BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c10409_g1_i1 len=764 path=[1:0-489 491:490-763]

Length=764
                                                                      Score     E

ref|XP_011085411.1|  PREDICTED: RPM1-interacting protein 4 isofor...  62.8    1e-09   
ref|XP_006660464.1|  PREDICTED: RPM1-interacting protein 4-like       62.4    2e-09   
ref|XP_006447821.1|  hypothetical protein CICLE_v10018013mg           61.6    4e-09   
ref|NP_001062688.1|  Os09g0253000                                     61.2    6e-09   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ08306.1|  hypothetical protein OsI_30557                        61.2    6e-09   Oryza sativa Indica Group [Indian rice]
ref|XP_008362317.1|  PREDICTED: RPM1-interacting protein 4-like       60.8    7e-09   
ref|XP_004956372.1|  PREDICTED: RPM1-interacting protein 4-like i...  60.5    1e-08   
ref|XP_006353097.1|  PREDICTED: RPM1-interacting protein 4-like       60.1    1e-08   
ref|XP_010551964.1|  PREDICTED: RPM1-interacting protein 4-like       59.3    3e-08   
ref|XP_011008071.1|  PREDICTED: RPM1-interacting protein 4 isofor...  59.3    3e-08   
ref|XP_004491613.1|  PREDICTED: RPM1-interacting protein 4-like       58.9    3e-08   
ref|XP_011085412.1|  PREDICTED: RPM1-interacting protein 4 isofor...  58.9    3e-08   
ref|XP_010243957.1|  PREDICTED: RPM1-interacting protein 4-like       58.9    4e-08   
ref|XP_009759543.1|  PREDICTED: RPM1-interacting protein 4-like       58.9    4e-08   
ref|XP_009361537.1|  PREDICTED: RPM1-interacting protein 4            58.5    4e-08   
ref|XP_006357656.1|  PREDICTED: RPM1-interacting protein 4-like       58.9    4e-08   
ref|XP_003519678.1|  PREDICTED: RPM1-interacting protein 4-like       58.9    5e-08   
ref|XP_004243583.1|  PREDICTED: RPM1-interacting protein 4            58.5    6e-08   
ref|XP_010532965.1|  PREDICTED: RPM1-interacting protein 4            58.2    7e-08   
ref|XP_009590916.1|  PREDICTED: RPM1-interacting protein 4-like       58.2    7e-08   
ref|XP_010557722.1|  PREDICTED: RPM1-interacting protein 4-like       57.8    9e-08   
ref|XP_010061442.1|  PREDICTED: RPM1-interacting protein 4-like i...  57.8    1e-07   
ref|XP_002320529.2|  hypothetical protein POPTR_0014s16680g           57.8    1e-07   Populus trichocarpa [western balsam poplar]
ref|XP_004148258.1|  PREDICTED: RPM1-interacting protein 4-like       57.4    1e-07   
ref|XP_009618347.1|  PREDICTED: RPM1-interacting protein 4            57.4    1e-07   
gb|AAQ10001.1|  putative nitrate-induced NOI protein                  57.4    2e-07   Petunia integrifolia subsp. inflata
ref|XP_009387587.1|  PREDICTED: uncharacterized protein LOC103974469  57.4    2e-07   
ref|XP_009777841.1|  PREDICTED: RPM1-interacting protein 4            57.0    2e-07   
gb|EYU33710.1|  hypothetical protein MIMGU_mgv1a017515mg              57.0    2e-07   
emb|CBI28462.3|  unnamed protein product                              57.0    2e-07   
ref|XP_008229934.1|  PREDICTED: RPM1-interacting protein 4            56.6    2e-07   
gb|KFK32398.1|  hypothetical protein AALP_AA6G236300                  57.0    2e-07   
ref|XP_008380010.1|  PREDICTED: RPM1-interacting protein 4            56.6    2e-07   
ref|XP_009414531.1|  PREDICTED: RPM1-interacting protein 4-like       56.6    2e-07   
ref|XP_008449047.1|  PREDICTED: RPM1-interacting protein 4-like       56.2    4e-07   
gb|KDP29951.1|  hypothetical protein JCGZ_18520                       56.2    4e-07   
gb|EYU27446.1|  hypothetical protein MIMGU_mgv1a017408mg              56.2    4e-07   
gb|ADE76265.1|  unknown                                               56.2    4e-07   
ref|XP_007049382.1|  RPM1-interacting protein 4 (RIN4) family pro...  57.8    5e-07   
ref|XP_011097755.1|  PREDICTED: RPM1-interacting protein 4-like       55.5    6e-07   
ref|XP_011095561.1|  PREDICTED: RPM1-interacting protein 4            55.5    8e-07   
ref|XP_009408263.1|  PREDICTED: RPM1-interacting protein 4-like       55.5    8e-07   
ref|XP_007142424.1|  hypothetical protein PHAVU_008G279500g           55.8    8e-07   
ref|XP_011008069.1|  PREDICTED: RPM1-interacting protein 4 isofor...  55.5    9e-07   
ref|XP_010061443.1|  PREDICTED: RPM1-interacting protein 4-like i...  55.1    1e-06   
ref|XP_010514487.1|  PREDICTED: RPM1-interacting protein 4-like       55.1    1e-06   
ref|XP_004956369.1|  PREDICTED: RPM1-interacting protein 4-like       55.1    1e-06   
ref|XP_006296639.1|  hypothetical protein CARUB_v10015029mg           55.1    1e-06   
ref|XP_002532206.1|  NOI, putative                                    55.1    1e-06   Ricinus communis
ref|XP_007215168.1|  hypothetical protein PRUPE_ppa013593mg           55.5    1e-06   
emb|CDP20461.1|  unnamed protein product                              55.8    2e-06   
ref|XP_010926960.1|  PREDICTED: RPM1-interacting protein 4-like i...  54.7    2e-06   
ref|XP_006452611.1|  hypothetical protein CICLE_v10010079mg           54.3    2e-06   
ref|XP_006352016.1|  PREDICTED: RPM1-interacting protein 4-like       54.3    2e-06   
ref|XP_010466996.1|  PREDICTED: RPM1-interacting protein 4-like       54.3    2e-06   
ref|XP_004154510.1|  PREDICTED: uncharacterized LOC101217194          53.9    2e-06   
ref|XP_010252792.1|  PREDICTED: uncharacterized protein LOC104594267  53.9    3e-06   
ref|XP_010547201.1|  PREDICTED: RPM1-interacting protein 4-like i...  53.9    3e-06   
ref|XP_010547199.1|  PREDICTED: RPM1-interacting protein 4-like i...  53.9    3e-06   
ref|XP_008446098.1|  PREDICTED: RPM1-interacting protein 4-like       53.9    3e-06   
gb|ACU13629.1|  unknown                                               53.5    4e-06   Glycine max [soybeans]
ref|NP_178522.2|  RPM1-interacting protein 4-like protein             53.1    4e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010942599.1|  PREDICTED: RPM1-interacting protein 4 isofor...  53.1    5e-06   
ref|NP_001147003.1|  LOC100280613                                     53.1    6e-06   Zea mays [maize]
ref|XP_002438259.1|  hypothetical protein SORBIDRAFT_10g010690        53.1    6e-06   Sorghum bicolor [broomcorn]
ref|XP_010061441.1|  PREDICTED: RPM1-interacting protein 4-like i...  53.5    6e-06   
ref|XP_006474872.1|  PREDICTED: uncharacterized protein LOC102627443  52.8    6e-06   
ref|XP_010524624.1|  PREDICTED: RPM1-interacting protein 4-like       52.8    7e-06   
ref|XP_004148923.1|  PREDICTED: RPM1-interacting protein 4-like       52.8    7e-06   
ref|XP_008357962.1|  PREDICTED: RPM1-interacting protein 4-like       53.1    7e-06   
gb|KHN43901.1|  RPM1-interacting protein 4                            53.1    7e-06   
ref|XP_008646185.1|  PREDICTED: uncharacterized protein LOC103627672  53.1    8e-06   
ref|XP_007049389.1|  RPM1-interacting protein 4 family protein        54.3    8e-06   
ref|XP_006418573.1|  hypothetical protein EUTSA_v10002884mg           52.8    8e-06   
ref|NP_001104900.1|  LOC541680                                        52.8    9e-06   Zea mays [maize]
ref|XP_009793110.1|  PREDICTED: RPM1-interacting protein 4-like i...  52.8    9e-06   
ref|XP_009606343.1|  PREDICTED: RPM1-interacting protein 4-like i...  52.4    9e-06   
ref|XP_003532179.1|  PREDICTED: RPM1-interacting protein 4            52.4    9e-06   
ref|XP_007207399.1|  hypothetical protein PRUPE_ppa014254mg           52.4    1e-05   
ref|XP_003551429.1|  PREDICTED: RPM1-interacting protein 4            52.4    1e-05   
ref|XP_008464153.1|  PREDICTED: RPM1-interacting protein 4-like i...  52.4    1e-05   
gb|EAZ43921.1|  hypothetical protein OsJ_28544                        53.5    1e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010063254.1|  PREDICTED: RPM1-interacting protein 4-like       52.4    1e-05   
ref|XP_008349485.1|  PREDICTED: uncharacterized protein LOC103412...  52.4    1e-05   
ref|XP_004295204.1|  PREDICTED: RPM1-interacting protein 4-like i...  52.4    1e-05   
ref|XP_009624027.1|  PREDICTED: RPM1-interacting protein 4-like i...  52.4    1e-05   
ref|XP_004956371.1|  PREDICTED: RPM1-interacting protein 4-like i...  52.8    1e-05   
ref|XP_009408747.1|  PREDICTED: uncharacterized protein LOC103991115  53.5    1e-05   
ref|XP_010037471.1|  PREDICTED: RPM1-interacting protein 4-like       52.4    1e-05   
dbj|BAJ78239.1|  putative nitrate-induced NOI protein                 52.0    1e-05   
ref|XP_004135294.1|  PREDICTED: RPM1-interacting protein 4-like       52.4    1e-05   
gb|KCW70466.1|  hypothetical protein EUGRSUZ_F03683                   52.0    1e-05   
ref|XP_009606344.1|  PREDICTED: RPM1-interacting protein 4-like i...  52.0    1e-05   
ref|XP_008811272.1|  PREDICTED: RPM1-interacting protein 4-like i...  52.0    1e-05   
ref|XP_004516092.1|  PREDICTED: RPM1-interacting protein 4-like i...  52.4    1e-05   
dbj|BAK02565.1|  predicted protein                                    52.8    1e-05   
ref|XP_009793111.1|  PREDICTED: RPM1-interacting protein 4-like i...  52.0    2e-05   
ref|XP_010539329.1|  PREDICTED: RPM1-interacting protein 4-like       52.0    2e-05   
ref|XP_009379453.1|  PREDICTED: uncharacterized protein LOC103967...  52.0    2e-05   
ref|XP_002316782.2|  hypothetical protein POPTR_0011s09650g           52.4    2e-05   Populus trichocarpa [western balsam poplar]
gb|KHF99798.1|  RPM1-interacting 4 -like protein                      51.6    2e-05   
ref|XP_007146651.1|  hypothetical protein PHAVU_006G058100g           51.6    2e-05   
ref|XP_008239399.1|  PREDICTED: uncharacterized protein LOC103338...  52.0    2e-05   
ref|XP_004965245.1|  PREDICTED: RPM1-interacting protein 4-like       51.6    2e-05   
gb|AFW73220.1|  hypothetical protein ZEAMMB73_896291                  53.1    2e-05   
ref|XP_004139992.1|  PREDICTED: uncharacterized protein LOC101217194  52.0    2e-05   
ref|XP_004516091.1|  PREDICTED: RPM1-interacting protein 4-like i...  52.0    2e-05   
ref|XP_010926961.1|  PREDICTED: RPM1-interacting protein 4-like i...  51.6    2e-05   
gb|AFK38504.1|  unknown                                               51.6    2e-05   
ref|XP_004244039.1|  PREDICTED: RPM1-interacting protein 4 isofor...  51.2    2e-05   
ref|XP_006852276.1|  hypothetical protein AMTR_s00049p00179160        51.6    2e-05   
ref|XP_008239398.1|  PREDICTED: uncharacterized protein LOC103338...  51.6    2e-05   
emb|CDP13707.1|  unnamed protein product                              51.2    2e-05   
ref|XP_004516093.1|  PREDICTED: RPM1-interacting protein 4-like i...  51.2    3e-05   
ref|XP_010942597.1|  PREDICTED: uncharacterized protein LOC105060...  52.0    3e-05   
ref|XP_006346128.1|  PREDICTED: RPM1-interacting protein 4-like i...  51.2    3e-05   
gb|AAN46279.1|  unknown protein                                       50.8    3e-05   Arabidopsis thaliana [mouse-ear cress]
gb|AFK35596.1|  unknown                                               51.2    3e-05   
ref|XP_006656004.1|  PREDICTED: uncharacterized protein LOC102719774  51.2    3e-05   
ref|XP_009387828.1|  PREDICTED: RPM1-interacting protein 4-like       51.2    3e-05   
ref|XP_008463015.1|  PREDICTED: RPM1-interacting protein 4-like i...  50.8    3e-05   
ref|XP_009379452.1|  PREDICTED: uncharacterized protein LOC103967...  50.8    4e-05   
ref|XP_010675968.1|  PREDICTED: RPM1-interacting protein 4            50.8    4e-05   
ref|XP_007142525.1|  hypothetical protein PHAVU_008G288100g           51.6    4e-05   
ref|XP_010929050.1|  PREDICTED: RPM1-interacting protein 4            50.8    4e-05   
ref|XP_004303574.1|  PREDICTED: uncharacterized protein LOC101310717  51.6    4e-05   
gb|ACU64879.1|  NIP                                                   50.8    4e-05   
ref|XP_007208788.1|  hypothetical protein PRUPE_ppa024175mg           50.8    4e-05   
dbj|BAD69095.1|  putative nitrate-induced NOI protein                 50.8    4e-05   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ00558.1|  hypothetical protein OsI_22578                        51.2    4e-05   Oryza sativa Indica Group [Indian rice]
ref|XP_004295203.1|  PREDICTED: RPM1-interacting protein 4-like i...  50.8    5e-05   
ref|XP_002864413.1|  hypothetical protein ARALYDRAFT_495666           50.8    5e-05   
ref|XP_010495907.1|  PREDICTED: uncharacterized protein LOC104773057  50.8    5e-05   
ref|NP_200396.2|  protein NOI                                         51.2    5e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009417934.1|  PREDICTED: RPM1-interacting protein 4-like       50.4    5e-05   
ref|XP_008799100.1|  PREDICTED: uncharacterized protein LOC103713838  51.6    5e-05   
gb|KHG00197.1|  RPM1-interacting 4 -like protein                      50.4    6e-05   
ref|XP_009616559.1|  PREDICTED: RPM1-interacting protein 4-like i...  50.1    6e-05   
ref|XP_007037860.1|  RPM1-interacting protein 4 family protein, p...  50.1    6e-05   
gb|KHG20304.1|  RPM1-interacting 4 -like protein                      50.8    6e-05   
emb|CDY15080.1|  BnaC03g44410D                                        50.8    6e-05   
gb|KFK27152.1|  hypothetical protein AALP_AA8G341900                  50.1    7e-05   
ref|XP_010545279.1|  PREDICTED: RPM1-interacting protein 4 isofor...  50.1    7e-05   
ref|XP_010443225.1|  PREDICTED: uncharacterized protein LOC104726132  50.1    8e-05   
emb|CDY06554.1|  BnaC02g12780D                                        50.1    8e-05   
ref|XP_010052923.1|  PREDICTED: RPM1-interacting protein 4-like       50.1    8e-05   
gb|KDO59137.1|  hypothetical protein CISIN_1g034970mg                 49.7    8e-05   
ref|XP_008349484.1|  PREDICTED: uncharacterized protein LOC103412...  50.1    8e-05   
gb|AAB86938.1|  NOI protein                                           50.1    8e-05   Arabidopsis thaliana [mouse-ear cress]
emb|CDY17362.1|  BnaA10g09960D                                        50.1    9e-05   
ref|XP_009120102.1|  PREDICTED: uncharacterized protein LOC103845026  50.1    9e-05   
ref|XP_009126980.1|  PREDICTED: RPM1-interacting protein 4-like       49.7    9e-05   
ref|XP_010088435.1|  Transmembrane emp24 domain-containing protein    52.8    9e-05   
emb|CBI39753.3|  unnamed protein product                              49.7    9e-05   
ref|XP_009132351.1|  PREDICTED: uncharacterized protein LOC103856963  49.7    1e-04   
ref|XP_007207400.1|  hypothetical protein PRUPE_ppa014254mg           49.7    1e-04   
gb|ACU64883.1|  NIP                                                   49.7    1e-04   
ref|XP_009624026.1|  PREDICTED: RPM1-interacting protein 4-like i...  49.7    1e-04   
ref|XP_004251536.2|  PREDICTED: uncharacterized protein LOC101254273  52.8    1e-04   
ref|XP_009333887.1|  PREDICTED: uncharacterized protein LOC103926742  49.7    1e-04   
ref|XP_008352009.1|  PREDICTED: uncharacterized protein LOC103415455  49.7    1e-04   
gb|EYU34771.1|  hypothetical protein MIMGU_mgv1a017463mg              49.3    1e-04   
ref|XP_008811271.1|  PREDICTED: RPM1-interacting protein 4-like i...  49.3    1e-04   
gb|EYU34772.1|  hypothetical protein MIMGU_mgv1a017463mg              49.3    1e-04   
ref|XP_006281872.1|  hypothetical protein CARUB_v10028069mg           49.7    1e-04   
ref|XP_003563945.1|  PREDICTED: uncharacterized protein LOC100826114  49.3    1e-04   
gb|EYU40206.1|  hypothetical protein MIMGU_mgv1a020512mg              49.3    2e-04   
ref|XP_010044515.1|  PREDICTED: RPM1-interacting protein 4-like       48.9    2e-04   
emb|CDY66246.1|  BnaA03g57910D                                        50.4    2e-04   
ref|XP_009396103.1|  PREDICTED: RPM1-interacting protein 4-like       48.9    2e-04   
ref|XP_009787782.1|  PREDICTED: RPM1-interacting protein 4-like       48.9    2e-04   
ref|XP_009384192.1|  PREDICTED: RPM1-interacting protein 4-like       48.9    2e-04   
ref|XP_002298875.2|  hypothetical protein POPTR_0001s37750g           48.9    2e-04   Populus trichocarpa [western balsam poplar]
gb|AFK47855.1|  unknown                                               48.9    2e-04   
ref|XP_008783031.1|  PREDICTED: RPM1-interacting protein 4 isofor...  48.9    2e-04   
ref|XP_010088434.1|  RPM1-interacting protein 4                       51.6    2e-04   
gb|KHN23838.1|  RPM1-interacting protein 4                            48.5    2e-04   
ref|XP_002322218.2|  hypothetical protein POPTR_0015s10070g           49.7    2e-04   Populus trichocarpa [western balsam poplar]
ref|XP_010324248.1|  PREDICTED: RPM1-interacting protein 4 isofor...  48.5    3e-04   
gb|KCW49179.1|  hypothetical protein EUGRSUZ_K02761                   49.3    3e-04   
gb|ABK93375.1|  unknown                                               48.5    3e-04   Populus trichocarpa [western balsam poplar]
ref|XP_011038812.1|  PREDICTED: uncharacterized protein LOC105135...  48.5    3e-04   
gb|AFK36295.1|  unknown                                               48.9    3e-04   
ref|XP_009616562.1|  PREDICTED: uncharacterized protein LOC104109...  48.1    3e-04   
ref|XP_006346127.1|  PREDICTED: RPM1-interacting protein 4-like i...  48.5    3e-04   
ref|XP_002277247.1|  PREDICTED: RPM1-interacting protein 4            48.1    3e-04   Vitis vinifera
ref|XP_009359537.1|  PREDICTED: uncharacterized protein LOC103950113  48.5    3e-04   
ref|XP_002964475.1|  hypothetical protein SELMODRAFT_81777            48.5    3e-04   
ref|XP_003545095.1|  PREDICTED: RPM1-interacting protein 4-like       48.1    3e-04   
ref|XP_011044920.1|  PREDICTED: uncharacterized protein LOC105139967  48.1    3e-04   
gb|KHN05307.1|  hypothetical protein glysoja_048999                   47.8    3e-04   
ref|XP_002448552.1|  hypothetical protein SORBIDRAFT_06g028920        48.5    3e-04   Sorghum bicolor [broomcorn]
ref|XP_006857767.1|  hypothetical protein AMTR_s00061p00201580        48.1    3e-04   
ref|XP_003518553.1|  PREDICTED: RPM1-interacting protein 4-like       48.1    4e-04   
ref|XP_008463014.1|  PREDICTED: RPM1-interacting protein 4-like i...  48.1    4e-04   
dbj|BAJ85220.1|  predicted protein                                    48.1    4e-04   
gb|KGN44037.1|  hypothetical protein Csa_7G127370                     48.5    4e-04   
ref|XP_008392866.1|  PREDICTED: uncharacterized protein LOC103455049  48.1    4e-04   
gb|KHG24788.1|  RPM1-interacting 4 -like protein                      47.8    4e-04   
ref|XP_004491519.1|  PREDICTED: RPM1-interacting protein 4-like       47.8    5e-04   
ref|XP_010250904.1|  PREDICTED: RPM1-interacting protein 4-like       47.8    5e-04   
ref|NP_001154782.1|  protein NOI                                      48.5    5e-04   Arabidopsis thaliana [mouse-ear cress]
gb|KHN34382.1|  RPM1-interacting protein 4                            47.8    5e-04   
ref|XP_010519526.1|  PREDICTED: RPM1-interacting protein 4-like i...  47.8    5e-04   
ref|XP_010519527.1|  PREDICTED: RPM1-interacting protein 4-like i...  47.8    5e-04   
ref|XP_009405358.1|  PREDICTED: RPM1-interacting protein 4-like       47.8    5e-04   
ref|XP_007044937.1|  Uncharacterized protein TCM_010689               48.1    5e-04   
ref|XP_011038810.1|  PREDICTED: uncharacterized protein LOC105135...  47.8    6e-04   
gb|ACJ83273.1|  unknown                                               47.8    6e-04   Medicago truncatula
ref|XP_010942598.1|  PREDICTED: uncharacterized protein LOC105060...  47.8    6e-04   
gb|EYU44829.1|  hypothetical protein MIMGU_mgv1a017518mg              47.4    6e-04   
ref|NP_001190552.1|  protein NOI                                      47.8    6e-04   
ref|XP_006401406.1|  hypothetical protein EUTSA_v10015980mg           47.8    6e-04   
ref|XP_011098793.1|  PREDICTED: RPM1-interacting protein 4            47.4    6e-04   
gb|EMT04021.1|  hypothetical protein F775_29299                       47.4    6e-04   
ref|XP_009137048.1|  PREDICTED: uncharacterized protein LOC103861092  48.9    7e-04   
ref|XP_010545278.1|  PREDICTED: RPM1-interacting protein 4 isofor...  47.0    8e-04   
ref|XP_004231820.1|  PREDICTED: RPM1-interacting protein 4            47.0    8e-04   
ref|XP_010111655.1|  hypothetical protein L484_017683                 47.0    8e-04   
ref|XP_004504159.1|  PREDICTED: RPM1-interacting protein 4-like       47.0    8e-04   
ref|XP_008439265.1|  PREDICTED: RPM1-interacting protein 4 isofor...  47.0    8e-04   
ref|XP_004515842.1|  PREDICTED: RPM1-interacting protein 4-like i...  47.0    8e-04   
ref|XP_009605629.1|  PREDICTED: RPM1-interacting protein 4-like       47.0    8e-04   
gb|AFK45254.1|  unknown                                               49.7    8e-04   
gb|KEH31733.1|  RPM1-interacting protein 4 (RIN4) family protein      47.4    9e-04   
ref|XP_008340150.1|  PREDICTED: RPM1-interacting protein 4-like       47.4    9e-04   
ref|XP_009590829.1|  PREDICTED: RPM1-interacting protein 4-like       47.0    0.001   
ref|XP_003608903.1|  NOI protein                                      47.4    0.001   
ref|XP_008439256.1|  PREDICTED: RPM1-interacting protein 4 isofor...  47.0    0.001   
ref|XP_004953756.1|  PREDICTED: RPM1-interacting protein 4-like       47.0    0.001   
ref|XP_010249436.1|  PREDICTED: uncharacterized protein LOC104591981  48.5    0.001   



>ref|XP_011085411.1| PREDICTED: RPM1-interacting protein 4 isoform X1 [Sesamum indicum]
Length=78

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 48/94 (51%), Gaps = 23/94 (24%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRK  325
            MAEK  PLPKFG+WD  +PA++  F+VIF+KAR+ KR G +  S          D PT K
Sbjct  1    MAEKGLPLPKFGEWDVNDPASAEGFTVIFNKARNEKRTGGKSDSPPK-------DEPTYK  53

Query  324  DRpnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
                            H   LGK  + +KW CC+
Sbjct  54   ----------------HGSILGKPHSQKKWFCCM  71



>ref|XP_006660464.1| PREDICTED: RPM1-interacting protein 4-like [Oryza brachyantha]
Length=81

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 48/93 (52%), Gaps = 21/93 (23%)
 Frame = -3

Query  501  AEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRKD  322
            AEK +PLPKFG+WD  +PA++  F+VIF+KAR  K+ G               D P++ +
Sbjct  3    AEKGSPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTGGSQGQ----------DLPSKSE  52

Query  321  RpnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
            +           P+   LY  K  + +KW CC+
Sbjct  53   Q-----------PSGQGLYPAKPNSSKKWFCCM  74



>ref|XP_006447821.1| hypothetical protein CICLE_v10018013mg [Citrus clementina]
 ref|XP_006469435.1| PREDICTED: RPM1-interacting protein 4-like [Citrus sinensis]
 gb|ESR61061.1| hypothetical protein CICLE_v10018013mg [Citrus clementina]
 gb|KDO50954.1| hypothetical protein CISIN_1g040492mg [Citrus sinensis]
Length=77

 Score = 61.6 bits (148),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 36/98 (37%), Positives = 50/98 (51%), Gaps = 24/98 (24%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRK  325
            MAEK  PLPKFG+WD  +PA++  F+VIF+KAR+ K+ G             + DSP + 
Sbjct  1    MAEKGGPLPKFGEWDVNDPASAEGFTVIFNKARNEKKTGG------------KPDSPVKD  48

Query  324  DRpnnnsspssNTPAAHFLYLGKSRTGRKWLCCVGRRR  211
            D               H   LGK ++ +KW CC+   R
Sbjct  49   DSQFK-----------HGAVLGKPQS-KKWFCCMQAAR  74



>ref|NP_001062688.1| Os09g0253000 [Oryza sativa Japonica Group]
 gb|AAB86939.1| NOI protein [Oryza sativa]
 dbj|BAD22341.1| NOI protein [Oryza sativa Japonica Group]
 dbj|BAF24602.1| Os09g0253000 [Oryza sativa Japonica Group]
Length=82

 Score = 61.2 bits (147),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 46/93 (49%), Gaps = 20/93 (22%)
 Frame = -3

Query  501  AEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRKD  322
            AEK +PLPKFG+WD  +PA++  F+VIF+KAR  K+ G     +    + +Q        
Sbjct  3    AEKGSPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTGGNSQGQDLAAKSEQ--------  54

Query  321  RpnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
                        P+   LY  K  + +KW CC+
Sbjct  55   ------------PSGQGLYPAKPNSSKKWFCCM  75



>gb|EAZ08306.1| hypothetical protein OsI_30557 [Oryza sativa Indica Group]
Length=94

 Score = 61.2 bits (147),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 31/95 (33%), Positives = 47/95 (49%), Gaps = 20/95 (21%)
 Frame = -3

Query  507  EMAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTR  328
            E+ EK +PLPKFG+WD  +PA++  F+VIF+KAR  K+ G     +    + +Q      
Sbjct  13   ELNEKGSPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTGGNSQGQDLAAKSEQ------  66

Query  327  KDRpnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
                          P+   LY  K  + +KW CC+
Sbjct  67   --------------PSGQGLYPAKPNSSKKWFCCM  87



>ref|XP_008362317.1| PREDICTED: RPM1-interacting protein 4-like [Malus domestica]
Length=74

 Score = 60.8 bits (146),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 49/94 (52%), Gaps = 24/94 (26%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRK  325
            M EK  PLPKFG+WD  +PA++  F+VIF+KAR  K+ G             + DSP+++
Sbjct  1    MGEKGVPLPKFGEWDVNDPASAEGFTVIFNKARTEKKTGG------------RPDSPSKE  48

Query  324  DRpnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
            DR              H   LGK  + +KW CC+
Sbjct  49   DRTYK-----------HEAVLGKPPS-KKWFCCL  70



>ref|XP_004956372.1| PREDICTED: RPM1-interacting protein 4-like isoform X2 [Setaria 
italica]
Length=83

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 48/94 (51%), Gaps = 21/94 (22%)
 Frame = -3

Query  501  AEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRKD  322
            AEK +PLPKFG+WD  +PA++  F+VIF+KAR  K+ G     +         D PT+  
Sbjct  3    AEKGSPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTGGNSQGQ---------DVPTKNS  53

Query  321  RpnnnsspssNTPAAHFLYLGKS-RTGRKWLCCV  223
            +           P+   LY  K   + +KW CC+
Sbjct  54   Q-----------PSGQGLYAAKGPSSSKKWFCCM  76



>ref|XP_006353097.1| PREDICTED: RPM1-interacting protein 4-like [Solanum tuberosum]
Length=77

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 48/94 (51%), Gaps = 24/94 (26%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRK  325
            MAEK  PLPKFG+WD  +PA++  ++VIF+KAR+ KR G               +SP + 
Sbjct  1    MAEKGHPLPKFGEWDVNDPASAEGYTVIFNKARNEKRSGG------------NTNSPPKG  48

Query  324  DRpnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
            D               H   LGK ++ +KW CC+
Sbjct  49   DPTYK-----------HGATLGKPQS-KKWFCCI  70



>ref|XP_010551964.1| PREDICTED: RPM1-interacting protein 4-like [Tarenaya hassleriana]
Length=77

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 52/94 (55%), Gaps = 23/94 (24%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRK  325
            MAEK  PLPKFG+WD  +PA++  F+VIF+KAR+ ++ G +           + +SP + 
Sbjct  1    MAEKGQPLPKFGEWDVNDPASAEGFTVIFNKARNERKGGTK-----------KTESPNKD  49

Query  324  DRpnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
             R   ++           + LGK ++ R WLCCV
Sbjct  50   SRNYKST-----------VVLGKPQSKR-WLCCV  71



>ref|XP_011008071.1| PREDICTED: RPM1-interacting protein 4 isoform X2 [Populus euphratica]
Length=78

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 50/94 (53%), Gaps = 22/94 (23%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRK  325
            MAEK+ PLPKFG+WD  +P ++  F+VIF+KAR+ K+ G             + DSP + 
Sbjct  1    MAEKDQPLPKFGEWDVNDPTSAEGFTVIFNKARNEKKTGG------------KPDSPAKD  48

Query  324  DRpnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
                         P A    LGK +T +KWLCC+
Sbjct  49   SSTYK--------PGAT-ATLGKPQT-KKWLCCI  72



>ref|XP_004491613.1| PREDICTED: RPM1-interacting protein 4-like [Cicer arietinum]
Length=78

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 48/94 (51%), Gaps = 22/94 (23%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRK  325
            MA+K  PLPKFG+WD  +PA++  F+VIF+KAR+ ++ GA             + SP + 
Sbjct  1    MADKGIPLPKFGEWDVNDPASAEGFTVIFNKARNERKTGA------------NIHSPPK-  47

Query  324  DRpnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
                       NT   H + LG     +KW CC+
Sbjct  48   ---------DLNTKHKHQVVLGGKPQSKKWFCCI  72



>ref|XP_011085412.1| PREDICTED: RPM1-interacting protein 4 isoform X2 [Sesamum indicum]
Length=77

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 48/94 (51%), Gaps = 24/94 (26%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRK  325
            MAEK  PLPKFG+WD  +PA++  F+VIF+KAR+ KR G +  S          D PT K
Sbjct  1    MAEKGLPLPKFGEWDVNDPASAEGFTVIFNKARNEKRTGGKSDSPPK-------DEPTYK  53

Query  324  DRpnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
                            H   LGK  + +KW CC+
Sbjct  54   ----------------HGSILGKPHS-KKWFCCM  70



>ref|XP_010243957.1| PREDICTED: RPM1-interacting protein 4-like [Nelumbo nucifera]
Length=77

 Score = 58.9 bits (141),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 49/94 (52%), Gaps = 24/94 (26%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRK  325
            M+E   PLPKFG+WD  +PA++  F+VIF+KAR+ K+ G             +LDSP + 
Sbjct  1    MSETGRPLPKFGEWDVNDPASAEGFTVIFNKARNEKKTGG------------KLDSPAKD  48

Query  324  DRpnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
            D    N S S+               G+KWLCCV
Sbjct  49   DSTTKNGSDSAKP------------QGKKWLCCV  70



>ref|XP_009759543.1| PREDICTED: RPM1-interacting protein 4-like [Nicotiana sylvestris]
Length=76

 Score = 58.9 bits (141),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 51/94 (54%), Gaps = 25/94 (27%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRK  325
            MAEK  PLPKFG+WD  +PA++  F+VIF+KAR+ K+ G             ++DSP + 
Sbjct  1    MAEKGRPLPKFGEWDVNDPASAEGFTVIFNKARNEKKGG-------------KMDSPPKG  47

Query  324  DRpnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
            D    N +            LGK ++ +KW CC+
Sbjct  48   DSAYKNKA-----------MLGKPQS-KKWFCCM  69



>ref|XP_009361537.1| PREDICTED: RPM1-interacting protein 4 [Pyrus x bretschneideri]
Length=74

 Score = 58.5 bits (140),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 48/94 (51%), Gaps = 24/94 (26%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRK  325
            M EK  PLPKFG+WD  +PA++  F+VIF+KAR  K+ G             + DSP+++
Sbjct  1    MGEKGVPLPKFGEWDVNDPASAEGFTVIFNKARTEKKTGG------------RPDSPSKE  48

Query  324  DRpnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
            D               H   LGK  + +KW CC+
Sbjct  49   DHTYK-----------HEAVLGKPPS-KKWFCCL  70



>ref|XP_006357656.1| PREDICTED: RPM1-interacting protein 4-like [Solanum tuberosum]
Length=77

 Score = 58.9 bits (141),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 51/94 (54%), Gaps = 24/94 (26%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRK  325
            MAEK  PLPKFG+WD  +P+++  F+VIF+KAR+ K+ G             ++DSP + 
Sbjct  1    MAEKGQPLPKFGEWDVNDPSSAEGFTVIFNKARNEKKTGG------------KVDSPPKG  48

Query  324  DRpnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
            D    N S            LGK ++ +KW CC+
Sbjct  49   DSAYKNKS-----------MLGKPQS-KKWFCCM  70



>ref|XP_003519678.1| PREDICTED: RPM1-interacting protein 4-like [Glycine max]
 gb|KHN43973.1| RPM1-interacting protein 4 [Glycine soja]
Length=80

 Score = 58.9 bits (141),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 35/95 (37%), Positives = 50/95 (53%), Gaps = 20/95 (21%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRK  325
            MAE+   LPKFGDWD  NP+A+ DFSVIF+KAR+ ++ GA           +++  P   
Sbjct  1    MAERGRALPKFGDWDVNNPSAAQDFSVIFNKARNERKTGA-----------NKIHFPPNH  49

Query  324  DRpnnnsspssNTPAAHFLYLGKSRTGRKWLCCVG  220
            +     + P         + LGKS   +KW CC+ 
Sbjct  50   NNTTKCNPPQ--------VVLGKSHY-KKWFCCIN  75



>ref|XP_004243583.1| PREDICTED: RPM1-interacting protein 4 [Solanum lycopersicum]
Length=77

 Score = 58.5 bits (140),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 51/94 (54%), Gaps = 24/94 (26%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRK  325
            MAEK  PLPKFG+WD  +P+++  F+VIF+KAR+ K+ G             ++DSP + 
Sbjct  1    MAEKGQPLPKFGEWDVNDPSSAEGFTVIFNKARNEKKTGG------------KVDSPPKG  48

Query  324  DRpnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
            D    N +            LGK ++ +KW CC+
Sbjct  49   DSAYKNKAT-----------LGKPQS-KKWFCCM  70



>ref|XP_010532965.1| PREDICTED: RPM1-interacting protein 4 [Tarenaya hassleriana]
Length=75

 Score = 58.2 bits (139),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 47/94 (50%), Gaps = 22/94 (23%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRK  325
            MAE   PLPKFG+WD  +PA++  F+VIF+KAR+ K+ G    S          D PT K
Sbjct  1    MAEMGRPLPKFGEWDVNDPASAEGFTVIFNKARNEKKGGGNSDSHVK-------DEPTYK  53

Query  324  DRpnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
                            H   LGK ++ +KW CCV
Sbjct  54   H--------------GHGEVLGKPQS-KKWFCCV  72



>ref|XP_009590916.1| PREDICTED: RPM1-interacting protein 4-like [Nicotiana tomentosiformis]
Length=76

 Score = 58.2 bits (139),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 52/94 (55%), Gaps = 25/94 (27%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRK  325
            MAEK  PLPKFG+WD  +PA++  F+VIF+KAR+ K+ G             ++DSP + 
Sbjct  1    MAEKGRPLPKFGEWDVNDPASAEGFTVIFNKARNEKKAG-------------KIDSPPKG  47

Query  324  DRpnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
            D  + N +            LGK ++ +KW CC+
Sbjct  48   DSAHKNKA-----------MLGKPQS-KKWFCCM  69



>ref|XP_010557722.1| PREDICTED: RPM1-interacting protein 4-like [Tarenaya hassleriana]
Length=76

 Score = 57.8 bits (138),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 51/94 (54%), Gaps = 21/94 (22%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRK  325
            MA+K+ PLPKFG+WD  +PA++  F+VIF+KAR+ K+ G            ++ DSP + 
Sbjct  1    MADKDRPLPKFGEWDVNDPASAEGFTVIFNKARNEKKAGG-----------NKSDSPVKD  49

Query  324  DRpnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
            D    +          H   LGK +  +KW CC+
Sbjct  50   DPRYKH---------GHGEVLGKPQP-KKWFCCI  73



>ref|XP_010061442.1| PREDICTED: RPM1-interacting protein 4-like isoform X2 [Eucalyptus 
grandis]
Length=77

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 48/94 (51%), Gaps = 24/94 (26%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRK  325
            M+EK  PLPKFG+WD  +PA++  F+VIF+KAR  K+ G             + +SP + 
Sbjct  1    MSEKGQPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTGG------------KPESPGKA  48

Query  324  DRpnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
            D               H +  GK  T +KWLCC+
Sbjct  49   DAQ-----------TKHTVDPGKPPT-KKWLCCI  70



>ref|XP_002320529.2| hypothetical protein POPTR_0014s16680g [Populus trichocarpa]
 gb|EEE98844.2| hypothetical protein POPTR_0014s16680g [Populus trichocarpa]
Length=78

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 49/94 (52%), Gaps = 22/94 (23%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRK  325
            M EK+ PLPKFG+WD  +PA++  F+VIF+KAR+ K+ G             + DSP + 
Sbjct  1    MEEKDQPLPKFGEWDVNDPASAEGFTVIFNKARNEKKTGG------------KPDSPAKD  48

Query  324  DRpnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
                         P A    LGK +T +KW CC+
Sbjct  49   SSTYK--------PGAT-TTLGKPQT-KKWFCCI  72



>ref|XP_004148258.1| PREDICTED: RPM1-interacting protein 4-like [Cucumis sativus]
 ref|XP_004168586.1| PREDICTED: RPM1-interacting protein 4-like [Cucumis sativus]
 gb|KGN56031.1| hypothetical protein Csa_3G047910 [Cucumis sativus]
Length=76

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 47/94 (50%), Gaps = 25/94 (27%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRK  325
            M+EK  PLPKFG+WD  NPA++  F+VIF+KAR  K+ G             Q +SP + 
Sbjct  1    MSEKGQPLPKFGEWDVNNPASAEGFTVIFNKARDEKKTGG------------QPESPGKA  48

Query  324  DRpnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
             R            A +    GK +  +KW CC+
Sbjct  49   PR------------AKNVADPGKPQA-KKWFCCI  69



>ref|XP_009618347.1| PREDICTED: RPM1-interacting protein 4 [Nicotiana tomentosiformis]
Length=77

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 50/95 (53%), Gaps = 26/95 (27%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRK  325
            MA+K  PLPKFG+WD  +PA++  F+VIF+KAR+ KR G               +SP + 
Sbjct  1    MADKGRPLPKFGEWDVNDPASAEGFTVIFNKARNEKRSGG------------NTNSPPKD  48

Query  324  DRpnnnsspssNTPA-AHFLYLGKSRTGRKWLCCV  223
            D            PA  H   LGK ++ +KW CC+
Sbjct  49   D------------PAYKHGATLGKPQS-KKWFCCM  70



>gb|AAQ10001.1| putative nitrate-induced NOI protein [Petunia integrifolia subsp. 
inflata]
 gb|AAQ10002.1| putative nitrate-induced NOI protein [Petunia integrifolia subsp. 
inflata]
Length=85

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 45/87 (52%), Gaps = 18/87 (21%)
 Frame = -3

Query  486  PLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRKDRpnnn  307
            PLP+FG+WD  NPAA+ +FSVIFD+AR+AK+D                DSP +       
Sbjct  9    PLPRFGEWDVNNPAAAREFSVIFDRARNAKKDVNN-------------DSPWKNKERETT  55

Query  306  sspssNTPAAHFLYLGKSRTGRKWLCC  226
                 + P      L KS + +KWLCC
Sbjct  56   PFTVKSDPQ-----LRKSSSKQKWLCC  77



>ref|XP_009387587.1| PREDICTED: uncharacterized protein LOC103974469 [Musa acuminata 
subsp. malaccensis]
Length=79

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 50/94 (53%), Gaps = 21/94 (22%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRK  325
            M++K  PLPKFG+WD  +PA++  F+VIF+KAR  ++ G+            + DSP ++
Sbjct  1    MSDKGRPLPKFGEWDVNDPASAEGFTVIFNKARDERKTGSNAR---------ETDSPGKE  51

Query  324  DRpnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
            +           T   H  Y  KS T +KW CC+
Sbjct  52   E-----------TGFKHGPYASKS-TAKKWFCCM  73



>ref|XP_009777841.1| PREDICTED: RPM1-interacting protein 4 [Nicotiana sylvestris]
Length=78

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 49/94 (52%), Gaps = 23/94 (24%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRK  325
            MA+K  PLPKFG+WD  +PA++  F+VIF+KAR+ KR G               +SP + 
Sbjct  1    MADKGRPLPKFGEWDVNDPASAEGFTVIFNKARNEKRSGG------------NTNSPPKG  48

Query  324  DRpnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
            D   N           H   +GK ++ +KW CC+
Sbjct  49   DPAYNK----------HGATIGKPQS-KKWFCCM  71



>gb|EYU33710.1| hypothetical protein MIMGU_mgv1a017515mg [Erythranthe guttata]
Length=70

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 45/94 (48%), Gaps = 24/94 (26%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRK  325
            M+EK  PLPKFG+WD  +PA++  F+VIF+KAR+ K+ G             + DSPT  
Sbjct  1    MSEKGRPLPKFGEWDVNDPASAEGFTVIFNKARNEKKTGG------------KPDSPT--  46

Query  324  DRpnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
                            HF        G+KW CC+
Sbjct  47   ----------GGVSNTHFREETLKPQGKKWFCCM  70



>emb|CBI28462.3| unnamed protein product [Vitis vinifera]
Length=77

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 49/94 (52%), Gaps = 24/94 (26%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRK  325
            M+EK  PLPKFGDWD  +P +++ F++IF+KAR  K+ G             + DSP ++
Sbjct  1    MSEKGQPLPKFGDWDVNDPTSADGFTMIFNKARDEKKTGG------------KPDSPAKE  48

Query  324  DRpnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
            D               H   LGK ++ +KW CC+
Sbjct  49   DSAFK-----------HGADLGKPQS-KKWFCCM  70



>ref|XP_008229934.1| PREDICTED: RPM1-interacting protein 4 [Prunus mume]
Length=74

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 46/94 (49%), Gaps = 24/94 (26%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRK  325
            M EK  PLPKFG+WD  +PA++  F+VIF+KAR  K+ G             + DSP++ 
Sbjct  1    MGEKGVPLPKFGEWDVNDPASAEGFTVIFNKARTEKKAGG------------RPDSPSKD  48

Query  324  DRpnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
            D               H   LGK    +KW CC+
Sbjct  49   DHAFK-----------HGAVLGKP-PAKKWFCCL  70



>gb|KFK32398.1| hypothetical protein AALP_AA6G236300 [Arabis alpina]
Length=78

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 54/101 (53%), Gaps = 23/101 (23%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRK  325
            MAEK+ PLPKFG+WD  +PA++  F+VIF+KAR+ K+ G               DSP + 
Sbjct  1    MAEKDRPLPKFGEWDVNDPASAEGFTVIFNKARNEKKGGGTS------------DSPAKD  48

Query  324  DRpnnnsspssNTPAAHFLYLGKSRTGRKWLCCVGRRRHTD  202
            +   N+          H   LGK +  +KW CC+ +  HT+
Sbjct  49   EPGYNHK---------HREVLGKPQP-KKWFCCM-QATHTE  78



>ref|XP_008380010.1| PREDICTED: RPM1-interacting protein 4 [Malus domestica]
Length=74

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/94 (33%), Positives = 46/94 (49%), Gaps = 24/94 (26%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRK  325
            M EK  PLPKFG+WD  +PA++  F+VIF+KAR  K+ G             + DSP+++
Sbjct  1    MGEKGVPLPKFGEWDVNDPASAEGFTVIFNKARTEKQTGG------------RPDSPSKE  48

Query  324  DRpnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
            D      +     P+            +KW CC+
Sbjct  49   DHAYKQGAVLGKPPS------------KKWFCCL  70



>ref|XP_009414531.1| PREDICTED: RPM1-interacting protein 4-like [Musa acuminata subsp. 
malaccensis]
Length=76

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 45/92 (49%), Gaps = 19/92 (21%)
 Frame = -3

Query  501  AEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRKD  322
            AEK  PLPKFG+WD  NPA++  F+VIF+K R  K+ G    + T         +PTRKD
Sbjct  3    AEKGQPLPKFGEWDVNNPASAEGFTVIFNKVRDEKKTGGNSGTPT---------TPTRKD  53

Query  321  RpnnnsspssNTPAAHFLYLGKSRTGRKWLCC  226
              +     +   P          R  RKW CC
Sbjct  54   VGSLPPDDTYQHP----------RKTRKWFCC  75



>ref|XP_008449047.1| PREDICTED: RPM1-interacting protein 4-like [Cucumis melo]
Length=76

 Score = 56.2 bits (134),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 47/94 (50%), Gaps = 25/94 (27%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRK  325
            M+EK  PLPKFG+WD  NPA++  F+VIF+KAR  K+ G             Q +SP + 
Sbjct  1    MSEKGQPLPKFGEWDVNNPASAEGFTVIFNKARDEKKTGG------------QPESPGKA  48

Query  324  DRpnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
             +            A +    GK +  +KW CC+
Sbjct  49   PQ------------AKNVADPGKPQA-KKWFCCI  69



>gb|KDP29951.1| hypothetical protein JCGZ_18520 [Jatropha curcas]
Length=80

 Score = 56.2 bits (134),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 44/81 (54%), Gaps = 12/81 (15%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRK  325
            MAEK  PLPKFG+WD  +PA++  F+VIF+KAR+ K+ G             + DSP R 
Sbjct  1    MAEKGQPLPKFGEWDVNDPASAEGFTVIFNKARNEKKTGG------------KPDSPARD  48

Query  324  DRpnnnsspssNTPAAHFLYL  262
            +      S +   P + F YL
Sbjct  49   NSSFKPGSNTLGKPQSPFKYL  69



>gb|EYU27446.1| hypothetical protein MIMGU_mgv1a017408mg [Erythranthe guttata]
Length=77

 Score = 56.2 bits (134),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 47/94 (50%), Gaps = 24/94 (26%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRK  325
            M EK  PLPKFG+WD  +PA++  F+VIF+KAR+ K+ G             + DSPT+ 
Sbjct  1    MTEKGRPLPKFGEWDVNDPASAEGFTVIFNKARNEKKTGG------------KPDSPTKV  48

Query  324  DRpnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
            +             ++H         G+KW CC+
Sbjct  49   EM------------SSHNGVEPIKPHGKKWFCCM  70



>gb|ADE76265.1| unknown [Picea sitchensis]
Length=86

 Score = 56.2 bits (134),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 46/92 (50%), Gaps = 16/92 (17%)
 Frame = -3

Query  498  EKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRKDR  319
            EK  PLPKFG+WD  +PA++  F+VIF+KAR  K+ G               +SP + D 
Sbjct  4    EKGRPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTGGTTRIPGVPA-----ESPAKDDD  58

Query  318  pnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
               N          H  Y  KS T RKWLCC+
Sbjct  59   AYKN----------HGSYQQKSST-RKWLCCM  79



>ref|XP_007049382.1| RPM1-interacting protein 4 (RIN4) family protein isoform 2 [Theobroma 
cacao]
 gb|EOX93539.1| RPM1-interacting protein 4 (RIN4) family protein isoform 2 [Theobroma 
cacao]
Length=188

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 39/61 (64%), Gaps = 12/61 (20%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRK  325
            MA+K  PLPKFG+WD  +PA++  F+VIF+KAR+ K+ G             ++DSP RK
Sbjct  1    MADKGRPLPKFGEWDVNDPASAEGFTVIFNKARNEKKTGG------------KVDSPGRK  48

Query  324  D  322
            D
Sbjct  49   D  49



>ref|XP_011097755.1| PREDICTED: RPM1-interacting protein 4-like [Sesamum indicum]
Length=70

 Score = 55.5 bits (132),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 45/94 (48%), Gaps = 24/94 (26%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRK  325
            M+EK  PLPKFG+WD  +PA++  F+VIF+KAR  K+ G             + DSPT+ 
Sbjct  1    MSEKGRPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTGG------------KPDSPTKV  48

Query  324  DRpnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
            D     +                   G+KW CC+
Sbjct  49   DSSTKQAEEPLKP------------QGKKWFCCM  70



>ref|XP_011095561.1| PREDICTED: RPM1-interacting protein 4 [Sesamum indicum]
Length=77

 Score = 55.5 bits (132),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 48/94 (51%), Gaps = 24/94 (26%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRK  325
            M+EK  PLPKFG+WD  +PA++  F+VIF+KAR  K+ G             + DSPT+ 
Sbjct  1    MSEKGRPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTGG------------KPDSPTKV  48

Query  324  DRpnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
            D           T   H     K + G+KW CC+
Sbjct  49   D-----------TNKNHGAEPLKPQ-GKKWFCCM  70



>ref|XP_009408263.1| PREDICTED: RPM1-interacting protein 4-like [Musa acuminata subsp. 
malaccensis]
Length=76

 Score = 55.5 bits (132),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 43/92 (47%), Gaps = 19/92 (21%)
 Frame = -3

Query  501  AEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRKD  322
            +EK  PLPKFG+WD  NPA++  F+VIF+KAR  K+ GA   +           +P R D
Sbjct  3    SEKGQPLPKFGEWDVNNPASAEGFTVIFNKARDEKKTGANSGATA---------TPPRND  53

Query  321  RpnnnsspssNTPAAHFLYLGKSRTGRKWLCC  226
                    +   P          R  RKW CC
Sbjct  54   AGGFQQDDTYQHP----------RKSRKWFCC  75



>ref|XP_007142424.1| hypothetical protein PHAVU_008G279500g [Phaseolus vulgaris]
 gb|ESW14418.1| hypothetical protein PHAVU_008G279500g [Phaseolus vulgaris]
Length=112

 Score = 55.8 bits (133),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 60/116 (52%), Gaps = 24/116 (21%)
 Frame = -3

Query  567  SLFSRLFPFDRIGS-ESKKIEEMAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRD  391
            S FS LFP   + S +S  I  M+++  PLPKFG+WD  +P+++  ++VIF+KAR  K+ 
Sbjct  13   SRFSPLFPRSFLFSGKSIIIVFMSDEGRPLPKFGEWDVNDPSSAESYTVIFNKARDDKKT  72

Query  390  GArppsrttttrRDQLDSPTRKDRpnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
            G             + DSP++++               H L   +++  +KW CC+
Sbjct  73   GG------------KPDSPSKRNHR-----------TRHQLDPARTQQQKKWFCCM  105



>ref|XP_011008069.1| PREDICTED: RPM1-interacting protein 4 isoform X1 [Populus euphratica]
Length=80

 Score = 55.5 bits (132),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 48/92 (52%), Gaps = 22/92 (24%)
 Frame = -3

Query  498  EKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRKDR  319
            EK+ PLPKFG+WD  +P ++  F+VIF+KAR+ K+ G             + DSP +   
Sbjct  5    EKDQPLPKFGEWDVNDPTSAEGFTVIFNKARNEKKTGG------------KPDSPAKDSS  52

Query  318  pnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
                       P A    LGK +T +KWLCC+
Sbjct  53   TYK--------PGAT-ATLGKPQT-KKWLCCI  74



>ref|XP_010061443.1| PREDICTED: RPM1-interacting protein 4-like isoform X3 [Eucalyptus 
grandis]
Length=76

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 46/92 (50%), Gaps = 24/92 (26%)
 Frame = -3

Query  498  EKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRKDR  319
            EK  PLPKFG+WD  +PA++  F+VIF+KAR  K+ G             + +SP + D 
Sbjct  2    EKGQPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTGG------------KPESPGKADA  49

Query  318  pnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
                          H +  GK  T +KWLCC+
Sbjct  50   Q-----------TKHTVDPGKPPT-KKWLCCI  69



>ref|XP_010514487.1| PREDICTED: RPM1-interacting protein 4-like [Camelina sativa]
Length=76

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/94 (33%), Positives = 46/94 (49%), Gaps = 24/94 (26%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRK  325
            MA+K  PLPKFG+WD  +P+++  F+VIF+KAR+ K+ G             + DSP R 
Sbjct  1    MADKGRPLPKFGEWDVNDPSSAEGFTVIFNKARNEKKGGG------------KTDSPGRD  48

Query  324  DRpnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
            +   N +      P             +KW CC+
Sbjct  49   ESGYNKNGEVLEKPT------------KKWFCCI  70



>ref|XP_004956369.1| PREDICTED: RPM1-interacting protein 4-like [Setaria italica]
Length=83

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/92 (33%), Positives = 43/92 (47%), Gaps = 19/92 (21%)
 Frame = -3

Query  501  AEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRKD  322
            AEK +PLPKFG+WD  +PA++  F+VIF+KAR  K+ G     +    + +Q  S     
Sbjct  3    AEKGSPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTGGNSQGQDEQVKNEQQSS-----  57

Query  321  RpnnnsspssNTPAAHFLYLGKSRTGRKWLCC  226
                                 K+   +KWLCC
Sbjct  58   --------------GQGFNAPKAGNTKKWLCC  75



>ref|XP_006296639.1| hypothetical protein CARUB_v10015029mg [Capsella rubella]
 gb|EOA29537.1| hypothetical protein CARUB_v10015029mg [Capsella rubella]
Length=76

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 47/94 (50%), Gaps = 24/94 (26%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRK  325
            MA+K  PLPKFG+WD  +P+++  F+VIF+KAR+ K+ G             + DSP R 
Sbjct  1    MADKGRPLPKFGEWDVNDPSSAEGFTVIFNKARNEKKGGG------------KSDSPGRD  48

Query  324  DRpnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
            +   N +      PA            +KW CC+
Sbjct  49   EPGYNKNGEVLEKPA------------KKWFCCI  70



>ref|XP_002532206.1| NOI, putative [Ricinus communis]
 gb|EEF30175.1| NOI, putative [Ricinus communis]
Length=77

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 50/94 (53%), Gaps = 23/94 (24%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRK  325
            MA+K  PLPKFG+WD  +PA++  F+VIF+KAR+ K+ G             + DSP + 
Sbjct  1    MADKGRPLPKFGEWDVNDPASAEGFTVIFNKARNEKKTGG------------KPDSPAKD  48

Query  324  DRpnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
            +      + +          LGK ++ +KW CC+
Sbjct  49   NSGYKPGTTT----------LGKPQS-KKWFCCI  71



>ref|XP_007215168.1| hypothetical protein PRUPE_ppa013593mg [Prunus persica]
 gb|EMJ16367.1| hypothetical protein PRUPE_ppa013593mg [Prunus persica]
Length=114

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 47/94 (50%), Gaps = 24/94 (26%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRK  325
             +EK  PLPKFG+WD  +PA++  F+VIF+KAR  K++G             + DSP++ 
Sbjct  41   FSEKGVPLPKFGEWDVNDPASAEGFTVIFNKARTEKKEGG------------RPDSPSKD  88

Query  324  DRpnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
            D               H   LGK    +KW CC+
Sbjct  89   DHAFK-----------HGAVLGKP-PAKKWFCCL  110



>emb|CDP20461.1| unnamed protein product [Coffea canephora]
Length=150

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 47/94 (50%), Gaps = 24/94 (26%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRK  325
            MAE + PLPKFG+WD  +PA++  F+VIF+KAR+ K+ G             + DSP + 
Sbjct  75   MAEHDRPLPKFGEWDVNDPASAEGFTVIFNKARNEKKTGG------------KSDSPQKG  122

Query  324  DRpnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
                            H   LGK  + +KW CCV
Sbjct  123  SSAYK-----------HRATLGKPPS-KKWFCCV  144



>ref|XP_010926960.1| PREDICTED: RPM1-interacting protein 4-like isoform X1 [Elaeis 
guineensis]
Length=93

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 46/96 (48%), Gaps = 19/96 (20%)
 Frame = -3

Query  513  IEEMAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSP  334
            + E +EK  PLPKFGDWD  NPA++  F+VIF+KAR  K+    P            +SP
Sbjct  16   VSESSEKGRPLPKFGDWDVNNPASAEGFTVIFNKARDEKKTSGNPGVA---------NSP  66

Query  333  TRKDRpnnnsspssNTPAAHFLYLGKSRTGRKWLCC  226
             R +            P   + Y  KS   +KW CC
Sbjct  67   RRNN-------MGGLKPDETYQYPRKS---KKWFCC  92



>ref|XP_006452611.1| hypothetical protein CICLE_v10010079mg [Citrus clementina]
 gb|ESR65851.1| hypothetical protein CICLE_v10010079mg [Citrus clementina]
 gb|KDO59136.1| hypothetical protein CISIN_1g034970mg [Citrus sinensis]
Length=77

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 47/94 (50%), Gaps = 24/94 (26%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRK  325
            M++K  PLPKFG+WD  +PA++  F+VIF+KAR  K+ G             + DSP + 
Sbjct  1    MSDKGRPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTGG------------KPDSPGKV  48

Query  324  DRpnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
            D            P  H +   K +  RKW CC+
Sbjct  49   D-----------PPIRHGVDPAKPQP-RKWFCCI  70



>ref|XP_006352016.1| PREDICTED: RPM1-interacting protein 4-like [Solanum tuberosum]
Length=74

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 46/94 (49%), Gaps = 26/94 (28%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRK  325
            M E   PLPKFG+WD  +PA +  F+VIF+KAR+ KR G             + D+P + 
Sbjct  1    MEEAGRPLPKFGEWDVNDPATAEGFTVIFNKARNEKRLGG------------KADAPPKS  48

Query  324  DRpnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
            +               H   LGK ++ +KW CC+
Sbjct  49   NHK-------------HTATLGKPQS-KKWFCCM  68



>ref|XP_010466996.1| PREDICTED: RPM1-interacting protein 4-like [Camelina sativa]
 ref|XP_010488692.1| PREDICTED: RPM1-interacting protein 4-like [Camelina sativa]
Length=76

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/94 (33%), Positives = 46/94 (49%), Gaps = 24/94 (26%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRK  325
            MA+K  PLPKFG+WD  +P+++  F+VIF+KAR+ K+ G             + DSP R 
Sbjct  1    MADKGRPLPKFGEWDVNDPSSAEGFTVIFNKARNEKKGGG------------KTDSPGRD  48

Query  324  DRpnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
            +   N +      P             +KW CC+
Sbjct  49   EPGYNKNGEVLEKPT------------KKWFCCI  70



>ref|XP_004154510.1| PREDICTED: uncharacterized LOC101217194 [Cucumis sativus]
 ref|XP_008464154.1| PREDICTED: RPM1-interacting protein 4-like isoform X2 [Cucumis 
melo]
 gb|KGN46614.1| hypothetical protein Csa_6G113510 [Cucumis sativus]
Length=77

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 52/96 (54%), Gaps = 26/96 (27%)
 Frame = -3

Query  504  MAEK--NAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPT  331
            MAEK  ++PLPKFG+WD  +PA++  F+VIF+KAR+ K+ G  P            DSP 
Sbjct  1    MAEKGSSSPLPKFGEWDVNDPASAEGFTVIFNKARNEKKTGGMP------------DSPA  48

Query  330  RKDRpnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
            + +           T   +   LGKS+  +KW CC+
Sbjct  49   KDE-----------TAFKNGSVLGKSQP-KKWFCCL  72



>ref|XP_010252792.1| PREDICTED: uncharacterized protein LOC104594267 [Nelumbo nucifera]
Length=77

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 45/94 (48%), Gaps = 24/94 (26%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRK  325
            M+EK  PLPKFG+WD  +PA++  F+VIF+KAR  K+ G             + DSP + 
Sbjct  1    MSEKGRPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTGG------------KPDSPAKD  48

Query  324  DRpnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
            D    + +                  G+KW CCV
Sbjct  49   DSTFKHGTDPVKP------------QGKKWFCCV  70



>ref|XP_010547201.1| PREDICTED: RPM1-interacting protein 4-like isoform X2 [Tarenaya 
hassleriana]
Length=79

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 51/96 (53%), Gaps = 23/96 (24%)
 Frame = -3

Query  498  EKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRKDR  319
            EK   LPKFG+WD  +PA+++ F+VIF+KAR+ ++ G             + D+P++  R
Sbjct  5    EKGQHLPKFGEWDVNDPASADGFTVIFNKARNERKGGT------------KTDTPSKDSR  52

Query  318  pnnnsspssNTPAAHFLYLGKSRTGRKWLCCVGRRR  211
             +            + + LGK ++ R WLCCV   R
Sbjct  53   SHKK----------NTVVLGKPQSKR-WLCCVKAER  77



>ref|XP_010547199.1| PREDICTED: RPM1-interacting protein 4-like isoform X1 [Tarenaya 
hassleriana]
Length=81

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/97 (33%), Positives = 52/97 (54%), Gaps = 23/97 (24%)
 Frame = -3

Query  498  EKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRKDR  319
            EK   LPKFG+WD  +PA+++ F+VIF+KAR+ ++ G             + D+P++  R
Sbjct  5    EKGQHLPKFGEWDVNDPASADGFTVIFNKARNERKGGT------------KTDTPSKDSR  52

Query  318  pnnnsspssNTPAAHFLYLGKSRTGRK-WLCCVGRRR  211
             +            + + LGK ++ +K WLCCV   R
Sbjct  53   SHKK----------NTVVLGKPQSMQKRWLCCVKAER  79



>ref|XP_008446098.1| PREDICTED: RPM1-interacting protein 4-like [Cucumis melo]
Length=84

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -3

Query  501  AEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGA  385
            A+K   LPKFGDWDEKNPAA+  F+VIF++AR  K++G 
Sbjct  4    AQKGPFLPKFGDWDEKNPAAAEGFTVIFNRARDNKKNGG  42



>gb|ACU13629.1| unknown [Glycine max]
Length=79

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 51/94 (54%), Gaps = 22/94 (23%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRK  325
            M+EK  PLPKFG+WD+ +P ++  F+VIF+KAR  K+ G               DSP + 
Sbjct  1    MSEKGRPLPKFGEWDDNDPTSAEGFTVIFNKARDEKKTGG------------NPDSPGK-  47

Query  324  DRpnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
                  ++   + PA   +  GK++T +KW CC+
Sbjct  48   -----TATDPHSKPA---VEPGKTQT-KKWFCCM  72



>ref|NP_178522.2| RPM1-interacting protein 4-like protein [Arabidopsis thaliana]
 gb|AEC05832.1| RPM1-interacting protein 4-like protein [Arabidopsis thaliana]
Length=73

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/94 (33%), Positives = 47/94 (50%), Gaps = 24/94 (26%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRK  325
            MA+K  PLPKFG+WD  +P+++  F+VIF+KAR+ K+ G             + DSP + 
Sbjct  1    MADKGRPLPKFGEWDVNDPSSAEGFTVIFNKARNEKKGGG------------KSDSPGKD  48

Query  324  DRpnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
            +   N +      PA            +KW CC+
Sbjct  49   EPGYNKNGEVLEKPA------------KKWFCCI  70



>ref|XP_010942599.1| PREDICTED: RPM1-interacting protein 4 isoform X3 [Elaeis guineensis]
Length=82

 Score = 53.1 bits (126),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 32/95 (34%), Positives = 46/95 (48%), Gaps = 21/95 (22%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRK  325
            M++K  PLPKFG+WD  +PA++  F+VIF+KAR  K+ G               DSP ++
Sbjct  1    MSDKGQPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTGGSARGP---------DSPGKE  51

Query  324  DRpnnnsspssNTPAAHFLYLGKSRT-GRKWLCCV  223
            +           T   H  Y  K     +KW CC+
Sbjct  52   E-----------TAFKHGPYAPKPNVNAKKWFCCI  75



>ref|NP_001147003.1| LOC100280613 [Zea mays]
 gb|ACG25021.1| nitrate-induced NOI protein [Zea mays]
 gb|AFW86381.1| hypothetical protein ZEAMMB73_687899 [Zea mays]
Length=80

 Score = 53.1 bits (126),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 35/95 (37%), Positives = 48/95 (51%), Gaps = 23/95 (24%)
 Frame = -3

Query  504  MAEKNA-PLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTR  328
            MAE++  PLPKFGDWD  +PA+++ F+VIF+KAR  K+ G               +SP++
Sbjct  1    MAEESGRPLPKFGDWDVNDPASADGFTVIFNKARDEKKGG----------NGQDTESPSK  50

Query  327  KDRpnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
              R     S           Y  K  T +KW CCV
Sbjct  51   DTRTERVES-----------YAAKPST-KKWFCCV  73



>ref|XP_002438259.1| hypothetical protein SORBIDRAFT_10g010690 [Sorghum bicolor]
 gb|EER89626.1| hypothetical protein SORBIDRAFT_10g010690 [Sorghum bicolor]
Length=80

 Score = 53.1 bits (126),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 35/95 (37%), Positives = 48/95 (51%), Gaps = 23/95 (24%)
 Frame = -3

Query  504  MAEKNA-PLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTR  328
            MAE++  PLPKFG+WD  +PA+++ F+VIF+KAR  K+ G               DSP++
Sbjct  1    MAEESGRPLPKFGEWDVNDPASADGFTVIFNKARDEKKGG----------NGQDTDSPSK  50

Query  327  KDRpnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
              R     S           Y  K  T +KW CCV
Sbjct  51   DTRTERVES-----------YAAKPST-KKWFCCV  73



>ref|XP_010061441.1| PREDICTED: RPM1-interacting protein 4-like isoform X1 [Eucalyptus 
grandis]
Length=113

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 46/92 (50%), Gaps = 24/92 (26%)
 Frame = -3

Query  498  EKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRKDR  319
            EK  PLPKFG+WD  +PA++  F+VIF+KAR  K+ G             + +SP + D 
Sbjct  39   EKGQPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTGG------------KPESPGKADA  86

Query  318  pnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
                          H +  GK  T +KWLCC+
Sbjct  87   Q-----------TKHTVDPGKPPT-KKWLCCI  106



>ref|XP_006474872.1| PREDICTED: uncharacterized protein LOC102627443 [Citrus sinensis]
Length=77

 Score = 52.8 bits (125),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 47/96 (49%), Gaps = 24/96 (25%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRK  325
            M++K  PLPKFG+WD  +PA++  F+VIF+KAR  K+ G             + DSP + 
Sbjct  1    MSDKGRPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTGG------------KPDSPGKV  48

Query  324  DRpnnnsspssNTPAAHFLYLGKSRTGRKWLCCVGR  217
            D            P    +   K +  RKW CC+ R
Sbjct  49   D-----------PPIRQGVDPAKPQP-RKWFCCIQR  72



>ref|XP_010524624.1| PREDICTED: RPM1-interacting protein 4-like [Tarenaya hassleriana]
Length=74

 Score = 52.8 bits (125),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 47/94 (50%), Gaps = 26/94 (28%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRK  325
            MAEK  PL KFG+WD  +PA++  F+VIF+KAR+ K+ G          + D  DS   K
Sbjct  1    MAEKGPPLHKFGEWDVNDPASAEGFTVIFNKARNEKKGGV---------KTDDKDSRNYK  51

Query  324  DRpnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
                              + LGK ++ R WLCCV
Sbjct  52   TT----------------VVLGKPQSKR-WLCCV  68



>ref|XP_004148923.1| PREDICTED: RPM1-interacting protein 4-like [Cucumis sativus]
Length=77

 Score = 52.8 bits (125),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 46/94 (49%), Gaps = 24/94 (26%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRK  325
            M +K  PLPKFG+WD  +P ++  F+VIF+KAR  K+ G             + DSP + 
Sbjct  1    MTDKGRPLPKFGEWDVNDPTSAEGFTVIFNKARDEKKTGG------------KPDSPGKV  48

Query  324  DRpnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
            D    N+   + TP             +KWLCC+
Sbjct  49   DAHGRNAPDPAKTPP------------KKWLCCI  70



>ref|XP_008357962.1| PREDICTED: RPM1-interacting protein 4-like [Malus domestica]
Length=85

 Score = 53.1 bits (126),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 30/92 (33%), Positives = 44/92 (48%), Gaps = 24/92 (26%)
 Frame = -3

Query  498  EKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRKDR  319
            EK  PLPKFG+WD  +PA++  F+VIF+KAR  K  G             + DSP+++D 
Sbjct  14   EKGVPLPKFGEWDVNDPASAEGFTVIFNKARTEKXTGG------------RPDSPSKEDH  61

Query  318  pnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
                 +     P+            +KW CC+
Sbjct  62   AYKQGAVLGKPPS------------KKWFCCL  81



>gb|KHN43901.1| RPM1-interacting protein 4, partial [Glycine soja]
Length=99

 Score = 53.1 bits (126),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 40/60 (67%), Gaps = 1/60 (2%)
 Frame = -3

Query  564  LFSRLFPFDRIGSESKKIEEMAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGA  385
            + +  FPF+ +  +S  I  M++   PLPKFG+WD  +PA++  ++VIF+KAR+ K+ G 
Sbjct  2    ITTHWFPFNTL-HKSSNIVFMSDTGRPLPKFGEWDVNDPASAEGYTVIFNKARNDKKTGG  60



>ref|XP_008646185.1| PREDICTED: uncharacterized protein LOC103627672 [Zea mays]
Length=88

 Score = 53.1 bits (126),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 45/87 (52%), Gaps = 14/87 (16%)
 Frame = -3

Query  483  LPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRKDRpnnns  304
            +PKFG+WD  NPA+++ F+VIF KAR  K+  A+   R  +   D  DS +R ++  +  
Sbjct  9    IPKFGEWDVNNPASADGFTVIFSKARDEKKAPAQGHIRDRSASADSKDSRSRDEKMTS--  66

Query  303  spssNTPAAHFLYLGKSRTGRKWLCCV  223
                        Y  ++   +KW CCV
Sbjct  67   ------------YSSRTNASKKWFCCV  81



>ref|XP_007049389.1| RPM1-interacting protein 4 family protein [Theobroma cacao]
 gb|EOX93546.1| RPM1-interacting protein 4 family protein [Theobroma cacao]
Length=163

 Score = 54.3 bits (129),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 31/95 (33%), Positives = 49/95 (52%), Gaps = 25/95 (26%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKR-DGArppsrttttrRDQLDSPTR  328
            + +K  PLPKFG+W+  +PA++  F+VIF+K R+ K+ DG             ++DSP R
Sbjct  87   IKDKGRPLPKFGEWNVNDPASAEGFTVIFNKTRNEKKTDG-------------KVDSPGR  133

Query  327  KDRpnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
             D      +            LGK ++ +KW CC+
Sbjct  134  NDPTYKQGA-----------VLGKPQSQKKWFCCI  157



>ref|XP_006418573.1| hypothetical protein EUTSA_v10002884mg [Eutrema salsugineum]
 gb|ESQ37009.1| hypothetical protein EUTSA_v10002884mg [Eutrema salsugineum]
Length=76

 Score = 52.8 bits (125),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 31/98 (32%), Positives = 47/98 (48%), Gaps = 24/98 (24%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRK  325
            MA+K  PLPKFG+WD  +P+++  F+VIF+KAR+ K+ G             + DSP + 
Sbjct  1    MADKGRPLPKFGEWDVNDPSSAEGFTVIFNKARNEKKGGG------------KSDSPGKD  48

Query  324  DRpnnnsspssNTPAAHFLYLGKSRTGRKWLCCVGRRR  211
            +   N +      P             +KW CC+   R
Sbjct  49   EPGYNKNGQVLGKPT------------KKWFCCIQSTR  74



>ref|NP_001104900.1| LOC541680 [Zea mays]
 gb|AAB86937.1| nitrate-induced NOI protein [Zea mays]
 gb|AAC03022.1| nitrate-induced NOI protein [Zea mays]
 gb|AFW76991.1| nitrate-induced NOI protein [Zea mays]
Length=80

 Score = 52.8 bits (125),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 35/95 (37%), Positives = 48/95 (51%), Gaps = 23/95 (24%)
 Frame = -3

Query  504  MAEKNA-PLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTR  328
            MAE++  PLPKFG+WD  +PA+++ F+VIF+KAR  K+ G               DSP++
Sbjct  1    MAEESGRPLPKFGEWDVNDPASADGFTVIFNKARDEKKGG----------NGQDTDSPSK  50

Query  327  KDRpnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
              R     S           Y  K  T +KW CCV
Sbjct  51   DPRTERVES-----------YAAKPST-KKWFCCV  73



>ref|XP_009793110.1| PREDICTED: RPM1-interacting protein 4-like isoform X1 [Nicotiana 
sylvestris]
Length=80

 Score = 52.8 bits (125),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGA  385
            M+EK  PLPKFG+WD  +PA++  F+VIF+KAR  K+ G 
Sbjct  1    MSEKGRPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTGG  40



>ref|XP_009606343.1| PREDICTED: RPM1-interacting protein 4-like isoform X1 [Nicotiana 
tomentosiformis]
Length=80

 Score = 52.4 bits (124),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGA  385
            M+EK  PLPKFG+WD  +PA++  F+VIF+KAR  K+ G 
Sbjct  1    MSEKGRPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTGG  40



>ref|XP_003532179.1| PREDICTED: RPM1-interacting protein 4 [Glycine max]
 gb|ACU13701.1| unknown [Glycine max]
 gb|KHN11153.1| RPM1-interacting protein 4 [Glycine soja]
Length=79

 Score = 52.4 bits (124),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 51/94 (54%), Gaps = 22/94 (23%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRK  325
            M+EK  PLPKFG+WD  +PA++  F+VIF+KAR  K+ G               +SP + 
Sbjct  1    MSEKGRPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTGG------------NPESPGK-  47

Query  324  DRpnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
                  ++   + PA   +  GK++T +KW CC+
Sbjct  48   -----TATDPHSKPA---VEPGKTQT-KKWFCCM  72



>ref|XP_007207399.1| hypothetical protein PRUPE_ppa014254mg [Prunus persica]
 ref|XP_008219698.1| PREDICTED: RPM1-interacting protein 4 [Prunus mume]
 gb|EMJ08598.1| hypothetical protein PRUPE_ppa014254mg [Prunus persica]
Length=77

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/94 (33%), Positives = 47/94 (50%), Gaps = 24/94 (26%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRK  325
            M+EK  PLPKFG+WD  +PA++  F+VIF+KAR  K+ G             + +SP + 
Sbjct  1    MSEKGRPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTGG------------KPESPGKA  48

Query  324  DRpnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
            D               H +  G+  + +KW CC+
Sbjct  49   DPNIR-----------HGVEPGRPPS-KKWFCCI  70



>ref|XP_003551429.1| PREDICTED: RPM1-interacting protein 4 [Glycine max]
Length=79

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 50/94 (53%), Gaps = 22/94 (23%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRK  325
            M+EK  PLPKFG+WD  +P ++  F+VIF+KAR  K+ G               DSP + 
Sbjct  1    MSEKGRPLPKFGEWDVNDPTSAEGFTVIFNKARDEKKTGG------------NPDSPGK-  47

Query  324  DRpnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
                  ++   + PA   +  GK++T +KW CC+
Sbjct  48   -----TATDPHSKPA---VEPGKTQT-KKWFCCM  72



>ref|XP_008464153.1| PREDICTED: RPM1-interacting protein 4-like isoform X1 [Cucumis 
melo]
Length=78

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 51/97 (53%), Gaps = 24/97 (25%)
 Frame = -3

Query  513  IEEMAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSP  334
            ++E    ++PLPKFG+WD  +PA++  F+VIF+KAR+ K+ G  P            DSP
Sbjct  1    MKEEKGSSSPLPKFGEWDVNDPASAEGFTVIFNKARNEKKTGGMP------------DSP  48

Query  333  TRKDRpnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
             + +           T   +   LGKS+  +KW CC+
Sbjct  49   AKDE-----------TAFKNGSVLGKSQP-KKWFCCL  73



>gb|EAZ43921.1| hypothetical protein OsJ_28544 [Oryza sativa Japonica Group]
Length=136

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -3

Query  507  EMAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGA  385
            E+ EK +PLPKFG+WD  +PA++  F+VIF+KAR  K+ G 
Sbjct  13   ELNEKGSPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTGG  53



>ref|XP_010063254.1| PREDICTED: RPM1-interacting protein 4-like [Eucalyptus grandis]
 gb|KCW70467.1| hypothetical protein EUGRSUZ_F03683 [Eucalyptus grandis]
Length=76

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 46/94 (49%), Gaps = 24/94 (26%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRK  325
            M+EK  PLPKFG+WD  +PA++  F+VIF+KAR  K+ G             + +SP + 
Sbjct  1    MSEKGQPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTGG------------KPESPAKA  48

Query  324  DRpnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
            +    NS   S  P             +KW CC+
Sbjct  49   NPQVKNSVDPSKPPT------------KKWFCCI  70



>ref|XP_008349485.1| PREDICTED: uncharacterized protein LOC103412729 isoform X2 [Malus 
domestica]
Length=82

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGA  385
            M+EK  PLPKFG+WD  +PA++  F+VIF+KAR  K+ G 
Sbjct  1    MSEKGRPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTGG  40



>ref|XP_004295204.1| PREDICTED: RPM1-interacting protein 4-like isoform 2 [Fragaria 
vesca subsp. vesca]
Length=78

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 49/96 (51%), Gaps = 23/96 (24%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRK  325
            M++K  PLPKFG+WD  +PA++  F+VIF+KAR  K+ G             + +SP++ 
Sbjct  1    MSDKGRPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTGG------------KPESPSKA  48

Query  324  DRpnnnsspssNTPAAHFLYLGKSRTGRKWLCCVGR  217
            D+ N         P++           +KW CC+ +
Sbjct  49   DQSNVRPGVDPGRPSS-----------KKWFCCMAQ  73



>ref|XP_009624027.1| PREDICTED: RPM1-interacting protein 4-like isoform X2 [Nicotiana 
tomentosiformis]
Length=77

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGA  385
            M+EK  PLPKFG+WD  +PA++  F+VIF+KAR+ K+ G 
Sbjct  1    MSEKGQPLPKFGEWDVNDPASAEGFTVIFNKARNEKKTGG  40



>ref|XP_004956371.1| PREDICTED: RPM1-interacting protein 4-like isoform X1 [Setaria 
italica]
Length=99

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -3

Query  501  AEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGA  385
            AEK +PLPKFG+WD  +PA++  F+VIF+KAR  K+ G 
Sbjct  3    AEKGSPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTGG  41



>ref|XP_009408747.1| PREDICTED: uncharacterized protein LOC103991115 [Musa acuminata 
subsp. malaccensis]
Length=151

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 45/93 (48%), Gaps = 19/93 (20%)
 Frame = -3

Query  501  AEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRKD  322
            +EK  PLPKFG+WD  NPA++  F+VIF+KAR  K+ GA   +           +P R D
Sbjct  78   SEKGQPLPKFGEWDVNNPASAEGFTVIFNKARDEKKTGANSGATA---------TPPRND  128

Query  321  RpnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
                    +       + Y  KS   RKW CC 
Sbjct  129  AGGFQQDDT-------YQYRRKS---RKWFCCC  151



>ref|XP_010037471.1| PREDICTED: RPM1-interacting protein 4-like [Eucalyptus grandis]
Length=79

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 43/93 (46%), Gaps = 15/93 (16%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRK  325
            MA    PLPKFG+WD  NPA++  F+VIF+KAR  K+      +  +  R     SP R 
Sbjct  1    MASAGRPLPKFGEWDVNNPASAEGFTVIFNKARDEKKTSGTTANMMSPRRN---VSPRRN  57

Query  324  DRpnnnsspssNTPAAHFLYLGKSRTGRKWLCC  226
            +   N       +P             RKWLCC
Sbjct  58   NSTYNKKEKRQQSPK------------RKWLCC  78



>dbj|BAJ78239.1| putative nitrate-induced NOI protein [Vicia faba]
Length=79

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 50/94 (53%), Gaps = 22/94 (23%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRK  325
            M+EK  PLPKFG+WD  +PA++  F+VIF+KAR  K+ G               +SP + 
Sbjct  1    MSEKGRPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTGG------------NTESPGK-  47

Query  324  DRpnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
                  ++   + PA+     GK ++ +KW CC+
Sbjct  48   -----TATEPQSKPASD---PGKPQS-KKWFCCI  72



>ref|XP_004135294.1| PREDICTED: RPM1-interacting protein 4-like [Cucumis sativus]
 ref|XP_004164190.1| PREDICTED: RPM1-interacting protein 4-like [Cucumis sativus]
 gb|KGN51712.1| hypothetical protein Csa_5G591770 [Cucumis sativus]
Length=83

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -3

Query  501  AEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGA  385
            A+K   LPKFGDWDE+NPAA+  F+VIF++AR  K++G 
Sbjct  4    AQKGPFLPKFGDWDEQNPAAAEGFTVIFNRARDNKKNGG  42



>gb|KCW70466.1| hypothetical protein EUGRSUZ_F03683 [Eucalyptus grandis]
Length=75

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGA  385
            M+EK  PLPKFG+WD  +PA++  F+VIF+KAR  K+ G 
Sbjct  1    MSEKGQPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTGG  40



>ref|XP_009606344.1| PREDICTED: RPM1-interacting protein 4-like isoform X2 [Nicotiana 
tomentosiformis]
Length=77

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGA  385
            M+EK  PLPKFG+WD  +PA++  F+VIF+KAR  K+ G 
Sbjct  1    MSEKGRPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTGG  40



>ref|XP_008811272.1| PREDICTED: RPM1-interacting protein 4-like isoform X2 [Phoenix 
dactylifera]
Length=82

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/95 (33%), Positives = 46/95 (48%), Gaps = 21/95 (22%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRK  325
            M++K  PLPKFG+WD  +PA++  F+VIF+KAR  ++ G               DSP ++
Sbjct  1    MSDKGRPLPKFGEWDVNDPASAEGFTVIFNKARDERKTGGSTRGP---------DSPGKE  51

Query  324  DRpnnnsspssNTPAAHFLYLGKSRT-GRKWLCCV  223
            +           T   H  Y  K     +KW CC+
Sbjct  52   E-----------TAFKHGPYATKPNVNAKKWFCCI  75



>ref|XP_004516092.1| PREDICTED: RPM1-interacting protein 4-like isoform X2 [Cicer 
arietinum]
Length=94

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGA  385
            M+EK  PLPKFG+WD  +PA++  F+VIF+KAR  K+ G 
Sbjct  1    MSEKGRPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTGG  40



>dbj|BAK02565.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=118

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/117 (31%), Positives = 57/117 (49%), Gaps = 23/117 (20%)
 Frame = -3

Query  570  TSLFSRLFPFDRIGSESKKIEEMAEKNA-PLPKFGDWDEKNPAASNDFSVIFDKARHAKR  394
            T L  +       GS+ ++ + M+E++  PLPKFG+WD  +PA+++ F+VIF+KAR  K+
Sbjct  17   TKLSPKPLSLPLGGSDRRRAQSMSEESGRPLPKFGEWDVNDPASADGFTVIFNKARDEKK  76

Query  393  DGArppsrttttrRDQLDSPTRKDRpnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
             G               +SP +  R     S           Y  K+ + +KW CCV
Sbjct  77   AG----------NGQDTESPCKDARTERVES-----------YATKANS-KKWFCCV  111



>ref|XP_009793111.1| PREDICTED: RPM1-interacting protein 4-like isoform X2 [Nicotiana 
sylvestris]
Length=77

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGA  385
            M+EK  PLPKFG+WD  +PA++  F+VIF+KAR  K+ G 
Sbjct  1    MSEKGRPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTGG  40



>ref|XP_010539329.1| PREDICTED: RPM1-interacting protein 4-like [Tarenaya hassleriana]
Length=78

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/94 (31%), Positives = 47/94 (50%), Gaps = 23/94 (24%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRK  325
            M++K  PLPKFG+WD  +PA++  F+VIF+KAR  K+ G             + +SP + 
Sbjct  1    MSDKGRPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTGG------------KPESPGKA  48

Query  324  DRpnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
            +  +     + + P             +KWLCC+
Sbjct  49   NETHAKHGAAPSKPPP-----------KKWLCCI  71



>ref|XP_009379453.1| PREDICTED: uncharacterized protein LOC103967858 isoform X2 [Pyrus 
x bretschneideri]
Length=81

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGA  385
            M+EK  PLPKFG+WD  +PA++  F+VIF+KAR  K+ G 
Sbjct  1    MSEKGRPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTGG  40



>ref|XP_002316782.2| hypothetical protein POPTR_0011s09650g [Populus trichocarpa]
 gb|EEE97394.2| hypothetical protein POPTR_0011s09650g [Populus trichocarpa]
Length=122

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -3

Query  525  ESKKIEEMAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGA  385
            ES  +E M++   PLPKFG+WD  +PA++  F+VIF+KAR  K+ G 
Sbjct  38   ESLSLEFMSDTGRPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTGG  84



>gb|KHF99798.1| RPM1-interacting 4 -like protein [Gossypium arboreum]
 gb|KHG14575.1| RPM1-interacting 4 -like protein [Gossypium arboreum]
Length=77

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 46/94 (49%), Gaps = 24/94 (26%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRK  325
            M+EK  PLPKFG+WD  +PA++  F+VIF+KAR  K+ G             + +SP+  
Sbjct  1    MSEKGRPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTGG------------KPESPSGG  48

Query  324  DRpnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
            D      +  S T              +KWLCC+
Sbjct  49   DPHVKPGADPSKT------------QPKKWLCCM  70



>ref|XP_007146651.1| hypothetical protein PHAVU_006G058100g [Phaseolus vulgaris]
 gb|ESW18645.1| hypothetical protein PHAVU_006G058100g [Phaseolus vulgaris]
Length=77

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 51/94 (54%), Gaps = 22/94 (23%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRK  325
            M+EK  PLPKFG+WD  +PA++  F+VIF+KAR  K+ G               +SP + 
Sbjct  1    MSEKGRPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTGG------------NPESPAK-  47

Query  324  DRpnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
                  ++   + PA   +  GK++T +KW CC+
Sbjct  48   -----TAADPHSKPA---VDPGKTQT-KKWFCCM  72



>ref|XP_008239399.1| PREDICTED: uncharacterized protein LOC103338001 isoform X2 [Prunus 
mume]
Length=84

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/92 (33%), Positives = 47/92 (51%), Gaps = 11/92 (12%)
 Frame = -3

Query  501  AEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRKD  322
            ++K  PLPKFG+WD  NPA++  F+VIF+KAR  K+  A            ++ +P + D
Sbjct  3    SDKGRPLPKFGEWDVNNPASAEGFTVIFNKARDEKKTSAAQV---------KMVTPRKTD  53

Query  321  RpnnnsspssNTPAAHFLYLGKSRTGRKWLCC  226
                 +    NT   H+     S+  ++W CC
Sbjct  54   GSLRRNGAGYNTVNEHYPKYPPSK--KRWFCC  83



>ref|XP_004965245.1| PREDICTED: RPM1-interacting protein 4-like [Setaria italica]
Length=80

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/95 (35%), Positives = 49/95 (52%), Gaps = 23/95 (24%)
 Frame = -3

Query  504  MAEKNA-PLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTR  328
            MAE++  PLPKFG+WD  +PA+++ F+VIF+KAR  K+ G             + +SP++
Sbjct  1    MAEESGRPLPKFGEWDVNDPASADGFTVIFNKARDEKKGG----------NGQETESPSK  50

Query  327  KDRpnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
              R     S           Y  K  + +KW CCV
Sbjct  51   DTRTERVES-----------YAAKPNS-KKWFCCV  73



>gb|AFW73220.1| hypothetical protein ZEAMMB73_896291 [Zea mays]
Length=172

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 45/87 (52%), Gaps = 14/87 (16%)
 Frame = -3

Query  483  LPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRKDRpnnns  304
            +PKFG+WD  NPA+++ F+VIF KAR  K+  A+   R  +   D  DS +R ++  +  
Sbjct  93   IPKFGEWDVNNPASADGFTVIFSKARDEKKAPAQGHIRDRSASADSKDSRSRDEKMTS--  150

Query  303  spssNTPAAHFLYLGKSRTGRKWLCCV  223
                        Y  ++   +KW CCV
Sbjct  151  ------------YSSRTNASKKWFCCV  165



>ref|XP_004139992.1| PREDICTED: uncharacterized protein LOC101217194 [Cucumis sativus]
Length=97

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 33/42 (79%), Gaps = 2/42 (5%)
 Frame = -3

Query  504  MAEK--NAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGA  385
            MAEK  ++PLPKFG+WD  +PA++  F+VIF+KAR+ K+ G 
Sbjct  1    MAEKGSSSPLPKFGEWDVNDPASAEGFTVIFNKARNEKKTGG  42



>ref|XP_004516091.1| PREDICTED: RPM1-interacting protein 4-like isoform X1 [Cicer 
arietinum]
Length=104

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGA  385
            M+EK  PLPKFG+WD  +PA++  F+VIF+KAR  K+ G 
Sbjct  1    MSEKGRPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTGG  40



>ref|XP_010926961.1| PREDICTED: RPM1-interacting protein 4-like isoform X2 [Elaeis 
guineensis]
Length=76

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 44/92 (48%), Gaps = 19/92 (21%)
 Frame = -3

Query  501  AEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRKD  322
            +EK  PLPKFGDWD  NPA++  F+VIF+KAR  K+    P            +SP R +
Sbjct  3    SEKGRPLPKFGDWDVNNPASAEGFTVIFNKARDEKKTSGNPGVA---------NSPRRNN  53

Query  321  RpnnnsspssNTPAAHFLYLGKSRTGRKWLCC  226
                        P   + Y  KS   +KW CC
Sbjct  54   -------MGGLKPDETYQYPRKS---KKWFCC  75



>gb|AFK38504.1| unknown [Lotus japonicus]
Length=77

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 49/94 (52%), Gaps = 23/94 (24%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRK  325
            M++K  PLPKFG+WD  +PA++  F+VIF+KAR  K+ G               +SP + 
Sbjct  1    MSDKGRPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTGGS-------------ESPGK-  46

Query  324  DRpnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
                     ++ T +   L  GK ++ +KW CCV
Sbjct  47   --------TATKTQSKPALDPGKPQS-KKWFCCV  71



>ref|XP_004244039.1| PREDICTED: RPM1-interacting protein 4 isoform X2 [Solanum lycopersicum]
Length=77

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 46/94 (49%), Gaps = 24/94 (26%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRK  325
            M+EK  PLPKFG+WD  +PA++  F+VIF+KAR  K+ G             + DSP++ 
Sbjct  1    MSEKGRPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTGG------------KPDSPSKT  48

Query  324  DRpnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
            D                     K +T +KW CC+
Sbjct  49   DGNRKEGEEPL-----------KPQT-KKWFCCM  70



>ref|XP_006852276.1| hypothetical protein AMTR_s00049p00179160 [Amborella trichopoda]
 gb|ERN13743.1| hypothetical protein AMTR_s00049p00179160 [Amborella trichopoda]
Length=96

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -3

Query  498  EKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGA  385
            +K  PLPKFG+WD  NPA++  F+VIF+KAR  K+ G 
Sbjct  13   DKGVPLPKFGEWDVNNPASAEGFTVIFNKARDEKKTGG  50



>ref|XP_008239398.1| PREDICTED: uncharacterized protein LOC103338001 isoform X1 [Prunus 
mume]
Length=85

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/91 (33%), Positives = 46/91 (51%), Gaps = 11/91 (12%)
 Frame = -3

Query  498  EKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRKDR  319
            +K  PLPKFG+WD  NPA++  F+VIF+KAR  K+  A            ++ +P + D 
Sbjct  5    DKGRPLPKFGEWDVNNPASAEGFTVIFNKARDEKKTSAAQV---------KMVTPRKTDG  55

Query  318  pnnnsspssNTPAAHFLYLGKSRTGRKWLCC  226
                +    NT   H+     S+  ++W CC
Sbjct  56   SLRRNGAGYNTVNEHYPKYPPSK--KRWFCC  84



>emb|CDP13707.1| unnamed protein product [Coffea canephora]
Length=77

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGA  385
            M+EK  PLPKFG+WD  +PA++  F+VIF+KAR  K+ G 
Sbjct  1    MSEKGRPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTGG  40



>ref|XP_004516093.1| PREDICTED: RPM1-interacting protein 4-like isoform X3 [Cicer 
arietinum]
Length=79

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGA  385
            M+EK  PLPKFG+WD  +PA++  F+VIF+KAR  K+ G 
Sbjct  1    MSEKGRPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTGG  40



>ref|XP_010942597.1| PREDICTED: uncharacterized protein LOC105060536 isoform X1 [Elaeis 
guineensis]
Length=128

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/117 (31%), Positives = 51/117 (44%), Gaps = 23/117 (20%)
 Frame = -3

Query  564  LFSRLFPFDRIGSESKKIEEMA--EKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRD  391
             F+R  P          +EE    +K  PLPKFG+WD  +PA++  F+VIF+KAR  K+ 
Sbjct  25   FFARPLPLSHPSFPLGFLEEFMSQDKGQPLPKFGEWDVNDPASAEGFTVIFNKARDEKKT  84

Query  390  GArppsrttttrRDQLDSPTRKDRpnnnsspssNTPAAHFLYLGKSRT-GRKWLCCV  223
            G               DSP +++           T   H  Y  K     +KW CC+
Sbjct  85   GGSARGP---------DSPGKEE-----------TAFKHGPYAPKPNVNAKKWFCCI  121



>ref|XP_006346128.1| PREDICTED: RPM1-interacting protein 4-like isoform X2 [Solanum 
tuberosum]
Length=77

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 46/94 (49%), Gaps = 24/94 (26%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRK  325
            M+EK  PLPKFG+WD  +PA++  F+VIF+KAR  K+ G             + DSP++ 
Sbjct  1    MSEKGRPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTGG------------KPDSPSKA  48

Query  324  DRpnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
            D                     K +T +KW CC+
Sbjct  49   DGNRKEGEEPL-----------KPQT-KKWFCCM  70



>gb|AAN46279.1| unknown protein [Arabidopsis thaliana]
 gb|AAN46280.1| unknown protein [Arabidopsis thaliana]
 gb|AAN46281.1| unknown protein [Arabidopsis thaliana]
 gb|AAN46282.1| unknown protein [Arabidopsis thaliana]
 gb|AAN46283.1| unknown protein [Arabidopsis thaliana]
 gb|AAN46284.1| unknown protein [Arabidopsis thaliana]
 gb|AAN46285.1| unknown protein [Arabidopsis thaliana]
 gb|AAN46286.1| unknown protein [Arabidopsis thaliana]
 gb|AAN46287.1| unknown protein [Arabidopsis thaliana]
 gb|AAN46288.1| unknown protein [Arabidopsis thaliana]
 gb|AAN46289.1| unknown protein [Arabidopsis thaliana]
 gb|AAN46290.1| unknown protein [Arabidopsis thaliana]
 gb|AAN46291.1| unknown protein [Arabidopsis lyrata]
 gb|AAN46292.1| unknown protein [Arabidopsis lyrata]
 gb|AAN46293.1| unknown protein [Arabidopsis lyrata]
 gb|AAN46294.1| unknown protein [Arabidopsis lyrata]
 gb|AAN46295.1| unknown protein [Arabidopsis lyrata]
Length=63

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGA  385
            MA+K  PLPKFG+WD  +P+++  F+VIF+KAR+ K+ G 
Sbjct  1    MADKGRPLPKFGEWDVNDPSSAEGFTVIFNKARNEKKGGG  40



>gb|AFK35596.1| unknown [Lotus japonicus]
Length=84

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/94 (29%), Positives = 47/94 (50%), Gaps = 16/94 (17%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRK  325
            MA+   PLPKFG+WD  +PA++  F++IF+KAR+ ++ G    + +           ++K
Sbjct  1    MADSGRPLPKFGEWDVNDPASAEGFTIIFNKARNERKTGTPKAAHSPPNDNQNPKYSSKK  60

Query  324  DRpnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
                              + LGK ++ +KW CC+
Sbjct  61   KNQ---------------VVLGKPQS-KKWFCCI  78



>ref|XP_006656004.1| PREDICTED: uncharacterized protein LOC102719774 [Oryza brachyantha]
Length=80

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/92 (35%), Positives = 45/92 (49%), Gaps = 22/92 (24%)
 Frame = -3

Query  498  EKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRKDR  319
            E   PLPKFG+WD  +PA+++ F+VIF+KAR  K+ G               DSP ++ R
Sbjct  4    EAGRPLPKFGEWDVNDPASADGFTVIFNKARDEKKGG----------NGQDTDSPCKETR  53

Query  318  pnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
                       P     Y  K+ + +KW CCV
Sbjct  54   -----------PERVESYAPKTNS-KKWFCCV  73



>ref|XP_009387828.1| PREDICTED: RPM1-interacting protein 4-like, partial [Musa acuminata 
subsp. malaccensis]
Length=95

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -3

Query  498  EKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGA  385
            EK  PLPKFG+WD  NPA++  F+VIF+KAR  K+ G 
Sbjct  24   EKGQPLPKFGEWDVNNPASAEGFTVIFNKARDEKKTGG  61



>ref|XP_008463015.1| PREDICTED: RPM1-interacting protein 4-like isoform X2 [Cucumis 
melo]
Length=77

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/94 (32%), Positives = 44/94 (47%), Gaps = 24/94 (26%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRK  325
            M +K  PLPKFG+WD  +P ++  F+VIF+KAR  K+ G             + DSP + 
Sbjct  1    MTDKGRPLPKFGEWDVNDPTSAEGFTVIFNKARDEKKTGG------------KPDSPGKV  48

Query  324  DRpnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
            D     +   +  P             +KWLCC+
Sbjct  49   DAHGRTAPDPAKAPP------------KKWLCCI  70



>ref|XP_009379452.1| PREDICTED: uncharacterized protein LOC103967858 isoform X1 [Pyrus 
x bretschneideri]
Length=81

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGA  385
            M EK  PLPKFG+WD  +PA++  F+VIF+KAR  K+ G 
Sbjct  1    MLEKGRPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTGG  40



>ref|XP_010675968.1| PREDICTED: RPM1-interacting protein 4 [Beta vulgaris subsp. vulgaris]
Length=77

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/94 (32%), Positives = 43/94 (46%), Gaps = 24/94 (26%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRK  325
            M +K  PLPKFG+WD  +PA++  F+VIF+KAR  K+ G             + +SP + 
Sbjct  1    MTDKGRPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTGG------------KPESPGKS  48

Query  324  DRpnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
                         P +           +KWLCCV
Sbjct  49   Q------------PTSRSGMEPTKSQPKKWLCCV  70



>ref|XP_007142525.1| hypothetical protein PHAVU_008G288100g, partial [Phaseolus vulgaris]
 gb|ESW14519.1| hypothetical protein PHAVU_008G288100g, partial [Phaseolus vulgaris]
Length=134

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = -3

Query  513  IEEMAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGA  385
            +  MAEK   LPKFG+WD  +P++  DFSVIF+KAR  ++  A
Sbjct  54   LSTMAEKGRTLPKFGEWDVSDPSSGADFSVIFNKARTERKQCA  96



>ref|XP_010929050.1| PREDICTED: RPM1-interacting protein 4 [Elaeis guineensis]
Length=83

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 45/93 (48%), Gaps = 21/93 (23%)
 Frame = -3

Query  498  EKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRKDR  319
            +K  PLPKFG+WD  +PA++  F+VIF+KAR  ++ G              +DSP +++ 
Sbjct  4    DKGRPLPKFGEWDVNDPASAEGFTVIFNKARDERKTGGSTRG---------VDSPGKEE-  53

Query  318  pnnnsspssNTPAAHFLYLGKSRT-GRKWLCCV  223
                      T   H  Y  K     +KW CC+
Sbjct  54   ----------TAFKHGPYATKPNVNAKKWFCCI  76



>ref|XP_004303574.1| PREDICTED: uncharacterized protein LOC101310717 [Fragaria vesca 
subsp. vesca]
Length=126

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGA  385
            MA+K  PLPKFG+WD  +P ++  F+VIF+KAR  K+ G 
Sbjct  1    MADKGVPLPKFGEWDVNDPTSAEGFTVIFNKARTEKKTGG  40



>gb|ACU64879.1| NIP [Oryza punctata]
Length=80

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/92 (35%), Positives = 45/92 (49%), Gaps = 22/92 (24%)
 Frame = -3

Query  498  EKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRKDR  319
            E   PLPKFG+WD  +PA+++ F+VIF+KAR+ K+ G               DSP +  R
Sbjct  4    EAGRPLPKFGEWDVNDPASADGFTVIFNKARNEKKGG----------NGQDTDSPCKDTR  53

Query  318  pnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
                 S           Y  K+ + +KW CCV
Sbjct  54   TERVES-----------YAPKTNS-KKWFCCV  73



>ref|XP_007208788.1| hypothetical protein PRUPE_ppa024175mg [Prunus persica]
 gb|EMJ09987.1| hypothetical protein PRUPE_ppa024175mg [Prunus persica]
Length=81

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/91 (33%), Positives = 45/91 (49%), Gaps = 12/91 (13%)
 Frame = -3

Query  498  EKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRKDR  319
            +K  PLPKFG+WD  NPA++  F+VIF+KAR  K+  A            ++ +P + D 
Sbjct  2    DKGRPLPKFGEWDVNNPASAEGFTVIFNKARDEKKTSAAQV---------KMVTPRKTDG  52

Query  318  pnnnsspssNTPAAHFLYLGKSRTGRKWLCC  226
                +    NT   H+    K    ++W CC
Sbjct  53   SLRRNGTGYNTVNEHYP---KYPPSKRWFCC  80



>dbj|BAD69095.1| putative nitrate-induced NOI protein [Oryza sativa Japonica Group]
 gb|ABC94596.1| nitrate-induced NOI protein-like protein [Oryza sativa Indica 
Group]
 gb|ABE02740.1| nitrate-induced NOI protein-like protein [Oryza sativa Japonica 
Group]
 gb|EEE65540.1| hypothetical protein OsJ_21007 [Oryza sativa Japonica Group]
 gb|ACU64875.1| NIP [Oryza nivara]
Length=80

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/92 (35%), Positives = 45/92 (49%), Gaps = 22/92 (24%)
 Frame = -3

Query  498  EKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRKDR  319
            E   PLPKFG+WD  +PA+++ F+VIF+KAR  K+ G               DSP ++ R
Sbjct  4    EAGRPLPKFGEWDVNDPASADGFTVIFNKARDEKKGG----------NGQDTDSPCKETR  53

Query  318  pnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
                 S           Y  K+ + +KW CCV
Sbjct  54   TERVES-----------YAPKTNS-KKWFCCV  73



>gb|EAZ00558.1| hypothetical protein OsI_22578 [Oryza sativa Indica Group]
Length=103

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 50/99 (51%), Gaps = 24/99 (24%)
 Frame = -3

Query  519  KKIEEMAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLD  340
            + +EE A +  PLPKFG+WD  +PA+++ F+VIF+KAR  K+ G               D
Sbjct  22   QGVEEEAGR--PLPKFGEWDVNDPASADGFTVIFNKARDEKKGG----------NGQDTD  69

Query  339  SPTRKDRpnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
            SP ++ R     S           Y  K+ + +KW CCV
Sbjct  70   SPCKETRTERVES-----------YAPKTNS-KKWFCCV  96



>ref|XP_004295203.1| PREDICTED: RPM1-interacting protein 4-like isoform 1 [Fragaria 
vesca subsp. vesca]
Length=88

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGA  385
            M++K  PLPKFG+WD  +PA++  F+VIF+KAR  K+ G 
Sbjct  1    MSDKGRPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTGG  40



>ref|XP_002864413.1| hypothetical protein ARALYDRAFT_495666 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40672.1| hypothetical protein ARALYDRAFT_495666 [Arabidopsis lyrata subsp. 
lyrata]
Length=102

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGA  385
            M++K  PLPKFG+WD  +PA++  F+VIF+KAR  K+ G 
Sbjct  1    MSDKGRPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTGG  40



>ref|XP_010495907.1| PREDICTED: uncharacterized protein LOC104773057 [Camelina sativa]
Length=98

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGA  385
            M++K  PLPKFG+WD  +PA++  F+VIF+KAR  K+ G 
Sbjct  1    MSDKGRPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTGG  40



>ref|NP_200396.2| protein NOI [Arabidopsis thaliana]
 gb|AED96687.1| RPM1-interacting protein 4 (RIN4) family protein [Arabidopsis 
thaliana]
Length=114

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGA  385
            M++K  PLPKFG+WD  +PA++  F+VIF+KAR  K+ G 
Sbjct  1    MSDKGRPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTGG  40



>ref|XP_009417934.1| PREDICTED: RPM1-interacting protein 4-like [Musa acuminata subsp. 
malaccensis]
Length=76

 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/92 (35%), Positives = 46/92 (50%), Gaps = 19/92 (21%)
 Frame = -3

Query  501  AEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRKD  322
            +E   PLPKFG+WD  NPA++  ++VIF+KAR  K+ G                +PT   
Sbjct  3    SETAQPLPKFGEWDVNNPASAEGYTVIFNKARDEKKTGGNS------------GTPTATP  50

Query  321  RpnnnsspssNTPAAHFLYLGKSRTGRKWLCC  226
            + +     + +T    + Y  KS   RKWLCC
Sbjct  51   KRDVGGLQADDT----YQYPRKS---RKWLCC  75



>ref|XP_008799100.1| PREDICTED: uncharacterized protein LOC103713838 [Phoenix dactylifera]
Length=140

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 45/92 (49%), Gaps = 18/92 (20%)
 Frame = -3

Query  501  AEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRKD  322
            +EK+ PLPKFGDWD  NPA +  FS+IF+KAR  ++  A  P           +SP R +
Sbjct  66   SEKSWPLPKFGDWDVNNPATAEGFSIIFNKARDERKTSAGNPGVA--------NSPRRNN  117

Query  321  RpnnnsspssNTPAAHFLYLGKSRTGRKWLCC  226
                        P   + Y  KS   +KW CC
Sbjct  118  -------MGGLKPDETYQYPRKS---KKWFCC  139



>gb|KHG00197.1| RPM1-interacting 4 -like protein [Gossypium arboreum]
Length=78

 Score = 50.4 bits (119),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 46/92 (50%), Gaps = 24/92 (26%)
 Frame = -3

Query  498  EKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRKDR  319
            EK  PLPKFG+WD  +PA++  F+VIF+KAR  K+ G             + +SP + D 
Sbjct  4    EKGRPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTGG------------KPESPAKSDS  51

Query  318  pnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
                       P A     GK++  +KW CCV
Sbjct  52   NVK--------PGAD---PGKTQP-KKWFCCV  71



>ref|XP_009616559.1| PREDICTED: RPM1-interacting protein 4-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009616560.1| PREDICTED: RPM1-interacting protein 4-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009616561.1| PREDICTED: RPM1-interacting protein 4-like isoform X1 [Nicotiana 
tomentosiformis]
Length=73

 Score = 50.1 bits (118),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 35/95 (37%), Positives = 50/95 (53%), Gaps = 29/95 (31%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLD-SPTR  328
            MAE   PLPKFG+WD  +PA++  FSVIF+KAR+ K+ G             ++D SP +
Sbjct  1    MAE-GRPLPKFGEWDVNDPASAERFSVIFNKARNEKKTG-------------KIDHSPPK  46

Query  327  KDRpnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
            K+               H   LGK ++ +KW CC+
Sbjct  47   KNYK-------------HTATLGKPQS-KKWFCCM  67



>ref|XP_007037860.1| RPM1-interacting protein 4 family protein, putative [Theobroma 
cacao]
 gb|EOY22361.1| RPM1-interacting protein 4 family protein, putative [Theobroma 
cacao]
Length=73

 Score = 50.1 bits (118),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -3

Query  498  EKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKR  394
            E+  PLPKFG+WD  NPA +  F+VIF+KARH K+
Sbjct  4    ERGRPLPKFGEWDVNNPATAEGFTVIFNKARHEKK  38



>gb|KHG20304.1| RPM1-interacting 4 -like protein [Gossypium arboreum]
Length=108

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 39/66 (59%), Gaps = 9/66 (14%)
 Frame = -3

Query  576  NHTSLF--SRLFPFDRIGSESKKIEEMAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARH  403
            N+  LF  S  FP    G+       + ++  PLPKFG+WD  +PA+++ F+VIF+KAR 
Sbjct  13   NNEELFVISWFFPLLEFGT-------IVDQGRPLPKFGEWDVNDPASADGFTVIFNKARD  65

Query  402  AKRDGA  385
             K+ G 
Sbjct  66   EKKTGG  71



>emb|CDY15080.1| BnaC03g44410D [Brassica napus]
Length=105

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 49/94 (52%), Gaps = 24/94 (26%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRK  325
            MA+K  PLPKFG+WD  +P+++  F+VIF+KAR+ K+ G             Q DSP + 
Sbjct  36   MADK--PLPKFGEWDVNDPSSAEGFTVIFNKARNEKKGGG------------QSDSPGKD  81

Query  324  DRpnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
            ++P   +         H L     +  +KW CC+
Sbjct  82   EQPPGFNKN------GHVL----GKPSKKWFCCI  105



>gb|KFK27152.1| hypothetical protein AALP_AA8G341900 [Arabis alpina]
Length=79

 Score = 50.1 bits (118),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGA  385
            M++K  PLPKFG+WD  +PA++  F+VIF+KAR  K+ G 
Sbjct  1    MSDKGRPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTGG  40



>ref|XP_010545279.1| PREDICTED: RPM1-interacting protein 4 isoform X2 [Tarenaya hassleriana]
Length=78

 Score = 50.1 bits (118),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGA  385
            M++K  PLPKFG+WD  +PA++  F+VIF+KAR  K+ G 
Sbjct  1    MSDKGRPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTGG  40



>ref|XP_010443225.1| PREDICTED: uncharacterized protein LOC104726132 [Camelina sativa]
Length=79

 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGA  385
            M++K  PLPKFG+WD  +PA++  F+VIF+KAR  K+ G 
Sbjct  1    MSDKGRPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTGG  40



>emb|CDY06554.1| BnaC02g12780D [Brassica napus]
Length=80

 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGA  385
            M++K  PLPKFG+WD  +PA++  F+VIF+KAR  K+ G 
Sbjct  1    MSDKGRPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTGG  40



>ref|XP_010052923.1| PREDICTED: RPM1-interacting protein 4-like [Eucalyptus grandis]
Length=75

 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -3

Query  498  EKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGA  385
            E+  PLPKFG+WD  +PA++  F+VIF+KAR+ K+ G 
Sbjct  2    ERGQPLPKFGEWDVNDPASAEGFTVIFNKARYEKKTGG  39



>gb|KDO59137.1| hypothetical protein CISIN_1g034970mg [Citrus sinensis]
Length=67

 Score = 49.7 bits (117),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGA  385
            M++K  PLPKFG+WD  +PA++  F+VIF+KAR  K+ G 
Sbjct  1    MSDKGRPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTGG  40



>ref|XP_008349484.1| PREDICTED: uncharacterized protein LOC103412729 isoform X1 [Malus 
domestica]
Length=83

 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGA  385
            + EK  PLPKFG+WD  +PA++  F+VIF+KAR  K+ G 
Sbjct  2    VQEKGRPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTGG  41



>gb|AAB86938.1| NOI protein [Arabidopsis thaliana]
 dbj|BAA97284.1| NOI protein, nitrate-induced [Arabidopsis thaliana]
 gb|AAL38736.1| putative NOI protein, nitrate-induced [Arabidopsis thaliana]
 gb|AAM20305.1| putative nitrate-induced NOI protein [Arabidopsis thaliana]
Length=79

 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGA  385
            M++K  PLPKFG+WD  +PA++  F+VIF+KAR  K+ G 
Sbjct  1    MSDKGRPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTGG  40



>emb|CDY17362.1| BnaA10g09960D [Brassica napus]
Length=81

 Score = 50.1 bits (118),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGA  385
            M++K  PLPKFG+WD  +PA++  F+VIF+KAR  K+ G 
Sbjct  1    MSDKGRPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTGG  40



>ref|XP_009120102.1| PREDICTED: uncharacterized protein LOC103845026 [Brassica rapa]
Length=83

 Score = 50.1 bits (118),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGA  385
            M++K  PLPKFG+WD  +PA++  F+VIF+KAR  K+ G 
Sbjct  1    MSDKGRPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTGG  40



>ref|XP_009126980.1| PREDICTED: RPM1-interacting protein 4-like [Brassica rapa]
Length=80

 Score = 49.7 bits (117),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGA  385
            M++K  PLPKFG+WD  +PA++  F+VIF+KAR  K+ G 
Sbjct  1    MSDKGRPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTGG  40



>ref|XP_010088435.1| Transmembrane emp24 domain-containing protein [Morus notabilis]
 gb|EXB36050.1| Transmembrane emp24 domain-containing protein [Morus notabilis]
Length=292

 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGA  385
            M+EK  PLPKFG+WD  +PA++  F+VIF+KAR  K+ G 
Sbjct  1    MSEKGRPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTGG  40



>emb|CBI39753.3| unnamed protein product [Vitis vinifera]
Length=77

 Score = 49.7 bits (117),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGA  385
            M++   PLPKFG+WD  +PA++  F+VIF+KAR  KR G 
Sbjct  1    MSDNGRPLPKFGEWDVNDPASAEGFTVIFNKARDEKRTGG  40



>ref|XP_009132351.1| PREDICTED: uncharacterized protein LOC103856963 [Brassica rapa]
 emb|CDY36767.1| BnaA03g11190D [Brassica napus]
 emb|CDY20745.1| BnaA02g08850D [Brassica napus]
 emb|CDY11975.1| BnaC03g14010D [Brassica napus]
Length=81

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGA  385
            M++K  PLPKFG+WD  +PA++  F+VIF+KAR  K+ G 
Sbjct  1    MSDKGRPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTGG  40



>ref|XP_007207400.1| hypothetical protein PRUPE_ppa014254mg [Prunus persica]
 gb|EMJ08599.1| hypothetical protein PRUPE_ppa014254mg [Prunus persica]
Length=78

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/92 (33%), Positives = 45/92 (49%), Gaps = 24/92 (26%)
 Frame = -3

Query  498  EKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRKDR  319
            EK  PLPKFG+WD  +PA++  F+VIF+KAR  K+ G             + +SP + D 
Sbjct  4    EKGRPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTGG------------KPESPGKADP  51

Query  318  pnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
                          H +  G+  + +KW CC+
Sbjct  52   NIR-----------HGVEPGRPPS-KKWFCCI  71



>gb|ACU64883.1| NIP [Oryza minuta]
 gb|ACU64890.1| NIP [Oryza officinalis]
Length=80

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/92 (35%), Positives = 44/92 (48%), Gaps = 22/92 (24%)
 Frame = -3

Query  498  EKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRKDR  319
            E   PLPKFG+WD  +PA+++ F+VIF+KAR  K+ G               DSP +  R
Sbjct  4    EAGRPLPKFGEWDVNDPASADGFTVIFNKARDEKKGG----------NGQDTDSPCKDTR  53

Query  318  pnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
                 S           Y  K+ + +KW CCV
Sbjct  54   TERVES-----------YAPKTNS-KKWFCCV  73



>ref|XP_009624026.1| PREDICTED: RPM1-interacting protein 4-like isoform X1 [Nicotiana 
tomentosiformis]
Length=78

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -3

Query  498  EKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGA  385
            EK  PLPKFG+WD  +PA++  F+VIF+KAR+ K+ G 
Sbjct  4    EKGQPLPKFGEWDVNDPASAEGFTVIFNKARNEKKTGG  41



>ref|XP_004251536.2| PREDICTED: uncharacterized protein LOC101254273 [Solanum lycopersicum]
Length=550

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/92 (34%), Positives = 45/92 (49%), Gaps = 26/92 (28%)
 Frame = -3

Query  498  EKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRKDR  319
            E   PLPKFG+WD  +PA +  F+VIF+KAR+ KR G             + D+P + + 
Sbjct  479  EAGRPLPKFGEWDVNDPATAEGFTVIFNKARNEKRSGG------------KADAPPKSNH  526

Query  318  pnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
                          H   LGK ++ +KW CC+
Sbjct  527  K-------------HTATLGKPQS-KKWFCCM  544



>ref|XP_009333887.1| PREDICTED: uncharacterized protein LOC103926742 [Pyrus x bretschneideri]
Length=85

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/91 (33%), Positives = 44/91 (48%), Gaps = 11/91 (12%)
 Frame = -3

Query  498  EKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRKDR  319
            +K  PLPKFG+WD  NPA++  F+VIF+KAR  K+  A            ++ +P + D 
Sbjct  5    DKGRPLPKFGEWDVNNPASAEGFTVIFNKARDDKKTSAAQV---------KIVTPRKNDG  55

Query  318  pnnnsspssNTPAAHFLYLGKSRTGRKWLCC  226
                +    NT   H+      +   KW CC
Sbjct  56   STRRNGAGYNTVNEHYPKYPPPKN--KWFCC  84



>ref|XP_008352009.1| PREDICTED: uncharacterized protein LOC103415455 [Malus domestica]
Length=85

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/91 (33%), Positives = 44/91 (48%), Gaps = 11/91 (12%)
 Frame = -3

Query  498  EKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRKDR  319
            +K  PLPKFG+WD  NPA++  F+VIF+KAR  K+  A            ++ +P + D 
Sbjct  5    DKGRPLPKFGEWDVNNPASAEGFTVIFNKARDDKKTSAAQV---------KIVTPRKNDG  55

Query  318  pnnnsspssNTPAAHFLYLGKSRTGRKWLCC  226
                +    NT   H+      +   KW CC
Sbjct  56   STRRNGAGYNTVNEHYPKYPPPKN--KWFCC  84



>gb|EYU34771.1| hypothetical protein MIMGU_mgv1a017463mg [Erythranthe guttata]
Length=73

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -3

Query  498  EKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGA  385
            EK  PLPKFG+WD  NPA+++ F+VIF KAR  K  G+
Sbjct  5    EKGRPLPKFGEWDVNNPASADGFTVIFAKARDEKNSGS  42



>ref|XP_008811271.1| PREDICTED: RPM1-interacting protein 4-like isoform X1 [Phoenix 
dactylifera]
Length=83

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 44/93 (47%), Gaps = 21/93 (23%)
 Frame = -3

Query  498  EKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRKDR  319
            +K  PLPKFG+WD  +PA++  F+VIF+KAR  ++ G               DSP +++ 
Sbjct  4    DKGRPLPKFGEWDVNDPASAEGFTVIFNKARDERKTGGSTRGP---------DSPGKEE-  53

Query  318  pnnnsspssNTPAAHFLYLGKSRT-GRKWLCCV  223
                      T   H  Y  K     +KW CC+
Sbjct  54   ----------TAFKHGPYATKPNVNAKKWFCCI  76



>gb|EYU34772.1| hypothetical protein MIMGU_mgv1a017463mg [Erythranthe guttata]
Length=72

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -3

Query  498  EKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGA  385
            EK  PLPKFG+WD  NPA+++ F+VIF KAR  K  G+
Sbjct  4    EKGRPLPKFGEWDVNNPASADGFTVIFAKARDEKNSGS  41



>ref|XP_006281872.1| hypothetical protein CARUB_v10028069mg, partial [Capsella rubella]
 gb|EOA14770.1| hypothetical protein CARUB_v10028069mg, partial [Capsella rubella]
Length=101

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = -3

Query  513  IEEMAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGA  385
            + E  +K  PLPKFG+WD  +PA++  F+VIF+KAR  K+ G 
Sbjct  4    LYEQQDKGRPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTGG  46



>ref|XP_003563945.1| PREDICTED: uncharacterized protein LOC100826114 [Brachypodium 
distachyon]
Length=80

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/92 (34%), Positives = 44/92 (48%), Gaps = 22/92 (24%)
 Frame = -3

Query  498  EKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRKDR  319
            E   PLPKFG+WD  +PA+++ F+VIF+KAR  K+ G               +SP +  R
Sbjct  4    ESGRPLPKFGEWDVNDPASADGFTVIFNKARDEKKAG----------NGQDTESPCKDTR  53

Query  318  pnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
                 S           Y  K+ + +KW CCV
Sbjct  54   TERVES-----------YAAKTNS-KKWFCCV  73



>gb|EYU40206.1| hypothetical protein MIMGU_mgv1a020512mg, partial [Erythranthe 
guttata]
Length=80

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 42/90 (47%), Gaps = 19/90 (21%)
 Frame = -3

Query  495  KNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRKDRp  316
            +N  LPKFG WD  NPAA+  +S+IFD+A + KR               Q DSP   +  
Sbjct  2    ENVALPKFGSWDVNNPAAAGKYSMIFDRAMNEKRSNG------------QRDSPRSSNDN  49

Query  315  nnnsspssNTPAAHFLYLGKSRTGRKWLCC  226
             + +    ++         K  T R+WLCC
Sbjct  50   MSVTKHEDHSSR-------KPSTSRRWLCC  72



>ref|XP_010044515.1| PREDICTED: RPM1-interacting protein 4-like [Eucalyptus grandis]
Length=75

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -3

Query  498  EKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGA  385
            E+  PLPKFG+WD  +PA++  F+VIF+KAR  K+ G 
Sbjct  5    EEGRPLPKFGEWDVNDPASAEGFTVIFNKAREEKKGGG  42



>emb|CDY66246.1| BnaA03g57910D [Brassica napus]
Length=178

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/98 (33%), Positives = 47/98 (48%), Gaps = 23/98 (23%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRK  325
            + +K  PLPKFG+WD  +P+++  F+VIF+KAR+ K+ G               DSP RK
Sbjct  102  VIDKGRPLPKFGEWDVNDPSSAEGFTVIFNKARNEKKGGGVS------------DSP-RK  148

Query  324  DRpnnnsspssNTPAAHFLYLGKSRTGRKWLCCVGRRR  211
            D     +         H L     +  +KW CC+   R
Sbjct  149  DEHAGFNKN------GHVL----GKPTKKWFCCIKSTR  176



>ref|XP_009396103.1| PREDICTED: RPM1-interacting protein 4-like [Musa acuminata subsp. 
malaccensis]
Length=80

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/92 (33%), Positives = 43/92 (47%), Gaps = 21/92 (23%)
 Frame = -3

Query  498  EKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRKDR  319
            +K  PLPKFG+WD  +PA++  F+VIF+KAR  ++ G             + DSP +   
Sbjct  4    DKGRPLPKFGEWDVNDPASAEGFTVIFNKARDERKTGGNSR---------ETDSPGK---  51

Query  318  pnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
                      T   H  Y  K    +KW CC+
Sbjct  52   --------GGTAFKHGPYASKPNA-KKWFCCM  74



>ref|XP_009787782.1| PREDICTED: RPM1-interacting protein 4-like [Nicotiana sylvestris]
Length=73

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/95 (36%), Positives = 49/95 (52%), Gaps = 29/95 (31%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLD-SPTR  328
            MAE   PLPKFG+WD  +PA++  FSVIF+KAR+ K+ G             ++D SP +
Sbjct  1    MAE-GRPLPKFGEWDVNDPASAERFSVIFNKARNEKKTG-------------KIDHSPPK  46

Query  327  KDRpnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
            K+               H    GK ++ +KW CC+
Sbjct  47   KNYK-------------HTATFGKPQS-KKWFCCM  67



>ref|XP_009384192.1| PREDICTED: RPM1-interacting protein 4-like [Musa acuminata subsp. 
malaccensis]
Length=78

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -3

Query  498  EKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKR  394
            EK  PLPKFG+WD  NPA++  F+VIF+KAR  K+
Sbjct  5    EKGRPLPKFGEWDVNNPASAEGFTVIFNKARDEKK  39



>ref|XP_002298875.2| hypothetical protein POPTR_0001s37750g, partial [Populus trichocarpa]
 gb|EEE83680.2| hypothetical protein POPTR_0001s37750g, partial [Populus trichocarpa]
Length=81

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGA  385
            M++   PLPKFG+WD  +PA++  F+VIF+KAR  K+ G 
Sbjct  1    MSDTGRPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTGG  40



>gb|AFK47855.1| unknown [Medicago truncatula]
Length=79

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGA  385
            M++   PLPKFG+WD  +PA++  F+VIF+KAR+ K+ G 
Sbjct  1    MSDNGRPLPKFGEWDVNDPASAEGFTVIFNKARNEKKTGG  40



>ref|XP_008783031.1| PREDICTED: RPM1-interacting protein 4 isoform X2 [Phoenix dactylifera]
Length=82

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGA  385
            M++K  PLPKFG+WD  +PA++  F+VIF+KAR  ++ G 
Sbjct  1    MSDKGRPLPKFGEWDVNDPASAEGFTVIFNKARDERKTGG  40



>ref|XP_010088434.1| RPM1-interacting protein 4 [Morus notabilis]
 gb|EXB36049.1| RPM1-interacting protein 4 [Morus notabilis]
Length=266

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -3

Query  501  AEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGA  385
             EK  PLPKFGDWD  +PA++  F+VIF+KAR  K+ G 
Sbjct  19   GEKGRPLPKFGDWDVNDPASAEGFTVIFNKARDEKKTGG  57



>gb|KHN23838.1| RPM1-interacting protein 4 [Glycine soja]
Length=73

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGA  385
            M++   PLPKFG+WD  +PA++  ++VIF+KAR+ K+ G 
Sbjct  1    MSDTGRPLPKFGEWDVNDPASAEGYTVIFNKARNEKKTGG  40



>ref|XP_002322218.2| hypothetical protein POPTR_0015s10070g, partial [Populus trichocarpa]
 gb|EEF06345.2| hypothetical protein POPTR_0015s10070g, partial [Populus trichocarpa]
Length=136

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKR  394
            MA +  PLPKFG+WD  NPA++  F+VIF+KAR  K+
Sbjct  61   MASQGRPLPKFGEWDVNNPASAEGFTVIFNKARDEKK  97



>ref|XP_010324248.1| PREDICTED: RPM1-interacting protein 4 isoform X1 [Solanum lycopersicum]
Length=78

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/92 (34%), Positives = 44/92 (48%), Gaps = 24/92 (26%)
 Frame = -3

Query  498  EKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRKDR  319
            EK  PLPKFG+WD  +PA++  F+VIF+KAR  K+ G             + DSP++ D 
Sbjct  4    EKGRPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTGG------------KPDSPSKTDG  51

Query  318  pnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
                                K +T +KW CC+
Sbjct  52   NRKEGEEPL-----------KPQT-KKWFCCM  71



>gb|KCW49179.1| hypothetical protein EUGRSUZ_K02761 [Eucalyptus grandis]
Length=123

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/87 (36%), Positives = 41/87 (47%), Gaps = 15/87 (17%)
 Frame = -3

Query  486  PLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRKDRpnnn  307
            PLPKFG+WD  NPA++  F+VIF+KAR  K+      +  +  R     SP R +   N 
Sbjct  51   PLPKFGEWDVNNPASAEGFTVIFNKARDEKKTSGTTANMMSPRRN---VSPRRNNSTYNK  107

Query  306  sspssNTPAAHFLYLGKSRTGRKWLCC  226
                  +P             RKWLCC
Sbjct  108  KEKRQQSPK------------RKWLCC  122



>gb|ABK93375.1| unknown [Populus trichocarpa]
Length=76

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGA  385
            M++   PLPKFG+WD  +PA++  F+VIF+KAR  K+ G 
Sbjct  1    MSDTGRPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTGG  40



>ref|XP_011038812.1| PREDICTED: uncharacterized protein LOC105135584 isoform X4 [Populus 
euphratica]
Length=78

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/94 (30%), Positives = 42/94 (45%), Gaps = 23/94 (24%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRK  325
            M++   PLPKFG+WD  +PA++  F+VIF+KAR  K+ G                 P   
Sbjct  1    MSDTGRPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTGG---------------KPESP  45

Query  324  DRpnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
             +  ++       PA H          +KW CC+
Sbjct  46   GKAGDSHVKPGVNPAKH--------QPKKWFCCI  71



>gb|AFK36295.1| unknown [Lotus japonicus]
Length=94

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/88 (30%), Positives = 43/88 (49%), Gaps = 16/88 (18%)
 Frame = -3

Query  486  PLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRKDRpnnn  307
            PLPKFG+WD  +PA++  F+VIF+KAR+ ++ G    +             ++K      
Sbjct  17   PLPKFGEWDVNDPASAEGFTVIFNKARNERKTGTPKAAHPPPNDNQNPKYSSKKKNQ---  73

Query  306  sspssNTPAAHFLYLGKSRTGRKWLCCV  223
                        + LGK ++ +KW CC+
Sbjct  74   ------------VVLGKPQS-KKWFCCI  88



>ref|XP_009616562.1| PREDICTED: uncharacterized protein LOC104109070 isoform X2 [Nicotiana 
tomentosiformis]
Length=66

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 30/39 (77%), Gaps = 1/39 (3%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDG  388
            MAE   PLPKFG+WD  +PA++  FSVIF+KAR+ K+ G
Sbjct  1    MAE-GRPLPKFGEWDVNDPASAERFSVIFNKARNEKKTG  38



>ref|XP_006346127.1| PREDICTED: RPM1-interacting protein 4-like isoform X1 [Solanum 
tuberosum]
Length=78

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/92 (34%), Positives = 44/92 (48%), Gaps = 24/92 (26%)
 Frame = -3

Query  498  EKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRKDR  319
            EK  PLPKFG+WD  +PA++  F+VIF+KAR  K+ G             + DSP++ D 
Sbjct  4    EKGRPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTGG------------KPDSPSKADG  51

Query  318  pnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
                                K +T +KW CC+
Sbjct  52   NRKEGEEPL-----------KPQT-KKWFCCM  71



>ref|XP_002277247.1| PREDICTED: RPM1-interacting protein 4 [Vitis vinifera]
 emb|CBI14882.3| unnamed protein product [Vitis vinifera]
Length=74

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 38/87 (44%), Gaps = 22/87 (25%)
 Frame = -3

Query  486  PLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRKDRpnnn  307
            PLPKFG+WD  NPA++  F+VIF+KAR  K+  A             + SP R       
Sbjct  9    PLPKFGEWDVNNPASAEGFTVIFNKARDEKKTNA----------AGNVASPRRNGNGYKQ  58

Query  306  sspssNTPAAHFLYLGKSRTGRKWLCC  226
            +     +P             RKW CC
Sbjct  59   NEDYHYSPK------------RKWFCC  73



>ref|XP_009359537.1| PREDICTED: uncharacterized protein LOC103950113 [Pyrus x bretschneideri]
Length=85

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -3

Query  498  EKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGA  385
            +K+ PLPKFG+WD  NPA++  F+VIF+KAR  K+  A
Sbjct  6    DKSRPLPKFGEWDVNNPASAEGFTVIFNKARDEKKTSA  43



>ref|XP_002964475.1| hypothetical protein SELMODRAFT_81777, partial [Selaginella moellendorffii]
 gb|EFJ34808.1| hypothetical protein SELMODRAFT_81777, partial [Selaginella moellendorffii]
Length=93

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 47/89 (53%), Gaps = 2/89 (2%)
 Frame = -3

Query  486  PLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRKDRpnnn  307
            PLPKFG WD K+P++++ F++IF+KAR  KR G+     +      +L      DR ++N
Sbjct  3    PLPKFGAWDPKDPSSADGFTIIFNKARDEKRAGSGGRPASPVKNDSELYK-NNPDRSSSN  61

Query  306  sspssNTPAAHFLYLGKSRTGRKWLCCVG  220
               SS  P    +   +    +KW CC G
Sbjct  62   VMQSSLFPLPSRI-ADRVLMQKKWYCCFG  89



>ref|XP_003545095.1| PREDICTED: RPM1-interacting protein 4-like [Glycine max]
Length=78

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/95 (32%), Positives = 47/95 (49%), Gaps = 25/95 (26%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRK  325
            M++   PLPKFG+WD  +PA++  ++VIF+KAR+ K+ G             + DSP + 
Sbjct  1    MSDTGRPLPKFGEWDVNDPASAEGYTVIFNKARNEKKTGG------------KPDSPAKV  48

Query  324  DRpnnnsspssNTPAAHFLYLGKSRT-GRKWLCCV  223
            + P                 L  S+T  +KW CC+
Sbjct  49   NNPRTRPP------------LDPSKTQSKKWFCCI  71



>ref|XP_011044920.1| PREDICTED: uncharacterized protein LOC105139967 [Populus euphratica]
Length=78

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGA  385
            M++   PLPKFG+WD  +PA++  F+VIF+KAR  K+ G 
Sbjct  1    MSDTGRPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTGG  40



>gb|KHN05307.1| hypothetical protein glysoja_048999, partial [Glycine soja]
Length=56

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/34 (56%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -3

Query  486  PLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGA  385
            PLPKFG+WD  +PA++ +F+VIF+KAR  K+ G 
Sbjct  9    PLPKFGEWDVNDPASTEEFTVIFNKARDEKKTGG  42



>ref|XP_002448552.1| hypothetical protein SORBIDRAFT_06g028920 [Sorghum bicolor]
 gb|EES12880.1| hypothetical protein SORBIDRAFT_06g028920 [Sorghum bicolor]
Length=95

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = -3

Query  486  PLPKFGDWDEKNPAASNDFSVIFDKARHAKR  394
            PLPKFG+WD KNPA S  F+VIF KAR  K+
Sbjct  11   PLPKFGEWDVKNPATSEGFTVIFQKARDGKK  41



>ref|XP_006857767.1| hypothetical protein AMTR_s00061p00201580 [Amborella trichopoda]
 gb|ERN19234.1| hypothetical protein AMTR_s00061p00201580 [Amborella trichopoda]
Length=78

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGA  385
            M +K  PLPKFG+W+  +PA++  F+VIF+KAR  K+ G 
Sbjct  1    MTDKGGPLPKFGEWNVNDPASAERFTVIFNKARDEKKTGG  40



>ref|XP_003518553.1| PREDICTED: RPM1-interacting protein 4-like [Glycine max]
Length=79

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGA  385
            M++   PLPKFG+WD  +PA++  ++VIF+KAR+ K+ G 
Sbjct  1    MSDTGRPLPKFGEWDVNDPASAEGYTVIFNKARNDKKTGG  40



>ref|XP_008463014.1| PREDICTED: RPM1-interacting protein 4-like isoform X1 [Cucumis 
melo]
Length=88

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGA  385
            M +K  PLPKFG+WD  +P ++  F+VIF+KAR  K+ G 
Sbjct  1    MTDKGRPLPKFGEWDVNDPTSAEGFTVIFNKARDEKKTGG  40



>dbj|BAJ85220.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMS60745.1| hypothetical protein TRIUR3_29061 [Triticum urartu]
Length=80

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/92 (34%), Positives = 44/92 (48%), Gaps = 22/92 (24%)
 Frame = -3

Query  498  EKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRKDR  319
            E   PLPKFG+WD  +PA+++ F+VIF+KAR  K+ G               +SP +  R
Sbjct  4    ESGRPLPKFGEWDVNDPASADGFTVIFNKARDEKKAG----------NGQDTESPCKDAR  53

Query  318  pnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
                 S           Y  K+ + +KW CCV
Sbjct  54   TERVES-----------YATKANS-KKWFCCV  73



>gb|KGN44037.1| hypothetical protein Csa_7G127370 [Cucumis sativus]
Length=114

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGA  385
            M +K  PLPKFG+WD  +P ++  F+VIF+KAR  K+ G 
Sbjct  1    MTDKGRPLPKFGEWDVNDPTSAEGFTVIFNKARDEKKTGG  40



>ref|XP_008392866.1| PREDICTED: uncharacterized protein LOC103455049 [Malus domestica]
Length=84

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -3

Query  498  EKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGA  385
            +K  PLPKFG+WD  NPA++  F+VIF+KAR  K+  A
Sbjct  5    DKGRPLPKFGEWDVNNPASAEGFTVIFNKARDEKKTSA  42



>gb|KHG24788.1| RPM1-interacting 4 -like protein [Gossypium arboreum]
Length=78

 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/92 (33%), Positives = 43/92 (47%), Gaps = 24/92 (26%)
 Frame = -3

Query  498  EKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRKDR  319
            +K  PLPKFG+WD  +PA++  F+VIF+KAR  K+ G             + +SP + D 
Sbjct  4    DKGRPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTGG------------KPESPAKADA  51

Query  318  pnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
             +      S                +KWLCCV
Sbjct  52   HSKPGPDPSKP------------QSKKWLCCV  71



>ref|XP_004491519.1| PREDICTED: RPM1-interacting protein 4-like [Cicer arietinum]
Length=78

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/92 (32%), Positives = 46/92 (50%), Gaps = 24/92 (26%)
 Frame = -3

Query  498  EKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRKDR  319
            E   PLPKFG+WD  +PA++  ++VIF+KAR  K+ G             + +SP + + 
Sbjct  4    ENGRPLPKFGEWDVNDPASAEGYTVIFNKARDEKKTGG------------KPESPAKANH  51

Query  318  pnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
                       PA H    GK+++ + W CC+
Sbjct  52   QTKP-------PADH----GKTQS-KSWFCCI  71



>ref|XP_010250904.1| PREDICTED: RPM1-interacting protein 4-like [Nelumbo nucifera]
Length=75

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -3

Query  498  EKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGA  385
            +K  PLPKFG+WD  NPA++  F+VIF+KAR  K+  A
Sbjct  5    DKGRPLPKFGEWDVNNPASAEGFTVIFNKARDEKKSSA  42



>ref|NP_001154782.1| protein NOI [Arabidopsis thaliana]
 gb|AED96688.1| RPM1-interacting protein 4 (RIN4) family protein [Arabidopsis 
thaliana]
Length=130

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 33/56 (59%), Gaps = 11/56 (20%)
 Frame = -3

Query  552  LFPFDRIGSESKKIEEMAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGA  385
            +FPFD             +K  PLPKFG+WD  +PA++  F+VIF+KAR  K+ G 
Sbjct  12   MFPFD-----------WRDKGRPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTGG  56



>gb|KHN34382.1| RPM1-interacting protein 4 [Glycine soja]
Length=72

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 43/91 (47%), Gaps = 24/91 (26%)
 Frame = -3

Query  498  EKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRKDR  319
            E   PLPKFG+WD  NPA++  F+VIF+KAR  K+                  +P R D 
Sbjct  5    ENGRPLPKFGEWDVNNPASAEGFTVIFNKARDEKKTNTA--------------TPRRSD-  49

Query  318  pnnnsspssNTPAAHFLYLGKSRTGRKWLCC  226
                 + + NTP     Y GK    RKW CC
Sbjct  50   -PVFKNENYNTPQ----YSGK----RKWFCC  71



>ref|XP_010519526.1| PREDICTED: RPM1-interacting protein 4-like isoform X1 [Tarenaya 
hassleriana]
Length=80

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 47/90 (52%), Gaps = 16/90 (18%)
 Frame = -3

Query  498  EKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRKDR  319
            +K  PLPKFG+WD  NPA++  F+VIF+KAR  K+      ++ T+     L SP R + 
Sbjct  5    DKGRPLPKFGEWDVSNPASAEGFTVIFNKARDEKK------TKKTSVAGPDLVSPPRNE-  57

Query  318  pnnnsspssNTPAAHFLYLGKSRTGRKWLC  229
                       PA H      S++ +KWLC
Sbjct  58   --------DPNPAQHHGSHN-SKSKKKWLC  78



>ref|XP_010519527.1| PREDICTED: RPM1-interacting protein 4-like isoform X2 [Tarenaya 
hassleriana]
Length=79

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 47/91 (52%), Gaps = 16/91 (18%)
 Frame = -3

Query  501  AEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRKD  322
             +K  PLPKFG+WD  NPA++  F+VIF+KAR  K+      ++ T+     L SP R +
Sbjct  3    TDKGRPLPKFGEWDVSNPASAEGFTVIFNKARDEKK------TKKTSVAGPDLVSPPRNE  56

Query  321  RpnnnsspssNTPAAHFLYLGKSRTGRKWLC  229
                        PA H      S++ +KWLC
Sbjct  57   ---------DPNPAQHHGSHN-SKSKKKWLC  77



>ref|XP_009405358.1| PREDICTED: RPM1-interacting protein 4-like [Musa acuminata subsp. 
malaccensis]
Length=78

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 40/91 (44%), Gaps = 18/91 (20%)
 Frame = -3

Query  498  EKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRKDR  319
            EK  PLPKFG+WD  NPA++  F+VIF+KAR  ++                  SP R D 
Sbjct  5    EKGRPLPKFGEWDVNNPASAEGFTVIFNKARDERKTPIVNSGAPA--------SPRRND-  55

Query  318  pnnnsspssNTPAAHFLYLGKSRTGRKWLCC  226
                       P   + Y  KS    KW CC
Sbjct  56   ------VGGLNPDPTYQYPRKS---SKWFCC  77



>ref|XP_007044937.1| Uncharacterized protein TCM_010689 [Theobroma cacao]
 gb|EOY00769.1| Uncharacterized protein TCM_010689 [Theobroma cacao]
Length=104

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 33/59 (56%), Gaps = 0/59 (0%)
 Frame = -3

Query  495  KNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRKDR  319
            K  PLPKFG+WD  NPA++  F+ IF+ AR  KR G      TT   + Q  +   K+R
Sbjct  31   KGQPLPKFGEWDVNNPASAEGFTAIFNIARDEKRTGGNVTVLTTDGVKSQHKNGAHKER  89



>ref|XP_011038810.1| PREDICTED: uncharacterized protein LOC105135584 isoform X2 [Populus 
euphratica]
Length=84

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 28/94 (30%), Positives = 41/94 (44%), Gaps = 23/94 (24%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRK  325
            M +   PLPKFG+WD  +PA++  F+VIF+KAR  K+ G                 P   
Sbjct  7    MQDTGRPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTGG---------------KPESP  51

Query  324  DRpnnnsspssNTPAAHFLYLGKSRTGRKWLCCV  223
             +  ++       PA H          +KW CC+
Sbjct  52   GKAGDSHVKPGVNPAKH--------QPKKWFCCI  77



>gb|ACJ83273.1| unknown [Medicago truncatula]
 gb|AFK38484.1| unknown [Medicago truncatula]
Length=94

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGA  385
            M++   PLPKFG+W   +PA++  F+VIF+KAR+ K+ G 
Sbjct  1    MSDNGRPLPKFGEWGVNDPASAEGFTVIFNKARNEKKTGG  40



>ref|XP_010942598.1| PREDICTED: uncharacterized protein LOC105060536 isoform X2 [Elaeis 
guineensis]
Length=99

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -3

Query  498  EKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGA  385
            +K  PLPKFG+WD  +PA++  F+VIF+KAR  K+ G 
Sbjct  19   DKGQPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTGG  56



>gb|EYU44829.1| hypothetical protein MIMGU_mgv1a017518mg [Erythranthe guttata]
Length=70

 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -3

Query  498  EKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKR  394
            EK  PLPKFG+WD  NPA+++ F+VIF KAR  K+
Sbjct  5    EKGRPLPKFGEWDVNNPASADGFTVIFAKARDEKK  39



>ref|NP_001190552.1| protein NOI [Arabidopsis thaliana]
 gb|AED96689.1| RPM1-interacting protein 4 (RIN4) family protein [Arabidopsis 
thaliana]
Length=95

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 33/56 (59%), Gaps = 11/56 (20%)
 Frame = -3

Query  552  LFPFDRIGSESKKIEEMAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGA  385
            +FPFD             +K  PLPKFG+WD  +PA++  F+VIF+KAR  K+ G 
Sbjct  12   MFPFD-----------WRDKGRPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTGG  56



>ref|XP_006401406.1| hypothetical protein EUTSA_v10015980mg, partial [Eutrema salsugineum]
 gb|ESQ42859.1| hypothetical protein EUTSA_v10015980mg, partial [Eutrema salsugineum]
Length=101

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -3

Query  498  EKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGA  385
            +K  PLPKFG+WD  +PA++  F+VIF+KAR  K+ G 
Sbjct  1    DKGRPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTGG  38



>ref|XP_011098793.1| PREDICTED: RPM1-interacting protein 4 [Sesamum indicum]
Length=75

 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -3

Query  498  EKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKR  394
            EK  PLPKFG+WD  NPA+++ F+VIF KAR  K+
Sbjct  5    EKGRPLPKFGEWDVNNPASADGFTVIFAKARDEKK  39



>gb|EMT04021.1| hypothetical protein F775_29299 [Aegilops tauschii]
Length=82

 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDG  388
            + E   PLPKFG+WD  +PA+++ F+VIF+KAR  K+ G
Sbjct  3    VEESGRPLPKFGEWDVNDPASADGFTVIFNKARDEKKAG  41



>ref|XP_009137048.1| PREDICTED: uncharacterized protein LOC103861092 [Brassica rapa]
Length=176

 Score = 48.9 bits (115),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 33/98 (34%), Positives = 48/98 (49%), Gaps = 23/98 (23%)
 Frame = -3

Query  504  MAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRK  325
            + +K  PLPKFG+WD  +P+++  F+VIF+KAR+ K+ G               DSP RK
Sbjct  100  VIDKGRPLPKFGEWDVNDPSSAEGFTVIFNKARNEKKGGGVS------------DSP-RK  146

Query  324  DRpnnnsspssNTPAAHFLYLGKSRTGRKWLCCVGRRR  211
            D P   +         +    GK    +KW CC+   R
Sbjct  147  DEPPGFNK--------NGYVFGKPT--KKWFCCIKSTR  174



>ref|XP_010545278.1| PREDICTED: RPM1-interacting protein 4 isoform X1 [Tarenaya hassleriana]
Length=79

 Score = 47.0 bits (110),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -3

Query  498  EKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGA  385
            +K  PLPKFG+WD  +PA++  F+VIF+KAR  K+ G 
Sbjct  4    DKGRPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTGG  41



>ref|XP_004231820.1| PREDICTED: RPM1-interacting protein 4 [Solanum lycopersicum]
 ref|XP_006338644.1| PREDICTED: RPM1-interacting protein 4-like [Solanum tuberosum]
Length=74

 Score = 47.0 bits (110),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -3

Query  498  EKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKR  394
            EK  PLPKFG+WD  NPA+++ F+VIF KAR  K+
Sbjct  5    EKGRPLPKFGEWDVNNPASADGFTVIFAKARDDKK  39



>ref|XP_010111655.1| hypothetical protein L484_017683 [Morus notabilis]
 gb|EXC31400.1| hypothetical protein L484_017683 [Morus notabilis]
Length=73

 Score = 47.0 bits (110),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -3

Query  498  EKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKR  394
            +K  PLPKFG+WD  NPA++  F+VIF KAR  K+
Sbjct  5    DKGRPLPKFGEWDVNNPASAEGFTVIFSKARDEKK  39



>ref|XP_004504159.1| PREDICTED: RPM1-interacting protein 4-like [Cicer arietinum]
Length=73

 Score = 47.0 bits (110),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = -3

Query  507  EMAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGA  385
            +  ++  PLPKFG+WD  +PA++  F+VIF+KAR  K+ G 
Sbjct  2    QYEQQGRPLPKFGEWDVNDPASAEGFTVIFNKARDEKKTGG  42



>ref|XP_008439265.1| PREDICTED: RPM1-interacting protein 4 isoform X2 [Cucumis melo]
Length=75

 Score = 47.0 bits (110),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -3

Query  501  AEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKR  394
            +++  PLPKFG+WD  NPA++  F+VIF+KAR+ K+
Sbjct  3    SDRGRPLPKFGEWDVNNPASAEGFTVIFNKARNEKK  38



>ref|XP_004515842.1| PREDICTED: RPM1-interacting protein 4-like isoform X2 [Cicer 
arietinum]
Length=71

 Score = 47.0 bits (110),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -3

Query  501  AEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKR  394
            ++K  PLPKFG+WD  NPA++  F+VIF+KAR  K+
Sbjct  3    SDKGRPLPKFGEWDVNNPASAEGFTVIFNKARDEKK  38



>ref|XP_009605629.1| PREDICTED: RPM1-interacting protein 4-like [Nicotiana tomentosiformis]
Length=74

 Score = 47.0 bits (110),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -3

Query  498  EKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKR  394
            EK  PLPKFG+WD  NPA+++ F+VIF KAR  K+
Sbjct  5    EKGRPLPKFGEWDVNNPASADGFTVIFAKARDDKK  39



>gb|AFK45254.1| unknown [Lotus japonicus]
Length=250

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 39/65 (60%), Gaps = 8/65 (12%)
 Frame = -3

Query  576  NH-TSLFSRLFPFDRIGSESKKIEEMAEKNAPLPKFGDWDEKNPAASNDFSVIFDKARHA  400
            NH T   SRL P +R        +E  EK A +PKFG+WD  NPA+++ F+ IF+K R  
Sbjct  161  NHGTPGRSRLRPVNRG-------DETPEKGAAVPKFGEWDVSNPASADGFTHIFNKVREE  213

Query  399  KRDGA  385
            ++ GA
Sbjct  214  RQGGA  218



>gb|KEH31733.1| RPM1-interacting protein 4 (RIN4) family protein [Medicago truncatula]
Length=108

 Score = 47.4 bits (111),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 30/42 (71%), Gaps = 2/42 (5%)
 Frame = -3

Query  513  IEEMAE--KNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKR  394
            IE + E  K  PLPKFG+WD  NPA++  F+VIF+KAR  K+
Sbjct  12   IECLKEQDKGRPLPKFGEWDVNNPASAEGFTVIFNKARDEKK  53



>ref|XP_008340150.1| PREDICTED: RPM1-interacting protein 4-like [Malus domestica]
Length=86

 Score = 47.4 bits (111),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -3

Query  489  APLPKFGDWDEKNPAASNDFSVIFDKARHAKRDGA  385
             PLPKFG+WD  NPA++  F+VIF+KAR  ++ G 
Sbjct  15   GPLPKFGEWDVNNPASAEGFTVIFNKARDDRKSGG  49



>ref|XP_009590829.1| PREDICTED: RPM1-interacting protein 4-like [Nicotiana tomentosiformis]
 ref|XP_009768599.1| PREDICTED: RPM1-interacting protein 4-like [Nicotiana sylvestris]
Length=74

 Score = 47.0 bits (110),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -3

Query  498  EKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKR  394
            EK  PLPKFG+WD  NPA+++ F+VIF KAR  K+
Sbjct  5    EKGRPLPKFGEWDVNNPASADGFTVIFAKARDDKK  39



>ref|XP_003608903.1| NOI protein [Medicago truncatula]
Length=97

 Score = 47.4 bits (111),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -3

Query  498  EKNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKR  394
            +K  PLPKFG+WD  NPA++  F+VIF+KAR  K+
Sbjct  5    DKGRPLPKFGEWDVNNPASAEGFTVIFNKARDEKK  39



>ref|XP_008439256.1| PREDICTED: RPM1-interacting protein 4 isoform X1 [Cucumis melo]
Length=76

 Score = 47.0 bits (110),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = -3

Query  486  PLPKFGDWDEKNPAASNDFSVIFDKARHAKR  394
            PLPKFG+WD  NPA++  F+VIF+KAR+ K+
Sbjct  9    PLPKFGEWDVNNPASAEGFTVIFNKARNEKK  39



>ref|XP_004953756.1| PREDICTED: RPM1-interacting protein 4-like [Setaria italica]
Length=86

 Score = 47.0 bits (110),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 42/87 (48%), Gaps = 16/87 (18%)
 Frame = -3

Query  483  LPKFGDWDEKNPAASNDFSVIFDKARHAKRDGArppsrttttrRDQLDSPTRKDRpnnns  304
            LPKFG+WD  NPA+++ F+VIF KAR  K+  A      +    D  DS +R D    + 
Sbjct  9    LPKFGEWDVNNPASADGFTVIFSKARDEKK--APTKGHISNRSADSKDS-SRVDNKVTS-  64

Query  303  spssNTPAAHFLYLGKSRTGRKWLCCV  223
                        Y  ++   +KW CCV
Sbjct  65   ------------YNSRNNASKKWFCCV  79



>ref|XP_010249436.1| PREDICTED: uncharacterized protein LOC104591981 [Nelumbo nucifera]
Length=170

 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -3

Query  495  KNAPLPKFGDWDEKNPAASNDFSVIFDKARHAKR  394
            K  PLPKFG+WD  NPA++  F+VIF+KAR  K+
Sbjct  9    KGLPLPKFGEWDVNNPASAEGFTVIFNKARDEKK  42



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1346324970506