BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c103949_g1_i1 len=132 path=[110:0-131]

Length=132
                                                                      Score     E

emb|CDP15192.1|  unnamed protein product                              82.8    1e-16   
ref|XP_009593737.1|  PREDICTED: pleiotropic drug resistance prote...  79.7    1e-15   
sp|Q5W274.1|PDR3_TOBAC  RecName: Full=Pleiotropic drug resistance...  79.7    1e-15   Nicotiana tabacum [American tobacco]
ref|XP_011092686.1|  PREDICTED: pleiotropic drug resistance prote...  79.7    1e-15   
ref|XP_002280231.1|  PREDICTED: pleiotropic drug resistance prote...  79.3    2e-15   Vitis vinifera
emb|CBI39657.3|  unnamed protein product                              79.3    2e-15   
emb|CAN65735.1|  hypothetical protein VITISV_037751                   79.3    2e-15   Vitis vinifera
ref|XP_009765624.1|  PREDICTED: pleiotropic drug resistance prote...  79.0    3e-15   
gb|EYU19393.1|  hypothetical protein MIMGU_mgv1a000209mg              76.6    2e-14   
ref|XP_004230350.1|  PREDICTED: pleiotropic drug resistance prote...  76.6    2e-14   
ref|XP_006358552.1|  PREDICTED: pleiotropic drug resistance prote...  76.3    2e-14   
ref|XP_010313828.1|  PREDICTED: pleiotropic drug resistance prote...  75.9    3e-14   
ref|XP_010042342.1|  PREDICTED: pleiotropic drug resistance prote...  75.1    6e-14   
ref|XP_010042321.1|  PREDICTED: pleiotropic drug resistance prote...  74.7    7e-14   
ref|XP_010042261.1|  PREDICTED: pleiotropic drug resistance prote...  74.7    8e-14   
gb|KCW84985.1|  hypothetical protein EUGRSUZ_B01809                   74.3    9e-14   
gb|KCW84983.1|  hypothetical protein EUGRSUZ_B01807                   74.3    1e-13   
gb|KCW84986.1|  hypothetical protein EUGRSUZ_B01810                   73.9    1e-13   
ref|XP_008456863.1|  PREDICTED: LOW QUALITY PROTEIN: pleiotropic ...  73.2    2e-13   
ref|XP_004140460.1|  PREDICTED: pleiotropic drug resistance prote...  73.2    2e-13   
ref|XP_004167702.1|  PREDICTED: pleiotropic drug resistance prote...  72.8    2e-13   
gb|KGN50864.1|  hypothetical protein Csa_5G292210                     72.4    2e-13   
gb|EYU38388.1|  hypothetical protein MIMGU_mgv1a019245mg              73.2    2e-13   
ref|XP_010042275.1|  PREDICTED: pleiotropic drug resistance prote...  72.4    4e-13   
ref|XP_010042268.1|  PREDICTED: pleiotropic drug resistance prote...  72.4    4e-13   
ref|XP_010042280.1|  PREDICTED: pleiotropic drug resistance prote...  72.4    4e-13   
ref|XP_010042294.1|  PREDICTED: pleiotropic drug resistance prote...  72.0    6e-13   
ref|XP_010042288.1|  PREDICTED: pleiotropic drug resistance prote...  72.0    6e-13   
ref|XP_010270958.1|  PREDICTED: pleiotropic drug resistance prote...  72.0    6e-13   
gb|KCW84984.1|  hypothetical protein EUGRSUZ_B01808                   72.0    6e-13   
ref|XP_010042313.1|  PREDICTED: pleiotropic drug resistance prote...  71.2    1e-12   
ref|XP_004302337.1|  PREDICTED: pleiotropic drug resistance prote...  71.2    1e-12   
ref|XP_008443150.1|  PREDICTED: pleiotropic drug resistance prote...  71.2    1e-12   
gb|KCW84989.1|  hypothetical protein EUGRSUZ_B01813                   70.9    1e-12   
emb|CDP15193.1|  unnamed protein product                              70.9    2e-12   
ref|XP_010270960.1|  PREDICTED: pleiotropic drug resistance prote...  70.9    2e-12   
ref|XP_008443151.1|  PREDICTED: pleiotropic drug resistance prote...  70.5    2e-12   
ref|XP_008443152.1|  PREDICTED: pleiotropic drug resistance prote...  70.5    2e-12   
ref|XP_010270961.1|  PREDICTED: pleiotropic drug resistance prote...  70.5    2e-12   
ref|XP_004136754.1|  PREDICTED: pleiotropic drug resistance prote...  70.1    2e-12   
gb|KGN59365.1|  hypothetical protein Csa_3G814320                     70.1    3e-12   
ref|XP_004169360.1|  PREDICTED: pleiotropic drug resistance prote...  69.7    4e-12   
ref|XP_008246301.1|  PREDICTED: pleiotropic drug resistance prote...  69.7    4e-12   
emb|CDP15194.1|  unnamed protein product                              69.7    4e-12   
ref|XP_007208138.1|  hypothetical protein PRUPE_ppa000249mg           69.7    4e-12   
ref|XP_010042251.1|  PREDICTED: pleiotropic drug resistance prote...  68.9    7e-12   
ref|XP_010042247.1|  PREDICTED: pleiotropic drug resistance prote...  68.9    7e-12   
gb|KCW84982.1|  hypothetical protein EUGRSUZ_B01806                   68.6    9e-12   
ref|XP_009366041.1|  PREDICTED: pleiotropic drug resistance prote...  68.6    9e-12   
ref|XP_008370348.1|  PREDICTED: pleiotropic drug resistance prote...  68.2    1e-11   
ref|XP_002982121.1|  ATP-binding cassette transporter                 68.2    1e-11   
ref|XP_002993409.1|  hypothetical protein SELMODRAFT_137082           68.2    2e-11   
emb|CDP15190.1|  unnamed protein product                              67.8    2e-11   
ref|NP_181265.1|  ABC transporter G family member 33                  67.0    3e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006441094.1|  hypothetical protein CICLE_v10024400mg           67.0    3e-11   
ref|XP_006493341.1|  PREDICTED: pleiotropic drug resistance prote...  67.0    3e-11   
ref|XP_002879660.1|  predicted protein                                66.6    5e-11   
gb|KDO39966.1|  hypothetical protein CISIN_1g001048mg                 66.6    5e-11   
ref|XP_010529758.1|  PREDICTED: ABC transporter G family member 3...  66.6    5e-11   
ref|XP_010529759.1|  PREDICTED: ABC transporter G family member 3...  66.6    5e-11   
ref|XP_010529761.1|  PREDICTED: ABC transporter G family member 3...  66.6    5e-11   
ref|XP_010529760.1|  PREDICTED: ABC transporter G family member 3...  66.2    5e-11   
ref|XP_008443154.1|  PREDICTED: pleiotropic drug resistance prote...  66.2    6e-11   
ref|XP_008443153.1|  PREDICTED: pleiotropic drug resistance prote...  66.2    6e-11   
emb|CDP18458.1|  unnamed protein product                              66.2    6e-11   
ref|XP_004167869.1|  PREDICTED: pleiotropic drug resistance prote...  65.9    8e-11   
ref|XP_004136753.1|  PREDICTED: pleiotropic drug resistance prote...  65.9    8e-11   
ref|XP_006428293.1|  hypothetical protein CICLE_v10013618mg           65.5    1e-10   
ref|XP_007031243.1|  Pleiotropic drug resistance 9                    65.5    1e-10   
ref|XP_002991414.1|  ATP-binding cassette transporter                 65.1    1e-10   
ref|XP_007035968.1|  Pleiotropic drug resistance 9                    65.1    1e-10   
ref|XP_010099713.1|  Pleiotropic drug resistance protein 3            65.1    2e-10   
ref|XP_010914761.1|  PREDICTED: pleiotropic drug resistance prote...  64.7    2e-10   
ref|XP_010505309.1|  PREDICTED: ABC transporter G family member 3...  64.7    2e-10   
ref|XP_011092194.1|  PREDICTED: pleiotropic drug resistance prote...  64.7    2e-10   
ref|XP_010516994.1|  PREDICTED: ABC transporter G family member 3...  64.7    2e-10   
ref|XP_009390975.1|  PREDICTED: pleiotropic drug resistance prote...  64.3    3e-10   
gb|KDO40197.1|  hypothetical protein CISIN_1g000865mg                 64.3    3e-10   
ref|XP_004298256.1|  PREDICTED: pleiotropic drug resistance prote...  64.3    3e-10   
emb|CDP15191.1|  unnamed protein product                              64.3    3e-10   
ref|XP_002993849.1|  hypothetical protein SELMODRAFT_137645           63.9    3e-10   
ref|XP_006293441.1|  hypothetical protein CARUB_v10022507mg           63.9    4e-10   
gb|KDO40198.1|  hypothetical protein CISIN_1g000865mg                 63.9    4e-10   
ref|XP_006480305.1|  PREDICTED: pleiotropic drug resistance prote...  63.9    4e-10   
ref|XP_009143512.1|  PREDICTED: ABC transporter G family member 3...  63.9    4e-10   
emb|CDX74973.1|  BnaA05g07190D                                        63.9    4e-10   
ref|XP_010509355.1|  PREDICTED: ABC transporter G family member 3...  63.5    5e-10   
gb|KFK34600.1|  hypothetical protein AALP_AA5G166700                  63.2    5e-10   
gb|KDO41110.1|  hypothetical protein CISIN_1g042194mg                 62.4    5e-10   
ref|XP_006428294.1|  hypothetical protein CICLE_v10010905mg           63.5    6e-10   
ref|XP_006480376.1|  PREDICTED: pleiotropic drug resistance prote...  63.5    6e-10   
gb|KFK34599.1|  hypothetical protein AALP_AA5G166700                  63.2    6e-10   
gb|KFK34601.1|  hypothetical protein AALP_AA5G166700                  63.2    6e-10   
ref|XP_010541365.1|  PREDICTED: ABC transporter G family member 4...  63.5    6e-10   
ref|XP_009413084.1|  PREDICTED: pleiotropic drug resistance prote...  63.5    6e-10   
ref|XP_006480377.1|  PREDICTED: pleiotropic drug resistance prote...  63.5    6e-10   
gb|KDO41829.1|  hypothetical protein CISIN_1g000517mg                 63.5    6e-10   
ref|XP_010541364.1|  PREDICTED: ABC transporter G family member 4...  63.2    6e-10   
ref|XP_002977493.1|  hypothetical protein SELMODRAFT_106775           63.2    7e-10   
ref|XP_002972182.1|  ATP-binding cassette transporter                 63.2    7e-10   
ref|XP_008223485.1|  PREDICTED: pleiotropic drug resistance prote...  63.2    7e-10   
ref|XP_007226413.1|  hypothetical protein PRUPE_ppa023381mg           63.2    7e-10   
ref|XP_006410911.1|  hypothetical protein EUTSA_v10016144mg           63.2    7e-10   
ref|XP_006410910.1|  hypothetical protein EUTSA_v10016141mg           63.2    8e-10   
emb|CDX74974.1|  BnaA05g07200D                                        62.8    8e-10   
ref|XP_006428269.1|  hypothetical protein CICLE_v10010929mg           62.8    9e-10   
ref|XP_009342540.1|  PREDICTED: ABC transporter G family member 2...  59.7    9e-10   
emb|CDX91350.1|  BnaC04g08000D                                        62.8    9e-10   
ref|XP_009143515.1|  PREDICTED: ABC transporter G family member 3...  62.8    1e-09   
emb|CDY63361.1|  BnaC07g50030D                                        61.6    1e-09   
ref|XP_008228430.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...  62.4    1e-09   
emb|CDY58249.1|  BnaA03g58040D                                        61.6    1e-09   
ref|XP_010267164.1|  PREDICTED: ABC transporter G family member 3...  62.4    1e-09   
emb|CDY65557.1|  BnaCnng47680D                                        61.2    1e-09   
ref|XP_010276541.1|  PREDICTED: LOW QUALITY PROTEIN: pleiotropic ...  62.0    2e-09   
ref|XP_009136684.1|  PREDICTED: ABC transporter G family member 4...  62.0    2e-09   
ref|XP_007217659.1|  hypothetical protein PRUPE_ppa000237mg           62.0    2e-09   
ref|XP_009353554.1|  PREDICTED: ABC transporter G family member 2...  62.0    2e-09   
ref|XP_008380891.1|  PREDICTED: ABC transporter G family member 2...  62.0    2e-09   
gb|KFK23133.1|  hypothetical protein AALP_AAs61551U000700             62.0    2e-09   
gb|KFK23132.1|  hypothetical protein AALP_AAs61551U000700             62.0    2e-09   
ref|XP_007154453.1|  hypothetical protein PHAVU_003G120500g           62.0    2e-09   
gb|EAZ01322.1|  hypothetical protein OsI_23352                        61.6    2e-09   Oryza sativa Indica Group [Indian rice]
sp|Q5Z9S8.1|PDR12_ORYSJ  RecName: Full=Pleiotropic drug resistanc...  61.6    2e-09   Oryza sativa Japonica Group [Japonica rice]
emb|CAD59565.1|  PDR-like ABC transporter                             61.6    2e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007216610.1|  hypothetical protein PRUPE_ppa026987mg           61.6    2e-09   
ref|XP_009359775.1|  PREDICTED: pleiotropic drug resistance prote...  61.6    2e-09   
ref|XP_011013375.1|  PREDICTED: ABC transporter G family member 2...  61.6    3e-09   
ref|XP_008810342.1|  PREDICTED: LOW QUALITY PROTEIN: pleiotropic ...  61.6    3e-09   
ref|XP_006656159.1|  PREDICTED: pleiotropic drug resistance prote...  61.6    3e-09   
ref|XP_009353553.1|  PREDICTED: ABC transporter G family member 3...  61.6    3e-09   
gb|ABK24866.1|  unknown                                               60.8    3e-09   Picea sitchensis
ref|XP_008228429.1|  PREDICTED: ABC transporter G family member 2...  61.6    3e-09   
ref|XP_007024294.1|  ABC-2 and Plant PDR ABC-type transporter fam...  61.6    3e-09   
ref|XP_009353555.1|  PREDICTED: ABC transporter G family member 3...  61.6    3e-09   
ref|NP_001057850.1|  Os06g0554800                                     61.2    3e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009348546.1|  PREDICTED: ABC transporter G family member 2...  61.2    3e-09   
ref|XP_002303308.1|  ABC transporter family protein                   61.2    3e-09   Populus trichocarpa [western balsam poplar]
ref|XP_007024295.1|  ABC-2 and Plant PDR ABC-type transporter fam...  61.2    3e-09   
ref|XP_007024297.1|  ABC-2 and Plant PDR ABC-type transporter fam...  61.2    3e-09   
emb|CDX97743.1|  BnaA05g23360D                                        61.2    3e-09   
ref|XP_002512482.1|  ATP-binding cassette transporter, putative       61.2    3e-09   Ricinus communis
ref|XP_006296832.1|  hypothetical protein CARUB_v10012817mg           61.2    3e-09   
ref|XP_007024296.1|  ABC-2 and Plant PDR ABC-type transporter fam...  61.2    3e-09   
ref|XP_009146147.1|  PREDICTED: ABC transporter G family member 29    61.2    4e-09   
gb|AEX12569.1|  hypothetical protein 2_4825_01                        57.8    4e-09   
ref|XP_009137091.1|  PREDICTED: ABC transporter G family member 4...  61.2    4e-09   
ref|XP_009141643.1|  PREDICTED: ABC transporter G family member 33    60.8    4e-09   
ref|XP_008392747.1|  PREDICTED: ABC transporter G family member 3...  60.8    4e-09   
ref|XP_002870254.1|  predicted protein                                60.8    4e-09   
gb|KHM98721.1|  ABC transporter G family member 36                    60.8    4e-09   
dbj|BAK07655.1|  predicted protein                                    60.5    4e-09   
emb|CDY30162.1|  BnaC05g37000D                                        60.5    5e-09   
ref|XP_010250339.1|  PREDICTED: pleiotropic drug resistance prote...  60.8    5e-09   
ref|XP_003563764.2|  PREDICTED: pleiotropic drug resistance prote...  60.8    5e-09   
emb|CDY20193.1|  BnaA01g28090D                                        60.8    5e-09   
ref|XP_010674511.1|  PREDICTED: LOW QUALITY PROTEIN: pleiotropic ...  60.8    5e-09   
ref|XP_004305262.1|  PREDICTED: ABC transporter G family member 3...  60.8    5e-09   
emb|CDY18456.1|  BnaA04g21310D                                        60.5    5e-09   
ref|XP_009114810.1|  PREDICTED: ABC transporter G family member 29    60.5    5e-09   
gb|KHN32645.1|  ABC transporter G family member 36                    60.5    6e-09   
gb|EMS55442.1|  Pleiotropic drug resistance protein 12                60.5    6e-09   
ref|XP_006595126.1|  PREDICTED: ABC transporter G family member 3...  60.5    6e-09   
ref|XP_010515839.1|  PREDICTED: ABC transporter G family member 3...  60.5    6e-09   
ref|XP_010426998.1|  PREDICTED: ABC transporter G family member 3...  60.5    6e-09   
ref|XP_010515840.1|  PREDICTED: ABC transporter G family member 3...  60.5    6e-09   
ref|XP_010504111.1|  PREDICTED: ABC transporter G family member 3...  60.5    6e-09   
ref|XP_006290499.1|  hypothetical protein CARUB_v10016573mg           60.5    6e-09   
ref|XP_008390491.1|  PREDICTED: pleiotropic drug resistance prote...  60.5    6e-09   
ref|XP_004486779.1|  PREDICTED: ABC transporter G family member 3...  60.5    6e-09   
ref|NP_193258.3|  ABC transporter G family member 30                  60.5    6e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010033839.1|  PREDICTED: ABC transporter G family member 3...  60.5    6e-09   
gb|KCW53679.1|  hypothetical protein EUGRSUZ_J02941                   60.5    6e-09   
gb|KCW53680.1|  hypothetical protein EUGRSUZ_J02944                   60.5    6e-09   
ref|XP_010033840.1|  PREDICTED: ABC transporter G family member 2...  60.5    6e-09   
ref|XP_002876207.1|  ATPDR9/PDR9                                      60.5    6e-09   
ref|XP_004304950.1|  PREDICTED: pleiotropic drug resistance prote...  60.5    7e-09   
ref|XP_010099709.1|  Pleiotropic drug resistance protein 3            60.5    7e-09   
emb|CAB45997.1|  ABC transporter like protein                         60.1    7e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002883000.1|  ATPDR1/PDR1                                      60.5    7e-09   
ref|XP_010487490.1|  PREDICTED: ABC transporter G family member 2...  60.1    7e-09   
gb|AES67934.2|  drug resistance transporter-like ABC domain protein   60.1    7e-09   
gb|EMT29772.1|  Pleiotropic drug resistance protein 3                 60.1    8e-09   
ref|XP_002298240.1|  ABC transporter family protein                   60.1    8e-09   Populus trichocarpa [western balsam poplar]
ref|XP_009148905.1|  PREDICTED: ABC transporter G family member 3...  60.1    8e-09   
emb|CDY39621.1|  BnaC05g11500D                                        60.1    8e-09   
ref|XP_010465656.1|  PREDICTED: ABC transporter G family member 29    60.1    8e-09   
ref|NP_566543.1|  p-coumaryl alcohol exporter                         60.1    8e-09   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001189911.1|  p-coumaryl alcohol exporter                      60.1    8e-09   
emb|CDY36535.1|  BnaA06g09880D                                        60.1    8e-09   
ref|XP_011010430.1|  PREDICTED: ABC transporter G family member 2...  60.1    8e-09   
ref|XP_003597683.1|  ABC transporter G family member                  60.1    8e-09   
ref|XP_010062527.1|  PREDICTED: ABC transporter G family member 2...  60.1    8e-09   
ref|XP_006853667.1|  hypothetical protein AMTR_s00056p00117010        60.1    8e-09   
gb|AEM44336.1|  PEN3                                                  60.1    8e-09   
gb|KCW69670.1|  hypothetical protein EUGRSUZ_F03072                   60.1    9e-09   
gb|AAK91463.1|  AT3g16340/MYA6_15                                     59.3    9e-09   Arabidopsis thaliana [mouse-ear cress]
dbj|BAC41879.1|  putative ABC transporter                             59.7    9e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009417715.1|  PREDICTED: pleiotropic drug resistance prote...  60.1    9e-09   
ref|XP_006414554.1|  hypothetical protein EUTSA_v10024221mg           60.1    9e-09   
gb|EMS59048.1|  Putative pleiotropic drug resistance protein 7        60.1    9e-09   
ref|NP_190916.1|  ABC transporter G family member 37                  60.1    9e-09   Arabidopsis thaliana [mouse-ear cress]
gb|AFW56027.1|  hypothetical protein ZEAMMB73_465499                  60.1    1e-08   
ref|XP_004239721.1|  PREDICTED: pleiotropic drug resistance prote...  60.1    1e-08   
ref|XP_008662457.1|  PREDICTED: pleiotropic drug resistance prote...  59.7    1e-08   
ref|XP_008662458.1|  PREDICTED: pleiotropic drug resistance prote...  59.7    1e-08   
ref|XP_006374091.1|  hypothetical protein POPTR_0015s00840g           59.7    1e-08   
ref|XP_010545667.1|  PREDICTED: ABC transporter G family member 29    59.7    1e-08   
ref|XP_008679861.1|  PREDICTED: putative pleiotropic drug resista...  59.7    1e-08   
ref|XP_002321371.2|  hypothetical protein POPTR_0015s00840g           59.7    1e-08   Populus trichocarpa [western balsam poplar]
gb|KDP27997.1|  hypothetical protein JCGZ_19077                       58.9    1e-08   
emb|CDY07588.1|  BnaC06g14760D                                        59.7    1e-08   
ref|XP_002451754.1|  hypothetical protein SORBIDRAFT_04g007270        59.7    1e-08   Sorghum bicolor [broomcorn]
ref|XP_007024300.1|  Pleiotropic drug resistance 1                    59.7    1e-08   
ref|XP_009353552.1|  PREDICTED: ABC transporter G family member 3...  59.7    1e-08   
ref|XP_010234020.1|  PREDICTED: putative pleiotropic drug resista...  59.7    1e-08   
ref|XP_007216612.1|  hypothetical protein PRUPE_ppa027044mg           59.7    1e-08   
ref|XP_010038526.1|  PREDICTED: pleiotropic drug resistance prote...  59.7    1e-08   
emb|CDY58246.1|  BnaA03g58020D                                        58.9    1e-08   
gb|EEE56535.1|  hypothetical protein OsJ_05840                        59.7    1e-08   Oryza sativa Japonica Group [Japonica rice]
gb|EEC72716.1|  hypothetical protein OsI_06321                        59.7    1e-08   Oryza sativa Indica Group [Indian rice]
sp|Q8GU88.1|PDR7_ORYSJ  RecName: Full=Putative pleiotropic drug r...  59.7    1e-08   Oryza sativa Japonica Group [Japonica rice]
gb|KCW47027.1|  hypothetical protein EUGRSUZ_K00831                   56.6    1e-08   
ref|XP_006406843.1|  hypothetical protein EUTSA_v10019897mg           59.7    1e-08   
ref|XP_009385804.1|  PREDICTED: putative pleiotropic drug resista...  59.7    1e-08   
gb|KCW46776.1|  hypothetical protein EUGRSUZ_K00581                   59.3    1e-08   
ref|XP_006647060.1|  PREDICTED: putative pleiotropic drug resista...  59.3    1e-08   
ref|XP_011044720.1|  PREDICTED: pleiotropic drug resistance prote...  59.3    1e-08   
ref|XP_010532489.1|  PREDICTED: ABC transporter G family member 4...  59.3    1e-08   
ref|XP_010449957.1|  PREDICTED: ABC transporter G family member 42    59.3    1e-08   
ref|XP_011005974.1|  PREDICTED: pleiotropic drug resistance prote...  59.3    1e-08   
ref|XP_009353551.1|  PREDICTED: ABC transporter G family member 3...  59.3    2e-08   
ref|XP_010532488.1|  PREDICTED: ABC transporter G family member 4...  59.3    2e-08   
ref|XP_010270957.1|  PREDICTED: pleiotropic drug resistance prote...  59.3    2e-08   
ref|XP_002458133.1|  hypothetical protein SORBIDRAFT_03g027440        59.3    2e-08   Sorghum bicolor [broomcorn]
gb|KHN05335.1|  ABC transporter G family member 36                    59.3    2e-08   
ref|XP_010510997.1|  PREDICTED: ABC transporter G family member 3...  59.3    2e-08   
gb|EMS59279.1|  Pleiotropic drug resistance protein 3                 58.2    2e-08   
ref|XP_006303787.1|  hypothetical protein CARUB_v10012050mg           59.3    2e-08   
gb|EMS55441.1|  Pleiotropic drug resistance protein 12                59.3    2e-08   
ref|XP_010459043.1|  PREDICTED: ABC transporter G family member 3...  59.3    2e-08   
ref|XP_006389734.1|  hypothetical protein EUTSA_v10018005mg           59.3    2e-08   
dbj|BAJ33663.1|  unnamed protein product                              59.3    2e-08   
ref|NP_176196.1|  ABC transporter G family member 36                  59.3    2e-08   Arabidopsis thaliana [mouse-ear cress]
dbj|BAK02156.1|  predicted protein                                    59.3    2e-08   
ref|XP_006300647.1|  hypothetical protein CARUB_v10019656mg           59.3    2e-08   
ref|XP_010459039.1|  PREDICTED: ABC transporter G family member 3...  59.3    2e-08   
ref|XP_002892853.1|  ATPDR7/PDR7                                      59.3    2e-08   
gb|AAD39650.1|AC007591_15  Similar to gb|Z70524 PDR5-like ABC tra...  59.3    2e-08   Arabidopsis thaliana [mouse-ear cress]
gb|KHN39251.1|  ABC transporter G family member 36                    59.3    2e-08   
ref|XP_003530098.1|  PREDICTED: ABC transporter G family member 3...  59.3    2e-08   
ref|XP_010476601.1|  PREDICTED: ABC transporter G family member 35    59.3    2e-08   
ref|XP_010496920.1|  PREDICTED: ABC transporter G family member 3...  59.3    2e-08   
ref|NP_172973.1|  ABC transporter G family member 35                  59.3    2e-08   Arabidopsis thaliana [mouse-ear cress]
emb|CDX83991.1|  BnaC08g16540D                                        59.3    2e-08   
ref|XP_002888166.1|  PDR8/PEN3                                        59.3    2e-08   
ref|XP_009104417.1|  PREDICTED: ABC transporter G family member 36    59.3    2e-08   
dbj|BAF01774.1|  putative ABC transporter                             58.9    2e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010414635.1|  PREDICTED: ABC transporter G family member 36    59.3    2e-08   
ref|XP_006585572.1|  PREDICTED: ABC transporter G family member 3...  59.3    2e-08   
ref|XP_010470178.1|  PREDICTED: ABC transporter G family member 36    59.3    2e-08   
ref|XP_009110502.1|  PREDICTED: ABC transporter G family member 3...  59.3    2e-08   
emb|CBI36063.3|  unnamed protein product                              57.8    2e-08   
gb|AAL67129.1|  putative ABC transporter protein                      58.9    2e-08   Arabidopsis thaliana [mouse-ear cress]
ref|NP_680692.1|  ABC transporter G family member 41                  58.9    2e-08   Arabidopsis thaliana [mouse-ear cress]
emb|CDY69529.1|  BnaCnng64010D                                        58.9    2e-08   
sp|Q7PC83.1|AB41G_ARATH  RecName: Full=ABC transporter G family m...  58.9    2e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004304949.1|  PREDICTED: pleiotropic drug resistance prote...  58.9    2e-08   
emb|CDX67921.1|  BnaA07g19610D                                        58.9    2e-08   
emb|CDY36534.1|  BnaA06g09870D                                        58.9    2e-08   
ref|XP_009342526.1|  PREDICTED: ABC transporter G family member 2...  58.9    2e-08   
ref|XP_009148904.1|  PREDICTED: ABC transporter G family member 35    58.9    2e-08   
ref|XP_008230974.1|  PREDICTED: pleiotropic drug resistance prote...  58.9    2e-08   
ref|XP_009342527.1|  PREDICTED: ABC transporter G family member 2...  58.9    2e-08   
ref|XP_009399772.1|  PREDICTED: putative pleiotropic drug resista...  58.9    2e-08   
ref|XP_009103863.1|  PREDICTED: ABC transporter G family member 37    58.9    2e-08   
ref|XP_002870255.1|  hypothetical protein ARALYDRAFT_329987           58.9    2e-08   
gb|EAZ13392.1|  hypothetical protein OsJ_03311                        58.9    2e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007135636.1|  hypothetical protein PHAVU_010G145600g           58.9    2e-08   
emb|CDY52757.1|  BnaA07g37720D                                        58.9    2e-08   
ref|XP_010654903.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...  58.9    2e-08   
ref|XP_010665917.1|  PREDICTED: ABC transporter G family member 36    58.9    2e-08   
ref|XP_006416935.1|  hypothetical protein EUTSA_v10006563mg           58.9    2e-08   
sp|Q7FMW4.1|PDR15_ORYSJ  RecName: Full=Pleiotropic drug resistanc...  58.9    2e-08   
gb|EAY75671.1|  hypothetical protein OsI_03578                        58.9    2e-08   
ref|NP_001044111.1|  Os01g0724500                                     58.5    2e-08   
ref|XP_010914975.1|  PREDICTED: putative pleiotropic drug resista...  58.9    2e-08   
emb|CDY39620.1|  BnaC05g11490D                                        58.9    2e-08   
ref|XP_002515968.1|  ATP-binding cassette transporter, putative       58.9    2e-08   
ref|XP_010435037.1|  PREDICTED: ABC transporter G family member 4...  58.9    2e-08   
ref|XP_006389735.1|  hypothetical protein EUTSA_v10018005mg           58.9    2e-08   
ref|XP_010654625.1|  PREDICTED: ABC transporter G family member 2...  58.9    2e-08   
ref|XP_004951497.1|  PREDICTED: putative pleiotropic drug resista...  58.9    2e-08   
ref|XP_009353635.1|  PREDICTED: ABC transporter G family member 2...  58.9    2e-08   
ref|XP_010435036.1|  PREDICTED: ABC transporter G family member 4...  58.9    2e-08   
ref|XP_002515971.1|  ATP-binding cassette transporter, putative       58.9    2e-08   
ref|XP_004983502.1|  PREDICTED: pleiotropic drug resistance prote...  58.9    2e-08   
ref|XP_002451753.1|  hypothetical protein SORBIDRAFT_04g007260        58.9    2e-08   
ref|XP_008775867.1|  PREDICTED: pleiotropic drug resistance prote...  58.9    2e-08   
ref|XP_008775866.1|  PREDICTED: pleiotropic drug resistance prote...  58.9    2e-08   
ref|XP_008775868.1|  PREDICTED: pleiotropic drug resistance prote...  58.9    2e-08   
emb|CAN76184.1|  hypothetical protein VITISV_033076                   58.5    2e-08   
ref|XP_002870253.1|  hypothetical protein ARALYDRAFT_355259           58.9    2e-08   
ref|XP_006285206.1|  hypothetical protein CARUB_v10006562mg           58.9    2e-08   
ref|XP_011011571.1|  PREDICTED: pleiotropic drug resistance prote...  58.9    2e-08   
ref|XP_008348495.1|  PREDICTED: ABC transporter G family member 3...  58.9    2e-08   
ref|XP_011011579.1|  PREDICTED: pleiotropic drug resistance prote...  58.9    2e-08   
ref|XP_001774693.1|  ATP-binding cassette transporter, subfamily ...  58.9    2e-08   
ref|XP_009383471.1|  PREDICTED: pleiotropic drug resistance prote...  58.9    2e-08   
ref|XP_008659680.1|  PREDICTED: pleiotropic drug resistance prote...  58.9    2e-08   
ref|XP_006378562.1|  hypothetical protein POPTR_0010s16340g           58.9    2e-08   
gb|AIU41654.1|  ABC transporter family protein                        58.5    2e-08   
ref|XP_010024864.1|  PREDICTED: pleiotropic drug resistance prote...  58.5    2e-08   
ref|XP_002301544.2|  hypothetical protein POPTR_0002s18990g           58.5    3e-08   
gb|KFK36615.1|  hypothetical protein AALP_AA4G146800                  58.5    3e-08   
ref|XP_010920881.1|  PREDICTED: pleiotropic drug resistance prote...  58.5    3e-08   
ref|XP_007217658.1|  hypothetical protein PRUPE_ppa000226mg           58.5    3e-08   
ref|XP_006854453.1|  hypothetical protein AMTR_s00039p00225530        58.5    3e-08   
gb|KCW46777.1|  hypothetical protein EUGRSUZ_K005832                  57.8    3e-08   
ref|XP_010239576.1|  PREDICTED: pleiotropic drug resistance prote...  58.5    3e-08   
gb|KEH21503.1|  ABC-2 type transporter family protein                 58.2    3e-08   
ref|XP_008791552.1|  PREDICTED: pleiotropic drug resistance prote...  58.5    3e-08   
ref|XP_010914762.1|  PREDICTED: pleiotropic drug resistance prote...  58.5    3e-08   
ref|XP_010532149.1|  PREDICTED: ABC transporter G family member 4...  58.5    3e-08   
emb|CDY06512.1|  BnaC06g11320D                                        58.5    3e-08   
ref|XP_011034492.1|  PREDICTED: pleiotropic drug resistance prote...  58.5    3e-08   
ref|XP_008380887.1|  PREDICTED: pleiotropic drug resistance prote...  58.5    3e-08   
ref|XP_008380892.1|  PREDICTED: ABC transporter G family member 3...  58.5    3e-08   
gb|AFW86934.1|  hypothetical protein ZEAMMB73_662108                  58.5    3e-08   
ref|XP_007162619.1|  hypothetical protein PHAVU_001G166400g           58.5    3e-08   
gb|KDP36994.1|  hypothetical protein JCGZ_06050                       58.5    3e-08   
ref|XP_011015760.1|  PREDICTED: pleiotropic drug resistance prote...  57.4    3e-08   
gb|KHG04406.1|  ABC transporter G family member 31                    55.1    4e-08   
emb|CDO97981.1|  unnamed protein product                              58.2    4e-08   
ref|XP_010440323.1|  PREDICTED: ABC transporter G family member 4...  58.2    4e-08   
ref|XP_004493879.1|  PREDICTED: pleiotropic drug resistance prote...  58.2    4e-08   
ref|XP_010440322.1|  PREDICTED: ABC transporter G family member 4...  58.2    4e-08   
sp|Q7PC82.1|AB42G_ARATH  RecName: Full=ABC transporter G family m...  58.2    4e-08   
emb|CDY08278.1|  BnaA05g13410D                                        58.2    4e-08   
ref|XP_009144720.1|  PREDICTED: ABC transporter G family member 41    58.2    4e-08   
ref|NP_680693.5|  ABC transporter G family member 42                  58.2    4e-08   
emb|CDP04831.1|  unnamed protein product                              58.2    4e-08   
ref|XP_007216270.1|  hypothetical protein PRUPE_ppa017338mg           58.2    4e-08   
sp|Q7PC81.1|AB43G_ARATH  RecName: Full=ABC transporter G family m...  58.2    4e-08   
gb|KFK38987.1|  hypothetical protein AALP_AA3G185300                  58.2    4e-08   
ref|XP_006359484.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...  58.2    4e-08   
ref|XP_010038528.1|  PREDICTED: pleiotropic drug resistance prote...  57.8    4e-08   
ref|NP_680694.2|  ABC transporter G family member 43                  58.2    4e-08   
ref|XP_004965600.1|  PREDICTED: pleiotropic drug resistance prote...  58.2    4e-08   
ref|XP_007154452.1|  hypothetical protein PHAVU_003G120400g           58.2    4e-08   
ref|XP_003625399.1|  Pleiotropic drug resistance protein              58.2    5e-08   
gb|AES81617.2|  drug resistance transporter-like ABC domain protein   57.8    5e-08   
ref|XP_008785597.1|  PREDICTED: putative pleiotropic drug resista...  57.8    5e-08   
gb|KDP40866.1|  hypothetical protein JCGZ_24865                       57.8    5e-08   
ref|XP_010528954.1|  PREDICTED: ABC transporter G family member 2...  57.8    5e-08   
ref|XP_006414553.1|  hypothetical protein EUTSA_v10024460mg           57.8    5e-08   
ref|XP_010435039.1|  PREDICTED: ABC transporter G family member 4...  57.8    5e-08   
ref|XP_010925282.1|  PREDICTED: putative pleiotropic drug resista...  57.8    5e-08   
gb|AES81618.2|  drug resistance transporter-like ABC domain protein   57.8    5e-08   
ref|XP_003550575.1|  PREDICTED: pleiotropic drug resistance prote...  57.8    5e-08   
ref|XP_010925283.1|  PREDICTED: putative pleiotropic drug resista...  57.8    5e-08   
ref|XP_010435041.1|  PREDICTED: ABC transporter G family member 4...  57.8    5e-08   
ref|XP_006283003.1|  hypothetical protein CARUB_v10003991mg           57.8    5e-08   
ref|XP_003528598.1|  PREDICTED: pleiotropic drug resistance prote...  57.8    5e-08   
ref|XP_002512728.1|  ATP-binding cassette transporter, putative       57.8    6e-08   
ref|XP_006600401.1|  PREDICTED: pleiotropic drug resistance prote...  57.8    6e-08   
ref|XP_006583982.1|  PREDICTED: pleiotropic drug resistance prote...  57.8    6e-08   
ref|XP_010521510.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...  57.8    6e-08   
ref|XP_006368914.1|  hypothetical protein POPTR_0001s14650g           57.4    6e-08   
ref|XP_006854452.1|  hypothetical protein AMTR_s00039p00224920        57.4    7e-08   
gb|KHG05750.1|  ABC transporter G family member 36                    57.4    7e-08   
gb|KHN03242.1|  Pleiotropic drug resistance protein 3                 57.4    7e-08   
gb|KHG17288.1|  ABC transporter G family member 40                    57.4    7e-08   
emb|CDP04826.1|  unnamed protein product                              57.4    7e-08   
ref|XP_002515970.1|  ATP-binding cassette transporter, putative       57.4    8e-08   
ref|XP_008373544.1|  PREDICTED: pleiotropic drug resistance prote...  57.4    8e-08   
ref|NP_001046259.2|  Os02g0208300                                     54.7    8e-08   
ref|XP_008373537.1|  PREDICTED: pleiotropic drug resistance prote...  57.4    8e-08   
ref|XP_009343426.1|  PREDICTED: pleiotropic drug resistance prote...  57.0    9e-08   
ref|XP_004298258.1|  PREDICTED: pleiotropic drug resistance prote...  57.0    9e-08   
ref|XP_004493881.1|  PREDICTED: pleiotropic drug resistance prote...  57.0    9e-08   
gb|EEC73315.1|  hypothetical protein OsI_07502                        56.6    9e-08   
ref|XP_006829655.1|  hypothetical protein AMTR_s00122p00117310        57.0    1e-07   
tpg|DAA58927.1|  TPA: hypothetical protein ZEAMMB73_940685            56.6    1e-07   
gb|AES81619.2|  drug resistance transporter-like ABC domain protein   57.0    1e-07   
gb|KCW46781.1|  hypothetical protein EUGRSUZ_K00587                   57.0    1e-07   
ref|NP_001170122.1|  uncharacterized protein LOC100384044             56.6    1e-07   
dbj|BAP90384.1|  ATP binding cassette transporter                     57.0    1e-07   
emb|CAD59575.1|  PDR-like ABC transporter                             57.0    1e-07   
ref|XP_004969802.1|  PREDICTED: pleiotropic drug resistance prote...  57.0    1e-07   
gb|AES81621.2|  drug resistance transporter-like ABC domain protein   57.0    1e-07   
gb|KDP36998.1|  hypothetical protein JCGZ_06054                       57.0    1e-07   
ref|XP_010038532.1|  PREDICTED: pleiotropic drug resistance prote...  57.0    1e-07   
ref|XP_010254261.1|  PREDICTED: pleiotropic drug resistance prote...  57.0    1e-07   
ref|XP_003625401.1|  Pleiotropic drug resistance protein              57.0    1e-07   
ref|XP_010254262.1|  PREDICTED: pleiotropic drug resistance prote...  57.0    1e-07   
ref|XP_003625403.1|  Pleiotropic drug resistance protein              57.0    1e-07   
ref|XP_010104634.1|  ABC transporter G family member 31               57.0    1e-07   
gb|EAZ23288.1|  hypothetical protein OsJ_06985                        56.6    1e-07   
ref|XP_003625398.1|  Pleiotropic drug resistance protein              56.6    1e-07   
gb|AES81616.2|  drug resistance transporter-like ABC domain protein   56.6    1e-07   
ref|XP_010649677.1|  PREDICTED: pleiotropic drug resistance prote...  56.6    1e-07   
gb|EEC73306.1|  hypothetical protein OsI_07483                        56.6    1e-07   
gb|EMT16838.1|  Putative pleiotropic drug resistance protein 7        56.6    1e-07   
ref|XP_007023982.1|  Pleiotropic drug resistance 12                   56.6    1e-07   
ref|XP_010923045.1|  PREDICTED: pleiotropic drug resistance prote...  56.6    1e-07   
emb|CBI26001.3|  unnamed protein product                              56.6    1e-07   
ref|XP_010915401.1|  PREDICTED: pleiotropic drug resistance prote...  56.6    1e-07   
ref|XP_001754895.1|  ATP-binding cassette transporter, subfamily ...  56.6    1e-07   
ref|XP_003550950.1|  PREDICTED: pleiotropic drug resistance prote...  56.6    1e-07   
gb|AET01510.2|  drug resistance transporter-like ABC domain protein   56.6    1e-07   
gb|KHN03241.1|  Pleiotropic drug resistance protein 3                 56.6    1e-07   
ref|XP_002297807.2|  hypothetical protein POPTR_0001s14660g           56.6    1e-07   
ref|XP_007150610.1|  hypothetical protein PHAVU_005G166500g           56.6    1e-07   
ref|XP_006427141.1|  hypothetical protein CICLE_v10027430mg           56.6    1e-07   
ref|XP_003627034.1|  ABC transporter family pleiotropic drug resi...  56.6    1e-07   
gb|KDO58228.1|  hypothetical protein CISIN_1g038815mg                 56.6    2e-07   
ref|XP_009415904.1|  PREDICTED: pleiotropic drug resistance prote...  56.6    2e-07   
gb|KFK36344.1|  hypothetical protein AALP_AA4G110300                  56.6    2e-07   
ref|XP_006465421.1|  PREDICTED: pleiotropic drug resistance prote...  56.2    2e-07   
ref|XP_009415905.1|  PREDICTED: pleiotropic drug resistance prote...  56.2    2e-07   
ref|XP_008445474.1|  PREDICTED: ABC transporter G family member 2...  56.2    2e-07   
ref|XP_010537955.1|  PREDICTED: ABC transporter G family member 4...  56.2    2e-07   
ref|NP_001237697.1|  PDR-like ABC-transporter                         56.2    2e-07   
ref|XP_004169718.1|  PREDICTED: ABC transporter G family member 3...  56.2    2e-07   
ref|XP_004969129.1|  PREDICTED: pleiotropic drug resistance prote...  56.2    2e-07   
ref|XP_004144266.1|  PREDICTED: pleiotropic drug resistance prote...  56.2    2e-07   
gb|KGN47634.1|  hypothetical protein Csa_6G366320                     56.2    2e-07   
gb|KGN47083.1|  hypothetical protein Csa_6G185320                     56.2    2e-07   
sp|Q8GU89.1|PDR4_ORYSJ  RecName: Full=Pleiotropic drug resistance...  56.2    2e-07   
ref|XP_004158295.1|  PREDICTED: pleiotropic drug resistance prote...  56.2    2e-07   
gb|KDP36995.1|  hypothetical protein JCGZ_06051                       56.2    2e-07   
gb|KHN09389.1|  Pleiotropic drug resistance protein 1                 56.2    2e-07   
ref|XP_010244003.1|  PREDICTED: pleiotropic drug resistance prote...  56.2    2e-07   
ref|XP_006600402.1|  PREDICTED: pleiotropic drug resistance prote...  56.2    2e-07   
gb|ACN41354.1|  LR34                                                  56.2    2e-07   
gb|ADK62371.1|  LR34                                                  56.2    2e-07   
gb|EAY74922.1|  hypothetical protein OsI_02816                        56.2    2e-07   
ref|XP_002879608.1|  ATPDR6/PDR6                                      56.2    2e-07   
ref|XP_010670733.1|  PREDICTED: pleiotropic drug resistance prote...  56.2    2e-07   
gb|ACL36478.1|  unknown                                               56.2    2e-07   
gb|ACL36480.1|  PDR-like ABC transporter                              56.2    2e-07   
ref|XP_004143156.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...  56.2    2e-07   
gb|EYU29216.1|  hypothetical protein MIMGU_mgv1a000208mg              56.2    2e-07   
ref|XP_006646277.1|  PREDICTED: pleiotropic drug resistance prote...  56.2    2e-07   
ref|XP_006576269.1|  PREDICTED: PDR-like ABC-transporter isoform X1   56.2    2e-07   
gb|EAZ12650.1|  hypothetical protein OsJ_02565                        56.2    2e-07   
ref|XP_006644354.1|  PREDICTED: pleiotropic drug resistance prote...  56.2    2e-07   
ref|NP_001043541.1|  Os01g0609900                                     56.2    2e-07   
ref|XP_008464042.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...  56.2    2e-07   
ref|XP_009141587.1|  PREDICTED: ABC transporter G family member 39    56.2    2e-07   
emb|CDY43723.1|  BnaAnng07380D                                        56.2    2e-07   
ref|XP_002972164.1|  ATP-binding cassette transporter                 56.2    2e-07   
ref|XP_004969123.1|  PREDICTED: probable pleiotropic drug resista...  56.2    2e-07   
ref|XP_011081908.1|  PREDICTED: pleiotropic drug resistance prote...  56.2    2e-07   
ref|XP_010244015.1|  PREDICTED: pleiotropic drug resistance prote...  56.2    2e-07   
dbj|BAD93879.1|  putative ABC transporter                             54.7    2e-07   
ref|XP_010049001.1|  PREDICTED: pleiotropic drug resistance prote...  56.2    2e-07   
ref|XP_010249928.1|  PREDICTED: putative pleiotropic drug resista...  56.2    2e-07   
dbj|BAD52527.1|  putative PDR-type ABC transporter 2                  56.2    2e-07   
ref|XP_010654624.1|  PREDICTED: pleiotropic drug resistance prote...  56.2    2e-07   
ref|XP_004173302.1|  PREDICTED: LOW QUALITY PROTEIN: pleiotropic ...  55.5    2e-07   
ref|XP_010057834.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...  55.8    2e-07   
ref|XP_006477851.1|  PREDICTED: pleiotropic drug resistance prote...  55.8    2e-07   
gb|KCW75159.1|  hypothetical protein EUGRSUZ_E03908                   55.8    2e-07   
emb|CAN76183.1|  hypothetical protein VITISV_033075                   55.8    2e-07   
ref|XP_009420881.1|  PREDICTED: pleiotropic drug resistance prote...  55.1    2e-07   
emb|CBI37027.3|  unnamed protein product                              53.1    2e-07   
gb|EPS60993.1|  hypothetical protein M569_13808                       55.8    2e-07   
ref|XP_010099662.1|  Pleiotropic drug resistance protein 1            55.8    2e-07   
gb|EYU21929.1|  hypothetical protein MIMGU_mgv1a023987mg              55.8    2e-07   
gb|EYU45728.1|  hypothetical protein MIMGU_mgv1a000229mg              55.8    2e-07   
ref|XP_007162613.1|  hypothetical protein PHAVU_001G166100g           52.8    2e-07   
emb|CBI36069.3|  unnamed protein product                              55.8    2e-07   
ref|XP_004969127.1|  PREDICTED: pleiotropic drug resistance prote...  55.8    2e-07   
ref|XP_006416897.1|  hypothetical protein EUTSA_v10006564mg           55.8    2e-07   
ref|XP_009359774.1|  PREDICTED: pleiotropic drug resistance prote...  55.8    2e-07   
ref|NP_173005.1|  ABC transporter G family member 40                  55.8    2e-07   
ref|XP_009407444.1|  PREDICTED: pleiotropic drug resistance prote...  55.8    2e-07   
ref|XP_002892871.1|  ATPDR12/PDR12                                    55.8    2e-07   
gb|KGN58140.1|  hypothetical protein Csa_3G550680                     55.8    2e-07   
emb|CDM86331.1|  unnamed protein product                              55.8    2e-07   
ref|XP_011019029.1|  PREDICTED: pleiotropic drug resistance prote...  55.8    2e-07   
ref|XP_002977484.1|  ATP-binding cassette transporter                 55.8    2e-07   
emb|CBH32605.1|  ABC transporter domain containing protein,expressed  55.8    2e-07   
ref|XP_010476642.1|  PREDICTED: ABC transporter G family member 4...  55.8    2e-07   
ref|XP_010497221.1|  PREDICTED: ABC transporter G family member 4...  55.8    2e-07   
ref|XP_002977481.1|  hypothetical protein SELMODRAFT_443490           55.8    2e-07   
ref|XP_010459089.1|  PREDICTED: ABC transporter G family member 4...  55.8    2e-07   
ref|XP_007016113.1|  Pleiotropic drug resistance 3                    55.8    2e-07   
ref|XP_002458135.1|  hypothetical protein SORBIDRAFT_03g027460        55.8    2e-07   
gb|KDO72160.1|  hypothetical protein CISIN_1g043954mg                 55.8    2e-07   
ref|XP_004148018.1|  PREDICTED: LOW QUALITY PROTEIN: pleiotropic ...  55.8    2e-07   
ref|XP_010459091.1|  PREDICTED: ABC transporter G family member 4...  55.8    3e-07   
ref|XP_006442391.1|  hypothetical protein CICLE_v10024261mg           55.8    3e-07   
gb|KEH28742.1|  drug resistance transporter-like ABC domain protein   55.8    3e-07   
ref|XP_002972160.1|  ATP-binding cassette transporter                 55.8    3e-07   
emb|CDY39660.1|  BnaC05g11890D                                        55.8    3e-07   
ref|XP_009148948.1|  PREDICTED: ABC transporter G family member 40    55.8    3e-07   
ref|XP_002311358.2|  ABC transporter family protein                   55.8    3e-07   



>emb|CDP15192.1| unnamed protein product [Coffea canephora]
Length=1444

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/43 (84%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YLGMLL+A+TPSFP+AAILQS FY+MF+LFAGFLVP+PQIPKW
Sbjct  1319  YLGMLLIAITPSFPVAAILQSTFYTMFNLFAGFLVPRPQIPKW  1361



>ref|XP_009593737.1| PREDICTED: pleiotropic drug resistance protein 3 [Nicotiana tomentosiformis]
Length=1447

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/43 (81%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YLGM+LV+MTPSFP+AAILQS+FY+MF+LFAGFL+PK QIPKW
Sbjct  1322  YLGMMLVSMTPSFPVAAILQSSFYTMFNLFAGFLMPKAQIPKW  1364



>sp|Q5W274.1|PDR3_TOBAC RecName: Full=Pleiotropic drug resistance protein 3; AltName: 
Full=NtPDR3 [Nicotiana tabacum]
 emb|CAH39853.1| PDR-like ABC transporter [Nicotiana tabacum]
Length=1447

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/43 (81%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YLGM+LV+MTPSFP+AAILQS+FY+MF+LFAGFL+PK QIPKW
Sbjct  1322  YLGMMLVSMTPSFPVAAILQSSFYTMFNLFAGFLMPKAQIPKW  1364



>ref|XP_011092686.1| PREDICTED: pleiotropic drug resistance protein 3-like [Sesamum 
indicum]
Length=1407

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YLGMLL+A+TP FP+AAILQSAFY+ F+LFAGFL+P+PQIPKW
Sbjct  1282  YLGMLLIAITPRFPVAAILQSAFYTTFNLFAGFLIPRPQIPKW  1324



>ref|XP_002280231.1| PREDICTED: pleiotropic drug resistance protein 3-like [Vitis 
vinifera]
Length=1448

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YLGMLLVAMTPSFP+A+IL SAFY++F+LFAGFL+P+PQ+PKW
Sbjct  1323  YLGMLLVAMTPSFPVASILSSAFYTIFNLFAGFLIPQPQVPKW  1365



>emb|CBI39657.3| unnamed protein product [Vitis vinifera]
Length=1406

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YLGMLLVAMTPSFP+A+IL SAFY++F+LFAGFL+P+PQ+PKW
Sbjct  1281  YLGMLLVAMTPSFPVASILSSAFYTIFNLFAGFLIPQPQVPKW  1323



>emb|CAN65735.1| hypothetical protein VITISV_037751 [Vitis vinifera]
Length=1417

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YLGMLLVAMTPSFP+A+IL SAFY++F+LFAGFL+P+PQ+PKW
Sbjct  1292  YLGMLLVAMTPSFPVASILSSAFYTIFNLFAGFLIPQPQVPKW  1334



>ref|XP_009765624.1| PREDICTED: pleiotropic drug resistance protein 3 [Nicotiana sylvestris]
Length=1451

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YLGM+LV+MTP+FP+AAILQS+FY+MF+LFAGFL+PK QIPKW
Sbjct  1326  YLGMMLVSMTPNFPVAAILQSSFYTMFNLFAGFLMPKAQIPKW  1368



>gb|EYU19393.1| hypothetical protein MIMGU_mgv1a000209mg [Erythranthe guttata]
Length=1430

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YLGM+LV++TP+FP+AAI QSAFY+MF+LFAGFL+P PQIP+W
Sbjct  1305  YLGMMLVSITPNFPVAAISQSAFYTMFNLFAGFLIPHPQIPRW  1347



>ref|XP_004230350.1| PREDICTED: pleiotropic drug resistance protein 3 isoform X1 [Solanum 
lycopersicum]
Length=1447

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YLGM+LV++TP+ P+AAILQS+FY+MF+LFAGFL+PK QIPKW
Sbjct  1322  YLGMMLVSLTPNLPVAAILQSSFYTMFNLFAGFLIPKAQIPKW  1364



>ref|XP_006358552.1| PREDICTED: pleiotropic drug resistance protein 3-like [Solanum 
tuberosum]
Length=1447

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YLGM+LV++TP+ P+AAILQS+FY+MF+LFAGFL+PK QIPKW
Sbjct  1322  YLGMMLVSLTPNLPVAAILQSSFYTMFNLFAGFLIPKAQIPKW  1364



>ref|XP_010313828.1| PREDICTED: pleiotropic drug resistance protein 3 isoform X2 [Solanum 
lycopersicum]
Length=1266

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YLGM+LV++TP+ P+AAILQS+FY+MF+LFAGFL+PK QIPKW
Sbjct  1141  YLGMMLVSLTPNLPVAAILQSSFYTMFNLFAGFLIPKAQIPKW  1183



>ref|XP_010042342.1| PREDICTED: pleiotropic drug resistance protein 3-like [Eucalyptus 
grandis]
Length=1450

 Score = 75.1 bits (183),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YLGMLLV++TP+F +AAILQSAFY+ F+LFAGFL+PKP+IPKW
Sbjct  1325  YLGMLLVSLTPNFMVAAILQSAFYANFNLFAGFLIPKPRIPKW  1367



>ref|XP_010042321.1| PREDICTED: pleiotropic drug resistance protein 3-like isoform 
X1 [Eucalyptus grandis]
Length=1450

 Score = 74.7 bits (182),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YLGMLLV++TP+F +AAILQSAFY+ F+LFAGF +PKP+IPKW
Sbjct  1325  YLGMLLVSLTPNFTVAAILQSAFYTNFNLFAGFFIPKPRIPKW  1367



>ref|XP_010042261.1| PREDICTED: pleiotropic drug resistance protein 3-like [Eucalyptus 
grandis]
Length=1448

 Score = 74.7 bits (182),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YLGMLLV++TP+F +AAILQSAFY+ F LFAGFL+PKP+IPKW
Sbjct  1323  YLGMLLVSLTPTFMVAAILQSAFYTNFHLFAGFLIPKPKIPKW  1365



>gb|KCW84985.1| hypothetical protein EUGRSUZ_B01809 [Eucalyptus grandis]
Length=1211

 Score = 74.3 bits (181),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YLGMLLV++TP+F +AAILQSAFY+ F+LFAGFL+PKP+IPKW
Sbjct  1086  YLGMLLVSLTPNFMVAAILQSAFYANFNLFAGFLIPKPRIPKW  1128



>gb|KCW84983.1| hypothetical protein EUGRSUZ_B01807, partial [Eucalyptus grandis]
Length=1177

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YLGMLLV++TP+F +AAILQSAFY+ F LFAGFL+PKP+IPKW
Sbjct  1052  YLGMLLVSLTPTFMVAAILQSAFYTNFHLFAGFLIPKPKIPKW  1094



>gb|KCW84986.1| hypothetical protein EUGRSUZ_B01810, partial [Eucalyptus grandis]
Length=879

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +2

Query  2    YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
            YLGMLLV++TP+F +AAILQSAFY+ F+LFAGF +PKP+IPKW
Sbjct  785  YLGMLLVSLTPNFTVAAILQSAFYTNFNLFAGFFIPKPRIPKW  827



>ref|XP_008456863.1| PREDICTED: LOW QUALITY PROTEIN: pleiotropic drug resistance protein 
3-like [Cucumis melo]
Length=1441

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YLGMLLV++TP++ IA+IL SAFY+MF+LF+GFLVPKPQIP W
Sbjct  1316  YLGMLLVSITPNYQIASILSSAFYTMFNLFSGFLVPKPQIPGW  1358



>ref|XP_004140460.1| PREDICTED: pleiotropic drug resistance protein 3-like [Cucumis 
sativus]
Length=1440

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YLGMLLV++TP++ IA+IL SAFY+MF+LF+GFLVPKPQIP W
Sbjct  1315  YLGMLLVSITPNYQIASILSSAFYTMFNLFSGFLVPKPQIPGW  1357



>ref|XP_004167702.1| PREDICTED: pleiotropic drug resistance protein 3-like, partial 
[Cucumis sativus]
Length=638

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +2

Query  2    YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
            YLGMLLV++TP++ IA+IL SAFY+MF+LF+GFLVPKPQIP W
Sbjct  513  YLGMLLVSITPNYQIASILSSAFYTMFNLFSGFLVPKPQIPGW  555



>gb|KGN50864.1| hypothetical protein Csa_5G292210 [Cucumis sativus]
Length=590

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +2

Query  2    YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
            YLGMLLV++TP++ IA+IL SAFY+MF+LF+GFLVPKPQIP W
Sbjct  465  YLGMLLVSITPNYQIASILSSAFYTMFNLFSGFLVPKPQIPGW  507



>gb|EYU38388.1| hypothetical protein MIMGU_mgv1a019245mg [Erythranthe guttata]
Length=1448

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YLGM+L+A+TPS+ IAAILQ++FY+M +LF+GFL+P+PQIPKW
Sbjct  1323  YLGMMLIAITPSYSIAAILQTSFYTMLNLFSGFLLPRPQIPKW  1365



>ref|XP_010042275.1| PREDICTED: pleiotropic drug resistance protein 3-like isoform 
X2 [Eucalyptus grandis]
Length=1450

 Score = 72.4 bits (176),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YLGMLLV++TP+  +AAILQSAFY+ F+LFAGFL+PKP+IPKW
Sbjct  1325  YLGMLLVSLTPNVMVAAILQSAFYANFNLFAGFLIPKPKIPKW  1367



>ref|XP_010042268.1| PREDICTED: pleiotropic drug resistance protein 3-like isoform 
X1 [Eucalyptus grandis]
Length=1451

 Score = 72.4 bits (176),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YLGMLLV++TP+  +AAILQSAFY+ F+LFAGFL+PKP+IPKW
Sbjct  1326  YLGMLLVSLTPNVMVAAILQSAFYANFNLFAGFLIPKPKIPKW  1368



>ref|XP_010042280.1| PREDICTED: pleiotropic drug resistance protein 3-like isoform 
X3 [Eucalyptus grandis]
Length=1433

 Score = 72.4 bits (176),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YLGMLLV++TP+  +AAILQSAFY+ F+LFAGFL+PKP+IPKW
Sbjct  1308  YLGMLLVSLTPNVMVAAILQSAFYANFNLFAGFLIPKPKIPKW  1350



>ref|XP_010042294.1| PREDICTED: pleiotropic drug resistance protein 3-like isoform 
X5 [Eucalyptus grandis]
Length=1190

 Score = 72.0 bits (175),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YLGMLLV++TP+  +AAILQSAFY+ F+LFAGFL+PKP+IPKW
Sbjct  1065  YLGMLLVSLTPNVMVAAILQSAFYANFNLFAGFLIPKPKIPKW  1107



>ref|XP_010042288.1| PREDICTED: pleiotropic drug resistance protein 3-like isoform 
X4 [Eucalyptus grandis]
Length=1283

 Score = 72.0 bits (175),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YLGMLLV++TP+  +AAILQSAFY+ F+LFAGFL+PKP+IPKW
Sbjct  1158  YLGMLLVSLTPNVMVAAILQSAFYANFNLFAGFLIPKPKIPKW  1200



>ref|XP_010270958.1| PREDICTED: pleiotropic drug resistance protein 3-like [Nelumbo 
nucifera]
Length=1450

 Score = 72.0 bits (175),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YLGML+VA+TP+  +AAIL SAFY+M +LFAGFL+PKP+IPKW
Sbjct  1325  YLGMLMVALTPNVQVAAILSSAFYTMLNLFAGFLIPKPRIPKW  1367



>gb|KCW84984.1| hypothetical protein EUGRSUZ_B01808 [Eucalyptus grandis]
Length=1206

 Score = 72.0 bits (175),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YLGMLLV++TP+  +AAILQSAFY+ F+LFAGFL+PKP+IPKW
Sbjct  1081  YLGMLLVSLTPNVMVAAILQSAFYANFNLFAGFLIPKPKIPKW  1123



>ref|XP_010042313.1| PREDICTED: pleiotropic drug resistance protein 3-like [Eucalyptus 
grandis]
Length=1450

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YLGMLLV++T +F +AAILQSAF + FSLFAGFL+PKP+IPKW
Sbjct  1325  YLGMLLVSLTTNFTVAAILQSAFNANFSLFAGFLIPKPRIPKW  1367



>ref|XP_004302337.1| PREDICTED: pleiotropic drug resistance protein 3-like [Fragaria 
vesca subsp. vesca]
Length=1443

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y+GM+LV++TP+F +AAIL S FY++++LFAGFL+PKPQIPKW
Sbjct  1318  YMGMMLVSLTPNFMVAAILSSVFYTLYNLFAGFLIPKPQIPKW  1360



>ref|XP_008443150.1| PREDICTED: pleiotropic drug resistance protein 3-like isoform 
X1 [Cucumis melo]
Length=1455

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YLGMLLV++TP+F IA IL SAFY++F+LF+GFLVP P+IPKW
Sbjct  1330  YLGMLLVSITPNFHIANILSSAFYTVFNLFSGFLVPNPRIPKW  1372



>gb|KCW84989.1| hypothetical protein EUGRSUZ_B01813, partial [Eucalyptus grandis]
Length=1157

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YLGMLLV++T +F +AAILQSAF + FSLFAGFL+PKP+IPKW
Sbjct  1063  YLGMLLVSLTTNFTVAAILQSAFNANFSLFAGFLIPKPRIPKW  1105



>emb|CDP15193.1| unnamed protein product [Coffea canephora]
Length=1450

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +2

Query  5     LGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             +GM +V++TPS+P+AA+LQSAFY++F LFAGFL+P+PQIPKW
Sbjct  1326  VGMTIVSITPSYPLAAVLQSAFYNIFYLFAGFLIPRPQIPKW  1367



>ref|XP_010270960.1| PREDICTED: pleiotropic drug resistance protein 3-like isoform 
X1 [Nelumbo nucifera]
Length=1452

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YLGML+VA+TP+  +AAIL SAFY+M +LFAGFL+PKP+IPKW
Sbjct  1327  YLGMLIVALTPNVQVAAILSSAFYTMLNLFAGFLMPKPRIPKW  1369



>ref|XP_008443151.1| PREDICTED: pleiotropic drug resistance protein 3-like isoform 
X2 [Cucumis melo]
Length=1269

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YLGMLLV++TP+F IA IL SAFY++F+LF+GFLVP P+IPKW
Sbjct  1144  YLGMLLVSITPNFHIANILSSAFYTVFNLFSGFLVPNPRIPKW  1186



>ref|XP_008443152.1| PREDICTED: pleiotropic drug resistance protein 3-like isoform 
X3 [Cucumis melo]
Length=1243

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YLGMLLV++TP+F IA IL SAFY++F+LF+GFLVP P+IPKW
Sbjct  1118  YLGMLLVSITPNFHIANILSSAFYTVFNLFSGFLVPNPRIPKW  1160



>ref|XP_010270961.1| PREDICTED: pleiotropic drug resistance protein 3-like isoform 
X2 [Nelumbo nucifera]
Length=1251

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YLGML+VA+TP+  +AAIL SAFY+M +LFAGFL+PKP+IPKW
Sbjct  1126  YLGMLIVALTPNVQVAAILSSAFYTMLNLFAGFLMPKPRIPKW  1168



>ref|XP_004136754.1| PREDICTED: pleiotropic drug resistance protein 3-like [Cucumis 
sativus]
Length=1256

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YLGMLL+++TP+F IA IL SAF+++F+LF+GFL+P PQIPKW
Sbjct  1131  YLGMLLISITPNFHIANILSSAFFTLFNLFSGFLIPNPQIPKW  1173



>gb|KGN59365.1| hypothetical protein Csa_3G814320 [Cucumis sativus]
Length=1451

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YLGMLL+++TP+F IA IL SAF+++F+LF+GFL+P PQIPKW
Sbjct  1326  YLGMLLISITPNFHIANILSSAFFTLFNLFSGFLIPNPQIPKW  1368



>ref|XP_004169360.1| PREDICTED: pleiotropic drug resistance protein 3-like [Cucumis 
sativus]
Length=1345

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YLGMLL+++TP+F IA IL SAF+++F+LF+GFL+P PQIPKW
Sbjct  1220  YLGMLLISITPNFHIANILSSAFFTLFNLFSGFLIPNPQIPKW  1262



>ref|XP_008246301.1| PREDICTED: pleiotropic drug resistance protein 3-like [Prunus 
mume]
Length=1445

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y+G++LV++TP+F IAAIL S FY++++LFAGFL+P+PQIPKW
Sbjct  1320  YMGLMLVSLTPNFMIAAILSSVFYTLYNLFAGFLIPRPQIPKW  1362



>emb|CDP15194.1| unnamed protein product [Coffea canephora]
Length=1449

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = +2

Query  8     GMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             GM++V++TPSFP+AA+LQSAFY+++ L AGFL+P+PQIPKW
Sbjct  1326  GMMIVSITPSFPVAAVLQSAFYNIYYLVAGFLIPRPQIPKW  1366



>ref|XP_007208138.1| hypothetical protein PRUPE_ppa000249mg [Prunus persica]
 gb|EMJ09337.1| hypothetical protein PRUPE_ppa000249mg [Prunus persica]
Length=1402

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y+G++LV++TP+F IAAIL S FY++++LFAGFL+P+PQIPKW
Sbjct  1277  YMGLMLVSLTPNFMIAAILSSVFYTLYNLFAGFLIPRPQIPKW  1319



>ref|XP_010042251.1| PREDICTED: pleiotropic drug resistance protein 3-like isoform 
X2 [Eucalyptus grandis]
Length=1339

 Score = 68.9 bits (167),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YLGMLLV++TP+  +AA LQSAF + FSLFAGFL+PKP+IPKW
Sbjct  1214  YLGMLLVSLTPNLMVAATLQSAFSTNFSLFAGFLIPKPKIPKW  1256



>ref|XP_010042247.1| PREDICTED: pleiotropic drug resistance protein 3-like isoform 
X1 [Eucalyptus grandis]
Length=1450

 Score = 68.9 bits (167),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YLGMLLV++TP+  +AA LQSAF + FSLFAGFL+PKP+IPKW
Sbjct  1325  YLGMLLVSLTPNLMVAATLQSAFSTNFSLFAGFLIPKPKIPKW  1367



>gb|KCW84982.1| hypothetical protein EUGRSUZ_B01806, partial [Eucalyptus grandis]
Length=1187

 Score = 68.6 bits (166),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YLGMLLV++TP+  +AA LQSAF + FSLFAGFL+PKP+IPKW
Sbjct  1071  YLGMLLVSLTPNLMVAATLQSAFSTNFSLFAGFLIPKPKIPKW  1113



>ref|XP_009366041.1| PREDICTED: pleiotropic drug resistance protein 3-like [Pyrus 
x bretschneideri]
Length=1466

 Score = 68.6 bits (166),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y+G++LV++TP++ +AAIL S FY++++LFAGFL+PKPQIPKW
Sbjct  1341  YMGLMLVSLTPNYLVAAILSSVFYTLYNLFAGFLIPKPQIPKW  1383



>ref|XP_008370348.1| PREDICTED: pleiotropic drug resistance protein 3-like [Malus 
domestica]
Length=1447

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y+G++LV++TP++ +AAIL S FY++++LFAGFL+PKPQIPKW
Sbjct  1322  YMGLMLVSLTPNYLVAAILASVFYTLYNLFAGFLIPKPQIPKW  1364



>ref|XP_002982121.1| ATP-binding cassette transporter [Selaginella moellendorffii]
 gb|EFJ16789.1| ATP-binding cassette transporter [Selaginella moellendorffii]
Length=1459

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+ VA+TP++ IA IL SAFYS+F+LF+GFL+PKP+IPKW
Sbjct  1333  YYGMMAVAITPNYQIAGILASAFYSLFNLFSGFLIPKPKIPKW  1375



>ref|XP_002993409.1| hypothetical protein SELMODRAFT_137082 [Selaginella moellendorffii]
 gb|EFJ05502.1| hypothetical protein SELMODRAFT_137082 [Selaginella moellendorffii]
Length=1465

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+ VA+TP++ IA IL SAFYS+F+LF+GFL+PKP+IPKW
Sbjct  1339  YYGMMAVAITPNYQIAGILASAFYSLFNLFSGFLIPKPKIPKW  1381



>emb|CDP15190.1| unnamed protein product [Coffea canephora]
Length=1431

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y+GM++VAMTPSF +A+IL S FY+  +LFAG+L+P+PQIPKW
Sbjct  1306  YIGMMIVAMTPSFQVASILSSGFYTAANLFAGYLIPQPQIPKW  1348



>ref|NP_181265.1| ABC transporter G family member 33 [Arabidopsis thaliana]
 sp|Q9ZUT8.1|AB33G_ARATH RecName: Full=ABC transporter G family member 33; Short=ABC transporter 
ABCG.33; Short=AtABCG33; AltName: Full=Probable pleiotropic 
drug resistance protein 5 [Arabidopsis thaliana]
 gb|AAC98048.1| putative ABC transporter [Arabidopsis thaliana]
 tpg|DAA00873.1| TPA_exp: PDR5 ABC transporter [Arabidopsis thaliana]
 gb|AEC09377.1| ABC transporter G family member 33 [Arabidopsis thaliana]
Length=1413

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YL M L+++TP+F +AAILQS F++ F++FAGFL+PKPQIPKW
Sbjct  1288  YLAMFLISITPNFMVAAILQSLFFTTFNIFAGFLIPKPQIPKW  1330



>ref|XP_006441094.1| hypothetical protein CICLE_v10024400mg [Citrus clementina]
 gb|ESR54334.1| hypothetical protein CICLE_v10024400mg [Citrus clementina]
Length=1384

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y+GML+V++TP+  +A+IL S+FYSM +LF GF +PKPQIPKW
Sbjct  1259  YMGMLIVSLTPNIQVASILASSFYSMLNLFCGFTIPKPQIPKW  1301



>ref|XP_006493341.1| PREDICTED: pleiotropic drug resistance protein 3-like [Citrus 
sinensis]
Length=1442

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y+GML+V++TP+  +A+IL S+FYSM +LF GF +PKPQIPKW
Sbjct  1317  YMGMLIVSLTPNIQVASILASSFYSMLNLFCGFTIPKPQIPKW  1359



>ref|XP_002879660.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55919.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=1424

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YL M L+++TP+F +AAILQS F+  F+LFAGFL+PKPQIPKW
Sbjct  1299  YLAMFLISITPNFMVAAILQSLFFMTFNLFAGFLIPKPQIPKW  1341



>gb|KDO39966.1| hypothetical protein CISIN_1g001048mg [Citrus sinensis]
Length=1174

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y+GML+V++TP+  +A+IL S+FYSM +LF GF +PKPQIPKW
Sbjct  1049  YMGMLIVSLTPNIQVASILASSFYSMLNLFCGFTIPKPQIPKW  1091



>ref|XP_010529758.1| PREDICTED: ABC transporter G family member 37 isoform X1 [Tarenaya 
hassleriana]
Length=1496

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YL M LV++TP+F +AAILQS FY  F+LFAGFLVP+PQ+P+W
Sbjct  1371  YLAMFLVSITPNFMVAAILQSLFYVNFNLFAGFLVPEPQVPRW  1413



>ref|XP_010529759.1| PREDICTED: ABC transporter G family member 37 isoform X2 [Tarenaya 
hassleriana]
Length=1472

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YL M LV++TP+F +AAILQS FY  F+LFAGFLVP+PQ+P+W
Sbjct  1347  YLAMFLVSITPNFMVAAILQSLFYVNFNLFAGFLVPEPQVPRW  1389



>ref|XP_010529761.1| PREDICTED: ABC transporter G family member 37 isoform X4 [Tarenaya 
hassleriana]
Length=1446

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YL M LV++TP+F +AAILQS FY  F+LFAGFLVP+PQ+P+W
Sbjct  1321  YLAMFLVSITPNFMVAAILQSLFYVNFNLFAGFLVPEPQVPRW  1363



>ref|XP_010529760.1| PREDICTED: ABC transporter G family member 37 isoform X3 [Tarenaya 
hassleriana]
Length=1470

 Score = 66.2 bits (160),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YL M LV++TP+F +AAILQS FY  F+LFAGFLVP+PQ+P+W
Sbjct  1345  YLAMFLVSITPNFMVAAILQSLFYVNFNLFAGFLVPEPQVPRW  1387



>ref|XP_008443154.1| PREDICTED: pleiotropic drug resistance protein 3-like isoform 
X2 [Cucumis melo]
Length=1433

 Score = 66.2 bits (160),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +2

Query  5     LGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             LG+LLV++TP++ IA IL SAFY  F+LFAGFLVPKP+IP+W
Sbjct  1309  LGLLLVSITPNYHIATILSSAFYVTFNLFAGFLVPKPRIPRW  1350



>ref|XP_008443153.1| PREDICTED: pleiotropic drug resistance protein 3-like isoform 
X1 [Cucumis melo]
Length=1434

 Score = 66.2 bits (160),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +2

Query  5     LGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             LG+LLV++TP++ IA IL SAFY  F+LFAGFLVPKP+IP+W
Sbjct  1310  LGLLLVSITPNYHIATILSSAFYVTFNLFAGFLVPKPRIPRW  1351



>emb|CDP18458.1| unnamed protein product [Coffea canephora]
Length=1341

 Score = 66.2 bits (160),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 25/43 (58%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GMLLV++TPSF +A+++ S  Y+MF+LF+GF++P P+IPKW
Sbjct  1216  YFGMLLVSLTPSFQVASVVASFCYTMFTLFSGFIIPAPKIPKW  1258



>ref|XP_004167869.1| PREDICTED: pleiotropic drug resistance protein 3-like [Cucumis 
sativus]
 gb|KGN59364.1| hypothetical protein Csa_3G813820 [Cucumis sativus]
Length=1428

 Score = 65.9 bits (159),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +2

Query  5     LGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             LG+LLV++TP++ IA IL SAFY  F+LFAGFLVPKP+IP+W
Sbjct  1304  LGLLLVSITPNYHIATILASAFYVTFNLFAGFLVPKPRIPRW  1345



>ref|XP_004136753.1| PREDICTED: pleiotropic drug resistance protein 3-like [Cucumis 
sativus]
Length=1428

 Score = 65.9 bits (159),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +2

Query  5     LGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             LG+LLV++TP++ IA IL SAFY  F+LFAGFLVPKP+IP+W
Sbjct  1304  LGLLLVSITPNYHIATILASAFYVTFNLFAGFLVPKPRIPRW  1345



>ref|XP_006428293.1| hypothetical protein CICLE_v10013618mg [Citrus clementina]
 gb|ESR41533.1| hypothetical protein CICLE_v10013618mg [Citrus clementina]
Length=1430

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YLGMLLV++TP+F IA+IL + FY++F+LF+GFL+P P+IP W
Sbjct  1305  YLGMLLVSLTPNFMIASILSTVFYTLFNLFSGFLIPGPKIPNW  1347



>ref|XP_007031243.1| Pleiotropic drug resistance 9 [Theobroma cacao]
 gb|EOY11745.1| Pleiotropic drug resistance 9 [Theobroma cacao]
Length=1453

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YLGM LV++TP+F +A+IL S FY++F+LFAGFL+P+PQIP W
Sbjct  1328  YLGMSLVSLTPNFILASILSSIFYTLFNLFAGFLIPQPQIPGW  1370



>ref|XP_002991414.1| ATP-binding cassette transporter [Selaginella moellendorffii]
 gb|EFJ07526.1| ATP-binding cassette transporter [Selaginella moellendorffii]
Length=1474

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+ VA+TP+  +AAI+ S+FYS+F+LF+GF++PKP+IPKW
Sbjct  1348  YYGMMAVAITPNHQVAAIMASSFYSLFNLFSGFMIPKPRIPKW  1390



>ref|XP_007035968.1| Pleiotropic drug resistance 9 [Theobroma cacao]
 gb|EOY06894.1| Pleiotropic drug resistance 9 [Theobroma cacao]
Length=1474

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YLGMLLV++TP+  +A+IL S+ Y+M +LF+GF++P+PQIPKW
Sbjct  1349  YLGMLLVSLTPNVQVASILSSSAYTMLNLFSGFIIPRPQIPKW  1391



>ref|XP_010099713.1| Pleiotropic drug resistance protein 3 [Morus notabilis]
 gb|EXB80290.1| Pleiotropic drug resistance protein 3 [Morus notabilis]
Length=1451

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YLGM LV++TP+  +A+IL S+ Y+M +LFAGF+VPKPQIPKW
Sbjct  1326  YLGMFLVSVTPNTQVASILASSAYTMLNLFAGFMVPKPQIPKW  1368



>ref|XP_010914761.1| PREDICTED: pleiotropic drug resistance protein 3-like [Elaeis 
guineensis]
Length=1451

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YLGMLLV++TP+  +A+IL S  Y++ +LF+GFLVP+PQIPKW
Sbjct  1326  YLGMLLVSLTPNIQVASILASVCYTLLNLFSGFLVPRPQIPKW  1368



>ref|XP_010505309.1| PREDICTED: ABC transporter G family member 33-like [Camelina 
sativa]
Length=1434

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YL + L+++TP+F +AAILQS F+  F+LFAGFL+P+PQIPKW
Sbjct  1309  YLALFLISVTPNFMVAAILQSLFFVTFNLFAGFLIPRPQIPKW  1351



>ref|XP_011092194.1| PREDICTED: pleiotropic drug resistance protein 3-like [Sesamum 
indicum]
Length=1448

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YLGM+L+A+TPSF IAAI QS  Y++ +LF+GFL+P  QIPKW
Sbjct  1323  YLGMMLIAITPSFMIAAISQSGVYTLLNLFSGFLIPSKQIPKW  1365



>ref|XP_010516994.1| PREDICTED: ABC transporter G family member 33 isoform X1 [Camelina 
sativa]
 ref|XP_010516995.1| PREDICTED: ABC transporter G family member 33 isoform X2 [Camelina 
sativa]
 ref|XP_010516996.1| PREDICTED: ABC transporter G family member 33 isoform X3 [Camelina 
sativa]
Length=1425

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YL + L+++TP+F +AAILQS F+  F+LFAGFL+P+PQIPKW
Sbjct  1300  YLALFLISVTPNFMVAAILQSLFFVTFNLFAGFLIPRPQIPKW  1342



>ref|XP_009390975.1| PREDICTED: pleiotropic drug resistance protein 3-like [Musa acuminata 
subsp. malaccensis]
Length=1465

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YLGMLLV++TP+  +A IL S  Y++F+LF+GF+VP PQIPKW
Sbjct  1340  YLGMLLVSLTPNVQVATILASVCYTLFNLFSGFIVPSPQIPKW  1382



>gb|KDO40197.1| hypothetical protein CISIN_1g000865mg [Citrus sinensis]
Length=1218

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YLG+LLVA++P+  +A+ L SAFY+ +SLFAGF++P+PQIPKW
Sbjct  1093  YLGLLLVALSPNVTVASTLFSAFYTTYSLFAGFVIPQPQIPKW  1135



>ref|XP_004298256.1| PREDICTED: pleiotropic drug resistance protein 3-like [Fragaria 
vesca subsp. vesca]
Length=1452

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YLGMLLV++TP+  +AAI+ S+ Y+M +LF+GF+VP+PQIPKW
Sbjct  1327  YLGMLLVSLTPNAQVAAIVASSSYTMVNLFSGFIVPRPQIPKW  1369



>emb|CDP15191.1| unnamed protein product [Coffea canephora]
Length=1445

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YLGML+V++TPS P+A+IL S   ++ +LFAGFLVP+PQIPKW
Sbjct  1320  YLGMLMVSITPSLPLASILLSTSNTLLNLFAGFLVPRPQIPKW  1362



>ref|XP_002993849.1| hypothetical protein SELMODRAFT_137645 [Selaginella moellendorffii]
 gb|EFJ05086.1| hypothetical protein SELMODRAFT_137645 [Selaginella moellendorffii]
Length=1434

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+ V++TP+  +AAI+ S+FYS+F+LF+GF++PKP+IPKW
Sbjct  1308  YYGMMAVSITPNHQVAAIMASSFYSLFNLFSGFMIPKPRIPKW  1350



>ref|XP_006293441.1| hypothetical protein CARUB_v10022507mg [Capsella rubella]
 gb|EOA26339.1| hypothetical protein CARUB_v10022507mg [Capsella rubella]
Length=1433

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YL +LL+++TP+F +AA+LQS F+  F+LFAGFL+PK QIPKW
Sbjct  1308  YLALLLISITPNFMVAAVLQSLFFVTFNLFAGFLIPKTQIPKW  1350



>gb|KDO40198.1| hypothetical protein CISIN_1g000865mg [Citrus sinensis]
Length=1247

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YLG+LLVA++P+  +A+ L SAFY+ +SLFAGF++P+PQIPKW
Sbjct  1122  YLGLLLVALSPNVTVASTLFSAFYTTYSLFAGFVIPQPQIPKW  1164



>ref|XP_006480305.1| PREDICTED: pleiotropic drug resistance protein 3-like [Citrus 
sinensis]
Length=1312

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YLG+LLVA++P+  +A+ L SAFY+ +SLFAGF++P+PQIPKW
Sbjct  1187  YLGLLLVALSPNVTVASTLFSAFYTTYSLFAGFVIPQPQIPKW  1229



>ref|XP_009143512.1| PREDICTED: ABC transporter G family member 33-like isoform X1 
[Brassica rapa]
Length=1423

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y+ + L+++TP+F +AAILQS F+  F+LFAGFL+PKPQIPKW
Sbjct  1298  YVALFLISVTPNFMVAAILQSLFFVAFNLFAGFLIPKPQIPKW  1340



>emb|CDX74973.1| BnaA05g07190D [Brassica napus]
Length=1396

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y+ + L+++TP+F +AAILQS F+  F+LFAGFL+PKPQIPKW
Sbjct  1271  YVALFLISVTPNFMVAAILQSLFFVAFNLFAGFLIPKPQIPKW  1313



>ref|XP_010509355.1| PREDICTED: ABC transporter G family member 33-like [Camelina 
sativa]
Length=1436

 Score = 63.5 bits (153),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YL + L+++TP+F +AA LQS F+  F+LFAGFL+PKPQIPKW
Sbjct  1311  YLALFLISITPNFIVAATLQSLFFVTFNLFAGFLIPKPQIPKW  1353



>gb|KFK34600.1| hypothetical protein AALP_AA5G166700 [Arabis alpina]
Length=705

 Score = 63.2 bits (152),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  2    YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
            YL M LV++TP+F +AAILQS FY  F+LFAGFL+P  Q+PKW
Sbjct  580  YLAMFLVSITPNFMVAAILQSLFYVNFNLFAGFLIPATQVPKW  622



>gb|KDO41110.1| hypothetical protein CISIN_1g042194mg, partial [Citrus sinensis]
Length=364

 Score = 62.4 bits (150),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +2

Query  2    YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
            YLGMLLV++TP+F IA+IL + FY++F+LF+GFL+  P+IP W
Sbjct  239  YLGMLLVSLTPNFMIASILSTVFYTLFNLFSGFLITGPKIPNW  281



>ref|XP_006428294.1| hypothetical protein CICLE_v10010905mg [Citrus clementina]
 gb|ESR41534.1| hypothetical protein CICLE_v10010905mg [Citrus clementina]
Length=1449

 Score = 63.5 bits (153),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YLGMLLV++TP+  IA+IL S  Y++F+LFAGFL+P P+IPKW
Sbjct  1324  YLGMLLVSLTPNSMIASILSSVCYTLFNLFAGFLIPGPKIPKW  1366



>ref|XP_006480376.1| PREDICTED: pleiotropic drug resistance protein 3-like isoform 
X1 [Citrus sinensis]
Length=1449

 Score = 63.5 bits (153),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YLGMLLV++TP+  IA+IL S  Y++F+LFAGFL+P P+IPKW
Sbjct  1324  YLGMLLVSLTPNSMIASILSSVCYTLFNLFAGFLIPGPKIPKW  1366



>gb|KFK34599.1| hypothetical protein AALP_AA5G166700 [Arabis alpina]
Length=728

 Score = 63.2 bits (152),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  2    YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
            YL M LV++TP+F +AAILQS FY  F+LFAGFL+P  Q+PKW
Sbjct  603  YLAMFLVSITPNFMVAAILQSLFYVNFNLFAGFLIPATQVPKW  645



>gb|KFK34601.1| hypothetical protein AALP_AA5G166700 [Arabis alpina]
Length=700

 Score = 63.2 bits (152),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  2    YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
            YL M LV++TP+F +AAILQS FY  F+LFAGFL+P  Q+PKW
Sbjct  575  YLAMFLVSITPNFMVAAILQSLFYVNFNLFAGFLIPATQVPKW  617



>ref|XP_010541365.1| PREDICTED: ABC transporter G family member 42-like isoform X2 
[Tarenaya hassleriana]
Length=1342

 Score = 63.5 bits (153),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YLGMLLVA+TP+  +A  L+SAFY+M +LF+G+L+P+P IPKW
Sbjct  1215  YLGMLLVAITPTLHVAFTLRSAFYAMVNLFSGYLMPEPNIPKW  1257



>ref|XP_009413084.1| PREDICTED: pleiotropic drug resistance protein 3-like [Musa acuminata 
subsp. malaccensis]
Length=1457

 Score = 63.5 bits (153),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YLGMLLV++TP+  +A+I+ S  Y++F+LF+GF+VP PQIPKW
Sbjct  1332  YLGMLLVSLTPNVQVASIMASVCYTLFNLFSGFIVPGPQIPKW  1374



>ref|XP_006480377.1| PREDICTED: pleiotropic drug resistance protein 3-like isoform 
X2 [Citrus sinensis]
Length=1446

 Score = 63.5 bits (153),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YLGMLLV++TP+  IA+IL S  Y++F+LFAGFL+P P+IPKW
Sbjct  1321  YLGMLLVSLTPNSMIASILSSVCYTLFNLFAGFLIPGPKIPKW  1363



>gb|KDO41829.1| hypothetical protein CISIN_1g000517mg [Citrus sinensis]
Length=1449

 Score = 63.5 bits (153),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YLGMLLV++TP+  IA+IL S  Y++F+LFAGFL+P P+IPKW
Sbjct  1324  YLGMLLVSLTPNSMIASILSSVCYTLFNLFAGFLIPGPKIPKW  1366



>ref|XP_010541364.1| PREDICTED: ABC transporter G family member 42-like isoform X1 
[Tarenaya hassleriana]
Length=1375

 Score = 63.2 bits (152),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YLGMLLVA+TP+  +A  L+SAFY+M +LF+G+L+P+P IPKW
Sbjct  1248  YLGMLLVAITPTLHVAFTLRSAFYAMVNLFSGYLMPEPNIPKW  1290



>ref|XP_002977493.1| hypothetical protein SELMODRAFT_106775 [Selaginella moellendorffii]
 gb|EFJ21497.1| hypothetical protein SELMODRAFT_106775 [Selaginella moellendorffii]
Length=1489

 Score = 63.2 bits (152),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  8     GMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             G++ V+MTP+  +AAIL SAFYS+F+LFAGFL+P P+IPKW
Sbjct  1365  GLMSVSMTPNHQVAAILSSAFYSLFNLFAGFLIPYPKIPKW  1405



>ref|XP_002972182.1| ATP-binding cassette transporter [Selaginella moellendorffii]
 gb|EFJ27099.1| ATP-binding cassette transporter [Selaginella moellendorffii]
Length=1450

 Score = 63.2 bits (152),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  8     GMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             G++ V+MTP+  +AAIL SAFYS+F+LFAGFL+P P+IPKW
Sbjct  1326  GLMSVSMTPNHQVAAILSSAFYSLFNLFAGFLIPYPKIPKW  1366



>ref|XP_008223485.1| PREDICTED: pleiotropic drug resistance protein 3-like [Prunus 
mume]
Length=1451

 Score = 63.2 bits (152),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YLGMLLV++TP+  +A+I+ S+ Y+M +LF+GF++P+PQIPKW
Sbjct  1326  YLGMLLVSLTPNVQVASIVASSAYTMLNLFSGFVIPRPQIPKW  1368



>ref|XP_007226413.1| hypothetical protein PRUPE_ppa023381mg [Prunus persica]
 gb|EMJ27612.1| hypothetical protein PRUPE_ppa023381mg [Prunus persica]
Length=1392

 Score = 63.2 bits (152),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YLGMLLV++TP+  +A+I+ S+ Y+M +LF+GF++P+PQIPKW
Sbjct  1267  YLGMLLVSLTPNVQVASIVASSAYTMLNLFSGFVIPRPQIPKW  1309



>ref|XP_006410911.1| hypothetical protein EUTSA_v10016144mg [Eutrema salsugineum]
 dbj|BAJ34252.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ52364.1| hypothetical protein EUTSA_v10016144mg [Eutrema salsugineum]
Length=1427

 Score = 63.2 bits (152),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YL + L+++TP+F +AAILQS F+ +F+LFAGFL+P PQIPKW
Sbjct  1302  YLALFLISITPNFMVAAILQSLFFVVFNLFAGFLIPGPQIPKW  1344



>ref|XP_006410910.1| hypothetical protein EUTSA_v10016141mg [Eutrema salsugineum]
 gb|ESQ52363.1| hypothetical protein EUTSA_v10016141mg [Eutrema salsugineum]
Length=1433

 Score = 63.2 bits (152),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YL + L+++TP+F +AAILQS F+ +F+LFAGFL+P PQIPKW
Sbjct  1308  YLALFLISITPNFMVAAILQSLFFVVFNLFAGFLIPGPQIPKW  1350



>emb|CDX74974.1| BnaA05g07200D [Brassica napus]
Length=1413

 Score = 62.8 bits (151),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YL M L+++TP+F +AAILQS F+  F+LFAGFL+P PQIPKW
Sbjct  1288  YLAMFLISVTPNFMVAAILQSLFFVAFNLFAGFLIPLPQIPKW  1330



>ref|XP_006428269.1| hypothetical protein CICLE_v10010929mg [Citrus clementina]
 gb|ESR41509.1| hypothetical protein CICLE_v10010929mg [Citrus clementina]
Length=1253

 Score = 62.8 bits (151),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YLG+LLVA++P+  +A+ L SAFY+ +SLFAGF++P+PQIPKW
Sbjct  1128  YLGLLLVALSPNVIVASTLFSAFYTTYSLFAGFVIPQPQIPKW  1170



>ref|XP_009342540.1| PREDICTED: ABC transporter G family member 29-like [Pyrus x bretschneideri]
Length=186

 Score = 59.7 bits (143),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +2

Query  2    YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
            Y GM+ V++TP+  +AAI  +AFYS+F+LF+GF +P+P+IPKW
Sbjct  59   YYGMMTVSITPNHQVAAIFAAAFYSIFNLFSGFFIPRPKIPKW  101



>emb|CDX91350.1| BnaC04g08000D [Brassica napus]
Length=1413

 Score = 62.8 bits (151),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YL M L+++TP+F +AAILQS F+  F+LFAGFL+P PQIPKW
Sbjct  1288  YLAMFLISVTPNFMVAAILQSLFFVAFNLFAGFLIPLPQIPKW  1330



>ref|XP_009143515.1| PREDICTED: ABC transporter G family member 33-like [Brassica 
rapa]
Length=1415

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YL M L+++TP+F +AAILQS F+  F+LFAGFL+P PQIPKW
Sbjct  1290  YLAMFLISVTPNFMVAAILQSLFFVAFNLFAGFLIPLPQIPKW  1332



>emb|CDY63361.1| BnaC07g50030D [Brassica napus]
Length=398

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +2

Query  2    YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
            Y GMLLV +TP+  +A  L+S FYSM +LFAG+++PKP IPKW
Sbjct  298  YFGMLLVVITPNIHVAFTLRSGFYSMVNLFAGYVIPKPSIPKW  340



>ref|XP_008228430.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter G family member 
29 [Prunus mume]
Length=1471

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+ V++TP+  IAAI  +AFYS+F+LF+GF +P+P+IPKW
Sbjct  1344  YYGMMTVSITPNHQIAAIFATAFYSVFNLFSGFFIPRPRIPKW  1386



>emb|CDY58249.1| BnaA03g58040D [Brassica napus]
Length=424

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +2

Query  2    YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
            Y GMLLV +TP+  +A  L+S FYSM +LFAG+++PKP IPKW
Sbjct  299  YFGMLLVVITPNIHVAFTLRSGFYSMVNLFAGYVIPKPSIPKW  341



>ref|XP_010267164.1| PREDICTED: ABC transporter G family member 36-like [Nelumbo nucifera]
Length=1497

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+ VA+TP+  +AAI  +AFY +F+LF+GF +PKP+IPKW
Sbjct  1370  YYGMMTVAITPNHQVAAIFAAAFYGLFNLFSGFFIPKPRIPKW  1412



>emb|CDY65557.1| BnaCnng47680D [Brassica napus]
Length=374

 Score = 61.2 bits (147),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +2

Query  2    YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
            Y GMLLV +TP+  +A  L+S FYSM +LFAG+++PKP IPKW
Sbjct  249  YFGMLLVVITPNIHVAFTLRSGFYSMVNLFAGYVIPKPSIPKW  291



>ref|XP_010276541.1| PREDICTED: LOW QUALITY PROTEIN: pleiotropic drug resistance protein 
3-like [Nelumbo nucifera]
Length=1456

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y+GMLLVA+TP+  +AAI  S FY+M  LFAGF++PK QIPKW
Sbjct  1330  YIGMLLVAVTPNVQVAAISTSLFYTMLFLFAGFVIPKQQIPKW  1372



>ref|XP_009136684.1| PREDICTED: ABC transporter G family member 42-like [Brassica 
rapa]
Length=1388

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GMLLV +TP+  +A  L+S FYSM +LFAG+++PKP IPKW
Sbjct  1263  YFGMLLVVITPNIHVAFTLRSGFYSMVNLFAGYVIPKPSIPKW  1305



>ref|XP_007217659.1| hypothetical protein PRUPE_ppa000237mg [Prunus persica]
 gb|EMJ18858.1| hypothetical protein PRUPE_ppa000237mg [Prunus persica]
Length=1419

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+ V++TP+  +AAI  +AFYS+F+LF+GF +P+P+IPKW
Sbjct  1292  YYGMMTVSITPNHQVAAIFATAFYSVFNLFSGFFIPRPRIPKW  1334



>ref|XP_009353554.1| PREDICTED: ABC transporter G family member 29-like [Pyrus x bretschneideri]
Length=1488

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+ VA++P+  +AAIL S FYS F+LF+GF +P+P+IPKW
Sbjct  1361  YYGMMTVAISPNHQVAAILASTFYSFFNLFSGFFIPRPKIPKW  1403



>ref|XP_008380891.1| PREDICTED: ABC transporter G family member 29-like [Malus domestica]
Length=1489

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+ VA++P+  +AAIL S FYS F+LF+GF +P+P+IPKW
Sbjct  1362  YYGMMTVAISPNHQVAAILASTFYSFFNLFSGFFIPRPKIPKW  1404



>gb|KFK23133.1| hypothetical protein AALP_AAs61551U000700 [Arabis alpina]
Length=1318

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/43 (58%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GMLLV +TP+  +A  L+S+FYS+ +LFAGF++PKP IP+W
Sbjct  1193  YFGMLLVVVTPNIHVAFTLRSSFYSIVNLFAGFVIPKPSIPRW  1235



>gb|KFK23132.1| hypothetical protein AALP_AAs61551U000700 [Arabis alpina]
Length=1319

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/43 (58%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GMLLV +TP+  +A  L+S+FYS+ +LFAGF++PKP IP+W
Sbjct  1194  YFGMLLVVVTPNIHVAFTLRSSFYSIVNLFAGFVIPKPSIPRW  1236



>ref|XP_007154453.1| hypothetical protein PHAVU_003G120500g [Phaseolus vulgaris]
 gb|ESW26447.1| hypothetical protein PHAVU_003G120500g [Phaseolus vulgaris]
Length=1450

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YLGMLLV++TP+  +A+I+ S+ Y+M +LF+G+ VP+PQIPKW
Sbjct  1325  YLGMLLVSLTPNVQLASIVASSSYTMLNLFSGYFVPRPQIPKW  1367



>gb|EAZ01322.1| hypothetical protein OsI_23352 [Oryza sativa Indica Group]
Length=1499

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+ VA++P+  +AAI  +AFYS+F+LF+GF +P+P+IPKW
Sbjct  1373  YYGMMTVAISPNHEVAAIFAAAFYSLFNLFSGFFIPRPRIPKW  1415



>sp|Q5Z9S8.1|PDR12_ORYSJ RecName: Full=Pleiotropic drug resistance protein 12 [Oryza sativa 
Japonica Group]
 dbj|BAD53545.1| PDR-like ABC transporter [Oryza sativa Japonica Group]
 gb|EEE65874.1| hypothetical protein OsJ_21675 [Oryza sativa Japonica Group]
Length=1500

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+ VA++P+  +AAI  +AFYS+F+LF+GF +P+P+IPKW
Sbjct  1374  YYGMMTVAISPNHEVAAIFAAAFYSLFNLFSGFFIPRPRIPKW  1416



>emb|CAD59565.1| PDR-like ABC transporter [Oryza sativa Japonica Group]
Length=1500

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+ VA++P+  +AAI  +AFYS+F+LF+GF +P+P+IPKW
Sbjct  1374  YYGMMTVAISPNHEVAAIFAAAFYSLFNLFSGFFIPRPRIPKW  1416



>ref|XP_007216610.1| hypothetical protein PRUPE_ppa026987mg [Prunus persica]
 gb|EMJ17809.1| hypothetical protein PRUPE_ppa026987mg [Prunus persica]
Length=1493

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+ V++TP+  +AAI  +AFYS+F+LF+GF +P+P+IPKW
Sbjct  1366  YYGMMTVSITPNHQVAAIFAAAFYSVFNLFSGFFIPRPRIPKW  1408



>ref|XP_009359775.1| PREDICTED: pleiotropic drug resistance protein 3-like [Pyrus 
x bretschneideri]
Length=1453

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YLGML+V++TP+  +AAI+ SA Y+M +LF+GF++P+P IPKW
Sbjct  1328  YLGMLIVSLTPNVQVAAIVASASYAMLNLFSGFVLPRPHIPKW  1370



>ref|XP_011013375.1| PREDICTED: ABC transporter G family member 29-like [Populus euphratica]
Length=1485

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+ V++TP+  IAAI   AFYS+F+LF+GF +P+P+IPKW
Sbjct  1358  YYGMMAVSVTPNHQIAAIFAGAFYSLFNLFSGFFIPRPKIPKW  1400



>ref|XP_008810342.1| PREDICTED: LOW QUALITY PROTEIN: pleiotropic drug resistance protein 
3-like, partial [Phoenix dactylifera]
Length=1154

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YLGMLLV++TP+  +A+IL S  Y++  LF+GF+VP+PQIPKW
Sbjct  1029  YLGMLLVSLTPNIQVASILASVCYTLLILFSGFVVPRPQIPKW  1071



>ref|XP_006656159.1| PREDICTED: pleiotropic drug resistance protein 12-like [Oryza 
brachyantha]
Length=1181

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+ VA++P+  +AAI  +AFYS+F+LF+GF +P+P+IPKW
Sbjct  1055  YYGMMTVAISPNHEVAAIFAAAFYSLFNLFSGFFIPRPRIPKW  1097



>ref|XP_009353553.1| PREDICTED: ABC transporter G family member 36-like [Pyrus x bretschneideri]
Length=1352

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+ V++TP+  +AAI  +AFYS+F+LF+GF +P+P+IPKW
Sbjct  1225  YYGMMTVSITPNHQVAAIFAAAFYSVFNLFSGFFIPRPKIPKW  1267



>gb|ABK24866.1| unknown [Picea sitchensis]
Length=471

 Score = 60.8 bits (146),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +2

Query  2    YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
            Y GML VA++P+  +AA++ SAFYS+F+LF+GFL+ +PQ+P+W
Sbjct  345  YYGMLTVAISPNAQVAAVISSAFYSIFNLFSGFLITRPQLPRW  387



>ref|XP_008228429.1| PREDICTED: ABC transporter G family member 29-like [Prunus mume]
Length=1504

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+ V++TP+  +AAI  +AFYS+F+LF+GF +P+P+IPKW
Sbjct  1377  YYGMMTVSITPNHQVAAIFAAAFYSVFNLFSGFFIPRPRIPKW  1419



>ref|XP_007024294.1| ABC-2 and Plant PDR ABC-type transporter family protein isoform 
1 [Theobroma cacao]
 gb|EOY26916.1| ABC-2 and Plant PDR ABC-type transporter family protein isoform 
1 [Theobroma cacao]
Length=1494

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+ V++TP+  IAAI  SAFY++F++F+GF +P+P+IPKW
Sbjct  1367  YYGMMTVSITPNLQIAAIFASAFYALFNVFSGFFIPRPRIPKW  1409



>ref|XP_009353555.1| PREDICTED: ABC transporter G family member 36-like [Pyrus x bretschneideri]
Length=1463

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+ V++TP+  +AAI  +AFYS+F+LF+GF +P+P+IPKW
Sbjct  1336  YYGMMTVSITPNHQVAAIFAAAFYSIFNLFSGFFIPRPKIPKW  1378



>ref|NP_001057850.1| Os06g0554800 [Oryza sativa Japonica Group]
 dbj|BAD53546.1| putative PDR-like ABC transporter [Oryza sativa Japonica Group]
 dbj|BAF19764.1| Os06g0554800 [Oryza sativa Japonica Group]
 dbj|BAH00354.1| unnamed protein product [Oryza sativa Japonica Group]
Length=1167

 Score = 61.2 bits (147),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+ VA++P+  +AAI  +AFYS+F+LF+GF +P+P+IPKW
Sbjct  1041  YYGMMTVAISPNHEVAAIFAAAFYSLFNLFSGFFIPRPRIPKW  1083



>ref|XP_009348546.1| PREDICTED: ABC transporter G family member 29-like [Pyrus x bretschneideri]
Length=1499

 Score = 61.2 bits (147),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+ V++TP+  +AAI  +AFYS+F+LF+GF +P+P+IPKW
Sbjct  1372  YYGMMTVSITPNHQVAAIFAAAFYSVFNLFSGFFIPRPKIPKW  1414



>ref|XP_002303308.1| ABC transporter family protein [Populus trichocarpa]
 gb|EEE78287.1| ABC transporter family protein [Populus trichocarpa]
Length=1448

 Score = 61.2 bits (147),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+ VA+TP+  IAAI  + FYS+F+LF+GF +P+P+IPKW
Sbjct  1321  YYGMMAVAVTPNHQIAAIFAATFYSLFNLFSGFFIPRPKIPKW  1363



>ref|XP_007024295.1| ABC-2 and Plant PDR ABC-type transporter family protein isoform 
2 [Theobroma cacao]
 gb|EOY26917.1| ABC-2 and Plant PDR ABC-type transporter family protein isoform 
2 [Theobroma cacao]
Length=1455

 Score = 61.2 bits (147),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+ V++TP+  IAAI  SAFY++F++F+GF +P+P+IPKW
Sbjct  1328  YYGMMTVSITPNLQIAAIFASAFYALFNVFSGFFIPRPRIPKW  1370



>ref|XP_007024297.1| ABC-2 and Plant PDR ABC-type transporter family protein isoform 
4, partial [Theobroma cacao]
 gb|EOY26919.1| ABC-2 and Plant PDR ABC-type transporter family protein isoform 
4, partial [Theobroma cacao]
Length=1144

 Score = 61.2 bits (147),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+ V++TP+  IAAI  SAFY++F++F+GF +P+P+IPKW
Sbjct  1097  YYGMMTVSITPNLQIAAIFASAFYALFNVFSGFFIPRPRIPKW  1139



>emb|CDX97743.1| BnaA05g23360D [Brassica napus]
Length=1413

 Score = 61.2 bits (147),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+ VA+TP+  +AAI   AFY +F+LF+GFL+P+P+IPKW
Sbjct  1286  YYGMMAVAITPNQQVAAIFAGAFYGLFNLFSGFLIPRPRIPKW  1328



>ref|XP_002512482.1| ATP-binding cassette transporter, putative [Ricinus communis]
 gb|EEF49934.1| ATP-binding cassette transporter, putative [Ricinus communis]
Length=1458

 Score = 61.2 bits (147),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y+GMLLV++TP+  +A+IL S+ Y+M  LF GF+VP+P+IPKW
Sbjct  1316  YMGMLLVSLTPNIQVASILASSTYTMLILFTGFIVPRPRIPKW  1358



>ref|XP_006296832.1| hypothetical protein CARUB_v10012817mg [Capsella rubella]
 gb|EOA29730.1| hypothetical protein CARUB_v10012817mg [Capsella rubella]
Length=1411

 Score = 61.2 bits (147),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+ VA+TP+  +AA+   AFY +F+LF+GFL+P+P+IPKW
Sbjct  1284  YYGMMTVALTPNQQVAAVFAGAFYGLFNLFSGFLIPRPRIPKW  1326



>ref|XP_007024296.1| ABC-2 and Plant PDR ABC-type transporter family protein isoform 
3 [Theobroma cacao]
 gb|EOY26918.1| ABC-2 and Plant PDR ABC-type transporter family protein isoform 
3 [Theobroma cacao]
Length=1322

 Score = 61.2 bits (147),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+ V++TP+  IAAI  SAFY++F++F+GF +P+P+IPKW
Sbjct  1195  YYGMMTVSITPNLQIAAIFASAFYALFNVFSGFFIPRPRIPKW  1237



>ref|XP_009146147.1| PREDICTED: ABC transporter G family member 29 [Brassica rapa]
Length=1413

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+ VA+TP+  +AAI   AFY +F+LF+GFL+P+P+IPKW
Sbjct  1286  YYGMMAVAITPNQQVAAIFAGAFYGLFNLFSGFLIPRPRIPKW  1328



>gb|AEX12569.1| hypothetical protein 2_4825_01 [Pinus taeda]
 gb|AEX12570.1| hypothetical protein 2_4825_01 [Pinus taeda]
Length=142

 Score = 57.8 bits (138),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +2

Query  8    GMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
            GML VA+TP++ I AI+ SAFYS+++LF GF++P+P++P W
Sbjct  36   GMLTVAVTPNYHIGAIISSAFYSLWNLFCGFIIPRPKMPIW  76



>ref|XP_009137091.1| PREDICTED: ABC transporter G family member 42-like [Brassica 
rapa]
Length=1389

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GMLLV +TP+  +A  L+S FYSM +LFAG+++PKP IPKW
Sbjct  1264  YFGMLLVVITPNIHVAFTLRSGFYSMVNLFAGYVMPKPSIPKW  1306



>ref|XP_009141643.1| PREDICTED: ABC transporter G family member 33 [Brassica rapa]
Length=1414

 Score = 60.8 bits (146),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YL + L+++TP+F +AAILQS F+  F+LFAGFL+P PQIPKW
Sbjct  1289  YLALFLISITPNFMLAAILQSLFFVAFNLFAGFLIPLPQIPKW  1331



>ref|XP_008392747.1| PREDICTED: ABC transporter G family member 36-like, partial [Malus 
domestica]
Length=1192

 Score = 60.8 bits (146),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+ V++TP+  +AAI  +AFYS+F+LF+GF +P+P+IPKW
Sbjct  1065  YYGMMTVSITPNHQVAAIFAAAFYSVFNLFSGFFIPRPKIPKW  1107



>ref|XP_002870254.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46513.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=1149

 Score = 60.8 bits (146),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GML+VA+TP+  +A  L+S+F+SM +LFAGF++PK +IPKW
Sbjct  1024  YCGMLMVALTPNVHMAVTLRSSFFSMLNLFAGFVIPKQKIPKW  1066



>gb|KHM98721.1| ABC transporter G family member 36 [Glycine soja]
Length=1485

 Score = 60.8 bits (146),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+ V++TP+  IA+IL +AFY +F+LF+GF +P+P+IPKW
Sbjct  1359  YYGMMTVSITPNHQIASILGAAFYGIFNLFSGFFIPRPKIPKW  1401



>dbj|BAK07655.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=593

 Score = 60.5 bits (145),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +2

Query  2    YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
            Y GM+ V+++P+  +AAI  +AFYS+F+LF+GF +P+P+IPKW
Sbjct  467  YYGMMTVSISPNHEVAAIFAAAFYSLFNLFSGFFIPRPKIPKW  509



>emb|CDY30162.1| BnaC05g37000D [Brassica napus]
Length=889

 Score = 60.5 bits (145),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  2    YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
            Y GM+ VA+TP+  +AAI   AFY +F+LF+GFL+P+P+IPKW
Sbjct  762  YYGMMAVAITPNQQVAAIFAGAFYGLFNLFSGFLIPRPRIPKW  804



>ref|XP_010250339.1| PREDICTED: pleiotropic drug resistance protein 12-like [Nelumbo 
nucifera]
Length=1271

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+ V++TP+  IA+I  +AFY +F+LF+GF +PKP+IPKW
Sbjct  1145  YYGMMTVSITPNHEIASIFAAAFYGLFNLFSGFFIPKPKIPKW  1187



>ref|XP_003563764.2| PREDICTED: pleiotropic drug resistance protein 12 [Brachypodium 
distachyon]
Length=1509

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+ V+++P+  +AAI  +AFYS+F+LF+GF +P+P+IPKW
Sbjct  1383  YYGMMTVSISPNHEVAAIFAAAFYSLFNLFSGFFIPRPRIPKW  1425



>emb|CDY20193.1| BnaA01g28090D [Brassica napus]
Length=1386

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+ VA+TP+  +AA+   AFY +F+LF+GFL+P+P+IPKW
Sbjct  1259  YYGMMAVAITPNQQVAAVFAGAFYGLFNLFSGFLIPRPRIPKW  1301



>ref|XP_010674511.1| PREDICTED: LOW QUALITY PROTEIN: pleiotropic drug resistance protein 
3-like [Beta vulgaris subsp. vulgaris]
Length=1441

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y+GM+L+++TP+  +AAI  SA Y++ +LF+GFL+P+PQIPKW
Sbjct  1316  YMGMMLISLTPNSQLAAITASAIYALMNLFSGFLIPQPQIPKW  1358



>ref|XP_004305262.1| PREDICTED: ABC transporter G family member 36-like [Fragaria 
vesca subsp. vesca]
Length=1489

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+ V++TP+  +A+I  +AFYS+F+LF+GF +P+P+IPKW
Sbjct  1362  YYGMMTVSITPNHQVASIFAAAFYSLFNLFSGFFIPRPKIPKW  1404



>emb|CDY18456.1| BnaA04g21310D [Brassica napus]
Length=1406

 Score = 60.5 bits (145),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YL + L+++TP+F +AAILQS F+  F+LFAGFL+P PQIPKW
Sbjct  1281  YLALFLISITPNFMLAAILQSLFFIAFNLFAGFLIPLPQIPKW  1323



>ref|XP_009114810.1| PREDICTED: ABC transporter G family member 29 [Brassica rapa]
Length=1413

 Score = 60.5 bits (145),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+ VA+TP+  +AA+   AFY +F+LF+GFL+P+P+IPKW
Sbjct  1286  YYGMMAVAITPNQQVAAVFAGAFYGLFNLFSGFLIPRPRIPKW  1328



>gb|KHN32645.1| ABC transporter G family member 36 [Glycine soja]
Length=1487

 Score = 60.5 bits (145),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+ V++TP+  +A+IL +AFY +F+LF+GF +P+P+IPKW
Sbjct  1361  YYGMMTVSITPNHQVASILGAAFYGIFNLFSGFFIPRPKIPKW  1403



>gb|EMS55442.1| Pleiotropic drug resistance protein 12 [Triticum urartu]
Length=1088

 Score = 60.5 bits (145),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+ V+++P+  +AAI  +AFYS+F+LF+GF +P+P+IPKW
Sbjct  962   YYGMMTVSISPNHEVAAIFAAAFYSLFNLFSGFFIPRPKIPKW  1004



>ref|XP_006595126.1| PREDICTED: ABC transporter G family member 36-like [Glycine max]
Length=1487

 Score = 60.5 bits (145),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+ V++TP+  +A+IL +AFY +F+LF+GF +P+P+IPKW
Sbjct  1361  YYGMMTVSITPNHQVASILGAAFYGIFNLFSGFFIPRPKIPKW  1403



>ref|XP_010515839.1| PREDICTED: ABC transporter G family member 37 isoform X1 [Camelina 
sativa]
Length=1483

 Score = 60.5 bits (145),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YL M LV++TP+F +AAILQS FY  F+LF+GFL+P+ Q+P W
Sbjct  1358  YLAMFLVSITPNFMVAAILQSLFYVNFNLFSGFLIPQTQVPGW  1400



>ref|XP_010426998.1| PREDICTED: ABC transporter G family member 37-like [Camelina 
sativa]
Length=1456

 Score = 60.5 bits (145),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YL M LV++TP+F +AAILQS FY  F+LF+GFL+P+ Q+P W
Sbjct  1331  YLAMFLVSITPNFMVAAILQSLFYVNFNLFSGFLIPQTQVPGW  1373



>ref|XP_010515840.1| PREDICTED: ABC transporter G family member 37 isoform X2 [Camelina 
sativa]
Length=1456

 Score = 60.5 bits (145),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YL M LV++TP+F +AAILQS FY  F+LF+GFL+P+ Q+P W
Sbjct  1331  YLAMFLVSITPNFMVAAILQSLFYVNFNLFSGFLIPQTQVPGW  1373



>ref|XP_010504111.1| PREDICTED: ABC transporter G family member 37-like [Camelina 
sativa]
Length=1456

 Score = 60.5 bits (145),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YL M LV++TP+F +AAILQS FY  F+LF+GFL+P+ Q+P W
Sbjct  1331  YLAMFLVSITPNFMVAAILQSLFYVNFNLFSGFLIPQTQVPGW  1373



>ref|XP_006290499.1| hypothetical protein CARUB_v10016573mg [Capsella rubella]
 gb|EOA23397.1| hypothetical protein CARUB_v10016573mg [Capsella rubella]
Length=1448

 Score = 60.5 bits (145),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YL M LV++TP+F +AAILQS FY  F+LF+GFL+P+ Q+P W
Sbjct  1323  YLAMFLVSITPNFMVAAILQSLFYVNFNLFSGFLIPQTQVPGW  1365



>ref|XP_008390491.1| PREDICTED: pleiotropic drug resistance protein 3-like [Malus 
domestica]
Length=1453

 Score = 60.5 bits (145),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YLGML+V++TP+  +AAI+ SA Y+M +LF+GF++P+ QIPKW
Sbjct  1328  YLGMLIVSLTPNVQVAAIVASASYAMLNLFSGFVIPRLQIPKW  1370



>ref|XP_004486779.1| PREDICTED: ABC transporter G family member 36-like isoform X1 
[Cicer arietinum]
 ref|XP_004486780.1| PREDICTED: ABC transporter G family member 36-like isoform X2 
[Cicer arietinum]
Length=1446

 Score = 60.5 bits (145),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 22/43 (51%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+ V++TP+  +A+I  +AFY +F+LF+GF +P+P+IPKW
Sbjct  1319  YYGMMTVSITPNHQVASIFGAAFYGLFNLFSGFFIPRPKIPKW  1361



>ref|NP_193258.3| ABC transporter G family member 30 [Arabidopsis thaliana]
 sp|Q8GZ52.2|AB30G_ARATH RecName: Full=ABC transporter G family member 30; Short=ABC transporter 
ABCG.30; Short=AtABCG30; AltName: Full=Pleiotropic 
drug resistance protein 2 [Arabidopsis thaliana]
 tpg|DAA00869.1| TPA_exp: PDR2 ABC transporter [Arabidopsis thaliana]
 gb|AEE83571.1| ABC transporter G family member 30 [Arabidopsis thaliana]
Length=1400

 Score = 60.5 bits (145),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GML+VA+TP+  +A  L+S+F+SM +LFAGF++PK +IPKW
Sbjct  1275  YSGMLMVALTPNIHMAVTLRSSFFSMLNLFAGFVIPKQKIPKW  1317



>ref|XP_010033839.1| PREDICTED: ABC transporter G family member 35-like [Eucalyptus 
grandis]
Length=1503

 Score = 60.5 bits (145),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+ VA+TP+  +AAI  +AFY +F+LF+GF +P+P+IPKW
Sbjct  1377  YYGMMTVALTPNQQVAAIFAAAFYGLFNLFSGFFIPRPKIPKW  1419



>gb|KCW53679.1| hypothetical protein EUGRSUZ_J02941 [Eucalyptus grandis]
Length=1458

 Score = 60.5 bits (145),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+ VA+TP+  +AAI  +AFY +F+LF+GF +P+P+IPKW
Sbjct  1332  YYGMMTVALTPNQQVAAIFAAAFYGLFNLFSGFFIPRPRIPKW  1374



>gb|KCW53680.1| hypothetical protein EUGRSUZ_J02944 [Eucalyptus grandis]
Length=1479

 Score = 60.5 bits (145),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+ VA+TP+  +AAI  +AFY +F+LF+GF +P+P+IPKW
Sbjct  1353  YYGMMTVALTPNQQVAAIFAAAFYGLFNLFSGFFIPRPKIPKW  1395



>ref|XP_010033840.1| PREDICTED: ABC transporter G family member 29-like isoform X1 
[Eucalyptus grandis]
Length=1495

 Score = 60.5 bits (145),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+ VA+TP+  +AAI  +AFY +F+LF+GF +P+P+IPKW
Sbjct  1369  YYGMMTVALTPNQQVAAIFAAAFYGLFNLFSGFFIPRPRIPKW  1411



>ref|XP_002876207.1| ATPDR9/PDR9 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52466.1| ATPDR9/PDR9 [Arabidopsis lyrata subsp. lyrata]
Length=1450

 Score = 60.5 bits (145),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YL M LV++TP+F +AAILQS FY  F+LF+GFL+P+ Q+P W
Sbjct  1325  YLAMFLVSITPNFMVAAILQSLFYVNFNLFSGFLIPQTQVPGW  1367



>ref|XP_004304950.1| PREDICTED: pleiotropic drug resistance protein 3-like [Fragaria 
vesca subsp. vesca]
Length=1479

 Score = 60.5 bits (145),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y G+LL A+TP+F +A +L S  Y+MF+LF+GFLVP P+IPKW
Sbjct  1354  YFGILLAALTPTFQVAMVLASFCYTMFNLFSGFLVPGPKIPKW  1396



>ref|XP_010099709.1| Pleiotropic drug resistance protein 3 [Morus notabilis]
 gb|EXB80286.1| Pleiotropic drug resistance protein 3 [Morus notabilis]
Length=1431

 Score = 60.5 bits (145),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YLGML+V+++P+  +A IL SA Y++ +LF+GFL+P P+IPKW
Sbjct  1306  YLGMLIVSLSPNLEVATILSSAIYTILNLFSGFLMPGPKIPKW  1348



>emb|CAB45997.1| ABC transporter like protein [Arabidopsis thaliana]
 emb|CAB78565.1| ABC transporter like protein [Arabidopsis thaliana]
Length=979

 Score = 60.1 bits (144),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +2

Query  2    YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
            Y GML+VA+TP+  +A  L+S+F+SM +LFAGF++PK +IPKW
Sbjct  854  YSGMLMVALTPNIHMAVTLRSSFFSMLNLFAGFVIPKQKIPKW  896



>ref|XP_002883000.1| ATPDR1/PDR1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59259.1| ATPDR1/PDR1 [Arabidopsis lyrata subsp. lyrata]
Length=1420

 Score = 60.5 bits (145),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+ VA+TP+  +AA+   AFY +F+LF+GF++P+P+IPKW
Sbjct  1293  YYGMMTVALTPNQQVAAVFAGAFYGLFNLFSGFVIPRPRIPKW  1335



>ref|XP_010487490.1| PREDICTED: ABC transporter G family member 29-like [Camelina 
sativa]
Length=1416

 Score = 60.1 bits (144),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+ VA+TP+  +AA+   AFY +F+LF+GF++P+P+IPKW
Sbjct  1289  YYGMMTVALTPNQQVAAVFAGAFYGLFNLFSGFVIPRPRIPKW  1331



>gb|AES67934.2| drug resistance transporter-like ABC domain protein [Medicago 
truncatula]
Length=1446

 Score = 60.1 bits (144),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+ V++TP+  +AAI  +AFY +F+LF+GF +P+P+IPKW
Sbjct  1319  YYGMMTVSITPNHQVAAIFGAAFYGLFNLFSGFFIPRPKIPKW  1361



>gb|EMT29772.1| Pleiotropic drug resistance protein 3 [Aegilops tauschii]
Length=1372

 Score = 60.1 bits (144),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YLGML+V++TP+  +A+IL S FY++ +L +GF+VP PQIPKW
Sbjct  1246  YLGMLMVSLTPNIQVASILASMFYTLQNLMSGFIVPAPQIPKW  1288



>ref|XP_002298240.1| ABC transporter family protein [Populus trichocarpa]
 gb|EEE83045.1| ABC transporter family protein [Populus trichocarpa]
Length=1436

 Score = 60.1 bits (144),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+ V++TP+  +AAI  + FYS+F+LF+GF +P+P+IPKW
Sbjct  1308  YYGMMTVSVTPNHQVAAIFAATFYSLFNLFSGFFIPRPKIPKW  1350



>ref|XP_009148905.1| PREDICTED: ABC transporter G family member 35-like [Brassica 
rapa]
Length=1435

 Score = 60.1 bits (144),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+ V++TP+  +A+I  SAFY +F+LF+GF +P+P+IPKW
Sbjct  1308  YYGMMTVSLTPNHQVASIFASAFYGIFNLFSGFFIPRPKIPKW  1350



>emb|CDY39621.1| BnaC05g11500D [Brassica napus]
Length=1436

 Score = 60.1 bits (144),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+ V++TP+  +A+I  SAFY +F+LF+GF +P+P+IPKW
Sbjct  1309  YYGMMTVSLTPNHQVASIFASAFYGIFNLFSGFFIPRPKIPKW  1351



>ref|XP_010465656.1| PREDICTED: ABC transporter G family member 29 [Camelina sativa]
Length=1414

 Score = 60.1 bits (144),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+ VA+TP+  +AA+   AFY +F+LF+GF++P+P+IPKW
Sbjct  1287  YYGMMTVALTPNQQVAAVFAGAFYGLFNLFSGFVIPRPRIPKW  1329



>ref|NP_566543.1| p-coumaryl alcohol exporter [Arabidopsis thaliana]
 sp|Q94A18.2|AB29G_ARATH RecName: Full=ABC transporter G family member 29; Short=ABC transporter 
ABCG.29; Short=AtABCG29; AltName: Full=Pleiotropic 
drug resistance protein 1 [Arabidopsis thaliana]
 gb|AAB63643.1| ABC transporter (PDR5-like) isolog [Arabidopsis thaliana]
 dbj|BAB01273.1| ABC transporter [Arabidopsis thaliana]
 tpg|DAA00870.1| TPA_exp: PDR1 ABC transporter [Arabidopsis thaliana]
 gb|AEE75799.1| p-coumaryl alcohol exporter [Arabidopsis thaliana]
Length=1416

 Score = 60.1 bits (144),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+ VA+TP+  +AA+   AFY +F+LF+GF++P+P+IPKW
Sbjct  1289  YYGMMTVALTPNQQVAAVFAGAFYGLFNLFSGFVIPRPRIPKW  1331



>ref|NP_001189911.1| p-coumaryl alcohol exporter [Arabidopsis thaliana]
 gb|AEE75800.1| p-coumaryl alcohol exporter [Arabidopsis thaliana]
Length=1411

 Score = 60.1 bits (144),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+ VA+TP+  +AA+   AFY +F+LF+GF++P+P+IPKW
Sbjct  1284  YYGMMTVALTPNQQVAAVFAGAFYGLFNLFSGFVIPRPRIPKW  1326



>emb|CDY36535.1| BnaA06g09880D [Brassica napus]
Length=1460

 Score = 60.1 bits (144),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+ V++TP+  +A+I  SAFY +F+LF+GF +P+P+IPKW
Sbjct  1333  YYGMMTVSLTPNHQVASIFASAFYGIFNLFSGFFIPRPKIPKW  1375



>ref|XP_011010430.1| PREDICTED: ABC transporter G family member 29-like [Populus euphratica]
Length=1479

 Score = 60.1 bits (144),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+ V++TP+  +AAI  + FYS+F+LF+GF +P+P+IPKW
Sbjct  1352  YYGMMTVSVTPNHQVAAIFAATFYSLFNLFSGFFIPRPKIPKW  1394



>ref|XP_003597683.1| ABC transporter G family member [Medicago truncatula]
Length=1301

 Score = 60.1 bits (144),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+ V++TP+  +AAI  +AFY +F+LF+GF +P+P+IPKW
Sbjct  1174  YYGMMTVSITPNHQVAAIFGAAFYGLFNLFSGFFIPRPKIPKW  1216



>ref|XP_010062527.1| PREDICTED: ABC transporter G family member 29-like [Eucalyptus 
grandis]
 gb|KCW69671.1| hypothetical protein EUGRSUZ_F03072 [Eucalyptus grandis]
Length=1492

 Score = 60.1 bits (144),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+ V++TP+  +A+I  +AFY +F+LF+GF +PKP+IPKW
Sbjct  1365  YYGMMTVSLTPNHQVASIFAAAFYGLFNLFSGFFIPKPKIPKW  1407



>ref|XP_006853667.1| hypothetical protein AMTR_s00056p00117010 [Amborella trichopoda]
 gb|ERN15134.1| hypothetical protein AMTR_s00056p00117010 [Amborella trichopoda]
Length=1492

 Score = 60.1 bits (144),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+ V++TP+  +AAI  +AFYS+F+LF+GF +PK +IPKW
Sbjct  1366  YYGMMTVSITPNHQVAAIFAAAFYSLFNLFSGFFIPKKRIPKW  1408



>gb|AEM44336.1| PEN3 [Arabis alpina]
 gb|KFK42381.1| hypothetical protein AALP_AA2G248800 [Arabis alpina]
Length=1467

 Score = 60.1 bits (144),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+ V++TP+  +A+I  SAFY +F+LF+GF +PKP+IPKW
Sbjct  1340  YYGMMTVSLTPNQQVASIFASAFYGIFNLFSGFFIPKPKIPKW  1382



>gb|KCW69670.1| hypothetical protein EUGRSUZ_F03072 [Eucalyptus grandis]
Length=1493

 Score = 60.1 bits (144),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+ V++TP+  +A+I  +AFY +F+LF+GF +PKP+IPKW
Sbjct  1366  YYGMMTVSLTPNHQVASIFAAAFYGLFNLFSGFFIPKPKIPKW  1408



>gb|AAK91463.1| AT3g16340/MYA6_15 [Arabidopsis thaliana]
Length=412

 Score = 59.3 bits (142),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  2    YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
            Y GM+ VA+TP+  +AA+   AFY +F+LF+GF++P+P+IPKW
Sbjct  285  YYGMMTVALTPNQQVAAVFAGAFYGLFNLFSGFVIPRPRIPKW  327



>dbj|BAC41879.1| putative ABC transporter [Arabidopsis thaliana]
Length=760

 Score = 59.7 bits (143),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +2

Query  2    YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
            Y GML+VA+TP+  +A  L+S+F+SM +LFAGF++PK +IPKW
Sbjct  635  YSGMLMVALTPNIHMAVTLRSSFFSMLNLFAGFVIPKQKIPKW  677



>ref|XP_009417715.1| PREDICTED: pleiotropic drug resistance protein 12-like [Musa 
acuminata subsp. malaccensis]
Length=1500

 Score = 60.1 bits (144),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+ V+++P+  +AAI  S FYS+F+LF+GF +P+P+IPKW
Sbjct  1373  YYGMMTVSLSPNHQVAAIFASTFYSVFNLFSGFFIPRPRIPKW  1415



>ref|XP_006414554.1| hypothetical protein EUTSA_v10024221mg [Eutrema salsugineum]
 gb|ESQ56007.1| hypothetical protein EUTSA_v10024221mg [Eutrema salsugineum]
Length=1394

 Score = 60.1 bits (144),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GML+VA+TP+  +A  L+S F+SM +LFAGF++PK +IPKW
Sbjct  1269  YCGMLMVALTPNIHMALTLRSTFFSMVNLFAGFVIPKQKIPKW  1311



>gb|EMS59048.1| Putative pleiotropic drug resistance protein 7 [Triticum urartu]
Length=1379

 Score = 60.1 bits (144),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  8     GMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             GM+ VAMTP+  IAAI+ +AFY+++++FAGFLVP+P+IP W
Sbjct  1258  GMMAVAMTPNSDIAAIVATAFYAVWNIFAGFLVPRPRIPIW  1298



>ref|NP_190916.1| ABC transporter G family member 37 [Arabidopsis thaliana]
 sp|Q9LFH0.1|AB37G_ARATH RecName: Full=ABC transporter G family member 37; Short=ABC transporter 
ABCG.37; Short=AtABCG37; AltName: Full=Probable pleiotropic 
drug resistance protein 9 [Arabidopsis thaliana]
 emb|CAB67655.1| ABC transporter-like protein [Arabidopsis thaliana]
 tpg|DAA00877.1| TPA_exp: PDR9 ABC transporter [Arabidopsis thaliana]
 gb|AEE79095.1| ABC transporter G family member 37 [Arabidopsis thaliana]
Length=1450

 Score = 60.1 bits (144),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YL M LV++TP+F +AAILQS FY  F+LF+GFL+P+ Q+P W
Sbjct  1325  YLAMFLVSITPNFMVAAILQSLFYVGFNLFSGFLIPQTQVPGW  1367



>gb|AFW56027.1| hypothetical protein ZEAMMB73_465499 [Zea mays]
Length=1377

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YLGML+V++TP+  +A+IL S FY++ +L +GF+VP PQIPKW
Sbjct  1251  YLGMLMVSVTPNIQVASILTSLFYTIQNLMSGFIVPGPQIPKW  1293



>ref|XP_004239721.1| PREDICTED: pleiotropic drug resistance protein 2-like [Solanum 
lycopersicum]
Length=1478

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +2

Query  8     GMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             GM+LVA+TPS+PIAAI+ + F ++++LF+GFL+P+PQIP W
Sbjct  1354  GMMLVALTPSYPIAAIVMTFFLTLWNLFSGFLIPRPQIPIW  1394



>ref|XP_008662457.1| PREDICTED: pleiotropic drug resistance protein 3-like isoform 
X1 [Zea mays]
Length=1477

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YLGML+V++TP+  +A+IL S FY++ +L +GF+VP PQIPKW
Sbjct  1351  YLGMLMVSVTPNIQVASILTSLFYTIQNLMSGFIVPGPQIPKW  1393



>ref|XP_008662458.1| PREDICTED: pleiotropic drug resistance protein 3-like isoform 
X2 [Zea mays]
Length=1472

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YLGML+V++TP+  +A+IL S FY++ +L +GF+VP PQIPKW
Sbjct  1346  YLGMLMVSVTPNIQVASILTSLFYTIQNLMSGFIVPGPQIPKW  1388



>ref|XP_006374091.1| hypothetical protein POPTR_0015s00840g [Populus trichocarpa]
 gb|ERP51888.1| hypothetical protein POPTR_0015s00840g [Populus trichocarpa]
Length=1406

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GMLLV++TP+  +AAIL S  Y+M + F+GF+VPKP IPKW
Sbjct  1281  YQGMLLVSLTPNIQVAAILASFSYTMLNFFSGFVVPKPHIPKW  1323



>ref|XP_010545667.1| PREDICTED: ABC transporter G family member 29 [Tarenaya hassleriana]
Length=1449

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+ V++TP+  +AAI  +AFY +F+LF+GF +P+P+IPKW
Sbjct  1322  YYGMMTVSITPNLQVAAIFAAAFYGVFNLFSGFFIPRPKIPKW  1364



>ref|XP_008679861.1| PREDICTED: putative pleiotropic drug resistance protein 7 [Zea 
mays]
 gb|AFW66091.1| hypothetical protein ZEAMMB73_361265 [Zea mays]
Length=1443

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  8     GMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             GM+ VAMTP+  IAAI+ +AFY+++++FAGFL+P+P+IP W
Sbjct  1321  GMMAVAMTPNSDIAAIVSTAFYAIWNIFAGFLIPRPRIPIW  1361



>ref|XP_002321371.2| hypothetical protein POPTR_0015s00840g [Populus trichocarpa]
 gb|EEF05498.2| hypothetical protein POPTR_0015s00840g [Populus trichocarpa]
Length=1450

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GMLLV++TP+  +AAIL S  Y+M + F+GF+VPKP IPKW
Sbjct  1325  YQGMLLVSLTPNIQVAAILASFSYTMLNFFSGFVVPKPHIPKW  1367



>gb|KDP27997.1| hypothetical protein JCGZ_19077 [Jatropha curcas]
Length=426

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +2

Query  2    YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
            YLGMLLV++TP+  +A+IL S+ Y M  LF+GF+VPKP+IPKW
Sbjct  301  YLGMLLVSLTPNIQVASILASSAYIMQILFSGFIVPKPRIPKW  343



>emb|CDY07588.1| BnaC06g14760D [Brassica napus]
Length=1441

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YL M L+++TP+F +A+ILQS FY  F+LF+GFL+P+ ++P+W
Sbjct  1316  YLAMFLISITPNFMVASILQSIFYVNFNLFSGFLIPETEVPRW  1358



>ref|XP_002451754.1| hypothetical protein SORBIDRAFT_04g007270 [Sorghum bicolor]
 gb|EES04730.1| hypothetical protein SORBIDRAFT_04g007270 [Sorghum bicolor]
Length=1440

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  8     GMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             GM+ VAMTP+  IAAI+ +AFY+++++FAGFL+P+P+IP W
Sbjct  1319  GMMAVAMTPNSDIAAIVSTAFYAIWNIFAGFLIPRPRIPIW  1359



>ref|XP_007024300.1| Pleiotropic drug resistance 1 [Theobroma cacao]
 gb|EOY26922.1| Pleiotropic drug resistance 1 [Theobroma cacao]
Length=1395

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +2

Query  8     GMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             GM+ VA+TP+  IAAIL +AFYS+F+LF+GF +P+P+IP W
Sbjct  1270  GMMNVAITPNVHIAAILAAAFYSLFNLFSGFCIPRPRIPGW  1310



>ref|XP_009353552.1| PREDICTED: ABC transporter G family member 35-like isoform X2 
[Pyrus x bretschneideri]
Length=1497

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+ V++TP+  +AAI  +AFYS+F+LF+GF +P+P+IP W
Sbjct  1370  YYGMMTVSITPNHQVAAIFAAAFYSVFNLFSGFFIPRPKIPNW  1412



>ref|XP_010234020.1| PREDICTED: putative pleiotropic drug resistance protein 7 [Brachypodium 
distachyon]
Length=1447

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  8     GMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             GM+ VAMTP+  IAAI+ +AFY+++++FAGFL+P+P+IP W
Sbjct  1326  GMMAVAMTPNSDIAAIVATAFYAVWNIFAGFLIPRPRIPIW  1366



>ref|XP_007216612.1| hypothetical protein PRUPE_ppa027044mg [Prunus persica]
 gb|EMJ17811.1| hypothetical protein PRUPE_ppa027044mg [Prunus persica]
Length=1470

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+ V++TP+  +AA++ S FYS F+LF+GF +P+P+IPKW
Sbjct  1343  YYGMMTVSITPNHQVAAMVASTFYSFFNLFSGFFIPRPKIPKW  1385



>ref|XP_010038526.1| PREDICTED: pleiotropic drug resistance protein 3-like [Eucalyptus 
grandis]
Length=1455

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+LV++TP++ +AA+  S  Y+MF+LFAGFL+P PQIP W
Sbjct  1330  YFGMMLVSLTPTYQVAAVFGSFAYTMFNLFAGFLIPGPQIPVW  1372



>emb|CDY58246.1| BnaA03g58020D [Brassica napus]
Length=426

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +2

Query  2    YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
            Y G+LLV +TP+  +A  L+S FYSM +LFAG+++PKP IPKW
Sbjct  301  YFGVLLVVITPNIHVAFTLRSGFYSMVNLFAGYVMPKPSIPKW  343



>gb|EEE56535.1| hypothetical protein OsJ_05840 [Oryza sativa Japonica Group]
Length=1441

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +2

Query  8     GMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             GM+ VAMTP+  IAAI+ +AFY ++++FAGFL+P+P+IP W
Sbjct  1320  GMMAVAMTPNSDIAAIVSTAFYCIWNIFAGFLIPRPRIPIW  1360



>gb|EEC72716.1| hypothetical protein OsI_06321 [Oryza sativa Indica Group]
Length=1441

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +2

Query  8     GMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             GM+ VAMTP+  IAAI+ +AFY ++++FAGFL+P+P+IP W
Sbjct  1320  GMMAVAMTPNSDIAAIVSTAFYCIWNIFAGFLIPRPRIPIW  1360



>sp|Q8GU88.1|PDR7_ORYSJ RecName: Full=Putative pleiotropic drug resistance protein 7 
[Oryza sativa Japonica Group]
 emb|CAD59570.1| PDR-like ABC transporter [Oryza sativa Japonica Group]
 dbj|BAD24998.1| PDR-like ABC transporter [Oryza sativa Japonica Group]
 dbj|BAD25007.1| PDR-like ABC transporter [Oryza sativa Japonica Group]
Length=1444

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +2

Query  8     GMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             GM+ VAMTP+  IAAI+ +AFY ++++FAGFL+P+P+IP W
Sbjct  1323  GMMAVAMTPNSDIAAIVSTAFYCIWNIFAGFLIPRPRIPIW  1363



>gb|KCW47027.1| hypothetical protein EUGRSUZ_K00831, partial [Eucalyptus grandis]
Length=173

 Score = 56.6 bits (135),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +2

Query  2    YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
            Y GM+LV++TP++ +AA+  S  Y+MF+LFAGFL+  PQIP W
Sbjct  48   YFGMMLVSLTPTYQVAAVFASFAYTMFNLFAGFLITGPQIPVW  90



>ref|XP_006406843.1| hypothetical protein EUTSA_v10019897mg [Eutrema salsugineum]
 gb|ESQ48296.1| hypothetical protein EUTSA_v10019897mg [Eutrema salsugineum]
Length=1413

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+ V++TP+  +AA+   AFY +F+LF+GFL+P+P+IPKW
Sbjct  1286  YYGMMAVSITPNQQVAAVFAGAFYGLFNLFSGFLIPRPRIPKW  1328



>ref|XP_009385804.1| PREDICTED: putative pleiotropic drug resistance protein 7 [Musa 
acuminata subsp. malaccensis]
Length=1457

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  8     GMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             GM+ VAMTP+  IAAI+ +AFY+++++FAGFLVP+P+IP W
Sbjct  1337  GMMAVAMTPNSDIAAIVSTAFYAIWNIFAGFLVPRPKIPVW  1377



>gb|KCW46776.1| hypothetical protein EUGRSUZ_K00581 [Eucalyptus grandis]
Length=1430

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+LV++TP++ +AA+  S  Y+MF+LFAGFL+P PQIP W
Sbjct  1305  YFGMMLVSLTPTYQVAAVFGSFAYTMFNLFAGFLIPGPQIPVW  1347



>ref|XP_006647060.1| PREDICTED: putative pleiotropic drug resistance protein 7-like 
[Oryza brachyantha]
Length=1451

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +2

Query  8     GMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             GM+ VAMTP+  IAAI+ +AFY ++++FAGFL+P+P+IP W
Sbjct  1330  GMMAVAMTPNSDIAAIVSTAFYCIWNIFAGFLIPRPKIPIW  1370



>ref|XP_011044720.1| PREDICTED: pleiotropic drug resistance protein 3 isoform X1 [Populus 
euphratica]
Length=1452

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GMLLV++TP+  +AAI+ S  Y+M + F+GF+VPKP+IPKW
Sbjct  1327  YQGMLLVSLTPNIQVAAIIASFSYTMLNFFSGFIVPKPRIPKW  1369



>ref|XP_010532489.1| PREDICTED: ABC transporter G family member 41-like isoform X2 
[Tarenaya hassleriana]
Length=1420

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GMLLVA+TP+  IA  L+S+FY+M +LF+G+++PK  IP+W
Sbjct  1295  YFGMLLVAITPNLHIAFTLRSSFYTMVNLFSGYVIPKSNIPRW  1337



>ref|XP_010449957.1| PREDICTED: ABC transporter G family member 42 [Camelina sativa]
Length=1395

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GMLLV +TP+  +A  L+S+FYS+ +LFAG+++PKP IPKW
Sbjct  1270  YFGMLLVVVTPNVHVAFTLRSSFYSVVNLFAGYVMPKPNIPKW  1312



>ref|XP_011005974.1| PREDICTED: pleiotropic drug resistance protein 3-like [Populus 
euphratica]
Length=1452

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YLG+LLV++TP+F +A+I  S FY+M +LF+G+LVP+P++P+W
Sbjct  1327  YLGLLLVSLTPNFQMASIWASFFYTMTNLFSGYLVPEPKLPRW  1369



>ref|XP_009353551.1| PREDICTED: ABC transporter G family member 36-like isoform X1 
[Pyrus x bretschneideri]
Length=1237

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+ V++TP+  +AAI  +AFYS+F+LF+GF +P+P+IP W
Sbjct  1110  YYGMMTVSITPNHQVAAIFAAAFYSVFNLFSGFFIPRPKIPNW  1152



>ref|XP_010532488.1| PREDICTED: ABC transporter G family member 41-like isoform X1 
[Tarenaya hassleriana]
Length=1425

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GMLLVA+TP+  IA  L+S+FY+M +LF+G+++PK  IP+W
Sbjct  1300  YFGMLLVAITPNLHIAFTLRSSFYTMVNLFSGYVIPKSNIPRW  1342



>ref|XP_010270957.1| PREDICTED: pleiotropic drug resistance protein 3-like [Nelumbo 
nucifera]
Length=1433

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             YLGML+V+++ +  +A++L SA Y+M SLF+GFL+P P+IPKW
Sbjct  1308  YLGMLIVSLSSNLQVASVLASATYTMLSLFSGFLIPGPKIPKW  1350



>ref|XP_002458133.1| hypothetical protein SORBIDRAFT_03g027440 [Sorghum bicolor]
 gb|EES03253.1| hypothetical protein SORBIDRAFT_03g027440 [Sorghum bicolor]
Length=1464

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             + GM+ V +TPS+P+A+I+ SAFY++++LF+GF++P+P++P W
Sbjct  1342  FYGMMAVGLTPSYPVASIVSSAFYNIWNLFSGFIIPRPKVPIW  1384



>gb|KHN05335.1| ABC transporter G family member 36 [Glycine soja]
Length=1482

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+ V++TP+  +A+I  +AFY +F+LF+GF +P+P+IPKW
Sbjct  1354  YYGMMTVSITPNHQVASIFAAAFYGLFNLFSGFFIPRPKIPKW  1396



>ref|XP_010510997.1| PREDICTED: ABC transporter G family member 36-like [Camelina 
sativa]
Length=1467

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+ V++TP+  +A+I  SAFY +F+LF+GF +P+P+IPKW
Sbjct  1340  YYGMMTVSLTPNQQVASIFASAFYGIFNLFSGFFIPRPKIPKW  1382



>gb|EMS59279.1| Pleiotropic drug resistance protein 3 [Triticum urartu]
Length=382

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +2

Query  2    YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
            YLGM++V++TP+  IA+IL S FY++ +L +GF+VP PQIPKW
Sbjct  256  YLGMMIVSLTPNIQIASILASMFYTLQNLMSGFIVPAPQIPKW  298



>ref|XP_006303787.1| hypothetical protein CARUB_v10012050mg [Capsella rubella]
 gb|EOA36685.1| hypothetical protein CARUB_v10012050mg [Capsella rubella]
Length=1418

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+ V++TP+  +A+I  SAFY +F+LF+GF +P+P+IPKW
Sbjct  1291  YYGMMTVSLTPNQQVASIFASAFYGIFNLFSGFFIPRPKIPKW  1333



>gb|EMS55441.1| Pleiotropic drug resistance protein 12 [Triticum urartu]
Length=1136

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+ V+++P+  +A I  +AFYS+F+LF+GF +P+P+IPKW
Sbjct  1010  YYGMMTVSISPNHEVAGIFAAAFYSLFNLFSGFFIPRPKIPKW  1052



>ref|XP_010459043.1| PREDICTED: ABC transporter G family member 35-like isoform X4 
[Camelina sativa]
Length=1429

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+ V++TP+  +A+I  SAFY +F+LF+GF +P+P+IPKW
Sbjct  1302  YYGMMTVSLTPNQQVASIFASAFYGIFNLFSGFFIPRPKIPKW  1344



>ref|XP_006389734.1| hypothetical protein EUTSA_v10018005mg [Eutrema salsugineum]
 gb|ESQ27020.1| hypothetical protein EUTSA_v10018005mg [Eutrema salsugineum]
Length=1469

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+ V++TP+  +A+I  SAFY +F+LF+GF +P+P+IPKW
Sbjct  1342  YYGMMTVSLTPNQQVASIFASAFYGIFNLFSGFFIPRPKIPKW  1384



>dbj|BAJ33663.1| unnamed protein product [Thellungiella halophila]
Length=1469

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+ V++TP+  +A+I  SAFY +F+LF+GF +P+P+IPKW
Sbjct  1342  YYGMMTVSLTPNQQVASIFASAFYGIFNLFSGFFIPRPKIPKW  1384



>ref|NP_176196.1| ABC transporter G family member 36 [Arabidopsis thaliana]
 sp|Q9XIE2.1|AB36G_ARATH RecName: Full=ABC transporter G family member 36; Short=ABC transporter 
ABCG.36; Short=AtABCG36; AltName: Full=Pleiotropic 
drug resistance protein 8; AltName: Full=Protein PENETRATION 
3 [Arabidopsis thaliana]
 gb|AAD39329.1|AC007258_18 Putative ABC transporter [Arabidopsis thaliana]
 tpg|DAA00876.1| TPA_exp: PDR8 ABC transporter [Arabidopsis thaliana]
 gb|AEE33632.1| ABC transporter G family member 36 [Arabidopsis thaliana]
Length=1469

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+ V++TP+  +A+I  SAFY +F+LF+GF +P+P+IPKW
Sbjct  1342  YYGMMTVSLTPNQQVASIFASAFYGIFNLFSGFFIPRPKIPKW  1384



>dbj|BAK02156.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1512

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+ V+++P+  +A I  +AFYS+F+LF+GF +P+P+IPKW
Sbjct  1386  YYGMMTVSISPNHEVAGIFAAAFYSLFNLFSGFFIPRPKIPKW  1428



>ref|XP_006300647.1| hypothetical protein CARUB_v10019656mg [Capsella rubella]
 gb|EOA33545.1| hypothetical protein CARUB_v10019656mg [Capsella rubella]
Length=1467

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+ V++TP+  +A+I  SAFY +F+LF+GF +P+P+IPKW
Sbjct  1340  YYGMMTVSLTPNQQVASIFASAFYGIFNLFSGFFIPRPKIPKW  1382



>ref|XP_010459039.1| PREDICTED: ABC transporter G family member 35-like isoform X1 
[Camelina sativa]
 ref|XP_010459040.1| PREDICTED: ABC transporter G family member 35-like isoform X2 
[Camelina sativa]
 ref|XP_010459042.1| PREDICTED: ABC transporter G family member 35-like isoform X3 
[Camelina sativa]
Length=1438

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+ V++TP+  +A+I  SAFY +F+LF+GF +P+P+IPKW
Sbjct  1311  YYGMMTVSLTPNQQVASIFASAFYGIFNLFSGFFIPRPKIPKW  1353



>ref|XP_002892853.1| ATPDR7/PDR7 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69112.1| ATPDR7/PDR7 [Arabidopsis lyrata subsp. lyrata]
Length=1445

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+ V++TP+  +A+I  SAFY +F+LF+GF +P+P+IPKW
Sbjct  1318  YYGMMTVSLTPNQQVASIFASAFYGIFNLFSGFFIPRPKIPKW  1360



>gb|AAD39650.1|AC007591_15 Similar to gb|Z70524 PDR5-like ABC transporter from Spirodela 
polyrrhiza and is a member of the PF|00005 ABC transporter 
family. ESTs gb|N97039 and gb|T43169 come from this gene [Arabidopsis 
thaliana]
Length=1451

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+ V++TP+  +A+I  SAFY +F+LF+GF +P+P+IPKW
Sbjct  1324  YYGMMTVSLTPNQQVASIFASAFYGIFNLFSGFFIPRPKIPKW  1366



>gb|KHN39251.1| ABC transporter G family member 36 [Glycine soja]
Length=1462

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  2     YLGMLLVAMTPSFPIAAILQSAFYSMFSLFAGFLVPKPQIPKW  130
             Y GM+ V++TP+  +A+I  +AFY +F+LF+GF +P+P+IPKW
Sbjct  1334  YYGMMTVSITPNHQVASIFAAAFYGLFNLFSGFFIPRPKIPKW  1376



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 512165903184