BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c103771_g1_i1 len=390 path=[1:0-389]

Length=390
                                                                      Score     E

ref|XP_007139384.1|  hypothetical protein PHAVU_008G024900g           57.0    7e-08   
ref|XP_007139364.1|  hypothetical protein PHAVU_008G023200g           55.5    1e-07   
ref|XP_006379360.1|  hypothetical protein POPTR_0009s16380g           55.5    2e-07   
ref|XP_006384790.1|  hypothetical protein POPTR_0004s21130g           54.3    4e-07   
gb|EPS68835.1|  hypothetical protein M569_05933                       48.9    3e-05   
gb|KHN14459.1|  Defensin-like protein 242                             47.8    8e-05   
ref|XP_010056435.1|  PREDICTED: defensin-like protein 242             47.8    9e-05   
gb|KHN13787.1|  Putative defensin-like protein 244                    46.2    3e-04   
gb|KHG20925.1|  Defensin protein                                      45.1    6e-04   



>ref|XP_007139384.1| hypothetical protein PHAVU_008G024900g [Phaseolus vulgaris]
 gb|ESW11378.1| hypothetical protein PHAVU_008G024900g [Phaseolus vulgaris]
Length=127

 Score = 57.0 bits (136),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 42/76 (55%), Gaps = 5/76 (7%)
 Frame = +2

Query  86   VIFSLTIFLTLLSPSLGQVKFCPGSFTADGVC----GSISCGNLALFHWPASSMPHSCVC  253
            V+  L +F  L S + G++KFCP     DG C      +SC    L    AS+MP +C C
Sbjct  51   VLIVLALF-ALFSQTYGEIKFCPKDMVFDGQCPLGTSGMSCFREFLARLGASAMPMNCRC  109

Query  254  ADAGAGKSLCTCQIVC  301
             +AG+ K  CTCQ+VC
Sbjct  110  NNAGSNKRKCTCQVVC  125



>ref|XP_007139364.1| hypothetical protein PHAVU_008G023200g [Phaseolus vulgaris]
 gb|ESW11358.1| hypothetical protein PHAVU_008G023200g [Phaseolus vulgaris]
Length=84

 Score = 55.5 bits (132),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 41/76 (54%), Gaps = 5/76 (7%)
 Frame = +2

Query  86   VIFSLTIFLTLLSPSLGQVKFCPGSFTADGVC----GSISCGNLALFHWPASSMPHSCVC  253
            V+  L +F  L S   G++KFCP     DG C      +SC    L    AS+MP SC C
Sbjct  8    VLIVLALF-ALFSQIYGEIKFCPKDMVFDGQCPLGTSGMSCFREFLARLGASAMPMSCSC  66

Query  254  ADAGAGKSLCTCQIVC  301
             +AG+ K  CTCQ+VC
Sbjct  67   NNAGSNKRKCTCQVVC  82



>ref|XP_006379360.1| hypothetical protein POPTR_0009s16380g [Populus trichocarpa]
 gb|ERP57157.1| hypothetical protein POPTR_0009s16380g [Populus trichocarpa]
Length=92

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 48/77 (62%), Gaps = 4/77 (5%)
 Frame = +2

Query  80   MFVIFSLTIFLTLLSPSLGQVKFCPGSFTADGVC---GSISCGNLALFHWPASSMPHSCV  250
            +F++ S    L+L +P+ GQ+K+CP +    G C   GS  C    L ++ ASSMP +CV
Sbjct  5    VFLLISWVALLSLFTPTQGQIKWCPKTARFPGGCGNNGSQQCLVDFLSNYGASSMPKNCV  64

Query  251  CADAGAGKSLCTCQIVC  301
            C +AG+ + LC+C +VC
Sbjct  65   CKNAGSQR-LCSCDVVC  80



>ref|XP_006384790.1| hypothetical protein POPTR_0004s21130g [Populus trichocarpa]
 gb|ERP62587.1| hypothetical protein POPTR_0004s21130g [Populus trichocarpa]
Length=94

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 46/81 (57%), Gaps = 3/81 (4%)
 Frame = +2

Query  80   MFVIFSLTIFLTLLSPSLGQVKFCPGSFTADGVCGSIS---CGNLALFHWPASSMPHSCV  250
            +F++ S     +L + + GQ+++CP   T  G CG+ S   C    L ++ ASSMP +CV
Sbjct  5    VFLLISCVTLFSLFTRAQGQLRWCPKQVTFPGTCGNNSRQQCLVDFLSNFGASSMPKNCV  64

Query  251  CADAGAGKSLCTCQIVC*NDY  313
            C D+ + +  CTC +VC   Y
Sbjct  65   CRDSRSSQRSCTCDVVCQESY  85



>gb|EPS68835.1| hypothetical protein M569_05933 [Genlisea aurea]
Length=83

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 40/82 (49%), Gaps = 8/82 (10%)
 Frame = +2

Query  80   MFVIFSLTIFLTLLSPSL----GQVKFCPGS-FTADGVCGS---ISCGNLALFHWPASSM  235
            M  I    IFL +L P       Q K+CP       G C S   ++C ++ L ++PAS M
Sbjct  1    MKAIIIPLIFLVVLLPVFTHGQRQFKYCPAPPLARRGSCSSNVDLTCFDIVLANYPASLM  60

Query  236  PHSCVCADAGAGKSLCTCQIVC  301
            P    C D G  KS CT QI+C
Sbjct  61   PTRIRCVDVGPNKSQCTSQIIC  82



>gb|KHN14459.1| Defensin-like protein 242, partial [Glycine soja]
Length=92

 Score = 47.8 bits (112),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 45/86 (52%), Gaps = 9/86 (10%)
 Frame = +2

Query  62   IMK-NSNMFVIFSLTIFLTLLSPSLGQVKFCPGSFTADGVC----GSISCGNLALFHWPA  226
            IMK  S + ++++L     L+S + G+++FCP   T DG C       SC    L    A
Sbjct  8    IMKLRSILLIVWAL---FALISHTYGEIRFCPKEMTLDGSCPLGTSGQSCFLEFLDRLGA  64

Query  227  SSMPHSCVCA-DAGAGKSLCTCQIVC  301
            S+MP +C C  D    K LCTC +VC
Sbjct  65   SAMPMNCSCKDDRTKNKRLCTCNVVC  90



>ref|XP_010056435.1| PREDICTED: defensin-like protein 242 [Eucalyptus grandis]
 gb|KCW73159.1| hypothetical protein EUGRSUZ_E01612 [Eucalyptus grandis]
Length=103

 Score = 47.8 bits (112),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 39/83 (47%), Gaps = 4/83 (5%)
 Frame = +2

Query  62   IMKNSNMFVIFSLTIFLTLLSPSLGQVKFCPGSFTADGVC---GSISCGNLALFHWPASS  232
            IM+ S +  +F+L +   L+  S G   FC    T DG C   GS  C    L    A +
Sbjct  12   IMRKSVILTVFALVLISGLVDLSKGDPYFCRKEKTYDGACSKDGSYQCALKFLNDLGARA  71

Query  233  MPHSCVCADAGAGKSLCTCQIVC  301
            MP  C+C    A + LC C +VC
Sbjct  72   MPQKCICI-PKASQQLCNCLVVC  93



>gb|KHN13787.1| Putative defensin-like protein 244 [Glycine soja]
Length=109

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 45/86 (52%), Gaps = 9/86 (10%)
 Frame = +2

Query  62   IMK-NSNMFVIFSLTIFLTLLSPSLGQVKFCPGSFTADGVC----GSISCGNLALFHWPA  226
            IMK  S + ++++L     LLS + G+++FCP   T DG C       SC    L    A
Sbjct  25   IMKLRSILLIVWAL---FALLSHAYGEIRFCPKEMTLDGSCPLGTSGESCFLEFLNRLGA  81

Query  227  SSMPHSCVCADAGA-GKSLCTCQIVC  301
            S+MP +C C D  +  K  CTC +VC
Sbjct  82   SAMPMNCSCKDDPSHNKRQCTCNVVC  107



>gb|KHG20925.1| Defensin protein [Gossypium arboreum]
Length=83

 Score = 45.1 bits (105),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 38/82 (46%), Gaps = 3/82 (4%)
 Frame = +2

Query  65   MKNSNMFVIFSLTIFLTLLSPSLGQVKFCPGSFTADGVC---GSISCGNLALFHWPASSM  235
            MK      I    + L LLSPS G +KFCP +    G C   G+  C       + AS+M
Sbjct  1    MKKYIAIPILCTLLLLALLSPSKGDLKFCPTTMQISGPCGPNGAFECFEAINAKYGASAM  60

Query  236  PHSCVCADAGAGKSLCTCQIVC  301
               C C D  A + LC C IVC
Sbjct  61   AQRCSCKDLSANEHLCQCYIVC  82



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 528968723284