BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c103946_g1_i1 len=234 path=[1:0-233]

Length=234
                                                                      Score     E

gb|KDO43525.1|  hypothetical protein CISIN_1g012194mg                 79.3    2e-15   
gb|KCW57500.1|  hypothetical protein EUGRSUZ_H00268                   77.8    6e-15   
ref|XP_006447932.1|  hypothetical protein CICLE_v10015140mg           78.2    8e-15   
ref|XP_006469356.1|  PREDICTED: UDP-glycosyltransferase 74E2-like     77.8    8e-15   
ref|XP_010069221.1|  PREDICTED: UDP-glycosyltransferase 74E2-like     77.8    8e-15   
ref|XP_010101352.1|  UDP-glycosyltransferase 74E2                     77.0    3e-14   
ref|XP_007045533.1|  UDP-xylose phenolic glycosyltransferase, put...  76.3    3e-14   
gb|EYU20869.1|  hypothetical protein MIMGU_mgv1a005301mg              76.3    3e-14   
ref|XP_008236257.1|  PREDICTED: UDP-glycosyltransferase 74E2-like     75.5    6e-14   
ref|XP_007199830.1|  hypothetical protein PRUPE_ppa005475mg           75.5    6e-14   
ref|XP_008236255.1|  PREDICTED: UDP-glycosyltransferase 74F1-like     75.1    8e-14   
emb|CBI24719.3|  unnamed protein product                              75.1    9e-14   
ref|XP_009335348.1|  PREDICTED: UDP-glycosyltransferase 74E1-like     75.1    9e-14   
ref|XP_010672480.1|  PREDICTED: UDP-glycosyltransferase 74E2-like     74.7    9e-14   
ref|XP_006370131.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...  74.7    1e-13   
ref|XP_002532442.1|  UDP-glucosyltransferase, putative                74.7    1e-13   Ricinus communis
ref|XP_002275194.2|  PREDICTED: UDP-glycosyltransferase 74E2          75.1    1e-13   Vitis vinifera
gb|EYU36667.1|  hypothetical protein MIMGU_mgv1a006023mg              74.3    1e-13   
emb|CAN68288.1|  hypothetical protein VITISV_017017                   75.1    2e-13   Vitis vinifera
ref|XP_006447931.1|  hypothetical protein CICLE_v10015145mg           73.9    2e-13   
ref|XP_006447928.1|  hypothetical protein CICLE_v10017682mg           73.9    2e-13   
ref|XP_010672479.1|  PREDICTED: UDP-glycosyltransferase 74E2-like     73.9    2e-13   
ref|XP_008236256.1|  PREDICTED: UDP-glycosyltransferase 74F2-like     73.6    3e-13   
gb|AJA79079.1|  UDP-glycosyltransferase                               72.8    3e-13   
ref|XP_011002910.1|  PREDICTED: UDP-glycosyltransferase 74E2-like...  73.6    3e-13   
ref|XP_011002911.1|  PREDICTED: UDP-glycosyltransferase 74E2-like...  73.6    3e-13   
gb|AIE12488.1|  UGT8                                                  73.2    3e-13   
ref|XP_010684803.1|  PREDICTED: UDP-glycosyltransferase 74E1-like     73.2    4e-13   
gb|KEH25946.1|  UDP-glucosyltransferase family protein                73.2    4e-13   
ref|XP_010042371.1|  PREDICTED: UDP-glycosyltransferase 74E2-like     72.0    4e-13   
ref|XP_010522243.1|  PREDICTED: UDP-glycosyltransferase 74E2          72.8    5e-13   
ref|XP_010510162.1|  PREDICTED: UDP-glycosyltransferase 74D1-like     72.8    6e-13   
ref|XP_010069225.1|  PREDICTED: UDP-glycosyltransferase 74E2-like     72.8    6e-13   
ref|XP_010069224.1|  PREDICTED: UDP-glycosyltransferase 74E2-like     72.8    6e-13   
ref|XP_010414087.1|  PREDICTED: UDP-glycosyltransferase 74D1-like     72.8    6e-13   
gb|KFK31187.1|  hypothetical protein AALP_AA6G079800                  72.8    6e-13   
gb|KCW57503.1|  hypothetical protein EUGRSUZ_H00275                   72.8    6e-13   
gb|KCW57502.1|  hypothetical protein EUGRSUZ_H00273                   72.8    6e-13   
ref|XP_011079130.1|  PREDICTED: UDP-glycosyltransferase 74E1-like     72.4    7e-13   
gb|AFJ52952.1|  UDP-glycosyltransferase 1                             72.4    7e-13   
ref|XP_010037081.1|  PREDICTED: UDP-glycosyltransferase 74F2-like     72.4    7e-13   
ref|XP_004289756.1|  PREDICTED: UDP-glycosyltransferase 74E1-like     72.4    8e-13   
ref|XP_004289758.1|  PREDICTED: UDP-glycosyltransferase 74E1-like     72.4    8e-13   
dbj|BAG80543.1|  UDP-glucose:glucosyltransferase                      72.0    8e-13   Lycium barbarum [goji berry]
gb|EYU17621.1|  hypothetical protein MIMGU_mgv1a006158mg              72.4    8e-13   
gb|EYU41208.1|  hypothetical protein MIMGU_mgv1a025741mg              72.0    1e-12   
ref|XP_007199135.1|  hypothetical protein PRUPE_ppa019481mg           70.1    1e-12   
gb|KDO41311.1|  hypothetical protein CISIN_1g038830mg                 70.9    1e-12   
gb|KEH25945.1|  UDP-glucosyltransferase family protein                71.6    1e-12   
gb|KDP45202.1|  hypothetical protein JCGZ_15067                       71.2    2e-12   
ref|XP_011082055.1|  PREDICTED: UDP-glycosyltransferase 74E2-like     71.2    2e-12   
ref|XP_002529822.1|  UDP-glucosyltransferase, putative                71.2    2e-12   Ricinus communis
ref|XP_010908661.1|  PREDICTED: UDP-glycosyltransferase 74F2-like     71.2    2e-12   
ref|XP_010469679.1|  PREDICTED: UDP-glycosyltransferase 74D1          70.9    2e-12   
ref|XP_006447238.1|  hypothetical protein CICLE_v10018164mg           70.9    2e-12   
ref|XP_004957367.1|  PREDICTED: UDP-glycosyltransferase 74F2-like     70.9    3e-12   
ref|XP_002532443.1|  UDP-glucosyltransferase, putative                70.5    3e-12   Ricinus communis
ref|XP_002879339.1|  hypothetical protein ARALYDRAFT_482098           70.9    3e-12   
gb|AAM61249.1|  putative glucosyltransferase                          70.9    3e-12   Arabidopsis thaliana [mouse-ear cress]
ref|NP_180734.1|  UDP-glucosyl transferase 74D1                       70.9    3e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004289755.1|  PREDICTED: UDP-glycosyltransferase 74F2-like     70.5    3e-12   
ref|XP_007033374.1|  Uridine diphosphate glycosyltransferase 74E2...  71.2    3e-12   
emb|CDP08070.1|  unnamed protein product                              70.1    3e-12   
gb|KEH25950.1|  UDP-glucosyltransferase family protein                70.5    4e-12   
ref|XP_011002951.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...  70.5    4e-12   
ref|XP_007201011.1|  hypothetical protein PRUPE_ppa005386mg           70.1    4e-12   
gb|ABK76266.1|  triterpene carboxylic acid glucosyltransferase        70.5    4e-12   Vaccaria hispanica [bladder-soapwort]
gb|KDP45199.1|  hypothetical protein JCGZ_15064                       70.1    5e-12   
ref|XP_006294187.1|  hypothetical protein CARUB_v10023181mg           70.1    5e-12   
gb|KDP35131.1|  hypothetical protein JCGZ_10665                       70.1    5e-12   
ref|XP_008460407.1|  PREDICTED: UDP-glycosyltransferase 74E1-like     70.1    5e-12   
emb|CDP08069.1|  unnamed protein product                              70.1    5e-12   
ref|XP_002460530.1|  hypothetical protein SORBIDRAFT_02g030020        70.1    5e-12   Sorghum bicolor [broomcorn]
emb|CDP21774.1|  unnamed protein product                              69.3    7e-12   
ref|XP_010414084.1|  PREDICTED: UDP-glycosyltransferase 74C1          69.7    7e-12   
ref|XP_010542772.1|  PREDICTED: UDP-glycosyltransferase 74D1          69.7    7e-12   
ref|XP_009141176.1|  PREDICTED: UDP-glycosyltransferase 74D1          69.3    8e-12   
ref|XP_011100878.1|  PREDICTED: UDP-glycosyltransferase 74F2-like     69.3    8e-12   
ref|XP_007033645.1|  UDP-glucosyltransferase 74F2, putative           69.3    9e-12   
ref|XP_002529825.1|  UDP-glucosyltransferase, putative                69.3    9e-12   Ricinus communis
emb|CDY64375.1|  BnaCnng43810D                                        69.3    9e-12   
gb|AIE12489.1|  UGT9                                                  69.3    9e-12   
gb|AGR44631.1|  UDP-glucosyltransferase 74A1                          69.3    9e-12   
gb|AEZ01222.1|  UDP-glucosyltransferase                               69.3    1e-11   
ref|XP_007151915.1|  hypothetical protein PHAVU_004G086500g           69.3    1e-11   
gb|KCW57957.1|  hypothetical protein EUGRSUZ_H00691                   68.9    1e-11   
dbj|BAG80534.1|  putative glycosyltransferase                         68.9    1e-11   Lycium barbarum [goji berry]
emb|CDP03926.1|  unnamed protein product                              68.9    1e-11   
ref|XP_007159561.1|  hypothetical protein PHAVU_002G247700g           68.9    1e-11   
ref|XP_003548080.2|  PREDICTED: UDP-glycosyltransferase 74E2-like     68.9    1e-11   
ref|XP_006410305.1|  hypothetical protein EUTSA_v10016638mg           68.9    1e-11   
ref|XP_006447240.1|  hypothetical protein CICLE_v10015138mg           68.9    1e-11   
gb|ABP49574.1|  UDP-glucose glucosyltransferase                       68.9    1e-11   Rhodiola sachalinensis
ref|XP_010069226.1|  PREDICTED: UDP-glycosyltransferase 74E2-like     68.9    1e-11   
emb|CDP03994.1|  unnamed protein product                              68.6    2e-11   
ref|XP_011082054.1|  PREDICTED: UDP-glycosyltransferase 74E2-like     68.6    2e-11   
ref|XP_004244485.1|  PREDICTED: UDP-glycosyltransferase 74E2-like     68.6    2e-11   
ref|NP_001234680.1|  UDP-xylose phenolic glycosyltransferase          68.6    2e-11   
ref|XP_010469678.1|  PREDICTED: UDP-glycosyltransferase 74C1-like     68.6    2e-11   
ref|XP_004253027.1|  PREDICTED: UDP-glycosyltransferase 74E2-like     68.6    2e-11   
emb|CBI24721.3|  unnamed protein product                              68.9    2e-11   
ref|XP_007222164.1|  hypothetical protein PRUPE_ppa005780mg           68.2    2e-11   
ref|XP_004292062.1|  PREDICTED: UDP-glycosyltransferase 74F2-like     68.2    2e-11   
ref|XP_010510154.1|  PREDICTED: UDP-glycosyltransferase 74C1-like     68.2    2e-11   
emb|CAN67248.1|  hypothetical protein VITISV_008683                   67.8    3e-11   Vitis vinifera
ref|XP_010475277.1|  PREDICTED: UDP-glycosyltransferase 74E2          67.8    3e-11   
gb|KDP45201.1|  hypothetical protein JCGZ_15066                       67.8    3e-11   
ref|XP_010091337.1|  UDP-glycosyltransferase 74E2                     67.8    3e-11   
ref|XP_007033647.1|  UDP-glycosyltransferase 74 F1, putative          67.8    3e-11   
dbj|BAG80538.1|  UDP-glucose:glucosyltransferase                      67.8    3e-11   Lycium barbarum [goji berry]
ref|XP_006342416.1|  PREDICTED: UDP-glycosyltransferase 74E2-like     67.4    4e-11   
ref|XP_007033375.1|  Uridine diphosphate glycosyltransferase 74E2...  67.4    4e-11   
ref|NP_180738.1|  UDP-glycosyltransferase 74C1                        67.4    4e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004162653.1|  PREDICTED: UDP-glycosyltransferase 74F1-like     66.6    4e-11   
ref|XP_006469358.1|  PREDICTED: UDP-glycosyltransferase 74E2-like...  67.4    4e-11   
ref|XP_010457662.1|  PREDICTED: UDP-glycosyltransferase 74E2-like     67.4    4e-11   
ref|XP_006469357.1|  PREDICTED: UDP-glycosyltransferase 74E2-like     67.4    5e-11   
ref|XP_009119126.1|  PREDICTED: UDP-glycosyltransferase 74E2-like     67.4    5e-11   
ref|XP_008338819.1|  PREDICTED: UDP-glycosyltransferase 74E2-like     67.4    5e-11   
ref|XP_009366994.1|  PREDICTED: UDP-glycosyltransferase 74E2-like     67.4    5e-11   
ref|XP_006342417.1|  PREDICTED: UDP-glycosyltransferase 74E2-like     67.0    6e-11   
ref|XP_008237299.1|  PREDICTED: UDP-glycosyltransferase 74F2-like     67.0    6e-11   
gb|AAZ32904.1|  putative glucosyltransferase                          64.7    7e-11   Medicago sativa [alfalfa]
ref|XP_009141182.1|  PREDICTED: UDP-glycosyltransferase 74C1-like     66.6    7e-11   
ref|XP_004144399.1|  PREDICTED: UDP-glycosyltransferase 74F2-like     67.0    7e-11   
emb|CDY19104.1|  BnaA04g18440D                                        66.6    7e-11   
ref|XP_011037065.1|  PREDICTED: UDP-glycosyltransferase 74E1-like     66.6    8e-11   
emb|CDP13108.1|  unnamed protein product                              66.6    8e-11   
ref|XP_007201501.1|  hypothetical protein PRUPE_ppa016883mg           66.6    8e-11   
ref|XP_004504205.1|  PREDICTED: UDP-glycosyltransferase 74F1-like     66.6    9e-11   
ref|XP_008670324.1|  PREDICTED: UDP-glycosyltransferase 74F2-like     66.6    9e-11   
gb|KEH25943.1|  UDP-glucosyltransferase family protein                66.2    1e-10   
emb|CDP13110.1|  unnamed protein product                              66.2    1e-10   
gb|AIT15666.1|  UDP-glycosyltransferase                               66.2    1e-10   
ref|XP_010095579.1|  UDP-glycosyltransferase 74E2                     66.2    1e-10   
gb|ACR10263.1|  UDP-glucosyl transferase 74c1                         66.2    1e-10   Brassica rapa subsp. pekinensis [bai cai]
ref|XP_010069571.1|  PREDICTED: UDP-glycosyltransferase 74F2-like     66.2    1e-10   
ref|XP_009776061.1|  PREDICTED: UDP-glycosyltransferase 74E2-like     66.2    1e-10   
gb|KDO37942.1|  hypothetical protein CISIN_1g048393mg                 65.9    1e-10   
ref|XP_011073993.1|  PREDICTED: UDP-glycosyltransferase 74E2-like     66.2    1e-10   
ref|XP_010069572.1|  PREDICTED: UDP-glycosyltransferase 74F2-like     66.2    1e-10   
ref|XP_003531287.1|  PREDICTED: UDP-glycosyltransferase 74F1-like     66.2    1e-10   
dbj|BAF96597.1|  UDP-glucose:anthocysnin 5-O-glucosyltransferase      65.5    1e-10   Rosa hybrid cultivar
ref|XP_011037069.1|  PREDICTED: UDP-glycosyltransferase 74E1-like     66.2    1e-10   
gb|KFK42906.1|  hypothetical protein AALP_AA1G053600                  65.9    1e-10   
ref|XP_006342195.1|  PREDICTED: UDP-glycosyltransferase 74E2-like     65.9    1e-10   
ref|XP_009590532.1|  PREDICTED: UDP-glycosyltransferase 74F2-like     65.9    1e-10   
ref|XP_004253028.1|  PREDICTED: UDP-glycosyltransferase 74E2-like     65.9    1e-10   
gb|AGI44003.1|  UDP-glucose glucosyltransferase                       65.9    1e-10   
ref|XP_008235864.1|  PREDICTED: UDP-glycosyltransferase 74E2-like     65.9    1e-10   
ref|XP_008235866.1|  PREDICTED: UDP-glycosyltransferase 74E2-like     65.9    2e-10   
ref|XP_008233916.1|  PREDICTED: UDP-glycosyltransferase 74E2-like     65.9    2e-10   
ref|XP_003632087.1|  PREDICTED: UDP-glycosyltransferase 74E2-like     65.9    2e-10   
ref|XP_007199115.1|  hypothetical protein PRUPE_ppa020804mg           65.9    2e-10   
emb|CAN67249.1|  hypothetical protein VITISV_008684                   65.5    2e-10   Vitis vinifera
ref|XP_006296254.1|  hypothetical protein CARUB_v10025420mg           65.9    2e-10   
ref|XP_011047629.1|  PREDICTED: UDP-glycosyltransferase 74E1-like...  65.5    2e-10   
emb|CDP08071.1|  unnamed protein product                              65.9    2e-10   
ref|XP_009603219.1|  PREDICTED: UDP-glycosyltransferase 74E2-like     65.5    2e-10   
ref|XP_010485192.1|  PREDICTED: UDP-glycosyltransferase 74E2-like     65.5    2e-10   
ref|XP_006304660.1|  hypothetical protein CARUB_v10011842mg           65.5    2e-10   
emb|CDP03995.1|  unnamed protein product                              65.5    2e-10   
gb|KCW57959.1|  hypothetical protein EUGRSUZ_H00694                   65.5    2e-10   
ref|XP_011047628.1|  PREDICTED: UDP-glycosyltransferase 74E1-like...  65.5    2e-10   
ref|XP_010025996.1|  PREDICTED: UDP-glycosyltransferase 74F2-like     65.5    2e-10   
emb|CDY15551.1|  BnaA08g28350D                                        65.1    2e-10   
ref|XP_009782413.1|  PREDICTED: UDP-glycosyltransferase 74E2-like     65.5    2e-10   
ref|XP_006307470.1|  hypothetical protein CARUB_v10009096mg           65.5    2e-10   
ref|XP_002529826.1|  UDP-glucosyltransferase, putative                65.5    2e-10   Ricinus communis
gb|AFK43317.1|  unknown                                               65.5    2e-10   
ref|XP_002529823.1|  UDP-glucosyltransferase, putative                65.5    2e-10   Ricinus communis
emb|CAN73416.1|  hypothetical protein VITISV_017052                   65.1    2e-10   Vitis vinifera
ref|XP_002532451.1|  UDP-glucosyltransferase, putative                65.1    2e-10   Ricinus communis
ref|XP_003629941.1|  UDP-glucose glucosyltransferase                  65.1    3e-10   
ref|XP_009111039.1|  PREDICTED: UDP-glycosyltransferase 74E2          65.1    3e-10   
ref|XP_006447926.1|  hypothetical protein CICLE_v10015147mg           65.1    3e-10   
ref|XP_006410308.1|  hypothetical protein EUTSA_v10016636mg           65.1    3e-10   
emb|CDY10139.1|  BnaC05g03820D                                        65.1    3e-10   
ref|XP_009590343.1|  PREDICTED: UDP-glycosyltransferase 74E2-like     64.7    3e-10   
ref|XP_002892308.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...  64.7    3e-10   
ref|XP_009783229.1|  PREDICTED: UDP-glycosyltransferase 74F1-like     64.7    3e-10   
ref|XP_010475278.1|  PREDICTED: UDP-glycosyltransferase 74E2-like...  64.7    4e-10   
emb|CDY70064.1|  BnaC08g46320D                                        64.7    4e-10   
ref|XP_006661442.1|  PREDICTED: crocetin glucosyltransferase 2-like   64.3    4e-10   
ref|XP_010475279.1|  PREDICTED: UDP-glycosyltransferase 74E2-like...  64.7    4e-10   
dbj|BAO51836.1|  UDP-glycosyltransferase 74Y1                         64.7    4e-10   
ref|NP_172059.1|  Uridine diphosphate glycosyltransferase 74E2        64.7    4e-10   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001274852.1|  UDP-glycosyltransferase 74E2-like                64.7    4e-10   
ref|XP_008235865.1|  PREDICTED: UDP-glycosyltransferase 74E2-like     64.7    4e-10   
ref|XP_004238636.1|  PREDICTED: UDP-glycosyltransferase 74E1-like     64.3    4e-10   
emb|CDX79437.1|  BnaC03g17730D                                        64.3    5e-10   
ref|XP_010095580.1|  UDP-glycosyltransferase 74F2                     64.3    5e-10   
ref|XP_002263532.1|  PREDICTED: crocetin glucosyltransferase, chl...  64.3    5e-10   Vitis vinifera
gb|KCW57960.1|  hypothetical protein EUGRSUZ_H00695                   63.9    5e-10   
gb|KFK31183.1|  hypothetical protein AALP_AA6G079400                  64.3    5e-10   
ref|XP_011085046.1|  PREDICTED: UDP-glycosyltransferase 74F2-like     64.3    5e-10   
ref|XP_006447927.1|  hypothetical protein CICLE_v10017904mg           63.5    5e-10   
ref|XP_006357098.1|  PREDICTED: UDP-glycosyltransferase 74E2-like     64.3    6e-10   
emb|CBI24722.3|  unnamed protein product                              63.9    6e-10   
ref|XP_009630995.1|  PREDICTED: UDP-glycosyltransferase 74F1-like     64.3    6e-10   
emb|CDY15370.1|  BnaC04g42530D                                        64.3    6e-10   
ref|XP_010557055.1|  PREDICTED: UDP-glycosyltransferase 74C1          64.3    6e-10   
ref|XP_006380268.1|  hypothetical protein POPTR_0007s00740g           62.4    6e-10   
ref|XP_002892307.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...  64.7    7e-10   
ref|XP_010457690.1|  PREDICTED: UDP-glycosyltransferase 74E2-like     63.9    7e-10   
ref|XP_009613938.1|  PREDICTED: UDP-glycosyltransferase 74E2-like     63.9    7e-10   
emb|CDP08068.1|  unnamed protein product                              63.9    7e-10   
ref|XP_006357097.1|  PREDICTED: UDP-glycosyltransferase 74F2-like     63.2    7e-10   
ref|XP_010069228.1|  PREDICTED: UDP-glycosyltransferase 74F2-like     63.9    7e-10   
ref|XP_010242509.1|  PREDICTED: UDP-glycosyltransferase 74F1-like     63.9    7e-10   
ref|XP_006357100.1|  PREDICTED: UDP-glycosyltransferase 74E1-like     63.9    8e-10   
ref|XP_006447930.1|  hypothetical protein CICLE_v10015149mg           63.9    8e-10   
ref|XP_009776895.1|  PREDICTED: UDP-glycosyltransferase 74E2-like     63.5    8e-10   
ref|XP_002306205.2|  putative glucosyltransferase family protein      63.9    8e-10   Populus trichocarpa [western balsam poplar]
emb|CDP06918.1|  unnamed protein product                              63.9    8e-10   
ref|XP_009132814.1|  PREDICTED: UDP-glycosyltransferase 74D1          63.9    8e-10   
emb|CDP20085.1|  unnamed protein product                              63.5    9e-10   
ref|XP_010069229.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...  63.5    9e-10   
emb|CBI24715.3|  unnamed protein product                              63.5    9e-10   
ref|XP_010908630.1|  PREDICTED: UDP-glycosyltransferase 74E2-like     62.0    9e-10   
gb|ACM09993.3|  UDP-glycosyltransferase BMGT1                         63.5    9e-10   Bacopa monnieri
ref|XP_004287163.1|  PREDICTED: UDP-glycosyltransferase 74E1-like     63.5    9e-10   
ref|XP_002309739.1|  putative glucosyltransferase family protein      63.5    9e-10   Populus trichocarpa [western balsam poplar]
ref|XP_007049534.1|  UDP-xylose phenolic glycosyltransferase, put...  63.5    1e-09   
ref|XP_002532449.1|  UDP-glucosyltransferase, putative                61.2    1e-09   Ricinus communis
ref|XP_006417998.1|  hypothetical protein EUTSA_v10007603mg           63.5    1e-09   
ref|XP_010242476.1|  PREDICTED: UDP-glycosyltransferase 74F2-like     63.5    1e-09   
ref|XP_004244487.1|  PREDICTED: UDP-glycosyltransferase 74F2-like...  63.5    1e-09   
ref|XP_011047632.1|  PREDICTED: UDP-glycosyltransferase 74F1-like     63.2    1e-09   
ref|XP_007033641.1|  Uridine diphosphate glycosyltransferase 74E2...  63.2    1e-09   
gb|EYU17628.1|  hypothetical protein MIMGU_mgv1a020645mg              63.2    1e-09   
ref|NP_001184915.1|  UDP-Glycosyltransferase superfamily protein      63.2    1e-09   
gb|AFJ52958.1|  UDP-glycosyltransferase 1                             63.2    1e-09   
ref|XP_002278455.1|  PREDICTED: UDP-glycosyltransferase 74F2          63.2    1e-09   Vitis vinifera
gb|EYU17631.1|  hypothetical protein MIMGU_mgv1a006064mg              63.2    1e-09   
ref|XP_010679006.1|  PREDICTED: UDP-glycosyltransferase 74F2-like     63.2    1e-09   
ref|XP_006372895.1|  hypothetical protein POPTR_0017s06080g           62.8    1e-09   
gb|KCW57497.1|  hypothetical protein EUGRSUZ_H00262                   61.6    1e-09   
ref|XP_004244486.1|  PREDICTED: UDP-glycosyltransferase 74E1-like     63.2    1e-09   
ref|XP_002310479.2|  putative glucosyltransferase family protein      62.8    2e-09   Populus trichocarpa [western balsam poplar]
emb|CAN69453.1|  hypothetical protein VITISV_002845                   62.8    2e-09   Vitis vinifera
ref|XP_004489724.1|  PREDICTED: UDP-glycosyltransferase 74E2-like     62.8    2e-09   
gb|ACM09899.2|  glycosyltransferase                                   62.8    2e-09   Withania somnifera [ashwagandha]
ref|XP_010069222.1|  PREDICTED: UDP-glycosyltransferase 74E2-like     62.8    2e-09   
gb|AHK60847.1|  CrUGT9                                                62.8    2e-09   
gb|AFJ52957.1|  UDP-glycosyltransferase 1                             62.8    2e-09   
gb|KDP35132.1|  hypothetical protein JCGZ_10666                       62.8    2e-09   
ref|XP_006478564.1|  PREDICTED: UDP-glycosyltransferase 74F2-like     62.4    2e-09   
ref|XP_007049526.1|  UDP-xylose phenolic glycosyltransferase, put...  62.4    2e-09   
ref|XP_002518671.1|  UDP-glucosyltransferase, putative                62.8    2e-09   Ricinus communis
ref|XP_009410732.1|  PREDICTED: crocetin glucosyltransferase 2-like   62.8    2e-09   
ref|XP_007049529.1|  UDP-xylose phenolic glycosyltransferase, put...  62.4    2e-09   
ref|XP_004288732.1|  PREDICTED: UDP-glycosyltransferase 74E1-like     62.0    2e-09   
ref|XP_010069220.1|  PREDICTED: UDP-glycosyltransferase 74E2-like     62.4    2e-09   
gb|AAD30619.1|AC007153_11  similar to indole-3-acetate beta-gluco...  63.2    2e-09   Arabidopsis thaliana [mouse-ear cress]
gb|KDO43526.1|  hypothetical protein CISIN_1g0406122mg                60.5    2e-09   
ref|XP_006357101.1|  PREDICTED: UDP-glycosyltransferase 74F1-like     62.8    2e-09   
gb|EYU17634.1|  hypothetical protein MIMGU_mgv1a006216mg              62.4    2e-09   
ref|XP_002310396.2|  hypothetical protein POPTR_0007s00860g           62.4    2e-09   Populus trichocarpa [western balsam poplar]
emb|CAN68287.1|  hypothetical protein VITISV_017016                   62.4    3e-09   Vitis vinifera
ref|XP_010069223.1|  PREDICTED: UDP-glycosyltransferase 74E2-like     62.4    3e-09   
gb|KCW57498.1|  hypothetical protein EUGRSUZ_H00263                   62.4    3e-09   
ref|XP_002879343.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...  62.4    3e-09   
emb|CDP08067.1|  unnamed protein product                              60.8    3e-09   
dbj|BAF96588.1|  anthocyanin 5-glucosyltransferase                    61.6    3e-09   Rosa hybrid cultivar
dbj|BAF96592.1|  flavonoid 5-glucosyltransferase                      61.6    3e-09   Rosa hybrid cultivar
emb|CDP13109.1|  unnamed protein product                              61.6    3e-09   
ref|XP_006372900.1|  hypothetical protein POPTR_0017s061201g          61.2    3e-09   
gb|KDP45197.1|  hypothetical protein JCGZ_15062                       62.0    3e-09   
ref|XP_004298592.1|  PREDICTED: UDP-glycosyltransferase 74B1-like     62.0    3e-09   
gb|ABQ02256.1|  O-glucosyltransferase 1                               62.0    3e-09   Vitis labrusca [Concord grape]
ref|XP_006357047.1|  PREDICTED: UDP-glycosyltransferase 74E2-like     62.0    3e-09   
ref|XP_011047630.1|  PREDICTED: UDP-glycosyltransferase 74E2-like     62.0    3e-09   
ref|XP_004957373.1|  PREDICTED: UDP-glycosyltransferase 74F1-like     62.0    3e-09   
dbj|BAG80541.1|  UDP-glucose:glucosyltransferase                      62.0    4e-09   Lycium barbarum [goji berry]
ref|XP_009599369.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...  62.0    4e-09   
ref|NP_001063683.1|  Os09g0517900                                     62.0    4e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006442124.1|  hypothetical protein CICLE_v10023826mg           61.6    4e-09   
ref|XP_006478556.1|  PREDICTED: UDP-glycosyltransferase 74F2-like...  62.0    4e-09   
ref|XP_004307485.1|  PREDICTED: UDP-glycosyltransferase 75C1-like     61.6    4e-09   
ref|XP_006478555.1|  PREDICTED: UDP-glycosyltransferase 74F2-like...  61.6    4e-09   
ref|XP_008670325.1|  PREDICTED: crocetin glucosyltransferase 2-like   61.6    4e-09   
ref|XP_008780789.1|  PREDICTED: cyanidin 3-O-rutinoside 5-O-gluco...  59.7    4e-09   
ref|XP_010672483.1|  PREDICTED: UDP-glycosyltransferase 74E2-like     61.6    4e-09   
ref|XP_008805997.1|  PREDICTED: indole-3-acetate beta-glucosyltra...  61.6    4e-09   
ref|XP_006388126.1|  hypothetical protein POPTR_0322s00200g           61.6    5e-09   
ref|XP_004296695.1|  PREDICTED: UDP-glycosyltransferase 74E1-like     61.6    5e-09   
emb|CAN80193.1|  hypothetical protein VITISV_017236                   62.4    5e-09   
ref|XP_009786106.1|  PREDICTED: UDP-glycosyltransferase 74E2-like     61.6    5e-09   
gb|KHN09954.1|  UDP-glycosyltransferase 74E1                          61.6    5e-09   
emb|CBI23328.3|  unnamed protein product                              59.7    5e-09   
gb|KHN45525.1|  UDP-glycosyltransferase 74E2                          61.2    5e-09   
gb|KEH25944.1|  UDP-glucosyltransferase family protein                61.2    6e-09   
ref|XP_007201692.1|  hypothetical protein PRUPE_ppa016444mg           61.2    6e-09   
ref|XP_006372897.1|  putative glucosyltransferase family protein      61.2    6e-09   
ref|XP_002520220.1|  UDP-glucosyltransferase, putative                61.2    6e-09   
gb|ACU19612.1|  unknown                                               61.2    6e-09   
ref|XP_003554595.1|  PREDICTED: UDP-glycosyltransferase 74E2-like     61.2    6e-09   
gb|ACD03251.1|  UDP-glycosyltransferase UGT75E3                       61.2    6e-09   
ref|XP_008233915.1|  PREDICTED: UDP-glycosyltransferase 74E2-like     61.2    6e-09   
ref|XP_004158251.1|  PREDICTED: UDP-glycosyltransferase 74C1-like     59.7    6e-09   
ref|XP_004245060.1|  PREDICTED: UDP-glycosyltransferase 74F2-like     61.2    6e-09   
ref|XP_010679007.1|  PREDICTED: UDP-glycosyltransferase 74E2-like     61.2    6e-09   
ref|XP_006351615.1|  PREDICTED: UDP-glycosyltransferase 74F2-like     61.2    7e-09   
emb|CDY34513.1|  BnaC04g12860D                                        61.2    7e-09   
ref|XP_008445481.1|  PREDICTED: UDP-glycosyltransferase 74E2-like     61.2    7e-09   
ref|XP_011082052.1|  PREDICTED: UDP-glycosyltransferase 74F2-like     61.2    7e-09   
ref|XP_006478567.1|  PREDICTED: UDP-glycosyltransferase 74F2-like     60.8    7e-09   
ref|XP_010242477.1|  PREDICTED: UDP-glycosyltransferase 74F2-like     61.2    7e-09   
ref|XP_009144048.1|  PREDICTED: UDP-glycosyltransferase 74C1          60.8    7e-09   
ref|XP_006664936.1|  PREDICTED: crocetin glucosyltransferase 2-like   60.8    7e-09   
ref|XP_004309287.1|  PREDICTED: UDP-glycosyltransferase 74F2-like     60.5    7e-09   
gb|KHN13207.1|  UDP-glycosyltransferase 74E1                          60.8    7e-09   
ref|XP_010679010.1|  PREDICTED: UDP-glycosyltransferase 74E2-like...  60.8    7e-09   
gb|AGZ84547.1|  glycosyltransferase KGT18                             60.8    8e-09   
ref|XP_010925530.1|  PREDICTED: crocetin glucosyltransferase, chl...  60.5    8e-09   
ref|XP_003543857.1|  PREDICTED: UDP-glycosyltransferase 74E1-like     60.8    8e-09   
ref|XP_010242475.1|  PREDICTED: UDP-glycosyltransferase 74F2-like     60.8    8e-09   
gb|ABQ02259.1|  truncated O-glucosyltransferase 4                     60.8    8e-09   
ref|XP_007033644.1|  Uridine diphosphate glycosyltransferase 74E2     61.2    8e-09   
ref|XP_008348313.1|  PREDICTED: UDP-glycosyltransferase 74E2-like     59.7    9e-09   
dbj|BAK00438.1|  predicted protein                                    60.8    9e-09   
ref|XP_008361795.1|  PREDICTED: UDP-glycosyltransferase 74B1-like     60.8    9e-09   
ref|XP_008445482.1|  PREDICTED: UDP-glycosyltransferase 74E2-like     60.8    1e-08   
ref|XP_006442123.1|  hypothetical protein CICLE_v10020092mg           60.5    1e-08   
dbj|BAJ97695.1|  predicted protein                                    60.5    1e-08   
ref|XP_008793440.1|  PREDICTED: cyanidin 3-O-rutinoside 5-O-gluco...  60.5    1e-08   
ref|XP_003632443.1|  PREDICTED: UDP-glycosyltransferase 74E2-like     60.5    1e-08   
gb|AFJ52960.1|  UDP-glycosyltransferase 1                             60.5    1e-08   
ref|XP_004290110.1|  PREDICTED: UDP-glycosyltransferase 74F2-like     60.5    1e-08   
dbj|BAJ96898.1|  predicted protein                                    60.5    1e-08   
ref|XP_008789394.1|  PREDICTED: UDP-glycosyltransferase 85A5-like     60.5    1e-08   
ref|XP_006379180.1|  hypothetical protein POPTR_0009s09830g           60.5    1e-08   
dbj|BAJ97910.1|  predicted protein                                    60.5    1e-08   
ref|XP_008791887.1|  PREDICTED: cyanidin 3-O-rutinoside 5-O-gluco...  60.5    1e-08   
ref|XP_003578448.1|  PREDICTED: UDP-glycosyltransferase 74F2-like     60.5    1e-08   
ref|XP_008245156.1|  PREDICTED: UDP-glycosyltransferase 74B1-like     60.5    1e-08   
ref|XP_007151237.1|  hypothetical protein PHAVU_004G029500g           60.5    1e-08   
ref|XP_002263497.1|  PREDICTED: crocetin glucosyltransferase, chl...  60.1    1e-08   
ref|XP_004144190.1|  PREDICTED: UDP-glycosyltransferase 74E2-like     60.1    1e-08   
ref|XP_010023607.1|  PREDICTED: crocetin glucosyltransferase, chl...  60.1    1e-08   
gb|EMS58492.1|  UDP-glycosyltransferase 75D1                          60.1    1e-08   
ref|XP_006357048.1|  PREDICTED: UDP-glycosyltransferase 74E2-like     60.1    2e-08   
ref|XP_010025874.1|  PREDICTED: UDP-glycosyltransferase 74E2-like     60.1    2e-08   
ref|XP_007151178.1|  hypothetical protein PHAVU_004G024500g           60.1    2e-08   
ref|XP_002273866.1|  PREDICTED: UDP-glycosyltransferase 74E2          60.1    2e-08   
gb|KGN58388.1|  hypothetical protein Csa_3G636370                     60.1    2e-08   
dbj|BAP90370.1|  UDP-glycose: glycosyltransferase UGT75R1             60.1    2e-08   
ref|XP_010691669.1|  PREDICTED: UDP-glycosyltransferase 84B2-like     60.1    2e-08   
emb|CBI15081.3|  unnamed protein product                              59.7    2e-08   
gb|ABD95974.1|  UDP glucose:salicylic acid glucosyl transferase       57.4    2e-08   
ref|XP_004144461.1|  PREDICTED: UDP-glycosyltransferase 74F1-like     60.1    2e-08   
ref|XP_004162644.1|  PREDICTED: UDP-glycosyltransferase 74F1-like     59.7    2e-08   
emb|CBI39412.3|  unnamed protein product                              60.1    2e-08   
emb|CDP21504.1|  unnamed protein product                              59.7    2e-08   
ref|XP_008787439.1|  PREDICTED: LOW QUALITY PROTEIN: cyanidin 3-O...  59.7    2e-08   
emb|CDP20003.1|  unnamed protein product                              59.7    2e-08   
ref|XP_002460531.1|  hypothetical protein SORBIDRAFT_02g030050        59.7    2e-08   
emb|CBI24724.3|  unnamed protein product                              59.3    2e-08   
ref|XP_008449397.1|  PREDICTED: UDP-glycosyltransferase 74E2-like     59.7    2e-08   
gb|EPS69486.1|  glycosyltransferase                                   59.7    2e-08   
ref|XP_003541519.1|  PREDICTED: UDP-glycosyltransferase 74E1-like     59.7    2e-08   
ref|XP_007151254.1|  hypothetical protein PHAVU_004G031100g           59.7    2e-08   
ref|XP_010069575.1|  PREDICTED: UDP-glycosyltransferase 74F2-like     59.7    2e-08   
ref|XP_002280305.1|  PREDICTED: UDP-glycosyltransferase 74B1          59.7    2e-08   
ref|XP_010679009.1|  PREDICTED: UDP-glycosyltransferase 74F2-like...  59.7    2e-08   
ref|XP_002275387.2|  PREDICTED: UDP-glycosyltransferase 74E1-like     59.7    2e-08   
ref|XP_010025339.1|  PREDICTED: UDP-glycosyltransferase 84B2-like     59.7    2e-08   
gb|KDP35130.1|  hypothetical protein JCGZ_10664                       59.7    2e-08   
ref|XP_009625439.1|  PREDICTED: UDP-glycosyltransferase 74F2-like     59.3    2e-08   
gb|AHA54051.1|  UGT84A13                                              59.7    2e-08   
ref|XP_009783231.1|  PREDICTED: UDP-glycosyltransferase 74F2-like     59.3    3e-08   
ref|XP_004253024.1|  PREDICTED: cinnamate beta-D-glucosyltransfer...  59.7    3e-08   
ref|XP_004144267.1|  PREDICTED: UDP-glycosyltransferase 74F1-like     59.3    3e-08   
ref|XP_004957371.1|  PREDICTED: crocetin glucosyltransferase 2-like   59.3    3e-08   
ref|XP_006295862.1|  hypothetical protein CARUB_v10024992mg           59.3    3e-08   
ref|XP_009783230.1|  PREDICTED: UDP-glycosyltransferase 74E1-like     59.3    3e-08   
gb|KGN47941.1|  hypothetical protein Csa_6G418410                     59.3    3e-08   
ref|XP_002309737.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...  59.3    3e-08   
ref|XP_004137099.1|  PREDICTED: limonoid UDP-glucosyltransferase-...  59.3    3e-08   
gb|ABK96547.1|  unknown                                               59.3    3e-08   
ref|XP_008788244.1|  PREDICTED: crocetin glucosyltransferase 2-li...  59.3    3e-08   
ref|XP_011047643.1|  PREDICTED: UDP-glycosyltransferase 74F2-like     59.3    3e-08   
ref|XP_004171568.1|  PREDICTED: putative UDP-glucose glucosyltran...  59.3    3e-08   
ref|XP_004297667.1|  PREDICTED: UDP-glycosyltransferase 74B1-like     59.3    3e-08   
ref|XP_006342414.1|  PREDICTED: cinnamate beta-D-glucosyltransfer...  59.3    3e-08   
gb|EAZ45384.1|  hypothetical protein OsJ_30030                        58.9    3e-08   
emb|CBI33056.3|  unnamed protein product                              58.9    3e-08   
gb|ABQ02257.1|  O-glucosyltransferase 2                               58.9    3e-08   
ref|XP_007224980.1|  hypothetical protein PRUPE_ppa020679mg           59.3    3e-08   
ref|NP_001063685.1|  Os09g0518200                                     58.9    3e-08   
emb|CDP20005.1|  unnamed protein product                              58.9    4e-08   
ref|XP_007041389.1|  UDP-Glycosyltransferase superfamily protein      58.9    4e-08   
ref|XP_009604418.1|  PREDICTED: crocetin glucosyltransferase, chl...  58.9    4e-08   
gb|EAZ09772.1|  hypothetical protein OsI_32059                        58.9    4e-08   
ref|XP_002269003.2|  PREDICTED: UDP-glycosyltransferase 74E2          58.9    4e-08   
ref|XP_010043823.1|  PREDICTED: UDP-glycosyltransferase 74B1          58.9    4e-08   
ref|XP_007151246.1|  hypothetical protein PHAVU_004G030400g           58.9    4e-08   
ref|XP_003578449.1|  PREDICTED: crocetin glucosyltransferase 2-like   58.9    5e-08   
gb|ABX46246.1|  limonoid UDP glucosyltransferase                      57.8    5e-08   
gb|AAR06920.1|  UDP-glycosyltransferase 74G1                          58.5    5e-08   
gb|ABX46235.1|  limonoid UDP glucosyltransferase                      57.8    5e-08   
gb|ABX46229.1|  limonoid UDP glucosyltransferase                      57.8    5e-08   
emb|CDY51326.1|  BnaA10g03470D                                        58.5    5e-08   
gb|ABX46230.1|  limonoid UDP glucosyltransferase                      57.8    5e-08   
gb|ABX46260.1|  limonoid UDP glucosyltransferase                      57.8    5e-08   
gb|ABX46255.1|  limonoid UDP glucosyltransferase                      57.8    5e-08   
gb|ABX46247.1|  limonoid UDP glucosyltransferase                      57.8    5e-08   
gb|ABX46237.1|  limonoid UDP glucosyltransferase                      57.8    5e-08   
gb|ABX46232.1|  limonoid UDP glucosyltransferase                      57.8    5e-08   
ref|XP_002524932.1|  UDP-glucosyltransferase, putative                58.5    5e-08   
gb|ABX46259.1|  limonoid UDP glucosyltransferase                      57.8    5e-08   
sp|Q767C8.1|IH5GT_IRIHO  RecName: Full=Cyanidin 3-O-rutinoside 5-...  58.5    5e-08   
ref|XP_010037076.1|  PREDICTED: UDP-glycosyltransferase 74E2-like     58.5    5e-08   
ref|XP_009778639.1|  PREDICTED: crocetin glucosyltransferase, chl...  58.5    5e-08   
gb|ABX46254.1|  limonoid UDP glucosyltransferase                      57.8    5e-08   
gb|ABX46241.1|  limonoid UDP glucosyltransferase                      57.8    5e-08   
dbj|BAD34403.1|  putative UDP-glucose:salicylic acid glucosyltran...  58.5    5e-08   
ref|XP_008788243.1|  PREDICTED: crocetin glucosyltransferase 2-li...  58.5    5e-08   
ref|XP_010101355.1|  UDP-glycosyltransferase 74F2                     58.5    5e-08   
gb|ABX46227.1|  limonoid UDP glucosyltransferase                      57.4    5e-08   
ref|XP_011004954.1|  PREDICTED: cinnamate beta-D-glucosyltransfer...  58.5    5e-08   
ref|XP_010091051.1|  UDP-glycosyltransferase                          58.5    5e-08   
gb|ABX46251.1|  limonoid UDP glucosyltransferase                      57.4    5e-08   
ref|XP_011043909.1|  PREDICTED: crocetin glucosyltransferase, chl...  58.5    5e-08   
ref|XP_010065965.1|  PREDICTED: UDP-glycosyltransferase 84B2-like     58.5    6e-08   
gb|KHN28671.1|  UDP-glycosyltransferase 74B1                          58.5    6e-08   
gb|ACU22885.1|  unknown                                               58.2    6e-08   
ref|XP_010925318.1|  PREDICTED: crocetin glucosyltransferase, chl...  58.5    6e-08   
ref|XP_003519432.1|  PREDICTED: UDP-glycosyltransferase 74B1-like     58.2    6e-08   
ref|XP_003554601.1|  PREDICTED: UDP-glycosyltransferase 74F1-like     58.2    6e-08   
ref|XP_004166474.1|  PREDICTED: UDP-glycosyltransferase 74E2-like     58.5    7e-08   
gb|ABX46233.1|  limonoid UDP glucosyltransferase                      57.4    7e-08   
ref|NP_001063686.2|  Os09g0518400                                     58.5    7e-08   
ref|XP_007041390.1|  UDP-Glycosyltransferase superfamily protein      58.2    7e-08   
ref|XP_007143050.1|  hypothetical protein PHAVU_007G039400g           58.2    8e-08   
gb|ABX46265.1|  limonoid UDP glucosyltransferase                      57.0    8e-08   
emb|CDY67861.1|  BnaAnng25390D                                        56.6    8e-08   
emb|CDP15113.1|  unnamed protein product                              57.8    8e-08   
ref|XP_007143052.1|  hypothetical protein PHAVU_007G039600g           58.2    8e-08   
ref|XP_003624245.1|  UDP-glucosyltransferase, putative                58.2    8e-08   
gb|ABX46264.1|  limonoid UDP glucosyltransferase                      57.0    8e-08   
gb|ABX46234.1|  limonoid UDP glucosyltransferase                      57.0    8e-08   
gb|ABX46224.1|  limonoid UDP glucosyltransferase                      57.0    8e-08   
ref|NP_001267849.1|  cinnamate beta-D-glucosyltransferase-like        58.2    8e-08   
emb|CAN68409.1|  hypothetical protein VITISV_022913                   58.2    8e-08   
ref|XP_002271368.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase  58.2    8e-08   
gb|ABX46226.1|  limonoid UDP glucosyltransferase                      57.0    9e-08   
ref|XP_008460408.1|  PREDICTED: UDP-glycosyltransferase 74F1-like     57.8    9e-08   
ref|XP_007133505.1|  hypothetical protein PHAVU_011G184600g           57.8    9e-08   
gb|AII32448.1|  hydroxycinnamate glycosyltransferase                  58.2    9e-08   
ref|XP_003551702.2|  PREDICTED: UDP-glycosyltransferase 74E1-like     57.4    9e-08   
ref|XP_003543858.1|  PREDICTED: UDP-glycosyltransferase 74F1-like     57.8    9e-08   
gb|KHN13206.1|  UDP-glycosyltransferase 74F1                          57.8    9e-08   
gb|KDO40364.1|  hypothetical protein CISIN_1g022744mg                 57.0    1e-07   
ref|XP_008793436.1|  PREDICTED: cyanidin 3-O-rutinoside 5-O-gluco...  57.8    1e-07   
ref|XP_006858828.1|  hypothetical protein AMTR_s00066p00177320        57.8    1e-07   
ref|XP_007041388.1|  UDP-Glycosyltransferase superfamily protein      57.8    1e-07   
ref|XP_004287162.1|  PREDICTED: UDP-glycosyltransferase 74E1-like     57.8    1e-07   
gb|ACD14145.1|  limonoid UDP-glucosyltransferase                      57.8    1e-07   
ref|XP_006486997.1|  PREDICTED: limonoid UDP-glucosyltransferase-...  57.8    1e-07   
ref|XP_006422922.1|  hypothetical protein CICLE_v10028247mg           57.4    1e-07   
gb|ACD14144.1|  limonoid UDP-glucosyltransferase                      57.4    1e-07   
ref|XP_009630994.1|  PREDICTED: UDP-glycosyltransferase 74F2-like     57.4    1e-07   
gb|ABY27084.1|  limonoid UDP-glucosyltransferase                      57.4    1e-07   
gb|ACD14147.1|  limonoid UDP-glucosyltransferase                      57.4    1e-07   
gb|KDP21298.1|  hypothetical protein JCGZ_21769                       57.4    1e-07   
gb|ACD03246.1|  UDP-glycosyltransferase UGT74H7                       57.4    1e-07   
ref|XP_004244752.1|  PREDICTED: cinnamate beta-D-glucosyltransfer...  57.4    2e-07   
ref|XP_007137294.1|  hypothetical protein PHAVU_009G115200g           57.4    2e-07   
gb|KHN40518.1|  UDP-glycosyltransferase 74F1                          57.0    2e-07   
ref|XP_006858830.1|  hypothetical protein AMTR_s00066p00177790        57.4    2e-07   
ref|XP_002529824.1|  UDP-glucosyltransferase, putative                57.4    2e-07   
ref|XP_009622557.1|  PREDICTED: crocetin glucosyltransferase, chl...  57.0    2e-07   
emb|CDP20004.1|  unnamed protein product                              55.1    2e-07   
ref|XP_002450264.1|  hypothetical protein SORBIDRAFT_05g002710        57.4    2e-07   
gb|ABX46238.1|  limonoid UDP glucosyltransferase                      56.2    2e-07   
gb|ABB88578.1|  UDP-glucosyltransferase                               57.0    2e-07   
gb|ABX46223.1|  limonoid UDP glucosyltransferase                      56.2    2e-07   
ref|XP_007143051.1|  hypothetical protein PHAVU_007G039500g           57.0    2e-07   
ref|XP_006588331.1|  PREDICTED: UDP-glycosyltransferase 74E1-like     57.0    2e-07   
ref|XP_006414506.1|  hypothetical protein EUTSA_v10025072mg           57.0    2e-07   
gb|ACD03250.1|  UDP-glycosyltransferase UGT74H5                       57.0    2e-07   
ref|XP_007203876.1|  hypothetical protein PRUPE_ppa005294mg           57.0    2e-07   
ref|XP_006414503.1|  hypothetical protein EUTSA_v10024946mg           57.0    2e-07   
ref|XP_006858829.1|  hypothetical protein AMTR_s00066p00177490        57.0    2e-07   
ref|XP_003536615.2|  PREDICTED: UDP-glycosyltransferase 84B1-like     57.0    2e-07   
ref|XP_010037078.1|  PREDICTED: UDP-glycosyltransferase 74E2-like     57.0    2e-07   
sp|Q66PF4.1|CGT_FRAAN  RecName: Full=Cinnamate beta-D-glucosyltra...  57.0    2e-07   
ref|XP_002320558.1|  putative glucosyltransferase family protein      57.0    2e-07   
emb|CAN59771.1|  hypothetical protein VITISV_029146                   57.0    2e-07   
ref|XP_010915126.1|  PREDICTED: LOW QUALITY PROTEIN: crocetin glu...  57.4    2e-07   
ref|XP_007042537.1|  UDP-glucoronosyl/UDP-glucosyltransferase         57.0    2e-07   
gb|KDO69768.1|  hypothetical protein CISIN_1g012645mg                 57.0    2e-07   
ref|XP_006439748.1|  hypothetical protein CICLE_v10020081mg           57.0    2e-07   
ref|XP_002313148.2|  hypothetical protein POPTR_0009s09800g           57.0    2e-07   
gb|ACD03261.1|  UDP-glycosyltransferase UGT74H6                       57.0    2e-07   
ref|XP_006858837.1|  hypothetical protein AMTR_s00066p00179570        56.6    2e-07   
ref|XP_004253165.1|  PREDICTED: crocetin glucosyltransferase, chl...  56.6    2e-07   
gb|AAN85566.1|  UDP-glucosyl transferase                              57.0    2e-07   



>gb|KDO43525.1| hypothetical protein CISIN_1g012194mg [Citrus sinensis]
Length=468

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 53/82 (65%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            KAD  L NTFY LEE+V +W+  +WS+KT+GP VP L+ D+           +F+ D ES
Sbjct  210  KADWVLCNTFYELEEEVAEWLGKLWSLKTIGPTVPSLYLDKQLEDDKDYGFSMFKPDNES  269

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             ++WL+ R   SVVYVSFGS A
Sbjct  270  CIKWLNDRAKGSVVYVSFGSYA  291



>gb|KCW57500.1| hypothetical protein EUGRSUZ_H00268 [Eucalyptus grandis]
Length=389

 Score = 77.8 bits (190),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 56/82 (68%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            +A  FL N+F  LEE++VKWM + WS+ T+GP +P ++ D+         + LF+ + E+
Sbjct  130  RAKWFLFNSFAELEEEIVKWMGNQWSIMTIGPTIPSVYLDKRLEDDKDYGLSLFKPEAEA  189

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             ++WLD + PKSV+YVSFGS+A
Sbjct  190  CLKWLDSKPPKSVLYVSFGSMA  211



>ref|XP_006447932.1| hypothetical protein CICLE_v10015140mg [Citrus clementina]
 gb|ESR61172.1| hypothetical protein CICLE_v10015140mg [Citrus clementina]
Length=468

 Score = 78.2 bits (191),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 53/82 (65%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            KAD  L NTFY LEE+V +W+  +WS+KT+GP VP L+ D+           +F+ + ES
Sbjct  210  KADWVLCNTFYELEEEVAEWLGKLWSLKTIGPTVPSLYLDKQLEDDKDYGFSMFKPNNES  269

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             ++WL+ R   SVVYVSFGS A
Sbjct  270  CIKWLNDRAKGSVVYVSFGSYA  291



>ref|XP_006469356.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Citrus sinensis]
 gb|ACS87993.1| UDP-glucosyltransferase family 1 protein [Citrus sinensis]
Length=468

 Score = 77.8 bits (190),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 53/82 (65%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            KAD  L NTFY LEE+V +W+  +WS+KT+GP VP L+ D+           +F+ + ES
Sbjct  210  KADWVLCNTFYELEEEVAEWLGKLWSLKTIGPTVPSLYLDKQLEDDKDYGFSMFKPNNES  269

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             ++WL+ R   SVVYVSFGS A
Sbjct  270  CIKWLNDRAKGSVVYVSFGSYA  291



>ref|XP_010069221.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Eucalyptus grandis]
Length=464

 Score = 77.8 bits (190),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 56/82 (68%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            +A  FL N+F  LEE++VKWM + WS+ T+GP +P ++ D+         + LF+ + E+
Sbjct  205  RAKWFLFNSFAELEEEIVKWMGNQWSIMTIGPTIPSVYLDKRLEDDKDYGLSLFKPEAEA  264

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             ++WLD + PKSV+YVSFGS+A
Sbjct  265  CLKWLDSKPPKSVLYVSFGSMA  286



>ref|XP_010101352.1| UDP-glycosyltransferase 74E2 [Morus notabilis]
 gb|EXB88299.1| UDP-glycosyltransferase 74E2 [Morus notabilis]
Length=649

 Score = 77.0 bits (188),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 53/82 (65%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            +ADC   NTF SLEE+VV W A  W VK +GP +P ++ D+         + LF+ + E+
Sbjct  394  EADCIFFNTFESLEEEVVSWAASQWPVKNIGPTIPSMYLDKRLQDDKDYGLSLFKPEAET  453

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
              +WLD ++ KSVVYV+FGS+A
Sbjct  454  CRKWLDSKDDKSVVYVAFGSLA  475



>ref|XP_007045533.1| UDP-xylose phenolic glycosyltransferase, putative isoform 1 [Theobroma 
cacao]
 ref|XP_007045534.1| UDP-xylose phenolic glycosyltransferase, putative isoform 1 [Theobroma 
cacao]
 gb|EOY01365.1| UDP-xylose phenolic glycosyltransferase, putative isoform 1 [Theobroma 
cacao]
 gb|EOY01366.1| UDP-xylose phenolic glycosyltransferase, putative isoform 1 [Theobroma 
cacao]
Length=457

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 53/81 (65%), Gaps = 9/81 (11%)
 Frame = +2

Query  8    ADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGESY  160
            AD  L+NTFY LE++VV WM++IW + TVGP +P +H DR         ++LF  +  + 
Sbjct  203  ADWVLVNTFYELEKEVVDWMSEIWKLGTVGPTIPSMHLDRRLEGNKDYGMNLFNPNTNTC  262

Query  161  VQWLDIREPKSVVYVSFGSVA  223
            + WL+ +   SVVYVSFGS+A
Sbjct  263  MNWLNGKPNGSVVYVSFGSLA  283



>gb|EYU20869.1| hypothetical protein MIMGU_mgv1a005301mg [Erythranthe guttata]
Length=490

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 36/85 (42%), Positives = 54/85 (64%), Gaps = 9/85 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            KAD  LINTF  LE++V++WM+  W VK +GP +P ++ D+         +++F     +
Sbjct  233  KADWILINTFDKLEQEVLEWMSRFWRVKAIGPTIPSMYLDKRLQDDKEYGLNMFNPMTNT  292

Query  158  YVQWLDIREPKSVVYVSFGSVAIFT  232
             + WLD +EPKSV+Y SFGS+A  T
Sbjct  293  CMNWLDNQEPKSVIYASFGSLAQLT  317



>ref|XP_008236257.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Prunus mume]
Length=459

 Score = 75.5 bits (184),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 51/82 (62%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            KAD  L NTFY LEEQVV W+A  W ++TVGP +P  + D          ++LF+ D ++
Sbjct  205  KADWVLCNTFYELEEQVVDWLAKFWPLRTVGPTIPSKYLDERLEDDKEYGVNLFKSDNDA  264

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             ++WL+ R   SV YVSFGS A
Sbjct  265  CIKWLNERPKGSVAYVSFGSAA  286



>ref|XP_007199830.1| hypothetical protein PRUPE_ppa005475mg [Prunus persica]
 gb|EMJ01029.1| hypothetical protein PRUPE_ppa005475mg [Prunus persica]
Length=459

 Score = 75.5 bits (184),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 51/82 (62%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            KAD  L NTFY LEEQVV W+A  W ++TVGP +P  + D          ++LF+ D ++
Sbjct  205  KADWVLCNTFYELEEQVVDWLAKFWPLRTVGPTIPSKYLDERLEDDKEYGVNLFKSDNDA  264

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             ++WL+ R   SV YVSFGS A
Sbjct  265  CIKWLNERPKGSVAYVSFGSTA  286



>ref|XP_008236255.1| PREDICTED: UDP-glycosyltransferase 74F1-like [Prunus mume]
Length=459

 Score = 75.1 bits (183),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 51/82 (62%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            KAD  L NTFY LEEQVV W+A  W ++TVGP +P  + D          ++LF+ D ++
Sbjct  205  KADWILSNTFYELEEQVVDWLAKFWPLRTVGPTIPSKYLDERLEDDKEYGVNLFKSDNDA  264

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             ++WL+ R   SV YVSFGS A
Sbjct  265  CIKWLNERPKGSVAYVSFGSAA  286



>emb|CBI24719.3| unnamed protein product [Vitis vinifera]
Length=453

 Score = 75.1 bits (183),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 51/82 (62%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            KA C LINTF  LE +VVKWM   W VKT+GP +P ++ D+         +    L+ ++
Sbjct  197  KAKCLLINTFDMLEAEVVKWMGSQWPVKTIGPTIPSMYLDKRLEDDKDYGLSPLNLNVDA  256

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             + WLD R+  SVVYVSFGS+A
Sbjct  257  CITWLDARDIGSVVYVSFGSLA  278



>ref|XP_009335348.1| PREDICTED: UDP-glycosyltransferase 74E1-like [Pyrus x bretschneideri]
Length=460

 Score = 75.1 bits (183),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 53/82 (65%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            KAD  L NTFY LE QVV WMA +W +KTVGP +P  + ++         ++LF+ D ++
Sbjct  204  KADWVLCNTFYDLEVQVVDWMAKLWRLKTVGPTIPSNYLNKRLKDDKEYSVNLFKSDNDA  263

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             ++WL+ R   SV YVSFGS+A
Sbjct  264  CIKWLNERPKGSVAYVSFGSLA  285



>ref|XP_010672480.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Beta vulgaris subsp. 
vulgaris]
Length=456

 Score = 74.7 bits (182),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 50/82 (61%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            +AD    NTF +LE + V WM + W VKT+GP +P  + D+         + LFE   ++
Sbjct  201  EADWRFFNTFEALESKAVNWMTNQWPVKTIGPCIPSTYLDKRLPDDKDYGLSLFEAQTDA  260

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             +QWLD REP SVVY+S GS+A
Sbjct  261  CIQWLDAREPTSVVYISMGSLA  282



>ref|XP_006370131.1| UDP-glucoronosyl/UDP-glucosyl transferase family protein [Populus 
trichocarpa]
 gb|ERP66700.1| UDP-glucoronosyl/UDP-glucosyl transferase family protein [Populus 
trichocarpa]
Length=471

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 54/85 (64%), Gaps = 9/85 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            +A   L NTF  LE+++V WMA  W +K +GP +P +  D+         + LF+ + E+
Sbjct  203  EASWLLWNTFNELEDEIVDWMASKWPIKPIGPTIPSMFLDKRLEDDKDYGLSLFKPNSET  262

Query  158  YVQWLDIREPKSVVYVSFGSVAIFT  232
             ++WLD +EP SVVYVSFGS+A+ T
Sbjct  263  CMKWLDSKEPGSVVYVSFGSLAVLT  287



>ref|XP_002532442.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF29928.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=457

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 51/81 (63%), Gaps = 9/81 (11%)
 Frame = +2

Query  8    ADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGESY  160
            AD  L NTFY LEE+VV WMA  W ++TVGP +P  + D+         I+LF+ D  + 
Sbjct  203  ADWVLCNTFYRLEEEVVDWMAKKWRLRTVGPTLPSKYLDKRLEYDKDYGINLFKPDSGTC  262

Query  161  VQWLDIREPKSVVYVSFGSVA  223
            + WL  +  +SVVYVSFGSVA
Sbjct  263  LNWLKTKPSRSVVYVSFGSVA  283



>ref|XP_002275194.2| PREDICTED: UDP-glycosyltransferase 74E2 [Vitis vinifera]
Length=654

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 51/82 (62%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            KA C LINTF  LE +VVKWM   W VKT+GP +P ++ D+         +    L+ ++
Sbjct  398  KAKCLLINTFDMLEAEVVKWMGSQWPVKTIGPTIPSMYLDKRLEDDKDYGLSPLNLNVDA  457

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             + WLD R+  SVVYVSFGS+A
Sbjct  458  CITWLDARDIGSVVYVSFGSLA  479



>gb|EYU36667.1| hypothetical protein MIMGU_mgv1a006023mg [Erythranthe guttata]
Length=461

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 38/82 (46%), Positives = 49/82 (60%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            + D    NTF +LE +VV WMA +W +KTVGP   +L KD          I LFE +  +
Sbjct  206  QVDWIFFNTFDNLEYEVVDWMAKLWPIKTVGPTFALLQKDEKLSDNKSHMISLFEPNTTT  265

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
              +WLD +E  SVVYVSFGS+A
Sbjct  266  CKEWLDSKETASVVYVSFGSIA  287



>emb|CAN68288.1| hypothetical protein VITISV_017017 [Vitis vinifera]
Length=1085

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 51/82 (62%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            KA C LINTF  LE +VVKWM   W VKT+GP +P ++ D+         +    L+ ++
Sbjct  197  KAKCLLINTFDMLEAEVVKWMGSQWPVKTIGPTIPSMYLDKRLEDDKDYGLSPLNLNVDA  256

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             + WLD R+  SVVYVSFGS+A
Sbjct  257  CITWLDARDIGSVVYVSFGSLA  278



>ref|XP_006447931.1| hypothetical protein CICLE_v10015145mg [Citrus clementina]
 gb|ESR61171.1| hypothetical protein CICLE_v10015145mg [Citrus clementina]
Length=466

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 53/84 (63%), Gaps = 9/84 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            KAD  L NTFY LEE+VV+W+   WS++T+GP VP  + D+           +F+ + ES
Sbjct  208  KADWVLSNTFYDLEEEVVEWLGRHWSLRTIGPTVPSTYLDKQLEDDKDYGFSMFKQNNES  267

Query  158  YVQWLDIREPKSVVYVSFGSVAIF  229
             ++WL+ +   SVVYVSFGS+A  
Sbjct  268  CIKWLNDQAKGSVVYVSFGSMATL  291



>ref|XP_006447928.1| hypothetical protein CICLE_v10017682mg [Citrus clementina]
 gb|ESR61168.1| hypothetical protein CICLE_v10017682mg [Citrus clementina]
Length=466

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 52/84 (62%), Gaps = 9/84 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            KAD  L NTFY LEE+V +W+   W +KT+GP VP ++ D+           +F+ + ES
Sbjct  208  KADWVLSNTFYELEEEVAEWLGRHWPLKTIGPTVPSMYLDKQLEDNKDYGFSMFKQNNES  267

Query  158  YVQWLDIREPKSVVYVSFGSVAIF  229
             ++WL+ +   SVVYVSFGSVA  
Sbjct  268  CIKWLNDQAKGSVVYVSFGSVATL  291



>ref|XP_010672479.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Beta vulgaris subsp. 
vulgaris]
Length=455

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 48/81 (59%), Gaps = 9/81 (11%)
 Frame = +2

Query  8    ADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGESY  160
            AD    NTF  LE +VV WM + W VKT+GP +P  + D+         + LFE    + 
Sbjct  201  ADWRFFNTFEGLESEVVNWMTNQWPVKTIGPCIPSTYLDKRLPDDKDYGLSLFEAQTNAC  260

Query  161  VQWLDIREPKSVVYVSFGSVA  223
            +QWLD R+P SVVY+S GS+A
Sbjct  261  IQWLDARKPASVVYISMGSMA  281



>ref|XP_008236256.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Prunus mume]
Length=459

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 51/82 (62%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            KAD  L NTFY LEEQVV W+A  W ++TVGP +P  + D          ++LF+ + ++
Sbjct  205  KADWILFNTFYELEEQVVDWLAKFWPLRTVGPTIPSKYLDERLEDDKEYGVNLFKSENDA  264

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             ++WL+ R   SV YVSFGS A
Sbjct  265  CIKWLNERPKGSVAYVSFGSFA  286



>gb|AJA79079.1| UDP-glycosyltransferase [Prunus persica]
 gb|AJA79080.1| UDP-glycosyltransferase [Prunus persica]
Length=352

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 50/82 (61%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            KAD  L NTFY LEEQVV W+A  W ++TVGP +P  + D          ++LF+ D ++
Sbjct  223  KADWVLCNTFYELEEQVVDWLAKFWPLRTVGPTIPSKYLDERLEDDKEYGVNLFKSDNDA  282

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             ++WL+ R   SV YVSF S A
Sbjct  283  CIKWLNERPKGSVAYVSFSSTA  304



>ref|XP_011002910.1| PREDICTED: UDP-glycosyltransferase 74E2-like isoform X1 [Populus 
euphratica]
Length=458

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 53/85 (62%), Gaps = 9/85 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            +A   L NTF  LE+++V WMA  W +K +GP +P +  D+         + LF+ + E+
Sbjct  203  EASWLLWNTFNELEDEIVDWMASKWPIKPIGPTIPSMFLDKRLEDDKDYGLSLFKPNSET  262

Query  158  YVQWLDIREPKSVVYVSFGSVAIFT  232
             ++WLD +EP SVVYVSFGS+A  T
Sbjct  263  CMKWLDSKEPGSVVYVSFGSLATLT  287



>ref|XP_011002911.1| PREDICTED: UDP-glycosyltransferase 74E2-like isoform X2 [Populus 
euphratica]
Length=458

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 53/85 (62%), Gaps = 9/85 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            +A   L NTF  LE+++V WMA  W +K +GP +P +  D+         + LF+ + E+
Sbjct  203  EASWLLWNTFNELEDEIVDWMASKWPIKPIGPTIPSMFLDKRLEDDKDYGLSLFKPNSET  262

Query  158  YVQWLDIREPKSVVYVSFGSVAIFT  232
             ++WLD +EP SVVYVSFGS+A  T
Sbjct  263  CMKWLDSKEPGSVVYVSFGSLATLT  287



>gb|AIE12488.1| UGT8 [Panax ginseng]
Length=452

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 36/81 (44%), Positives = 52/81 (64%), Gaps = 9/81 (11%)
 Frame = +2

Query  8    ADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGESY  160
            A+  L N+F  LEE+VVKWM+++W+V+ +GP VP ++ D           +LF+   E  
Sbjct  202  AEWVLFNSFDKLEEEVVKWMSNLWTVRNIGPTVPSVYLDNRVENDNDYGFNLFKPSTEVC  261

Query  161  VQWLDIREPKSVVYVSFGSVA  223
            +QWL+ +E  SVVYVSFGS A
Sbjct  262  MQWLNTKETGSVVYVSFGSAA  282



>ref|XP_010684803.1| PREDICTED: UDP-glycosyltransferase 74E1-like [Beta vulgaris subsp. 
vulgaris]
Length=472

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 34/84 (40%), Positives = 55/84 (65%), Gaps = 9/84 (11%)
 Frame = +2

Query  8    ADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGESY  160
            AD  L N+F +LE++VVKWMA++W V+T+GP +P  + D+          +LF+ + ++ 
Sbjct  218  ADLVLFNSFDNLEDEVVKWMANLWPVRTIGPTLPSAYLDKRVEHDVDYGFNLFKSNNDTC  277

Query  161  VQWLDIREPKSVVYVSFGSVAIFT  232
            + WL+ ++  SVVYVSFGS A  +
Sbjct  278  LNWLNAKQVASVVYVSFGSAAALS  301



>gb|KEH25946.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=461

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 50/80 (63%), Gaps = 9/80 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            + D  L NTFY LE +VV W+  IWS+KT+GP VP +  DR         I++F  + ES
Sbjct  203  QVDWVLANTFYELEPEVVDWLKKIWSLKTIGPCVPSMFLDRRIQDDNDYGINIFNPNSES  262

Query  158  YVQWLDIREPKSVVYVSFGS  217
             ++WLD +   SVVYVSFGS
Sbjct  263  CIKWLDDKPKGSVVYVSFGS  282



>ref|XP_010042371.1| PREDICTED: UDP-glycosyltransferase 74E2-like, partial [Eucalyptus 
grandis]
Length=346

 Score = 72.0 bits (175),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 52/82 (63%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            KA   L NTF  LEE++V WM + WS+ TVGP +P ++KD+         + LF+ + E+
Sbjct  176  KAKWLLFNTFSELEEELVNWMGNQWSMMTVGPTIPSVYKDKRLEDDTGYGLSLFKPEAEA  235

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             ++WLD + P S +YVSFG +A
Sbjct  236  CLRWLDSKLPCSTIYVSFGCLA  257



>ref|XP_010522243.1| PREDICTED: UDP-glycosyltransferase 74E2 [Tarenaya hassleriana]
Length=455

 Score = 72.8 bits (177),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 52/85 (61%), Gaps = 10/85 (12%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMA-DIWSVKTVGPLVPILHKDR---------IDLFELDGE  154
            KAD  L NTF  LEE+V+KWM  ++W VK +GP VP L+ D+         + LF    +
Sbjct  198  KADLVLCNTFDKLEEKVMKWMEENLWPVKNIGPTVPSLYLDKRLPGDKDYGLSLFNPKVD  257

Query  155  SYVQWLDIREPKSVVYVSFGSVAIF  229
              + WLD +EP SVVYVSFGS+ + 
Sbjct  258  ECLTWLDTKEPNSVVYVSFGSLVVL  282



>ref|XP_010510162.1| PREDICTED: UDP-glycosyltransferase 74D1-like [Camelina sativa]
Length=456

 Score = 72.8 bits (177),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 52/82 (63%), Gaps = 9/82 (11%)
 Frame = +2

Query  11   DCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGESYV  163
            D FL+N+F  LE +V++WM + W VK +GP++P ++ D+         I+LF       +
Sbjct  202  DFFLVNSFDELEVEVLQWMTNQWPVKNIGPMIPSMYLDKRLAGDKDYGINLFNAQVNECL  261

Query  164  QWLDIREPKSVVYVSFGSVAIF  229
             WLD ++P SV+YVSFGS+A+ 
Sbjct  262  DWLDSKQPSSVIYVSFGSLAVL  283



>ref|XP_010069225.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Eucalyptus grandis]
Length=467

 Score = 72.8 bits (177),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 52/82 (63%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            KA   L NTF  LEE++V WM + WS+ TVGP +P ++ D+         + LF+ + E+
Sbjct  205  KAKWLLFNTFTELEEELVNWMGNQWSMMTVGPTIPSVYMDKRLEDDTGYGLSLFKPEAEA  264

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             ++WLD + P S VYVSFGS+A
Sbjct  265  CLRWLDSKPPCSTVYVSFGSLA  286



>ref|XP_010069224.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Eucalyptus grandis]
Length=467

 Score = 72.8 bits (177),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 52/82 (63%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            KA   L NTF  LEE++V WM + WS+ TVGP +P ++ D+         + LF+ + E+
Sbjct  205  KAKWLLFNTFTELEEELVNWMGNQWSMMTVGPTIPSVYMDKRLEDDTGYGLSLFKPEAEA  264

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             ++WLD + P S VYVSFGS+A
Sbjct  265  CLRWLDSKPPCSTVYVSFGSLA  286



>ref|XP_010414087.1| PREDICTED: UDP-glycosyltransferase 74D1-like [Camelina sativa]
Length=456

 Score = 72.8 bits (177),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 52/82 (63%), Gaps = 9/82 (11%)
 Frame = +2

Query  11   DCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGESYV  163
            D FL+N+F  LE +V++WM + W VK +GP++P ++ D+         I+LF       +
Sbjct  202  DFFLVNSFDELEVEVLQWMTNQWPVKNIGPMIPSMYLDKRLAGDKDYGINLFNAQVNECL  261

Query  164  QWLDIREPKSVVYVSFGSVAIF  229
             WLD ++P SV+YVSFGS+A+ 
Sbjct  262  DWLDSKQPSSVIYVSFGSLAVL  283



>gb|KFK31187.1| hypothetical protein AALP_AA6G079800 [Arabis alpina]
Length=456

 Score = 72.8 bits (177),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 51/82 (62%), Gaps = 9/82 (11%)
 Frame = +2

Query  11   DCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGESYV  163
            D FL+N+F  LE +V++WM + W VK +GP++P ++ D+         I LF       +
Sbjct  202  DFFLVNSFDELEFEVLEWMKNQWPVKNIGPMIPSMYLDKRITGDKDYGISLFNAQTNECL  261

Query  164  QWLDIREPKSVVYVSFGSVAIF  229
             WLD + P SV+YVSFGS+A+F
Sbjct  262  NWLDSKPPGSVIYVSFGSLAVF  283



>gb|KCW57503.1| hypothetical protein EUGRSUZ_H00275 [Eucalyptus grandis]
Length=483

 Score = 72.8 bits (177),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 52/82 (63%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            KA   L NTF  LEE++V WM + WS+ TVGP +P ++ D+         + LF+ + E+
Sbjct  221  KAKWLLFNTFTELEEELVNWMGNQWSMMTVGPTIPSVYMDKRLEDDTGYGLSLFKPEAEA  280

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             ++WLD + P S VYVSFGS+A
Sbjct  281  CLRWLDSKPPCSTVYVSFGSLA  302



>gb|KCW57502.1| hypothetical protein EUGRSUZ_H00273 [Eucalyptus grandis]
Length=483

 Score = 72.8 bits (177),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 52/82 (63%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            KA   L NTF  LEE++V WM + WS+ TVGP +P ++ D+         + LF+ + E+
Sbjct  221  KAKWLLFNTFTELEEELVNWMGNQWSMMTVGPTIPSVYMDKRLEDDTGYGLSLFKPEAEA  280

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             ++WLD + P S VYVSFGS+A
Sbjct  281  CLRWLDSKPPCSTVYVSFGSLA  302



>ref|XP_011079130.1| PREDICTED: UDP-glycosyltransferase 74E1-like [Sesamum indicum]
Length=462

 Score = 72.4 bits (176),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 36/85 (42%), Positives = 52/85 (61%), Gaps = 9/85 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            KAD   INTF  LEE+V++WM+    VK +GP +P ++ D+           +F+ D  +
Sbjct  201  KADWIFINTFDELEEEVLEWMSRSLRVKAIGPAIPSMYLDKRLQDDREYDFTIFKPDTNA  260

Query  158  YVQWLDIREPKSVVYVSFGSVAIFT  232
               WL+ R+PKSV+YVSFGS+A  T
Sbjct  261  CKNWLNQRQPKSVIYVSFGSLAQLT  285



>gb|AFJ52952.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=441

 Score = 72.4 bits (176),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 52/83 (63%), Gaps = 10/83 (12%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            KADC L NT Y LE +   W++ IW ++TVGP +P ++ D+           +F+ + E+
Sbjct  181  KADCILCNTVYDLENETADWLSTIWPLRTVGPTIPSMYLDKQLQDDRDYGFSIFKPNNEA  240

Query  158  YVQWLDIREPK-SVVYVSFGSVA  223
             + WL+  +PK SV+YVSFGS+A
Sbjct  241  CINWLNNNKPKGSVIYVSFGSLA  263



>ref|XP_010037081.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Eucalyptus grandis]
 gb|KCW48705.1| hypothetical protein EUGRSUZ_K02356 [Eucalyptus grandis]
Length=468

 Score = 72.4 bits (176),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 53/81 (65%), Gaps = 9/81 (11%)
 Frame = +2

Query  8    ADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGESY  160
            AD  L N+FY LE++VV +MA +W +KTVGP +P ++ D+         I+LF  D ES 
Sbjct  212  ADLVLYNSFYELEKEVVDYMAKLWPLKTVGPAIPSIYLDKRLQDDKDYGINLFRPDTESC  271

Query  161  VQWLDIREPKSVVYVSFGSVA  223
            + WL+ +   SV+YVSFGS+A
Sbjct  272  LSWLNDKPINSVIYVSFGSMA  292



>ref|XP_004289756.1| PREDICTED: UDP-glycosyltransferase 74E1-like [Fragaria vesca 
subsp. vesca]
Length=461

 Score = 72.4 bits (176),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 49/82 (60%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            KAD  L NTFY LEEQVV W+A  W V+T+GP +P  + D          +DLF+   ++
Sbjct  206  KADWVLCNTFYELEEQVVDWLAKFWPVRTIGPTIPSNYLDNRLKDDKGYGVDLFKSSNDA  265

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             ++WL+     SV Y+SFGS A
Sbjct  266  CMKWLNKHPKNSVAYISFGSAA  287



>ref|XP_004289758.1| PREDICTED: UDP-glycosyltransferase 74E1-like [Fragaria vesca 
subsp. vesca]
Length=461

 Score = 72.4 bits (176),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 49/82 (60%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            KAD  L NTFY LEEQVV W+A  W V+T+GP +P  + D          +DLF+   ++
Sbjct  206  KADWVLCNTFYDLEEQVVDWLAKFWPVRTIGPTIPSNYLDNRLKDDKGYGVDLFKSSNDA  265

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             ++WL+     SV Y+SFGS A
Sbjct  266  CMKWLNKHPKNSVAYISFGSAA  287



>dbj|BAG80543.1| UDP-glucose:glucosyltransferase [Lycium barbarum]
Length=445

 Score = 72.0 bits (175),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 54/82 (66%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            KAD  L NTF  LE++VV W+   + +KT+GP +P ++ D+         + LF+ +GE+
Sbjct  193  KADWLLFNTFDVLEKEVVNWLRTQYPIKTIGPTIPSMYLDKRLKEDKEYGLSLFKPNGET  252

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             V+WLD RE  SVVYVSFG++A
Sbjct  253  CVKWLDSREIGSVVYVSFGTLA  274



>gb|EYU17621.1| hypothetical protein MIMGU_mgv1a006158mg [Erythranthe guttata]
Length=454

 Score = 72.4 bits (176),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 55/85 (65%), Gaps = 9/85 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
             AD  L NTF  LE++++KWM++ + ++T+GP VP ++ D+         + LF+   ES
Sbjct  202  NADWRLFNTFDKLEDEILKWMSNKYPIRTIGPTVPSMYADKRLKGNYDYGLSLFKPSTES  261

Query  158  YVQWLDIREPKSVVYVSFGSVAIFT  232
              QWL+ +E +SV+YVSFGS+A  T
Sbjct  262  CFQWLETKEDRSVIYVSFGSLADLT  286



>gb|EYU41208.1| hypothetical protein MIMGU_mgv1a025741mg [Erythranthe guttata]
Length=467

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 31/82 (38%), Positives = 53/82 (65%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            KAD  L N+F+ LEE+V+ WM+ IW V+ +GP +P ++ D           ++ + + E+
Sbjct  208  KADWILFNSFHHLEEEVINWMSKIWPVRPIGPTLPSIYLDNRVKDDNNYGFNIHKPNTET  267

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             ++WLD ++ +SV+Y+SFGS A
Sbjct  268  CMKWLDSKKTRSVIYISFGSAA  289



>ref|XP_007199135.1| hypothetical protein PRUPE_ppa019481mg, partial [Prunus persica]
 gb|EMJ00334.1| hypothetical protein PRUPE_ppa019481mg, partial [Prunus persica]
Length=275

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 49/82 (60%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            KAD    NTFY  E+QVV WMA  W V+++GP +P  + D+         ++LF+ D  +
Sbjct  190  KADWIFCNTFYDSEKQVVDWMAKFWPVRSIGPTIPSNYLDKRLENDKEYGVNLFKPDNGA  249

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             ++WL+ R   SV YVSFGS A
Sbjct  250  SLKWLNDRPKGSVAYVSFGSAA  271



>gb|KDO41311.1| hypothetical protein CISIN_1g038830mg, partial [Citrus sinensis]
Length=335

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 52/84 (62%), Gaps = 9/84 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            KAD  L NTFY LE++V +W+   W ++T+GP +P ++ D+           +FE D ES
Sbjct  77   KADWILCNTFYELEKEVTEWLGKHWLLRTIGPTLPSIYLDKQIEDDKEYGFSIFEPDIES  136

Query  158  YVQWLDIREPKSVVYVSFGSVAIF  229
             ++WL+ R   SVVYVSFGS+A  
Sbjct  137  SMKWLNDRANGSVVYVSFGSMATL  160



>gb|KEH25945.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=457

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 52/82 (63%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            KAD  L NTFY LE +VV W++ IW +KT+GP VP  H D+         + + + + ES
Sbjct  203  KADWILANTFYELEPEVVDWLSKIWPLKTIGPSVPSSHLDKRIKDDKEYGVSVSDPNTES  262

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             ++WL+ +  +SVVYVSFGS A
Sbjct  263  SIKWLNEKPKRSVVYVSFGSNA  284



>gb|KDP45202.1| hypothetical protein JCGZ_15067 [Jatropha curcas]
Length=454

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 51/82 (62%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            +AD  L N+FY LEE+ V WMA  W ++T+GP +P ++ D+         I+LFE D  +
Sbjct  201  EADWILYNSFYKLEEEAVDWMAKRWRLRTIGPTLPSMYLDKRLEDDKHYGINLFEPDTTA  260

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             + WL  +   SVVYVSFGS+A
Sbjct  261  CLNWLQDKPSGSVVYVSFGSMA  282



>ref|XP_011082055.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Sesamum indicum]
Length=476

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 52/82 (63%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
             AD    NTFY LEE+V+  MA  + VKTVGP +P ++ D+         + ++  D E+
Sbjct  213  NADWLFFNTFYKLEEEVIDNMAKFFPVKTVGPTIPSMYLDKRLSDDREYGLSIYNPDTEA  272

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             ++WL  R+P+SVVYVSFGS+A
Sbjct  273  CMEWLKQRQPESVVYVSFGSLA  294



>ref|XP_002529822.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF32571.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=453

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 54/82 (66%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            +AD    NTF SLE++V++ M   W VK++GP +P ++ D+         I+LF+ + E+
Sbjct  192  EADWVFFNTFNSLEDEVLRGMTSQWPVKSIGPTIPSMYLDKRVEDNREYGINLFKPNVEN  251

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             ++WLD+RE  SVVYVSFGS+ 
Sbjct  252  CMKWLDLREASSVVYVSFGSIT  273



>ref|XP_010908661.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Elaeis guineensis]
Length=461

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 52/81 (64%), Gaps = 9/81 (11%)
 Frame = +2

Query  8    ADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPI------LHKDR---IDLFELDGESY  160
            AD  L NTF  LE +V+ WMA+   +K +GP+VP       L  D+   +DL++ +G   
Sbjct  197  ADWVLCNTFQELENEVINWMANYMPMKAIGPMVPSTCINEHLDGDKNYGVDLWKANGGVC  256

Query  161  VQWLDIREPKSVVYVSFGSVA  223
            + WLD REP+SVVYVSFGS++
Sbjct  257  MNWLDKREPQSVVYVSFGSIS  277



>ref|XP_010469679.1| PREDICTED: UDP-glycosyltransferase 74D1 [Camelina sativa]
Length=456

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 51/82 (62%), Gaps = 9/82 (11%)
 Frame = +2

Query  11   DCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGESYV  163
            D FL+N+F  LE +V++WM + W VK +GP++P ++ D+         I+LF       +
Sbjct  202  DFFLVNSFDELEVEVLQWMKNQWPVKNIGPMIPSMYLDKRLGGDKDYGINLFNAQVNECL  261

Query  164  QWLDIREPKSVVYVSFGSVAIF  229
             WLD + P SV+YVSFGS+A+ 
Sbjct  262  DWLDSKPPSSVIYVSFGSLAVL  283



>ref|XP_006447238.1| hypothetical protein CICLE_v10018164mg, partial [Citrus clementina]
 gb|ESR60478.1| hypothetical protein CICLE_v10018164mg, partial [Citrus clementina]
Length=428

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 52/84 (62%), Gaps = 9/84 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            KAD  L NTFY LE++V +W+   W ++T+GP +P ++ D+           +FE D ES
Sbjct  170  KADWILCNTFYELEKEVTEWLGKHWLLRTIGPTLPSIYLDKQIEDDKEYGFSIFEPDIES  229

Query  158  YVQWLDIREPKSVVYVSFGSVAIF  229
             ++WL+ R   SVVYVSFGS+A  
Sbjct  230  SMKWLNDRANGSVVYVSFGSMATL  253



>ref|XP_004957367.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Setaria italica]
Length=478

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 37/83 (45%), Positives = 48/83 (58%), Gaps = 10/83 (12%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVP--ILHKDR--------IDLFELDGE  154
            +AD  L+N+FY LE +  ++MA  W  KT+GP VP   L  DR        + LFEL   
Sbjct  218  EADDVLVNSFYELEPEEAEYMASAWRAKTIGPTVPASYLGDDRLPSDTKYGLHLFELTAA  277

Query  155  SYVQWLDIREPKSVVYVSFGSVA  223
              V WLD   P+SVVY SFGS++
Sbjct  278  PCVAWLDAHPPRSVVYASFGSLS  300



>ref|XP_002532443.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF29929.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=406

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 48/80 (60%), Gaps = 9/80 (11%)
 Frame = +2

Query  8    ADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGESY  160
            AD  L NTFY LEE+VV WMA  W + T+GP VP  + D+         I+LF+ D  + 
Sbjct  152  ADWVLCNTFYRLEEEVVDWMAKSWRLGTIGPTVPSRYLDKRLEDDKDYGINLFKPDSSTC  211

Query  161  VQWLDIREPKSVVYVSFGSV  220
            + WL  +   SVVYVSFGS+
Sbjct  212  MNWLKTKPSSSVVYVSFGSM  231



>ref|XP_002879339.1| hypothetical protein ARALYDRAFT_482098 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55598.1| hypothetical protein ARALYDRAFT_482098 [Arabidopsis lyrata subsp. 
lyrata]
Length=456

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 51/82 (62%), Gaps = 9/82 (11%)
 Frame = +2

Query  11   DCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGESYV  163
            D FL+N+F  LE +V++WM + W VK +GP++P ++ D+         I+LF       +
Sbjct  202  DFFLVNSFDELEVEVLQWMKNQWPVKNIGPMIPSMYLDKRIAGDKDYGINLFNAQVNECL  261

Query  164  QWLDIREPKSVVYVSFGSVAIF  229
             WLD + P SV+YVSFGS+A+ 
Sbjct  262  DWLDSKPPGSVIYVSFGSLAVL  283



>gb|AAM61249.1| putative glucosyltransferase [Arabidopsis thaliana]
Length=456

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 51/82 (62%), Gaps = 9/82 (11%)
 Frame = +2

Query  11   DCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGESYV  163
            D FL+N+F  LE +V++WM + W VK +GP++P ++ D+         I+LF       +
Sbjct  202  DFFLVNSFDELEVEVLQWMKNQWPVKNIGPMIPSMYLDKRLAGDKDYGINLFNAQVNECL  261

Query  164  QWLDIREPKSVVYVSFGSVAIF  229
             WLD + P SV+YVSFGS+A+ 
Sbjct  262  DWLDSKPPGSVIYVSFGSLAVL  283



>ref|NP_180734.1| UDP-glucosyl transferase 74D1 [Arabidopsis thaliana]
 sp|Q9SKC5.1|U74D1_ARATH RecName: Full=UDP-glycosyltransferase 74D1; AltName: Full=Jasmonate 
glucosyltransferase 1; Short=AtJGT1 [Arabidopsis thaliana]
 gb|AAD32297.1| putative glucosyltransferase [Arabidopsis thaliana]
 gb|AAM78098.1| At2g31750/F20M17.21 [Arabidopsis thaliana]
 gb|AAN38705.1| At2g31750/F20M17.21 [Arabidopsis thaliana]
 gb|ABA39729.1| jasmonic acid glucosyltransferase [Arabidopsis thaliana]
 gb|AEC08580.1| UDP-glucosyl transferase 74D1 [Arabidopsis thaliana]
 gb|AHL38825.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=456

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 51/82 (62%), Gaps = 9/82 (11%)
 Frame = +2

Query  11   DCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGESYV  163
            D FL+N+F  LE +V++WM + W VK +GP++P ++ D+         I+LF       +
Sbjct  202  DFFLVNSFDELEVEVLQWMKNQWPVKNIGPMIPSMYLDKRLAGDKDYGINLFNAQVNECL  261

Query  164  QWLDIREPKSVVYVSFGSVAIF  229
             WLD + P SV+YVSFGS+A+ 
Sbjct  262  DWLDSKPPGSVIYVSFGSLAVL  283



>ref|XP_004289755.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Fragaria vesca 
subsp. vesca]
Length=461

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 51/82 (62%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVP------ILHKDR---IDLFELDGES  157
            KAD  L NTFY LEEQVV W+A  W V+T+GP +P      +L  D+   +DLF+   ++
Sbjct  206  KADWVLCNTFYELEEQVVDWLAKFWPVRTIGPTIPSNYLDNLLKDDQGYGVDLFKSSNDA  265

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             ++WL+     +V Y+SFGS A
Sbjct  266  CMKWLNKHPKNTVAYISFGSGA  287



>ref|XP_007033374.1| Uridine diphosphate glycosyltransferase 74E2, putative isoform 
1 [Theobroma cacao]
 gb|EOY04300.1| Uridine diphosphate glycosyltransferase 74E2, putative isoform 
1 [Theobroma cacao]
Length=645

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 51/85 (60%), Gaps = 9/85 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            +AD    NTF  LE +V+  MA  W +KTVGP +P ++ D+         + LF+ D E 
Sbjct  390  EADWLFCNTFKELEHEVINCMASKWPIKTVGPTIPSMYLDKRIKDDNDYGLHLFKPDSEL  449

Query  158  YVQWLDIREPKSVVYVSFGSVAIFT  232
             ++WLD +E  SVVYVSFGS+A  T
Sbjct  450  CIKWLDSKETDSVVYVSFGSLAGLT  474



>emb|CDP08070.1| unnamed protein product [Coffea canephora]
Length=383

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 51/82 (62%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            K+D  L N+F  LE +VV W+ + + +KT+GP  P ++ D+         I+ F  D E+
Sbjct  202  KSDWLLFNSFDKLENEVVTWLTERYPIKTIGPCTPSMYTDKRLKDDKDYTINFFAPDSEA  261

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             ++WLD +E  SVVYVSFGSV+
Sbjct  262  CLKWLDTKETGSVVYVSFGSVS  283



>gb|KEH25950.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=458

 Score = 70.5 bits (171),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 50/82 (61%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            + D  L+NTFY LE +VV WMA  W +KT+GP +P +  D+         I  F  + E+
Sbjct  203  QVDWVLVNTFYELEPEVVDWMAKKWRLKTIGPCIPSMFLDKRLEDDNDYGISTFGPNSEA  262

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             ++WLD +   SVVYVSFGS+A
Sbjct  263  CIKWLDNKPKDSVVYVSFGSLA  284



>ref|XP_011002951.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyltransferase 74E2-like 
[Populus euphratica]
Length=493

 Score = 70.5 bits (171),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 50/85 (59%), Gaps = 9/85 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            +A   L NTF  LE+++V WMA  W +K  GP +P +  D+         + LF+ + E+
Sbjct  205  EASWLLGNTFNELEDEIVDWMASKWPIKPTGPTIPSMFLDKRLEDDKDYGLSLFKPNSET  264

Query  158  YVQWLDIREPKSVVYVSFGSVAIFT  232
             ++WLD +EP SVVYVSFG  A  T
Sbjct  265  CMKWLDSKEPGSVVYVSFGGFAALT  289



>ref|XP_007201011.1| hypothetical protein PRUPE_ppa005386mg [Prunus persica]
 gb|EMJ02210.1| hypothetical protein PRUPE_ppa005386mg [Prunus persica]
Length=463

 Score = 70.1 bits (170),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 52/82 (63%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            KAD  L NTF+ LE++ V WMA  W ++T+GP +P ++ D+         + L + + ++
Sbjct  208  KADWVLCNTFHELEQEAVDWMAKFWPLRTIGPTIPSMYMDKRHEDNWEYGLSLLKPNSDA  267

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             ++WL+++   SV YVSFGSVA
Sbjct  268  CMKWLNVKPKGSVAYVSFGSVA  289



>gb|ABK76266.1| triterpene carboxylic acid glucosyltransferase [Vaccaria hispanica]
Length=478

 Score = 70.5 bits (171),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 54/85 (64%), Gaps = 9/85 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            KAD  L+N+F  LEE+ +KW+++I SVKT+GP +P  + D+          + ++   E 
Sbjct  222  KADFVLLNSFDKLEEEAIKWISNICSVKTIGPTIPSTYLDKQIENDVDYGFNQYKPTNED  281

Query  158  YVQWLDIREPKSVVYVSFGSVAIFT  232
             ++WLD +E  SVVY++FGSVA  +
Sbjct  282  CMKWLDTKEANSVVYIAFGSVARLS  306



>gb|KDP45199.1| hypothetical protein JCGZ_15064 [Jatropha curcas]
Length=469

 Score = 70.1 bits (170),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 49/81 (60%), Gaps = 9/81 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            KAD    NTFY LE++VV W+A IW  KT+GP +P ++ D+         I +F+ + E+
Sbjct  207  KADWVFCNTFYDLEKEVVDWLAKIWPFKTIGPCIPSIYLDKQLENDKDYGISIFKPNNEA  266

Query  158  YVQWLDIREPKSVVYVSFGSV  220
             + WL  R   SV YVSFGS+
Sbjct  267  CMNWLSKRPKGSVAYVSFGSL  287



>ref|XP_006294187.1| hypothetical protein CARUB_v10023181mg [Capsella rubella]
 gb|EOA27085.1| hypothetical protein CARUB_v10023181mg [Capsella rubella]
Length=456

 Score = 70.1 bits (170),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 51/82 (62%), Gaps = 9/82 (11%)
 Frame = +2

Query  11   DCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGESYV  163
            D FL+N+F  LE +V++WM + W VK +GP++P ++ D+         I+LF       +
Sbjct  202  DFFLVNSFDELEVEVLEWMKNQWPVKNIGPMIPSMYLDKRLAGDKDYGINLFNPQVNECL  261

Query  164  QWLDIREPKSVVYVSFGSVAIF  229
             WLD + P SV+YVSFGS+A+ 
Sbjct  262  DWLDSKPPSSVIYVSFGSLAVL  283



>gb|KDP35131.1| hypothetical protein JCGZ_10665 [Jatropha curcas]
Length=462

 Score = 70.1 bits (170),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 48/78 (62%), Gaps = 9/78 (12%)
 Frame = +2

Query  26   NTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGESYVQWLDI  178
            NTFY LE+++V WMA  W  K +GP +P +  D+         + LF+ + ++ + WL+ 
Sbjct  204  NTFYELEDEIVNWMARKWPTKPIGPTIPSMFLDKQLEDDKDYGLSLFKPNSDACMNWLNA  263

Query  179  REPKSVVYVSFGSVAIFT  232
            +EP SVVY+SFGS+A   
Sbjct  264  KEPNSVVYISFGSLAALN  281



>ref|XP_008460407.1| PREDICTED: UDP-glycosyltransferase 74E1-like [Cucumis melo]
Length=468

 Score = 70.1 bits (170),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 53/85 (62%), Gaps = 9/85 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            +AD  L N+FY  E+QV++WM   W +KTVGP +P ++ DR          + F+ + E+
Sbjct  209  EADFLLCNSFYEQEQQVLEWMEKKWRMKTVGPNIPSMYADRQIQDDREYGFNFFKPNDEA  268

Query  158  YVQWLDIREPKSVVYVSFGSVAIFT  232
              +WL+ R+ KSVV+V+FGS +  +
Sbjct  269  CRKWLNDRQKKSVVFVAFGSFSTLS  293



>emb|CDP08069.1| unnamed protein product [Coffea canephora]
Length=435

 Score = 70.1 bits (170),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 51/82 (62%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            K+D  L N+F  LE +VV W+ + + +KT+GP  P ++ D+         I+ F  D E+
Sbjct  179  KSDWLLFNSFDKLENEVVTWLTERYPIKTIGPCTPSMYTDKRLKDDKDYTINFFAPDSEA  238

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             ++WLD +E  SVVYVSFGSV+
Sbjct  239  CLKWLDTKETGSVVYVSFGSVS  260



>ref|XP_002460530.1| hypothetical protein SORBIDRAFT_02g030020 [Sorghum bicolor]
 gb|EER97051.1| hypothetical protein SORBIDRAFT_02g030020 [Sorghum bicolor]
Length=494

 Score = 70.1 bits (170),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 35/83 (42%), Positives = 49/83 (59%), Gaps = 10/83 (12%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVP--ILHKDR--------IDLFELDGE  154
            +AD  L+N+FY LE +  ++MA  W  KT+GP VP   +  DR        + L+EL   
Sbjct  228  QADDVLVNSFYELEPEEAEYMASAWRAKTIGPTVPASYIGDDRLPSDTKYGLHLYELTAA  287

Query  155  SYVQWLDIREPKSVVYVSFGSVA  223
              + WLD   P+SVVYVSFGS++
Sbjct  288  PCIAWLDAHPPRSVVYVSFGSLS  310



>emb|CDP21774.1| unnamed protein product, partial [Coffea canephora]
Length=376

 Score = 69.3 bits (168),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 52/82 (63%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            +AD    NTFY LEE+V+ WMA I  VKT+GP +P ++ ++         ++LF+    +
Sbjct  196  EADWIFFNTFYGLEEEVIHWMAKILPVKTIGPTIPSMYLEKRLEDDKQYGVNLFKPMTNA  255

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             + WL+ R  +SVVYVSFGS+A
Sbjct  256  CMSWLNERSIRSVVYVSFGSLA  277



>ref|XP_010414084.1| PREDICTED: UDP-glycosyltransferase 74C1 [Camelina sativa]
Length=456

 Score = 69.7 bits (169),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 50/86 (58%), Gaps = 10/86 (12%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDRIDL----FELDG------E  154
            +ADC L NTF  LE +VVKWM D W VK +GP+VP  + D   L    +EL        E
Sbjct  200  RADCILCNTFDQLEPKVVKWMNDQWPVKNIGPVVPSKYLDNRLLEDKDYELQNSKTEPDE  259

Query  155  SYVQWLDIREPKSVVYVSFGSVAIFT  232
            S + WL  R  KSVVYV+FG++   +
Sbjct  260  SVLNWLGNRPAKSVVYVAFGTLVALS  285



>ref|XP_010542772.1| PREDICTED: UDP-glycosyltransferase 74D1 [Tarenaya hassleriana]
 ref|XP_010542773.1| PREDICTED: UDP-glycosyltransferase 74D1 [Tarenaya hassleriana]
Length=460

 Score = 69.7 bits (169),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 52/84 (62%), Gaps = 9/84 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            +A  FL+N+F  LE ++++WM ++W VK +GP VP ++ D+         + LF    + 
Sbjct  204  EAQFFLVNSFEELEVEILEWMENVWPVKNIGPTVPSMYLDKRLGDEKDYGLSLFNPKVDE  263

Query  158  YVQWLDIREPKSVVYVSFGSVAIF  229
             + WLD + P SVVYVSFGS+A+ 
Sbjct  264  CLTWLDTKPPDSVVYVSFGSLAVL  287



>ref|XP_009141176.1| PREDICTED: UDP-glycosyltransferase 74D1 [Brassica rapa]
Length=456

 Score = 69.3 bits (168),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 50/82 (61%), Gaps = 9/82 (11%)
 Frame = +2

Query  11   DCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGESYV  163
            D FL+N+F  LE +V++WM + W VK +GP++P ++ D+         I LF       +
Sbjct  202  DFFLVNSFDELEVEVLEWMKNQWPVKNIGPMIPSMYLDKRLAGDKDYGISLFNAQVNECL  261

Query  164  QWLDIREPKSVVYVSFGSVAIF  229
             WLD + P SV+YVSFGS+A+ 
Sbjct  262  DWLDSKPPGSVIYVSFGSLAVL  283



>ref|XP_011100878.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Sesamum indicum]
Length=455

 Score = 69.3 bits (168),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 54/85 (64%), Gaps = 9/85 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            KAD  L N+F  LEE+V+ WM+ +W +KT+GP +P ++ D           +++  + ++
Sbjct  200  KADWVLFNSFAKLEEEVINWMSRLWPLKTIGPTLPSVYVDNRLKDDNDYGFNIYTPNTDT  259

Query  158  YVQWLDIREPKSVVYVSFGSVAIFT  232
             ++WLD +E +SV+Y+SFGS A  +
Sbjct  260  CMKWLDSKETRSVIYISFGSAASLS  284



>ref|XP_007033645.1| UDP-glucosyltransferase 74F2, putative [Theobroma cacao]
 gb|EOY04571.1| UDP-glucosyltransferase 74F2, putative [Theobroma cacao]
Length=455

 Score = 69.3 bits (168),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 52/82 (63%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            KAD  L+NTFY LE + V+ M+ +  + T+GP +P ++ D+         ++LF+LD  S
Sbjct  200  KADFVLVNTFYKLEHEAVESMSKVSPLLTIGPTIPSMYLDQRVETDEDYDLNLFKLDSSS  259

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
              +WL  + P SVV+VSFGS+A
Sbjct  260  STEWLSTKPPGSVVFVSFGSMA  281



>ref|XP_002529825.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF32574.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=467

 Score = 69.3 bits (168),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 51/82 (62%), Gaps = 9/82 (11%)
 Frame = +2

Query  11   DCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGESYV  163
            D  L NTF  LE+++V WMA  W++  +GP +P +  D          ++LF+ + ++ +
Sbjct  205  DWLLWNTFTELEDEIVNWMASKWTIMPIGPAIPSMFLDNRLEDDKDYGVNLFKPNSDACM  264

Query  164  QWLDIREPKSVVYVSFGSVAIF  229
            +WLD +EP SV+YVSFGS+A  
Sbjct  265  KWLDSKEPSSVIYVSFGSLAAL  286



>emb|CDY64375.1| BnaCnng43810D [Brassica napus]
Length=474

 Score = 69.3 bits (168),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 50/82 (61%), Gaps = 9/82 (11%)
 Frame = +2

Query  11   DCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGESYV  163
            D FL+N+F  LE +V++WM + W VK +GP++P ++ D+         I LF       +
Sbjct  202  DFFLVNSFDELEVEVLEWMKNQWPVKNIGPMIPSMYLDKRLAGDKDYGISLFNAQVNECL  261

Query  164  QWLDIREPKSVVYVSFGSVAIF  229
             WLD + P SV+YVSFGS+A+ 
Sbjct  262  DWLDSKPPGSVIYVSFGSLAVL  283



>gb|AIE12489.1| UGT9 [Panax ginseng]
Length=439

 Score = 69.3 bits (168),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 51/81 (63%), Gaps = 9/81 (11%)
 Frame = +2

Query  8    ADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGESY  160
            AD  L N+F  LE ++VKWMA  W +KT+GP +P ++ D+         I LF+ + +  
Sbjct  187  ADWLLFNSFDKLENELVKWMASKWPIKTIGPTIPSIYLDKRLEDDKDYGISLFKPNDDVC  246

Query  161  VQWLDIREPKSVVYVSFGSVA  223
            ++WLD +   SVVY+SFGS+A
Sbjct  247  MKWLDTKPNNSVVYISFGSLA  267



>gb|AGR44631.1| UDP-glucosyltransferase 74A1 [Panax ginseng]
Length=451

 Score = 69.3 bits (168),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 50/81 (62%), Gaps = 9/81 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            KAD    NTF  LE +  KW++  W + ++GPL+P ++ D+         I+L++ D  S
Sbjct  195  KADWIFFNTFDKLENEEAKWLSSQWPITSIGPLIPSMYLDKQLPNDKGNGINLYKADVGS  254

Query  158  YVQWLDIREPKSVVYVSFGSV  220
             ++WLD ++P SVVY SFGSV
Sbjct  255  CIKWLDAKDPGSVVYASFGSV  275



>gb|AEZ01222.1| UDP-glucosyltransferase [Carica papaya]
Length=472

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 49/85 (58%), Gaps = 9/85 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            +A C L N+F  LE QV+ WM   W +K +GP VP +  D+         + LF+    +
Sbjct  217  EAKCVLANSFDELENQVMNWMPSQWRIKNIGPTVPSMFLDKRLEDDKDYGLTLFKPQAVT  276

Query  158  YVQWLDIREPKSVVYVSFGSVAIFT  232
             + WLD ++P SV+YVSFGS+A  +
Sbjct  277  CLTWLDSKQPSSVIYVSFGSLASLS  301



>ref|XP_007151915.1| hypothetical protein PHAVU_004G086500g [Phaseolus vulgaris]
 gb|ESW23909.1| hypothetical protein PHAVU_004G086500g [Phaseolus vulgaris]
Length=460

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 51/82 (62%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            KAD  L NTFY LE+ VV W+  IW +K +GP +P ++ D+         +D++    E+
Sbjct  201  KADWVLANTFYELEQGVVDWLVKIWPLKPIGPTLPSMYLDKRVQDDKDYGVDMYIPKSEA  260

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             ++WLD +   SVVYVSFGS+A
Sbjct  261  CIKWLDDKPKGSVVYVSFGSMA  282



>gb|KCW57957.1| hypothetical protein EUGRSUZ_H00691 [Eucalyptus grandis]
Length=443

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 39/83 (47%), Positives = 51/83 (61%), Gaps = 11/83 (13%)
 Frame = +2

Query  8    ADCFLINTFYSLEEQVVKWMA-DIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            AD  L N FY LEE+VV WM+ ++W +KT+GP +P L+ D+         I+LF     S
Sbjct  181  ADLVLFNNFYELEEEVVDWMSTNLWPLKTIGPTLPSLYLDKRLPDDTAYGINLFTPTTTS  240

Query  158  YVQ-WLDIREPKSVVYVSFGSVA  223
             V  WL    P+SVVYVSFGS+A
Sbjct  241  TVSAWLCSHPPRSVVYVSFGSMA  263



>dbj|BAG80534.1| putative glycosyltransferase [Lycium barbarum]
Length=447

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 54/82 (66%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            KAD  L N+F  LE++V+ W+   + +KT+GP++P ++ D+         + LF+ + E+
Sbjct  195  KADWLLFNSFDVLEKEVINWLRSQYRIKTIGPIIPSMYLDKRLKDDKEYGLSLFKPNSET  254

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             ++WLD RE  SVVYVSFGS+A
Sbjct  255  CMKWLDSREFGSVVYVSFGSLA  276



>emb|CDP03926.1| unnamed protein product [Coffea canephora]
Length=461

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 50/80 (63%), Gaps = 9/80 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            +AD  +++ F+ LEE V+ WMA +W VKTVGP VP ++ D+         I+LF+ D   
Sbjct  200  QADWVILSNFHKLEEDVLNWMARLWRVKTVGPTVPSMYLDKRLEDDTGYGINLFKPDSSL  259

Query  158  YVQWLDIREPKSVVYVSFGS  217
             + WLD +   SVVYV+FGS
Sbjct  260  CINWLDNQPKDSVVYVAFGS  279



>ref|XP_007159561.1| hypothetical protein PHAVU_002G247700g [Phaseolus vulgaris]
 gb|ESW31555.1| hypothetical protein PHAVU_002G247700g [Phaseolus vulgaris]
Length=459

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 52/85 (61%), Gaps = 10/85 (12%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            KAD  L+N+FY LE+QVV  M+ +  + T+GP VP  H D+         ++LFELD  S
Sbjct  204  KADLILVNSFYKLEDQVVDSMSKLCPLLTIGPTVPSFHLDKAVPNDTENVLNLFELD-SS  262

Query  158  YVQWLDIREPKSVVYVSFGSVAIFT  232
             + WL  +   SV+Y+SFGS+  F+
Sbjct  263  AISWLKQKGAGSVIYISFGSMVCFS  287



>ref|XP_003548080.2| PREDICTED: UDP-glycosyltransferase 74E2-like [Glycine max]
 gb|KHN32810.1| UDP-glycosyltransferase 74E2 [Glycine soja]
Length=478

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 52/82 (63%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            KAD  L N+FY LE+ VV W+  IW +K +GP +P ++ D+         ++++  + E+
Sbjct  219  KADWVLANSFYELEQGVVDWLVKIWPLKPIGPCLPSIYLDKRLQDDKDYGVNMYNPNSEA  278

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             ++WLD +   SVVYVSFGS+A
Sbjct  279  CIKWLDEKPKGSVVYVSFGSMA  300



>ref|XP_006410305.1| hypothetical protein EUTSA_v10016638mg [Eutrema salsugineum]
 gb|ESQ51758.1| hypothetical protein EUTSA_v10016638mg [Eutrema salsugineum]
Length=456

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 49/82 (60%), Gaps = 9/82 (11%)
 Frame = +2

Query  11   DCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGESYV  163
            D FL+N+F  LE +V++WM   W VK +GP++P ++ D+         I LF       +
Sbjct  202  DFFLVNSFDELEVEVLEWMKKQWQVKNIGPMIPSMYLDKRLEGDKEYGISLFNAQVNECL  261

Query  164  QWLDIREPKSVVYVSFGSVAIF  229
             WLD + P SV+YVSFGS+A+ 
Sbjct  262  DWLDSKPPGSVIYVSFGSLAVL  283



>ref|XP_006447240.1| hypothetical protein CICLE_v10015138mg [Citrus clementina]
 ref|XP_006469903.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Citrus sinensis]
 gb|ESR60480.1| hypothetical protein CICLE_v10015138mg [Citrus clementina]
Length=468

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 50/84 (60%), Gaps = 9/84 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            KAD  L NTFY LE++V +W+   WS+KT+GP  P ++  +           +F+ + ES
Sbjct  210  KADWVLCNTFYELEKEVAQWLGKHWSLKTIGPTKPSMYLGKQIEEDKDYGFSIFKPNNES  269

Query  158  YVQWLDIREPKSVVYVSFGSVAIF  229
             ++WL+ R    VVYVSFGS+A  
Sbjct  270  CIKWLNDRANGCVVYVSFGSMATL  293



>gb|ABP49574.1| UDP-glucose glucosyltransferase [Rhodiola sachalinensis]
Length=453

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 50/84 (60%), Gaps = 9/84 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            +AD    NTF  LE Q+V+WMA  W V TVGP +P ++ D+         ++LF+ + ES
Sbjct  195  EADYVFFNTFDKLENQMVEWMARQWQVLTVGPTIPSMYLDKCVKDDRSYGLNLFKPNRES  254

Query  158  YVQWLDIREPKSVVYVSFGSVAIF  229
               WL  R   SV+YVSFGS+AI 
Sbjct  255  CRDWLCERRASSVIYVSFGSMAIL  278



>ref|XP_010069226.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Eucalyptus grandis]
 gb|KCW57504.1| hypothetical protein EUGRSUZ_H00277 [Eucalyptus grandis]
Length=483

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 51/82 (62%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            KA   L NTF  LEE++V WM + W + TVGP +P L+ D+         + LF+ + E+
Sbjct  221  KAKWLLFNTFTELEEEMVNWMGNQWLMLTVGPTIPSLYLDKRLEDDTDYGLSLFKPEAEA  280

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             ++WLD + P S +Y+SFGS+A
Sbjct  281  CLRWLDSKPPCSTLYISFGSLA  302



>emb|CDP03994.1| unnamed protein product [Coffea canephora]
Length=461

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 49/80 (61%), Gaps = 9/80 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            +AD  +++ F+ LEE  V WMA +W VKTVGP VP ++ D+         I+LF+ D   
Sbjct  200  QADWVILSNFHKLEEDAVNWMARLWRVKTVGPTVPSMYLDKRLEDDTGYGINLFKPDSSL  259

Query  158  YVQWLDIREPKSVVYVSFGS  217
             + WLD +   SVVYV+FGS
Sbjct  260  CINWLDNQPKDSVVYVAFGS  279



>ref|XP_011082054.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Sesamum indicum]
Length=473

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 55/82 (67%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            KAD   +NTFY LEE+V+  MA    VKT+GP VP ++ D+         +++++ D  +
Sbjct  201  KADWLFLNTFYQLEEEVIDNMAKFLPVKTIGPTVPSMYLDKRVPDDKEYGLNVYKPDTVA  260

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             ++WL+ ++P++VVYVSFGS+A
Sbjct  261  CMEWLNQQQPETVVYVSFGSLA  282



>ref|XP_004244485.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Solanum lycopersicum]
Length=456

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 52/82 (63%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            K DC LIN+FY LE++V++WM+ I+ +KT+GP +P ++ D+         + +F+     
Sbjct  199  KVDCVLINSFYELEKEVIEWMSKIYPIKTIGPTIPSMYLDKRLHDDKEYGLSVFKPMTNE  258

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             + WL+ +   SVVYVSFGS+ 
Sbjct  259  CLNWLNHQPISSVVYVSFGSIT  280



>ref|NP_001234680.1| UDP-xylose phenolic glycosyltransferase [Solanum lycopersicum]
 emb|CAI62049.1| UDP-xylose phenolic glycosyltransferase [Solanum lycopersicum]
Length=456

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 52/82 (63%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            K DC LIN+FY LE++V+ WM+ I+ +KT+GP +P ++ D+         + +F+     
Sbjct  199  KVDCVLINSFYELEKEVIDWMSKIYPIKTIGPTIPSMYLDKRLHDDKEYGLSMFKPMTNE  258

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             + WL+ +   SV+YVSFGS+A
Sbjct  259  CLNWLNHQPISSVLYVSFGSLA  280



>ref|XP_010469678.1| PREDICTED: UDP-glycosyltransferase 74C1-like [Camelina sativa]
Length=465

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 49/86 (57%), Gaps = 10/86 (12%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDRI----DLFELDG------E  154
            +ADC L NTF  LE +VVKWM D W VK +GP+VP  + D        +EL        E
Sbjct  200  RADCILCNTFGQLEPKVVKWMNDQWPVKNIGPVVPSKYLDNRLPEDKDYELQNSKTEPDE  259

Query  155  SYVQWLDIREPKSVVYVSFGSVAIFT  232
            S + WL  R  KSVVYV+FG++   +
Sbjct  260  SVLNWLGNRPAKSVVYVAFGTLVALS  285



>ref|XP_004253027.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Solanum lycopersicum]
Length=453

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 53/82 (65%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            KAD  L N+F  LE++V+ W+     +KT+GPL+P ++ D+         + LF+ + E+
Sbjct  199  KADWLLFNSFDVLEKEVISWLRTQCRIKTIGPLIPSMYLDKRLKDDKEYGLSLFKPNSET  258

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             ++WLD RE  SVVYVSFGS+A
Sbjct  259  CMKWLDSREIGSVVYVSFGSLA  280



>emb|CBI24721.3| unnamed protein product [Vitis vinifera]
Length=717

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 52/82 (63%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            K    L NTF  LEE+V+KWMA +  +KT+GP VP ++ D+         + LF+ + ++
Sbjct  535  KVKWILFNTFDKLEEEVMKWMASLRPIKTIGPTVPSMYLDKRLEEDKEYGLSLFKQNVDA  594

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
            Y+ WLD++   SVVY SFGS+A
Sbjct  595  YIAWLDLKGIGSVVYASFGSMA  616


 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 51/82 (62%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            K +    NTF  LE++VVKW+A    +KT+GP +P ++ DR         + LF+ + ++
Sbjct  194  KVNWVFFNTFCELEDEVVKWLASKRPIKTIGPTIPSMYLDRRIDDDEDYGLSLFKPNADA  253

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             + WLD ++  SVVYVSFGS+A
Sbjct  254  CITWLDTKDTVSVVYVSFGSLA  275



>ref|XP_007222164.1| hypothetical protein PRUPE_ppa005780mg [Prunus persica]
 gb|EMJ23363.1| hypothetical protein PRUPE_ppa005780mg [Prunus persica]
Length=444

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 50/81 (62%), Gaps = 9/81 (11%)
 Frame = +2

Query  8    ADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGESY  160
            AD    NTF  LE +VV WM   W +KT+GP +P ++ D+         I+ F+ + ++ 
Sbjct  201  ADWIFCNTFDCLEPEVVSWMRTKWPIKTIGPTLPSMYLDKRLEDDRDYGINFFKPNNDTC  260

Query  161  VQWLDIREPKSVVYVSFGSVA  223
            ++WLD +E  +VVYVSFGS+A
Sbjct  261  IKWLDSKEASTVVYVSFGSIA  281



>ref|XP_004292062.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Fragaria vesca 
subsp. vesca]
Length=463

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 52/80 (65%), Gaps = 9/80 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            +AD  L NTFY LE +VV WM+ +W +KT+GP +P ++ D          ++LF+ + ++
Sbjct  205  EADWVLCNTFYELEPEVVDWMSKLWPLKTIGPTIPSMYLDNRLKEDKGYGVNLFKQNHDA  264

Query  158  YVQWLDIREPKSVVYVSFGS  217
             ++WL+ +   SVVYVSFGS
Sbjct  265  CMKWLNEQPKDSVVYVSFGS  284



>ref|XP_010510154.1| PREDICTED: UDP-glycosyltransferase 74C1-like [Camelina sativa]
Length=456

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 49/86 (57%), Gaps = 10/86 (12%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDRI----DLFELD------GE  154
            +ADC L NTF  LE +VVKWM D W VK +GP+VP  + D        +EL        E
Sbjct  200  RADCILCNTFDQLEPKVVKWMNDQWPVKNIGPVVPSKYLDNRLPEDKDYELQNSKTEPNE  259

Query  155  SYVQWLDIREPKSVVYVSFGSVAIFT  232
            S + WL  R  KSVVYV+FG++   +
Sbjct  260  SVLNWLGKRPAKSVVYVAFGTLVALS  285



>emb|CAN67248.1| hypothetical protein VITISV_008683 [Vitis vinifera]
Length=422

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 50/75 (67%), Gaps = 9/75 (12%)
 Frame = +2

Query  26   NTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGESYVQWLDI  178
            NTF  LEE+V+KWMA +  +KT+GP VP ++ D+         + LF+ + ++Y+ WLD+
Sbjct  172  NTFDKLEEEVMKWMASLRPIKTIGPTVPSMYLDKRLEEDKEYGLSLFKQNVDAYIAWLDL  231

Query  179  REPKSVVYVSFGSVA  223
            +   SVVY SFGS+A
Sbjct  232  KGIGSVVYASFGSMA  246



>ref|XP_010475277.1| PREDICTED: UDP-glycosyltransferase 74E2 [Camelina sativa]
Length=452

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 49/84 (58%), Gaps = 9/84 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            + D  L NTF  LEE+V+KW+  +W V  +GP+VP ++ D+           LF      
Sbjct  200  RVDILLCNTFDKLEEKVLKWVQSLWPVLNIGPMVPSMYLDKRLSEDKNYGFSLFNAKVTE  259

Query  158  YVQWLDIREPKSVVYVSFGSVAIF  229
             ++WL+ ++P SVVYVSFGS+ I 
Sbjct  260  CIEWLNSKQPNSVVYVSFGSLVIL  283



>gb|KDP45201.1| hypothetical protein JCGZ_15066 [Jatropha curcas]
Length=457

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 51/82 (62%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            +AD  L N+FY LEE++V WMA  W ++T+GP +P ++ D+         I  F+ D  +
Sbjct  202  EADWVLFNSFYKLEEEIVVWMAKRWRLRTIGPTLPSMYLDKRIEDDKDYGISTFKPDETN  261

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             ++WL  +   SVVYV+FGSVA
Sbjct  262  CIKWLQDKPSASVVYVAFGSVA  283



>ref|XP_010091337.1| UDP-glycosyltransferase 74E2 [Morus notabilis]
 gb|EXB44327.1| UDP-glycosyltransferase 74E2 [Morus notabilis]
Length=453

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 52/82 (63%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            KAD    ++F +LE++VV WM  +W +KT+GP +P ++ D+           LF  + ++
Sbjct  196  KADWIFFSSFDNLEKEVVSWMRTLWRIKTIGPTIPSMYLDKRLEEDKDYGFGLFNPNADA  255

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             ++WLD +E  SVVY+SFGS+A
Sbjct  256  CIKWLDSKEVDSVVYLSFGSIA  277



>ref|XP_007033647.1| UDP-glycosyltransferase 74 F1, putative [Theobroma cacao]
 gb|EOY04573.1| UDP-glycosyltransferase 74 F1, putative [Theobroma cacao]
Length=458

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 49/81 (60%), Gaps = 9/81 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            KAD  LINTFY LE + V+ M+ ++ V T+GP VP ++ D+         +DLF+ +  +
Sbjct  201  KADFILINTFYKLENEAVESMSKVYPVLTIGPTVPSIYLDKPVENDKAYGLDLFDFNSST  260

Query  158  YVQWLDIREPKSVVYVSFGSV  220
               WL  + P SV+ VSFGSV
Sbjct  261  STDWLSTKPPGSVICVSFGSV  281



>dbj|BAG80538.1| UDP-glucose:glucosyltransferase [Lycium barbarum]
Length=461

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 51/82 (62%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            K D  LIN+FY LE++V+ WMA ++ +KT+GP +P ++ DR         + LF+     
Sbjct  200  KVDWVLINSFYKLEKEVIDWMAKLYPIKTIGPTIPSMYLDRRLPNDKEYGLSLFKPMANE  259

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             + WL+ +   SVVYVSFGS+A
Sbjct  260  CLNWLNNQPISSVVYVSFGSMA  281



>ref|XP_006342416.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Solanum tuberosum]
Length=448

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 53/82 (65%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            KAD    NTF +LE++VV W+   + +KT+GP +P ++ D+         + LF+ + E+
Sbjct  196  KADWLFFNTFNALEKEVVDWIRPRYPIKTIGPTIPSMYLDKRLKDDKEYGLSLFKPNSET  255

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             ++WLD +E  SVVYVSFGS+A
Sbjct  256  CMKWLDSKEIGSVVYVSFGSLA  277



>ref|XP_007033375.1| Uridine diphosphate glycosyltransferase 74E2, putative isoform 
2 [Theobroma cacao]
 gb|EOY04301.1| Uridine diphosphate glycosyltransferase 74E2, putative isoform 
2 [Theobroma cacao]
Length=425

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 52/85 (61%), Gaps = 9/85 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            +A+    NT+  LE++V+  MA  W +KTVGP +P ++ D+         + LF+ D E 
Sbjct  170  EANWVFCNTYDELEDEVINCMASKWPIKTVGPTIPSMYLDKRIKDDNDYGLHLFKPDSEL  229

Query  158  YVQWLDIREPKSVVYVSFGSVAIFT  232
             ++WLD +E  SVVYVSFGS+A  T
Sbjct  230  CIKWLDSKETDSVVYVSFGSLAGLT  254



>ref|NP_180738.1| UDP-glycosyltransferase 74C1 [Arabidopsis thaliana]
 sp|Q9SKC1.1|U74C1_ARATH RecName: Full=UDP-glycosyltransferase 74C1 [Arabidopsis thaliana]
 gb|AAD32293.1| putative glucosyltransferase [Arabidopsis thaliana]
 gb|AAL07126.1| putative glucosyltransferase [Arabidopsis thaliana]
 gb|AAM51293.1| putative glucosyltransferase [Arabidopsis thaliana]
 gb|AEC08584.1| UDP-glycosyltransferase 74C1 [Arabidopsis thaliana]
 gb|AHL38824.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=457

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 53/88 (60%), Gaps = 14/88 (16%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPI------LHKDRIDLFELDG-----  151
            +ADC L NTF  LE +VVKWM D W VK +GP+VP       L +D+   +EL+      
Sbjct  201  QADCILCNTFDQLEPKVVKWMNDQWPVKNIGPVVPSKFLDNRLPEDKD--YELENSKTEP  258

Query  152  -ESYVQWLDIREPKSVVYVSFGSVAIFT  232
             ES ++WL  R  KSVVYV+FG++   +
Sbjct  259  DESVLKWLGNRPAKSVVYVAFGTLVALS  286



>ref|XP_004162653.1| PREDICTED: UDP-glycosyltransferase 74F1-like [Cucumis sativus]
Length=334

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 51/85 (60%), Gaps = 9/85 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            +AD  L N+FY  E+QV++WM   W +KTVGP +P ++ DR          + F+   E+
Sbjct  209  EADWLLCNSFYEQEQQVLEWMEKEWRMKTVGPNIPSMYADRQIHDDREYGFNFFKPIDEA  268

Query  158  YVQWLDIREPKSVVYVSFGSVAIFT  232
              +WLD R+  SVV+V+FGS +  +
Sbjct  269  CRKWLDNRQKASVVFVAFGSFSTLS  293



>ref|XP_006469358.1| PREDICTED: UDP-glycosyltransferase 74E2-like isoform X1 [Citrus 
sinensis]
 ref|XP_006469359.1| PREDICTED: UDP-glycosyltransferase 74E2-like isoform X2 [Citrus 
sinensis]
 ref|XP_006469360.1| PREDICTED: UDP-glycosyltransferase 74E2-like isoform X3 [Citrus 
sinensis]
Length=466

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 48/84 (57%), Gaps = 9/84 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            K D  L NTFY LEE+V +W+   W ++ +GP VP ++ D+           +F+   ES
Sbjct  208  KVDWVLCNTFYELEEEVAEWLGRHWPLRAIGPTVPSMYLDKQLEDEKDYGFSIFKQSNES  267

Query  158  YVQWLDIREPKSVVYVSFGSVAIF  229
             ++WL+ +   SVVYVSFGS A  
Sbjct  268  CIKWLNDQAKGSVVYVSFGSAATL  291



>ref|XP_010457662.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Camelina sativa]
Length=452

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 49/84 (58%), Gaps = 9/84 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            + D  L NTF  LEE+V+KW+  +W V  +GP+VP ++ D+           LF      
Sbjct  200  QVDILLCNTFDKLEEKVLKWVQSLWPVLNIGPMVPSMYLDKRLSEDKSYGFSLFNAKVTE  259

Query  158  YVQWLDIREPKSVVYVSFGSVAIF  229
             ++WL+ ++P SVVYVSFGS+ I 
Sbjct  260  CIEWLNSKQPNSVVYVSFGSLVIL  283



>ref|XP_006469357.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Citrus sinensis]
Length=464

 Score = 67.4 bits (163),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 48/84 (57%), Gaps = 9/84 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            K D  L NTFY LEE+V +W+   W ++ +GP VP ++ D+           +F+   ES
Sbjct  206  KVDWVLCNTFYELEEEVAEWLGRHWPLRAIGPTVPSMYLDKQLEDEKDYGFSIFKQSNES  265

Query  158  YVQWLDIREPKSVVYVSFGSVAIF  229
             ++WL+ +   SVVYVSFGS A  
Sbjct  266  CIKWLNDQAKGSVVYVSFGSAATL  289



>ref|XP_009119126.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Brassica rapa]
Length=453

 Score = 67.4 bits (163),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 50/84 (60%), Gaps = 9/84 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            + D  L NTF +LEE+++KW+  +W V  +GP VP ++ D+           LF      
Sbjct  200  RVDILLCNTFDNLEEKLLKWVKSLWPVLNIGPTVPSMYLDKRLSEDKSYGFSLFTAKSTE  259

Query  158  YVQWLDIREPKSVVYVSFGSVAIF  229
             ++WL++++P SVVYVSFGS+ I 
Sbjct  260  CMEWLNLKKPHSVVYVSFGSLVIL  283



>ref|XP_008338819.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Malus domestica]
 ref|XP_008338820.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Malus domestica]
Length=456

 Score = 67.4 bits (163),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 32/81 (40%), Positives = 49/81 (60%), Gaps = 9/81 (11%)
 Frame = +2

Query  8    ADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGESY  160
            AD    NTF+ LE++VV WM   W +KT+GP +P ++ D+           +F  + E+ 
Sbjct  202  ADWIFFNTFHGLEKEVVNWMRTRWPIKTIGPTLPSMYLDKRLEDDKDYGFSIFNSNTEAC  261

Query  161  VQWLDIREPKSVVYVSFGSVA  223
             +WL+ +E  +VVYVSFGS+A
Sbjct  262  KKWLESKETGTVVYVSFGSMA  282



>ref|XP_009366994.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Pyrus x bretschneideri]
 ref|XP_009366995.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Pyrus x bretschneideri]
 ref|XP_009366996.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Pyrus x bretschneideri]
 ref|XP_009366997.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Pyrus x bretschneideri]
Length=463

 Score = 67.4 bits (163),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 32/81 (40%), Positives = 50/81 (62%), Gaps = 9/81 (11%)
 Frame = +2

Query  8    ADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGESY  160
            AD    NTF+ LE++VV WM   W +KT+GP +P ++ D+         + +F  + E+ 
Sbjct  202  ADWIFFNTFHGLEKEVVNWMRTQWPIKTIGPTLPSMYLDKRLEDDKEYGLSVFNPNTEAC  261

Query  161  VQWLDIREPKSVVYVSFGSVA  223
             +WL+ +E  +VVYVSFGS+A
Sbjct  262  NKWLESKETGTVVYVSFGSMA  282



>ref|XP_006342417.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Solanum tuberosum]
Length=451

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 53/82 (65%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            KAD  L N+F  LE++V+ W+     +KT+GP++P ++ D+         + LF+ + E+
Sbjct  197  KADWLLFNSFDVLEKEVIDWLRTQCRIKTIGPIIPSMYLDKRLKDDKEYGLSLFKPNSET  256

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             ++WLD RE  SVVYVSFGS+A
Sbjct  257  CMKWLDSREIGSVVYVSFGSLA  278



>ref|XP_008237299.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Prunus mume]
Length=471

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 50/82 (61%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            KAD  L N+FY LEEQVV WMA    +KT+GP +P  + D+         + LF+ + ++
Sbjct  207  KADWVLCNSFYELEEQVVDWMATFLPLKTIGPTIPSHYLDKRLEDDKQYGVSLFDTNNDA  266

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             ++WL+ +   SV YV+FGS A
Sbjct  267  CMKWLNEQPKGSVAYVAFGSAA  288



>gb|AAZ32904.1| putative glucosyltransferase [Medicago sativa]
Length=217

 Score = 64.7 bits (156),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 49/82 (60%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            KAD  L N+ Y LE +VV W+  IW +KT+GP VP +  D+         + L + + E 
Sbjct  51   KADWILANSIYELEPEVVDWLVKIWPLKTIGPSVPSMLLDKRLKDDKEYGVSLSDPNTEF  110

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
            Y++WL+ +   SVVY SFGS+A
Sbjct  111  YIKWLNDKPKGSVVYASFGSMA  132



>ref|XP_009141182.1| PREDICTED: UDP-glycosyltransferase 74C1-like [Brassica rapa]
Length=456

 Score = 66.6 bits (161),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 51/86 (59%), Gaps = 10/86 (12%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVP-------ILHKDRIDLFELD---GE  154
            +AD  L NTF  LE +VVKWM+D W VK +GP+VP       +L     DL +      E
Sbjct  200  RADLILCNTFDQLEPKVVKWMSDQWPVKNIGPMVPSKFLDNRLLEDKDYDLGDFKTEPDE  259

Query  155  SYVQWLDIREPKSVVYVSFGSVAIFT  232
            S ++WL  +  KSVVYV+FG++A  +
Sbjct  260  SVLRWLASKPAKSVVYVAFGTLAALS  285



>ref|XP_004144399.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Cucumis sativus]
 gb|KGN58387.1| hypothetical protein Csa_3G635870 [Cucumis sativus]
Length=468

 Score = 67.0 bits (162),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 51/85 (60%), Gaps = 9/85 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            +AD  L N+FY  E+QV++WM   W +KTVGP +P ++ DR          + F+   E+
Sbjct  209  EADWLLCNSFYEQEQQVLEWMEKEWRMKTVGPNIPSMYADRQIHDDREYGFNFFKPIDEA  268

Query  158  YVQWLDIREPKSVVYVSFGSVAIFT  232
              +WLD R+  SVV+V+FGS +  +
Sbjct  269  CRKWLDNRQKASVVFVAFGSFSTLS  293



>emb|CDY19104.1| BnaA04g18440D [Brassica napus]
Length=456

 Score = 66.6 bits (161),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 51/86 (59%), Gaps = 10/86 (12%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVP-------ILHKDRIDLFELD---GE  154
            +AD  L NTF  LE +VVKWM+D W VK +GP+VP       +L     DL +      E
Sbjct  200  RADLILCNTFDQLEPKVVKWMSDQWPVKNIGPMVPSKFLDNRLLEDKDYDLGDFKTEPDE  259

Query  155  SYVQWLDIREPKSVVYVSFGSVAIFT  232
            S ++WL  +  KSVVYV+FG++A  +
Sbjct  260  SVLRWLASKPAKSVVYVAFGTLAALS  285



>ref|XP_011037065.1| PREDICTED: UDP-glycosyltransferase 74E1-like [Populus euphratica]
Length=461

 Score = 66.6 bits (161),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 52/83 (63%), Gaps = 9/83 (11%)
 Frame = +2

Query  8    ADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGESY  160
            AD   +N+F +LEE+VV W+A   S+K +GP++P ++ DR         + LF+   +  
Sbjct  198  ADWVFVNSFNTLEEEVVNWLAGQRSIKPIGPMIPSVYLDRQLEDDTEYGLSLFKPALDGC  257

Query  161  VQWLDIREPKSVVYVSFGSVAIF  229
            ++WLD +E  SVVYVSFGS+A  
Sbjct  258  MEWLDSKETGSVVYVSFGSLAAL  280



>emb|CDP13108.1| unnamed protein product [Coffea canephora]
Length=422

 Score = 66.6 bits (161),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 51/82 (62%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            +AD    NTFY LEE+V+ WMA I  VKT+GP +P ++ ++         ++LF+    +
Sbjct  196  EADWIFFNTFYRLEEKVIHWMAKILPVKTIGPTIPSVYLEKRLEDDKQYGLNLFKPMTNA  255

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             + WL+ R   SVVYVSFGS+A
Sbjct  256  CMSWLNERSISSVVYVSFGSLA  277



>ref|XP_007201501.1| hypothetical protein PRUPE_ppa016883mg [Prunus persica]
 gb|EMJ02700.1| hypothetical protein PRUPE_ppa016883mg [Prunus persica]
Length=466

 Score = 66.6 bits (161),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 49/82 (60%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            KAD    NTFY LEE+VV  MA +W ++T+GP +P ++ D+           LF  + ++
Sbjct  210  KADWVFCNTFYELEEEVVDCMAKLWPLRTIGPTIPSMYLDKRREDDREYGFSLFNPNSDA  269

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             + WL+ +   SV YVSFGS+A
Sbjct  270  CLTWLNAKPKGSVAYVSFGSLA  291



>ref|XP_004504205.1| PREDICTED: UDP-glycosyltransferase 74F1-like [Cicer arietinum]
Length=469

 Score = 66.6 bits (161),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 53/85 (62%), Gaps = 10/85 (12%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            KAD  L+N+FY LE++VV  M+ +  + T+GP VP  + D+         ++LF+LD  S
Sbjct  213  KADVILVNSFYKLEDKVVDSMSKLCPILTIGPTVPSFYLDKEIPNDKDNDLNLFQLD-SS  271

Query  158  YVQWLDIREPKSVVYVSFGSVAIFT  232
             + WL+ +   SV+YVSFGS+  F+
Sbjct  272  AINWLNTKPEGSVIYVSFGSMVCFS  296



>ref|XP_008670324.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Zea mays]
 tpg|DAA40558.1| TPA: hypothetical protein ZEAMMB73_121977 [Zea mays]
Length=475

 Score = 66.6 bits (161),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 34/83 (41%), Positives = 48/83 (58%), Gaps = 10/83 (12%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVP--ILHKDR--------IDLFELDGE  154
            +AD  L+N+FY LE +  ++MA  W  KT+GP VP   +  DR        +DL+E    
Sbjct  211  QADDVLVNSFYELEPEEAEYMASAWRGKTIGPTVPASYIGDDRLPSDTKYGLDLYEPTAA  270

Query  155  SYVQWLDIREPKSVVYVSFGSVA  223
              + WLD   P+SVVY SFGS++
Sbjct  271  PCIAWLDAHPPRSVVYASFGSLS  293



>gb|KEH25943.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=457

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 51/82 (62%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            KAD  L NTFY LE++VV WM  IW ++T+GP +P +  D+         + + + + E 
Sbjct  203  KADWILANTFYELEKEVVDWMVKIWPLRTIGPSIPSIFLDKRLKDDKEYGVSISDPNTEI  262

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             ++WL+ +   SVVYVSFGS+A
Sbjct  263  CIKWLNEKPKGSVVYVSFGSMA  284



>emb|CDP13110.1| unnamed protein product [Coffea canephora]
Length=451

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 50/82 (61%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            +AD    NTFY LEE+ + WMA I  VKT+GP +P ++ ++         ++LF+    +
Sbjct  196  EADWIFFNTFYGLEEEAIHWMAKILPVKTIGPTIPSMYLEKRLEDDKQYGLNLFKPMTNA  255

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             + WL+ R   SVVYVSFGS+A
Sbjct  256  CMSWLNERSISSVVYVSFGSLA  277



>gb|AIT15666.1| UDP-glycosyltransferase, partial [Cicer arietinum]
Length=410

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 53/85 (62%), Gaps = 10/85 (12%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            KAD  L+N+FY LE++VV  M+ +  + T+GP VP  + D+         ++LF+LD  S
Sbjct  154  KADVILVNSFYKLEDKVVDSMSKLCPILTIGPTVPSFYLDKEIPNDKDNDLNLFQLD-SS  212

Query  158  YVQWLDIREPKSVVYVSFGSVAIFT  232
             + WL+ +   SV+YVSFGS+  F+
Sbjct  213  AINWLNTKPEGSVIYVSFGSMVCFS  237



>ref|XP_010095579.1| UDP-glycosyltransferase 74E2 [Morus notabilis]
 gb|EXB61152.1| UDP-glycosyltransferase 74E2 [Morus notabilis]
Length=456

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 47/83 (57%), Gaps = 9/83 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            KAD  L NT Y LEE+V  WM  I  +KT+GP +P +  D+           LF    E+
Sbjct  202  KADWVLCNTCYELEEEVANWMMKILPLKTIGPTIPSMFLDKRLEGDKLYGFSLFPSQSEA  261

Query  158  YVQWLDIREPKSVVYVSFGSVAI  226
             ++WLD R   SV Y+SFGS+A+
Sbjct  262  CLKWLDSRPKGSVAYLSFGSLAV  284



>gb|ACR10263.1| UDP-glucosyl transferase 74c1 [Brassica rapa subsp. pekinensis]
Length=456

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 51/86 (59%), Gaps = 10/86 (12%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVP-------ILHKDRIDLFELD---GE  154
            +AD  L NTF  LE +VVKWM+D W VK +GP+VP       +L     DL +      E
Sbjct  200  RADLILCNTFDQLEPKVVKWMSDQWPVKNIGPMVPSKFLDNRLLEDKDYDLGDFKTEPDE  259

Query  155  SYVQWLDIREPKSVVYVSFGSVAIFT  232
            S ++WL  +  KSVVYV+FG++A  +
Sbjct  260  SVLRWLASKPAKSVVYVAFGTLASLS  285



>ref|XP_010069571.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Eucalyptus grandis]
Length=466

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 38/83 (46%), Positives = 52/83 (63%), Gaps = 11/83 (13%)
 Frame = +2

Query  8    ADCFLINTFYSLEEQVVKWMA-DIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            AD  L +TFY LE++VV WM+ ++W +KT+GP +P L+ D+         I+LF     S
Sbjct  204  ADFVLFDTFYELEKEVVDWMSTNLWPLKTIGPTLPSLYLDKRLPDDTAYGINLFTPTTTS  263

Query  158  YVQ-WLDIREPKSVVYVSFGSVA  223
             V  WL    P+SVVYVSFGS+A
Sbjct  264  TVSAWLCSHPPRSVVYVSFGSMA  286



>ref|XP_009776061.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Nicotiana sylvestris]
Length=459

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 52/82 (63%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            K D  LIN+FY LE++V+ WMA ++ +KT+GP +P ++ D+         + LF+   + 
Sbjct  199  KVDWVLINSFYELEKEVIDWMAKLYPIKTIGPTIPSMYLDKRLPNDKEYGLSLFKPMAKE  258

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             + WL+ +   SVVYVSFGS+A
Sbjct  259  CLNWLNHQPISSVVYVSFGSMA  280



>gb|KDO37942.1| hypothetical protein CISIN_1g048393mg, partial [Citrus sinensis]
Length=369

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 52/85 (61%), Gaps = 10/85 (12%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMA-DIWSVKTVGPLVPILHKDR---------IDLFELDGE  154
            KAD  L NTFY LE++V +W+    W ++T+GP +P ++ D+           +FE + E
Sbjct  129  KADWILCNTFYELEKEVTEWLGKQHWLLRTIGPTLPSIYLDKQIEDDKEYGFSIFETNIE  188

Query  155  SYVQWLDIREPKSVVYVSFGSVAIF  229
            S ++WL+ R   SVVYVSFGS+A  
Sbjct  189  SCMKWLNDRANGSVVYVSFGSMATL  213



>ref|XP_011073993.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Sesamum indicum]
Length=452

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 48/82 (59%), Gaps = 12/82 (15%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            K D   +NTF  LE QVV+WMA  + +KTVGP   +L  D+         I+L E    +
Sbjct  198  KVDWIFLNTFDKLENQVVEWMASRYPIKTVGPTFSLLQMDKKLSNSKNHTINLLE---PA  254

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
              +WLD RE  SVVYVSFGS+A
Sbjct  255  CTEWLDSRETGSVVYVSFGSIA  276



>ref|XP_010069572.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Eucalyptus grandis]
Length=467

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 39/83 (47%), Positives = 51/83 (61%), Gaps = 11/83 (13%)
 Frame = +2

Query  8    ADCFLINTFYSLEEQVVKWM-ADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            AD  L +TFY LE++VV WM A++W +KTVGP +P L+ D+          +LF     S
Sbjct  205  ADFVLFDTFYELEKEVVDWMSANLWPLKTVGPTLPSLYLDKRLPNDTAYGANLFTPTTTS  264

Query  158  YVQ-WLDIREPKSVVYVSFGSVA  223
             V  WL    P+SVVYVSFGS+A
Sbjct  265  TVSAWLRRHPPRSVVYVSFGSMA  287



>ref|XP_003531287.1| PREDICTED: UDP-glycosyltransferase 74F1-like [Glycine max]
 gb|KHN48082.1| UDP-glycosyltransferase 74F1 [Glycine soja]
Length=460

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 51/85 (60%), Gaps = 10/85 (12%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            KAD  L+N+FY LEEQVV  M+ +  +  +GP VP  H D+         ++LF++D  S
Sbjct  204  KADIILVNSFYKLEEQVVDSMSKLCPILMIGPTVPSFHLDKAVPNDTDNVLNLFQVD-SS  262

Query  158  YVQWLDIREPKSVVYVSFGSVAIFT  232
             + WL  +   SV+Y+SFGS+  F+
Sbjct  263  AISWLRQKPAGSVIYISFGSMVCFS  287



>dbj|BAF96597.1| UDP-glucose:anthocysnin 5-O-glucosyltransferase [Rosa hybrid 
cultivar]
Length=354

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 50/79 (63%), Gaps = 10/79 (13%)
 Frame = +2

Query  17   FLINTFYSLEEQVVKWMADI-WSVKTVGPLVPI------LHKDR---IDLFELDGESYVQ  166
              I TF  LEE+VVKWM +  W V+T+GP VP       L  D+   + +F+ + E+Y++
Sbjct  209  LFICTFEKLEEEVVKWMINQEWPVRTIGPTVPSMFLGKRLEDDKEYSLSMFKPNVETYME  268

Query  167  WLDIREPKSVVYVSFGSVA  223
            WLD RE  SVVY SFGS+A
Sbjct  269  WLDSRESSSVVYASFGSLA  287



>ref|XP_011037069.1| PREDICTED: UDP-glycosyltransferase 74E1-like [Populus euphratica]
Length=461

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 51/83 (61%), Gaps = 9/83 (11%)
 Frame = +2

Query  8    ADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGESY  160
            AD   +N+F  LEE+VV W+A   S+K +GP++P ++ DR         + LF+   +  
Sbjct  198  ADWVFVNSFNPLEEEVVNWLAGQRSIKPIGPMIPSVYLDRQLEDDTEYGLSLFKPALDGC  257

Query  161  VQWLDIREPKSVVYVSFGSVAIF  229
            ++WLD +E  SVVYVSFGS+A  
Sbjct  258  MEWLDAKETGSVVYVSFGSLAAL  280



>gb|KFK42906.1| hypothetical protein AALP_AA1G053600 [Arabis alpina]
Length=460

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 49/83 (59%), Gaps = 9/83 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            + D  L NTF  LEE+++KW+  +W V  +GP VP ++ D+           LFE     
Sbjct  206  RVDIVLCNTFDILEEKLLKWVQSLWPVLNIGPTVPSMYLDKRLTEDKNYGFSLFEAKVTE  265

Query  158  YVQWLDIREPKSVVYVSFGSVAI  226
             ++WL+ ++P SVVYVSFGS+ I
Sbjct  266  CIEWLNTKQPNSVVYVSFGSLVI  288



>ref|XP_006342195.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Solanum tuberosum]
Length=468

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 51/82 (62%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            KAD  L N+F  LEE+VV+WM  +W+V T+GP +P  + D+          ++ + +  +
Sbjct  202  KADWVLFNSFDKLEEEVVEWMKKVWNVVTIGPTLPSFYLDKRVENDNEYGFNIHKPNSSN  261

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             ++WLD ++  SVVYVSFGS A
Sbjct  262  CMEWLDSKKTGSVVYVSFGSAA  283



>ref|XP_009590532.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Nicotiana tomentosiformis]
Length=460

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 51/82 (62%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            K D  LIN+FY LE++V+ WMA  + +KT+GP +P ++ D+         + LF+   + 
Sbjct  200  KVDWILINSFYELEKEVIDWMAKFYPIKTIGPTIPSMYLDKRLPNDKEYGLSLFKPMAKE  259

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             + WL+ +   SVVYVSFGS+A
Sbjct  260  CLNWLNHQTISSVVYVSFGSMA  281



>ref|XP_004253028.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Solanum lycopersicum]
Length=448

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 53/82 (65%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            KAD    NTF +LE+++V+W+   + +KTVGP +P ++ D+         + LF+ + E 
Sbjct  196  KADWLFFNTFDALEKEIVEWIRPRYPIKTVGPTIPSMYLDKRLMEDKEYGLSLFKPNSEI  255

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             ++WLD +E  SVVYVSFGS+A
Sbjct  256  CMKWLDSKEIDSVVYVSFGSLA  277



>gb|AGI44003.1| UDP-glucose glucosyltransferase [Rhodiola crenulata]
 gb|AGI44004.1| UDP-glucose glucosyltransferase [Rhodiola crenulata]
Length=450

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 51/84 (61%), Gaps = 9/84 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            KA+    NTF  LE Q+V+WM+  W V TVGP +P ++ D+         ++LF+ + ++
Sbjct  194  KAEYVFFNTFDKLESQMVEWMSSQWPVLTVGPTIPSMYLDKYIEDDTSYGLNLFKPNRQT  253

Query  158  YVQWLDIREPKSVVYVSFGSVAIF  229
               WL  R+  SV+YVSFGS+AI 
Sbjct  254  CQDWLSERKSGSVIYVSFGSMAIL  277



>ref|XP_008235864.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Prunus mume]
Length=461

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 51/82 (62%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            KAD  L NTF+ LE++ V  MA  W ++T+GP +P ++ D+         + L + + ++
Sbjct  206  KADWVLCNTFHELEQEAVDRMAKFWPLRTIGPTIPSMYMDKRHEDNWEYGLSLLKPNSDA  265

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             ++WL+++   SV YVSFGSVA
Sbjct  266  CMKWLNVKPKGSVAYVSFGSVA  287



>ref|XP_008235866.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Prunus mume]
Length=463

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 49/82 (60%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            KAD    +TFY LE + V WMA  W ++T+GP +P ++ D+         ++L   + ++
Sbjct  208  KADWVFYSTFYELEHETVDWMAKFWPLRTIGPTIPSMYLDKRHEEDKEYGLNLLNPNSDA  267

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             ++WL+ +   SV YVSFGSVA
Sbjct  268  CMKWLNAKPKGSVAYVSFGSVA  289



>ref|XP_008233916.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Prunus mume]
Length=455

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 50/81 (62%), Gaps = 9/81 (11%)
 Frame = +2

Query  8    ADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGESY  160
            AD    NTF  LE +VV WM   W +KT+GP +P ++ ++         I+ F+ + ++ 
Sbjct  201  ADWIFCNTFDCLEPEVVSWMRTKWPIKTIGPTLPSMYLEKRLEDDRDYGINFFKPNNDTC  260

Query  161  VQWLDIREPKSVVYVSFGSVA  223
            ++WLD +E  +VVYVSFGS+A
Sbjct  261  IKWLDSKEACTVVYVSFGSIA  281



>ref|XP_003632087.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Vitis vinifera]
Length=452

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 51/82 (62%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            K +    NTF  LE++VVKW+A    +KT+GP +P ++ DR         + LF+ + ++
Sbjct  197  KVNWVFFNTFCELEDEVVKWLASKRPIKTIGPTIPSMYLDRRIDDDEDYGLSLFKPNADA  256

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             + WLD ++  SVVYVSFGS+A
Sbjct  257  CITWLDTKDTVSVVYVSFGSLA  278



>ref|XP_007199115.1| hypothetical protein PRUPE_ppa020804mg [Prunus persica]
 gb|EMJ00314.1| hypothetical protein PRUPE_ppa020804mg [Prunus persica]
Length=463

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 49/82 (60%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            KAD    +TFY LE++ V WMA  W ++T+GP +P ++ D+         + L   + ++
Sbjct  208  KADWVFYSTFYELEQEAVDWMAKFWPLRTIGPTIPSMYLDKRHEEDKEYGLSLLNPNSDA  267

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             ++WL+ +   SV YVSFGSVA
Sbjct  268  CMKWLNAKPKGSVAYVSFGSVA  289



>emb|CAN67249.1| hypothetical protein VITISV_008684 [Vitis vinifera]
Length=419

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 51/82 (62%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            K +    NTF  LE++VVKW+A    +KT+GP +P ++ DR         + LF+ + ++
Sbjct  164  KVNWVFFNTFCELEDEVVKWLASKRPIKTIGPTIPSMYLDRRIDDDEDYGLSLFKPNADA  223

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             + WLD ++  SVVYVSFGS+A
Sbjct  224  CITWLDTKDTVSVVYVSFGSLA  245



>ref|XP_006296254.1| hypothetical protein CARUB_v10025420mg [Capsella rubella]
 gb|EOA29152.1| hypothetical protein CARUB_v10025420mg [Capsella rubella]
Length=455

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 50/85 (59%), Gaps = 9/85 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDRI----DLFELDG-----ES  157
            +ADC L NTF  LE +V+KWM + W VK +GP+VP  + D        +EL+      +S
Sbjct  200  QADCILCNTFDQLEPKVMKWMNNQWPVKNIGPVVPSKYLDNRLPEDKDYELENSTEPDQS  259

Query  158  YVQWLDIREPKSVVYVSFGSVAIFT  232
             + WL  R  KSVVYV+FG++   +
Sbjct  260  VLNWLGKRRAKSVVYVAFGTLVALS  284



>ref|XP_011047629.1| PREDICTED: UDP-glycosyltransferase 74E1-like isoform X2 [Populus 
euphratica]
Length=385

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 50/82 (61%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDRI---------DLFELDGES  157
            +AD   INTF +LEE+ V W+    SVK +GP++P  + DR           LF+ + + 
Sbjct  208  EADWIFINTFNTLEEKAVNWLDSQRSVKPIGPMIPSFYLDRQLEDDKEYGPSLFKPNLDG  267

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             ++WLD +E  SVVYVSFGS+A
Sbjct  268  CMEWLDSKETGSVVYVSFGSMA  289



>emb|CDP08071.1| unnamed protein product [Coffea canephora]
Length=462

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 31/82 (38%), Positives = 49/82 (60%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            K+D  L N+F  LE + V W+ + + +KT+GP  P ++ D+         I+ F  D  +
Sbjct  202  KSDWLLFNSFDKLENEAVTWLTERYPIKTIGPSTPSMYTDKRLKDDKDYTINFFTPDSGA  261

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             ++WLD +E  SVVYVSFGS++
Sbjct  262  CLKWLDTKETGSVVYVSFGSMS  283



>ref|XP_009603219.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Nicotiana tomentosiformis]
Length=449

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 51/76 (67%), Gaps = 3/76 (4%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---IDLFELDGESYVQWLD  175
            KAD  L NTF  LEE+VV W+ + +S+KT+GP+V  ++ D+     L +   E+  +WLD
Sbjct  199  KADWLLFNTFDMLEEEVVNWLRNQYSIKTIGPVVLPMYFDKEYDSSLIKPHYETCKKWLD  258

Query  176  IREPKSVVYVSFGSVA  223
             RE  SVVYVSFGS+A
Sbjct  259  SREIGSVVYVSFGSLA  274



>ref|XP_010485192.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Camelina sativa]
Length=452

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 47/84 (56%), Gaps = 9/84 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            + D  L NTF  LEE+V+KW+  +W V  +GP+VP +  D+           LF      
Sbjct  200  RVDILLCNTFDKLEEKVLKWVQSLWPVLNIGPMVPSMFLDKRLSEDKSYGFSLFNAKVTE  259

Query  158  YVQWLDIREPKSVVYVSFGSVAIF  229
             + WL+ ++P SVVYVSFGS+ I 
Sbjct  260  CIDWLNSKQPNSVVYVSFGSLVIL  283



>ref|XP_006304660.1| hypothetical protein CARUB_v10011842mg [Capsella rubella]
 gb|EOA37558.1| hypothetical protein CARUB_v10011842mg [Capsella rubella]
Length=440

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 49/84 (58%), Gaps = 9/84 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            + D  L NTF  LEE+++KW+  +W V  +GP VP ++ D+           LF+ +   
Sbjct  200  RVDIVLCNTFDKLEEKLLKWVQSLWPVLNIGPTVPSMYLDKRLTEDKNYGFSLFDANVAK  259

Query  158  YVQWLDIREPKSVVYVSFGSVAIF  229
             ++WLD ++P SVVYVS GS+ I 
Sbjct  260  CIEWLDSKQPSSVVYVSLGSLVIL  283



>emb|CDP03995.1| unnamed protein product [Coffea canephora]
Length=459

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 48/80 (60%), Gaps = 9/80 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            +AD  ++N F+ LEE  V W+A +W V TVGP VP ++ D+         I+LF+ D   
Sbjct  200  QADWVILNNFHKLEEDAVNWIAKLWRVITVGPTVPSIYLDKRLEDDIGYGINLFKPDSSL  259

Query  158  YVQWLDIREPKSVVYVSFGS  217
             + WL+ +   SVVYVSFGS
Sbjct  260  CINWLNSQPKDSVVYVSFGS  279



>gb|KCW57959.1| hypothetical protein EUGRSUZ_H00694 [Eucalyptus grandis]
Length=473

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 52/83 (63%), Gaps = 11/83 (13%)
 Frame = +2

Query  8    ADCFLINTFYSLEEQVVKWM-ADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            AD  L +TFY LE++VV WM A++W +KTVGP +P L+ D+         ++LF     S
Sbjct  181  ADFVLFDTFYELEKEVVDWMSANLWPLKTVGPTLPSLYLDKRLPNDTAYGVNLFTPTTTS  240

Query  158  YVQ-WLDIREPKSVVYVSFGSVA  223
             V  WL    P+SVVYVSFGS+A
Sbjct  241  TVSAWLHRHPPRSVVYVSFGSMA  263



>ref|XP_011047628.1| PREDICTED: UDP-glycosyltransferase 74E1-like isoform X1 [Populus 
euphratica]
Length=467

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 50/84 (60%), Gaps = 9/84 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDRI---------DLFELDGES  157
            +AD   INTF +LEE+ V W+    SVK +GP++P  + DR           LF+ + + 
Sbjct  208  EADWIFINTFNTLEEKAVNWLDSQRSVKPIGPMIPSFYLDRQLEDDKEYGPSLFKPNLDG  267

Query  158  YVQWLDIREPKSVVYVSFGSVAIF  229
             ++WLD +E  SVVYVSFGS+A  
Sbjct  268  CMEWLDSKETGSVVYVSFGSMAAL  291



>ref|XP_010025996.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Eucalyptus grandis]
Length=464

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 52/83 (63%), Gaps = 11/83 (13%)
 Frame = +2

Query  8    ADCFLINTFYSLEEQVVKWM-ADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            AD  L +TFY LE++VV WM A++W +KTVGP +P L+ D+         ++LF     S
Sbjct  184  ADFVLFDTFYELEKEVVDWMSANLWPLKTVGPTLPSLYLDKRLPNDTAYGVNLFTPTTTS  243

Query  158  YVQ-WLDIREPKSVVYVSFGSVA  223
             V  WL    P+SVVYVSFGS+A
Sbjct  244  TVSAWLHRHPPRSVVYVSFGSMA  266



>emb|CDY15551.1| BnaA08g28350D [Brassica napus]
Length=376

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 48/85 (56%), Gaps = 9/85 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            + D  L NTF  LEE+++KW+  +W V  VGP +P ++ D+           LF      
Sbjct  123  RVDIVLCNTFDKLEEKLLKWVKSMWPVLNVGPTLPSMYLDKRLSEDKNYGFSLFTAKSTE  182

Query  158  YVQWLDIREPKSVVYVSFGSVAIFT  232
             ++WL+ ++P SVVYVSFGS+ I  
Sbjct  183  CIEWLNSKQPSSVVYVSFGSLVILN  207



>ref|XP_009782413.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Nicotiana sylvestris]
Length=449

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 51/76 (67%), Gaps = 3/76 (4%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---IDLFELDGESYVQWLD  175
            KAD  L NTF +LEE+VV W+   +S+KT+GP+V  ++ D+     L +   E+  +WLD
Sbjct  199  KADWLLFNTFDALEEEVVNWLRTQYSIKTIGPVVLSMYLDKEYDSSLTKPHYETCKKWLD  258

Query  176  IREPKSVVYVSFGSVA  223
             RE  SV+YVSFGS+A
Sbjct  259  SREIGSVIYVSFGSLA  274



>ref|XP_006307470.1| hypothetical protein CARUB_v10009096mg [Capsella rubella]
 gb|EOA40368.1| hypothetical protein CARUB_v10009096mg [Capsella rubella]
Length=454

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 48/84 (57%), Gaps = 9/84 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            + D  L NTF  LEE+V+KW+  +W V  +GP+VP +  D+           LF      
Sbjct  201  RVDIVLCNTFDKLEEKVLKWVQSLWPVLNIGPMVPSMFLDKRLSEDKNYGFSLFNAKFTE  260

Query  158  YVQWLDIREPKSVVYVSFGSVAIF  229
             ++WL+ ++P SVVYVSFGS+ + 
Sbjct  261  CIEWLNSKQPNSVVYVSFGSLVVL  284



>ref|XP_002529826.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF32575.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=466

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 48/82 (59%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            KAD  L+NTFY LE QVV  M+ +  + T+GP +P  + D+         IDL+E +   
Sbjct  205  KADYILVNTFYKLEYQVVDTMSTLCPLLTIGPTIPSSYSDKRIENEDDYGIDLYEANASI  264

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             + WL  +   SVVYVSFGS+A
Sbjct  265  PITWLSTKPTGSVVYVSFGSIA  286



>gb|AFK43317.1| unknown [Medicago truncatula]
Length=460

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 52/85 (61%), Gaps = 10/85 (12%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            KAD  L+N+FY LE+QVV  M+ +  + T+GP VP  + D+         ++LF+LD  S
Sbjct  204  KADIILVNSFYKLEDQVVDSMSKLCPILTIGPTVPSFYLDKGVPNDKDNDLNLFQLD-SS  262

Query  158  YVQWLDIREPKSVVYVSFGSVAIFT  232
             + WL+ +   S +YVSFGS+  F+
Sbjct  263  PINWLNSKPEGSAIYVSFGSMVCFS  287



>ref|XP_002529823.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF32572.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=467

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 48/82 (59%), Gaps = 9/82 (11%)
 Frame = +2

Query  11   DCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGESYV  163
            D  L NTF  LE++VV WM   W +  +GP +P +  DR         + LF+ + ++ +
Sbjct  205  DWLLWNTFNELEDEVVNWMKSKWPIMPIGPTIPSMFLDRRLEDDKDYGLSLFKPNSDACM  264

Query  164  QWLDIREPKSVVYVSFGSVAIF  229
            +WLD +E +SVVYVSFGS A  
Sbjct  265  KWLDSKEARSVVYVSFGSQAAL  286



>emb|CAN73416.1| hypothetical protein VITISV_017052 [Vitis vinifera]
Length=453

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 33/70 (47%), Positives = 45/70 (64%), Gaps = 1/70 (1%)
 Frame = +2

Query  14   CFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDRIDLFELDGESYVQWLDIREPKS  193
            C LINTF +LEE V+K + D  +V  +GPLV +      DLFE   + Y+ WL+ +   S
Sbjct  203  CVLINTFNALEEDVIKALGDFMNVVAIGPLVQLDSSISCDLFE-RSKDYLPWLNSKPEGS  261

Query  194  VVYVSFGSVA  223
            V+YVSFGS+A
Sbjct  262  VIYVSFGSLA  271



>ref|XP_002532451.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF29937.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=458

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 50/84 (60%), Gaps = 9/84 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            KAD  L NTFY LE +   W+A +W ++T+GP +P ++ D+          ++F+ + ++
Sbjct  203  KADWVLCNTFYELEYEAADWLAKLWPLRTIGPTIPSMYLDKQLQDDRDYGFNIFKPNDDA  262

Query  158  YVQWLDIREPKSVVYVSFGSVAIF  229
             + WL  +   SVVYVSFGS+A  
Sbjct  263  CMNWLKDKPKGSVVYVSFGSLATL  286



>ref|XP_003629941.1| UDP-glucose glucosyltransferase [Medicago truncatula]
 gb|AET04417.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=460

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 52/85 (61%), Gaps = 10/85 (12%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            KAD  L+N+FY LE+QVV  M+ +  + T+GP VP  + D+         ++LF+LD  S
Sbjct  204  KADIILVNSFYKLEDQVVDSMSKLCPILTIGPTVPSFYLDKGVPNDKDNDLNLFQLD-SS  262

Query  158  YVQWLDIREPKSVVYVSFGSVAIFT  232
             + WL+ +   S +YVSFGS+  F+
Sbjct  263  PINWLNSKPEGSAIYVSFGSMVCFS  287



>ref|XP_009111039.1| PREDICTED: UDP-glycosyltransferase 74E2 [Brassica rapa]
Length=453

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 48/85 (56%), Gaps = 9/85 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            + D  L NTF  LEE+++KW+  +W V  VGP +P ++ D+           LF      
Sbjct  200  RVDIVLCNTFDKLEEKLLKWVKSMWPVLNVGPTLPSMYLDKRLSEDKNYGFSLFTAKSTE  259

Query  158  YVQWLDIREPKSVVYVSFGSVAIFT  232
             ++WL+ ++P SVVYVSFGS+ I  
Sbjct  260  CIEWLNSKQPSSVVYVSFGSLVILN  284



>ref|XP_006447926.1| hypothetical protein CICLE_v10015147mg [Citrus clementina]
 gb|ESR61166.1| hypothetical protein CICLE_v10015147mg [Citrus clementina]
Length=466

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 47/84 (56%), Gaps = 9/84 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            K D  L NTFY LEE+V +W+   W ++ +GP VP  + D+           +F    ES
Sbjct  208  KVDWVLCNTFYELEEEVAEWLGRHWPLRAIGPTVPSKYLDKQLEDDKDYGFSMFMQSNES  267

Query  158  YVQWLDIREPKSVVYVSFGSVAIF  229
             ++WL+ +   SVVYVSFGS+A  
Sbjct  268  CIKWLNDQAKGSVVYVSFGSMATL  291



>ref|XP_006410308.1| hypothetical protein EUTSA_v10016636mg [Eutrema salsugineum]
 gb|ESQ51761.1| hypothetical protein EUTSA_v10016636mg [Eutrema salsugineum]
Length=456

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 51/86 (59%), Gaps = 10/86 (12%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPI------LHKDR-IDLFELD---GE  154
            +ADC L NTF  LE +VVKWM D W VK +GP+VP       L +D+  DL +      E
Sbjct  200  RADCILCNTFDQLEPKVVKWMNDQWPVKNIGPVVPSRFLDNRLPEDKDYDLGDFKTEPDE  259

Query  155  SYVQWLDIREPKSVVYVSFGSVAIFT  232
            S + WL  +  KSVVYV+FG++   +
Sbjct  260  SVLSWLANKPAKSVVYVAFGTLVALS  285



>emb|CDY10139.1| BnaC05g03820D [Brassica napus]
Length=453

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 49/84 (58%), Gaps = 9/84 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            + D  + NTF +LEE+++KW+  +WSV  +GP VP ++ D+            F      
Sbjct  200  RVDILVCNTFDNLEEKLLKWVKRMWSVLNIGPTVPSMYLDKRLSEDKNYGFSFFTAKSAE  259

Query  158  YVQWLDIREPKSVVYVSFGSVAIF  229
             ++WL+ ++P SVVYVSFGS+ I 
Sbjct  260  CMEWLNSKQPNSVVYVSFGSLVIL  283



>ref|XP_009590343.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Nicotiana tomentosiformis]
Length=447

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 50/79 (63%), Gaps = 6/79 (8%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGP--LVPILHKDRIDLFEL----DGESYVQ  166
            KAD  L NTF  LE +V+ W+   +S+KT+GP  L   L K   D+ E      GE+ ++
Sbjct  195  KADWLLFNTFDVLENEVINWLRTQYSIKTIGPTFLTMYLDKQLKDVKENGLSPSGETCIK  254

Query  167  WLDIREPKSVVYVSFGSVA  223
            WLD+RE  SV+YVSFGS+A
Sbjct  255  WLDLREIGSVIYVSFGSLA  273



>ref|XP_002892308.1| UDP-glucoronosyl/UDP-glucosyl transferase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH68567.1| UDP-glucoronosyl/UDP-glucosyl transferase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=453

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 48/84 (57%), Gaps = 9/84 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            + D  L NTF  LEE+++KW+  +W V  +GP VP ++ D+           LF      
Sbjct  200  RVDILLCNTFDRLEEKLLKWVQSLWPVLNIGPTVPSMYLDKRLSEDKNYGFSLFNAKVAE  259

Query  158  YVQWLDIREPKSVVYVSFGSVAIF  229
             ++WL+ ++P SVVYVSFGS+ I 
Sbjct  260  CMEWLNSKQPNSVVYVSFGSLVIL  283



>ref|XP_009783229.1| PREDICTED: UDP-glycosyltransferase 74F1-like [Nicotiana sylvestris]
Length=462

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 54/82 (66%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            K D  LIN+FY LE++V+ WM++++ +KT+GP +P ++ D+         + +F+   ++
Sbjct  198  KVDWVLINSFYELEKEVIDWMSEVYPIKTIGPAIPSMYLDKRLPDDKEYGLSVFKPMTDA  257

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             + WL+ +   SVVYVSFGS+A
Sbjct  258  CLNWLNHQPVSSVVYVSFGSLA  279



>ref|XP_010475278.1| PREDICTED: UDP-glycosyltransferase 74E2-like isoform X1 [Camelina 
sativa]
Length=453

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 49/84 (58%), Gaps = 9/84 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            + D  L NTF  LEE+++KW+  +W V  +GP VP ++ D+           LF+ +   
Sbjct  200  RVDIILCNTFGKLEEKLLKWVQSLWPVLNIGPTVPSMYLDKRLSSDKNYGFSLFDANVAE  259

Query  158  YVQWLDIREPKSVVYVSFGSVAIF  229
             V+WL+ ++P SVVYVS GS+ + 
Sbjct  260  CVEWLNSKQPSSVVYVSLGSLVVL  283



>emb|CDY70064.1| BnaC08g46320D, partial [Brassica napus]
Length=416

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 48/85 (56%), Gaps = 9/85 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            + D  L NTF  LEE+++KW+  +W V  +GP +P ++ D+           LF      
Sbjct  163  RVDIVLCNTFDKLEEKLLKWVKSMWPVLNIGPTLPSMYLDKRLSEDKNYGFSLFTAKSTE  222

Query  158  YVQWLDIREPKSVVYVSFGSVAIFT  232
             ++WL+ ++P SVVYVSFGS+ I  
Sbjct  223  CIEWLNSKQPSSVVYVSFGSLVILN  247



>ref|XP_006661442.1| PREDICTED: crocetin glucosyltransferase 2-like [Oryza brachyantha]
Length=375

 Score = 64.3 bits (155),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 33/82 (40%), Positives = 45/82 (55%), Gaps = 10/82 (12%)
 Frame = +2

Query  8    ADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILH----------KDRIDLFELDGES  157
            AD  L+N+FY LE +   +MA  W  KT+GP VP  +          K    LF+L    
Sbjct  116  ADDVLVNSFYELEPEEAAYMASAWRAKTIGPTVPAAYLGDGRMPDDTKYGFHLFDLTTAP  175

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             + WLD   P+SVV+VSFGS++
Sbjct  176  CMAWLDAHPPRSVVFVSFGSLS  197



>ref|XP_010475279.1| PREDICTED: UDP-glycosyltransferase 74E2-like isoform X2 [Camelina 
sativa]
Length=433

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 49/84 (58%), Gaps = 9/84 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            + D  L NTF  LEE+++KW+  +W V  +GP VP ++ D+           LF+ +   
Sbjct  180  RVDIILCNTFGKLEEKLLKWVQSLWPVLNIGPTVPSMYLDKRLSSDKNYGFSLFDANVAE  239

Query  158  YVQWLDIREPKSVVYVSFGSVAIF  229
             V+WL+ ++P SVVYVS GS+ + 
Sbjct  240  CVEWLNSKQPSSVVYVSLGSLVVL  263



>dbj|BAO51836.1| UDP-glycosyltransferase 74Y1 [Camellia sinensis]
Length=463

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 50/86 (58%), Gaps = 10/86 (12%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMA-DIWSVKTVGPLVPILHKDR---------IDLFELDGE  154
            KAD  L NTF  LEEQ+VKWMA    S+KT+GP +P    D+         + LF+   E
Sbjct  205  KADWILFNTFDKLEEQIVKWMAIQRSSIKTIGPAIPSKFLDKRLEDDKDYGLSLFKPSVE  264

Query  155  SYVQWLDIREPKSVVYVSFGSVAIFT  232
              ++WLD +   SVVY SFGS+A  +
Sbjct  265  DCMKWLDTKPKASVVYASFGSLASLS  290



>ref|NP_172059.1| Uridine diphosphate glycosyltransferase 74E2 [Arabidopsis thaliana]
 sp|Q9SYK9.1|U74E2_ARATH RecName: Full=UDP-glycosyltransferase 74E2 [Arabidopsis thaliana]
 gb|AAD30627.1|AC007153_19 Similar to indole-3-acetate beta-glucosyltransferase [Arabidopsis 
thaliana]
 gb|AAY25431.1| At1g05680 [Arabidopsis thaliana]
 gb|ABJ17124.1| At1g05680 [Arabidopsis thaliana]
 gb|AEE27876.1| Uridine diphosphate glycosyltransferase 74E2 [Arabidopsis thaliana]
Length=453

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 48/84 (57%), Gaps = 9/84 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            + D  L NTF  LEE+++KW+  +W V  +GP VP ++ D+           LF      
Sbjct  200  RVDIVLCNTFDKLEEKLLKWVQSLWPVLNIGPTVPSMYLDKRLSEDKNYGFSLFNAKVAE  259

Query  158  YVQWLDIREPKSVVYVSFGSVAIF  229
             ++WL+ +EP SVVY+SFGS+ I 
Sbjct  260  CMEWLNSKEPNSVVYLSFGSLVIL  283



>ref|NP_001274852.1| UDP-glycosyltransferase 74E2-like [Solanum tuberosum]
 gb|AFX67035.1| UDP-glucose:glucosyltransferase [Solanum tuberosum]
Length=462

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 52/83 (63%), Gaps = 9/83 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            K D  LIN+FY LE++V+ WM+ I+ +KT+GP +P ++ D+         + +F+     
Sbjct  199  KTDWVLINSFYELEKEVIDWMSKIYPIKTIGPTIPSMYLDKRLHDDKEYGLSIFKPMTNE  258

Query  158  YVQWLDIREPKSVVYVSFGSVAI  226
             + WL+ +   SV+YVSFGS+AI
Sbjct  259  CLNWLNHQPISSVLYVSFGSLAI  281



>ref|XP_008235865.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Prunus mume]
Length=464

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 52/83 (63%), Gaps = 10/83 (12%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVK-WMADIWSVKTVGPLVPILHKDR---------IDLFELDGE  154
            KAD    NTFY LE++V++ WM   W+++T+GP +P ++ D+         + L +L+ +
Sbjct  208  KADWVFCNTFYELEQEVIEYWMTKFWTLRTIGPTIPSMYLDKRHEDNNEYGLSLLKLNSD  267

Query  155  SYVQWLDIREPKSVVYVSFGSVA  223
              ++WL+ +   SV Y+SFGS+A
Sbjct  268  PCMKWLNAKPKGSVAYMSFGSLA  290



>ref|XP_004238636.1| PREDICTED: UDP-glycosyltransferase 74E1-like [Solanum lycopersicum]
Length=465

 Score = 64.3 bits (155),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 50/82 (61%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            KAD  L N+F  LEE+VV WM  +W+V T+GP +P  + D+          ++ + +  +
Sbjct  199  KADWVLFNSFDKLEEEVVNWMKKVWNVVTIGPTLPSFYLDKRVENDNEYGFNIHKPNYSN  258

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             ++WLD ++  SVVYVSFGS A
Sbjct  259  CMEWLDSKKTGSVVYVSFGSAA  280



>emb|CDX79437.1| BnaC03g17730D [Brassica napus]
Length=455

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 49/82 (60%), Gaps = 10/82 (12%)
 Frame = +2

Query  11   DCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGESYV  163
            D FL+N+F  LE +V++WM   W VK +GP++P ++ D+         + LF    E  +
Sbjct  202  DFFLVNSFNELEVEVLEWMKKQWPVKNIGPMIPSMYLDKRLAGDKDYGLSLFSAQNEC-L  260

Query  164  QWLDIREPKSVVYVSFGSVAIF  229
             WLD +   SV+YVSFGS+A+ 
Sbjct  261  DWLDSKPHGSVIYVSFGSIAVL  282



>ref|XP_010095580.1| UDP-glycosyltransferase 74F2 [Morus notabilis]
 gb|EXB61153.1| UDP-glycosyltransferase 74F2 [Morus notabilis]
Length=455

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 47/81 (58%), Gaps = 9/81 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            KAD  L NT+Y LEE+V  WM  I  ++T+GP +P ++ D+           LF    E+
Sbjct  202  KADWVLCNTYYELEEEVANWMMKILPLRTIGPTIPSMYLDKRLEGDDQYGFSLFPSQSEA  261

Query  158  YVQWLDIREPKSVVYVSFGSV  220
             ++WL+ R   SV Y+SFGS+
Sbjct  262  CLKWLNSRPKGSVAYLSFGSL  282



>ref|XP_002263532.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Vitis 
vinifera]
Length=447

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 32/70 (46%), Positives = 45/70 (64%), Gaps = 1/70 (1%)
 Frame = +2

Query  14   CFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDRIDLFELDGESYVQWLDIREPKS  193
            C LINTF +LEE V+K + D  +V  +GPL+ +      DLFE   + Y+ WL+ +   S
Sbjct  203  CLLINTFNALEEDVIKALGDFMNVVAIGPLMQLDSSISCDLFE-RSKDYLPWLNSKPEGS  261

Query  194  VVYVSFGSVA  223
            V+YVSFGS+A
Sbjct  262  VIYVSFGSLA  271



>gb|KCW57960.1| hypothetical protein EUGRSUZ_H00695 [Eucalyptus grandis]
Length=398

 Score = 63.9 bits (154),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 51/83 (61%), Gaps = 11/83 (13%)
 Frame = +2

Query  8    ADCFLINTFYSLEEQVVKWM-ADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            AD  L +TFY LE++VV WM +++W +KTVGP +P L+ D+         ++LF     S
Sbjct  205  ADFVLFDTFYELEKEVVDWMSSNLWPLKTVGPTLPSLYPDKRLPNDTAYGVNLFTPTTTS  264

Query  158  YVQ-WLDIREPKSVVYVSFGSVA  223
             V  WL    P SVVYVSFGS+A
Sbjct  265  TVSAWLRRHPPHSVVYVSFGSMA  287



>gb|KFK31183.1| hypothetical protein AALP_AA6G079400 [Arabis alpina]
Length=456

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 51/86 (59%), Gaps = 10/86 (12%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR-------IDLFELD---GE  154
            +ADC L NTF  LE +VVKWM D W VK +GP+VP  + D         DL + +    E
Sbjct  200  QADCILCNTFDQLEPKVVKWMDDQWPVKNIGPVVPSKYLDNRLPEDKDYDLGDSETEPDE  259

Query  155  SYVQWLDIREPKSVVYVSFGSVAIFT  232
            S + WL+ +  KSVV+++FG++   +
Sbjct  260  SILSWLEKKPAKSVVFIAFGTLVALS  285



>ref|XP_011085046.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Sesamum indicum]
Length=465

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 52/84 (62%), Gaps = 11/84 (13%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGE-  154
            KAD  L+NTFY LEE V+  M  +  + T+GP VP ++ D+         ++LF+ D + 
Sbjct  203  KADFVLVNTFYKLEETVIDSMTKVCPLITIGPTVPSVYLDKRVENDHNYDLNLFQSDTQL  262

Query  155  -SYVQWLDIREPKSVVYVSFGSVA  223
             S + WLD + P S+VY++FGS++
Sbjct  263  SSIINWLDTKPPASIVYIAFGSMS  286



>ref|XP_006447927.1| hypothetical protein CICLE_v10017904mg [Citrus clementina]
 gb|ESR61167.1| hypothetical protein CICLE_v10017904mg [Citrus clementina]
Length=318

 Score = 63.5 bits (153),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 49/84 (58%), Gaps = 9/84 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            KAD  L N FY LE++V +W+   W ++T+GP +P  + D+          ++FE + ES
Sbjct  175  KADWILCNNFYELEKEVTEWLGKHWLLRTIGPTLPSKYLDKQIEDDKEYGFNIFEPNIES  234

Query  158  YVQWLDIREPKSVVYVSFGSVAIF  229
             ++WL+ R   SVVYVS G VA  
Sbjct  235  GMKWLNDRANGSVVYVSVGRVATL  258



>ref|XP_006357098.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Solanum tuberosum]
Length=457

 Score = 64.3 bits (155),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 51/82 (62%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            K D  LIN+FY LE++V+ WM+ I+ +KT+GP +P ++ D+         + +F+     
Sbjct  200  KVDWILINSFYELEKEVIDWMSKIYPIKTIGPTIPSMYLDKRLHDDKEYGLSIFKPMTNE  259

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             + WL+ +   SVVYVSFGS+A
Sbjct  260  CLNWLNHQPISSVVYVSFGSLA  281



>emb|CBI24722.3| unnamed protein product [Vitis vinifera]
Length=429

 Score = 63.9 bits (154),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 48/77 (62%), Gaps = 9/77 (12%)
 Frame = +2

Query  20   LINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGESYVQWL  172
            L NTF  LE++V+ WM     VKT+GP VP ++ D+         + LF+ + ++ + WL
Sbjct  179  LFNTFTKLEDEVMNWMDSQRPVKTIGPTVPSMYLDKRLEHDRDYGLSLFKQNIDTCITWL  238

Query  173  DIREPKSVVYVSFGSVA  223
            D +E  SVVYVSFGSVA
Sbjct  239  DTKEIGSVVYVSFGSVA  255



>ref|XP_009630995.1| PREDICTED: UDP-glycosyltransferase 74F1-like [Nicotiana tomentosiformis]
 gb|AAF61647.1|AF190634_1 UDP-glucose:salicylic acid glucosyltransferase [Nicotiana tabacum]
Length=459

 Score = 64.3 bits (155),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 51/82 (62%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
              D  LIN+FY LE++V+ WMA I+ +KT+GP +P ++ D+         + +F+    +
Sbjct  198  NTDWVLINSFYELEKEVIDWMAKIYPIKTIGPTIPSMYLDKRLPDDKEYGLSVFKPMTNA  257

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             + WL+ +   SVVYVSFGS+A
Sbjct  258  CLNWLNHQPVSSVVYVSFGSLA  279



>emb|CDY15370.1| BnaC04g42530D [Brassica napus]
Length=456

 Score = 64.3 bits (155),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 53/86 (62%), Gaps = 10/86 (12%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPI------LHKDR-IDLFELD---GE  154
            +AD  L NTF  LE +VVKWM+D W VK +GP+VP       L +D+  DL +      E
Sbjct  200  RADLILCNTFDQLEPKVVKWMSDQWLVKNIGPMVPSKFLDNRLPEDKDYDLGDFKTEPDE  259

Query  155  SYVQWLDIREPKSVVYVSFGSVAIFT  232
            S ++WL  +  KSVVYV+FG++A  +
Sbjct  260  SVLRWLASKPAKSVVYVAFGTLAALS  285



>ref|XP_010557055.1| PREDICTED: UDP-glycosyltransferase 74C1 [Tarenaya hassleriana]
Length=463

 Score = 64.3 bits (155),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 47/83 (57%), Gaps = 10/83 (12%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDRIDLFELD----------GE  154
            +ADC L NTF  LE++V+KWM   W VK +GP+VP    D     + D          G 
Sbjct  207  RADCILCNTFDQLEDKVMKWMGKEWPVKNIGPVVPSKFLDNRLPEDKDYGLGHFRPKPGG  266

Query  155  SYVQWLDIREPKSVVYVSFGSVA  223
              ++WL  +  KSVVYVS+G++A
Sbjct  267  DAIKWLQTKPSKSVVYVSYGTLA  289



>ref|XP_006380268.1| hypothetical protein POPTR_0007s00740g [Populus trichocarpa]
 gb|ERP58065.1| hypothetical protein POPTR_0007s00740g [Populus trichocarpa]
Length=252

 Score = 62.4 bits (150),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 49/84 (58%), Gaps = 9/84 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDRI---------DLFELDGES  157
            +AD   +NT  +LEE+ V W+A   S+K +GPL+P  + D+           LF+ + + 
Sbjct  57   EADWIFVNTSSTLEEEAVNWLASQRSIKPIGPLIPSFYLDKQLEDDKEYGPSLFKPNPDG  116

Query  158  YVQWLDIREPKSVVYVSFGSVAIF  229
              +WLD +E  SVVYVSFGS+A  
Sbjct  117  CNEWLDSKETGSVVYVSFGSMAAL  140



>ref|XP_002892307.1| UDP-glucoronosyl/UDP-glucosyl transferase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH68566.1| UDP-glucoronosyl/UDP-glucosyl transferase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=1164

 Score = 64.7 bits (156),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 49/84 (58%), Gaps = 9/84 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            + D  L NTF  LEE+++KW+  +W V  +GP VP ++ D+           LF      
Sbjct  200  RVDIVLCNTFDKLEEKLLKWVQSVWPVLNIGPTVPSMYLDKRLPEDKNYGFSLFGAKVAE  259

Query  158  YVQWLDIREPKSVVYVSFGSVAIF  229
             ++WL++++P SVVYVSFGS+ + 
Sbjct  260  CMEWLNLKQPSSVVYVSFGSLVVL  283



>ref|XP_010457690.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Camelina sativa]
Length=453

 Score = 63.9 bits (154),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 49/84 (58%), Gaps = 9/84 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            + D  L NTF  LEE+++KW+  +W V  +GP VP ++ D+           LF+ +   
Sbjct  200  RVDIVLCNTFDKLEEKLLKWVQSLWPVLNIGPTVPSMYLDKRLSEDKNYGFSLFDANVAE  259

Query  158  YVQWLDIREPKSVVYVSFGSVAIF  229
             V+WL+ ++P SVVYVS GS+ + 
Sbjct  260  CVEWLNSKQPSSVVYVSLGSLVVL  283



>ref|XP_009613938.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Nicotiana tomentosiformis]
Length=453

 Score = 63.9 bits (154),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 51/82 (62%), Gaps = 10/82 (12%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            KAD    NTF  LEE VV WM   + +KT+GP +P ++ D+           L + +GE+
Sbjct  194  KADWLFFNTFDVLEE-VVDWMRTQYPIKTIGPTIPSMYLDKRLKDDKEYGSSLIKPNGET  252

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             ++WLD++E  SVVYVSFGS+A
Sbjct  253  CMKWLDLKEIGSVVYVSFGSLA  274



>emb|CDP08068.1| unnamed protein product [Coffea canephora]
Length=448

 Score = 63.9 bits (154),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 54/82 (66%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            KAD    NTF +LE++V++W A+ + +K++GP +P ++ D+         + LF+   +S
Sbjct  193  KADWIFFNTFDNLEKEVLEWTANQYPIKSIGPAIPSVYLDKRLKDDTDYSLSLFKPTTKS  252

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             ++WLD +E  SVVYVSFGS++
Sbjct  253  CMEWLDSKEIDSVVYVSFGSLS  274



>ref|XP_006357097.1| PREDICTED: UDP-glycosyltransferase 74F2-like, partial [Solanum 
tuberosum]
Length=345

 Score = 63.2 bits (152),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 51/82 (62%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            K D  LIN+FY LE++V+ WM+ ++ +KT+GP +P ++ D+         + +F+     
Sbjct  199  KVDWVLINSFYELEKEVIDWMSKMYPIKTIGPTIPSMYLDKRLHDDKEYGLSIFKPMTNE  258

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             + WL+ +   SVVYVSFGS+A
Sbjct  259  CLNWLNHQPISSVVYVSFGSLA  280



>ref|XP_010069228.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Eucalyptus grandis]
 gb|KCW57506.1| hypothetical protein EUGRSUZ_H00279 [Eucalyptus grandis]
Length=469

 Score = 63.9 bits (154),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 51/83 (61%), Gaps = 10/83 (12%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            KAD  L+NTFY LE +VV  M+ +  V T+GP +P ++ D+         ++LF LD  +
Sbjct  201  KADWVLVNTFYELEAEVVDTMSKLCPVSTIGPTIPSMYLDKRVEDDIEYGLNLFTLDKST  260

Query  158  YV-QWLDIREPKSVVYVSFGSVA  223
             +  WL  + P SVVYVSFGS++
Sbjct  261  LITDWLRSKPPSSVVYVSFGSLS  283



>ref|XP_010242509.1| PREDICTED: UDP-glycosyltransferase 74F1-like [Nelumbo nucifera]
Length=462

 Score = 63.9 bits (154),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 51/80 (64%), Gaps = 7/80 (9%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR-------IDLFELDGESYV  163
            K D   INTF+ LE +V+  +  +W VKT+GP VP ++ ++       + L + + ++Y+
Sbjct  205  KVDWVFINTFHDLESEVLSTLVGLWRVKTIGPSVPSVYLNKSVDGDTDLSLRKANTDAYL  264

Query  164  QWLDIREPKSVVYVSFGSVA  223
             WLD +E  SVV++SFGS+A
Sbjct  265  GWLDTKEAGSVVFISFGSLA  284



>ref|XP_006357100.1| PREDICTED: UDP-glycosyltransferase 74E1-like [Solanum tuberosum]
Length=457

 Score = 63.9 bits (154),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 51/82 (62%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            K D  LIN+FY LE++V+ WM+ I+ +KT+GP +P ++ D+         + +F+     
Sbjct  200  KVDWVLINSFYELEKEVIDWMSKIYPIKTIGPTIPSMYLDKRLHDDKEYGLSIFKPMTNE  259

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             + WL+ +   SVVYVSFGS+A
Sbjct  260  CLNWLNHQPISSVVYVSFGSLA  281



>ref|XP_006447930.1| hypothetical protein CICLE_v10015149mg [Citrus clementina]
 gb|ESR61170.1| hypothetical protein CICLE_v10015149mg [Citrus clementina]
Length=465

 Score = 63.9 bits (154),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 52/85 (61%), Gaps = 10/85 (12%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMA-DIWSVKTVGPLVPILHKDR---------IDLFELDGE  154
            KAD  L NTFY LE++V +W+    W ++T+GP +P ++ D+           +FE + E
Sbjct  206  KADWILCNTFYELEKEVTEWLGKQHWLLRTIGPTLPSIYLDKQIEDDKEYGFSIFEPNIE  265

Query  155  SYVQWLDIREPKSVVYVSFGSVAIF  229
            S ++WL+ R   SVVY+SFGS+A  
Sbjct  266  SCMKWLNDRANGSVVYLSFGSMATL  290



>ref|XP_009776895.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Nicotiana sylvestris]
Length=445

 Score = 63.5 bits (153),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 51/82 (62%), Gaps = 10/82 (12%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            KAD    NTF  LEE VV WM   + +KT+GP +P ++ D+           L + +GE+
Sbjct  194  KADWLFFNTFDVLEE-VVDWMRTQYPIKTIGPTIPSMYLDKRLKDDKEYGSSLIKPNGET  252

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             ++WLD++E  SVVYVSFGS+A
Sbjct  253  CMKWLDLKEIGSVVYVSFGSLA  274



>ref|XP_002306205.2| putative glucosyltransferase family protein [Populus trichocarpa]
 gb|EEE86716.2| putative glucosyltransferase family protein [Populus trichocarpa]
Length=463

 Score = 63.9 bits (154),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 50/84 (60%), Gaps = 9/84 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDRI---------DLFELDGES  157
            +AD   +NTF +LEE+ V W+A   S+K +GP++P  + D+           LF+ + + 
Sbjct  204  EADWIFVNTFSTLEEEAVNWLASQRSIKPIGPMIPSFYLDKQLEDDREYGPSLFKPNLDG  263

Query  158  YVQWLDIREPKSVVYVSFGSVAIF  229
             ++WLD +E  SVVYVSFGS+   
Sbjct  264  CMEWLDSKETGSVVYVSFGSMTAL  287



>emb|CDP06918.1| unnamed protein product [Coffea canephora]
Length=458

 Score = 63.9 bits (154),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 48/80 (60%), Gaps = 9/80 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            +AD  ++N F+ LEE  + WMA +W V TVGP VP ++ D+         I+LF+ +   
Sbjct  199  QADWVILNNFHKLEEDALNWMAKLWRVITVGPTVPSIYLDKRLEDDIGYGINLFKPESSL  258

Query  158  YVQWLDIREPKSVVYVSFGS  217
             + WL+ +   SVVYV+FGS
Sbjct  259  CINWLNSQPKDSVVYVAFGS  278



>ref|XP_009132814.1| PREDICTED: UDP-glycosyltransferase 74D1 [Brassica rapa]
 emb|CDX84760.1| BnaA03g14700D [Brassica napus]
Length=455

 Score = 63.9 bits (154),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 49/82 (60%), Gaps = 10/82 (12%)
 Frame = +2

Query  11   DCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGESYV  163
            D FL+N+F  LE +V++WM   W VK +GP++P ++ D+         + LF    E  +
Sbjct  202  DFFLVNSFDELEVEVLEWMKKQWPVKNIGPMIPSMYLDKRLAGDKDYGLSLFSAQNEC-L  260

Query  164  QWLDIREPKSVVYVSFGSVAIF  229
             WLD +   SV+YVSFGS+A+ 
Sbjct  261  DWLDSKPHGSVIYVSFGSIAVL  282



>emb|CDP20085.1| unnamed protein product [Coffea canephora]
Length=428

 Score = 63.5 bits (153),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR-IDLFELDGESYVQWLDIR  181
            KA+    N+F  LE +V  WMA  WS+KTVGP +   +K     L E+  ++ ++WLD R
Sbjct  181  KANWIFFNSFDKLEYEVANWMARKWSIKTVGPTILKDNKHHGACLVEMKSDACLKWLDER  240

Query  182  EPKSVVYVSFGSVAIF  229
            +  SVVYVS GSVA+ 
Sbjct  241  DCSSVVYVSLGSVAVL  256



>ref|XP_010069229.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyltransferase 74F2-like 
[Eucalyptus grandis]
Length=469

 Score = 63.5 bits (153),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 51/83 (61%), Gaps = 10/83 (12%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            KAD  L+NTFY LE +VV  M+ +  V T+GP +P ++ D+         ++LF LD  +
Sbjct  201  KADWVLVNTFYELEAEVVDTMSKLCPVTTIGPTIPSMYLDKRVENDIEYGLNLFTLDKST  260

Query  158  YV-QWLDIREPKSVVYVSFGSVA  223
             +  WL  + P SVVYVSFGS++
Sbjct  261  LITDWLRSKPPSSVVYVSFGSMS  283



>emb|CBI24715.3| unnamed protein product [Vitis vinifera]
Length=388

 Score = 63.5 bits (153),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 50/83 (60%), Gaps = 10/83 (12%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFEL-DGE  154
            KADC L+N+FY LE+ VV  M+ + ++ T+GP +P    D+         ++ F+    E
Sbjct  131  KADCILVNSFYKLEDSVVDAMSKVCTLLTIGPTIPSFFSDKRVNDDMAYGLNFFKAHQSE  190

Query  155  SYVQWLDIREPKSVVYVSFGSVA  223
            + ++WL  +   SVVYVSFGS+A
Sbjct  191  TCIEWLSSKPKGSVVYVSFGSMA  213



>ref|XP_010908630.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Elaeis guineensis]
Length=266

 Score = 62.0 bits (149),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 32/84 (38%), Positives = 46/84 (55%), Gaps = 9/84 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            KAD   +N+FY LE +   +MA  W  KT+GP VP  + +            L++     
Sbjct  9    KADVVFVNSFYELEPEEAGYMASTWRAKTIGPTVPSSYLNNRLPSDFHYGFHLYKPSIAP  68

Query  158  YVQWLDIREPKSVVYVSFGSVAIF  229
             +QWLD +  KSV+YVSFGS+A+ 
Sbjct  69   CMQWLDSQPSKSVIYVSFGSMAVL  92



>gb|ACM09993.3| UDP-glycosyltransferase BMGT1 [Bacopa monnieri]
Length=463

 Score = 63.5 bits (153),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 48/83 (58%), Gaps = 11/83 (13%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            K D  L NTFY LE QV +WM   W +KT+GP   +L K +         I LFE + ++
Sbjct  203  KVDWILFNTFYDLETQVAEWMKAKWPIKTIGP-TSLLEKHKKLGNDKNQIISLFEQNHKA  261

Query  158  YV-QWLDIREPKSVVYVSFGSVA  223
             + QWLD  E  SVVYVS GS+A
Sbjct  262  CIDQWLDSMETCSVVYVSLGSIA  284



>ref|XP_004287163.1| PREDICTED: UDP-glycosyltransferase 74E1-like [Fragaria vesca 
subsp. vesca]
Length=504

 Score = 63.5 bits (153),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 50/80 (63%), Gaps = 11/80 (14%)
 Frame = +2

Query  26   NTFYSLEEQVVKWMADI-WSVKTVGPLVPILHKDR---------IDLFELDG-ESYVQWL  172
            NT+  LEEQV+KW A + W VKT+GP +P    D+         + LF+ D  E+ ++WL
Sbjct  253  NTYEKLEEQVLKWTASLDWPVKTIGPTIPSSFLDKRLEDEKDYSLSLFKPDRVETCMKWL  312

Query  173  DIREPKSVVYVSFGSVAIFT  232
            D +E  SVVYVSFGS+A  T
Sbjct  313  DSKETGSVVYVSFGSLANLT  332



>ref|XP_002309739.1| putative glucosyltransferase family protein [Populus trichocarpa]
 gb|EEE90189.1| putative glucosyltransferase family protein [Populus trichocarpa]
Length=457

 Score = 63.5 bits (153),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 50/84 (60%), Gaps = 9/84 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            +AD   +NTF +LEE+ V W+A   S+K +GP +P ++ DR         + LF+ +   
Sbjct  196  EADWIFVNTFNTLEEEAVNWLASQRSIKPIGPTIPSVYLDRQLEDDREYGLSLFKPNLYG  255

Query  158  YVQWLDIREPKSVVYVSFGSVAIF  229
              +WLD +E  SVVYVS+GS+A  
Sbjct  256  CKEWLDSKETGSVVYVSYGSMAAL  279



>ref|XP_007049534.1| UDP-xylose phenolic glycosyltransferase, putative [Theobroma 
cacao]
 gb|EOX93691.1| UDP-xylose phenolic glycosyltransferase, putative [Theobroma 
cacao]
Length=459

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 48/80 (60%), Gaps = 9/80 (11%)
 Frame = +2

Query  11   DCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGESYV  163
            D  L + FY LE QVV WM+ +W + T+GP +P ++ D+         ++LF+ D  + +
Sbjct  206  DWVLFDNFYELETQVVDWMSKLWKLGTIGPTLPSMYLDKRIEDDKDYGVNLFKPDTGTCM  265

Query  164  QWLDIREPKSVVYVSFGSVA  223
             WL+ +   SVVY SFGS+A
Sbjct  266  SWLNGKPKGSVVYASFGSMA  285



>ref|XP_002532449.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF29935.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=192

 Score = 61.2 bits (147),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 45/81 (56%), Gaps = 9/81 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGP------LVPILHKDR---IDLFELDGES  157
            +AD  L NTFY LE  V  W+A +W  +T+GP      L   L  DR     LF+ + + 
Sbjct  64   QADWVLCNTFYELERNVADWLAKLWRFRTIGPSIRSIYLDNRLENDRDYGFSLFKPNNDR  123

Query  158  YVQWLDIREPKSVVYVSFGSV  220
             + WL+ R   SVVYVSFGS+
Sbjct  124  CMGWLNDRTKGSVVYVSFGSL  144



>ref|XP_006417998.1| hypothetical protein EUTSA_v10007603mg [Eutrema salsugineum]
 gb|ESQ36351.1| hypothetical protein EUTSA_v10007603mg [Eutrema salsugineum]
Length=453

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 47/84 (56%), Gaps = 9/84 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            + D  L NTF  LEE+++ W+  +W V  +GP VP ++ D+           LF      
Sbjct  200  RVDVVLCNTFDKLEEKLLTWVQSLWPVMNIGPTVPSMYLDKRLPEDKNYGFSLFNAKVAE  259

Query  158  YVQWLDIREPKSVVYVSFGSVAIF  229
             ++WL+ ++P SVVYVSFGS+ I 
Sbjct  260  CIEWLNSKQPNSVVYVSFGSLVIL  283



>ref|XP_010242476.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Nelumbo nucifera]
Length=458

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 49/84 (58%), Gaps = 10/84 (12%)
 Frame = +2

Query  8    ADCFLINTFYSLEEQVVKWMADIWSV-KTVGPLVPILHKDR---------IDLFELDGES  157
             D  L+NTF  LE + V WM   W + +T+GP +P ++ D+         ++LF+ DG +
Sbjct  203  TDWILVNTFQELEVEEVDWMTRRWPLLRTIGPTIPSMYMDKRVTYDMDYGLNLFKSDGSA  262

Query  158  YVQWLDIREPKSVVYVSFGSVAIF  229
             + WL+ R   SVVYVSFGS+A  
Sbjct  263  CLNWLNKRAAGSVVYVSFGSLAAL  286



>ref|XP_004244487.1| PREDICTED: UDP-glycosyltransferase 74F2-like isoform X1 [Solanum 
lycopersicum]
Length=458

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 51/82 (62%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            K D  LIN+FY LE++V+ WM+ I+ +KT+GP +P ++ D+         + +F+     
Sbjct  199  KTDWVLINSFYELEKEVIDWMSKIYPIKTIGPTIPSMYLDKRLHDDKEYGLSMFKPMTNE  258

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             + WL+ +   SV+YVSFGS+A
Sbjct  259  CLNWLNHQPISSVLYVSFGSLA  280



>ref|XP_011047632.1| PREDICTED: UDP-glycosyltransferase 74F1-like [Populus euphratica]
Length=457

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 48/85 (56%), Gaps = 9/85 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            KAD  LINT+Y LE +VV  M+ +  + T+GP +P ++ D+         I L E+D   
Sbjct  201  KADLILINTYYKLECEVVDRMSKVCPLLTIGPTIPSIYLDKSIEDDDDYGISLSEIDASL  260

Query  158  YVQWLDIREPKSVVYVSFGSVAIFT  232
             + WL  +   SVVYVSFGS A  +
Sbjct  261  SINWLSTKPTASVVYVSFGSCATLS  285



>ref|XP_007033641.1| Uridine diphosphate glycosyltransferase 74E2 isoform 1 [Theobroma 
cacao]
 ref|XP_007033642.1| Uridine diphosphate glycosyltransferase 74E2 isoform 1 [Theobroma 
cacao]
 gb|EOY04567.1| Uridine diphosphate glycosyltransferase 74E2 isoform 1 [Theobroma 
cacao]
 gb|EOY04568.1| Uridine diphosphate glycosyltransferase 74E2 isoform 1 [Theobroma 
cacao]
Length=442

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 51/82 (62%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            +AD   INTF SLEE+V+ WMA    +K +GP++P  + D+         + LF+ + + 
Sbjct  187  EADWVFINTFTSLEEEVLNWMASQRPIKAIGPVIPSKYLDKRVEDDEEYGLHLFKPEIDI  246

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             + WL+ +E  SVVY+SFGS+A
Sbjct  247  CINWLNSKETGSVVYISFGSLA  268



>gb|EYU17628.1| hypothetical protein MIMGU_mgv1a020645mg [Erythranthe guttata]
Length=460

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 51/82 (62%), Gaps = 10/82 (12%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELD-GE  154
            KAD  L+NTFY LEE+VV  M  +  + T+GP +P  + D          ++LF+ D  +
Sbjct  202  KADFVLVNTFYKLEEKVVDSMTKVCPMLTIGPTLPSFYLDNRIENDDKYDVNLFQSDPSQ  261

Query  155  SYVQWLDIREPKSVVYVSFGSV  220
            + + WL+ + PKSVVY++FGS+
Sbjct  262  TILDWLNTKPPKSVVYIAFGSM  283



>ref|NP_001184915.1| UDP-Glycosyltransferase superfamily protein [Arabidopsis thaliana]
 sp|P0C7P7.1|U74E1_ARATH RecName: Full=UDP-glycosyltransferase 74E1 [Arabidopsis thaliana]
 gb|AEE27875.1| UDP-Glycosyltransferase superfamily protein [Arabidopsis thaliana]
Length=453

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 48/84 (57%), Gaps = 9/84 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            + D  L NTF  LEE+++KW+  +W V  +GP VP ++ D+           LF      
Sbjct  200  RVDIVLCNTFDKLEEKLLKWIKSVWPVLNIGPTVPSMYLDKRLAEDKNYGFSLFGAKIAE  259

Query  158  YVQWLDIREPKSVVYVSFGSVAIF  229
             ++WL+ ++P SVVYVSFGS+ + 
Sbjct  260  CMEWLNSKQPSSVVYVSFGSLVVL  283



>gb|AFJ52958.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=457

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 47/85 (55%), Gaps = 9/85 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKD---------RIDLFELDGES  157
            KAD  LINTFY LE++ +  M+ +  V  +GP VP  + D          +DLF L+   
Sbjct  199  KADYVLINTFYELEKEALHTMSKVCPVLAIGPTVPSTYLDGRIDDDAEYGVDLFSLERSI  258

Query  158  YVQWLDIREPKSVVYVSFGSVAIFT  232
               W+  + PKSV+YV+FGS+  F 
Sbjct  259  STAWIATKPPKSVIYVAFGSMVTFN  283



>ref|XP_002278455.1| PREDICTED: UDP-glycosyltransferase 74F2 [Vitis vinifera]
Length=457

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 51/86 (59%), Gaps = 10/86 (12%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFEL-DGE  154
            KADC L+N+FY LE+ VV  M+ + ++ T+GP +P    D+         ++ F+    E
Sbjct  200  KADCILVNSFYKLEDSVVDAMSKVCTLLTIGPTIPSFFSDKRVNDDMAYGLNFFKAHQSE  259

Query  155  SYVQWLDIREPKSVVYVSFGSVAIFT  232
            + ++WL  +   SVVYVSFGS+A  +
Sbjct  260  TCIEWLSSKPKGSVVYVSFGSMASLS  285



>gb|EYU17631.1| hypothetical protein MIMGU_mgv1a006064mg [Erythranthe guttata]
Length=459

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 51/82 (62%), Gaps = 10/82 (12%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELD-GE  154
            KAD  L+NTFY LEE+VV  M  +  + T+GP +P  + D          ++LF+ D  +
Sbjct  201  KADFVLVNTFYKLEEKVVDSMTKVCPMLTIGPTLPSFYLDNRIENDDKYDVNLFQSDPSQ  260

Query  155  SYVQWLDIREPKSVVYVSFGSV  220
            + + WL+ + PKSVVY++FGS+
Sbjct  261  TILDWLNTKPPKSVVYIAFGSM  282



>ref|XP_010679006.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Beta vulgaris subsp. 
vulgaris]
Length=465

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 48/82 (59%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            + D  L N FY +E++V+ WMA +W V+T+GP VP  + D+         + L + +   
Sbjct  210  QVDWVLCNIFYEMEKEVIDWMAKMWKVRTIGPTVPSYYLDKRLEDDRDYSLQLLKPNTAL  269

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
               WLD +  +SV+YVSFGS+A
Sbjct  270  CKNWLDTKTKESVIYVSFGSMA  291



>ref|XP_006372895.1| hypothetical protein POPTR_0017s06080g [Populus trichocarpa]
 gb|ERP50692.1| hypothetical protein POPTR_0017s06080g [Populus trichocarpa]
Length=350

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 51/83 (61%), Gaps = 9/83 (11%)
 Frame = +2

Query  8    ADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGESY  160
            AD   +N+F +LEE+VV  +A   S+K +GP++P ++ DR         + LF+   +  
Sbjct  87   ADWIFVNSFNTLEEEVVNCLASQRSIKPIGPMIPSVYLDRQLEDDTEYGLSLFKPAVDGC  146

Query  161  VQWLDIREPKSVVYVSFGSVAIF  229
            ++WLD +E  SVVYVSFGS+A  
Sbjct  147  MEWLDSKETGSVVYVSFGSLAAL  169



>gb|KCW57497.1| hypothetical protein EUGRSUZ_H00262 [Eucalyptus grandis]
Length=264

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 35/83 (42%), Positives = 51/83 (61%), Gaps = 10/83 (12%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFEL-DGE  154
            +A+  L +TF  LE +VVKWM     + TVGP VP ++ D+         + LF+  D E
Sbjct  2    RANWRLFSTFAELEVEVVKWMGSQCPLLTVGPTVPSMYLDKRIQHDKDYGLSLFKPNDAE  61

Query  155  SYVQWLDIREPKSVVYVSFGSVA  223
            + ++WLD ++  SVVYVSFGS+A
Sbjct  62   TCIEWLDSKDADSVVYVSFGSLA  84



>ref|XP_004244486.1| PREDICTED: UDP-glycosyltransferase 74E1-like [Solanum lycopersicum]
Length=456

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 51/82 (62%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            K D  LIN+FY LE++V+ WM+ I+ +KT+GP +P ++ D+         + +F+     
Sbjct  199  KVDWVLINSFYELEKEVIDWMSKIYPIKTIGPTIPSMYLDKRLHDDKEYGLSMFKPMTNE  258

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             + WL+ +   SV+YVSFGS+A
Sbjct  259  CLNWLNHQPISSVLYVSFGSLA  280



>ref|XP_002310479.2| putative glucosyltransferase family protein [Populus trichocarpa]
 gb|EEE90929.2| putative glucosyltransferase family protein [Populus trichocarpa]
Length=457

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 48/85 (56%), Gaps = 9/85 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            KAD  LINTFY LE +VV  M+ +  + T+GP +P ++ D+         I L E+D   
Sbjct  201  KADWILINTFYKLECEVVDTMSKVCPLLTIGPTIPSIYLDKSIEDEDDYGISLCEIDASL  260

Query  158  YVQWLDIREPKSVVYVSFGSVAIFT  232
             + WL  +   SVVYVSFGS A  +
Sbjct  261  SINWLSSKPTASVVYVSFGSCATLS  285



>emb|CAN69453.1| hypothetical protein VITISV_002845 [Vitis vinifera]
Length=433

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 51/86 (59%), Gaps = 10/86 (12%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFEL-DGE  154
            KADC L+N+FY LE+ VV  M+ + ++ T+GP +P    D+         ++ F+    E
Sbjct  88   KADCILVNSFYKLEDSVVDAMSKVCTLLTIGPTIPSFFSDKRVNDDMAYGLNFFKAHQSE  147

Query  155  SYVQWLDIREPKSVVYVSFGSVAIFT  232
            + ++WL  +   SVVYVSFGS+A  +
Sbjct  148  TCIEWLSSKPKGSVVYVSFGSMASLS  173



>ref|XP_004489724.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Cicer arietinum]
 gb|AGU14099.1| UDP-glycosyltransferase [Cicer arietinum]
Length=458

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 48/82 (59%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            KAD  L NT Y LE +VV W+  IW +KT+GP VP +  D+         + +   + E 
Sbjct  203  KADWILANTIYELEPEVVDWLVKIWPLKTIGPSVPSMLLDKRLKDDKEYGVSISNPNTEV  262

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             ++WL+ +   SVVYVSFGS+A
Sbjct  263  CIKWLNEKPKGSVVYVSFGSMA  284



>gb|ACM09899.2| glycosyltransferase [Withania somnifera]
Length=456

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 51/82 (62%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            K D  LIN+FY LE+ V+ WM+ I+ +K +GP +P ++ D+         + +F+   ++
Sbjct  199  KTDWVLINSFYELEKHVIDWMSKIYPIKAIGPTIPSMYLDKRLPDDKEYGLSMFKPITDA  258

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             + WL+ +   SV+YVSFGS+A
Sbjct  259  CINWLNHQPINSVLYVSFGSLA  280



>ref|XP_010069222.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Eucalyptus grandis]
 gb|KCW57499.1| hypothetical protein EUGRSUZ_H00266 [Eucalyptus grandis]
Length=475

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 51/83 (61%), Gaps = 10/83 (12%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFEL-DGE  154
            +A+  L NTF  LE +VVKW      V TVGP +P ++ D+         + LF+L D E
Sbjct  214  RANWRLFNTFAELEVEVVKWTGSQCPVLTVGPTIPSMYLDKRIQHDKDYGLSLFKLNDAE  273

Query  155  SYVQWLDIREPKSVVYVSFGSVA  223
            + ++WLD ++  SVVY+SFGS+A
Sbjct  274  TCIEWLDSKDADSVVYISFGSLA  296



>gb|AHK60847.1| CrUGT9 [Catharanthus roseus]
Length=474

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 49/87 (56%), Gaps = 13/87 (15%)
 Frame = +2

Query  11   DCFLINTFYSLEEQVVKWMADIWSVKTVGPLVP----ILHKDRID---------LFELDG  151
            D  L NTF +LE +VV WM   W + TVGP  P    +L K + +         LFE + 
Sbjct  215  DYVLFNTFDALEIEVVNWMGSKWPILTVGPTAPTSMFLLDKKQKNYEDGRSINYLFETNT  274

Query  152  ESYVQWLDIREPKSVVYVSFGSVAIFT  232
            E  ++WLD RE  +V+YVSFGS+A  T
Sbjct  275  EVCMKWLDQREIDTVIYVSFGSLASLT  301



>gb|AFJ52957.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
 gb|AGD95008.1| UDP-glucosyltransferase [Linum usitatissimum]
Length=475

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 49/87 (56%), Gaps = 11/87 (13%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILH-----------KDRIDLFELDG  151
            +ADCFLINTFY LE++VV   + I  +  +GP +P  +           K  +DLFE D 
Sbjct  205  RADCFLINTFYELEKEVVDTFSKICPILPIGPTIPSNYLTTKPSMTENGKYGLDLFEHDE  264

Query  152  ESYVQWLDIREPKSVVYVSFGSVAIFT  232
               ++WL  +   SV+YV+FGS A  T
Sbjct  265  SIPIKWLSNKPLSSVIYVAFGSRASLT  291



>gb|KDP35132.1| hypothetical protein JCGZ_10666 [Jatropha curcas]
Length=457

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 50/82 (61%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            KAD  LINTFY LE++VV  M+ +  V T+GP +P  + D+         +DLF L+   
Sbjct  200  KADYVLINTFYKLEKEVVDEMSKVCPVLTIGPTIPSKYLDKRIENDDDYGLDLFALEASF  259

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             + W+  +  +SVVYV+FGS++
Sbjct  260  SLNWISNKPARSVVYVAFGSLS  281



>ref|XP_006478564.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Citrus sinensis]
Length=423

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 33/82 (40%), Positives = 46/82 (56%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            +AD  L+NTFY LE QV   M+    + T+GP +P  + D          ++LF LD   
Sbjct  202  RADLVLVNTFYKLESQVADSMSKFCPMVTIGPTLPSFYLDNRILNDNDYDLNLFTLDKSI  261

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             + WL+ +   SVVYVSFGS+A
Sbjct  262  TMNWLNTKPEGSVVYVSFGSMA  283



>ref|XP_007049526.1| UDP-xylose phenolic glycosyltransferase, putative [Theobroma 
cacao]
 gb|EOX93683.1| UDP-xylose phenolic glycosyltransferase, putative [Theobroma 
cacao]
Length=459

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 48/82 (59%), Gaps = 9/82 (11%)
 Frame = +2

Query  5    KADCFLINTFYSLEEQVVKWMADIWSVKTVGPLVPILHKDR---------IDLFELDGES  157
            +AD   +N FY LE++ V WM+  W+V T+GP +P ++ D+         + LF+    +
Sbjct  203  EADWVFLNIFYDLEKEAVDWMSQFWNVMTIGPTIPSMYLDKRLENDKHYGMHLFKPKTST  262

Query  158  YVQWLDIREPKSVVYVSFGSVA  223
             + WL  +   SVVYVSFGS+A
Sbjct  263  CMSWLSGKPKSSVVYVSFGSMA  284



>ref|XP_002518671.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF43596.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=476

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 56/78 (72%), Gaps = 8/78 (10%)
 Frame = +2

Query  20   LINTFYSLEEQVVKWMADIWSVKTVGPLVP--ILHKDR-----IDLFELDGESYVQWLDI  178
            L N+F+ LE+ V+  MAD++ ++ VGPLVP  +L +D+     +D+++ + +S ++WL+ 
Sbjct  214  LGNSFFELEKDVINSMADLYPIRPVGPLVPPSLLGEDQDEDIGVDMWKAE-DSCIEWLNK  272

Query  179  REPKSVVYVSFGSVAIFT  232
            +EP SV+YVSFGS+ + +
Sbjct  273  QEPSSVIYVSFGSIIVLS  290



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 519253874986