BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c10420_g1_i1 len=305 path=[283:0-27 311:28-304]

Length=305
                                                                      Score     E

ref|XP_009599695.1|  PREDICTED: SNARE-interacting protein KEULE       76.6    9e-14   
emb|CDY26558.1|  BnaA09g47190D                                        72.0    2e-13   
ref|XP_010546254.1|  PREDICTED: SNARE-interacting protein KEULE       73.9    8e-13   
ref|XP_006851850.1|  hypothetical protein AMTR_s00041p00086140        73.2    1e-12   
ref|XP_002889930.1|  hypothetical protein ARALYDRAFT_471384           73.2    1e-12   
ref|XP_010918310.1|  PREDICTED: SNARE-interacting protein KEULE-like  72.8    2e-12   
ref|XP_009409809.1|  PREDICTED: SNARE-interacting protein KEULE-like  72.8    2e-12   
ref|XP_004245704.1|  PREDICTED: SNARE-interacting protein KEULE       72.4    2e-12   
ref|XP_006363728.1|  PREDICTED: SNARE-interacting protein KEULE-like  72.4    2e-12   
gb|EYU25606.1|  hypothetical protein MIMGU_mgv1a017441mg              67.4    2e-12   
ref|XP_010934674.1|  PREDICTED: SNARE-interacting protein KEULE-like  72.0    3e-12   
ref|XP_010533747.1|  PREDICTED: SNARE-interacting protein KEULE-like  72.0    4e-12   
ref|XP_008791331.1|  PREDICTED: SNARE-interacting protein KEULE       71.6    4e-12   
ref|XP_007039986.1|  Sec1/munc18-like (SM) proteins superfamily i...  71.6    5e-12   
ref|XP_009118089.1|  PREDICTED: SNARE-interacting protein KEULE       71.6    5e-12   
emb|CDY15993.1|  BnaC08g41300D                                        71.6    5e-12   
ref|XP_009340828.1|  PREDICTED: SNARE-interacting protein KEULE-like  71.6    5e-12   
ref|XP_008374022.1|  PREDICTED: SNARE-interacting protein KEULE-like  71.6    5e-12   
ref|XP_011034306.1|  PREDICTED: protein transport Sec1a               71.2    6e-12   
ref|XP_002320060.2|  cytokinesis-related Sec1 family protein          71.2    6e-12   Populus trichocarpa [western balsam poplar]
ref|NP_563905.1|  SNARE-interacting protein KEULE                     71.2    7e-12   Arabidopsis thaliana [mouse-ear cress]
gb|AAK01291.1|AF331066_1  KEULE                                       71.2    7e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004511648.1|  PREDICTED: SNARE-interacting protein KEULE-l...  70.9    8e-12   
gb|KFK43498.1|  hypothetical protein AALP_AA1G133200                  70.9    9e-12   
ref|XP_008798533.1|  PREDICTED: SNARE-interacting protein KEULE       70.9    9e-12   
ref|XP_004511647.1|  PREDICTED: SNARE-interacting protein KEULE-l...  70.9    9e-12   
gb|KDP25591.1|  hypothetical protein JCGZ_20747                       70.9    9e-12   
ref|XP_009409807.1|  PREDICTED: SNARE-interacting protein KEULE-like  70.9    1e-11   
ref|XP_010676659.1|  PREDICTED: SNARE-interacting protein KEULE       70.1    2e-11   
ref|XP_011069828.1|  PREDICTED: SNARE-interacting protein KEULE-l...  70.1    2e-11   
gb|KEH27454.1|  SNARE-interacting KEULE-like protein                  69.7    2e-11   
gb|AES94196.2|  SNARE-interacting KEULE-like protein                  69.7    2e-11   
ref|XP_006306027.1|  hypothetical protein CARUB_v10011323mg           69.7    2e-11   
ref|XP_010494099.1|  PREDICTED: SNARE-interacting protein KEULE       69.3    3e-11   
ref|XP_003611238.1|  SNARE-interacting protein KEULE                  69.7    3e-11   
ref|XP_010458665.1|  PREDICTED: SNARE-interacting protein KEULE-like  69.3    3e-11   
ref|XP_006417244.1|  hypothetical protein EUTSA_v10007001mg           69.3    3e-11   
ref|XP_003538607.1|  PREDICTED: SNARE-interacting protein KEULE-like  68.9    4e-11   
ref|XP_010276590.1|  PREDICTED: SNARE-interacting protein KEULE       68.6    5e-11   
ref|XP_010476209.1|  PREDICTED: SNARE-interacting protein KEULE-like  68.6    5e-11   
ref|XP_010661629.1|  PREDICTED: protein transport Sec1a isoform X2    68.2    6e-11   
ref|XP_011033888.1|  PREDICTED: SNARE-interacting protein KEULE-like  68.6    6e-11   
ref|XP_002278966.1|  PREDICTED: protein transport Sec1a isoform X3    68.2    6e-11   Vitis vinifera
ref|XP_008457205.1|  PREDICTED: SNARE-interacting protein KEULE i...  68.2    7e-11   
ref|XP_004138971.1|  PREDICTED: SNARE-interacting protein KEULE-like  68.2    7e-11   
ref|XP_008457207.1|  PREDICTED: SNARE-interacting protein KEULE i...  68.2    7e-11   
ref|XP_008457210.1|  PREDICTED: SNARE-interacting protein KEULE i...  68.2    7e-11   
gb|AFK39976.1|  unknown                                               65.5    8e-11   
emb|CBI38848.3|  unnamed protein product                              68.2    8e-11   
ref|XP_008457208.1|  PREDICTED: SNARE-interacting protein KEULE i...  67.8    8e-11   
ref|XP_008457209.1|  PREDICTED: SNARE-interacting protein KEULE i...  67.8    8e-11   
ref|XP_002303535.2|  KEULE family protein                             67.8    9e-11   Populus trichocarpa [western balsam poplar]
ref|XP_002509620.1|  plant sec1, putative                             67.8    1e-10   Ricinus communis
ref|XP_011081113.1|  PREDICTED: SNARE-interacting protein KEULE i...  67.4    1e-10   
ref|XP_003549889.1|  PREDICTED: SNARE-interacting protein KEULE-l...  67.4    1e-10   
ref|XP_010658345.1|  PREDICTED: SNARE-interacting protein KEULE-l...  67.4    1e-10   
ref|XP_010658346.1|  PREDICTED: SNARE-interacting protein KEULE-l...  67.4    2e-10   
gb|KHG01742.1|  SNARE-interacting protein KEULE                       67.0    2e-10   
gb|KHG01743.1|  SNARE-interacting protein KEULE                       67.0    2e-10   
ref|XP_004229811.1|  PREDICTED: protein transport Sec1a               66.6    2e-10   
ref|XP_002511719.1|  plant sec1, putative                             66.6    2e-10   Ricinus communis
ref|XP_009148600.1|  PREDICTED: SNARE-interacting protein KEULE-like  66.6    3e-10   
ref|XP_007210300.1|  hypothetical protein PRUPE_ppa002514mg           66.6    3e-10   
ref|XP_008238651.1|  PREDICTED: SNARE-interacting protein KEULE       66.6    3e-10   
ref|XP_011093219.1|  PREDICTED: protein transport Sec1a-like isof...  66.6    3e-10   
emb|CBI31407.3|  unnamed protein product                              66.6    3e-10   
ref|XP_003608803.1|  SNARE-interacting protein KEULE                  65.9    3e-10   
ref|XP_009362137.1|  PREDICTED: SNARE-interacting protein KEULE-like  66.2    3e-10   
ref|XP_008345378.1|  PREDICTED: SNARE-interacting protein KEULE-like  66.2    3e-10   
gb|KDO67938.1|  hypothetical protein CISIN_1g0060292mg                61.6    4e-10   
ref|XP_010056311.1|  PREDICTED: protein transport Sec1a               66.2    4e-10   
gb|KDO43208.1|  hypothetical protein CISIN_1g0060242mg                61.6    4e-10   
ref|XP_003608802.1|  SNARE-interacting protein KEULE                  65.9    4e-10   
ref|XP_002446199.1|  hypothetical protein SORBIDRAFT_06g003780        65.9    4e-10   Sorghum bicolor [broomcorn]
ref|XP_007134885.1|  hypothetical protein PHAVU_010G084300g           65.9    4e-10   
ref|XP_004298696.1|  PREDICTED: SNARE-interacting protein KEULE-like  65.9    5e-10   
ref|XP_006579617.1|  PREDICTED: SNARE-interacting protein KEULE-l...  65.9    5e-10   
ref|XP_003525770.1|  PREDICTED: SNARE-interacting protein KEULE-l...  65.5    5e-10   
gb|KFK42572.1|  hypothetical protein AALP_AA1G013000                  65.5    5e-10   
ref|XP_003517436.1|  PREDICTED: SNARE-interacting protein KEULE-l...  65.5    5e-10   
ref|XP_006573736.1|  PREDICTED: SNARE-interacting protein KEULE-l...  65.5    5e-10   
ref|XP_010908051.1|  PREDICTED: SNARE-interacting protein KEULE-l...  65.5    5e-10   
gb|ACN31334.1|  unknown                                               65.5    6e-10   Zea mays [maize]
ref|XP_010908050.1|  PREDICTED: SNARE-interacting protein KEULE-l...  65.5    6e-10   
ref|XP_010908047.1|  PREDICTED: SNARE-interacting protein KEULE-l...  65.5    6e-10   
ref|XP_010908049.1|  PREDICTED: SNARE-interacting protein KEULE-l...  65.5    6e-10   
ref|XP_010908048.1|  PREDICTED: SNARE-interacting protein KEULE-l...  65.5    6e-10   
gb|KHN42721.1|  SNARE-interacting protein KEULE                       65.5    6e-10   
ref|XP_006573735.1|  PREDICTED: SNARE-interacting protein KEULE-l...  65.5    6e-10   
ref|XP_006573734.1|  PREDICTED: SNARE-interacting protein KEULE-l...  65.5    6e-10   
ref|NP_567388.1|  protein transport sec1b                             65.5    7e-10   Arabidopsis thaliana [mouse-ear cress]
gb|EPS73965.1|  hypothetical protein M569_00789                       65.1    8e-10   
gb|KHM98888.1|  Protein transport Sec1a                               65.1    9e-10   
ref|XP_003521950.1|  PREDICTED: protein transport Sec1a-like          65.1    9e-10   
ref|XP_002453767.1|  hypothetical protein SORBIDRAFT_04g015010        64.3    1e-09   Sorghum bicolor [broomcorn]
ref|XP_004506504.1|  PREDICTED: protein transport Sec1a-like          64.3    1e-09   
ref|XP_008643567.1|  PREDICTED: SNARE-interacting protein KEULE i...  64.3    1e-09   
gb|AES87273.2|  Sec1-family transporter                               64.3    1e-09   
ref|NP_001146894.1|  SNARE-interacting protein KEULE                  64.3    1e-09   Zea mays [maize]
gb|ACG24270.1|  SNARE-interacting protein KEULE                       64.3    1e-09   Zea mays [maize]
ref|XP_003605076.1|  SNARE-interacting protein KEULE                  64.3    2e-09   
gb|EEC76890.1|  hypothetical protein OsI_15097                        64.3    2e-09   Oryza sativa Indica Group [Indian rice]
sp|Q7XWP3.2|SEC1A_ORYSJ  RecName: Full=Probable protein transport...  64.3    2e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010457049.1|  PREDICTED: protein transport Sec1a-like          61.2    2e-09   
ref|XP_006368712.1|  KEULE family protein                             63.9    2e-09   
ref|XP_010433745.1|  PREDICTED: protein transport Sec1b-like          63.9    2e-09   
ref|XP_010422186.1|  PREDICTED: protein transport Sec1b-like isof...  63.9    2e-09   
ref|XP_010422184.1|  PREDICTED: protein transport Sec1b-like isof...  63.9    2e-09   
ref|XP_011029096.1|  PREDICTED: SNARE-interacting protein KEULE       63.9    2e-09   
ref|XP_010422183.1|  PREDICTED: protein transport Sec1b-like isof...  63.9    2e-09   
ref|XP_010255636.1|  PREDICTED: SNARE-interacting protein KEULE-l...  63.5    2e-09   
emb|CDP09881.1|  unnamed protein product                              63.5    3e-09   
ref|XP_006486801.1|  PREDICTED: SNARE-interacting protein KEULE-l...  63.5    3e-09   
ref|XP_006486800.1|  PREDICTED: SNARE-interacting protein KEULE-l...  63.5    3e-09   
ref|XP_007155597.1|  hypothetical protein PHAVU_003G215400g           63.2    3e-09   
ref|XP_007155598.1|  hypothetical protein PHAVU_003G215400g           63.2    3e-09   
ref|XP_006421235.1|  hypothetical protein CICLE_v10004496mg           63.2    4e-09   
ref|XP_006421236.1|  hypothetical protein CICLE_v10004496mg           63.2    4e-09   
gb|KCW77685.1|  hypothetical protein EUGRSUZ_D01986                   63.2    4e-09   
ref|XP_006421234.1|  hypothetical protein CICLE_v10004496mg           63.2    4e-09   
ref|XP_006647243.1|  PREDICTED: probable protein transport Sec1a-...  63.2    4e-09   
ref|XP_010053400.1|  PREDICTED: SNARE-interacting protein KEULE       63.2    4e-09   
emb|CDY30074.1|  BnaC05g09460D                                        62.8    5e-09   
ref|XP_002892032.1|  hypothetical protein ARALYDRAFT_470074           62.8    5e-09   
gb|AAK15767.1|AF335539_1  AtSec1a                                     62.8    5e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004515765.1|  PREDICTED: SNARE-interacting protein KEULE-like  62.8    5e-09   
gb|EEE56916.1|  hypothetical protein OsJ_06593                        62.8    5e-09   Oryza sativa Japonica Group [Japonica rice]
gb|EEC73104.1|  hypothetical protein OsI_07088                        62.8    5e-09   Oryza sativa Indica Group [Indian rice]
ref|NP_563643.4|  protein transporter sec1a                           62.8    5e-09   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001184888.1|  protein transporter sec1a                        62.8    5e-09   
ref|XP_006418478.1|  hypothetical protein EUTSA_v10006989mg           62.8    5e-09   
ref|XP_009118849.1|  PREDICTED: protein transport Sec1a isoform X1    62.8    5e-09   
emb|CDY38041.1|  BnaCnng09020D                                        62.8    5e-09   
ref|XP_004975116.1|  PREDICTED: probable protein transport Sec1a-...  62.8    6e-09   
ref|XP_004975115.1|  PREDICTED: probable protein transport Sec1a-...  62.4    6e-09   
gb|KFK31959.1|  hypothetical protein AALP_AA6G182000                  62.4    6e-09   
ref|XP_006574263.1|  PREDICTED: protein transport Sec1a-like          62.8    7e-09   
ref|XP_010239737.1|  PREDICTED: probable protein transport Sec1a      62.4    7e-09   
ref|XP_006491554.1|  PREDICTED: SNARE-interacting protein KEULE-like  62.0    8e-09   
ref|XP_004513137.1|  PREDICTED: protein transport Sec1a-like isof...  62.0    9e-09   
ref|XP_009418742.1|  PREDICTED: SNARE-interacting protein KEULE-like  62.0    9e-09   
ref|XP_006287228.1|  hypothetical protein CARUB_v10000405mg           62.0    9e-09   
ref|XP_004513138.1|  PREDICTED: protein transport Sec1a-like isof...  62.0    9e-09   
gb|AAM67096.1|  KEULE                                                 62.0    9e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006422678.1|  hypothetical protein CICLE_v10027965mg           62.0    1e-08   
ref|XP_010455656.1|  PREDICTED: protein transport Sec1b isoform X2    62.0    1e-08   
gb|EYU31992.1|  hypothetical protein MIMGU_mgv1a002484mg              62.0    1e-08   
ref|XP_010455655.1|  PREDICTED: protein transport Sec1b isoform X1    61.6    1e-08   
ref|XP_006396794.1|  hypothetical protein EUTSA_v10028497mg           61.6    1e-08   
ref|XP_010474830.1|  PREDICTED: protein transport Sec1a isoform X1    61.6    1e-08   
ref|XP_010474832.1|  PREDICTED: protein transport Sec1a isoform X3    61.6    1e-08   
ref|XP_006422679.1|  hypothetical protein CICLE_v10027965mg           61.6    1e-08   
ref|XP_007157317.1|  hypothetical protein PHAVU_002G059900g           61.2    2e-08   
gb|EPS63425.1|  hypothetical protein M569_11359                       59.7    2e-08   
ref|XP_006306940.1|  hypothetical protein CARUB_v10008507mg           61.2    2e-08   
emb|CDX98070.1|  BnaA06g08210D                                        61.2    2e-08   
ref|XP_003562299.1|  PREDICTED: probable protein transport Sec1a ...  60.8    2e-08   
ref|XP_010232774.1|  PREDICTED: probable protein transport Sec1a ...  60.8    2e-08   
gb|EYU30559.1|  hypothetical protein MIMGU_mgv1a002638mg              60.8    2e-08   
ref|XP_002874754.1|  hypothetical protein ARALYDRAFT_327340           60.8    2e-08   
ref|XP_004952408.1|  PREDICTED: probable protein transport Sec1a-...  60.8    2e-08   
ref|XP_004952410.1|  PREDICTED: probable protein transport Sec1a-...  60.8    2e-08   
ref|XP_004952409.1|  PREDICTED: probable protein transport Sec1a-...  60.8    2e-08   
ref|XP_001785411.1|  SM/Sec1-family protein                           60.5    3e-08   
dbj|BAJ98955.1|  predicted protein                                    56.6    5e-08   
ref|XP_010523082.1|  PREDICTED: protein transport Sec1a               59.3    7e-08   
ref|XP_002985290.1|  hypothetical protein SELMODRAFT_234736           58.9    1e-07   
ref|XP_002970097.1|  hypothetical protein SELMODRAFT_92538            58.9    1e-07   
ref|XP_008393252.1|  PREDICTED: protein transport Sec1a               58.9    1e-07   
ref|XP_009338114.1|  PREDICTED: protein transport Sec1a               58.5    1e-07   
emb|CDO97685.1|  unnamed protein product                              58.5    1e-07   
ref|XP_010529508.1|  PREDICTED: protein transport Sec1b isoform X1    58.5    1e-07   
ref|XP_010529509.1|  PREDICTED: protein transport Sec1b isoform X2    58.5    1e-07   
ref|XP_008232655.1|  PREDICTED: protein transport Sec1a               57.4    3e-07   
ref|XP_007219134.1|  hypothetical protein PRUPE_ppa015909mg           57.4    4e-07   
ref|XP_004299977.1|  PREDICTED: SNARE-interacting protein KEULE-like  57.4    4e-07   
dbj|BAK07507.1|  predicted protein                                    56.6    5e-07   
ref|XP_004306922.1|  PREDICTED: protein transport Sec1a-like          56.2    8e-07   
ref|XP_004145061.1|  PREDICTED: protein transport Sec1a-like          55.1    2e-06   
ref|XP_008460124.1|  PREDICTED: protein transport Sec1a-like isof...  54.7    2e-06   
ref|XP_004160690.1|  PREDICTED: protein transport Sec1a-like          54.7    3e-06   
gb|EMT25362.1|  Putative protein transport Sec1a                      54.7    3e-06   
ref|XP_006445263.1|  hypothetical protein CICLE_v10023931mg           54.3    3e-06   
ref|XP_009134254.1|  PREDICTED: protein transport Sec1b               53.5    7e-06   
emb|CDY68111.1|  BnaCnng57670D                                        53.5    7e-06   
emb|CDX90817.1|  BnaA03g24970D                                        53.5    8e-06   
ref|XP_002992966.1|  hypothetical protein SELMODRAFT_236643           53.1    8e-06   
ref|XP_002992446.1|  hypothetical protein SELMODRAFT_135316           53.1    9e-06   
ref|XP_004964455.1|  PREDICTED: probable protein transport Sec1b-...  52.8    1e-05   
gb|EAZ35746.1|  hypothetical protein OsJ_20037                        50.4    1e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002437778.1|  hypothetical protein SORBIDRAFT_10g002411        52.8    1e-05   Sorghum bicolor [broomcorn]
ref|XP_011090689.1|  PREDICTED: protein transport Sec1a-like          52.4    1e-05   
gb|AFW85969.1|  hypothetical protein ZEAMMB73_289594                  52.4    1e-05   
gb|EMS45373.1|  putative protein transport Sec1a                      52.4    2e-05   
ref|XP_008659326.1|  PREDICTED: probable protein transport Sec1b ...  52.4    2e-05   
gb|EEC79942.1|  hypothetical protein OsI_21530                        50.4    2e-05   Oryza sativa Indica Group [Indian rice]
gb|AFW85968.1|  hypothetical protein ZEAMMB73_289594                  52.4    2e-05   
ref|XP_008659325.1|  PREDICTED: probable protein transport Sec1b ...  52.4    2e-05   
emb|CDX94488.1|  BnaC09g23480D                                        52.4    2e-05   
ref|NP_001151607.1|  SNARE-interacting protein KEULE                  52.0    2e-05   Zea mays [maize]
gb|ACN26935.1|  unknown                                               52.0    2e-05   Zea mays [maize]
dbj|BAK06817.1|  predicted protein                                    52.0    2e-05   
ref|XP_009610922.1|  PREDICTED: protein transport Sec1a               51.6    3e-05   
ref|XP_006655761.1|  PREDICTED: probable protein transport Sec1b-...  51.6    3e-05   
gb|EMT22189.1|  Putative protein transport Sec1b                      51.2    4e-05   
gb|EMS48081.1|  putative protein transport Sec1b                      51.2    4e-05   
sp|Q5VNU3.1|SEC1B_ORYSJ  RecName: Full=Probable protein transport...  51.2    4e-05   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001056722.1|  Os06g0135900                                     50.8    5e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009764741.1|  PREDICTED: SNARE-interacting protein KEULE i...  50.8    5e-05   
ref|XP_007020043.1|  Sec1/munc18-like (SM) proteins superfamily       50.8    6e-05   
ref|XP_009761132.1|  PREDICTED: protein transport Sec1a               50.4    6e-05   
ref|XP_007052059.1|  Secretory 1A                                     50.4    6e-05   
ref|XP_003557237.1|  PREDICTED: probable protein transport Sec1b      50.1    9e-05   
ref|XP_010692247.1|  PREDICTED: protein transport Sec1a-like          49.7    1e-04   
gb|EYU28980.1|  hypothetical protein MIMGU_mgv1a0251092mg             48.9    2e-04   
ref|XP_010108131.1|  SNARE-interacting protein KEULE                  47.8    5e-04   
ref|XP_002513760.1|  hypothetical protein RCOM_1030820                44.3    7e-04   Ricinus communis



>ref|XP_009599695.1| PREDICTED: SNARE-interacting protein KEULE [Nicotiana tomentosiformis]
Length=666

 Score = 76.6 bits (187),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = -3

Query  123  DYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            DYKYFRQ++RDRLL EMLRSAKSKDSK+ WKVLIMDKLTVK
Sbjct  14   DYKYFRQVSRDRLLYEMLRSAKSKDSKSAWKVLIMDKLTVK  54



>emb|CDY26558.1| BnaA09g47190D [Brassica napus]
Length=159

 Score = 72.0 bits (175),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/44 (80%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  HAIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
             A DYK FRQITR+RLL EMLRSAK+  SK+TWKVLIMDKLTVK
Sbjct  11   QAADYKNFRQITRERLLYEMLRSAKTGSSKSTWKVLIMDKLTVK  54



>ref|XP_010546254.1| PREDICTED: SNARE-interacting protein KEULE [Tarenaya hassleriana]
Length=665

 Score = 73.9 bits (180),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 35/44 (80%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  HAIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
              +DYK FRQITRDRLL EMLRSAK+  SK+TWKVLIMDKLTVK
Sbjct  11   QGVDYKNFRQITRDRLLYEMLRSAKTGSSKSTWKVLIMDKLTVK  54



>ref|XP_006851850.1| hypothetical protein AMTR_s00041p00086140 [Amborella trichopoda]
 gb|ERN13317.1| hypothetical protein AMTR_s00041p00086140 [Amborella trichopoda]
Length=634

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  HAIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            H  DY+ FRQI+RDRLL EMLRS KS DSK+TWKVLIMDK+TVK
Sbjct  8    HGGDYRSFRQISRDRLLHEMLRSTKSGDSKSTWKVLIMDKITVK  51



>ref|XP_002889930.1| hypothetical protein ARALYDRAFT_471384 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66189.1| hypothetical protein ARALYDRAFT_471384 [Arabidopsis lyrata subsp. 
lyrata]
Length=665

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/44 (80%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  HAIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            H  DYK FRQITR+RLL EMLRSAK+  SK+TWKVLIMDKLTVK
Sbjct  11   HGGDYKNFRQITRERLLYEMLRSAKTGSSKSTWKVLIMDKLTVK  54



>ref|XP_010918310.1| PREDICTED: SNARE-interacting protein KEULE-like [Elaeis guineensis]
 ref|XP_010918311.1| PREDICTED: SNARE-interacting protein KEULE-like [Elaeis guineensis]
 ref|XP_010918313.1| PREDICTED: SNARE-interacting protein KEULE-like [Elaeis guineensis]
Length=669

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -3

Query  123  DYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            D+K FRQITRDRLLCEM+RS K KDSK+TWKVLIMDK+TV+
Sbjct  13   DHKTFRQITRDRLLCEMIRSTKVKDSKSTWKVLIMDKVTVR  53



>ref|XP_009409809.1| PREDICTED: SNARE-interacting protein KEULE-like [Musa acuminata 
subsp. malaccensis]
Length=665

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -3

Query  123  DYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            DYK FR +TRDRLLCEML+S ++KDSK+TWKVLIMDK+TVK
Sbjct  14   DYKNFRHVTRDRLLCEMLQSTRAKDSKSTWKVLIMDKITVK  54



>ref|XP_004245704.1| PREDICTED: SNARE-interacting protein KEULE [Solanum lycopersicum]
Length=666

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  123  DYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            DYK FRQ+ RDRLL EMLRSAKSKDSK+ WKVLIMDKLTVK
Sbjct  14   DYKNFRQVIRDRLLYEMLRSAKSKDSKSAWKVLIMDKLTVK  54



>ref|XP_006363728.1| PREDICTED: SNARE-interacting protein KEULE-like [Solanum tuberosum]
Length=666

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  123  DYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            DYK FRQ+ RDRLL EMLRSAKSKDSK+ WKVLIMDKLTVK
Sbjct  14   DYKNFRQVIRDRLLYEMLRSAKSKDSKSAWKVLIMDKLTVK  54



>gb|EYU25606.1| hypothetical protein MIMGU_mgv1a017441mg [Erythranthe guttata]
Length=75

 Score = 67.4 bits (163),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -3

Query  123  DYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            +YK FRQI+RDRLL EMLRSAK+ DSK++WKVLIMDK+TVK
Sbjct  15   EYKTFRQISRDRLLYEMLRSAKTGDSKSSWKVLIMDKVTVK  55



>ref|XP_010934674.1| PREDICTED: SNARE-interacting protein KEULE-like [Elaeis guineensis]
Length=666

 Score = 72.0 bits (175),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  HAIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            H  DYK FRQI+R+RLL EMLRS K+KDSKA WKVLIMDK TVK
Sbjct  11   HGGDYKNFRQISRERLLYEMLRSTKAKDSKAAWKVLIMDKFTVK  54



>ref|XP_010533747.1| PREDICTED: SNARE-interacting protein KEULE-like [Tarenaya hassleriana]
Length=666

 Score = 72.0 bits (175),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  HAIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
              ++YK FRQITRDRLL EMLRSAK+  SK+TWKVLIMDKLTVK
Sbjct  11   QGVEYKNFRQITRDRLLYEMLRSAKTASSKSTWKVLIMDKLTVK  54



>ref|XP_008791331.1| PREDICTED: SNARE-interacting protein KEULE [Phoenix dactylifera]
Length=665

 Score = 71.6 bits (174),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  HAIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            H  DYK FRQ++R+RLL EML+S K+KDSKATWKVLIMDK TVK
Sbjct  10   HGGDYKNFRQVSRERLLYEMLQSTKAKDSKATWKVLIMDKFTVK  53



>ref|XP_007039986.1| Sec1/munc18-like (SM) proteins superfamily isoform 1 [Theobroma 
cacao]
 gb|EOY24487.1| Sec1/munc18-like (SM) proteins superfamily isoform 1 [Theobroma 
cacao]
Length=663

 Score = 71.6 bits (174),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = -3

Query  129  AIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            A DYK FRQI+R+RLL EMLRSAK++DSK+TWKVLIMDK+TVK
Sbjct  12   AGDYKNFRQISRERLLYEMLRSAKTRDSKSTWKVLIMDKVTVK  54



>ref|XP_009118089.1| PREDICTED: SNARE-interacting protein KEULE [Brassica rapa]
 emb|CDY26559.1| BnaA09g47180D [Brassica napus]
Length=666

 Score = 71.6 bits (174),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/44 (80%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  HAIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
             A DYK FRQITR+RLL EMLRSAK+  SK+TWKVLIMDKLTVK
Sbjct  11   QAADYKNFRQITRERLLYEMLRSAKTGSSKSTWKVLIMDKLTVK  54



>emb|CDY15993.1| BnaC08g41300D [Brassica napus]
Length=667

 Score = 71.6 bits (174),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/44 (80%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  HAIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
             A DYK FRQITR+RLL EMLRSAK+  SK+TWKVLIMDKLTVK
Sbjct  11   QAADYKNFRQITRERLLYEMLRSAKTGSSKSTWKVLIMDKLTVK  54



>ref|XP_009340828.1| PREDICTED: SNARE-interacting protein KEULE-like [Pyrus x bretschneideri]
Length=663

 Score = 71.6 bits (174),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  HAIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            +  DYK F+QI+RDRLL EMLRS K+ DSKATWKVLIMDKLTVK
Sbjct  12   YGGDYKNFKQISRDRLLIEMLRSCKTGDSKATWKVLIMDKLTVK  55



>ref|XP_008374022.1| PREDICTED: SNARE-interacting protein KEULE-like [Malus domestica]
Length=663

 Score = 71.6 bits (174),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  HAIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            +  DYK F+QI+RDRLL EMLRS K+ DSKATWKVLIMDKLTVK
Sbjct  12   YGGDYKNFKQISRDRLLIEMLRSCKTGDSKATWKVLIMDKLTVK  55



>ref|XP_011034306.1| PREDICTED: protein transport Sec1a [Populus euphratica]
Length=676

 Score = 71.2 bits (173),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  HAIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            H  +YK+FRQITRDRLL EML S ++ DSK+TWKVLIMDK+TVK
Sbjct  13   HGGEYKFFRQITRDRLLFEMLGSTRTGDSKSTWKVLIMDKVTVK  56



>ref|XP_002320060.2| cytokinesis-related Sec1 family protein [Populus trichocarpa]
 gb|EEE98375.2| cytokinesis-related Sec1 family protein [Populus trichocarpa]
Length=665

 Score = 71.2 bits (173),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  HAIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            H  +YK+FRQITRDRLL EML S ++ DSK+TWKVLIMDK+TVK
Sbjct  13   HGGEYKFFRQITRDRLLFEMLGSTRTGDSKSTWKVLIMDKVTVK  56



>ref|NP_563905.1| SNARE-interacting protein KEULE [Arabidopsis thaliana]
 sp|Q9C5X3.2|KEULE_ARATH RecName: Full=SNARE-interacting protein KEULE [Arabidopsis thaliana]
 dbj|BAE99577.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE28870.1| SNARE-interacting protein KEULE [Arabidopsis thaliana]
Length=666

 Score = 71.2 bits (173),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  HAIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            H  +YK FRQITR+RLL EMLRSAK+  SK+TWKVLIMDKLTVK
Sbjct  11   HGGEYKNFRQITRERLLYEMLRSAKTGSSKSTWKVLIMDKLTVK  54



>gb|AAK01291.1|AF331066_1 KEULE [Arabidopsis thaliana]
Length=666

 Score = 71.2 bits (173),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  HAIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            H  +YK FRQITR+RLL EMLRSAK+  SK+TWKVLIMDKLTVK
Sbjct  11   HGGEYKNFRQITRERLLYEMLRSAKTGSSKSTWKVLIMDKLTVK  54



>ref|XP_004511648.1| PREDICTED: SNARE-interacting protein KEULE-like isoform X2 [Cicer 
arietinum]
Length=664

 Score = 70.9 bits (172),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = -3

Query  129  AIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            A DY+ F+QITRDRLL EMLRS K+ DSK+TWKVLIMDKLT+K
Sbjct  14   AADYQNFKQITRDRLLHEMLRSTKTGDSKSTWKVLIMDKLTIK  56



>gb|KFK43498.1| hypothetical protein AALP_AA1G133200 [Arabis alpina]
Length=667

 Score = 70.9 bits (172),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 35/44 (80%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  HAIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
             A DYK FRQITR+RLL EMLRSAK+  SK+TWKVLIMDKLTVK
Sbjct  11   QAGDYKTFRQITRERLLYEMLRSAKTGSSKSTWKVLIMDKLTVK  54



>ref|XP_008798533.1| PREDICTED: SNARE-interacting protein KEULE [Phoenix dactylifera]
 ref|XP_008798534.1| PREDICTED: SNARE-interacting protein KEULE [Phoenix dactylifera]
Length=669

 Score = 70.9 bits (172),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  123  DYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            DYK FRQITRDRLL EM+RS K KDSK+TWKVLIMDK+TVK
Sbjct  13   DYKTFRQITRDRLLYEMIRSTKVKDSKSTWKVLIMDKVTVK  53



>ref|XP_004511647.1| PREDICTED: SNARE-interacting protein KEULE-like isoform X1 [Cicer 
arietinum]
Length=688

 Score = 70.9 bits (172),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = -3

Query  129  AIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            A DY+ F+QITRDRLL EMLRS K+ DSK+TWKVLIMDKLT+K
Sbjct  14   AADYQNFKQITRDRLLHEMLRSTKTGDSKSTWKVLIMDKLTIK  56



>gb|KDP25591.1| hypothetical protein JCGZ_20747 [Jatropha curcas]
Length=664

 Score = 70.9 bits (172),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  HAIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            +  +YK FRQI+R+RLL EMLRSAKS DSK+TWKVLIMDKLTVK
Sbjct  11   YGGEYKNFRQISRERLLHEMLRSAKSGDSKSTWKVLIMDKLTVK  54



>ref|XP_009409807.1| PREDICTED: SNARE-interacting protein KEULE-like [Musa acuminata 
subsp. malaccensis]
Length=668

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  HAIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            H  D K FRQI+RDRLL EMLRS K KDSK+TWKVLIMDK+TVK
Sbjct  11   HGGDQKTFRQISRDRLLYEMLRSTKVKDSKSTWKVLIMDKITVK  54



>ref|XP_010676659.1| PREDICTED: SNARE-interacting protein KEULE [Beta vulgaris subsp. 
vulgaris]
Length=665

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  HAIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            HA DYKYFRQ+TRDRLL EML S K  DS++ WKVLIMD+ TVK
Sbjct  10   HAGDYKYFRQMTRDRLLHEMLGSTKKGDSRSNWKVLIMDRFTVK  53



>ref|XP_011069828.1| PREDICTED: SNARE-interacting protein KEULE-like isoform X1 [Sesamum 
indicum]
Length=664

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -3

Query  123  DYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            +YK FRQITRDRLL EMLRSAK+ DSK++WKVLIMDK+TVK
Sbjct  14   EYKNFRQITRDRLLYEMLRSAKTGDSKSSWKVLIMDKVTVK  54



>gb|KEH27454.1| SNARE-interacting KEULE-like protein [Medicago truncatula]
Length=592

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -3

Query  129  AIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
              DY+ F+QITRDRLL EMLRS K+ DSK+TWKVLIMDKLT+K
Sbjct  14   GADYQNFKQITRDRLLHEMLRSTKTGDSKSTWKVLIMDKLTIK  56



>gb|AES94196.2| SNARE-interacting KEULE-like protein [Medicago truncatula]
Length=669

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -3

Query  129  AIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
              DY+ F+QITRDRLL EMLRS K+ DSK+TWKVLIMDKLT+K
Sbjct  14   GADYQNFKQITRDRLLHEMLRSTKTGDSKSTWKVLIMDKLTIK  56



>ref|XP_006306027.1| hypothetical protein CARUB_v10011323mg [Capsella rubella]
 gb|EOA38925.1| hypothetical protein CARUB_v10011323mg [Capsella rubella]
Length=666

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  HAIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
             A +YK FRQITR+RLL EMLRSAK+  SK+TWKVLIMDKLTVK
Sbjct  11   QAGEYKNFRQITRERLLYEMLRSAKTGSSKSTWKVLIMDKLTVK  54



>ref|XP_010494099.1| PREDICTED: SNARE-interacting protein KEULE [Camelina sativa]
Length=666

 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  HAIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
             A +YK FRQITR+RLL EMLRSAK+  SK+TWKVLIMDKLTVK
Sbjct  11   QAGEYKNFRQITRERLLYEMLRSAKTGSSKSTWKVLIMDKLTVK  54



>ref|XP_003611238.1| SNARE-interacting protein KEULE [Medicago truncatula]
Length=724

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -3

Query  129  AIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
              DY+ F+QITRDRLL EMLRS K+ DSK+TWKVLIMDKLT+K
Sbjct  14   GADYQNFKQITRDRLLHEMLRSTKTGDSKSTWKVLIMDKLTIK  56



>ref|XP_010458665.1| PREDICTED: SNARE-interacting protein KEULE-like [Camelina sativa]
Length=666

 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  HAIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
             A +YK FRQITR+RLL EMLRSAK+  SK+TWKVLIMDKLTVK
Sbjct  11   QAGEYKNFRQITRERLLYEMLRSAKTGSSKSTWKVLIMDKLTVK  54



>ref|XP_006417244.1| hypothetical protein EUTSA_v10007001mg [Eutrema salsugineum]
 gb|ESQ35597.1| hypothetical protein EUTSA_v10007001mg [Eutrema salsugineum]
Length=667

 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  HAIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
             A +YK FRQITR+RLL EMLRSAK+  SK+TWKVLIMDKLTVK
Sbjct  11   QAGEYKNFRQITRERLLYEMLRSAKTGSSKSTWKVLIMDKLTVK  54



>ref|XP_003538607.1| PREDICTED: SNARE-interacting protein KEULE-like [Glycine max]
 gb|KHN34969.1| SNARE-interacting protein KEULE [Glycine soja]
Length=663

 Score = 68.9 bits (167),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = -3

Query  129  AIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
              DYK F+QI+R+RLL EMLRS+K+ DSK+TWKVLIMDKLTVK
Sbjct  13   GADYKSFKQISRERLLHEMLRSSKTGDSKSTWKVLIMDKLTVK  55



>ref|XP_010276590.1| PREDICTED: SNARE-interacting protein KEULE [Nelumbo nucifera]
Length=665

 Score = 68.6 bits (166),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -3

Query  123  DYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            +YK F+QI+RDRLL EMLRSAK+ DSK+TWKVLIMDK+TVK
Sbjct  13   EYKNFKQISRDRLLHEMLRSAKTGDSKSTWKVLIMDKVTVK  53



>ref|XP_010476209.1| PREDICTED: SNARE-interacting protein KEULE-like [Camelina sativa]
Length=667

 Score = 68.6 bits (166),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  123  DYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            +YK FRQITR+RLL EMLRSAK+  SK+TWKVLIMDKLTVK
Sbjct  15   EYKNFRQITRERLLYEMLRSAKTGSSKSTWKVLIMDKLTVK  55



>ref|XP_010661629.1| PREDICTED: protein transport Sec1a isoform X2 [Vitis vinifera]
Length=632

 Score = 68.2 bits (165),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  HAIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            +A +YK FRQI+RDRLL EMLRS K+ DSK+TWKVLIMDK+T K
Sbjct  11   NAGEYKNFRQISRDRLLHEMLRSTKTGDSKSTWKVLIMDKVTTK  54



>ref|XP_011033888.1| PREDICTED: SNARE-interacting protein KEULE-like [Populus euphratica]
 ref|XP_011033889.1| PREDICTED: SNARE-interacting protein KEULE-like [Populus euphratica]
Length=666

 Score = 68.6 bits (166),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -3

Query  123  DYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            DY+ FRQI+R+RLL EMLRSAK+ +SK+TWKVLIMDKLTVK
Sbjct  15   DYRNFRQISRERLLREMLRSAKTGNSKSTWKVLIMDKLTVK  55



>ref|XP_002278966.1| PREDICTED: protein transport Sec1a isoform X3 [Vitis vinifera]
Length=665

 Score = 68.2 bits (165),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  HAIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            +A +YK FRQI+RDRLL EMLRS K+ DSK+TWKVLIMDK+T K
Sbjct  11   NAGEYKNFRQISRDRLLHEMLRSTKTGDSKSTWKVLIMDKVTTK  54



>ref|XP_008457205.1| PREDICTED: SNARE-interacting protein KEULE isoform X1 [Cucumis 
melo]
 ref|XP_008457206.1| PREDICTED: SNARE-interacting protein KEULE isoform X1 [Cucumis 
melo]
Length=664

 Score = 68.2 bits (165),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -3

Query  117  KYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            K FRQI+RDRLL EMLRSAK+ DSK+TWKVLIMDKLTVK
Sbjct  16   KNFRQISRDRLLHEMLRSAKTGDSKSTWKVLIMDKLTVK  54



>ref|XP_004138971.1| PREDICTED: SNARE-interacting protein KEULE-like [Cucumis sativus]
 ref|XP_004162356.1| PREDICTED: SNARE-interacting protein KEULE-like [Cucumis sativus]
 gb|KGN61509.1| hypothetical protein Csa_2G150510 [Cucumis sativus]
Length=664

 Score = 68.2 bits (165),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -3

Query  117  KYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            K FRQI+RDRLL EMLRSAK+ DSK+TWKVLIMDKLTVK
Sbjct  16   KSFRQISRDRLLHEMLRSAKTGDSKSTWKVLIMDKLTVK  54



>ref|XP_008457207.1| PREDICTED: SNARE-interacting protein KEULE isoform X2 [Cucumis 
melo]
Length=663

 Score = 68.2 bits (165),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -3

Query  117  KYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            K FRQI+RDRLL EMLRSAK+ DSK+TWKVLIMDKLTVK
Sbjct  16   KNFRQISRDRLLHEMLRSAKTGDSKSTWKVLIMDKLTVK  54



>ref|XP_008457210.1| PREDICTED: SNARE-interacting protein KEULE isoform X5 [Cucumis 
melo]
Length=579

 Score = 68.2 bits (165),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -3

Query  117  KYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            K FRQI+RDRLL EMLRSAK+ DSK+TWKVLIMDKLTVK
Sbjct  16   KNFRQISRDRLLHEMLRSAKTGDSKSTWKVLIMDKLTVK  54



>gb|AFK39976.1| unknown [Lotus japonicus]
Length=235

 Score = 65.5 bits (158),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  HAIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            +  +YK  +Q++R+RLL EMLRSAK+ DSK+TWKVLIMDKLTVK
Sbjct  9    YGGEYKSLKQVSRERLLHEMLRSAKTGDSKSTWKVLIMDKLTVK  52



>emb|CBI38848.3| unnamed protein product [Vitis vinifera]
Length=683

 Score = 68.2 bits (165),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  HAIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            +A +YK FRQI+RDRLL EMLRS K+ DSK+TWKVLIMDK+T K
Sbjct  11   NAGEYKNFRQISRDRLLHEMLRSTKTGDSKSTWKVLIMDKVTTK  54



>ref|XP_008457208.1| PREDICTED: SNARE-interacting protein KEULE isoform X3 [Cucumis 
melo]
Length=580

 Score = 67.8 bits (164),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -3

Query  117  KYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            K FRQI+RDRLL EMLRSAK+ DSK+TWKVLIMDKLTVK
Sbjct  16   KNFRQISRDRLLHEMLRSAKTGDSKSTWKVLIMDKLTVK  54



>ref|XP_008457209.1| PREDICTED: SNARE-interacting protein KEULE isoform X4 [Cucumis 
melo]
Length=579

 Score = 67.8 bits (164),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -3

Query  117  KYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            K FRQI+RDRLL EMLRSAK+ DSK+TWKVLIMDKLTVK
Sbjct  16   KNFRQISRDRLLHEMLRSAKTGDSKSTWKVLIMDKLTVK  54



>ref|XP_002303535.2| KEULE family protein [Populus trichocarpa]
 gb|EEE78514.2| KEULE family protein [Populus trichocarpa]
Length=673

 Score = 67.8 bits (164),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  HAIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            +  DY+ FRQI+R+RLL EMLRSAK+ +SK+TWKVLIMD+LTVK
Sbjct  12   YGGDYRNFRQISRERLLHEMLRSAKTGNSKSTWKVLIMDRLTVK  55



>ref|XP_002509620.1| plant sec1, putative [Ricinus communis]
 gb|EEF51007.1| plant sec1, putative [Ricinus communis]
Length=663

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  120  YKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            YK FRQI+R+RLL EMLRSAK+ +SK+TWKVLIMDKLTVK
Sbjct  15   YKNFRQISRERLLHEMLRSAKTGNSKSTWKVLIMDKLTVK  54



>ref|XP_011081113.1| PREDICTED: SNARE-interacting protein KEULE isoform X1 [Sesamum 
indicum]
Length=673

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  123  DYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            DYK FRQ+TR+RLL EMLRS K+ DSKA WKVL+MDK+TVK
Sbjct  18   DYKNFRQVTRERLLREMLRSTKTGDSKAVWKVLVMDKVTVK  58



>ref|XP_003549889.1| PREDICTED: SNARE-interacting protein KEULE-like isoform 1 [Glycine 
max]
 gb|KHN09762.1| SNARE-interacting protein KEULE [Glycine soja]
Length=666

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  HAIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            +  +YK  +Q++RDRLL EMLRSAK+ DSK+TWKVLIMDKLTVK
Sbjct  13   YGAEYKSLKQVSRDRLLHEMLRSAKTGDSKSTWKVLIMDKLTVK  56



>ref|XP_010658345.1| PREDICTED: SNARE-interacting protein KEULE-like isoform X1 [Vitis 
vinifera]
Length=667

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  123  DYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            DY+ FRQI+R+RLL EMLRSAK+ DSK+TWKVLIMDK T+K
Sbjct  14   DYRNFRQISRERLLHEMLRSAKTGDSKSTWKVLIMDKRTIK  54



>ref|XP_010658346.1| PREDICTED: SNARE-interacting protein KEULE-like isoform X2 [Vitis 
vinifera]
Length=665

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  123  DYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            DY+ FRQI+R+RLL EMLRSAK+ DSK+TWKVLIMDK T+K
Sbjct  14   DYRNFRQISRERLLHEMLRSAKTGDSKSTWKVLIMDKRTIK  54



>gb|KHG01742.1| SNARE-interacting protein KEULE [Gossypium arboreum]
Length=666

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  120  YKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            YK F+QI+R+RLL EMLRSAK KDSK+TWKVLIMDK+TVK
Sbjct  17   YKNFKQISRERLLHEMLRSAKVKDSKSTWKVLIMDKVTVK  56



>gb|KHG01743.1| SNARE-interacting protein KEULE [Gossypium arboreum]
Length=703

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  120  YKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            YK F+QI+R+RLL EMLRSAK KDSK+TWKVLIMDK+TVK
Sbjct  17   YKNFKQISRERLLHEMLRSAKVKDSKSTWKVLIMDKVTVK  56



>ref|XP_004229811.1| PREDICTED: protein transport Sec1a [Solanum lycopersicum]
 ref|XP_010325714.1| PREDICTED: protein transport Sec1a [Solanum lycopersicum]
Length=669

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  HAIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            H  +YK F+QI+RDRLL EMLR++ S DS+++WKVLIMDK+TVK
Sbjct  11   HGGEYKNFKQISRDRLLHEMLRTSDSGDSRSSWKVLIMDKVTVK  54



>ref|XP_002511719.1| plant sec1, putative [Ricinus communis]
 gb|EEF50388.1| plant sec1, putative [Ricinus communis]
Length=676

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  HAIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            H  +YK+FRQ +RDRLL EML S ++ +SK+TWKVLIMDK+TVK
Sbjct  11   HGGEYKFFRQTSRDRLLLEMLGSTRTGESKSTWKVLIMDKVTVK  54



>ref|XP_009148600.1| PREDICTED: SNARE-interacting protein KEULE-like [Brassica rapa]
Length=668

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  HAIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
             A +YK FRQ+TR+RLL EMLRS K+  SK+TWKVLIMDKLTVK
Sbjct  12   QAGEYKNFRQLTRERLLYEMLRSTKTGSSKSTWKVLIMDKLTVK  55



>ref|XP_007210300.1| hypothetical protein PRUPE_ppa002514mg [Prunus persica]
 gb|EMJ11499.1| hypothetical protein PRUPE_ppa002514mg [Prunus persica]
Length=664

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -3

Query  117  KYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            K F+QI+RDRLL EMLRS K+ DSKATWKVLIMDKLTVK
Sbjct  16   KNFKQISRDRLLIEMLRSCKTGDSKATWKVLIMDKLTVK  54



>ref|XP_008238651.1| PREDICTED: SNARE-interacting protein KEULE [Prunus mume]
Length=664

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -3

Query  117  KYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            K F+QI+RDRLL EMLRS K+ DSKATWKVLIMDKLTVK
Sbjct  16   KNFKQISRDRLLIEMLRSCKTGDSKATWKVLIMDKLTVK  54



>ref|XP_011093219.1| PREDICTED: protein transport Sec1a-like isoform X1 [Sesamum indicum]
Length=668

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  HAIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            H  DYK FRQ++RDRLL EML+++K  DS+++WKVLIMDK+TV+
Sbjct  11   HGGDYKTFRQVSRDRLLYEMLQTSKPGDSRSSWKVLIMDKVTVR  54



>emb|CBI31407.3| unnamed protein product [Vitis vinifera]
Length=736

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  123  DYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            DY+ FRQI+R+RLL EMLRSAK+ DSK+TWKVLIMDK T+K
Sbjct  14   DYRNFRQISRERLLHEMLRSAKTGDSKSTWKVLIMDKRTIK  54



>ref|XP_003608803.1| SNARE-interacting protein KEULE [Medicago truncatula]
Length=402

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  123  DYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            +YK  +QI+R+RLL EMLRSAK+ DSK+TWKVLIMDKLTVK
Sbjct  16   EYKNLKQISRERLLHEMLRSAKTGDSKSTWKVLIMDKLTVK  56



>ref|XP_009362137.1| PREDICTED: SNARE-interacting protein KEULE-like [Pyrus x bretschneideri]
Length=663

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -3

Query  123  DYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            DYK F+QITRDRLL EMLRS K+ DS ATWKVLI+DKLT+ 
Sbjct  15   DYKNFKQITRDRLLIEMLRSCKTGDSTATWKVLIVDKLTLN  55



>ref|XP_008345378.1| PREDICTED: SNARE-interacting protein KEULE-like [Malus domestica]
Length=663

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -3

Query  123  DYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            DYK F+QITRDRLL EMLRS K+ DS ATWKVLI+DKLT+ 
Sbjct  15   DYKNFKQITRDRLLIEMLRSCKTGDSTATWKVLIVDKLTLN  55



>gb|KDO67938.1| hypothetical protein CISIN_1g0060292mg, partial [Citrus sinensis]
 gb|KDO67939.1| hypothetical protein CISIN_1g0060292mg, partial [Citrus sinensis]
 gb|KDO67940.1| hypothetical protein CISIN_1g0060292mg, partial [Citrus sinensis]
 gb|KDO67941.1| hypothetical protein CISIN_1g0060292mg, partial [Citrus sinensis]
 gb|KDO67942.1| hypothetical protein CISIN_1g0060292mg, partial [Citrus sinensis]
 gb|KDO67943.1| hypothetical protein CISIN_1g0060292mg, partial [Citrus sinensis]
Length=71

 Score = 61.6 bits (148),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -3

Query  117  KYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            K F+QI+R+RLL EMLRSAK+  SK+TWKVLIMDKLTVK
Sbjct  16   KNFKQISRERLLYEMLRSAKTGTSKSTWKVLIMDKLTVK  54



>ref|XP_010056311.1| PREDICTED: protein transport Sec1a [Eucalyptus grandis]
 gb|KCW72977.1| hypothetical protein EUGRSUZ_E01424 [Eucalyptus grandis]
Length=670

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  HAIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            H  +Y+ F QI+RDRLL EML SAK+ DSK+TWKVLIMDK+T+K
Sbjct  11   HGGEYRTFGQISRDRLLHEMLGSAKTGDSKSTWKVLIMDKVTLK  54



>gb|KDO43208.1| hypothetical protein CISIN_1g0060242mg, partial [Citrus sinensis]
 gb|KDO43209.1| hypothetical protein CISIN_1g0060242mg, partial [Citrus sinensis]
Length=71

 Score = 61.6 bits (148),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -3

Query  117  KYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            K F+QITR+RLL EMLRSAK+  SK+TWKVLIMD+LTVK
Sbjct  16   KNFKQITRERLLYEMLRSAKTGKSKSTWKVLIMDRLTVK  54



>ref|XP_003608802.1| SNARE-interacting protein KEULE [Medicago truncatula]
 gb|AES90999.1| SNARE-interacting KEULE-like protein [Medicago truncatula]
Length=666

 Score = 65.9 bits (159),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  HAIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            +  +YK  +QI+R+RLL EMLRSAK+ DSK+TWKVLIMDKLTVK
Sbjct  13   YGGEYKNLKQISRERLLHEMLRSAKTGDSKSTWKVLIMDKLTVK  56



>ref|XP_002446199.1| hypothetical protein SORBIDRAFT_06g003780 [Sorghum bicolor]
 gb|EES10527.1| hypothetical protein SORBIDRAFT_06g003780 [Sorghum bicolor]
Length=639

 Score = 65.9 bits (159),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 36/43 (84%), Gaps = 1/43 (2%)
 Frame = -3

Query  129  AIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
              DY+ FRQITRDRLL EMLRS + K SK+TWKVLIMDKLTVK
Sbjct  12   GADYRSFRQITRDRLLVEMLRSTR-KSSKSTWKVLIMDKLTVK  53



>ref|XP_007134885.1| hypothetical protein PHAVU_010G084300g [Phaseolus vulgaris]
 ref|XP_007134886.1| hypothetical protein PHAVU_010G084300g [Phaseolus vulgaris]
 gb|ESW06879.1| hypothetical protein PHAVU_010G084300g [Phaseolus vulgaris]
 gb|ESW06880.1| hypothetical protein PHAVU_010G084300g [Phaseolus vulgaris]
Length=672

 Score = 65.9 bits (159),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 37/41 (90%), Gaps = 1/41 (2%)
 Frame = -3

Query  123  DYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            +YK FRQI+RDRLL EMLRSAKS DSKA WKVLIMDK+TVK
Sbjct  13   EYKPFRQISRDRLLFEMLRSAKSPDSKA-WKVLIMDKVTVK  52



>ref|XP_004298696.1| PREDICTED: SNARE-interacting protein KEULE-like [Fragaria vesca 
subsp. vesca]
Length=662

 Score = 65.9 bits (159),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -3

Query  117  KYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            K F+QI+RDRLL EMLRS KS DSK+TWKVLIMDKLTVK
Sbjct  16   KNFKQISRDRLLHEMLRSCKSGDSKSTWKVLIMDKLTVK  54



>ref|XP_006579617.1| PREDICTED: SNARE-interacting protein KEULE-like isoform X2 [Glycine 
max]
Length=667

 Score = 65.9 bits (159),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  HAIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            +  +YK  +Q++R+RLL EMLRSAK+ DSK+TWKVLIMDKLTVK
Sbjct  12   YGAEYKSLKQVSRERLLHEMLRSAKTGDSKSTWKVLIMDKLTVK  55



>ref|XP_003525770.1| PREDICTED: SNARE-interacting protein KEULE-like isoform X1 [Glycine 
max]
Length=665

 Score = 65.5 bits (158),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  HAIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            +  +YK  +Q++R+RLL EMLRSAK+ DSK+TWKVLIMDKLTVK
Sbjct  12   YGAEYKSLKQVSRERLLHEMLRSAKTGDSKSTWKVLIMDKLTVK  55



>gb|KFK42572.1| hypothetical protein AALP_AA1G013000 [Arabis alpina]
Length=671

 Score = 65.5 bits (158),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = -3

Query  132  HAIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            H  DYK+FRQI+RDRLL EML S K+ DSKA WK+LIMD++TVK
Sbjct  12   HGGDYKFFRQISRDRLLHEMLGSTKTGDSKA-WKILIMDRVTVK  54



>ref|XP_003517436.1| PREDICTED: SNARE-interacting protein KEULE-like isoform X1 [Glycine 
max]
Length=662

 Score = 65.5 bits (158),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -3

Query  129  AIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
              DYK F+QI+R+RLL EMLRSAK+ DSK+T KVLIMDKLTVK
Sbjct  13   GADYKSFKQISRERLLHEMLRSAKTGDSKSTLKVLIMDKLTVK  55



>ref|XP_006573736.1| PREDICTED: SNARE-interacting protein KEULE-like isoform X4 [Glycine 
max]
Length=663

 Score = 65.5 bits (158),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -3

Query  129  AIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
              DYK F+QI+R+RLL EMLRSAK+ DSK+T KVLIMDKLTVK
Sbjct  13   GADYKSFKQISRERLLHEMLRSAKTGDSKSTLKVLIMDKLTVK  55



>ref|XP_010908051.1| PREDICTED: SNARE-interacting protein KEULE-like isoform X5 [Elaeis 
guineensis]
Length=597

 Score = 65.5 bits (158),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  123  DYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            D++ FRQITR+RLL EMLRS K KDSK+ WKVLIMDK+TVK
Sbjct  13   DFQTFRQITRERLLYEMLRSTKVKDSKSAWKVLIMDKVTVK  53



>gb|ACN31334.1| unknown [Zea mays]
Length=652

 Score = 65.5 bits (158),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 38/43 (88%), Gaps = 1/43 (2%)
 Frame = -3

Query  129  AIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            ++DY+ FRQITRDRLL EMLRS + K+SK+TWKVLIMDK TVK
Sbjct  2    SLDYRSFRQITRDRLLFEMLRSTR-KNSKSTWKVLIMDKFTVK  43



>ref|XP_010908050.1| PREDICTED: SNARE-interacting protein KEULE-like isoform X4 [Elaeis 
guineensis]
Length=667

 Score = 65.5 bits (158),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  123  DYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            D++ FRQITR+RLL EMLRS K KDSK+ WKVLIMDK+TVK
Sbjct  13   DFQTFRQITRERLLYEMLRSTKVKDSKSAWKVLIMDKVTVK  53



>ref|XP_010908047.1| PREDICTED: SNARE-interacting protein KEULE-like isoform X1 [Elaeis 
guineensis]
Length=671

 Score = 65.5 bits (158),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  123  DYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            D++ FRQITR+RLL EMLRS K KDSK+ WKVLIMDK+TVK
Sbjct  13   DFQTFRQITRERLLYEMLRSTKVKDSKSAWKVLIMDKVTVK  53



>ref|XP_010908049.1| PREDICTED: SNARE-interacting protein KEULE-like isoform X3 [Elaeis 
guineensis]
Length=669

 Score = 65.5 bits (158),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  123  DYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            D++ FRQITR+RLL EMLRS K KDSK+ WKVLIMDK+TVK
Sbjct  13   DFQTFRQITRERLLYEMLRSTKVKDSKSAWKVLIMDKVTVK  53



>ref|XP_010908048.1| PREDICTED: SNARE-interacting protein KEULE-like isoform X2 [Elaeis 
guineensis]
Length=669

 Score = 65.5 bits (158),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  123  DYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            D++ FRQITR+RLL EMLRS K KDSK+ WKVLIMDK+TVK
Sbjct  13   DFQTFRQITRERLLYEMLRSTKVKDSKSAWKVLIMDKVTVK  53



>gb|KHN42721.1| SNARE-interacting protein KEULE [Glycine soja]
Length=663

 Score = 65.5 bits (158),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -3

Query  129  AIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
              DYK F+QI+R+RLL EMLRSAK+ DSK+T KVLIMDKLTVK
Sbjct  13   GADYKSFKQISRERLLHEMLRSAKTGDSKSTLKVLIMDKLTVK  55



>ref|XP_006573735.1| PREDICTED: SNARE-interacting protein KEULE-like isoform X3 [Glycine 
max]
Length=678

 Score = 65.5 bits (158),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -3

Query  129  AIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
              DYK F+QI+R+RLL EMLRSAK+ DSK+T KVLIMDKLTVK
Sbjct  13   GADYKSFKQISRERLLHEMLRSAKTGDSKSTLKVLIMDKLTVK  55



>ref|XP_006573734.1| PREDICTED: SNARE-interacting protein KEULE-like isoform X2 [Glycine 
max]
Length=679

 Score = 65.5 bits (158),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -3

Query  129  AIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
              DYK F+QI+R+RLL EMLRSAK+ DSK+T KVLIMDKLTVK
Sbjct  13   GADYKSFKQISRERLLHEMLRSAKTGDSKSTLKVLIMDKLTVK  55



>ref|NP_567388.1| protein transport sec1b [Arabidopsis thaliana]
 sp|Q9SZ77.3|SEC1B_ARATH RecName: Full=Protein transport Sec1b; Short=AtSec1b [Arabidopsis 
thaliana]
 gb|AEE83098.1| protein transport sec1b [Arabidopsis thaliana]
Length=662

 Score = 65.5 bits (158),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -3

Query  123  DYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            +YK FRQITR+RLLCEMLR  ++  SK TWKVL+MDK TVK
Sbjct  14   EYKNFRQITRERLLCEMLRPERNGSSKLTWKVLVMDKFTVK  54



>gb|EPS73965.1| hypothetical protein M569_00789 [Genlisea aurea]
Length=667

 Score = 65.1 bits (157),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  123  DYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            +YK FRQI+R+RLL EMLRS K+ DSK++WKVLIMDK+TVK
Sbjct  14   EYKNFRQISRERLLYEMLRSTKTGDSKSSWKVLIMDKVTVK  54



>gb|KHM98888.1| Protein transport Sec1a [Glycine soja]
Length=626

 Score = 65.1 bits (157),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 36/43 (84%), Gaps = 1/43 (2%)
 Frame = -3

Query  129  AIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
              +YK FR I+RDRLL EMLRSAKS DSKA WKVLIMDK+TVK
Sbjct  13   GTEYKPFRHISRDRLLIEMLRSAKSPDSKA-WKVLIMDKVTVK  54



>ref|XP_003521950.1| PREDICTED: protein transport Sec1a-like [Glycine max]
Length=669

 Score = 65.1 bits (157),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 36/43 (84%), Gaps = 1/43 (2%)
 Frame = -3

Query  129  AIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
              +YK FR I+RDRLL EMLRSAKS DSKA WKVLIMDK+TVK
Sbjct  13   GTEYKPFRHISRDRLLIEMLRSAKSPDSKA-WKVLIMDKVTVK  54



>ref|XP_002453767.1| hypothetical protein SORBIDRAFT_04g015010 [Sorghum bicolor]
 gb|EES06743.1| hypothetical protein SORBIDRAFT_04g015010 [Sorghum bicolor]
Length=661

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 1/41 (2%)
 Frame = -3

Query  123  DYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            DY+ FRQITRDRLL EMLRS + K+SK+TWKVLIMDK TVK
Sbjct  13   DYRSFRQITRDRLLFEMLRSTR-KNSKSTWKVLIMDKFTVK  52



>ref|XP_004506504.1| PREDICTED: protein transport Sec1a-like [Cicer arietinum]
Length=671

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 1/43 (2%)
 Frame = -3

Query  129  AIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            A +YK FR I+RDRLL EMLRSAKS DSKA WKVLIMDK+TVK
Sbjct  14   ASEYKPFRHISRDRLLYEMLRSAKSGDSKA-WKVLIMDKVTVK  55



>ref|XP_008643567.1| PREDICTED: SNARE-interacting protein KEULE isoform X1 [Zea mays]
Length=684

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 1/41 (2%)
 Frame = -3

Query  123  DYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            DY+ FRQITRDRLL EMLRS + K+SK+TWKVLIMDK TVK
Sbjct  13   DYRSFRQITRDRLLFEMLRSTR-KNSKSTWKVLIMDKFTVK  52



>gb|AES87273.2| Sec1-family transporter [Medicago truncatula]
Length=660

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 36/41 (88%), Gaps = 1/41 (2%)
 Frame = -3

Query  123  DYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            DY+ FR I+RDRLL EMLRSAKS DSKA WKVLIMDK+TVK
Sbjct  16   DYRPFRHISRDRLLYEMLRSAKSGDSKA-WKVLIMDKVTVK  55



>ref|NP_001146894.1| SNARE-interacting protein KEULE [Zea mays]
 gb|ACN31270.1| unknown [Zea mays]
 gb|AFW70817.1| SNARE-interacting protein KEULE [Zea mays]
Length=661

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 1/41 (2%)
 Frame = -3

Query  123  DYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            DY+ FRQITRDRLL EMLRS + K+SK+TWKVLIMDK TVK
Sbjct  13   DYRSFRQITRDRLLFEMLRSTR-KNSKSTWKVLIMDKFTVK  52



>gb|ACG24270.1| SNARE-interacting protein KEULE [Zea mays]
Length=661

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 1/41 (2%)
 Frame = -3

Query  123  DYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            DY+ FRQITRDRLL EMLRS + K+SK+TWKVLIMDK TVK
Sbjct  13   DYRSFRQITRDRLLFEMLRSTR-KNSKSTWKVLIMDKFTVK  52



>ref|XP_003605076.1| SNARE-interacting protein KEULE [Medicago truncatula]
Length=673

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 36/41 (88%), Gaps = 1/41 (2%)
 Frame = -3

Query  123  DYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            DY+ FR I+RDRLL EMLRSAKS DSKA WKVLIMDK+TVK
Sbjct  16   DYRPFRHISRDRLLYEMLRSAKSGDSKA-WKVLIMDKVTVK  55



>gb|EEC76890.1| hypothetical protein OsI_15097 [Oryza sativa Indica Group]
Length=802

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 35/43 (81%), Gaps = 1/43 (2%)
 Frame = -3

Query  129  AIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
              DY+ FRQITRDRLL EMLRS K K SK+ WKVLIMDKLTVK
Sbjct  149  GADYRSFRQITRDRLLFEMLRSTK-KSSKSAWKVLIMDKLTVK  190



>sp|Q7XWP3.2|SEC1A_ORYSJ RecName: Full=Probable protein transport Sec1a [Oryza sativa 
Japonica Group]
 emb|CAD39977.2| OSJNBa0032B23.7 [Oryza sativa Japonica Group]
 gb|EEE60622.1| hypothetical protein OsJ_14040 [Oryza sativa Japonica Group]
Length=665

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 35/43 (81%), Gaps = 1/43 (2%)
 Frame = -3

Query  129  AIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
              DY+ FRQITRDRLL EMLRS K K SK+ WKVLIMDKLTVK
Sbjct  12   GADYRSFRQITRDRLLFEMLRSTK-KSSKSAWKVLIMDKLTVK  53



>ref|XP_010457049.1| PREDICTED: protein transport Sec1a-like, partial [Camelina sativa]
Length=210

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 37/45 (82%), Gaps = 2/45 (4%)
 Frame = -3

Query  132  HAID-YKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            H  D YK+FRQI+RDRLL EML S K+ DSKA WK+LIMD++TVK
Sbjct  12   HGADSYKFFRQISRDRLLHEMLGSTKTGDSKA-WKILIMDRVTVK  55



>ref|XP_006368712.1| KEULE family protein [Populus trichocarpa]
 gb|ERP65281.1| KEULE family protein [Populus trichocarpa]
Length=628

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -3

Query  120  YKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            YK  RQI+R+RLL EMLRSAK+ +SK+TWKVLIMD+LTVK
Sbjct  16   YKNLRQISRERLLHEMLRSAKTGNSKSTWKVLIMDRLTVK  55



>ref|XP_010433745.1| PREDICTED: protein transport Sec1b-like [Camelina sativa]
Length=662

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -3

Query  120  YKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            YK FRQITR+RLLCEMLR  ++  SK TWKVL+MDK TVK
Sbjct  15   YKDFRQITRERLLCEMLRPERNGSSKLTWKVLVMDKFTVK  54



>ref|XP_010422186.1| PREDICTED: protein transport Sec1b-like isoform X4 [Camelina 
sativa]
Length=594

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -3

Query  120  YKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            YK FRQITR+RLLCEMLR  ++  SK TWKVL+MDK TVK
Sbjct  15   YKDFRQITRERLLCEMLRPERNGSSKLTWKVLVMDKFTVK  54



>ref|XP_010422184.1| PREDICTED: protein transport Sec1b-like isoform X2 [Camelina 
sativa]
Length=661

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -3

Query  120  YKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            YK FRQITR+RLLCEMLR  ++  SK TWKVL+MDK TVK
Sbjct  15   YKDFRQITRERLLCEMLRPERNGSSKLTWKVLVMDKFTVK  54



>ref|XP_011029096.1| PREDICTED: SNARE-interacting protein KEULE [Populus euphratica]
Length=666

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -3

Query  120  YKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            YK  RQI+R+RLL EMLRSAK+ +SK+TWKVLIMD+LTVK
Sbjct  16   YKNLRQISRERLLHEMLRSAKTGNSKSTWKVLIMDRLTVK  55



>ref|XP_010422183.1| PREDICTED: protein transport Sec1b-like isoform X1 [Camelina 
sativa]
Length=662

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -3

Query  120  YKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            YK FRQITR+RLLCEMLR  ++  SK TWKVL+MDK TVK
Sbjct  15   YKDFRQITRERLLCEMLRPERNGSSKLTWKVLVMDKFTVK  54



>ref|XP_010255636.1| PREDICTED: SNARE-interacting protein KEULE-like isoform X3 [Nelumbo 
nucifera]
Length=666

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  123  DYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            +YK F+QI+RDRLL EMLRS+K  D+K++WKVLIMDK+TVK
Sbjct  13   EYKTFKQISRDRLLHEMLRSSKVGDTKSSWKVLIMDKVTVK  53



>emb|CDP09881.1| unnamed protein product [Coffea canephora]
Length=672

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  123  DYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            +YK  RQI+R+RLL EMLRS K+ DSK+TWKVL+MDK+TVK
Sbjct  14   EYKNLRQISRERLLYEMLRSTKTGDSKSTWKVLVMDKVTVK  54



>ref|XP_006486801.1| PREDICTED: SNARE-interacting protein KEULE-like isoform X2 [Citrus 
sinensis]
Length=663

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -3

Query  117  KYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            K FRQI+R+RLL EMLRSAK+  SK+TWKVLIMDKLTVK
Sbjct  16   KNFRQISRERLLYEMLRSAKTGTSKSTWKVLIMDKLTVK  54



>ref|XP_006486800.1| PREDICTED: SNARE-interacting protein KEULE-like isoform X1 [Citrus 
sinensis]
Length=664

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -3

Query  117  KYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            K FRQI+R+RLL EMLRSAK+  SK+TWKVLIMDKLTVK
Sbjct  16   KNFRQISRERLLYEMLRSAKTGTSKSTWKVLIMDKLTVK  54



>ref|XP_007155597.1| hypothetical protein PHAVU_003G215400g [Phaseolus vulgaris]
 gb|ESW27591.1| hypothetical protein PHAVU_003G215400g [Phaseolus vulgaris]
Length=669

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  HAIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            +  D +  +Q++R+RLL EMLRSAK+ DSK+TWKVLIMDKLTVK
Sbjct  13   YGADSRSLKQVSRERLLHEMLRSAKTGDSKSTWKVLIMDKLTVK  56



>ref|XP_007155598.1| hypothetical protein PHAVU_003G215400g [Phaseolus vulgaris]
 gb|ESW27592.1| hypothetical protein PHAVU_003G215400g [Phaseolus vulgaris]
Length=667

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  HAIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            +  D +  +Q++R+RLL EMLRSAK+ DSK+TWKVLIMDKLTVK
Sbjct  13   YGADSRSLKQVSRERLLHEMLRSAKTGDSKSTWKVLIMDKLTVK  56



>ref|XP_006421235.1| hypothetical protein CICLE_v10004496mg [Citrus clementina]
 gb|ESR34475.1| hypothetical protein CICLE_v10004496mg [Citrus clementina]
Length=664

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -3

Query  117  KYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            K F+QITR+RLL EMLRSAK+  SK+TWKVLIMDKLTVK
Sbjct  16   KNFKQITRERLLYEMLRSAKTGKSKSTWKVLIMDKLTVK  54



>ref|XP_006421236.1| hypothetical protein CICLE_v10004496mg [Citrus clementina]
 gb|ESR34476.1| hypothetical protein CICLE_v10004496mg [Citrus clementina]
Length=595

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -3

Query  117  KYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            K F+QITR+RLL EMLRSAK+  SK+TWKVLIMDKLTVK
Sbjct  16   KNFKQITRERLLYEMLRSAKTGKSKSTWKVLIMDKLTVK  54



>gb|KCW77685.1| hypothetical protein EUGRSUZ_D01986 [Eucalyptus grandis]
Length=661

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -3

Query  120  YKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            +K  RQITRDRLL EMLRS K+ DSK+ WKVLIMDKLTVK
Sbjct  15   HKTIRQITRDRLLYEMLRSTKTGDSKSKWKVLIMDKLTVK  54



>ref|XP_006421234.1| hypothetical protein CICLE_v10004496mg [Citrus clementina]
 gb|ESR34474.1| hypothetical protein CICLE_v10004496mg [Citrus clementina]
Length=651

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -3

Query  117  KYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            K F+QITR+RLL EMLRSAK+  SK+TWKVLIMDKLTVK
Sbjct  16   KNFKQITRERLLYEMLRSAKTGKSKSTWKVLIMDKLTVK  54



>ref|XP_006647243.1| PREDICTED: probable protein transport Sec1a-like [Oryza brachyantha]
Length=667

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 1/41 (2%)
 Frame = -3

Query  123  DYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            D++ FRQITRDRLL EMLRS + K SK+TWKVLIMDKLTVK
Sbjct  13   DHRSFRQITRDRLLFEMLRSTR-KHSKSTWKVLIMDKLTVK  52



>ref|XP_010053400.1| PREDICTED: SNARE-interacting protein KEULE [Eucalyptus grandis]
 gb|KCW77686.1| hypothetical protein EUGRSUZ_D01986 [Eucalyptus grandis]
Length=662

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -3

Query  120  YKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            +K  RQITRDRLL EMLRS K+ DSK+ WKVLIMDKLTVK
Sbjct  15   HKTIRQITRDRLLYEMLRSTKTGDSKSKWKVLIMDKLTVK  54



>emb|CDY30074.1| BnaC05g09460D [Brassica napus]
Length=668

 Score = 62.8 bits (151),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  HAIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
             A + K FRQ+TR+RLL EMLRS K+  SK+TWKVLIMDKLTVK
Sbjct  12   QAGECKNFRQLTRERLLYEMLRSTKTGSSKSTWKVLIMDKLTVK  55



>ref|XP_002892032.1| hypothetical protein ARALYDRAFT_470074 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68291.1| hypothetical protein ARALYDRAFT_470074 [Arabidopsis lyrata subsp. 
lyrata]
Length=663

 Score = 62.8 bits (151),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 36/41 (88%), Gaps = 1/41 (2%)
 Frame = -3

Query  123  DYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            DYK+FRQI+RDRLL EML S K+ DSKA WK+LIMD++TVK
Sbjct  15   DYKFFRQISRDRLLHEMLGSTKTGDSKA-WKILIMDRVTVK  54



>gb|AAK15767.1|AF335539_1 AtSec1a, partial [Arabidopsis thaliana]
Length=601

 Score = 62.8 bits (151),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 36/41 (88%), Gaps = 1/41 (2%)
 Frame = -3

Query  123  DYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            DYK+FRQI+RDRLL EML S K+ DSKA WK+LIMD++TVK
Sbjct  17   DYKFFRQISRDRLLHEMLGSTKTGDSKA-WKILIMDRVTVK  56



>ref|XP_004515765.1| PREDICTED: SNARE-interacting protein KEULE-like [Cicer arietinum]
Length=666

 Score = 62.8 bits (151),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  123  DYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            +YK  +Q++R+RLL EMLRSAK+ DSK+TWKVLIMD+ TVK
Sbjct  15   EYKSLKQVSRERLLHEMLRSAKTGDSKSTWKVLIMDRFTVK  55



>gb|EEE56916.1| hypothetical protein OsJ_06593 [Oryza sativa Japonica Group]
Length=665

 Score = 62.8 bits (151),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 1/41 (2%)
 Frame = -3

Query  123  DYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            D++ FRQITRDRLL EMLRS + K SK+TWKVLIMDKLTVK
Sbjct  13   DHRSFRQITRDRLLFEMLRSTR-KHSKSTWKVLIMDKLTVK  52



>gb|EEC73104.1| hypothetical protein OsI_07088 [Oryza sativa Indica Group]
Length=665

 Score = 62.8 bits (151),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 1/41 (2%)
 Frame = -3

Query  123  DYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            D++ FRQITRDRLL EMLRS + K SK+TWKVLIMDKLTVK
Sbjct  13   DHRSFRQITRDRLLFEMLRSTR-KHSKSTWKVLIMDKLTVK  52



>ref|NP_563643.4| protein transporter sec1a [Arabidopsis thaliana]
 sp|Q9C5P7.3|SEC1A_ARATH RecName: Full=Protein transport Sec1a; Short=AtSec1a [Arabidopsis 
thaliana]
 gb|AEE27365.1| protein transport sec1a [Arabidopsis thaliana]
Length=673

 Score = 62.8 bits (151),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 36/41 (88%), Gaps = 1/41 (2%)
 Frame = -3

Query  123  DYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            DYK+FRQI+RDRLL EML S K+ DSKA WK+LIMD++TVK
Sbjct  17   DYKFFRQISRDRLLHEMLGSTKTGDSKA-WKILIMDRVTVK  56



>ref|NP_001184888.1| protein transporter sec1a [Arabidopsis thaliana]
 gb|AEE27366.1| protein transport sec1a [Arabidopsis thaliana]
Length=660

 Score = 62.8 bits (151),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 36/41 (88%), Gaps = 1/41 (2%)
 Frame = -3

Query  123  DYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            DYK+FRQI+RDRLL EML S K+ DSKA WK+LIMD++TVK
Sbjct  17   DYKFFRQISRDRLLHEMLGSTKTGDSKA-WKILIMDRVTVK  56



>ref|XP_006418478.1| hypothetical protein EUTSA_v10006989mg [Eutrema salsugineum]
 dbj|BAJ34466.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ36831.1| hypothetical protein EUTSA_v10006989mg [Eutrema salsugineum]
Length=675

 Score = 62.8 bits (151),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 36/41 (88%), Gaps = 1/41 (2%)
 Frame = -3

Query  123  DYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            DYK+FRQI+RDRLL EML S K+ DSKA WK+LIMD++TVK
Sbjct  18   DYKFFRQISRDRLLHEMLGSTKTGDSKA-WKILIMDRVTVK  57



>ref|XP_009118849.1| PREDICTED: protein transport Sec1a isoform X1 [Brassica rapa]
 ref|XP_009118850.1| PREDICTED: protein transport Sec1a isoform X1 [Brassica rapa]
Length=674

 Score = 62.8 bits (151),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 36/41 (88%), Gaps = 1/41 (2%)
 Frame = -3

Query  123  DYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            DYK+FRQI+RDRLL EML S K+ DSKA WK+LIMD++TVK
Sbjct  17   DYKFFRQISRDRLLHEMLGSTKTGDSKA-WKILIMDRVTVK  56



>emb|CDY38041.1| BnaCnng09020D [Brassica napus]
Length=675

 Score = 62.8 bits (151),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 36/41 (88%), Gaps = 1/41 (2%)
 Frame = -3

Query  123  DYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            DYK+FRQI+RDRLL EML S K+ DSKA WK+LIMD++TVK
Sbjct  17   DYKFFRQISRDRLLHEMLGSTKTGDSKA-WKILIMDRVTVK  56



>ref|XP_004975116.1| PREDICTED: probable protein transport Sec1a-like isoform X2 [Setaria 
italica]
Length=679

 Score = 62.8 bits (151),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 35/43 (81%), Gaps = 1/43 (2%)
 Frame = -3

Query  129  AIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
              D++ FRQITRDRLL EMLRS + K S +TWKVLIMDKLTVK
Sbjct  30   GADHRSFRQITRDRLLIEMLRSTR-KSSNSTWKVLIMDKLTVK  71



>ref|XP_004975115.1| PREDICTED: probable protein transport Sec1a-like isoform X1 [Setaria 
italica]
Length=684

 Score = 62.4 bits (150),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 35/43 (81%), Gaps = 1/43 (2%)
 Frame = -3

Query  129  AIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
              D++ FRQITRDRLL EMLRS + K S +TWKVLIMDKLTVK
Sbjct  30   GADHRSFRQITRDRLLIEMLRSTR-KSSNSTWKVLIMDKLTVK  71



>gb|KFK31959.1| hypothetical protein AALP_AA6G182000 [Arabis alpina]
Length=662

 Score = 62.4 bits (150),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  HAIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            +  DYK FRQITR+RLL EMLR  K+  SK+ WKVL+MDK TVK
Sbjct  11   NGGDYKNFRQITRERLLHEMLRPEKNGTSKSAWKVLVMDKFTVK  54



>ref|XP_006574263.1| PREDICTED: protein transport Sec1a-like [Glycine max]
Length=880

 Score = 62.8 bits (151),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 37/43 (86%), Gaps = 1/43 (2%)
 Frame = -3

Query  129  AIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            A +Y+ FR I+RDRLL EML+SAKS DSKA WKVLIMDK+TVK
Sbjct  224  ATEYRPFRHISRDRLLYEMLKSAKSPDSKA-WKVLIMDKVTVK  265



>ref|XP_010239737.1| PREDICTED: probable protein transport Sec1a [Brachypodium distachyon]
Length=672

 Score = 62.4 bits (150),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 38/44 (86%), Gaps = 1/44 (2%)
 Frame = -3

Query  132  HAIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            +  D + FR+ITRDRLL EMLRSAK+ +S++TWKVLIMDKLTVK
Sbjct  11   NGADRRSFREITRDRLLIEMLRSAKN-NSRSTWKVLIMDKLTVK  53



>ref|XP_006491554.1| PREDICTED: SNARE-interacting protein KEULE-like [Citrus sinensis]
Length=664

 Score = 62.0 bits (149),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -3

Query  117  KYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            K F+QITR+RLL EMLRSAK+  SK+TWKVLIMD+LTVK
Sbjct  16   KNFKQITRERLLYEMLRSAKTGKSKSTWKVLIMDRLTVK  54



>ref|XP_004513137.1| PREDICTED: protein transport Sec1a-like isoform X1 [Cicer arietinum]
Length=671

 Score = 62.0 bits (149),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 36/43 (84%), Gaps = 1/43 (2%)
 Frame = -3

Query  129  AIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            A +YK FR I+RDRLL EML SAKS DSKA WKVLIMDK+TVK
Sbjct  14   ASEYKPFRHISRDRLLYEMLTSAKSGDSKA-WKVLIMDKVTVK  55



>ref|XP_009418742.1| PREDICTED: SNARE-interacting protein KEULE-like [Musa acuminata 
subsp. malaccensis]
Length=663

 Score = 62.0 bits (149),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -3

Query  129  AIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            A DYK FRQ +RDRLL EMLRS  + +SK++WK+LIMDK T+K
Sbjct  11   ASDYKTFRQTSRDRLLYEMLRSTDTSNSKSSWKILIMDKFTLK  53



>ref|XP_006287228.1| hypothetical protein CARUB_v10000405mg [Capsella rubella]
 gb|EOA20126.1| hypothetical protein CARUB_v10000405mg [Capsella rubella]
Length=663

 Score = 62.0 bits (149),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -3

Query  120  YKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            YK FRQITR+RLL EMLR  K+  SK+TWKVL+MDK TVK
Sbjct  16   YKNFRQITRERLLYEMLRPEKNGSSKSTWKVLVMDKFTVK  55



>ref|XP_004513138.1| PREDICTED: protein transport Sec1a-like isoform X2 [Cicer arietinum]
Length=668

 Score = 62.0 bits (149),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 36/43 (84%), Gaps = 1/43 (2%)
 Frame = -3

Query  129  AIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            A +YK FR I+RDRLL EML SAKS DSKA WKVLIMDK+TVK
Sbjct  14   ASEYKPFRHISRDRLLYEMLTSAKSGDSKA-WKVLIMDKVTVK  55



>gb|AAM67096.1| KEULE [Arabidopsis thaliana]
Length=662

 Score = 62.0 bits (149),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -3

Query  117  KYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            K FRQITR+RLLCEMLR  ++  SK TWKVL+MDK TVK
Sbjct  16   KNFRQITRERLLCEMLRPERNGSSKLTWKVLVMDKFTVK  54



>ref|XP_006422678.1| hypothetical protein CICLE_v10027965mg [Citrus clementina]
 gb|ESR35918.1| hypothetical protein CICLE_v10027965mg [Citrus clementina]
Length=664

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -3

Query  117  KYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            K F+QI+R+RLL EMLRSAK+  SK+TWKVLIMDKLTVK
Sbjct  16   KNFKQISRERLLYEMLRSAKTGTSKSTWKVLIMDKLTVK  54



>ref|XP_010455656.1| PREDICTED: protein transport Sec1b isoform X2 [Camelina sativa]
Length=662

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -3

Query  120  YKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            YK FR+ITR+RLLCEMLR  ++  SK TWKVL+MDK TVK
Sbjct  15   YKDFRKITRERLLCEMLRPERNGSSKLTWKVLVMDKFTVK  54



>gb|EYU31992.1| hypothetical protein MIMGU_mgv1a002484mg [Erythranthe guttata]
Length=668

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  HAIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            H  +YK FRQI+RDRLL EML+  K+  ++++WKVLIMDK+TVK
Sbjct  11   HGGEYKTFRQISRDRLLYEMLQDTKAGGTRSSWKVLIMDKVTVK  54



>ref|XP_010455655.1| PREDICTED: protein transport Sec1b isoform X1 [Camelina sativa]
Length=662

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -3

Query  120  YKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            YK FR+ITR+RLLCEMLR  ++  SK TWKVL+MDK TVK
Sbjct  15   YKDFRKITRERLLCEMLRPERNGSSKLTWKVLVMDKFTVK  54



>ref|XP_006396794.1| hypothetical protein EUTSA_v10028497mg [Eutrema salsugineum]
 gb|ESQ38247.1| hypothetical protein EUTSA_v10028497mg [Eutrema salsugineum]
Length=662

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -3

Query  120  YKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            YK FRQITR+RLL EMLR+ K+  S++TWKVL+MDK TVK
Sbjct  15   YKSFRQITRERLLYEMLRTEKNGSSRSTWKVLVMDKFTVK  54



>ref|XP_010474830.1| PREDICTED: protein transport Sec1a isoform X1 [Camelina sativa]
Length=672

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 37/45 (82%), Gaps = 2/45 (4%)
 Frame = -3

Query  132  HAID-YKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            H  D YK+FRQI+RDRLL EML S K+ DSKA WK+LIMD++TVK
Sbjct  12   HGADSYKFFRQISRDRLLHEMLGSTKTGDSKA-WKILIMDRVTVK  55



>ref|XP_010474832.1| PREDICTED: protein transport Sec1a isoform X3 [Camelina sativa]
Length=672

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 37/45 (82%), Gaps = 2/45 (4%)
 Frame = -3

Query  132  HAID-YKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            H  D YK+FRQI+RDRLL EML S K+ DSKA WK+LIMD++TVK
Sbjct  12   HGADSYKFFRQISRDRLLHEMLGSTKTGDSKA-WKILIMDRVTVK  55



>ref|XP_006422679.1| hypothetical protein CICLE_v10027965mg [Citrus clementina]
 gb|ESR35919.1| hypothetical protein CICLE_v10027965mg [Citrus clementina]
Length=622

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -3

Query  117  KYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            K F+QI+R+RLL EMLRSAK+  SK+TWKVLIMDKLTVK
Sbjct  16   KNFKQISRERLLYEMLRSAKTGTSKSTWKVLIMDKLTVK  54



>ref|XP_007157317.1| hypothetical protein PHAVU_002G059900g [Phaseolus vulgaris]
 gb|ESW29311.1| hypothetical protein PHAVU_002G059900g [Phaseolus vulgaris]
Length=662

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -3

Query  123  DYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            D K F+ I+R+RLL EMLRS K+ DSK+TWKVLIMDKLTVK
Sbjct  14   DCKSFKLISRERLLHEMLRSTKTGDSKSTWKVLIMDKLTVK  54



>gb|EPS63425.1| hypothetical protein M569_11359, partial [Genlisea aurea]
Length=294

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  HAIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            H  +YK FRQI+R+RLL EML+  K+  S+++WKVLIMDK+T+K
Sbjct  11   HGGEYKTFRQISRERLLYEMLQDTKASGSRSSWKVLIMDKVTLK  54



>ref|XP_006306940.1| hypothetical protein CARUB_v10008507mg [Capsella rubella]
 gb|EOA39838.1| hypothetical protein CARUB_v10008507mg [Capsella rubella]
Length=671

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 37/45 (82%), Gaps = 2/45 (4%)
 Frame = -3

Query  132  HAID-YKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            H  D YK+FRQI+RDRLL EML S K+ DSKA WK+LIMD++TVK
Sbjct  11   HGGDSYKFFRQISRDRLLHEMLGSTKTGDSKA-WKILIMDRVTVK  54



>emb|CDX98070.1| BnaA06g08210D [Brassica napus]
Length=665

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 36/44 (82%), Gaps = 3/44 (7%)
 Frame = -3

Query  132  HAIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
             A +YK FRQ+TR+RLL EMLRS K   SK+TWKVLIMDKLTVK
Sbjct  12   QAGEYKNFRQLTRERLLYEMLRSTK---SKSTWKVLIMDKLTVK  52



>ref|XP_003562299.1| PREDICTED: probable protein transport Sec1a isoform X2 [Brachypodium 
distachyon]
Length=663

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 34/41 (83%), Gaps = 1/41 (2%)
 Frame = -3

Query  123  DYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            D + FRQITRDRLL EMLRS + KDSK+ WKVLIMDK TVK
Sbjct  13   DNRSFRQITRDRLLFEMLRSTR-KDSKSAWKVLIMDKFTVK  52



>ref|XP_010232774.1| PREDICTED: probable protein transport Sec1a isoform X1 [Brachypodium 
distachyon]
Length=688

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 34/41 (83%), Gaps = 1/41 (2%)
 Frame = -3

Query  123  DYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            D + FRQITRDRLL EMLRS + KDSK+ WKVLIMDK TVK
Sbjct  13   DNRSFRQITRDRLLFEMLRSTR-KDSKSAWKVLIMDKFTVK  52



>gb|EYU30559.1| hypothetical protein MIMGU_mgv1a002638mg [Erythranthe guttata]
Length=651

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  HAIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            H  +YK  R ++RDRLL EML++ KS DS+++WKVLIMDK+T+K
Sbjct  11   HGGEYKTLRHVSRDRLLYEMLQTPKSGDSRSSWKVLIMDKVTLK  54



>ref|XP_002874754.1| hypothetical protein ARALYDRAFT_327340 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51013.1| hypothetical protein ARALYDRAFT_327340 [Arabidopsis lyrata subsp. 
lyrata]
Length=662

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = -3

Query  120  YKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            YK FRQITR+RLL EMLR  K+  SK TWKVL+MDK TVK
Sbjct  15   YKNFRQITRERLLYEMLRPEKNGSSKLTWKVLVMDKFTVK  54



>ref|XP_004952408.1| PREDICTED: probable protein transport Sec1a-like isoform X1 [Setaria 
italica]
Length=661

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 35/41 (85%), Gaps = 1/41 (2%)
 Frame = -3

Query  123  DYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            D++ FR ITRDRLL EMLRS + K+SK+TWKVLIMDK TVK
Sbjct  13   DHRSFRHITRDRLLFEMLRSTR-KNSKSTWKVLIMDKFTVK  52



>ref|XP_004952410.1| PREDICTED: probable protein transport Sec1a-like isoform X3 [Setaria 
italica]
Length=660

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 35/41 (85%), Gaps = 1/41 (2%)
 Frame = -3

Query  123  DYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            D++ FR ITRDRLL EMLRS + K+SK+TWKVLIMDK TVK
Sbjct  13   DHRSFRHITRDRLLFEMLRSTR-KNSKSTWKVLIMDKFTVK  52



>ref|XP_004952409.1| PREDICTED: probable protein transport Sec1a-like isoform X2 [Setaria 
italica]
Length=660

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 35/41 (85%), Gaps = 1/41 (2%)
 Frame = -3

Query  123  DYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            D++ FR ITRDRLL EMLRS + K+SK+TWKVLIMDK TVK
Sbjct  13   DHRSFRHITRDRLLFEMLRSTR-KNSKSTWKVLIMDKFTVK  52



>ref|XP_001785411.1| SM/Sec1-family protein [Physcomitrella patens]
 gb|EDQ49785.1| SM/Sec1-family protein [Physcomitrella patens]
Length=675

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -3

Query  126  IDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            +D++ FRQITRDRLL EML++A++  + A WKVLIMD++TVK
Sbjct  16   VDFRSFRQITRDRLLQEMLKTARTGKASAEWKVLIMDEVTVK  57



>dbj|BAJ98955.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=118

 Score = 56.6 bits (135),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 32/39 (82%), Gaps = 1/39 (3%)
 Frame = -3

Query  117  KYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            + FRQITRDRLL EMLRS + K SK+ WKVLIMDK TVK
Sbjct  15   RSFRQITRDRLLFEMLRSTR-KGSKSAWKVLIMDKFTVK  52



>ref|XP_010523082.1| PREDICTED: protein transport Sec1a [Tarenaya hassleriana]
Length=672

 Score = 59.3 bits (142),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 1/41 (2%)
 Frame = -3

Query  123  DYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            DYK+FRQI+RDRLL EML S K+  SKA WK+LIMD++TVK
Sbjct  17   DYKFFRQISRDRLLYEMLGSTKTGASKA-WKILIMDRVTVK  56



>ref|XP_002985290.1| hypothetical protein SELMODRAFT_234736 [Selaginella moellendorffii]
 gb|EFJ13784.1| hypothetical protein SELMODRAFT_234736 [Selaginella moellendorffii]
Length=651

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -3

Query  120  YKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            Y+ FRQ TR+RLL EMLRSAKS  S + WKVLIMD+LTVK
Sbjct  8    YRSFRQNTRERLLHEMLRSAKSTKSASPWKVLIMDELTVK  47



>ref|XP_002970097.1| hypothetical protein SELMODRAFT_92538 [Selaginella moellendorffii]
 gb|EFJ29221.1| hypothetical protein SELMODRAFT_92538 [Selaginella moellendorffii]
Length=663

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -3

Query  120  YKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            Y+ FRQ TR+RLL EMLRSAKS  S + WKVLIMD+LTVK
Sbjct  8    YRSFRQNTRERLLHEMLRSAKSTKSASPWKVLIMDELTVK  47



>ref|XP_008393252.1| PREDICTED: protein transport Sec1a [Malus domestica]
Length=669

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 37/43 (86%), Gaps = 1/43 (2%)
 Frame = -3

Query  129  AIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            A +YK FRQ++RDRLL EML S ++++SK +WKVLIMDK+TVK
Sbjct  14   ATEYKIFRQVSRDRLLHEMLGSTRTENSK-SWKVLIMDKVTVK  55



>ref|XP_009338114.1| PREDICTED: protein transport Sec1a [Pyrus x bretschneideri]
Length=669

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 37/43 (86%), Gaps = 1/43 (2%)
 Frame = -3

Query  129  AIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            A +YK FRQ++RDRLL EML S ++++SK +WKVLIMDK+TVK
Sbjct  14   ATEYKIFRQVSRDRLLHEMLGSTRTENSK-SWKVLIMDKVTVK  55



>emb|CDO97685.1| unnamed protein product [Coffea canephora]
Length=685

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  HAIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            H  DYK FRQI+RDRLL EMLRS+KS+DS+++WKVLIMDK+TVK
Sbjct  11   HGGDYKNFRQISRDRLLHEMLRSSKSEDSRSSWKVLIMDKVTVK  54



>ref|XP_010529508.1| PREDICTED: protein transport Sec1b isoform X1 [Tarenaya hassleriana]
Length=664

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  HAIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            +  D K FRQIT  RLL EMLR  K+  SK++WKVL+MDKLTVK
Sbjct  11   NGGDQKNFRQITHGRLLHEMLRPEKAGSSKSSWKVLVMDKLTVK  54



>ref|XP_010529509.1| PREDICTED: protein transport Sec1b isoform X2 [Tarenaya hassleriana]
Length=663

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  HAIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            +  D K FRQIT  RLL EMLR  K+  SK++WKVL+MDKLTVK
Sbjct  11   NGGDQKNFRQITHGRLLHEMLRPEKAGSSKSSWKVLVMDKLTVK  54



>ref|XP_008232655.1| PREDICTED: protein transport Sec1a [Prunus mume]
Length=671

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 36/43 (84%), Gaps = 1/43 (2%)
 Frame = -3

Query  129  AIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            A +YK FRQ++RDRLL EML S +++ SK +WKVLIMDK+TVK
Sbjct  14   ATEYKIFRQVSRDRLLHEMLGSTRTEKSK-SWKVLIMDKITVK  55



>ref|XP_007219134.1| hypothetical protein PRUPE_ppa015909mg, partial [Prunus persica]
 gb|EMJ20333.1| hypothetical protein PRUPE_ppa015909mg, partial [Prunus persica]
Length=654

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 36/43 (84%), Gaps = 1/43 (2%)
 Frame = -3

Query  129  AIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            A +YK FRQ++RDRLL EML S +++ SK +WKVLIMDK+TVK
Sbjct  14   ATEYKIFRQVSRDRLLHEMLGSTRTEKSK-SWKVLIMDKITVK  55



>ref|XP_004299977.1| PREDICTED: SNARE-interacting protein KEULE-like [Fragaria vesca 
subsp. vesca]
Length=644

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -3

Query  120  YKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            Y+ F++ITR RLL EMLRS K+ +SK+TWKVL+MD+ TVK
Sbjct  14   YRNFKEITRHRLLNEMLRSCKTWNSKSTWKVLVMDEFTVK  53



>dbj|BAK07507.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=487

 Score = 56.6 bits (135),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 32/37 (86%), Gaps = 2/37 (5%)
 Frame = -3

Query  111  FRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            FR+ITRDRLL EMLRS ++K S  TWKVLIMDKLTVK
Sbjct  16   FREITRDRLLNEMLRSTRNKGS--TWKVLIMDKLTVK  50



>ref|XP_004306922.1| PREDICTED: protein transport Sec1a-like [Fragaria vesca subsp. 
vesca]
Length=671

 Score = 56.2 bits (134),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 36/43 (84%), Gaps = 1/43 (2%)
 Frame = -3

Query  129  AIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            A +YK FRQ +RDRLL EML S ++++SK +WKVLIMDK+TVK
Sbjct  15   ASEYKCFRQFSRDRLLHEMLGSTRTENSK-SWKVLIMDKVTVK  56



>ref|XP_004145061.1| PREDICTED: protein transport Sec1a-like [Cucumis sativus]
 ref|XP_004153750.1| PREDICTED: protein transport Sec1a-like [Cucumis sativus]
 gb|KGN46241.1| hypothetical protein Csa_6G077380 [Cucumis sativus]
Length=672

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 34/41 (83%), Gaps = 1/41 (2%)
 Frame = -3

Query  123  DYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            +YK FRQ +RDRLL EML +A +++SK  WKVLIMDK+TVK
Sbjct  16   EYKNFRQTSRDRLLYEMLGAANTENSKP-WKVLIMDKVTVK  55



>ref|XP_008460124.1| PREDICTED: protein transport Sec1a-like isoform X1 [Cucumis melo]
Length=672

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 34/41 (83%), Gaps = 1/41 (2%)
 Frame = -3

Query  123  DYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            +YK FRQ +RDRLL EML +A +++SK  WKVLIMDK+TVK
Sbjct  16   EYKNFRQTSRDRLLYEMLGAANTENSKP-WKVLIMDKVTVK  55



>ref|XP_004160690.1| PREDICTED: protein transport Sec1a-like [Cucumis sativus]
Length=682

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 34/41 (83%), Gaps = 1/41 (2%)
 Frame = -3

Query  123  DYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            +YK FRQ +RDRLL EML +A +++SK  WKVLIMDK+TVK
Sbjct  16   EYKNFRQTSRDRLLYEMLGAANTENSKP-WKVLIMDKVTVK  55



>gb|EMT25362.1| Putative protein transport Sec1a [Aegilops tauschii]
Length=667

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 32/37 (86%), Gaps = 1/37 (3%)
 Frame = -3

Query  111  FRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            FR+ITRDRLL EMLRS + ++  +TWKVLIMDKLTVK
Sbjct  19   FREITRDRLLNEMLRSTR-QNKGSTWKVLIMDKLTVK  54



>ref|XP_006445263.1| hypothetical protein CICLE_v10023931mg [Citrus clementina]
 ref|XP_006491457.1| PREDICTED: protein transport Sec1a-like [Citrus sinensis]
 gb|ESR58503.1| hypothetical protein CICLE_v10023931mg [Citrus clementina]
Length=664

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 34/41 (83%), Gaps = 2/41 (5%)
 Frame = -3

Query  123  DYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            +YK+FRQ +RDRLL EML S  + DSK +WKVLIMDK+TVK
Sbjct  14   EYKFFRQFSRDRLLHEMLESTNA-DSK-SWKVLIMDKVTVK  52



>ref|XP_009134254.1| PREDICTED: protein transport Sec1b [Brassica rapa]
Length=659

 Score = 53.5 bits (127),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 33/40 (83%), Gaps = 3/40 (8%)
 Frame = -3

Query  120  YKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            YK FRQITR+RLL EMLR    + SK+TWKVL++D+LTVK
Sbjct  15   YKTFRQITRERLLYEMLR---PEGSKSTWKVLVVDELTVK  51



>emb|CDY68111.1| BnaCnng57670D [Brassica napus]
Length=669

 Score = 53.5 bits (127),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 33/40 (83%), Gaps = 3/40 (8%)
 Frame = -3

Query  120  YKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            YK FRQITR+RLL EMLR    + SK+TWKVL++D+LTVK
Sbjct  15   YKTFRQITRERLLYEMLR---PESSKSTWKVLVVDELTVK  51



>emb|CDX90817.1| BnaA03g24970D [Brassica napus]
Length=669

 Score = 53.5 bits (127),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 33/40 (83%), Gaps = 3/40 (8%)
 Frame = -3

Query  120  YKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            YK FRQITR+RLL EMLR    + SK+TWKVL++D+LTVK
Sbjct  15   YKTFRQITRERLLYEMLR---PEGSKSTWKVLVVDELTVK  51



>ref|XP_002992966.1| hypothetical protein SELMODRAFT_236643 [Selaginella moellendorffii]
 gb|EFJ05985.1| hypothetical protein SELMODRAFT_236643 [Selaginella moellendorffii]
Length=639

 Score = 53.1 bits (126),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = -3

Query  120  YKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            YK FR  TR+RLL EML S KS DS   WKVL++D+LTV+
Sbjct  13   YKSFRHSTRERLLKEMLHSVKSGDSPNDWKVLVIDELTVR  52



>ref|XP_002992446.1| hypothetical protein SELMODRAFT_135316 [Selaginella moellendorffii]
 gb|EFJ06496.1| hypothetical protein SELMODRAFT_135316 [Selaginella moellendorffii]
Length=641

 Score = 53.1 bits (126),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = -3

Query  120  YKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            YK FR  TR+RLL EML S KS DS   WKVL++D+LTV+
Sbjct  13   YKSFRHSTRERLLKEMLHSVKSGDSPNDWKVLVIDELTVR  52



>ref|XP_004964455.1| PREDICTED: probable protein transport Sec1b-like [Setaria italica]
Length=655

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = -3

Query  129  AIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            A D K FR I RDR+L ++L+  K K++K++WKVLIMDK TVK
Sbjct  9    ADDPKVFRNICRDRILKDLLKPDKDKETKSSWKVLIMDKFTVK  51



>gb|EAZ35746.1| hypothetical protein OsJ_20037 [Oryza sativa Japonica Group]
Length=185

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -3

Query  123  DYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            D K FR I RDR+L ++L+  K K++K++WKVLIMDK TV+
Sbjct  14   DPKIFRNICRDRILKDLLQPDKDKETKSSWKVLIMDKFTVR  54



>ref|XP_002437778.1| hypothetical protein SORBIDRAFT_10g002411 [Sorghum bicolor]
 gb|EER89145.1| hypothetical protein SORBIDRAFT_10g002411 [Sorghum bicolor]
Length=644

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = -3

Query  129  AIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            A D K FR I RDR+L ++L+  K K++K++WKVLIMDK TVK
Sbjct  9    ADDPKVFRNICRDRILKDLLKPDKDKETKSSWKVLIMDKFTVK  51



>ref|XP_011090689.1| PREDICTED: protein transport Sec1a-like [Sesamum indicum]
Length=668

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  123  DYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            +YK FRQI+RDRLL EML+ +KS DSK++WKVLIMDK+TVK
Sbjct  12   EYKTFRQISRDRLLYEMLQDSKSADSKSSWKVLIMDKVTVK  52



>gb|AFW85969.1| hypothetical protein ZEAMMB73_289594, partial [Zea mays]
Length=646

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = -3

Query  129  AIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            A D K FR I RDR+L ++L+  K K++K++WKVLIMDK TVK
Sbjct  9    ADDPKAFRNICRDRILKDLLKPDKDKETKSSWKVLIMDKFTVK  51



>gb|EMS45373.1| putative protein transport Sec1a [Triticum urartu]
Length=661

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 31/37 (84%), Gaps = 1/37 (3%)
 Frame = -3

Query  111  FRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            FR+ITRDRLL EMLRS + ++  + WKVLIMDKLTVK
Sbjct  13   FREITRDRLLNEMLRSTR-QNKGSPWKVLIMDKLTVK  48



>ref|XP_008659326.1| PREDICTED: probable protein transport Sec1b isoform X2 [Zea mays]
Length=645

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = -3

Query  129  AIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            A D K FR I RDR+L ++L+  K K++K++WKVLIMDK TVK
Sbjct  9    ADDPKAFRNICRDRILKDLLKPDKDKETKSSWKVLIMDKFTVK  51



>gb|EEC79942.1| hypothetical protein OsI_21530 [Oryza sativa Indica Group]
Length=202

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -3

Query  123  DYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            D K FR I RDR+L ++L+  K K++K++WKVLIMDK TV+
Sbjct  14   DPKIFRNICRDRILKDLLQPDKDKETKSSWKVLIMDKFTVR  54



>gb|AFW85968.1| hypothetical protein ZEAMMB73_289594 [Zea mays]
Length=681

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = -3

Query  129  AIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            A D K FR I RDR+L ++L+  K K++K++WKVLIMDK TVK
Sbjct  9    ADDPKAFRNICRDRILKDLLKPDKDKETKSSWKVLIMDKFTVK  51



>ref|XP_008659325.1| PREDICTED: probable protein transport Sec1b isoform X1 [Zea mays]
Length=671

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = -3

Query  129  AIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            A D K FR I RDR+L ++L+  K K++K++WKVLIMDK TVK
Sbjct  9    ADDPKAFRNICRDRILKDLLKPDKDKETKSSWKVLIMDKFTVK  51



>emb|CDX94488.1| BnaC09g23480D [Brassica napus]
Length=665

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  HAIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            +  D+K FRQITR+RLL EML   K+    + WKVLI+DK TVK
Sbjct  11   NGGDHKSFRQITRERLLYEMLMPEKNGTPISVWKVLILDKFTVK  54



>ref|NP_001151607.1| SNARE-interacting protein KEULE [Zea mays]
 gb|ACG43503.1| SNARE-interacting protein KEULE [Zea mays]
Length=667

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 35/43 (81%), Gaps = 1/43 (2%)
 Frame = -3

Query  129  AIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
              DY+ FRQITRDRLL EMLRS +   SK++WKVLIMDKLTVK
Sbjct  12   GADYRSFRQITRDRLLVEMLRSTRKS-SKSSWKVLIMDKLTVK  53



>gb|ACN26935.1| unknown [Zea mays]
 tpg|DAA38375.1| TPA: SNARE-interacting protein KEULE [Zea mays]
Length=667

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 35/43 (81%), Gaps = 1/43 (2%)
 Frame = -3

Query  129  AIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
              DY+ FRQITRDRLL EMLRS +   SK++WKVLIMDKLTVK
Sbjct  12   GADYRSFRQITRDRLLVEMLRSTRKS-SKSSWKVLIMDKLTVK  53



>dbj|BAK06817.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=657

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -3

Query  123  DYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            D + FR I RDR+L +ML+  K K++K++WKVLIMDK TV+
Sbjct  14   DPRVFRNICRDRILKDMLKPDKDKETKSSWKVLIMDKFTVR  54



>ref|XP_009610922.1| PREDICTED: protein transport Sec1a [Nicotiana tomentosiformis]
 ref|XP_009610923.1| PREDICTED: protein transport Sec1a [Nicotiana tomentosiformis]
Length=667

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  HAIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            H  +YK F+ ++RDRLL EML S+ S DS+++WKVLIMDK+TVK
Sbjct  11   HGTEYKNFKHVSRDRLLHEMLGSSGSGDSRSSWKVLIMDKVTVK  54



>ref|XP_006655761.1| PREDICTED: probable protein transport Sec1b-like [Oryza brachyantha]
Length=668

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -3

Query  123  DYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            D K FR I RDR+L ++L+  K K++K++WKVLIMDK TV+
Sbjct  14   DSKIFRNICRDRILKDLLKPDKDKETKSSWKVLIMDKFTVR  54



>gb|EMT22189.1| Putative protein transport Sec1b [Aegilops tauschii]
Length=644

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -3

Query  123  DYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            D + FR I RDR+L +ML+  K K++K+ WKVLIMDK TV+
Sbjct  14   DPRIFRNICRDRILKDMLKPDKDKENKSAWKVLIMDKFTVR  54



>gb|EMS48081.1| putative protein transport Sec1b [Triticum urartu]
Length=751

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -3

Query  123  DYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            D + FR I RDR+L +ML+  K K++K+ WKVLIMDK TV+
Sbjct  114  DPRIFRNICRDRILKDMLKPDKDKENKSAWKVLIMDKFTVR  154



>sp|Q5VNU3.1|SEC1B_ORYSJ RecName: Full=Probable protein transport Sec1b [Oryza sativa 
Japonica Group]
 dbj|BAD68457.1| putative SNARE-interacting protein KEULE [Oryza sativa Japonica 
Group]
 dbj|BAD68882.1| putative SNARE-interacting protein KEULE [Oryza sativa Japonica 
Group]
 dbj|BAG94500.1| unnamed protein product [Oryza sativa Japonica Group]
Length=659

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -3

Query  123  DYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            D K FR I RDR+L ++L+  K K++K++WKVLIMDK TV+
Sbjct  14   DPKIFRNICRDRILKDLLQPDKDKETKSSWKVLIMDKFTVR  54



>ref|NP_001056722.1| Os06g0135900 [Oryza sativa Japonica Group]
 dbj|BAF18636.1| Os06g0135900 [Oryza sativa Japonica Group]
Length=522

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -3

Query  123  DYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            D K FR I RDR+L ++L+  K K++K++WKVLIMDK TV+
Sbjct  14   DPKIFRNICRDRILKDLLQPDKDKETKSSWKVLIMDKFTVR  54



>ref|XP_009764741.1| PREDICTED: SNARE-interacting protein KEULE isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009764742.1| PREDICTED: SNARE-interacting protein KEULE isoform X2 [Nicotiana 
sylvestris]
Length=691

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -3

Query  87  LLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
           LL EMLRSAK+KDSK+ WKVLIMDKLTVK
Sbjct  51  LLYEMLRSAKAKDSKSAWKVLIMDKLTVK  79



>ref|XP_007020043.1| Sec1/munc18-like (SM) proteins superfamily [Theobroma cacao]
 gb|EOY17268.1| Sec1/munc18-like (SM) proteins superfamily [Theobroma cacao]
Length=682

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 37/63 (59%), Gaps = 19/63 (30%)
 Frame = -3

Query  132  HAIDYKYFRQITRDRLLCEMLRSAKSKDSKATWK-------------------VLIMDKL  10
            +  +YK F+Q+TR+RLL +MLRS K+ DSK+TWK                   VLI+DK 
Sbjct  6    YGSEYKNFKQVTRERLLHDMLRSTKTADSKSTWKFKKGGGGLNLCISKLYSASVLIVDKF  65

Query  9    TVK  1
            TVK
Sbjct  66   TVK  68



>ref|XP_009761132.1| PREDICTED: protein transport Sec1a [Nicotiana sylvestris]
 ref|XP_009761140.1| PREDICTED: protein transport Sec1a [Nicotiana sylvestris]
Length=667

 Score = 50.4 bits (119),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  HAIDYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            H  +Y+ F+ ++RDRLL EML S+ S DS+++WKVLIMDK+TVK
Sbjct  11   HGTEYRNFKHVSRDRLLHEMLGSSGSGDSRSSWKVLIMDKVTVK  54



>ref|XP_007052059.1| Secretory 1A [Theobroma cacao]
 gb|EOX96216.1| Secretory 1A [Theobroma cacao]
Length=680

 Score = 50.4 bits (119),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -3

Query  123  DYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            +YK FRQ +RDRLL EML S+ S  SK+ WKVLIMDK+TVK
Sbjct  16   EYKVFRQFSRDRLLYEMLGSSTSGGSKSAWKVLIMDKVTVK  56



>ref|XP_003557237.1| PREDICTED: probable protein transport Sec1b [Brachypodium distachyon]
Length=652

 Score = 50.1 bits (118),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -3

Query  123  DYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            D + FR I RDR+L ++L+  K K++K++WKVLIMDK TV+
Sbjct  14   DPRIFRNICRDRILKDLLKPDKDKETKSSWKVLIMDKFTVR  54



>ref|XP_010692247.1| PREDICTED: protein transport Sec1a-like [Beta vulgaris subsp. 
vulgaris]
Length=669

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 31/41 (76%), Gaps = 2/41 (5%)
 Frame = -3

Query  123  DYKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            +YK FR  +RDRLL EML+S  S+    +WKVLIMDK+TVK
Sbjct  19   EYKNFRMTSRDRLLYEMLQSTSSESK--SWKVLIMDKVTVK  57



>gb|EYU28980.1| hypothetical protein MIMGU_mgv1a0251092mg, partial [Erythranthe 
guttata]
Length=642

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -3

Query  87  LLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
           LL EMLRSAK+ DSK++WKVLIMDK+TVK
Sbjct  1   LLYEMLRSAKTGDSKSSWKVLIMDKVTVK  29



>ref|XP_010108131.1| SNARE-interacting protein KEULE [Morus notabilis]
 gb|EXC17863.1| SNARE-interacting protein KEULE [Morus notabilis]
Length=694

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = -3

Query  90  RLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
           RLL EM++ AK+ DSK TWKVLIMDKLTVK
Sbjct  49  RLLHEMIQRAKTGDSKTTWKVLIMDKLTVK  78



>ref|XP_002513760.1| hypothetical protein RCOM_1030820 [Ricinus communis]
 gb|EEF48343.1| hypothetical protein RCOM_1030820 [Ricinus communis]
Length=69

 Score = 44.3 bits (103),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -3

Query  120  YKYFRQITRDRLLCEMLRSAKSKDSKATWKVLIMDKLTVK  1
            Y  FR +TR RL  EMLR A+ +D ++TWKVLI +  T++
Sbjct  15   YNDFRGLTRQRLSHEMLRFAREEDKESTWKVLITENFTLR  54



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 517403453504