BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c10383_g1_i2 len=882 path=[311:0-308 620:309-881]

Length=882
                                                                      Score     E

ref|XP_011102142.1|  PREDICTED: probable receptor-like serine/thr...  95.9    2e-18   
ref|XP_006357335.1|  PREDICTED: inactive leucine-rich repeat rece...  92.0    3e-17   
ref|XP_004237363.1|  PREDICTED: probable receptor-like serine/thr...  92.0    4e-17   
ref|XP_009795415.1|  PREDICTED: probable receptor-like serine/thr...  90.5    9e-17   
emb|CDP11935.1|  unnamed protein product                              89.7    2e-16   
ref|XP_009588636.1|  PREDICTED: probable receptor-like serine/thr...  86.7    2e-15   
gb|KHG01419.1|  Putative proline-rich receptor-like protein kinas...  80.5    2e-13   
ref|XP_010664160.1|  PREDICTED: LOW QUALITY PROTEIN: probable rec...  79.3    4e-13   
emb|CBI18962.3|  unnamed protein product                              79.0    5e-13   
gb|EYU32494.1|  hypothetical protein MIMGU_mgv1a001977mg              77.8    1e-12   
ref|XP_010087185.1|  Proline-rich receptor-like protein kinase PERK1  74.3    2e-11   
gb|KEH35354.1|  adenine nucleotide alpha hydrolase-like domain ki...  73.9    2e-11   
ref|XP_004290918.1|  PREDICTED: uncharacterized protein LOC101296735  72.8    5e-11   
ref|XP_007137480.1|  hypothetical protein PHAVU_009G130300g           72.4    7e-11   
gb|KHN44298.1|  Putative receptor-like serine/threonine-protein k...  72.0    1e-10   
ref|XP_006472861.1|  PREDICTED: probable L-type lectin-domain con...  71.6    1e-10   
ref|XP_009349910.1|  PREDICTED: LOW QUALITY PROTEIN: probable rec...  71.6    1e-10   
ref|XP_009362341.1|  PREDICTED: probable receptor-like serine/thr...  71.6    1e-10   
gb|KHN46982.1|  Putative receptor-like serine/threonine-protein k...  71.2    2e-10   
ref|NP_001238713.1|  protein kinase family protein                    70.9    2e-10   
ref|XP_003526656.1|  PREDICTED: probable receptor-like serine/thr...  70.9    2e-10   
gb|KDP32865.1|  hypothetical protein JCGZ_12157                       70.9    2e-10   
ref|XP_006595490.1|  PREDICTED: protein kinase family protein iso...  70.9    2e-10   
gb|KHN38974.1|  Receptor-like cytosolic serine/threonine-protein ...  70.9    3e-10   
ref|XP_007225237.1|  hypothetical protein PRUPE_ppa001811mg           70.5    3e-10   
ref|XP_006434294.1|  hypothetical protein CICLE_v10000358mg           70.5    3e-10   
gb|KDO80469.1|  hypothetical protein CISIN_1g004174mg                 70.5    3e-10   
gb|KDO80470.1|  hypothetical protein CISIN_1g004174mg                 70.5    3e-10   
ref|XP_009354013.1|  PREDICTED: probable receptor-like serine/thr...  70.5    3e-10   
ref|XP_008219572.1|  PREDICTED: interleukin-1 receptor-associated...  70.5    3e-10   
ref|XP_006434295.1|  hypothetical protein CICLE_v10000358mg           70.5    3e-10   
gb|KDO80471.1|  hypothetical protein CISIN_1g004174mg                 70.1    3e-10   
gb|KDO80468.1|  hypothetical protein CISIN_1g004174mg                 70.1    4e-10   
ref|XP_009355832.1|  PREDICTED: probable receptor-like serine/thr...  70.5    4e-10   
ref|XP_008394166.1|  PREDICTED: interleukin-1 receptor-associated...  68.9    9e-10   
ref|XP_010678918.1|  PREDICTED: probable receptor-like serine/thr...  67.8    3e-09   
ref|XP_010269084.1|  PREDICTED: probable receptor-like serine/thr...  67.4    3e-09   
ref|XP_007019225.1|  Kinase protein with adenine nucleotide alpha...  67.0    4e-09   
ref|XP_003522567.1|  PREDICTED: probable receptor-like serine/thr...  67.0    5e-09   
ref|XP_003542041.1|  PREDICTED: uncharacterized protein LOC100797280  66.2    8e-09   
gb|KHN05157.1|  Receptor-like cytosolic serine/threonine-protein ...  66.2    8e-09   
ref|XP_002520305.1|  ATP binding protein, putative                    66.2    8e-09   Ricinus communis
ref|XP_004502543.1|  PREDICTED: uncharacterized protein LOC101504509  65.5    1e-08   
ref|XP_010270301.1|  PREDICTED: probable receptor-like serine/thr...  65.5    2e-08   
gb|KEH40498.1|  adenine nucleotide alpha hydrolase-like domain ki...  63.9    5e-08   
ref|XP_011016100.1|  PREDICTED: probable receptor-like serine/thr...  63.9    5e-08   
gb|KGN47686.1|  hypothetical protein Csa_6G376270                     63.9    5e-08   
ref|XP_004168581.1|  PREDICTED: uncharacterized LOC101203034          63.5    6e-08   
ref|XP_004149436.1|  PREDICTED: uncharacterized protein LOC101203034  63.5    6e-08   
ref|XP_008441611.1|  PREDICTED: uncharacterized protein LOC103485693  63.5    7e-08   
ref|XP_002306655.2|  kinase family protein                            62.4    1e-07   Populus trichocarpa [western balsam poplar]
ref|XP_011011405.1|  PREDICTED: putative leucine-rich repeat rece...  62.0    2e-07   
ref|XP_007161426.1|  hypothetical protein PHAVU_001G067700g           62.0    2e-07   
ref|XP_011031142.1|  PREDICTED: probable LIM domain-containing se...  62.0    2e-07   
ref|XP_011031141.1|  PREDICTED: probable LIM domain-containing se...  62.0    2e-07   
ref|XP_011011403.1|  PREDICTED: putative leucine-rich repeat rece...  62.0    2e-07   
ref|XP_011011404.1|  PREDICTED: probable LIM domain-containing se...  62.0    2e-07   
ref|XP_011031140.1|  PREDICTED: probable LIM domain-containing se...  62.0    2e-07   
ref|XP_011031139.1|  PREDICTED: probable LRR receptor-like serine...  62.0    2e-07   
ref|XP_011011402.1|  PREDICTED: putative leucine-rich repeat rece...  62.0    2e-07   
ref|XP_002307046.2|  hypothetical protein POPTR_0005s06800g           62.0    2e-07   Populus trichocarpa [western balsam poplar]
ref|XP_004498354.1|  PREDICTED: uncharacterized protein LOC101490391  61.2    4e-07   
ref|XP_010093102.1|  Receptor-like cytosolic serine/threonine-pro...  60.8    5e-07   
ref|XP_002264653.2|  PREDICTED: probable receptor protein kinase ...  60.5    6e-07   Vitis vinifera
emb|CAN81737.1|  hypothetical protein VITISV_043580                   60.5    7e-07   Vitis vinifera
emb|CBI37518.3|  unnamed protein product                              60.5    7e-07   
dbj|BAF01933.1|  hypothetical protein                                 57.8    1e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010537354.1|  PREDICTED: probable receptor-like serine/thr...  60.1    1e-06   
ref|XP_007048485.1|  Kinase protein with adenine nucleotide alpha...  59.7    1e-06   
ref|XP_008783316.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...  59.7    1e-06   
ref|XP_008227546.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  59.3    1e-06   
ref|XP_002310531.2|  hypothetical protein POPTR_0007s04490g           58.5    3e-06   Populus trichocarpa [western balsam poplar]
ref|XP_006303211.1|  hypothetical protein CARUB_v10011454mg           58.5    3e-06   
gb|KDP20470.1|  hypothetical protein JCGZ_05332                       58.2    3e-06   
ref|XP_010459867.1|  PREDICTED: probable receptor-like serine/thr...  58.2    3e-06   
gb|AAC34357.1|  Putative protein kinase                               58.2    4e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010498614.1|  PREDICTED: probable receptor protein kinase ...  58.2    4e-06   
ref|NP_177852.2|  adenine nucleotide alpha hydrolases-domain cont...  58.2    4e-06   Arabidopsis thaliana [mouse-ear cress]
emb|CDP16448.1|  unnamed protein product                              57.8    5e-06   
ref|XP_007214539.1|  hypothetical protein PRUPE_ppa002094mg           57.8    5e-06   
gb|AFK38695.1|  unknown                                               54.7    6e-06   
gb|AAF87904.1|AC015447_14  Similar to protein kinases                 57.4    7e-06   Arabidopsis thaliana [mouse-ear cress]
gb|KFK42126.1|  hypothetical protein AALP_AA2G214300                  57.4    7e-06   
ref|NP_173578.2|  putative protein kinase                             57.4    7e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010534448.1|  PREDICTED: probable receptor-like serine/thr...  57.4    8e-06   
gb|KEH35608.1|  adenine nucleotide alpha hydrolase-like domain ki...  57.0    8e-06   
gb|KEH35607.1|  adenine nucleotide alpha hydrolase-like domain ki...  57.0    8e-06   
ref|XP_002893177.1|  kinase family protein                            57.0    1e-05   
gb|KHN31175.1|  Proline-rich receptor-like protein kinase PERK9       56.6    1e-05   
ref|XP_006578781.1|  PREDICTED: proline-rich receptor-like protei...  56.6    1e-05   
gb|KGN62217.1|  hypothetical protein Csa_2G336150                     56.6    1e-05   
ref|XP_010055962.1|  PREDICTED: probable receptor-like serine/thr...  56.6    1e-05   
ref|XP_010055963.1|  PREDICTED: probable receptor-like serine/thr...  56.6    1e-05   
ref|XP_004147358.1|  PREDICTED: probable receptor-like serine/thr...  56.6    1e-05   
gb|KFK44259.1|  hypothetical protein AALP_AA1G235200                  56.2    1e-05   
ref|XP_010527069.1|  PREDICTED: probable L-type lectin-domain con...  56.2    2e-05   
ref|XP_011022896.1|  PREDICTED: probable leucine-rich repeat rece...  55.5    3e-05   
ref|XP_008805891.1|  PREDICTED: LOW QUALITY PROTEIN: cyclin-depen...  55.5    3e-05   
ref|XP_008460873.1|  PREDICTED: probable LRR receptor-like serine...  55.5    3e-05   
ref|XP_011091800.1|  PREDICTED: proline-rich receptor-like protei...  55.5    3e-05   
ref|XP_008367819.1|  PREDICTED: uncharacterized protein LOC103431442  54.7    5e-05   
ref|XP_004289287.1|  PREDICTED: putative proline-rich receptor-li...  54.7    5e-05   
ref|XP_010674424.1|  PREDICTED: probable receptor-like serine/thr...  54.3    7e-05   
ref|XP_010428799.1|  PREDICTED: probable receptor-like serine/thr...  54.3    8e-05   
ref|XP_004502962.1|  PREDICTED: proline-rich receptor-like protei...  53.9    8e-05   
ref|XP_010471913.1|  PREDICTED: probable receptor-like serine/thr...  53.9    9e-05   
ref|XP_007137781.1|  hypothetical protein PHAVU_009G155000g           53.5    1e-04   
ref|XP_006829313.1|  hypothetical protein AMTR_s00202p00019370        53.5    1e-04   
ref|XP_010911250.1|  PREDICTED: proline-rich receptor-like protei...  53.5    1e-04   
emb|CDX88355.1|  BnaC06g37990D                                        53.5    1e-04   
gb|EYU42966.1|  hypothetical protein MIMGU_mgv1a002423mg              53.1    1e-04   
ref|XP_009355844.1|  PREDICTED: tyrosine-protein kinase Lck-like      53.1    2e-04   
ref|XP_006416287.1|  hypothetical protein EUTSA_v10006893mg           52.8    2e-04   
gb|KHN09628.1|  Proline-rich receptor-like protein kinase PERK9       52.4    3e-04   
ref|XP_003526871.1|  PREDICTED: proline-rich receptor-like protei...  52.4    3e-04   
emb|CDX96585.1|  BnaA08g21280D                                        49.3    4e-04   
ref|XP_010905327.1|  PREDICTED: uncharacterized protein LOC105032560  52.0    4e-04   
gb|KCW54153.1|  hypothetical protein EUGRSUZ_I00126                   52.0    4e-04   
ref|XP_010027607.1|  PREDICTED: proline-rich receptor-like protei...  52.0    4e-04   
emb|CDY38812.1|  BnaC08g19860D                                        51.6    5e-04   
ref|XP_004981112.1|  PREDICTED: uncharacterized protein LOC101777140  50.8    0.001   



>ref|XP_011102142.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Sesamum indicum]
Length=764

 Score = 95.9 bits (237),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 74/86 (86%), Gaps = 5/86 (6%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSE-AKLR---NSMEGGETLDDDTYSQHSNIQSHLNLALL  477
            +VKLLQG+ E +KWARLQVN SE + +R   NS++G + LDD+T+SQ SN+QSHLNLALL
Sbjct  673  VVKLLQGDAEVVKWARLQVNASEGSNIRQEANSLDGADALDDETFSQ-SNLQSHLNLALL  731

Query  478  GveedsvsvssieQHISLEDYLRGRW  555
            GVEEDS+S+SSIEQ +SLEDYLRGRW
Sbjct  732  GVEEDSLSISSIEQSVSLEDYLRGRW  757



>ref|XP_006357335.1| PREDICTED: inactive leucine-rich repeat receptor-like serine/threonine-protein 
kinase At1g60630-like [Solanum tuberosum]
Length=769

 Score = 92.0 bits (227),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 72/86 (84%), Gaps = 5/86 (6%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSE---AKLR-NSMEGGETLDDDTYSQHSNIQSHLNLALL  477
            + KLL+G+ ET KWARLQVNGSE    KL  N MEG + L+DDT+S HSN++SHLNLALL
Sbjct  678  VSKLLKGDDETTKWARLQVNGSEGSDTKLPINGMEGADMLEDDTFS-HSNLRSHLNLALL  736

Query  478  GveedsvsvssieQHISLEDYLRGRW  555
            GVEEDS+S+SSIE ++SLEDYLRGRW
Sbjct  737  GVEEDSLSISSIEHNVSLEDYLRGRW  762



>ref|XP_004237363.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Solanum lycopersicum]
Length=769

 Score = 92.0 bits (227),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 72/86 (84%), Gaps = 5/86 (6%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSE---AKLR-NSMEGGETLDDDTYSQHSNIQSHLNLALL  477
            + KLL+G+ ET KWARLQVNGSE    KL  N MEG + L+DDT+S HSN++SHLNLALL
Sbjct  678  VSKLLKGDDETTKWARLQVNGSEGSDTKLPINGMEGADMLEDDTFS-HSNLRSHLNLALL  736

Query  478  GveedsvsvssieQHISLEDYLRGRW  555
            GVEEDS+S+SSIE ++SLEDYLRGRW
Sbjct  737  GVEEDSLSISSIEHNVSLEDYLRGRW  762



>ref|XP_009795415.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Nicotiana sylvestris]
Length=774

 Score = 90.5 bits (223),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 71/86 (83%), Gaps = 5/86 (6%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAK----LRNSMEGGETLDDDTYSQHSNIQSHLNLALL  477
            + KLL+G+ ET KWARLQVNGSE        N++EG + L+DDT+SQ SN++SHLNLALL
Sbjct  683  VSKLLKGDTETTKWARLQVNGSEGSDTRLPINAIEGADMLEDDTFSQ-SNLRSHLNLALL  741

Query  478  GveedsvsvssieQHISLEDYLRGRW  555
            GVEEDS+S+SSIE ++SLEDYLRGRW
Sbjct  742  GVEEDSLSLSSIEHNVSLEDYLRGRW  767



>emb|CDP11935.1| unnamed protein product [Coffea canephora]
Length=776

 Score = 89.7 bits (221),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 65/86 (76%), Gaps = 8/86 (9%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSE----AKLRNSMEGGETLDDDTYSQHSNIQSHLNLALL  477
            I+KLLQG++E   WARLQVNG E    AKL +S+EG + LDD+T+S HSN+QSHLNLA  
Sbjct  688  ILKLLQGDIEVTNWARLQVNGLEGTNTAKLVDSLEGSDALDDETFS-HSNLQSHLNLAFH  746

Query  478  GveedsvsvssieQHISLEDYLRGRW  555
            G      S+SSIEQ ISLEDYLRGRW
Sbjct  747  G---VEDSLSSIEQTISLEDYLRGRW  769



>ref|XP_009588636.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Nicotiana tomentosiformis]
Length=772

 Score = 86.7 bits (213),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 72/86 (84%), Gaps = 5/86 (6%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNG---SEAKLR-NSMEGGETLDDDTYSQHSNIQSHLNLALL  477
            + KLL+G+ ET  WARLQVNG   S+ +L  N++EG + L+DDT+SQ SN++SHLNLALL
Sbjct  681  VSKLLKGDAETTNWARLQVNGLEGSDTRLPINAIEGADMLEDDTFSQ-SNLRSHLNLALL  739

Query  478  GveedsvsvssieQHISLEDYLRGRW  555
            GVEEDS+S+SSIE ++SLEDYLRGRW
Sbjct  740  GVEEDSLSLSSIEHNVSLEDYLRGRW  765



>gb|KHG01419.1| Putative proline-rich receptor-like protein kinase PERK11 [Gossypium 
arboreum]
Length=772

 Score = 80.5 bits (197),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 62/82 (76%), Gaps = 8/82 (10%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            +VKLLQG+ +  KWARLQVN SE        G +TLDD+     SN+QSHL+LALL VEE
Sbjct  692  VVKLLQGDADVTKWARLQVNASE--------GSDTLDDEACPGRSNLQSHLSLALLDVEE  743

Query  490  dsvsvssieQHISLEDYLRGRW  555
            DSVS+SSIEQ +SLEDYL+GRW
Sbjct  744  DSVSMSSIEQPVSLEDYLKGRW  765



>ref|XP_010664160.1| PREDICTED: LOW QUALITY PROTEIN: probable receptor-like serine/threonine-protein 
kinase At5g57670 [Vitis vinifera]
Length=754

 Score = 79.3 bits (194),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 63/82 (77%), Gaps = 9/82 (11%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            ++KLLQG+ E  KWARLQVN        + EG +T DD+ +  HSN+QSHLNLALL VEE
Sbjct  675  VLKLLQGDAEATKWARLQVN--------ACEGSDTPDDEAFP-HSNLQSHLNLALLDVEE  725

Query  490  dsvsvssieQHISLEDYLRGRW  555
            DS+S+SSIEQ +SLEDYL+GRW
Sbjct  726  DSLSMSSIEQSVSLEDYLQGRW  747



>emb|CBI18962.3| unnamed protein product [Vitis vinifera]
Length=732

 Score = 79.0 bits (193),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 63/82 (77%), Gaps = 9/82 (11%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            ++KLLQG+ E  KWARLQVN        + EG +T DD+ +  HSN+QSHLNLALL VEE
Sbjct  653  VLKLLQGDAEATKWARLQVN--------ACEGSDTPDDEAFP-HSNLQSHLNLALLDVEE  703

Query  490  dsvsvssieQHISLEDYLRGRW  555
            DS+S+SSIEQ +SLEDYL+GRW
Sbjct  704  DSLSMSSIEQSVSLEDYLQGRW  725



>gb|EYU32494.1| hypothetical protein MIMGU_mgv1a001977mg [Erythranthe guttata]
Length=731

 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 66/82 (80%), Gaps = 4/82 (5%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            ++KLL+G+ E +KWARLQVN S        EG + +D++ +S+ SN+QSHLNLALLGV+E
Sbjct  647  VLKLLEGDEEVVKWARLQVNASHEVCE---EGIDAIDEEIFSK-SNLQSHLNLALLGVDE  702

Query  490  dsvsvssieQHISLEDYLRGRW  555
            DS+SVSSIEQ +SLEDYLRGRW
Sbjct  703  DSLSVSSIEQSVSLEDYLRGRW  724



>ref|XP_010087185.1| Proline-rich receptor-like protein kinase PERK1 [Morus notabilis]
 gb|EXB28442.1| Proline-rich receptor-like protein kinase PERK1 [Morus notabilis]
Length=718

 Score = 74.3 bits (181),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 62/82 (76%), Gaps = 8/82 (10%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            +VKLLQG+ E +KWARLQ+N        S++  + +DD+     SN+QSHLNLALL VE+
Sbjct  638  VVKLLQGDPEVIKWARLQMN--------SVKEADIVDDEAGCPRSNLQSHLNLALLDVED  689

Query  490  dsvsvssieQHISLEDYLRGRW  555
            DS+S+SSIEQ +SLEDYL+GRW
Sbjct  690  DSLSMSSIEQSVSLEDYLQGRW  711



>gb|KEH35354.1| adenine nucleotide alpha hydrolase-like domain kinase [Medicago 
truncatula]
Length=754

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 61/82 (74%), Gaps = 9/82 (11%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            + KLLQG+++ +KWARL+VN        ++E  E LDD+     SNIQSHLNLALL V++
Sbjct  675  VSKLLQGDIDAIKWARLEVN--------ALEAHEMLDDEV-CPPSNIQSHLNLALLDVDD  725

Query  490  dsvsvssieQHISLEDYLRGRW  555
            DS+S+ S+EQ +SLEDYLRGRW
Sbjct  726  DSLSMYSVEQSVSLEDYLRGRW  747



>ref|XP_004290918.1| PREDICTED: uncharacterized protein LOC101296735 [Fragaria vesca 
subsp. vesca]
Length=744

 Score = 72.8 bits (177),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 63/82 (77%), Gaps = 9/82 (11%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            +VKLLQG+VE +KWARLQV+        + E  + LDD+   + SN+QSHLNLALL VE+
Sbjct  665  VVKLLQGDVEMIKWARLQVH--------AWEESDILDDEACPR-SNLQSHLNLALLDVED  715

Query  490  dsvsvssieQHISLEDYLRGRW  555
            DS+S+SSIEQ +SLEDYLRGRW
Sbjct  716  DSLSMSSIEQTVSLEDYLRGRW  737



>ref|XP_007137480.1| hypothetical protein PHAVU_009G130300g [Phaseolus vulgaris]
 gb|ESW09474.1| hypothetical protein PHAVU_009G130300g [Phaseolus vulgaris]
Length=753

 Score = 72.4 bits (176),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 61/81 (75%), Gaps = 7/81 (9%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            I+KLLQG+ ETMKWARL+VN       N+++  ET+DD+     +N+QSH+N+AL  V +
Sbjct  672  ILKLLQGDTETMKWARLEVN-------NALDAAETVDDEACPPSNNLQSHINVALGDVVD  724

Query  490  dsvsvssieQHISLEDYLRGR  552
            DSVS+ S+EQ ++LE+YLRGR
Sbjct  725  DSVSMCSVEQGLTLEEYLRGR  745



>gb|KHN44298.1| Putative receptor-like serine/threonine-protein kinase [Glycine 
soja]
Length=724

 Score = 72.0 bits (175),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 60/82 (73%), Gaps = 9/82 (11%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            I KLLQG+ E +KWARLQVN        +++  E LDD+     SN+QSH+NLALL VE+
Sbjct  645  ISKLLQGDAEAIKWARLQVN--------ALDAPEMLDDEACPP-SNLQSHINLALLDVED  695

Query  490  dsvsvssieQHISLEDYLRGRW  555
            DS+S+ S+EQ ++LEDYLRGRW
Sbjct  696  DSLSMCSVEQGLTLEDYLRGRW  717



>ref|XP_006472861.1| PREDICTED: probable L-type lectin-domain containing receptor 
kinase II.1-like [Citrus sinensis]
Length=770

 Score = 71.6 bits (174),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 61/82 (74%), Gaps = 9/82 (11%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            ++KLL+G+ +  KWARLQVN SE          E LDD++  + SN+QSHLNLALL VE+
Sbjct  691  VLKLLRGDADVTKWARLQVNASEE--------SEMLDDESCPR-SNLQSHLNLALLDVED  741

Query  490  dsvsvssieQHISLEDYLRGRW  555
            DS S+SSIEQ +SLEDYL+GRW
Sbjct  742  DSFSMSSIEQSVSLEDYLQGRW  763



>ref|XP_009349910.1| PREDICTED: LOW QUALITY PROTEIN: probable receptor-like serine/threonine-protein 
kinase At5g57670 [Pyrus x bretschneideri]
Length=764

 Score = 71.6 bits (174),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 63/82 (77%), Gaps = 9/82 (11%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            IVKLLQG+ +  KWARLQV+        ++E  + L+++T   HSN+QSHLNLALL VE+
Sbjct  685  IVKLLQGDADVTKWARLQVH--------AVEESDVLENET-CPHSNLQSHLNLALLDVED  735

Query  490  dsvsvssieQHISLEDYLRGRW  555
            DS+S+SSIEQ +SLEDYL+GRW
Sbjct  736  DSLSMSSIEQTVSLEDYLKGRW  757



>ref|XP_009362341.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Pyrus x bretschneideri]
 ref|XP_009362344.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Pyrus x bretschneideri]
Length=759

 Score = 71.6 bits (174),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 63/82 (77%), Gaps = 9/82 (11%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            IVKLLQG+ +  KWARLQV+        ++E  + L+++T   HSN+QSHLNLALL VE+
Sbjct  680  IVKLLQGDADVTKWARLQVH--------AVEESDVLENET-CPHSNLQSHLNLALLDVED  730

Query  490  dsvsvssieQHISLEDYLRGRW  555
            DS+S+SSIEQ +SLEDYL+GRW
Sbjct  731  DSLSMSSIEQTVSLEDYLKGRW  752



>gb|KHN46982.1| Putative receptor-like serine/threonine-protein kinase [Glycine 
soja]
Length=724

 Score = 71.2 bits (173),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/82 (55%), Positives = 59/82 (72%), Gaps = 9/82 (11%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            I KLLQG+ E +KWARLQVN        +++  E LDD+     SN+QSH+NLALL VE+
Sbjct  645  ISKLLQGDAEAIKWARLQVN--------ALDPPEMLDDEA-CPPSNLQSHINLALLDVED  695

Query  490  dsvsvssieQHISLEDYLRGRW  555
            D +S+ S+EQ ++LEDYLRGRW
Sbjct  696  DLLSMCSVEQGLTLEDYLRGRW  717



>ref|NP_001238713.1| protein kinase family protein [Glycine max]
 gb|ACM89509.1| protein kinase family protein [Glycine max]
Length=649

 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 60/82 (73%), Gaps = 9/82 (11%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            I KLL G+ + +KWARL+VN        ++E  E LDD+     SN+QSHLNLALL VE+
Sbjct  570  ISKLLGGDPDVIKWARLEVN--------ALEAPEMLDDEA-CPPSNLQSHLNLALLDVED  620

Query  490  dsvsvssieQHISLEDYLRGRW  555
            DS+S+ S+EQ++SLEDYLRGRW
Sbjct  621  DSLSMCSVEQNVSLEDYLRGRW  642



>ref|XP_003526656.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670-like [Glycine max]
Length=743

 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/82 (55%), Positives = 59/82 (72%), Gaps = 9/82 (11%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            I KLLQG+ E +KWARLQVN        +++  E LDD+     SN+QSH+NLALL VE+
Sbjct  664  ISKLLQGDAEAIKWARLQVN--------ALDPPEMLDDEA-CPPSNLQSHINLALLDVED  714

Query  490  dsvsvssieQHISLEDYLRGRW  555
            D +S+ S+EQ ++LEDYLRGRW
Sbjct  715  DLLSMCSVEQGLTLEDYLRGRW  736



>gb|KDP32865.1| hypothetical protein JCGZ_12157 [Jatropha curcas]
Length=751

 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 60/81 (74%), Gaps = 9/81 (11%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            ++KLLQG+ E MKWARLQVN +E          E LDDD   + SN++SHLNLALL VE+
Sbjct  672  VLKLLQGDTEVMKWARLQVNTAEEP--------EMLDDDVCPR-SNLRSHLNLALLDVED  722

Query  490  dsvsvssieQHISLEDYLRGR  552
            DS+S+SS EQ +SLEDYL+GR
Sbjct  723  DSLSLSSNEQTVSLEDYLQGR  743



>ref|XP_006595490.1| PREDICTED: protein kinase family protein isoform X1 [Glycine 
max]
Length=735

 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 60/82 (73%), Gaps = 9/82 (11%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            I KLL G+ + +KWARL+VN        ++E  E LDD+     SN+QSHLNLALL VE+
Sbjct  656  ISKLLGGDPDVIKWARLEVN--------ALEAPEMLDDEA-CPPSNLQSHLNLALLDVED  706

Query  490  dsvsvssieQHISLEDYLRGRW  555
            DS+S+ S+EQ++SLEDYLRGRW
Sbjct  707  DSLSMCSVEQNVSLEDYLRGRW  728



>gb|KHN38974.1| Receptor-like cytosolic serine/threonine-protein kinase RBK2 
[Glycine soja]
Length=733

 Score = 70.9 bits (172),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 60/82 (73%), Gaps = 9/82 (11%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            I KLL G+ + +KWARL+VN        ++E  E LDD+     SN+QSHLNLALL VE+
Sbjct  654  ISKLLGGDPDVIKWARLEVN--------ALEAPEMLDDEA-CPPSNLQSHLNLALLDVED  704

Query  490  dsvsvssieQHISLEDYLRGRW  555
            DS+S+ S+EQ++SLEDYLRGRW
Sbjct  705  DSLSMCSVEQNVSLEDYLRGRW  726



>ref|XP_007225237.1| hypothetical protein PRUPE_ppa001811mg [Prunus persica]
 gb|EMJ26436.1| hypothetical protein PRUPE_ppa001811mg [Prunus persica]
Length=761

 Score = 70.5 bits (171),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 63/82 (77%), Gaps = 9/82 (11%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            IVKLLQG+ + +KWARLQV+        ++E  + L+D+   + SN+QSHLNLALL VE+
Sbjct  682  IVKLLQGDADAIKWARLQVH--------ALEESDVLEDEACPR-SNLQSHLNLALLDVED  732

Query  490  dsvsvssieQHISLEDYLRGRW  555
            DS+S+SSIEQ +SLEDYL+GRW
Sbjct  733  DSLSMSSIEQSVSLEDYLKGRW  754



>ref|XP_006434294.1| hypothetical protein CICLE_v10000358mg [Citrus clementina]
 gb|ESR47534.1| hypothetical protein CICLE_v10000358mg [Citrus clementina]
Length=611

 Score = 70.5 bits (171),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 60/82 (73%), Gaps = 9/82 (11%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            ++KLL+G+ +  KWARLQVN SE          E LDD++  + SN+QSHLNLALL VE+
Sbjct  532  VLKLLRGDADVTKWARLQVNASEE--------SEMLDDESCPR-SNLQSHLNLALLDVED  582

Query  490  dsvsvssieQHISLEDYLRGRW  555
            DS S+SSIEQ +SLEDYL GRW
Sbjct  583  DSFSMSSIEQSVSLEDYLLGRW  604



>gb|KDO80469.1| hypothetical protein CISIN_1g004174mg [Citrus sinensis]
Length=766

 Score = 70.5 bits (171),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 60/82 (73%), Gaps = 9/82 (11%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            ++KLL+G+ +  KWARLQVN SE          E LDD++  + SN+QSHLNLALL VE+
Sbjct  687  VLKLLRGDADVTKWARLQVNASEE--------SEMLDDESCPR-SNLQSHLNLALLDVED  737

Query  490  dsvsvssieQHISLEDYLRGRW  555
            DS S+SSIEQ +SLEDYL GRW
Sbjct  738  DSFSMSSIEQSVSLEDYLLGRW  759



>gb|KDO80470.1| hypothetical protein CISIN_1g004174mg [Citrus sinensis]
Length=770

 Score = 70.5 bits (171),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 60/82 (73%), Gaps = 9/82 (11%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            ++KLL+G+ +  KWARLQVN SE          E LDD++  + SN+QSHLNLALL VE+
Sbjct  691  VLKLLRGDADVTKWARLQVNASEE--------SEMLDDESCPR-SNLQSHLNLALLDVED  741

Query  490  dsvsvssieQHISLEDYLRGRW  555
            DS S+SSIEQ +SLEDYL GRW
Sbjct  742  DSFSMSSIEQSVSLEDYLLGRW  763



>ref|XP_009354013.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Pyrus x bretschneideri]
Length=759

 Score = 70.5 bits (171),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 63/82 (77%), Gaps = 9/82 (11%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            IVKLLQG+ +  KW+RLQV+        +ME  E L+++T  + SN+QSHLNLALL VE+
Sbjct  680  IVKLLQGDADVTKWSRLQVH--------AMEESEVLENETCPR-SNLQSHLNLALLDVED  730

Query  490  dsvsvssieQHISLEDYLRGRW  555
            DS+S+SSIEQ +SLEDYL+GRW
Sbjct  731  DSLSMSSIEQTVSLEDYLKGRW  752



>ref|XP_008219572.1| PREDICTED: interleukin-1 receptor-associated kinase-like 2 [Prunus 
mume]
Length=761

 Score = 70.5 bits (171),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 63/82 (77%), Gaps = 9/82 (11%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            IVKLLQG+ + +KWARLQV+        ++E  + L+D+   + SN+QSHLNLALL VE+
Sbjct  682  IVKLLQGDADAIKWARLQVH--------ALEESDVLEDEACPR-SNLQSHLNLALLDVED  732

Query  490  dsvsvssieQHISLEDYLRGRW  555
            DS+S+SSIEQ +SLEDYL+GRW
Sbjct  733  DSLSMSSIEQSVSLEDYLKGRW  754



>ref|XP_006434295.1| hypothetical protein CICLE_v10000358mg [Citrus clementina]
 gb|ESR47535.1| hypothetical protein CICLE_v10000358mg [Citrus clementina]
Length=770

 Score = 70.5 bits (171),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 60/82 (73%), Gaps = 9/82 (11%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            ++KLL+G+ +  KWARLQVN SE          E LDD++  + SN+QSHLNLALL VE+
Sbjct  691  VLKLLRGDADVTKWARLQVNASEE--------SEMLDDESCPR-SNLQSHLNLALLDVED  741

Query  490  dsvsvssieQHISLEDYLRGRW  555
            DS S+SSIEQ +SLEDYL GRW
Sbjct  742  DSFSMSSIEQSVSLEDYLLGRW  763



>gb|KDO80471.1| hypothetical protein CISIN_1g004174mg [Citrus sinensis]
Length=611

 Score = 70.1 bits (170),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 60/82 (73%), Gaps = 9/82 (11%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            ++KLL+G+ +  KWARLQVN SE          E LDD++  + SN+QSHLNLALL VE+
Sbjct  532  VLKLLRGDADVTKWARLQVNASEE--------SEMLDDESCPR-SNLQSHLNLALLDVED  582

Query  490  dsvsvssieQHISLEDYLRGRW  555
            DS S+SSIEQ +SLEDYL GRW
Sbjct  583  DSFSMSSIEQSVSLEDYLLGRW  604



>gb|KDO80468.1| hypothetical protein CISIN_1g004174mg [Citrus sinensis]
Length=696

 Score = 70.1 bits (170),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 60/82 (73%), Gaps = 9/82 (11%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            ++KLL+G+ +  KWARLQVN SE          E LDD++  + SN+QSHLNLALL VE+
Sbjct  617  VLKLLRGDADVTKWARLQVNASEE--------SEMLDDESCPR-SNLQSHLNLALLDVED  667

Query  490  dsvsvssieQHISLEDYLRGRW  555
            DS S+SSIEQ +SLEDYL GRW
Sbjct  668  DSFSMSSIEQSVSLEDYLLGRW  689



>ref|XP_009355832.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Pyrus x bretschneideri]
Length=761

 Score = 70.5 bits (171),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 63/82 (77%), Gaps = 9/82 (11%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            IVKLLQG+ +  KW+RLQV+        +ME  E L+++T  + SN+QSHLNLALL VE+
Sbjct  682  IVKLLQGDADVTKWSRLQVH--------AMEESEVLENETCPR-SNLQSHLNLALLDVED  732

Query  490  dsvsvssieQHISLEDYLRGRW  555
            DS+S+SSIEQ +SLEDYL+GRW
Sbjct  733  DSLSMSSIEQTVSLEDYLKGRW  754



>ref|XP_008394166.1| PREDICTED: interleukin-1 receptor-associated kinase-like 2 [Malus 
domestica]
Length=759

 Score = 68.9 bits (167),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 63/82 (77%), Gaps = 9/82 (11%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            IVKLLQG+ +  KW+RLQV+        +ME  + L+++T  + SN+QSHLNLALL VE+
Sbjct  680  IVKLLQGDADVTKWSRLQVH--------AMEESDVLENETCPR-SNLQSHLNLALLDVED  730

Query  490  dsvsvssieQHISLEDYLRGRW  555
            DS+S+SSIEQ +SLEDYL+GRW
Sbjct  731  DSLSMSSIEQTVSLEDYLKGRW  752



>ref|XP_010678918.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Beta vulgaris subsp. vulgaris]
Length=752

 Score = 67.8 bits (164),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 63/82 (77%), Gaps = 9/82 (11%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            I+KLLQG  +T+KWARLQVN        ++E  + LD+D   +  ++QSHL+LALL VE+
Sbjct  673  ILKLLQGNPDTVKWARLQVN--------ALENIDRLDEDGLPR-IDLQSHLSLALLDVED  723

Query  490  dsvsvssieQHISLEDYLRGRW  555
            DS+S+SSIEQH+SLE+YLRGRW
Sbjct  724  DSLSMSSIEQHVSLEEYLRGRW  745



>ref|XP_010269084.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Nelumbo nucifera]
Length=765

 Score = 67.4 bits (163),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 59/84 (70%), Gaps = 13/84 (15%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGE--TLDDDTYSQHSNIQSHLNLALLGv  483
            ++KLLQG+ E  KWAR+QVN S          GE   LDD+      NIQSHLN+ALL V
Sbjct  686  VLKLLQGDAEVTKWARMQVNAS----------GEFDALDDEAIPP-PNIQSHLNVALLDV  734

Query  484  eedsvsvssieQHISLEDYLRGRW  555
            E+DS+SVSSIEQ +SLEDYL+GRW
Sbjct  735  EDDSLSVSSIEQSVSLEDYLQGRW  758



>ref|XP_007019225.1| Kinase protein with adenine nucleotide alpha hydrolases-like 
domain [Theobroma cacao]
 gb|EOY16450.1| Kinase protein with adenine nucleotide alpha hydrolases-like 
domain [Theobroma cacao]
Length=771

 Score = 67.0 bits (162),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 58/80 (73%), Gaps = 9/80 (11%)
 Frame = +1

Query  316  KLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGveeds  495
            KLLQG+ +  KWARLQVN SE        G + LD +   + SN+QSHL+LALL VE+DS
Sbjct  694  KLLQGDADVTKWARLQVNASE--------GSDALDGEACPR-SNLQSHLSLALLDVEDDS  744

Query  496  vsvssieQHISLEDYLRGRW  555
            +SVSSIEQ +SLEDYL GRW
Sbjct  745  LSVSSIEQSVSLEDYLNGRW  764



>ref|XP_003522567.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670-like isoform X1 [Glycine max]
 ref|XP_006578953.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670-like isoform X2 [Glycine max]
Length=750

 Score = 67.0 bits (162),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 45/82 (55%), Positives = 59/82 (72%), Gaps = 9/82 (11%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            I KLLQG+ E +K ARLQVN        +++  E LDD+     SN+QSH+NLALL VE+
Sbjct  671  ISKLLQGDAEAIKRARLQVN--------ALDAPEMLDDEACPP-SNLQSHINLALLDVED  721

Query  490  dsvsvssieQHISLEDYLRGRW  555
            DS+S+ S+EQ ++LEDYLRGRW
Sbjct  722  DSLSMCSVEQGLTLEDYLRGRW  743



>ref|XP_003542041.1| PREDICTED: uncharacterized protein LOC100797280 [Glycine max]
Length=736

 Score = 66.2 bits (160),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 58/82 (71%), Gaps = 9/82 (11%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            I KLL G+ + +KWARL+ N        ++E  E LD +     SN+QSHLNLALL VE+
Sbjct  657  ISKLLGGDPDVIKWARLEAN--------ALEAPEMLDGEA-CPPSNLQSHLNLALLDVED  707

Query  490  dsvsvssieQHISLEDYLRGRW  555
            DS+S+ S+EQ++SLEDYLRGRW
Sbjct  708  DSLSMCSVEQNVSLEDYLRGRW  729



>gb|KHN05157.1| Receptor-like cytosolic serine/threonine-protein kinase RBK2 
[Glycine soja]
Length=711

 Score = 66.2 bits (160),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 58/82 (71%), Gaps = 9/82 (11%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            I KLL G+ + +KWARL+ N        ++E  E LD +     SN+QSHLNLALL VE+
Sbjct  632  ISKLLGGDPDVIKWARLEAN--------ALEAPEMLDGEA-CPPSNLQSHLNLALLDVED  682

Query  490  dsvsvssieQHISLEDYLRGRW  555
            DS+S+ S+EQ++SLEDYLRGRW
Sbjct  683  DSLSMCSVEQNVSLEDYLRGRW  704



>ref|XP_002520305.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF42091.1| ATP binding protein, putative [Ricinus communis]
Length=758

 Score = 66.2 bits (160),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 59/81 (73%), Gaps = 9/81 (11%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            ++KLL G+ E  KWARLQVN         +E  + LDD+T  + SNIQSHLNLA L VE+
Sbjct  679  VLKLLHGDAEVTKWARLQVN--------KVEESDMLDDETCPR-SNIQSHLNLAFLDVED  729

Query  490  dsvsvssieQHISLEDYLRGR  552
            DS+S+SSIEQ +SLEDYL+GR
Sbjct  730  DSLSISSIEQTVSLEDYLQGR  750



>ref|XP_004502543.1| PREDICTED: uncharacterized protein LOC101504509 [Cicer arietinum]
Length=731

 Score = 65.5 bits (158),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 57/78 (73%), Gaps = 9/78 (12%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            + KLLQG+ + +KWARLQVN  EA+        E LD++  S HSN+QSH+NLALL VE+
Sbjct  651  VSKLLQGDTDAIKWARLQVNALEAR--------EMLDNEA-SPHSNLQSHINLALLDVED  701

Query  490  dsvsvssieQHISLEDYL  543
            DS+S+ S+ Q +SLEDYL
Sbjct  702  DSLSMCSVMQSVSLEDYL  719



>ref|XP_010270301.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Nelumbo nucifera]
Length=775

 Score = 65.5 bits (158),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 45/82 (55%), Positives = 58/82 (71%), Gaps = 9/82 (11%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            ++KLLQG+ E  KWAR+QV+ SE          +TLDD+      NIQSHLN+ALL VE+
Sbjct  696  VLKLLQGDAEISKWARMQVDASEQ--------FDTLDDEAVPP-PNIQSHLNVALLDVED  746

Query  490  dsvsvssieQHISLEDYLRGRW  555
            DS+S+SS EQ + LEDYL+GRW
Sbjct  747  DSLSISSSEQSVPLEDYLQGRW  768



>gb|KEH40498.1| adenine nucleotide alpha hydrolase-like domain kinase [Medicago 
truncatula]
Length=701

 Score = 63.9 bits (154),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 60/82 (73%), Gaps = 9/82 (11%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            I K+L+G+   +KWA+L++N        +++  E LD++     S+IQSHLNLALL V++
Sbjct  622  ISKVLKGDAVVIKWAKLEIN--------ALKASELLDEEA-CPPSDIQSHLNLALLDVDD  672

Query  490  dsvsvssieQHISLEDYLRGRW  555
            D++S+ S+EQ++SLEDYLRGRW
Sbjct  673  DTLSMFSVEQNVSLEDYLRGRW  694



>ref|XP_011016100.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Populus euphratica]
Length=758

 Score = 63.9 bits (154),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 60/82 (73%), Gaps = 9/82 (11%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            +VKLLQG+ E  +WARLQVN        ++E  + LDD+   + SN+QSHLNLALL VE 
Sbjct  679  VVKLLQGDAEVTRWARLQVN--------AVEESDVLDDEACPR-SNLQSHLNLALLDVEN  729

Query  490  dsvsvssieQHISLEDYLRGRW  555
            DS+S SS+EQ ISLEDYL+GRW
Sbjct  730  DSLSSSSLEQSISLEDYLQGRW  751



>gb|KGN47686.1| hypothetical protein Csa_6G376270 [Cucumis sativus]
Length=722

 Score = 63.9 bits (154),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 59/82 (72%), Gaps = 9/82 (11%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            ++KLLQG+ +  KWAR Q+N        ++    TLDD+   + S+IQSHLNLALL V++
Sbjct  643  VLKLLQGDADVTKWARQQIN--------ALGDSNTLDDEVCPR-SDIQSHLNLALLDVDD  693

Query  490  dsvsvssieQHISLEDYLRGRW  555
            DS+S+SSIE  ISLEDYL+GRW
Sbjct  694  DSLSLSSIEHSISLEDYLQGRW  715



>ref|XP_004168581.1| PREDICTED: uncharacterized LOC101203034 [Cucumis sativus]
Length=756

 Score = 63.5 bits (153),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 59/82 (72%), Gaps = 9/82 (11%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            ++KLLQG+ +  KWAR Q+N        ++    TLDD+   + S+IQSHLNLALL V++
Sbjct  677  VLKLLQGDADVTKWARQQIN--------ALGDSNTLDDEVCPR-SDIQSHLNLALLDVDD  727

Query  490  dsvsvssieQHISLEDYLRGRW  555
            DS+S+SSIE  ISLEDYL+GRW
Sbjct  728  DSLSLSSIEHSISLEDYLQGRW  749



>ref|XP_004149436.1| PREDICTED: uncharacterized protein LOC101203034 [Cucumis sativus]
Length=756

 Score = 63.5 bits (153),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 59/82 (72%), Gaps = 9/82 (11%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            ++KLLQG+ +  KWAR Q+N        ++    TLDD+   + S+IQSHLNLALL V++
Sbjct  677  VLKLLQGDADVTKWARQQIN--------ALGDSNTLDDEVCPR-SDIQSHLNLALLDVDD  727

Query  490  dsvsvssieQHISLEDYLRGRW  555
            DS+S+SSIE  ISLEDYL+GRW
Sbjct  728  DSLSLSSIEHSISLEDYLQGRW  749



>ref|XP_008441611.1| PREDICTED: uncharacterized protein LOC103485693 [Cucumis melo]
Length=756

 Score = 63.5 bits (153),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 59/82 (72%), Gaps = 9/82 (11%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            ++KLLQG+ +  KWAR Q+N        ++    TLDD+   + S+IQSHLNLALL V++
Sbjct  677  VLKLLQGDADVTKWARQQIN--------ALGDSNTLDDEVCPR-SDIQSHLNLALLDVDD  727

Query  490  dsvsvssieQHISLEDYLRGRW  555
            DS+S+SSIE  ISLEDYL+GRW
Sbjct  728  DSLSLSSIEHSISLEDYLQGRW  749



>ref|XP_002306655.2| kinase family protein [Populus trichocarpa]
 gb|EEE93651.2| kinase family protein [Populus trichocarpa]
Length=707

 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 60/82 (73%), Gaps = 9/82 (11%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            +VKLLQG+ E  +WARLQVN        ++E  + LDD+   + SN+QSHLNLALL VE 
Sbjct  628  VVKLLQGDAEVTRWARLQVN--------AVEESDVLDDEACPR-SNLQSHLNLALLDVEN  678

Query  490  dsvsvssieQHISLEDYLRGRW  555
            DS+S SS+EQ ISL+DYL+GRW
Sbjct  679  DSLSSSSLEQSISLQDYLQGRW  700



>ref|XP_011011405.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g53590 isoform X4 [Populus euphratica]
Length=713

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 57/82 (70%), Gaps = 10/82 (12%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            ++KLLQG+ E   WAR QV  SE          + +D +T+   SNIQSHLNLALL +E+
Sbjct  635  VLKLLQGDEEVKNWARHQVCASEEH--------DAMDGETFP--SNIQSHLNLALLDLED  684

Query  490  dsvsvssieQHISLEDYLRGRW  555
            DS+S+SS EQ +S+EDYL+GRW
Sbjct  685  DSLSISSTEQGVSIEDYLQGRW  706



>ref|XP_007161426.1| hypothetical protein PHAVU_001G067700g [Phaseolus vulgaris]
 gb|ESW33420.1| hypothetical protein PHAVU_001G067700g [Phaseolus vulgaris]
Length=742

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 58/82 (71%), Gaps = 9/82 (11%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            I KLL G+ E +  AR++V+        +ME  E LDD+  S  SN+QSHLNLAL  VE+
Sbjct  663  ISKLLGGDSEVVNRARVEVH--------AMEAAEMLDDEACSP-SNLQSHLNLALRDVED  713

Query  490  dsvsvssieQHISLEDYLRGRW  555
            DS+S+ S+EQ++SLEDYLRGRW
Sbjct  714  DSLSICSVEQNVSLEDYLRGRW  735



>ref|XP_011031142.1| PREDICTED: probable LIM domain-containing serine/threonine-protein 
kinase DDB_G0287001 isoform X4 [Populus euphratica]
Length=713

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 57/82 (70%), Gaps = 10/82 (12%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            ++KLLQG+ E   WAR QV  SE          + +D +T+   SNIQSHLNLALL +E+
Sbjct  635  VLKLLQGDEEVKNWARHQVCASEEH--------DAMDGETFP--SNIQSHLNLALLDLED  684

Query  490  dsvsvssieQHISLEDYLRGRW  555
            DS+S+SS EQ +S+EDYL+GRW
Sbjct  685  DSLSISSTEQGVSIEDYLQGRW  706



>ref|XP_011031141.1| PREDICTED: probable LIM domain-containing serine/threonine-protein 
kinase DDB_G0287001 isoform X3 [Populus euphratica]
Length=714

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 57/82 (70%), Gaps = 10/82 (12%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            ++KLLQG+ E   WAR QV  SE          + +D +T+   SNIQSHLNLALL +E+
Sbjct  636  VLKLLQGDEEVKNWARHQVCASEEH--------DAMDGETFP--SNIQSHLNLALLDLED  685

Query  490  dsvsvssieQHISLEDYLRGRW  555
            DS+S+SS EQ +S+EDYL+GRW
Sbjct  686  DSLSISSTEQGVSIEDYLQGRW  707



>ref|XP_011011403.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g53590 isoform X2 [Populus euphratica]
Length=718

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 57/82 (70%), Gaps = 10/82 (12%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            ++KLLQG+ E   WAR QV  SE          + +D +T+   SNIQSHLNLALL +E+
Sbjct  640  VLKLLQGDEEVKNWARHQVCASEEH--------DAMDGETFP--SNIQSHLNLALLDLED  689

Query  490  dsvsvssieQHISLEDYLRGRW  555
            DS+S+SS EQ +S+EDYL+GRW
Sbjct  690  DSLSISSTEQGVSIEDYLQGRW  711



>ref|XP_011011404.1| PREDICTED: probable LIM domain-containing serine/threonine-protein 
kinase DDB_G0287001 isoform X3 [Populus euphratica]
Length=714

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 57/82 (70%), Gaps = 10/82 (12%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            ++KLLQG+ E   WAR QV  SE          + +D +T+   SNIQSHLNLALL +E+
Sbjct  636  VLKLLQGDEEVKNWARHQVCASEEH--------DAMDGETFP--SNIQSHLNLALLDLED  685

Query  490  dsvsvssieQHISLEDYLRGRW  555
            DS+S+SS EQ +S+EDYL+GRW
Sbjct  686  DSLSISSTEQGVSIEDYLQGRW  707



>ref|XP_011031140.1| PREDICTED: probable LIM domain-containing serine/threonine-protein 
kinase DDB_G0287001 isoform X2 [Populus euphratica]
Length=718

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 57/82 (70%), Gaps = 10/82 (12%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            ++KLLQG+ E   WAR QV  SE          + +D +T+   SNIQSHLNLALL +E+
Sbjct  640  VLKLLQGDEEVKNWARHQVCASEEH--------DAMDGETFP--SNIQSHLNLALLDLED  689

Query  490  dsvsvssieQHISLEDYLRGRW  555
            DS+S+SS EQ +S+EDYL+GRW
Sbjct  690  DSLSISSTEQGVSIEDYLQGRW  711



>ref|XP_011031139.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430 isoform X1 [Populus euphratica]
Length=720

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 57/82 (70%), Gaps = 10/82 (12%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            ++KLLQG+ E   WAR QV  SE          + +D +T+   SNIQSHLNLALL +E+
Sbjct  642  VLKLLQGDEEVKNWARHQVCASEEH--------DAMDGETFP--SNIQSHLNLALLDLED  691

Query  490  dsvsvssieQHISLEDYLRGRW  555
            DS+S+SS EQ +S+EDYL+GRW
Sbjct  692  DSLSISSTEQGVSIEDYLQGRW  713



>ref|XP_011011402.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g53590 isoform X1 [Populus euphratica]
Length=720

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 57/82 (70%), Gaps = 10/82 (12%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            ++KLLQG+ E   WAR QV  SE          + +D +T+   SNIQSHLNLALL +E+
Sbjct  642  VLKLLQGDEEVKNWARHQVCASEEH--------DAMDGETFP--SNIQSHLNLALLDLED  691

Query  490  dsvsvssieQHISLEDYLRGRW  555
            DS+S+SS EQ +S+EDYL+GRW
Sbjct  692  DSLSISSTEQGVSIEDYLQGRW  713



>ref|XP_002307046.2| hypothetical protein POPTR_0005s06800g [Populus trichocarpa]
 gb|EEE94042.2| hypothetical protein POPTR_0005s06800g [Populus trichocarpa]
Length=720

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 57/82 (70%), Gaps = 10/82 (12%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            ++KLLQG+ E   WAR QV  SE          + +D +T+   SNIQSHLNLALL +E+
Sbjct  642  VLKLLQGDEEVKNWARHQVCASEEH--------DAMDGETFP--SNIQSHLNLALLDLED  691

Query  490  dsvsvssieQHISLEDYLRGRW  555
            DS+S+SS EQ +S+EDYL+GRW
Sbjct  692  DSLSISSTEQGVSIEDYLQGRW  713



>ref|XP_004498354.1| PREDICTED: uncharacterized protein LOC101490391 [Cicer arietinum]
Length=728

 Score = 61.2 bits (147),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 58/82 (71%), Gaps = 8/82 (10%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            I K+L+G+ + + WA++++N        +++  E  D++     S +QSHLNLALL VE+
Sbjct  648  ITKVLKGDADVIMWAKVEIN--------ALKVPEMFDEEEACPLSKLQSHLNLALLDVED  699

Query  490  dsvsvssieQHISLEDYLRGRW  555
            D++S+ S++Q++SLEDYLRGRW
Sbjct  700  DTLSLCSVDQNVSLEDYLRGRW  721



>ref|XP_010093102.1| Receptor-like cytosolic serine/threonine-protein kinase RBK2 
[Morus notabilis]
 gb|EXB53540.1| Receptor-like cytosolic serine/threonine-protein kinase RBK2 
[Morus notabilis]
Length=743

 Score = 60.8 bits (146),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 53/82 (65%), Gaps = 9/82 (11%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            +VK+LQG+ E ++WAR QV+ SE +                   SNIQSHLNLALL +E+
Sbjct  664  VVKILQGDEEAVRWARQQVSASEDEEEVVD---------GEPLPSNIQSHLNLALLDMED  714

Query  490  dsvsvssieQHISLEDYLRGRW  555
            DS S+S  EQ IS+EDYLRGRW
Sbjct  715  DSYSLSGSEQSISIEDYLRGRW  736



>ref|XP_002264653.2| PREDICTED: probable receptor protein kinase TMK1 [Vitis vinifera]
Length=768

 Score = 60.5 bits (145),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 59/82 (72%), Gaps = 11/82 (13%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            ++KLL G++E ++WA+ QV+        +MEG E    +  S  SNIQSHLNLALL +E+
Sbjct  691  VLKLLLGDMEIIQWAKQQVS--------AMEGQEV---EGESFPSNIQSHLNLALLDLED  739

Query  490  dsvsvssieQHISLEDYLRGRW  555
            DS+S+SS EQ ISLEDYL+GRW
Sbjct  740  DSLSISSTEQSISLEDYLQGRW  761



>emb|CAN81737.1| hypothetical protein VITISV_043580 [Vitis vinifera]
Length=738

 Score = 60.5 bits (145),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 59/82 (72%), Gaps = 11/82 (13%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            ++KLL G++E ++WA+ QV+        +MEG E    +  S  SNIQSHLNLALL +E+
Sbjct  661  VLKLLLGDMEIIQWAKQQVS--------AMEGQEV---EGESFPSNIQSHLNLALLDLED  709

Query  490  dsvsvssieQHISLEDYLRGRW  555
            DS+S+SS EQ ISLEDYL+GRW
Sbjct  710  DSLSISSTEQSISLEDYLQGRW  731



>emb|CBI37518.3| unnamed protein product [Vitis vinifera]
Length=726

 Score = 60.5 bits (145),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 59/82 (72%), Gaps = 11/82 (13%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            ++KLL G++E ++WA+ QV+        +MEG E    +  S  SNIQSHLNLALL +E+
Sbjct  649  VLKLLLGDMEIIQWAKQQVS--------AMEGQEV---EGESFPSNIQSHLNLALLDLED  697

Query  490  dsvsvssieQHISLEDYLRGRW  555
            DS+S+SS EQ ISLEDYL+GRW
Sbjct  698  DSLSISSTEQSISLEDYLQGRW  719



>dbj|BAF01933.1| hypothetical protein [Arabidopsis thaliana]
Length=188

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 59/81 (73%), Gaps = 8/81 (10%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            +++LL+G+VE +KWA+LQV+       N +E    L D+   + SN+QSHLNLA L +E+
Sbjct  108  VLELLKGDVEMLKWAKLQVS-------NPLEDSMLLKDEKL-RRSNLQSHLNLAFLDMED  159

Query  490  dsvsvssieQHISLEDYLRGR  552
            DS+S+ S+EQ IS+E+YL+GR
Sbjct  160  DSLSMGSMEQGISVEEYLKGR  180



>ref|XP_010537354.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Tarenaya hassleriana]
Length=765

 Score = 60.1 bits (144),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 58/81 (72%), Gaps = 8/81 (10%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            ++KLL+G+ + + WAR Q+N       N  E  E L D+ + + SN+QSHLNLALL VE+
Sbjct  685  VLKLLKGDEDALTWARQQLN-------NPSEDSEVLKDEKF-RRSNLQSHLNLALLDVED  736

Query  490  dsvsvssieQHISLEDYLRGR  552
            DS+S+ SIEQ IS+EDYL+GR
Sbjct  737  DSLSMGSIEQSISVEDYLKGR  757



>ref|XP_007048485.1| Kinase protein with adenine nucleotide alpha hydrolases-like 
domain, putative isoform 1 [Theobroma cacao]
 ref|XP_007048486.1| Kinase protein with adenine nucleotide alpha hydrolases-like 
domain, putative isoform 1 [Theobroma cacao]
 ref|XP_007048487.1| Kinase protein with adenine nucleotide alpha hydrolases-like 
domain, putative isoform 1 [Theobroma cacao]
 gb|EOX92642.1| Kinase protein with adenine nucleotide alpha hydrolases-like 
domain, putative isoform 1 [Theobroma cacao]
 gb|EOX92643.1| Kinase protein with adenine nucleotide alpha hydrolases-like 
domain, putative isoform 1 [Theobroma cacao]
 gb|EOX92644.1| Kinase protein with adenine nucleotide alpha hydrolases-like 
domain, putative isoform 1 [Theobroma cacao]
Length=726

 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 55/82 (67%), Gaps = 10/82 (12%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            I+KLLQG+ E   WAR QV  SE          +T+D + Y   +NI+SHLNLALL +E+
Sbjct  648  ILKLLQGDQEVTNWARQQVRASEEV--------DTVDGEVYP--TNIESHLNLALLDLED  697

Query  490  dsvsvssieQHISLEDYLRGRW  555
            DS+SVSS EQ + +EDYL GRW
Sbjct  698  DSLSVSSNEQSVPIEDYLLGRW  719



>ref|XP_008783316.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine-protein kinase 
STE20-like [Phoenix dactylifera]
Length=801

 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 59/89 (66%), Gaps = 15/89 (17%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            ++KLLQG+ + +KWAR QV+ SE        G + LDD+     S IQSHLNLALL V++
Sbjct  714  VLKLLQGDDDVVKWARSQVSTSE--------GLDELDDELTDMKSIIQSHLNLALLDVDD  765

Query  490  dsvsvssieQHI-------SLEDYLRGRW  555
            DS+S+SS EQ +       S+EDYL+GRW
Sbjct  766  DSLSISSTEQTVDSITANASMEDYLKGRW  794



>ref|XP_008227546.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103327047 
[Prunus mume]
Length=748

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/82 (55%), Positives = 55/82 (67%), Gaps = 10/82 (12%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            ++KLLQG+ E  + AR QV+ SE          E LD +     SNIQSHLNLALL +E+
Sbjct  670  VLKLLQGDEEVTRCARQQVSASEEL--------EALDGEALP--SNIQSHLNLALLDLED  719

Query  490  dsvsvssieQHISLEDYLRGRW  555
            DS+S SS EQ ISLEDYL+GRW
Sbjct  720  DSLSTSSGEQSISLEDYLQGRW  741



>ref|XP_002310531.2| hypothetical protein POPTR_0007s04490g [Populus trichocarpa]
 gb|EEE90981.2| hypothetical protein POPTR_0007s04490g [Populus trichocarpa]
Length=743

 Score = 58.5 bits (140),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 56/82 (68%), Gaps = 10/82 (12%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            I+KLLQG+ E   WAR QV  SE          + +D + +   +NIQSHLNLALL +E+
Sbjct  665  ILKLLQGDEEVKNWARHQVCASEEL--------DAVDGEAFP--TNIQSHLNLALLDLED  714

Query  490  dsvsvssieQHISLEDYLRGRW  555
            DS+S+SS EQ +S+EDYL+GRW
Sbjct  715  DSLSISSTEQGVSVEDYLQGRW  736



>ref|XP_006303211.1| hypothetical protein CARUB_v10011454mg [Capsella rubella]
 gb|EOA36109.1| hypothetical protein CARUB_v10011454mg [Capsella rubella]
Length=752

 Score = 58.5 bits (140),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 57/81 (70%), Gaps = 8/81 (10%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            +VKLL G+ E +KWA+LQV+       N +E  + L D+     SN+QSHLNLA L +E+
Sbjct  672  VVKLLNGDAEMLKWAKLQVS-------NPLEDSKVLKDEKL-WRSNLQSHLNLAFLDMED  723

Query  490  dsvsvssieQHISLEDYLRGR  552
            DS+S+ SIEQ IS+E+YL+GR
Sbjct  724  DSLSLGSIEQGISVENYLKGR  744



>gb|KDP20470.1| hypothetical protein JCGZ_05332 [Jatropha curcas]
Length=713

 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 55/82 (67%), Gaps = 11/82 (13%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            ++KLLQG+ E   WAR +V+ SE          +  D + +   +NIQSHLN+ALL +E+
Sbjct  636  VLKLLQGDNEVKNWARQEVSTSEV---------DAADGEVFP--TNIQSHLNIALLDLED  684

Query  490  dsvsvssieQHISLEDYLRGRW  555
            DS+S SS EQ ISLEDYL+GRW
Sbjct  685  DSLSTSSTEQGISLEDYLQGRW  706



>ref|XP_010459867.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Camelina sativa]
Length=752

 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 56/81 (69%), Gaps = 8/81 (10%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            ++KLL G+ E +KWA+LQVN       N +E  + L D+     SN+QSHLNLA L +E+
Sbjct  672  VLKLLNGDAEMLKWAKLQVN-------NPLEDSKVLKDEKL-WRSNLQSHLNLAFLDMED  723

Query  490  dsvsvssieQHISLEDYLRGR  552
            DS+S+ SIEQ IS+E YL+GR
Sbjct  724  DSLSMGSIEQGISVEGYLKGR  744



>gb|AAC34357.1| Putative protein kinase [Arabidopsis thaliana]
Length=781

 Score = 58.2 bits (139),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 58/81 (72%), Gaps = 8/81 (10%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            ++KLL+G+ +T++WA  QVN S        E  E L D+   Q SN+QSHLNLALL VE+
Sbjct  701  VLKLLKGDEDTLEWAMQQVNSSS-------EESEMLKDEQ-CQRSNLQSHLNLALLDVED  752

Query  490  dsvsvssieQHISLEDYLRGR  552
            DS+S+ SIEQ +S+EDYL+GR
Sbjct  753  DSISMGSIEQGVSVEDYLKGR  773



>ref|XP_010498614.1| PREDICTED: probable receptor protein kinase TMK1 [Camelina sativa]
Length=744

 Score = 58.2 bits (139),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 56/81 (69%), Gaps = 8/81 (10%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            ++KLL G+ E +KWA+LQVN       N +E  + L D+     SN+QSHLNLA L +E+
Sbjct  664  VLKLLNGDAEMLKWAKLQVN-------NPLEDSKVLKDEKL-WRSNLQSHLNLAFLDMED  715

Query  490  dsvsvssieQHISLEDYLRGR  552
            DS+S+ SIEQ IS+E YL+GR
Sbjct  716  DSLSMGSIEQGISVEGYLKGR  736



>ref|NP_177852.2| adenine nucleotide alpha hydrolases-domain containing protein 
kinase [Arabidopsis thaliana]
 gb|AEE35957.1| adenine nucleotide alpha hydrolases-domain containing protein 
kinase [Arabidopsis thaliana]
Length=794

 Score = 58.2 bits (139),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 58/81 (72%), Gaps = 8/81 (10%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            ++KLL+G+ +T++WA  QVN S        E  E L D+   Q SN+QSHLNLALL VE+
Sbjct  714  VLKLLKGDEDTLEWAMQQVNSSS-------EESEMLKDEQ-CQRSNLQSHLNLALLDVED  765

Query  490  dsvsvssieQHISLEDYLRGR  552
            DS+S+ SIEQ +S+EDYL+GR
Sbjct  766  DSISMGSIEQGVSVEDYLKGR  786



>emb|CDP16448.1| unnamed protein product [Coffea canephora]
Length=720

 Score = 57.8 bits (138),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 53/82 (65%), Gaps = 11/82 (13%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            + KLLQG+ ET +WAR QV           +G + +D +     +NIQS +NLALL +E+
Sbjct  639  VAKLLQGDQETTRWARQQV-----------KGMDEVDVEGQQSSTNIQSFINLALLNLED  687

Query  490  dsvsvssieQHISLEDYLRGRW  555
             SVS SS EQ IS+EDYL+GRW
Sbjct  688  HSVSSSSTEQTISVEDYLQGRW  709



>ref|XP_007214539.1| hypothetical protein PRUPE_ppa002094mg [Prunus persica]
 gb|EMJ15738.1| hypothetical protein PRUPE_ppa002094mg [Prunus persica]
Length=717

 Score = 57.8 bits (138),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 55/82 (67%), Gaps = 10/82 (12%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            ++KLLQG+ E  + AR QV+ SE          E LD +     S+IQSHLNLALL +E+
Sbjct  639  VLKLLQGDEEVTRCARQQVSASEEL--------EALDGEALP--SDIQSHLNLALLDLED  688

Query  490  dsvsvssieQHISLEDYLRGRW  555
            DS+S SS EQ ISLEDYL+GRW
Sbjct  689  DSLSTSSGEQSISLEDYLQGRW  710



>gb|AFK38695.1| unknown [Lotus japonicus]
Length=131

 Score = 54.7 bits (130),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 57/82 (70%), Gaps = 10/82 (12%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            I+KLL+G+ E  +WA L+V+  +          +  D++     +NIQSHLNLALL +E+
Sbjct  53   ILKLLRGDEEVTRWAELEVSAPQEH--------DGFDEEPV--LTNIQSHLNLALLDLED  102

Query  490  dsvsvssieQHISLEDYLRGRW  555
            D+VS+SS EQ++S+EDYL+GRW
Sbjct  103  DAVSISSSEQNVSMEDYLQGRW  124



>gb|AAF87904.1|AC015447_14 Similar to protein kinases [Arabidopsis thaliana]
Length=705

 Score = 57.4 bits (137),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 59/81 (73%), Gaps = 8/81 (10%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            +++LL+G+VE +KWA+LQV+       N +E    L D+   + SN+QSHLNLA L +E+
Sbjct  625  VLELLKGDVEMLKWAKLQVS-------NPLEDSMLLKDEKL-RRSNLQSHLNLAFLDMED  676

Query  490  dsvsvssieQHISLEDYLRGR  552
            DS+S+ S+EQ IS+E+YL+GR
Sbjct  677  DSLSMGSMEQGISVEEYLKGR  697



>gb|KFK42126.1| hypothetical protein AALP_AA2G214300 [Arabis alpina]
Length=738

 Score = 57.4 bits (137),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 58/81 (72%), Gaps = 8/81 (10%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            ++KLL+G+ +T+KWA  +VN S  +        E L D+   Q SN+QSHLN+ALL VE+
Sbjct  658  VLKLLKGDEDTLKWAMQKVNSSSGE-------AEMLKDEQ-CQRSNLQSHLNVALLDVED  709

Query  490  dsvsvssieQHISLEDYLRGR  552
            DS+S+ SIEQ IS+EDYL+GR
Sbjct  710  DSISMGSIEQGISVEDYLKGR  730



>ref|NP_173578.2| putative protein kinase [Arabidopsis thaliana]
 gb|AAL57632.1| At1g21590/F24J8_9 [Arabidopsis thaliana]
 gb|AAM98263.1| At1g21590/F24J8_9 [Arabidopsis thaliana]
 gb|AEE30121.1| adenine nucleotide alpha hydrolases-domain containing protein 
kinase [Arabidopsis thaliana]
Length=756

 Score = 57.4 bits (137),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 59/81 (73%), Gaps = 8/81 (10%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            +++LL+G+VE +KWA+LQV+       N +E    L D+   + SN+QSHLNLA L +E+
Sbjct  676  VLELLKGDVEMLKWAKLQVS-------NPLEDSMLLKDEKL-RRSNLQSHLNLAFLDMED  727

Query  490  dsvsvssieQHISLEDYLRGR  552
            DS+S+ S+EQ IS+E+YL+GR
Sbjct  728  DSLSMGSMEQGISVEEYLKGR  748



>ref|XP_010534448.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Tarenaya hassleriana]
Length=739

 Score = 57.4 bits (137),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 57/81 (70%), Gaps = 8/81 (10%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            ++KLL+G+ E + WAR QV        N  +  E L ++  SQ SN+QSHLNLALL VE+
Sbjct  659  VLKLLKGDEEVVAWARQQV-------ENPSDDSEALKEEE-SQRSNLQSHLNLALLDVED  710

Query  490  dsvsvssieQHISLEDYLRGR  552
            DS+S+ SIEQ IS+EDYL+GR
Sbjct  711  DSLSMGSIEQGISVEDYLKGR  731



>gb|KEH35608.1| adenine nucleotide alpha hydrolase-like domain kinase [Medicago 
truncatula]
Length=648

 Score = 57.0 bits (136),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 53/82 (65%), Gaps = 10/82 (12%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            I+KLL G+ E  +WA  +V   E          +  D++ +   +NIQSHLNLALL +E+
Sbjct  570  ILKLLHGDEEVTRWAEQEVCAPETH--------DGFDEELFP--TNIQSHLNLALLDLED  619

Query  490  dsvsvssieQHISLEDYLRGRW  555
            D+VS+ S EQ +SLEDYLRGRW
Sbjct  620  DAVSICSTEQCVSLEDYLRGRW  641



>gb|KEH35607.1| adenine nucleotide alpha hydrolase-like domain kinase [Medicago 
truncatula]
Length=690

 Score = 57.0 bits (136),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 53/82 (65%), Gaps = 10/82 (12%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            I+KLL G+ E  +WA  +V   E          +  D++ +   +NIQSHLNLALL +E+
Sbjct  612  ILKLLHGDEEVTRWAEQEVCAPETH--------DGFDEELFP--TNIQSHLNLALLDLED  661

Query  490  dsvsvssieQHISLEDYLRGRW  555
            D+VS+ S EQ +SLEDYLRGRW
Sbjct  662  DAVSICSTEQCVSLEDYLRGRW  683



>ref|XP_002893177.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69436.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=757

 Score = 57.0 bits (136),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 59/81 (73%), Gaps = 8/81 (10%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            ++KLL+G+VE +KWA+LQV+       N +E  + L D+   + SN+QSHLNLA L +E+
Sbjct  677  VLKLLKGDVEILKWAKLQVS-------NHLEDSKLLKDEKL-RRSNLQSHLNLAFLDMED  728

Query  490  dsvsvssieQHISLEDYLRGR  552
            DS+S+ S+EQ IS+E+YL+ R
Sbjct  729  DSLSMGSMEQGISVEEYLKDR  749



>gb|KHN31175.1| Proline-rich receptor-like protein kinase PERK9 [Glycine soja]
Length=699

 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 55/82 (67%), Gaps = 10/82 (12%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            I+KLL G+ E ++WA  +VN  +      ++G      D     +NIQSHLNLALL +E+
Sbjct  621  ILKLLHGDEEVIRWAEQEVNAPQ-----ELDGC-----DEEPVPTNIQSHLNLALLDLED  670

Query  490  dsvsvssieQHISLEDYLRGRW  555
            D+VS+SS EQ +SLEDYL+GRW
Sbjct  671  DTVSISSTEQSVSLEDYLQGRW  692



>ref|XP_006578781.1| PREDICTED: proline-rich receptor-like protein kinase PERK14-like 
[Glycine max]
Length=699

 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 55/82 (67%), Gaps = 10/82 (12%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            I+KLL G+ E ++WA  +VN  +      ++G      D     +NIQSHLNLALL +E+
Sbjct  621  ILKLLHGDEEVIRWAEQEVNAPQ-----ELDGC-----DEEPVPTNIQSHLNLALLDLED  670

Query  490  dsvsvssieQHISLEDYLRGRW  555
            D+VS+SS EQ +SLEDYL+GRW
Sbjct  671  DTVSISSTEQSVSLEDYLQGRW  692



>gb|KGN62217.1| hypothetical protein Csa_2G336150 [Cucumis sativus]
Length=725

 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 53/81 (65%), Gaps = 10/81 (12%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            I+KLLQG+ E   WAR Q++ S+         GE L        +NIQSHLNLALLG+E+
Sbjct  647  ILKLLQGDEEITTWARQQIDESD---EMDASDGEPLP-------TNIQSHLNLALLGLED  696

Query  490  dsvsvssieQHISLEDYLRGR  552
            DS+SV S  Q IS+EDYL+GR
Sbjct  697  DSLSVGSGIQSISIEDYLQGR  717



>ref|XP_010055962.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 isoform X1 [Eucalyptus grandis]
 gb|KCW72535.1| hypothetical protein EUGRSUZ_E01004 [Eucalyptus grandis]
Length=767

 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 54/82 (66%), Gaps = 10/82 (12%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            +VKLL G+V+ +K A+LQV+  ++             DD    + NIQSHLNLAL  VE+
Sbjct  689  VVKLLHGDVDVVKSAQLQVSCDQSDAA----------DDEACAYPNIQSHLNLALHDVED  738

Query  490  dsvsvssieQHISLEDYLRGRW  555
            DS SVS I+ ++SLEDYL+GRW
Sbjct  739  DSSSVSIIDSNVSLEDYLKGRW  760



>ref|XP_010055963.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 isoform X2 [Eucalyptus grandis]
Length=765

 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 54/82 (66%), Gaps = 10/82 (12%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            +VKLL G+V+ +K A+LQV+  ++             DD    + NIQSHLNLAL  VE+
Sbjct  687  VVKLLHGDVDVVKSAQLQVSCDQSDAA----------DDEACAYPNIQSHLNLALHDVED  736

Query  490  dsvsvssieQHISLEDYLRGRW  555
            DS SVS I+ ++SLEDYL+GRW
Sbjct  737  DSSSVSIIDSNVSLEDYLKGRW  758



>ref|XP_004147358.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670-like [Cucumis sativus]
 ref|XP_004169410.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670-like [Cucumis sativus]
Length=680

 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 53/81 (65%), Gaps = 10/81 (12%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            I+KLLQG+ E   WAR Q++ S+         GE L        +NIQSHLNLALLG+E+
Sbjct  602  ILKLLQGDEEITTWARQQIDESD---EMDASDGEPLP-------TNIQSHLNLALLGLED  651

Query  490  dsvsvssieQHISLEDYLRGR  552
            DS+SV S  Q IS+EDYL+GR
Sbjct  652  DSLSVGSGIQSISIEDYLQGR  672



>gb|KFK44259.1| hypothetical protein AALP_AA1G235200 [Arabis alpina]
Length=758

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 58/81 (72%), Gaps = 8/81 (10%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            ++ LL+G+ E +KWA+ QV+       NS+E  + L D+   + SN+QSHLNLA L +E+
Sbjct  678  VLNLLKGDAEMLKWAKQQVS-------NSLEDSKLLKDEKL-RRSNLQSHLNLAFLDIED  729

Query  490  dsvsvssieQHISLEDYLRGR  552
            DS+S+ SIEQ +S+EDYL+GR
Sbjct  730  DSLSMGSIEQGVSVEDYLKGR  750



>ref|XP_010527069.1| PREDICTED: probable L-type lectin-domain containing receptor 
kinase II.1 [Tarenaya hassleriana]
Length=745

 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 45/90 (50%), Positives = 56/90 (62%), Gaps = 17/90 (19%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDT---YSQH-SNIQSHLNLALL  477
            I+KLL+GE E  KWAR Q+N +           ET+DD+    +SQ  SNIQSHLNLALL
Sbjct  658  ILKLLKGEEEVEKWARQQLNSTSE---------ETVDDEMDGEWSQPTSNIQSHLNLALL  708

Query  478  ----GveedsvsvssieQHISLEDYLRGRW  555
                G ++     SS EQ +S+EDYLRGRW
Sbjct  709  DIDNGDDDSQSMSSSSEQSVSIEDYLRGRW  738



>ref|XP_011022896.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At5g15730 [Populus euphratica]
Length=718

 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 55/82 (67%), Gaps = 10/82 (12%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            I+KLLQG+ +   WAR QV  SE          + +D + +   +NIQSHLNLALL +E+
Sbjct  640  ILKLLQGDEDVKNWARHQVCASEEL--------DAVDGEAFP--TNIQSHLNLALLDLED  689

Query  490  dsvsvssieQHISLEDYLRGRW  555
            DS+S+SS E  +S+EDYL+GRW
Sbjct  690  DSLSISSTEHGVSIEDYLQGRW  711



>ref|XP_008805891.1| PREDICTED: LOW QUALITY PROTEIN: cyclin-dependent kinase 12-like 
[Phoenix dactylifera]
Length=812

 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 58/89 (65%), Gaps = 15/89 (17%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            ++KLLQG+ + +KWAR +V+ SE        G + LDD+     S IQSHLNLALL V++
Sbjct  725  VLKLLQGDDDVVKWARSKVSTSE--------GLDELDDELIHPKSIIQSHLNLALLDVDD  776

Query  490  dsvsvssieQHI-------SLEDYLRGRW  555
            DS+S+SS E  +       S+EDYL+GRW
Sbjct  777  DSLSISSTEHTVDFITANTSMEDYLKGRW  805



>ref|XP_008460873.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g10290 [Cucumis melo]
Length=725

 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 51/81 (63%), Gaps = 10/81 (12%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            I+KLLQG+ E   WAR Q++          E  E    D     +NIQSHLNLALLG+E+
Sbjct  647  ILKLLQGDEEITTWARQQID----------ETDELDASDGEPLPTNIQSHLNLALLGLED  696

Query  490  dsvsvssieQHISLEDYLRGR  552
            DS+SV S  Q IS+EDYL+GR
Sbjct  697  DSLSVGSGIQSISIEDYLQGR  717



>ref|XP_011091800.1| PREDICTED: proline-rich receptor-like protein kinase PERK10 [Sesamum 
indicum]
Length=690

 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 56/82 (68%), Gaps = 10/82 (12%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            ++KLL+G+ E + WAR + N SE    N++ G ++         +NIQS +NLALL +E+
Sbjct  610  VLKLLRGDPEVVDWARQETNASEDI--NAINGEQS--------AANIQSFINLALLNLED  659

Query  490  dsvsvssieQHISLEDYLRGRW  555
            D+ S+SS EQ+IS+EDYL GRW
Sbjct  660  DTASISSTEQNISVEDYLGGRW  681



>ref|XP_008367819.1| PREDICTED: uncharacterized protein LOC103431442 [Malus domestica]
Length=796

 Score = 54.7 bits (130),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 45/82 (55%), Positives = 56/82 (68%), Gaps = 11/82 (13%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            ++KLLQG+ E  +WAR QV+ SE          E +D +  S   NIQSHLNLAL  +E+
Sbjct  719  VLKLLQGDEEVTRWAR-QVSVSEED--------EAVDGEAPS--CNIQSHLNLALRDLED  767

Query  490  dsvsvssieQHISLEDYLRGRW  555
            DSVSVSS EQ I+LEDYL+GRW
Sbjct  768  DSVSVSSGEQSIALEDYLQGRW  789



>ref|XP_004289287.1| PREDICTED: putative proline-rich receptor-like protein kinase 
PERK11-like [Fragaria vesca subsp. vesca]
Length=698

 Score = 54.7 bits (130),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 56/82 (68%), Gaps = 10/82 (12%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            ++KLLQG+ E  +WAR QV+ S+          + LD +     +NI+SHLN+ALL +E+
Sbjct  620  VLKLLQGDEEITRWARQQVSASDEL--------DALDGEVVP--TNIKSHLNMALLDLED  669

Query  490  dsvsvssieQHISLEDYLRGRW  555
            DS+S SS EQ IS+E+YL+GRW
Sbjct  670  DSLSTSSGEQSISVEEYLQGRW  691



>ref|XP_010674424.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Beta vulgaris subsp. vulgaris]
Length=754

 Score = 54.3 bits (129),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 51/83 (61%), Gaps = 9/83 (11%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            ++KLLQG++E   WA+ QVN             E L+ +T  +   +QSHLN+ALLG+ E
Sbjct  673  VLKLLQGDIEVTNWAKQQVNSYPLDF-------EVLEGET-PRSEILQSHLNVALLGLVE  724

Query  490  dsvsvssieQ-HISLEDYLRGRW  555
            D  +  S  + +ISLEDYL+GRW
Sbjct  725  DDNASISSTEPNISLEDYLKGRW  747



>ref|XP_010428799.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Camelina sativa]
Length=756

 Score = 54.3 bits (129),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 56/81 (69%), Gaps = 8/81 (10%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            ++KLL+G+  T +WA  QV+       NS E  E L D+   Q SN+QSHLN+ALL VE+
Sbjct  676  VLKLLKGDEYTYEWALQQVS-------NSSEESEMLKDEQ-CQRSNLQSHLNVALLDVED  727

Query  490  dsvsvssieQHISLEDYLRGR  552
            DS+S  SIEQ +S+EDYL+GR
Sbjct  728  DSISTGSIEQGVSVEDYLKGR  748



>ref|XP_004502962.1| PREDICTED: proline-rich receptor-like protein kinase PERK14-like 
[Cicer arietinum]
Length=695

 Score = 53.9 bits (128),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 52/83 (63%), Gaps = 12/83 (14%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDD-DTYSQHSNIQSHLNLALLGve  486
            I+KLLQG+ E  +WA  +V+  E           TLD  D     +NIQSHLNLALL +E
Sbjct  617  ILKLLQGDEEVTRWAEQEVSAPE-----------TLDGFDEEPVPTNIQSHLNLALLDLE  665

Query  487  edsvsvssieQHISLEDYLRGRW  555
            +D+VS+   EQ + LEDYL+GRW
Sbjct  666  DDTVSLGGSEQGVLLEDYLQGRW  688



>ref|XP_010471913.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Camelina sativa]
Length=753

 Score = 53.9 bits (128),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 57/81 (70%), Gaps = 8/81 (10%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            ++KLL+G+ +T +WA  QV+       NS E  E L D    Q SN+QSHLN+ALL VE+
Sbjct  673  VLKLLKGDEDTHEWALQQVS-------NSSEESEMLKDKQ-CQRSNLQSHLNVALLDVED  724

Query  490  dsvsvssieQHISLEDYLRGR  552
            DS+S+ SIEQ +S+EDYL+GR
Sbjct  725  DSISMGSIEQGVSVEDYLKGR  745



>ref|XP_007137781.1| hypothetical protein PHAVU_009G155000g [Phaseolus vulgaris]
 gb|ESW09775.1| hypothetical protein PHAVU_009G155000g [Phaseolus vulgaris]
Length=697

 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 56/82 (68%), Gaps = 10/82 (12%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            I+KLL+G+ E  +WA  + N  +      ++G    D++     +NIQSHLNLAL+ +E+
Sbjct  619  ILKLLRGDEEVTRWAEQEANAPQ-----ELDG---FDEEPVP--TNIQSHLNLALMDLED  668

Query  490  dsvsvssieQHISLEDYLRGRW  555
            D+VS+SS EQ +SLEDYL+GRW
Sbjct  669  DAVSISSTEQSVSLEDYLQGRW  690



>ref|XP_006829313.1| hypothetical protein AMTR_s00202p00019370 [Amborella trichopoda]
 gb|ERM96729.1| hypothetical protein AMTR_s00202p00019370 [Amborella trichopoda]
Length=753

 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 60/89 (67%), Gaps = 16/89 (18%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            I+KLL+G+ + +KWARLQ++ SE      ++G   +D++T+    +IQSH+NLAL  V+ 
Sbjct  667  ILKLLKGDDDVVKWARLQLSASE-----ELDG---VDEETFCS-PDIQSHVNLALHDVDF  717

Query  490  dsvsvssieQHI-------SLEDYLRGRW  555
            D  SVSS++Q +       SLEDYL+GRW
Sbjct  718  DMQSVSSVDQSVDNITSYKSLEDYLQGRW  746



>ref|XP_010911250.1| PREDICTED: proline-rich receptor-like protein kinase PERK9 [Elaeis 
guineensis]
 ref|XP_010911254.1| PREDICTED: proline-rich receptor-like protein kinase PERK9 [Elaeis 
guineensis]
Length=736

 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 58/89 (65%), Gaps = 16/89 (18%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            ++KLLQG+ + +KWAR Q++ S        EG + LD++     S IQSHLNLALL V++
Sbjct  650  VLKLLQGDDDVVKWARSQISTS--------EGPDELDEE-LDMKSIIQSHLNLALLDVDD  700

Query  490  dsvsvssieQHI-------SLEDYLRGRW  555
            DS+S+SS EQ +       S EDYL+GRW
Sbjct  701  DSLSISSTEQTVDFITTNTSTEDYLKGRW  729



>emb|CDX88355.1| BnaC06g37990D [Brassica napus]
Length=707

 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 56/81 (69%), Gaps = 8/81 (10%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            ++KLL+G+ +T+KWA  Q +       NS +  E L D+   Q SN+QSHL +ALL VE+
Sbjct  631  VLKLLKGDEDTLKWAMQQAS-------NSSDESEMLKDEE-CQRSNLQSHLKVALLDVED  682

Query  490  dsvsvssieQHISLEDYLRGR  552
            DS+S+ S +Q +S+EDYL+GR
Sbjct  683  DSLSMGSFDQGVSVEDYLKGR  703



>gb|EYU42966.1| hypothetical protein MIMGU_mgv1a002423mg [Erythranthe guttata]
Length=677

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 60/83 (72%), Gaps = 9/83 (11%)
 Frame = +1

Query  307  QIVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGve  486
            +++KLL+G+ E ++WAR +V+  + ++ N++ G  + +        NIQS +NLALL +E
Sbjct  597  RVLKLLKGDQEIVEWARQEVSSLD-EVNNAINGERSTN--------NIQSFINLALLDLE  647

Query  487  edsvsvssieQHISLEDYLRGRW  555
            +D+ SVSS EQ+IS+EDYL+GRW
Sbjct  648  DDTNSVSSGEQNISVEDYLKGRW  670



>ref|XP_009355844.1| PREDICTED: tyrosine-protein kinase Lck-like [Pyrus x bretschneideri]
Length=742

 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 56/82 (68%), Gaps = 12/82 (15%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            ++KLLQG+ E  +WAR QV+ SE          E +D +  S   +IQSHLNLAL  +E+
Sbjct  666  VLKLLQGDEEVTRWAR-QVSVSE---------DEAVDGEAPS--CSIQSHLNLALRDLED  713

Query  490  dsvsvssieQHISLEDYLRGRW  555
            DSVSVSS EQ I+LEDYL+GRW
Sbjct  714  DSVSVSSGEQSIALEDYLQGRW  735



>ref|XP_006416287.1| hypothetical protein EUTSA_v10006893mg [Eutrema salsugineum]
 gb|ESQ34640.1| hypothetical protein EUTSA_v10006893mg [Eutrema salsugineum]
Length=754

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 56/81 (69%), Gaps = 8/81 (10%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            ++ LL+G+ E +KWA+ Q++       N +E  + L+D+   Q  ++QSHLNLA L +E+
Sbjct  674  VLNLLKGDAELLKWAKQQIS-------NCLEDSKLLNDEKL-QRLSLQSHLNLAFLDMED  725

Query  490  dsvsvssieQHISLEDYLRGR  552
            DS+S+ S EQ IS+EDYL+GR
Sbjct  726  DSLSMGSTEQGISVEDYLKGR  746



>gb|KHN09628.1| Proline-rich receptor-like protein kinase PERK9 [Glycine soja]
Length=699

 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 53/82 (65%), Gaps = 10/82 (12%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            I+KLL G+ E ++WA  +V   +      ++G      D     +NIQSHLNLALL +E+
Sbjct  621  ILKLLHGDEEVIRWAEQEVIAPQ-----ELDGC-----DEEPVPTNIQSHLNLALLDLED  670

Query  490  dsvsvssieQHISLEDYLRGRW  555
            D++S+SS EQ +SLEDYL GRW
Sbjct  671  DTISISSTEQSVSLEDYLHGRW  692



>ref|XP_003526871.1| PREDICTED: proline-rich receptor-like protein kinase PERK14-like 
[Glycine max]
Length=700

 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 53/82 (65%), Gaps = 10/82 (12%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            I+KLL G+ E ++WA  +V   +      ++G      D     +NIQSHLNLALL +E+
Sbjct  622  ILKLLHGDEEVIRWAEQEVIAPQ-----ELDGC-----DEEPVPTNIQSHLNLALLDLED  671

Query  490  dsvsvssieQHISLEDYLRGRW  555
            D++S+SS EQ +SLEDYL GRW
Sbjct  672  DTISISSTEQSVSLEDYLHGRW  693



>emb|CDX96585.1| BnaA08g21280D [Brassica napus]
Length=134

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 54/82 (66%), Gaps = 9/82 (11%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            ++ LL+G+VE +KWA+ QV+         +E  + L D+   + SN+QSHLN+A L +E+
Sbjct  53   VLNLLKGDVEMLKWAKEQVSS-------GLEDSKLLKDEKL-KRSNLQSHLNVAFLDMED  104

Query  490  dsv-svssieQHISLEDYLRGR  552
            +   S+ S+ Q IS+EDYL+GR
Sbjct  105  EESISMRSMVQGISVEDYLKGR  126



>ref|XP_010905327.1| PREDICTED: uncharacterized protein LOC105032560 [Elaeis guineensis]
Length=802

 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 56/90 (62%), Gaps = 15/90 (17%)
 Frame = +1

Query  307  QIVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGve  486
             ++KLLQG+ + +KWAR Q++        + EG + LDD+     S IQSHLNLALL V+
Sbjct  714  PVLKLLQGDDDVVKWARSQLS--------TFEGLDELDDELMHAKSIIQSHLNLALLDVD  765

Query  487  edsvsvssieQHI-------SLEDYLRGRW  555
            +DS+S+SS E  +        +EDYL+ RW
Sbjct  766  DDSLSISSAEHTVDFISANNPMEDYLKARW  795



>gb|KCW54153.1| hypothetical protein EUGRSUZ_I00126 [Eucalyptus grandis]
Length=742

 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 54/82 (66%), Gaps = 10/82 (12%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            I+KLLQG+ E  +WAR Q+N SE    + MEG    +D   S    IQSHLNLA   +E+
Sbjct  664  ILKLLQGDEEVREWARQQINSSEE--LDEMEG----EDSPVS----IQSHLNLAFQDLED  713

Query  490  dsvsvssieQHISLEDYLRGRW  555
            DS+SVSS +Q +S EDYL+ RW
Sbjct  714  DSLSVSSTDQSMSSEDYLQSRW  735



>ref|XP_010027607.1| PREDICTED: proline-rich receptor-like protein kinase PERK8 [Eucalyptus 
grandis]
 gb|KCW54154.1| hypothetical protein EUGRSUZ_I00126 [Eucalyptus grandis]
Length=717

 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 54/82 (66%), Gaps = 10/82 (12%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGvee  489
            I+KLLQG+ E  +WAR Q+N SE    + MEG    +D   S    IQSHLNLA   +E+
Sbjct  639  ILKLLQGDEEVREWARQQINSSEE--LDEMEG----EDSPVS----IQSHLNLAFQDLED  688

Query  490  dsvsvssieQHISLEDYLRGRW  555
            DS+SVSS +Q +S EDYL+ RW
Sbjct  689  DSLSVSSTDQSMSSEDYLQSRW  710



>emb|CDY38812.1| BnaC08g19860D [Brassica napus]
Length=704

 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 57/82 (70%), Gaps = 9/82 (11%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLGve-  486
            ++ LL+G+VE +KWA+ QV+       N +E  + L D+   + SN+QSHLN+A L +E 
Sbjct  623  VLNLLKGDVEMLKWAKEQVS-------NGLEDSKLLKDEKL-KRSNLQSHLNVAFLDMED  674

Query  487  edsvsvssieQHISLEDYLRGR  552
            E+S+S+ S+ Q IS+EDYL+GR
Sbjct  675  EESISMRSMVQGISVEDYLKGR  696



>ref|XP_004981112.1| PREDICTED: uncharacterized protein LOC101777140 [Setaria italica]
Length=934

 Score = 50.8 bits (120),  Expect = 0.001, Method: Composition-based stats.
 Identities = 28/57 (49%), Positives = 38/57 (67%), Gaps = 10/57 (18%)
 Frame = +1

Query  310  IVKLLQGEVETMKWARLQVNGSEAKLRNSMEGGETLDDDTYSQHSNIQSHLNLALLG  480
            ++KLLQG+ ET+ WARLQV         S +G    D++T +  +N+QSHLNLALLG
Sbjct  859  VLKLLQGDDETIGWARLQVTA-------SFDGS---DEETATPDANMQSHLNLALLG  905



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1819952291484