame = +2

Query  86   AKRPHGRPRGKSVKSTVRTHEMSTRSRSQ-------------APPSALTVQVCPSDPTCY  226
            A  PH         S++ +H M TR+++                   L   +  ++P  +
Sbjct  768  ASSPHSIEHAADSSSSLGSHPMITRAKAGIFKTRHPANLGVLGSSGLLXALLASTEPKGF  827

Query  227  IQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKAR  406
              A K   W  AMD+E  AL QN TW LVP     NI+G KW FRTK   DGS+ R KAR
Sbjct  828  KSAAKNPAWLAAMDEEVQALQQNGTWILVPRPVNTNIVGSKWVFRTKYLPDGSVERLKAR  887

Query  407  LVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
            LVAKG+  VPG D  DTFSPVVK TTVR++L LA+++ W +RQLDV+
Sbjct  888  LVAKGYTXVPGLDYTDTFSPVVKATTVRVVLSLAVTNKWPLRQLDVK  934



>emb|CAN68235.1| hypothetical protein VITISV_037104 [Vitis vinifera]
Length=2041

 Score =   129 bits (325),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 62/113 (55%), Positives = 75/113 (66%), Gaps = 0/113 (0%)
 Frame = +2

Query  209   SDPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSI  388
             ++PTCY +A ++LEW EAM  E +A+ +N TW L       N IG KW FRTK  +DGSI
Sbjct  1526  AEPTCYTEAARFLEWIEAMKAEIDAIERNGTWKLTELPEAKNAIGVKWVFRTKFNSDGSI  1585

Query  389   GRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
              RHKARLV KGF QV G D  DTF+PV +  T+RLLL LA   GW V  LDV+
Sbjct  1586  FRHKARLVVKGFAQVAGVDYGDTFAPVARHDTIRLLLALAGQMGWKVYHLDVK  1638



>emb|CAN74767.1| hypothetical protein VITISV_041860 [Vitis vinifera]
Length=1945

 Score =   129 bits (325),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 75/113 (66%), Gaps = 0/113 (0%)
 Frame = +2

Query  209  SDPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSI  388
            ++PTCY +A ++LEW EAM  E +A+ +N TW L       N IG KW FRTK  +DGSI
Sbjct  881  AEPTCYTEAARFLEWIEAMKAEIDAIERNGTWKLTELPEAKNAIGVKWVFRTKFNSDGSI  940

Query  389  GRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
             RHKARLV KGF QV G D  DTF+PV +  T+RLLL LA   GW V  LDV+
Sbjct  941  FRHKARLVVKGFAQVAGVDYGDTFAPVARHDTIRLLLALAGQMGWKVYHLDVK  993



>ref|XP_004958843.1| PREDICTED: uncharacterized protein LOC101772504 [Setaria italica]
Length=515

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 75/102 (74%), Gaps = 0/102 (0%)
 Frame = +2

Query  212  DPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIG  391
            +P    +A+   +WR+AM+ EF+AL +NQTW LVPS++G NII CKW ++ KRKADGS+ 
Sbjct  398  EPNSVQEALANSKWRQAMEAEFDALKKNQTWRLVPSKSGQNIIDCKWVYKIKRKADGSLD  457

Query  392  RHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSS  517
            R+KARLVAKGF Q  G D  DTFSPVVK  TVRL+   AL +
Sbjct  458  RYKARLVAKGFKQRYGIDYEDTFSPVVKIATVRLVFINALKT  499



>ref|XP_009342325.1| PREDICTED: uncharacterized protein LOC103934297 [Pyrus x bretschneideri]
Length=226

 Score =   122 bits (306),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 76/106 (72%), Gaps = 0/106 (0%)
 Frame = +2

Query  227  IQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKAR  406
            ++A KYLEW +AM +EFNALLQ  TW LV   + MN++  KW +R KR +DGSI R+KAR
Sbjct  121  LRANKYLEWPQAMAKEFNALLQTGTWSLVQFLSFMNVLPNKWVYRIKRHSDGSIQRYKAR  180

Query  407  LVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDV  544
            L+A GF+Q  G D  +TFSPVV   T+RL+L +AL   W +RQLDV
Sbjct  181  LLANGFHQQDGIDYSETFSPVVTYATIRLILSIALHYNWPIRQLDV  226



>ref|XP_008365257.1| PREDICTED: uncharacterized protein LOC103428904 [Malus domestica]
Length=884

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/171 (40%), Positives = 92/171 (54%), Gaps = 3/171 (2%)
 Frame = +2

Query  38   PASLPEQEPHEPSVKPAKRPHGRPRGKSVKSTVRTHE--MSTRSRSQAPPSALTVQVCPS  211
            P ++ E     PS  PA  P         +   R H+  + T ++   P S  ++   P 
Sbjct  416  PCNITECSSSTPSFAPAPIPINF-HXMLTRDKARIHKPKVFTATKHSLPASVDSITCLPX  474

Query  212  DPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIG  391
             PT ++QA K   W  AM  EF AL    TW LV     +N++GCKW F+ K + DG I 
Sbjct  475  XPTTFLQAXKNPNWMAAMKXEFQALQSTGTWDLVHFHPELNLVGCKWVFKVKHRPDGXIE  534

Query  392  RHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDV  544
              K RLVAKGF+Q  G D  +TFSPV KPTT+R+LL +A+S  W + QLDV
Sbjct  535  WXKXRLVAKGFHQQEGLDFTETFSPVAKPTTIRILLSIAVSYDWFIHQLDV  585



>ref|XP_004963727.1| PREDICTED: uncharacterized protein LOC101777694 [Setaria italica]
Length=1416

 Score =   129 bits (324),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/148 (47%), Positives = 88/148 (59%), Gaps = 1/148 (1%)
 Frame = +2

Query  107   PRGKSVKSTVRTHEMSTRSRSQA-PPSALTVQVCPSDPTCYIQAVKYLEWREAMDQEFNA  283
             P    V+  + TH M+TR +     P+          P  Y  A+    WR+AM +EF+A
Sbjct  863   PGAVPVRPVINTHSMTTRGKMGFWQPTLFHSSSLSPVPRSYRGALADPNWRQAMHEEFDA  922

Query  284   LLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFS  463
             LL N TW LVP  +G NI+  KW F+ K  ADGS+ R+KAR V +GF Q PG D  +TFS
Sbjct  923   LLSNNTWDLVPRPSGSNIVTGKWIFKHKFHADGSLERYKARWVLRGFTQRPGVDFSETFS  982

Query  464   PVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
             PVVKP TVR +L LALS  W + QLDV+
Sbjct  983   PVVKPATVRTVLSLALSCQWPIHQLDVK  1010



>ref|XP_010473832.1| PREDICTED: uncharacterized protein LOC104753254 [Camelina sativa]
Length=499

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/142 (46%), Positives = 92/142 (65%), Gaps = 7/142 (5%)
 Frame = +2

Query  143  HEMSTRSRSQA--PPSALTVQVC-----PSDPTCYIQAVKYLEWREAMDQEFNALLQNQT  301
            H M+TR ++    P +   + V      P +PT   QA+K  +WR AM  E +A  +NQT
Sbjct  216  HSMTTRRKNNIIKPNTKFNLYVALSRHIPPEPTTVNQALKDRKWRGAMSTEIDAFARNQT  275

Query  302  WHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKPT  481
              LVP Q+  N++GCKW F+ K  ++GS+GR KARLVAKG++Q  G+D   TFSPV+K T
Sbjct  276  LDLVPRQSHFNVVGCKWLFKNKFLSNGSLGRCKARLVAKGYSQQLGRDYDQTFSPVIKST  335

Query  482  TVRLLLYLALSSGWIVRQLDVQ  547
            T+RL+L +A+S  W ++QLDV 
Sbjct  336  TIRLVLDVAVSKSWPIKQLDVN  357



>ref|XP_008376990.1| PREDICTED: uncharacterized protein LOC103440084 [Malus domestica]
Length=1106

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 74/109 (68%), Gaps = 0/109 (0%)
 Frame = +2

Query  218  TCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRH  397
            + Y+QA K+  WR AM  E+NAL    TW LVP Q+  NI+GCKW F  K+  DG+I R+
Sbjct  588  STYLQASKHAHWRSAMQDEYNALQSTGTWSLVPFQSHQNIVGCKWVFXVKKHPDGTIDRY  647

Query  398  KARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDV  544
            KARLVAKGF+   G D  +TFSPV KP T+R+LL LA+   W + QLD+
Sbjct  648  KARLVAKGFHXQAGLDYKETFSPVAKPXTIRILLSLAVQXDWFLNQLDI  696



>ref|XP_004980642.1| PREDICTED: uncharacterized protein LOC101772525 [Setaria italica]
Length=469

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 80/119 (67%), Gaps = 12/119 (10%)
 Frame = +2

Query  188  LTVQVCPS------------DPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGM  331
            LTV+ C S            +P    +A+   +WR+AM+ EF+AL +NQTW LVPS++G 
Sbjct  328  LTVRDCYSGHDQVYTASGTGEPNSVQEALANSKWRQAMEAEFDALKKNQTWRLVPSKSGQ  387

Query  332  NIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLA  508
            NII CKW ++ KRKADGS+ R+KARLVAKGF Q  G D  DTFSPVVK  TVRL+  LA
Sbjct  388  NIIDCKWVYKIKRKADGSLDRYKARLVAKGFKQRYGIDYEDTFSPVVKIATVRLVSVLA  446



>emb|CAN75149.1| hypothetical protein VITISV_027193 [Vitis vinifera]
Length=587

 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 76/116 (66%), Gaps = 0/116 (0%)
 Frame = +2

Query  200  VCPSDPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKAD  379
            V  S+P  Y QA K   W +AM  E+ ALL N TW LVP     +I GC W ++ K   +
Sbjct  272  VTTSEPHTYNQASKSEPWVQAMQHEYQALLHNHTWSLVPPPPSAHIFGCCWIYKLKYLLN  331

Query  380  GSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
            GS+ RHKARLVA+GF Q  G D FDTFSPVVKP T+ L+L LA+S  W +RQLDV+
Sbjct  332  GSVERHKARLVAQGFTQTLGLDYFDTFSPVVKPCTILLILALAVSFQWPIRQLDVE  387



>ref|XP_008392161.1| PREDICTED: uncharacterized protein LOC103454341 [Malus domestica]
Length=483

 Score =   125 bits (315),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 76/180 (42%), Positives = 99/180 (55%), Gaps = 16/180 (9%)
 Frame = +2

Query  38   PASLPEQEPHEPSVKPAKRPHGRPRGKSVKSTVRTHEMSTRSR----------SQAPPSA  187
            PAS     P +P+ KP       P        +  H M TRS+          S+   S+
Sbjct  63   PASSSTSLPVDPNFKPDLLQVVLPIAP-----LNLHPMKTRSKDGIVKKKVFLSKVHDSS  117

Query  188  LTVQVCPSDPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTK  367
            + V +   +P  Y  A+K   W  AM  +  AL   QTW LVP  +  N++GCKW F+ K
Sbjct  118  V-VDLTQVEPATYKSALKVSVWLNAMRXKLVALQHQQTWSLVPLPSNKNLVGCKWVFKLK  176

Query  368  RKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
              ++GSI RHKARLVAKGF+Q  G D  +TFSPVVKPTTVRL+L +A    W +RQLDV+
Sbjct  177  XNSNGSIARHKARLVAKGFSQEXGLDYGETFSPVVKPTTVRLVLAMAAHFNWPLRQLDVK  236



>gb|AAK62788.1|AC027036_9 polyprotein, putative [Arabidopsis thaliana]
 dbj|BAB84015.1| polyprotein [Arabidopsis thaliana]
Length=1466

 Score =   129 bits (323),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 66/144 (46%), Positives = 92/144 (64%), Gaps = 6/144 (4%)
 Frame = +2

Query  134   VRTHEMSTRSRSQA----PPSALTVQVCP-SDPTCYIQAVKYLEWREAMDQEFNALLQNQ  298
             + TH M TR+++      P  +L V +   S+P   IQA+K   WR AM  E NA + N 
Sbjct  924   LNTHSMGTRAKAGIIKPNPKYSLAVSLAAESEPRTAIQALKDERWRNAMGSEINAQIGNH  983

Query  299   TWHLVPSQ-AGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVK  475
             TW LVP   + + I+GC+W F  K  +DGS+ R+KARLVAKG+NQ PG D  +TFSPV+K
Sbjct  984   TWDLVPPPPSHVTIVGCRWIFTKKYNSDGSLNRYKARLVAKGYNQRPGLDYAETFSPVIK  1043

Query  476   PTTVRLLLYLALSSGWIVRQLDVQ  547
              T++R++L +A+   W +RQLDV 
Sbjct  1044  STSIRIVLGVAVDRSWPIRQLDVN  1067



>ref|XP_010058987.1| PREDICTED: uncharacterized protein LOC104446890 [Eucalyptus grandis]
Length=1378

 Score =   129 bits (323),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 91/157 (58%), Gaps = 25/157 (16%)
 Frame = +2

Query  122  VKSTVRTHEMSTRSRS---------------QAPPSALTVQVCPSDPTCYIQAVKYLEWR  256
            V+ T  TH M TRS+S               Q PP   +V+   +DP           W 
Sbjct  829  VQGTQPTHHMQTRSKSGIVKVNPRYACLAQYQVPPEPKSVKSALADPG----------WY  878

Query  257  EAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVP  436
            +AM +E NAL  NQTW LVP    MN+IGCKW F+TK  + GS+ R KARLVAKGF+Q  
Sbjct  879  QAMQEEMNALHHNQTWLLVPRTNNMNVIGCKWVFKTKLTSTGSLDRLKARLVAKGFHQEQ  938

Query  437  GQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
            G D  +TFSPV+K +TVRL+L +A+   W + QLDV+
Sbjct  939  GIDFTETFSPVIKHSTVRLILSVAMVKHWSMHQLDVK  975



>ref|XP_009614297.1| PREDICTED: uncharacterized protein LOC104107258 [Nicotiana tomentosiformis]
Length=291

 Score =   123 bits (309),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 74/109 (68%), Gaps = 2/109 (2%)
 Frame = +2

Query  212  DPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIG  391
            +P+CY  AVK   WR+AM  EFNALL N TW LVP    +N++GCKW +R   K DGSI 
Sbjct  29   EPSCYSSAVKVSRWRDAMADEFNALLANHTWSLVPRPPNINVVGCKWVYRV--KFDGSID  86

Query  392  RHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQL  538
            R KARLV KG+ Q  G D   TFS V++P TVRL+L +ALS GW+ + L
Sbjct  87   RCKARLVDKGYTQSYGVDYGKTFSLVIRPATVRLVLSIALSRGWLHKAL  135



>ref|XP_004966833.1| PREDICTED: uncharacterized protein LOC101766505 [Setaria italica]
Length=943

 Score =   128 bits (321),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 76/163 (47%), Positives = 98/163 (60%), Gaps = 7/163 (4%)
 Frame = +2

Query  122  VKSTVRTHEMSTRSRS--QAPPSALTVQV--CPSDPTCYIQAVKYLEWREAMDQEFNALL  289
            ++  V  H M TR +S  + P   L +      + P  +  A+    WR AM  EF+ALL
Sbjct  490  IEPVVNDHGMRTRGKSGFRQPVDRLNLHTTTLSAVPKSFRSALADPHWRAAMQAEFDALL  549

Query  290  QNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPV  469
             N TW LVP  +G+NII  KW FR K  ADGS+ R+KAR V +GF Q PG D  +TFSPV
Sbjct  550  ANDTWTLVPRPSGVNIITGKWIFRHKFLADGSLDRYKARWVLRGFTQRPGIDYEETFSPV  609

Query  470  VKPTTVRLLLYLALSSGWIVRQLDVQ**AYLGQIHSNFQISYC  598
            VKP TVR++L LALS  W + QLDV+  A+L  I +  +I YC
Sbjct  610  VKPATVRVVLTLALSRSWPIHQLDVK-NAFLHGILT--EIVYC  649



>emb|CAN83877.1| hypothetical protein VITISV_014760 [Vitis vinifera]
Length=707

 Score =   127 bits (319),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 76/179 (42%), Positives = 105/179 (59%), Gaps = 6/179 (3%)
 Frame = +2

Query  14   SLLHTANEPASLPEQEPHEPSVKPAKRPHGRPRGKSVKSTVRT-HEMSTRSRSQAPPSAL  190
            SLL +    ++ P      P V  +  P    RGK+     R  H M   S SQ   + L
Sbjct  233  SLLDSIATDSTTPSLVSSSPRVTNSSHPM-ITRGKAGIFKPRLYHVMHISSSSQLFQALL  291

Query  191  TVQVCPSDPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKR  370
             ++    +P  +  A K+ +W  AMD E +AL +N TW LVP     N++GC+W F+TK 
Sbjct  292  ALK----EPCGFKPAAKHPKWLSAMDDEIHALKKNDTWVLVPRPQHHNVVGCRWVFKTKL  347

Query  371  KADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
             +DGSI RHKA LVA+GF+QV G D  DTFSPVV+P TVR++L LA++SG  + +LDV+
Sbjct  348  HSDGSIERHKACLVAQGFSQVHGLDFGDTFSPVVRPATVRIILSLAVTSGLRLHKLDVK  406



>ref|XP_008393396.1| PREDICTED: uncharacterized protein LOC103455594 [Malus domestica]
Length=509

 Score =   125 bits (314),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 69/147 (47%), Positives = 87/147 (59%), Gaps = 9/147 (6%)
 Frame = +2

Query  134  VRTHEMSTRSRSQAPP-SALTVQVCPS--------DPTCYIQAVKYLEWREAMDQEFNAL  286
            +  H M TRS+S      AL V +  S        +PT Y  A+K   W +AM +E NAL
Sbjct  239  INLHHMQTRSKSGIIKRKALLVALADSSEVDLSVIEPTSYKNALKVPIWYKAMQEEINAL  298

Query  287  LQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSP  466
                 W LV   +  N++GCKW F+ KR ADGSI RHKA LVAKGF+Q PG D  +TFS 
Sbjct  299  HSQGIWSLVSLPSQNNLVGCKWVFKLKRNADGSIARHKAHLVAKGFSQEPGLDFGETFSL  358

Query  467  VVKPTTVRLLLYLALSSGWIVRQLDVQ  547
            VVKPT VRL++ L    GW ++QL V+
Sbjct  359  VVKPTIVRLVISLVAHFGWPLQQLYVK  385



>emb|CAN77085.1| hypothetical protein VITISV_044282 [Vitis vinifera]
Length=1520

 Score =   128 bits (322),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 72/100 (72%), Gaps = 0/100 (0%)
 Frame = +2

Query  248  EWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFN  427
            +WR+AM  EF AL+ + TW LVP  +  NIIGCKW F  KR  DG++ R KA LVAKGFN
Sbjct  706  QWRKAMANEFTALVSHGTWKLVPQSSASNIIGCKWVFHVKRHPDGTVDRFKAGLVAKGFN  765

Query  428  QVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
            Q P  D  +TFSP++KPTT+RL+L LA S+GW + QL+V 
Sbjct  766  QRPDVDYTETFSPIIKPTTIRLILSLAFSNGWSLHQLNVN  805



>emb|CAN71823.1| hypothetical protein VITISV_007329 [Vitis vinifera]
Length=678

 Score =   126 bits (317),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 78/112 (70%), Gaps = 0/112 (0%)
 Frame = +2

Query  212  DPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIG  391
            +P  +  A K+ +W  AMD E  AL +N TW LVP     N++GC W F+TK  A+GSI 
Sbjct  238  EPRGFKSAAKHPKWLSAMDDEIQALKKNDTWDLVPCPVNHNVVGCCWIFKTKLHANGSIE  297

Query  392  RHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
            RHKARLVAKGF+ + G D  DTF+PVV+P T+R++L +A++SGW +  LDV+
Sbjct  298  RHKARLVAKGFSXIHGLDFRDTFNPVVRPATIRIILSIAVTSGWPLHLLDVK  349



>ref|XP_009587426.1| PREDICTED: uncharacterized protein LOC104085156 [Nicotiana tomentosiformis]
Length=559

 Score =   125 bits (313),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 75/111 (68%), Gaps = 0/111 (0%)
 Frame = +2

Query  215  PTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGR  394
            P  Y QA K  EWR+AM +E  AL+ N+TW LVP     N+IGCKW FR K+KADG+I R
Sbjct  374  PHTYKQAAKSKEWRDAMQKEVGALVMNETWSLVPPSFTQNVIGCKWVFRVKQKADGNIDR  433

Query  395  HKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
             KA+LVAKGF+Q    D   TFSPVVKP+++RL+L  A    W + +LDV 
Sbjct  434  LKAQLVAKGFHQRSDIDFKTTFSPVVKPSSIRLILTFATYFKWPLYELDVN  484



>emb|CAN67546.1| hypothetical protein VITISV_027734 [Vitis vinifera]
Length=1635

 Score =   127 bits (320),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 74/181 (41%), Positives = 103/181 (57%), Gaps = 17/181 (9%)
 Frame = +2

Query  5    APSSLLHTANEPASLPEQEPHEPSVKPAKRPHGRPRGKSVKSTVRTHEMSTRSRSQAPPS  184
            +P+    ++  P  + E +P  PS  P             + T R     T+ ++    S
Sbjct  629  SPTVTXASSTLPEDIHEDQPPSPSPAP-------------RMTTRLIRGITKKKTILDLS  675

Query  185  ALTVQVCPSDPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRT  364
            A+ +    S+P    QA+K   W +AMD E  AL +NQTW LV   + +N+IG KW ++ 
Sbjct  676  AVKI----SEPYTLKQALKDPNWIQAMDLEIXALHRNQTWDLVEQPSEVNLIGXKWVYKL  731

Query  365  KRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDV  544
            K K DGSI R+KARLVAKG+NQ  G D F+TFSPVVK  T+R++L +ALS  W +RQLDV
Sbjct  732  KHKPDGSIERYKARLVAKGYNQTHGLDYFETFSPVVKAATIRIILTVALSFQWEIRQLDV  791

Query  545  Q  547
             
Sbjct  792  H  792



>dbj|BAA78423.1| polyprotein [Arabidopsis thaliana]
Length=1431

 Score =   127 bits (320),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 91/144 (63%), Gaps = 6/144 (4%)
 Frame = +2

Query  134   VRTHEMSTRSRSQA----PPSALTVQVCP-SDPTCYIQAVKYLEWREAMDQEFNALLQNQ  298
             + TH M TR+++      P  +L V +   S+P   IQA+K   WR AM  E NA + N 
Sbjct  889   LNTHSMGTRAKAGIIKPNPKYSLAVSLAAESEPRTAIQALKDERWRNAMGSEINAQIGNH  948

Query  299   TWHLVPSQ-AGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVK  475
             TW LVP   + + I+GC+W F  K  +DGS+ R+KAR VAKG+NQ PG D  +TFSPV+K
Sbjct  949   TWDLVPPPPSHVTIVGCRWIFTKKYNSDGSLNRYKARFVAKGYNQRPGLDYAETFSPVIK  1008

Query  476   PTTVRLLLYLALSSGWIVRQLDVQ  547
              T++R++L +A+   W +RQLDV 
Sbjct  1009  STSIRIVLGVAVDRSWPIRQLDVN  1032



>gb|AAK62793.1|AC027036_14 polyprotein, putative [Arabidopsis thaliana]
 dbj|BAK41510.1| polyprotein [Arabidopsis thaliana]
Length=1466

 Score =   127 bits (320),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 91/144 (63%), Gaps = 6/144 (4%)
 Frame = +2

Query  134   VRTHEMSTRSRSQA----PPSALTVQVCP-SDPTCYIQAVKYLEWREAMDQEFNALLQNQ  298
             + TH M TR+++      P  +L V +   S+P   IQA+K   WR AM  E NA + N 
Sbjct  924   LNTHSMGTRAKAGIIKPNPKYSLAVSLAAESEPRTAIQALKDERWRNAMGSEINAQIGNH  983

Query  299   TWHLVPSQ-AGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVK  475
             TW LVP   + + I+GC+W F  K  +DGS+ R+KAR VAKG+NQ PG D  +TFSPV+K
Sbjct  984   TWDLVPPPPSHVTIVGCRWIFTKKYNSDGSLNRYKARFVAKGYNQRPGLDYAETFSPVIK  1043

Query  476   PTTVRLLLYLALSSGWIVRQLDVQ  547
              T++R++L +A+   W +RQLDV 
Sbjct  1044  STSIRIVLGVAVDRSWPIRQLDVN  1067



>dbj|BAA78425.1| polyprotein [Arabidopsis thaliana]
 dbj|BAK41505.1| polyprotein [Arabidopsis thaliana]
 dbj|BAK41506.1| polyprotein [Arabidopsis thaliana]
 dbj|BAK41508.1| polyprotein [Arabidopsis thaliana]
 dbj|BAK41509.1| polyprotein [Arabidopsis thaliana]
Length=1447

 Score =   127 bits (320),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 89/144 (62%), Gaps = 6/144 (4%)
 Frame = +2

Query  134   VRTHEMSTRSRSQAPPSALTVQVC-----PSDPTCYIQAVKYLEWREAMDQEFNALLQNQ  298
             + TH M TR+++      L   +       S+P   IQA+K   WR AM  E NA + N 
Sbjct  905   INTHSMGTRAKAGIIKPNLKYSLAVSLAAESEPRTAIQALKDERWRNAMGSEINAQIGNH  964

Query  299   TWHLVPSQ-AGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVK  475
             TW LVP   + + I+GC+W F  K  +DGS+ R+KARLVAKG+NQ PG D  +TFSPV+K
Sbjct  965   TWDLVPPPPSHVTIVGCRWIFTKKYNSDGSLNRYKARLVAKGYNQRPGLDYVETFSPVIK  1024

Query  476   PTTVRLLLYLALSSGWIVRQLDVQ  547
              T++R++L +A+   W +RQLDV 
Sbjct  1025  STSIRIVLGVAVDRSWPIRQLDVN  1048



>ref|XP_008340383.1| PREDICTED: uncharacterized protein LOC103403351 [Malus domestica]
Length=946

 Score =   127 bits (318),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 76/118 (64%), Gaps = 0/118 (0%)
 Frame = +2

Query  194  VQVCPSDPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRK  373
            V +   +P  Y  A+    W   M++E   L    TW LVP     N++GCKW F+ KR 
Sbjct  707  VDLSQMEPATYKSALTSHLWFSTMEEELATLKTQHTWSLVPLPHNKNLVGCKWVFKLKRH  766

Query  374  ADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
            ADG+I R+KARLVAKGFNQ  G D  +TFSPVVKPTTVRL++ LA   GW +RQLDV+
Sbjct  767  ADGTISRYKARLVAKGFNQEEGIDYGETFSPVVKPTTVRLVIALAAXFGWSLRQLDVK  824



>dbj|BAK41507.1| polyprotein [Arabidopsis thaliana]
Length=1447

 Score =   127 bits (320),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 89/144 (62%), Gaps = 6/144 (4%)
 Frame = +2

Query  134   VRTHEMSTRSRSQAPPSALTVQVC-----PSDPTCYIQAVKYLEWREAMDQEFNALLQNQ  298
             + TH M TR+++      L   +       S+P   IQA+K   WR AM  E NA + N 
Sbjct  905   INTHSMGTRAKAGIIKPNLKYSLAVSLAAESEPRTAIQALKDERWRNAMGSEINAQIGNH  964

Query  299   TWHLVPSQ-AGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVK  475
             TW LVP   + + I+GC+W F  K  +DGS+ R+KARLVAKG+NQ PG D  +TFSPV+K
Sbjct  965   TWDLVPPPPSHVTIVGCRWIFTKKYNSDGSLNRYKARLVAKGYNQRPGLDYVETFSPVIK  1024

Query  476   PTTVRLLLYLALSSGWIVRQLDVQ  547
              T++R++L +A+   W +RQLDV 
Sbjct  1025  STSIRIVLGVAVDRSWPIRQLDVN  1048



>ref|XP_010051209.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104439906 
[Eucalyptus grandis]
Length=2021

 Score =   127 bits (320),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 68/152 (45%), Positives = 91/152 (60%), Gaps = 5/152 (3%)
 Frame = +2

Query  107   PRGKSVKSTVRTHEMSTRSRS----QAPPSALTVQV-CPSDPTCYIQAVKYLEWREAMDQ  271
             P   +   T  +H M TRS+S      P  A   +   P++P     A+    W  AM +
Sbjct  927   PTTSTSHGTPTSHHMQTRSKSGIIKTNPKYACLAEYKVPAEPRSVKSALANQGWYTAMKE  986

Query  272   EFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIF  451
             E +AL  NQTW L+P    MN+IGCKW F+TK  +DGS+ R KARLVAKGF+Q  G D  
Sbjct  987   EMDALHHNQTWILIPRTTDMNVIGCKWVFKTKLASDGSLDRLKARLVAKGFHQEEGVDFT  1046

Query  452   DTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
             +TFSPVVK  T+RL+L +A+ + W + QLDV+
Sbjct  1047  ETFSPVVKHATIRLVLSVAMMNQWPIHQLDVK  1078



>emb|CAN75319.1| hypothetical protein VITISV_034031 [Vitis vinifera]
Length=771

 Score =   126 bits (317),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 65/154 (42%), Positives = 96/154 (62%), Gaps = 9/154 (6%)
 Frame = +2

Query  107  PRGKSVKSTVRTHEMSTRSRSQAPPSALTVQVC-------PSDPTCYIQAVKYLEWREAM  265
            P+G+ + +  +   M TRS+ +  PS  +  V         S+P  Y   +K   W +AM
Sbjct  267  PQGQHIDN--KGTHMITRSKLKNDPSLKSQMVTFVATRSDISEPKTYRTTLKIPHWLKAM  324

Query  266  DQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQD  445
             +E   L+QN+TW LVP     NI+G KW F+TK K D +I R+KARL+A+GF+Q+PG  
Sbjct  325  HKEIKILIQNRTWDLVPRLPTTNIVGSKWVFKTKLKEDETIDRYKARLIARGFSQIPGLG  384

Query  446  IFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
              +T SPV+K TT+R++L LA++ GW +RQLDV+
Sbjct  385  FGETLSPVIKYTTIRVILSLAVTLGWTMRQLDVK  418



>dbj|BAM42649.1| Polyprotein [Arabidopsis thaliana]
Length=1475

 Score =   127 bits (319),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/144 (46%), Positives = 89/144 (62%), Gaps = 6/144 (4%)
 Frame = +2

Query  134   VRTHEMSTRSRS-----QAPPSALTVQVCPSDPTCYIQAVKYLEWREAMDQEFNALLQNQ  298
             V TH M+TR++          S  T     S+P   IQA+K   WR+AM  E NA + N 
Sbjct  926   VNTHSMATRAKDGIRKPNQKYSYATSLAANSEPRTAIQAMKDDRWRQAMGSEINAQIGNH  985

Query  299   TWHLVPSQA-GMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVK  475
             TW LVP     + I+GC+W F  K  +DGS+ R+KARLVAKG+NQ PG D  +TFSPV+K
Sbjct  986   TWDLVPPPPPSVTIVGCRWIFTKKFNSDGSLNRYKARLVAKGYNQRPGLDYAETFSPVIK  1045

Query  476   PTTVRLLLYLALSSGWIVRQLDVQ  547
              T++R++L +A+   W +RQLDV 
Sbjct  1046  STSIRIVLGVAVDRSWPIRQLDVN  1069



>dbj|BAM42646.1| polyprotein [Arabidopsis thaliana]
Length=1475

 Score =   127 bits (319),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/144 (46%), Positives = 89/144 (62%), Gaps = 6/144 (4%)
 Frame = +2

Query  134   VRTHEMSTRSRS-----QAPPSALTVQVCPSDPTCYIQAVKYLEWREAMDQEFNALLQNQ  298
             V TH M+TR++          S  T     S+P   IQA+K   WR+AM  E NA + N 
Sbjct  926   VNTHSMATRAKDGIRKPNQKYSYATSLAANSEPRTAIQAMKDDRWRQAMGSEINAQIGNH  985

Query  299   TWHLVPSQA-GMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVK  475
             TW LVP     + I+GC+W F  K  +DGS+ R+KARLVAKG+NQ PG D  +TFSPV+K
Sbjct  986   TWDLVPPPPPSVTIVGCRWIFTKKFNSDGSLNRYKARLVAKGYNQRPGLDYAETFSPVIK  1045

Query  476   PTTVRLLLYLALSSGWIVRQLDVQ  547
              T++R++L +A+   W +RQLDV 
Sbjct  1046  STSIRIVLGVAVDRSWPIRQLDVN  1069



>gb|AAC79110.1| putative polyprotein of LTR transposon [Arabidopsis thaliana]
 emb|CAB77781.1| putative polyprotein of LTR transposon [Arabidopsis thaliana]
Length=1456

 Score =   127 bits (319),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/144 (46%), Positives = 89/144 (62%), Gaps = 6/144 (4%)
 Frame = +2

Query  134   VRTHEMSTRSRS-----QAPPSALTVQVCPSDPTCYIQAVKYLEWREAMDQEFNALLQNQ  298
             V TH M+TR++          S  T     S+P   IQA+K   WR+AM  E NA + N 
Sbjct  907   VNTHSMATRAKDGIRKPNQKYSYATSLAANSEPRTAIQAMKDDRWRQAMGSEINAQIGNH  966

Query  299   TWHLVPSQA-GMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVK  475
             TW LVP     + I+GC+W F  K  +DGS+ R+KARLVAKG+NQ PG D  +TFSPV+K
Sbjct  967   TWDLVPPPPPSVTIVGCRWIFTKKFNSDGSLNRYKARLVAKGYNQRPGLDYAETFSPVIK  1026

Query  476   PTTVRLLLYLALSSGWIVRQLDVQ  547
              T++R++L +A+   W +RQLDV 
Sbjct  1027  STSIRIVLGVAVDRSWPIRQLDVN  1050



>dbj|BAK41511.1| polyprotein [Arabidopsis thaliana]
Length=1466

 Score =   127 bits (319),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 91/144 (63%), Gaps = 6/144 (4%)
 Frame = +2

Query  134   VRTHEMSTRSRSQA----PPSALTVQVCP-SDPTCYIQAVKYLEWREAMDQEFNALLQNQ  298
             + TH M TR+++      P  +L V +   S+P   IQA+K   WR AM  E NA + N 
Sbjct  924   LNTHSMGTRAKAGIIKPNPKYSLAVSLAAESEPRTAIQALKDERWRNAMGSEINAQIGNH  983

Query  299   TWHLVPSQ-AGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVK  475
             TW LVP   + + I+GC+W F  K  +DGS+ R+K RLVAKG+NQ PG D  +TFSPV+K
Sbjct  984   TWDLVPPPPSHVTIVGCRWIFTKKYNSDGSLNRYKVRLVAKGYNQRPGLDYAETFSPVIK  1043

Query  476   PTTVRLLLYLALSSGWIVRQLDVQ  547
              T++R++L +A+   W +RQLDV 
Sbjct  1044  STSIRIVLGVAVDRSWPIRQLDVN  1067



>dbj|BAM42650.1| Polyprotein [Arabidopsis thaliana]
Length=1475

 Score =   127 bits (319),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/144 (46%), Positives = 89/144 (62%), Gaps = 6/144 (4%)
 Frame = +2

Query  134   VRTHEMSTRSRS-----QAPPSALTVQVCPSDPTCYIQAVKYLEWREAMDQEFNALLQNQ  298
             V TH M+TR++          S  T     S+P   IQA+K   WR+AM  E NA + N 
Sbjct  926   VNTHSMATRAKDGIRKPNQKYSYATSLAANSEPRTAIQAMKDDRWRQAMGSEINAQIGNH  985

Query  299   TWHLVPSQA-GMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVK  475
             TW LVP     + I+GC+W F  K  +DGS+ R+KARLVAKG+NQ PG D  +TFSPV+K
Sbjct  986   TWDLVPPPPPSVTIVGCRWIFTKKFNSDGSLNRYKARLVAKGYNQRPGLDYAETFSPVIK  1045

Query  476   PTTVRLLLYLALSSGWIVRQLDVQ  547
              T++R++L +A+   W +RQLDV 
Sbjct  1046  STSIRIVLGVAVDRSWPIRQLDVN  1069



>dbj|BAM42647.1| polyprotein [Arabidopsis thaliana]
 dbj|BAM42648.1| polyprotein [Arabidopsis thaliana]
Length=1475

 Score =   127 bits (319),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/144 (46%), Positives = 89/144 (62%), Gaps = 6/144 (4%)
 Frame = +2

Query  134   VRTHEMSTRSRS-----QAPPSALTVQVCPSDPTCYIQAVKYLEWREAMDQEFNALLQNQ  298
             V TH M+TR++          S  T     S+P   IQA+K   WR+AM  E NA + N 
Sbjct  926   VNTHSMATRAKDGIRKPNQKYSYATSLAANSEPRTAIQAMKDDRWRQAMGSEINAQIGNH  985

Query  299   TWHLVPSQA-GMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVK  475
             TW LVP     + I+GC+W F  K  +DGS+ R+KARLVAKG+NQ PG D  +TFSPV+K
Sbjct  986   TWDLVPPPPPSVTIVGCRWIFTKKFNSDGSLNRYKARLVAKGYNQRPGLDYAETFSPVIK  1045

Query  476   PTTVRLLLYLALSSGWIVRQLDVQ  547
              T++R++L +A+   W +RQLDV 
Sbjct  1046  STSIRIVLGVAVDRSWPIRQLDVN  1069



>dbj|BAA78427.1| polyprotein [Arabidopsis thaliana]
Length=1421

 Score =   127 bits (319),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/144 (46%), Positives = 89/144 (62%), Gaps = 6/144 (4%)
 Frame = +2

Query  134   VRTHEMSTRSRS-----QAPPSALTVQVCPSDPTCYIQAVKYLEWREAMDQEFNALLQNQ  298
             V TH M+TR++          S  T     S+P   IQA+K   WR+AM  E NA + N 
Sbjct  926   VNTHSMATRAKDGIRKPNQKYSYATSLAANSEPRTAIQAMKDDRWRQAMGSEINAQIGNH  985

Query  299   TWHLVPSQA-GMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVK  475
             TW LVP     + I+GC+W F  K  +DGS+ R+KARLVAKG+NQ PG D  +TFSPV+K
Sbjct  986   TWDLVPPPPPSVTIVGCRWIFTKKFNSDGSLNRYKARLVAKGYNQRPGLDYAETFSPVIK  1045

Query  476   PTTVRLLLYLALSSGWIVRQLDVQ  547
              T++R++L +A+   W +RQLDV 
Sbjct  1046  STSIRIVLGVAVDRSWPIRQLDVN  1069



>dbj|BAM44531.1| polyprotein [Arabidopsis thaliana]
Length=1421

 Score =   127 bits (319),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/144 (46%), Positives = 89/144 (62%), Gaps = 6/144 (4%)
 Frame = +2

Query  134   VRTHEMSTRSRS-----QAPPSALTVQVCPSDPTCYIQAVKYLEWREAMDQEFNALLQNQ  298
             V TH M+TR++          S  T     S+P   IQA+K   WR+AM  E NA + N 
Sbjct  926   VNTHSMATRAKDGIRKPNQKYSYATSLAANSEPRTAIQAMKDDRWRQAMGSEINAQIGNH  985

Query  299   TWHLVPSQA-GMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVK  475
             TW LVP     + I+GC+W F  K  +DGS+ R+KARLVAKG+NQ PG D  +TFSPV+K
Sbjct  986   TWDLVPPPPPSVTIVGCRWIFTKKFNSDGSLNRYKARLVAKGYNQRPGLDYAETFSPVIK  1045

Query  476   PTTVRLLLYLALSSGWIVRQLDVQ  547
              T++R++L +A+   W +RQLDV 
Sbjct  1046  STSIRIVLGVAVDRSWPIRQLDVN  1069



>dbj|BAA78424.1| polyprotein [Arabidopsis thaliana]
 dbj|BAM44533.1| polyprotein [Arabidopsis thaliana]
Length=1330

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/144 (46%), Positives = 89/144 (62%), Gaps = 6/144 (4%)
 Frame = +2

Query  134  VRTHEMSTRSRS-----QAPPSALTVQVCPSDPTCYIQAVKYLEWREAMDQEFNALLQNQ  298
            V TH M+TR++          S  T     S+P   IQA+K   WR+AM  E NA + N 
Sbjct  781  VNTHSMATRAKDGIRKPNQKYSYATSLAANSEPRTAIQAMKDDRWRQAMGSEINAQIGNH  840

Query  299  TWHLVPSQA-GMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVK  475
            TW LVP     + I+GC+W F  K  +DGS+ R+KARLVAKG+NQ PG D  +TFSPV+K
Sbjct  841  TWDLVPPPPPSVTIVGCRWIFTKKFNSDGSLNRYKARLVAKGYNQRPGLDYAETFSPVIK  900

Query  476  PTTVRLLLYLALSSGWIVRQLDVQ  547
             T++R++L +A+   W +RQLDV 
Sbjct  901  STSIRIVLGVAVDRSWPIRQLDVN  924



>dbj|BAM44529.1| polyprotein [Arabidopsis thaliana]
Length=1421

 Score =   127 bits (319),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/144 (46%), Positives = 89/144 (62%), Gaps = 6/144 (4%)
 Frame = +2

Query  134   VRTHEMSTRSRS-----QAPPSALTVQVCPSDPTCYIQAVKYLEWREAMDQEFNALLQNQ  298
             V TH M+TR++          S  T     S+P   IQA+K   WR+AM  E NA + N 
Sbjct  926   VNTHSMATRAKDGIRKPNQKYSYATSLAANSEPRTAIQAMKDDRWRQAMGSEINAQIGNH  985

Query  299   TWHLVPSQA-GMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVK  475
             TW LVP     + I+GC+W F  K  +DGS+ R+KARLVAKG+NQ PG D  +TFSPV+K
Sbjct  986   TWDLVPPPPPSVTIVGCRWIFTKKFNSDGSLNRYKARLVAKGYNQRPGLDYAETFSPVIK  1045

Query  476   PTTVRLLLYLALSSGWIVRQLDVQ  547
              T++R++L +A+   W +RQLDV 
Sbjct  1046  STSIRIVLGVAVDRSWPIRQLDVN  1069



>dbj|BAM44532.1| polyprotein [Arabidopsis thaliana]
Length=1421

 Score =   127 bits (319),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/144 (46%), Positives = 89/144 (62%), Gaps = 6/144 (4%)
 Frame = +2

Query  134   VRTHEMSTRSRS-----QAPPSALTVQVCPSDPTCYIQAVKYLEWREAMDQEFNALLQNQ  298
             V TH M+TR++          S  T     S+P   IQA+K   WR+AM  E NA + N 
Sbjct  926   VNTHSMATRAKDGIRKPNQKYSYATSLAANSEPRTAIQAMKDDRWRQAMGSEINAQIGNH  985

Query  299   TWHLVPSQA-GMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVK  475
             TW LVP     + I+GC+W F  K  +DGS+ R+KARLVAKG+NQ PG D  +TFSPV+K
Sbjct  986   TWDLVPPPPPSVTIVGCRWIFTKKFNSDGSLNRYKARLVAKGYNQRPGLDYAETFSPVIK  1045

Query  476   PTTVRLLLYLALSSGWIVRQLDVQ  547
              T++R++L +A+   W +RQLDV 
Sbjct  1046  STSIRIVLGVAVDRSWPIRQLDVN  1069



>dbj|BAM44530.1| polyprotein [Arabidopsis thaliana]
Length=1421

 Score =   127 bits (319),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/144 (46%), Positives = 89/144 (62%), Gaps = 6/144 (4%)
 Frame = +2

Query  134   VRTHEMSTRSRS-----QAPPSALTVQVCPSDPTCYIQAVKYLEWREAMDQEFNALLQNQ  298
             V TH M+TR++          S  T     S+P   IQA+K   WR+AM  E NA + N 
Sbjct  926   VNTHSMATRAKDGIRKPNQKYSYATSLAANSEPRTAIQAMKDDRWRQAMGSEINAQIGNH  985

Query  299   TWHLVPSQA-GMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVK  475
             TW LVP     + I+GC+W F  K  +DGS+ R+KARLVAKG+NQ PG D  +TFSPV+K
Sbjct  986   TWDLVPPPPPSVTIVGCRWIFTKKFNSDGSLNRYKARLVAKGYNQRPGLDYAETFSPVIK  1045

Query  476   PTTVRLLLYLALSSGWIVRQLDVQ  547
              T++R++L +A+   W +RQLDV 
Sbjct  1046  STSIRIVLGVAVDRSWPIRQLDVN  1069



>pir||T02087 gag/pol polyprotein - maize retrotransposon Hopscotch
 gb|AAA57005.1| copia-like retrotransposon Hopscotch polyprotein [Zea mays]
Length=1439

 Score =   127 bits (319),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 78/113 (69%), Gaps = 0/113 (0%)
 Frame = +2

Query  209   SDPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSI  388
             ++P+   +A+   +WR AM+ EF AL +N TW LVP     N+I CKW F+ K  ADGSI
Sbjct  923   TEPSSVSEALADPQWRAAMEAEFQALQKNNTWTLVPPDRTRNLIDCKWVFKVKYNADGSI  982

Query  389   GRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
              R KARLVAKGF Q  G D  DTFSPVVK +T+RL+L LA+S  W +RQLDVQ
Sbjct  983   DRLKARLVAKGFKQQYGIDYDDTFSPVVKHSTIRLVLSLAVSQKWSLRQLDVQ  1035



>emb|CAN72675.1| hypothetical protein VITISV_020405 [Vitis vinifera]
Length=1919

 Score =   127 bits (319),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 73/178 (41%), Positives = 95/178 (53%), Gaps = 17/178 (10%)
 Frame = +2

Query  65    HEPSVKPAKRPHGRPRG---------KSVKSTVRTHEMSTRSRSQAP-----PSALTVQV  202
             H PSVK  K      +G         K+++ST+    +   + S        P +   + 
Sbjct  1135  HVPSVKRGKLDERAEKGVFVGYAAESKAIESTIIEGPLDVEATSDTXVLKMRPLSDVYER  1194

Query  203   CP---SDPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRK  373
             C    ++PTCY +A ++LEW EAM    +A+ +N TW L       N IG KW FRTK  
Sbjct  1195  CNLVHAEPTCYTEAARFLEWIEAMKAXIDAIERNGTWKLTKLPEAKNAIGVKWVFRTKFN  1254

Query  374   ADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
             +DGSI RHKARLV KGF QV G D  DTF+PV +  T+RLLL L    GW V  LDV+
Sbjct  1255  SDGSIFRHKARLVVKGFAQVAGVDYGDTFAPVARHDTIRLLLALVGQMGWKVYHLDVK  1312



>ref|XP_008345130.1| PREDICTED: uncharacterized protein LOC103408038 [Malus domestica]
Length=1355

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 67/151 (44%), Positives = 92/151 (61%), Gaps = 17/151 (11%)
 Frame = +2

Query  134  VRTHEMSTRSR-------------SQAPPSALTVQVCPSDPTCYIQAVKYLEWREAMDQE  274
            +  H M TRS+             +++P   LT+     +P  Y  A+K   W +AM +E
Sbjct  814  LNMHPMQTRSKDGIIKKKVFFTQVTESPDVDLTL----VEPATYKSAMKVPVWYKAMQEE  869

Query  275  FNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFD  454
             NAL +  TW LV      N++GCKW F+ K+ +DG++ RH+ARLVAKGF+Q PG D  +
Sbjct  870  VNALHKQHTWSLVHLPPHKNLVGCKWVFKLKKNSDGTVARHEARLVAKGFSQEPGLDYGE  929

Query  455  TFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
            TFSPVVKPTTVR++L LA    W +RQLDV+
Sbjct  930  TFSPVVKPTTVRIVLALAAHFNWTLRQLDVK  960



>ref|XP_007024187.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 8 [Theobroma 
cacao]
 gb|EOY26809.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 8 [Theobroma 
cacao]
Length=1255

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 67/172 (39%), Positives = 93/172 (54%), Gaps = 0/172 (0%)
 Frame = +2

Query  32   NEPASLPEQEPHEPSVKPAKRPHGRPRGKSVKSTVRTHEMSTRSRSQAPPSALTVQVCPS  211
            N P     +  H P    A       +  +V +   T  +ST++ S A  +  T      
Sbjct  678  NLPVRKSTRHKHAPKYMDAYHLDMPSKSHNVTAHPITKFLSTKNLSPAYKTFTTSLSYTF  737

Query  212  DPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIG  391
            +P+ Y QA  Y  WR+AM  E  AL  N+TW ++P     ++IGCKW ++ K  ADG I 
Sbjct  738  EPSTYHQAASYSHWRDAMSAELKALQDNETWSIIPRPLNSHVIGCKWVYKVKLNADGQIE  797

Query  392  RHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
            R+KARLVAKG+NQ+ G D  +TFSPV K TTVR+   +A +  W + QLDV 
Sbjct  798  RYKARLVAKGYNQIAGFDYKETFSPVAKQTTVRVFFAIATAFNWHLTQLDVN  849



>emb|CAN76473.1| hypothetical protein VITISV_016007 [Vitis vinifera]
Length=1002

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/143 (45%), Positives = 87/143 (61%), Gaps = 10/143 (7%)
 Frame = +2

Query  143  HEMSTRSRSQAPP--------SALTVQVCPSD--PTCYIQAVKYLEWREAMDQEFNALLQ  292
            H M+TRS+             + L+  V PSD  PT   QA+K   W   M +E+ AL++
Sbjct  458  HPMTTRSKVGTIKPKLLPDHITYLSTSVSPSDQLPTTVSQALKNPNWHTTMVEEYQALVR  517

Query  293  NQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVV  472
            N TW LVP    MN+I  KW FR K  +DG+I R+KARLVAKGF Q  G +  DTFSPV+
Sbjct  518  NNTWTLVPFHPSMNVIDSKWIFRVKYNSDGTIQRYKARLVAKGFQQYAGVEFTDTFSPVI  577

Query  473  KPTTVRLLLYLALSSGWIVRQLD  541
            K +T+R++  LA++  W +RQ+D
Sbjct  578  KASTIRVVFTLAITYNWEIRQID  600



>ref|XP_006596772.1| PREDICTED: uncharacterized mitochondrial protein AtMg00820-like 
[Glycine max]
Length=131

 Score =   117 bits (293),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/124 (49%), Positives = 79/124 (64%), Gaps = 2/124 (2%)
 Frame = +2

Query  149  MSTRSRS--QAPPSALTVQVCPSDPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQ  322
            M TRS+S    P     + +  S+P    QA+   +W  AM QE++ALL+N+TW LV   
Sbjct  1    MQTRSKSGIHNPRLHPALFLSHSEPKTVKQALANADWLTAMRQEYDALLKNRTWDLVSLP  60

Query  323  AGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLY  502
                 IGCKW F+ K   DGSI R KARLVAKGF+QV G D  +TFSPV+KP T+R++L 
Sbjct  61   PNRQAIGCKWVFKVKENVDGSINRFKARLVAKGFHQVHGFDFHETFSPVIKPVTIRIILT  120

Query  503  LALS  514
            LA+S
Sbjct  121  LAVS  124



>emb|CAN62421.1| hypothetical protein VITISV_020606 [Vitis vinifera]
Length=1798

 Score =   127 bits (318),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 75/113 (66%), Gaps = 0/113 (0%)
 Frame = +2

Query  209   SDPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSI  388
             ++PTCY +A ++LEW EAM  E +A+ +N TW L       N IG KW FRTK  ++GSI
Sbjct  961   AEPTCYTEAARFLEWIEAMKAEIDAIERNGTWKLTELPEAKNAIGVKWVFRTKFNSNGSI  1020

Query  389   GRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
              +HKARLV KGF QV G D  DTF+PV +  T+RLLL LA   GW V  LDV+
Sbjct  1021  FKHKARLVVKGFAQVAGVDYGDTFAPVARHDTIRLLLALAGQMGWKVYHLDVK  1073



>ref|XP_008460736.1| PREDICTED: uncharacterized protein LOC103499498 [Cucumis melo]
Length=695

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 75/112 (67%), Gaps = 0/112 (0%)
 Frame = +2

Query  212  DPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIG  391
            +P+ Y +AV   EWREAM  E  A+  NQTW +VP   G N IGC+W ++ K K DGSI 
Sbjct  456  EPSFYHEAVISQEWREAMKAELEAMETNQTWSIVPLPKGKNSIGCRWVYKIKHKVDGSIE  515

Query  392  RHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
            R+KARLVAKG+ Q  G D F+TFSPV K  TV+ LL +A+S  W + QLDV 
Sbjct  516  RYKARLVAKGYTQQEGLDYFETFSPVAKMVTVKTLLTIAVSKEWPLVQLDVN  567



>emb|CAN80123.1| hypothetical protein VITISV_009646 [Vitis vinifera]
Length=478

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/156 (44%), Positives = 91/156 (58%), Gaps = 2/156 (1%)
 Frame = +2

Query  128  STVRTHEMSTRSR-SQAPPSALTVQVCPS-DPTCYIQAVKYLEWREAMDQEFNALLQNQT  301
            ST+ TH M T S+     P AL   V  +  P  +IQA+   EW   M +++N LL N T
Sbjct  128  STLSTHPMQTHSKLGLFKPRALVASVSSTTKPNSHIQALHIPEWTTPMQEKYNTLLCNNT  187

Query  302  WHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKPT  481
            W LVP     ++IGCKW FR K+  DGSI RHK RLVAKGF Q P  D  DTFS VVK T
Sbjct  188  WSLVPLPPNQSVIGCKWIFRLKKNPDGSIQRHKTRLVAKGFTQRPRFDFSDTFSLVVKAT  247

Query  482  TVRLLLYLALSSGWIVRQLDVQ**AYLGQIHSNFQI  589
            T+R+++ LA+   W + +      +Y+ Q  + FQ+
Sbjct  248  TIRIIIALAVHHNWPLDKSTSIMPSYMEQQSTYFQV  283



>emb|CAN60276.1| hypothetical protein VITISV_028253 [Vitis vinifera]
Length=579

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 97/175 (55%), Gaps = 18/175 (10%)
 Frame = +2

Query  59   EPHEPSVKPAKRPHGRP---------RGKSVKSTVRTH---EMSTRSRSQAPPSALTVQV  202
            EPH P V     P   P         R K+  S  +TH    +S  S S      L+V +
Sbjct  52   EPHPPLVASDIAPTPAPPLGSHPMLTRAKA--SIFKTHHPANLSVLSSS----GFLSVLL  105

Query  203  CPSDPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADG  382
              ++P  +  A K   W  +MD+E  AL  N+TW LVP  A  NI+G KW FRTK   DG
Sbjct  106  ASTEPKGFKSAAKNPAWLASMDEEVQALQHNRTWVLVPRPAHTNIVGXKWVFRTKYLLDG  165

Query  383  SIGRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
            SI   KA LVAKG+ QVPG D  DTFSPV+K TTV ++L L +++ W +RQLDV+
Sbjct  166  SIDCFKAHLVAKGYTQVPGLDYIDTFSPVIKATTVHVVLSLXVTNRWPLRQLDVK  220



>gb|KFK24418.1| hypothetical protein AALP_AAs62447U000100, partial [Arabis alpina]
Length=138

 Score =   117 bits (292),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 85/138 (62%), Gaps = 7/138 (5%)
 Frame = +2

Query  149  MSTRSRSQAPP-------SALTVQVCPSDPTCYIQAVKYLEWREAMDQEFNALLQNQTWH  307
            M+TR ++Q          SA  +   PS+P    QA+K   WR+AM  E  A  +N+T+ 
Sbjct  1    MTTRRQNQIIKPNPKYNYSAALLTSIPSEPQTITQALKDRLWRDAMSDEITAFARNRTFD  60

Query  308  LVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTV  487
            LVP     NI+GC+W ++ K  + G   R KARLVAKG+NQ  GQD  DTFSPV+K TT+
Sbjct  61   LVPRPTHCNIVGCRWLYKNKFLSTGMHHRCKARLVAKGYNQQYGQDYTDTFSPVIKSTTI  120

Query  488  RLLLYLALSSGWIVRQLD  541
            RL+L +A+S  W ++QLD
Sbjct  121  RLVLNIAVSKDWPIQQLD  138



>gb|KFK33814.1| hypothetical protein AALP_AA5G063400 [Arabis alpina]
Length=563

 Score =   123 bits (309),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 78/115 (68%), Gaps = 0/115 (0%)
 Frame = +2

Query  203  CPSDPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADG  382
             P++P    QA+K  +WREAM QE  A  +NQ++ LVP     NIIGCKW ++ K  + G
Sbjct  50   IPAEPQTLAQALKDRQWREAMSQEITAFARNQSYDLVPRLPHYNIIGCKWLYKNKFLSTG  109

Query  383  SIGRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
               R KARLVAKG+NQ  G D  DTFSPV+K TT+RL+L +A+S GW ++QLDV 
Sbjct  110  FHHRCKARLVAKGYNQKFGYDYTDTFSPVIKSTTIRLVLDIAVSKGWPIQQLDVN  164



>emb|CAN81140.1| hypothetical protein VITISV_007978 [Vitis vinifera]
Length=791

 Score =   125 bits (313),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 82/128 (64%), Gaps = 0/128 (0%)
 Frame = +2

Query  161  SRSQAPPSALTVQVCPSDPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNII  340
            S S+ P +AL   V  S P  Y QA    +W  AM+ EF ALL+N TW L P   G N++
Sbjct  386  SGSRVPSTALHASVIISKPHSYAQAAAIPKWHLAMESEFQALLKNDTWTLCPRPPGKNVV  445

Query  341  GCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSG  520
              KW F+ K   +GSI R KA+LVA G+ Q  G D FDTFSP++KP+TVR++L LA+S  
Sbjct  446  PSKWVFKCKCHPNGSIERLKAQLVAVGYLQRSGIDFFDTFSPIIKPSTVRMVLALAVSFN  505

Query  521  WIVRQLDV  544
            W +RQLD+
Sbjct  506  WDIRQLDM  513



>emb|CAN71996.1| hypothetical protein VITISV_023485 [Vitis vinifera]
Length=1087

 Score =   125 bits (314),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 66/141 (47%), Positives = 88/141 (62%), Gaps = 4/141 (3%)
 Frame = +2

Query  125  KSTVRTHEMSTRSRSQAPPSALTVQVCPSDPTCYIQAVKYLEWREAMDQEFNALLQNQTW  304
            + T R+    T+ ++    SA+ V    S+P+   Q  K   W +AM+ E  A  +N TW
Sbjct  598  RMTTRSMGGITKKKTILDQSAIKV----SEPSTLKQTFKDPNWTKAMEMEIAAFHRNHTW  653

Query  305  HLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKPTT  484
             LV     +N+IGCKWA + K K DGSI R+KARLVAKG+NQ  G D F+TFSPVVK  T
Sbjct  654  DLVEQPPDVNVIGCKWANKLKHKPDGSIERYKARLVAKGYNQTHGLDYFETFSPVVKXAT  713

Query  485  VRLLLYLALSSGWIVRQLDVQ  547
            +R++L +ALS  W +RQLDV 
Sbjct  714  IRIILTVALSFKWEIRQLDVH  734



>ref|XP_011093964.1| PREDICTED: uncharacterized protein LOC105173784 [Sesamum indicum]
Length=238

 Score =   119 bits (298),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 67/100 (67%), Gaps = 0/100 (0%)
 Frame = +2

Query  224  YIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKA  403
            +  AV++ EWREAM  E  AL +N TW LVP   G   IGCKW F+TK   DGS+ R+KA
Sbjct  137  FSDAVQHEEWREAMHTELQALDRNNTWKLVPLSPGKCAIGCKWVFKTKLNTDGSVERYKA  196

Query  404  RLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGW  523
            RLV KGFNQ+ G D  D+FSPV K  TVRL L +  ++GW
Sbjct  197  RLVVKGFNQIEGIDYSDSFSPVAKNVTVRLFLAITAANGW  236



>ref|XP_006606948.1| PREDICTED: uncharacterized protein LOC102661023 [Glycine max]
Length=592

 Score =   123 bits (309),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 57/105 (54%), Positives = 71/105 (68%), Gaps = 0/105 (0%)
 Frame = +2

Query  206  PSDPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGS  385
            P +     QA++  +WR AM  EF+AL  N TW LV   +  N++GCKW FR KR  DGS
Sbjct  488  PIESNTITQALRDPDWRSAMQAEFDALHHNNTWDLVSRSSDQNLVGCKWVFRIKRNPDGS  547

Query  386  IGRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSG  520
            I R+KARLVAKGF+Q PG D   TFSPVVKP T+R++L LA+  G
Sbjct  548  IDRYKARLVAKGFHQRPGWDYTKTFSPVVKPVTIRIVLTLAVRQG  592



>emb|CAN60188.1| hypothetical protein VITISV_002117 [Vitis vinifera]
Length=1079

 Score =   125 bits (314),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 67/159 (42%), Positives = 96/159 (60%), Gaps = 5/159 (3%)
 Frame = +2

Query  77   VKPAKRPHGRPRGKSVKSTV-RTHEMSTRSRSQA-PPSALTVQVCPSDPTCYIQAVKYLE  250
            ++  + P+      S+ STV   H M TRS+     P   +V     +P    +A++   
Sbjct  675  LENCQDPNAPIVSSSILSTVGNIHSMITRSKKGIFKPKVYSV---TKEPQSADEALQNEN  731

Query  251  WREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQ  430
            W+ AM  E++ LL++ TW LV   AG  +IGCKW FR K   D SI ++KARLVAKGF+Q
Sbjct  732  WKIAMIDEYSTLLRHNTWSLVDLLAGRKVIGCKWIFRVKENPDASINKYKARLVAKGFHQ  791

Query  431  VPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
              G D  +TFSP+VKPTT+R++L +ALS  W ++QLD+ 
Sbjct  792  TAGFDYTETFSPIVKPTTIRVVLTIALSRNWKIQQLDIN  830



>dbj|BAA78426.1| polyprotein [Arabidopsis thaliana]
Length=1475

 Score =   125 bits (315),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 89/144 (62%), Gaps = 6/144 (4%)
 Frame = +2

Query  134   VRTHEMSTRSRS-----QAPPSALTVQVCPSDPTCYIQAVKYLEWREAMDQEFNALLQNQ  298
             V TH M+TR++          S  T     S+P   IQA+K   WR+AM  + NA + N 
Sbjct  926   VNTHSMATRAKDGIRKPNQKYSYATSLAANSEPRTAIQAMKDDRWRQAMGSKINAQIGNH  985

Query  299   TWHLVPSQA-GMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVK  475
             TW LVP     + I+GC+W F  K  +DGS+ R+KARLVAKG+NQ PG D  +TFSPV+K
Sbjct  986   TWDLVPPPPPSVTIVGCRWIFTKKFNSDGSLNRYKARLVAKGYNQRPGLDYAETFSPVIK  1045

Query  476   PTTVRLLLYLALSSGWIVRQLDVQ  547
              T++R++L +A+   W +RQLDV 
Sbjct  1046  STSIRIVLGVAVDRSWPIRQLDVN  1069



>ref|XP_008390627.1| PREDICTED: uncharacterized protein LOC103452871 [Malus domestica]
Length=1159

 Score =   125 bits (314),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 66/142 (46%), Positives = 84/142 (59%), Gaps = 6/142 (4%)
 Frame = +2

Query  137  RTHEMSTRSRSQA-PPSALTVQVCPSD-----PTCYIQAVKYLEWREAMDQEFNALLQNQ  298
             TH M TRS++    P  L     P D     PT Y Q  K+  WR+AM +EF AL    
Sbjct  647  NTHPMLTRSKAGIFKPKILAATKHPIDTSNFVPTTYSQTSKHEHWRQAMFEEFQALQNTG  706

Query  299  TWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKP  478
            TW  VPS    +++GCKW FR KRK  G+I R+KARLVAKGF+Q  G D  +TFS V KP
Sbjct  707  TWTFVPSSPNQSVVGCKWVFRIKRKPYGTIDRYKARLVAKGFHQQEGVDFQETFSYVAKP  766

Query  479  TTVRLLLYLALSSGWIVRQLDV  544
             T+++LL L +   W + QLD+
Sbjct  767  VTIQILLTLDVQHNWFLNQLDI  788



>ref|XP_008357464.1| PREDICTED: uncharacterized protein LOC103421211 [Malus domestica]
Length=298

 Score =   120 bits (301),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 65/147 (44%), Positives = 82/147 (56%), Gaps = 9/147 (6%)
 Frame = +2

Query  134  VRTHEMSTRSRSQAPPSALT---------VQVCPSDPTCYIQAVKYLEWREAMDQEFNAL  286
            V  H M TRS+                  V +   +P  Y  A+K   W +AM  E  AL
Sbjct  142  VNLHPMQTRSKXXIVKXIXXLAXVHENXXVDLTXVEPXTYKSALKXPVWYDAMKDEIXAL  201

Query  287  LQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSP  466
                TW LV      N++ CKW ++ K+  DGSIGR+KAR VAKGF+Q  G D  +TFSP
Sbjct  202  HNQGTWSLVXLPQHKNLVXCKWVYKIKKXXDGSIGRYKARXVAKGFSQEEGIDYXETFSP  261

Query  467  VVKPTTVRLLLYLALSSGWIVRQLDVQ  547
            VVKPTTVRL+L L+   GW +RQLDV+
Sbjct  262  VVKPTTVRLVLALSAHFGWTLRQLDVK  288



>ref|XP_004509218.1| PREDICTED: uncharacterized protein LOC101501009 [Cicer arietinum]
Length=751

 Score =   124 bits (312),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 58/111 (52%), Positives = 74/111 (67%), Gaps = 0/111 (0%)
 Frame = +2

Query  212  DPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIG  391
            +P+ Y +A+K   WR A+D E  +LL N TW L    +   +IGCKW F+ K  A+G+I 
Sbjct  366  EPSSYSEAIKDSNWRLAIDSELRSLLNNNTWELTTLPSDKKVIGCKWVFKLKFHANGTIE  425

Query  392  RHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLDV  544
            R+KARLVAKGFNQ  G D  DTFSPVVK TT+RLLL +A    W + QLD+
Sbjct  426  RYKARLVAKGFNQTEGLDYLDTFSPVVKMTTIRLLLSIAAIKNWFLFQLDI  476



>emb|CAN72527.1| hypothetical protein VITISV_009255 [Vitis vinifera]
Length=1095

 Score =   125 bits (314),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 88/149 (59%), Gaps = 13/149 (9%)
 Frame = +2

Query  140  THEMSTRSRS-----QAPPSALTVQVCP--------SDPTCYIQAVKYLEWREAMDQEFN  280
            +H M TR++S     Q P     VQ  P         +P  +  A K   W   MD E  
Sbjct  543  SHPMITRAKSGIFKPQHPVHLSFVQSSPLIHALLATFEPKGFKSAAKNPAWLATMDDEIK  602

Query  281  ALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTF  460
            AL  N TW LVP  +  NI+G KW FRTK  +DGSI R KARLVAKG+ Q+PG D  DTF
Sbjct  603  ALQTNHTWDLVPRPSNTNIVGSKWVFRTKFLSDGSIERFKARLVAKGYTQLPGLDYKDTF  662

Query  461  SPVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
            SPVVK +TVR++L LA+S  W +RQLDV+
Sbjct  663  SPVVKASTVRVVLSLAVSHKWPLRQLDVK  691



>ref|XP_002444548.1| hypothetical protein SORBIDRAFT_07g023610 [Sorghum bicolor]
 gb|EES14043.1| hypothetical protein SORBIDRAFT_07g023610 [Sorghum bicolor]
Length=791

 Score =   124 bits (312),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 68/140 (49%), Positives = 88/140 (63%), Gaps = 6/140 (4%)
 Frame = +2

Query  140  THEMSTRSRSQAPPSALTVQVCPSD----PTCYIQAVKYLEWREAMDQEFNALLQNQTWH  307
            TH M TR  S+  P ALT   C +     P+   +A+    WR AM++E+ ALL NQTW 
Sbjct  256  THPMVTRQASR--PRALTAATCETGISPVPSSVREALSDPHWRRAMEEEYAALLANQTWD  313

Query  308  LVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTV  487
            LVP  +  N++  KW +  KR+ADGS+ R+KAR V  GF+Q PG D  +TFSPVVKP TV
Sbjct  314  LVPRPSASNVVTGKWIWTHKRRADGSLERYKARWVLWGFSQRPGIDYDETFSPVVKPATV  373

Query  488  RLLLYLALSSGWIVRQLDVQ  547
            R +L +AL   W V QLDV+
Sbjct  374  RTVLSVALERSWPVHQLDVK  393



>ref|XP_006494841.1| PREDICTED: uncharacterized protein LOC102608996 [Citrus sinensis]
Length=1923

 Score =   125 bits (314),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 86/137 (63%), Gaps = 1/137 (1%)
 Frame = +2

Query  140  THEMSTRSRSQA-PPSALTVQVCPSDPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVP  316
             H M TR+++    P A        +P+   +A+   +W+ AM  EF+AL +N TW LVP
Sbjct  663  NHPMITRAKAGIFKPKAFLTSHNSLEPSTVDEALSDPKWKAAMQSEFDALTRNNTWTLVP  722

Query  317  SQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLL  496
              +   ++GCKW FRTK    G++ +HKARLVAKGF+Q  G D  +TFSPVVK +TVR +
Sbjct  723  VTSQHKLVGCKWVFRTKYNTYGTVSKHKARLVAKGFHQTAGVDYKETFSPVVKSSTVRTI  782

Query  497  LYLALSSGWIVRQLDVQ  547
            L LA+  GW VRQ+D+ 
Sbjct  783  LSLAVMKGWKVRQIDIN  799



>emb|CAB46043.1| retrotransposon like protein [Arabidopsis thaliana]
 emb|CAB80958.1| retrotransposon like protein [Arabidopsis thaliana]
Length=1474

 Score =   125 bits (313),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 63/142 (44%), Positives = 93/142 (65%), Gaps = 8/142 (6%)
 Frame = +2

Query  143   HEMSTRSRS--QAPPSALTVQVC-----PSDPTCYIQAVKYLEWREAMDQEFNALLQNQT  301
             H M TR+++  + P +  ++        PS+PT   QA+K  +WR AM  EF+A  +N T
Sbjct  935   HNMKTRAKNNIKKPNTKFSLTATLPNRSPSEPTNVTQALKDKKWRFAMSDEFDAQQRNHT  994

Query  302   WHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKPT  481
             W LVP ++ + ++GCKW F+ K   +G+I ++KARLVAKGFNQ  G D  +TFSPV+K T
Sbjct  995   WDLVPHESQL-LVGCKWVFKLKYLPNGAIDKYKARLVAKGFNQQYGVDYAETFSPVIKST  1053

Query  482   TVRLLLYLALSSGWIVRQLDVQ  547
             T+RL+L +A+   W ++QLDV 
Sbjct  1054  TIRLVLDVAVKKDWEIKQLDVN  1075



>ref|XP_009629549.1| PREDICTED: uncharacterized protein LOC104119680 [Nicotiana tomentosiformis]
Length=368

 Score =   120 bits (302),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 76/122 (62%), Gaps = 1/122 (1%)
 Frame = +2

Query  185  ALTVQVCP-SDPTCYIQAVKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFR  361
            +L   +C  S+P+ Y  A     W+ AM+QEF AL  N TW LVP   G   IGCKW ++
Sbjct  203  SLVRDICSDSEPSSYEGAAMNPAWQTAMNQEFEALHANHTWDLVPLPVGKKTIGCKWVYK  262

Query  362  TKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSGWIVRQLD  541
             K KADGS+ R KARLV KG+ Q  G D  +TFS VVK TTVR L+ +A+  GW + QLD
Sbjct  263  IKHKADGSVERLKARLVVKGYTQQAGIDYTETFSHVVKMTTVRSLIAVAVKKGWHISQLD  322

Query  542  VQ  547
            V 
Sbjct  323  VN  324



>ref|XP_011016404.1| PREDICTED: uncharacterized protein LOC105119910 [Populus euphratica]
Length=987

 Score =   124 bits (311),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 65/146 (45%), Positives = 86/146 (59%), Gaps = 6/146 (4%)
 Frame = +2

Query  122  VKSTVRTHEMSTRSRSQA--PPSALTVQVCPS----DPTCYIQAVKYLEWREAMDQEFNA  283
            V + VR H M+TR  ++   P     V   P     +P+    A+    WREAM  +  A
Sbjct  515  VSAAVRVHSMTTRFMNEIYKPKKTFLVTKHPLPSSLEPSSVTVALADSRWREAMSSKLTA  574

Query  284  LLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFS  463
            L+++ TW LVP  +  NI+GCKW FR KR A+GS+ R KAR VAKGFNQ PG D   TFS
Sbjct  575  LMRHNTWQLVPPPSDCNIVGCKWVFRVKRHANGSVDRFKARFVAKGFNQRPGLDYKKTFS  634

Query  464  PVVKPTTVRLLLYLALSSGWIVRQLD  541
            PVVKP T+R++L + +  G  +R  D
Sbjct  635  PVVKPVTIRIVLAIVVMQGLSLRNPD  660



>ref|XP_008351905.1| PREDICTED: uncharacterized protein LOC103415342 [Malus domestica]
Length=308

 Score =   120 bits (300),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 68/91 (75%), Gaps = 0/91 (0%)
 Frame = +2

Query  263  MDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQ  442
            M  EFNAL++N TW LVPS    N+IGCKW FR K   DG+I R+KARLVAKGF+Q PG 
Sbjct  1    MSNEFNALIRNGTWELVPSLPSQNLIGCKWVFRIKWHPDGTIDRYKARLVAKGFHQRPGV  60

Query  443  DIFDTFSPVVKPTTVRLLLYLALSSGWIVRQ  535
            D  DTF+PVVKPTT+R++ +LA++  W +R 
Sbjct  61   DFSDTFNPVVKPTTIRIVXHLAVTHRWPIRN  91



>ref|XP_008377446.1| PREDICTED: uncharacterized protein LOC103440529 [Malus domestica]
Length=1072

 Score =   124 bits (311),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 67/147 (46%), Positives = 87/147 (59%), Gaps = 9/147 (6%)
 Frame = +2

Query  134  VRTHEMSTRSRSQA-PPSALTVQVCPS--------DPTCYIQAVKYLEWREAMDQEFNAL  286
            +  H M TRS++      A   QV  S        +P  Y  A+K   W +AM +E +AL
Sbjct  505  LNMHPMQTRSKNGIIKKKAFFTQVTESCEFDLTLVEPATYKSAMKVPVWYKAMQEEVDAL  564

Query  287  LQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSP  466
             +  TW LV      N++GCKW F+ K+  DG++ RHKARLVAKGF+Q PG D  +TFSP
Sbjct  565  HKQHTWSLVHLPPHKNLVGCKWVFKLKKNLDGTVARHKARLVAKGFSQEPGLDYGETFSP  624

Query  467  VVKPTTVRLLLYLALSSGWIVRQLDVQ  547
            VVKPTTVRL+L L     W  +QLDV+
Sbjct  625  VVKPTTVRLVLALEAHFNWTFQQLDVK  651



>emb|CAN74166.1| hypothetical protein VITISV_007721 [Vitis vinifera]
Length=631

 Score =   122 bits (307),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 73/95 (77%), Gaps = 0/95 (0%)
 Frame = +2

Query  236  VKYLEWREAMDQEFNALLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVA  415
            +KY +WR AM +E++AL++N TW LVP  +   ++GCKW FRTKRK+DGSI R KARLVA
Sbjct  233  LKYHKWRRAMFEEYDALVKNGTWALVPPNSSQYLVGCKWIFRTKRKSDGSIDRFKARLVA  292

Query  416  KGFNQVPGQDIFDTFSPVVKPTTVRLLLYLALSSG  520
            KGF+Q P  D  DT SP+VKPTTVR++L + ++ G
Sbjct  293  KGFHQHPRIDYHDTISPIVKPTTVRIILSIVVNHG  327



>ref|XP_008380799.1| PREDICTED: uncharacterized protein LOC103443689 [Malus domestica]
Length=896

 Score =   124 bits (310),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 71/147 (48%), Positives = 87/147 (59%), Gaps = 9/147 (6%)
 Frame = +2

Query  134  VRTHEMSTRSRSQ-APPSALTVQVCPS--------DPTCYIQAVKYLEWREAMDQEFNAL  286
            +  H M TRS++  +   AL   V  S        +PT Y  A+K   W  AM  E +AL
Sbjct  651  LNNHPMQTRSKNGISKKIALLASVHESRGTDLTQVEPTTYKSALKSPVWLAAMQDELSAL  710

Query  287  LQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFSP  466
                TW LVP     N++G KW F+ K+ ADGSIGR+KARLV KGFNQ    D  +TFSP
Sbjct  711  HTQGTWSLVPLPPHKNLVGYKWVFKIKKNADGSIGRYKARLVTKGFNQEEAIDYGETFSP  770

Query  467  VVKPTTVRLLLYLALSSGWIVRQLDVQ  547
            VVKPTTVRL+L LA    W +RQLDV+
Sbjct  771  VVKPTTVRLVLTLAAHFNWGIRQLDVK  797



>ref|XP_010068882.1| PREDICTED: uncharacterized protein LOC104455862 [Eucalyptus grandis]
Length=994

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 66/148 (45%), Positives = 87/148 (59%), Gaps = 5/148 (3%)
 Frame = +2

Query  119  SVKSTVRTHEMSTRSRSQA----PPSALTVQV-CPSDPTCYIQAVKYLEWREAMDQEFNA  283
            S + TV  H M TR +S      P  A +     P +P     A+    W  AM +E +A
Sbjct  746  SSQGTVNNHHMQTRLKSGIRKPNPKYAFSADYQVPMEPQSIKSALANEAWYRAMKEEMDA  805

Query  284  LLQNQTWHLVPSQAGMNIIGCKWAFRTKRKADGSIGRHKARLVAKGFNQVPGQDIFDTFS  463
            L +NQTW L+P    MN+IGCKW ++TK    G + R KARLVAKGF+Q  G D  +TFS
Sbjct  806  LAENQTWTLIPRTDQMNVIGCKWVYKTKLTPYGGLDRLKARLVAKGFHQEEGLDFTETFS  865

Query  464  PVVKPTTVRLLLYLALSSGWIVRQLDVQ  547
            PVVK TT+R++L LA+   W + QLDV+
Sbjct  866  PVVKHTTIRIVLSLAMIKHWPIHQLDVK  893



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 776559819808