BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c10361_g1_i1 len=720 path=[698:0-496 1195:497-719]

Length=720
                                                                      Score     E

ref|XP_009760407.1|  PREDICTED: thiosulfate sulfurtransferase 18-...    159   3e-45   
ref|XP_009760406.1|  PREDICTED: thiosulfate sulfurtransferase 18-...    159   7e-45   
ref|XP_006340747.1|  PREDICTED: thiosulfate sulfurtransferase 18-...    158   7e-45   
ref|XP_009607712.1|  PREDICTED: thiosulfate sulfurtransferase 18-...    156   4e-44   
ref|XP_009607709.1|  PREDICTED: thiosulfate sulfurtransferase 18-...    156   6e-44   
ref|XP_004232500.1|  PREDICTED: thiosulfate sulfurtransferase 18 ...    154   3e-43   
emb|CDP01882.1|  unnamed protein product                                153   7e-43   
ref|XP_010316426.1|  PREDICTED: thiosulfate sulfurtransferase 18 ...    153   7e-43   
ref|XP_009607710.1|  PREDICTED: thiosulfate sulfurtransferase 18-...    148   5e-41   
ref|XP_010113335.1|  hypothetical protein L484_026666                   142   1e-38   
gb|EYU30797.1|  hypothetical protein MIMGU_mgv1a022391mg                141   2e-38   
gb|EPS59300.1|  hypothetical protein M569_15510                         137   5e-37   
ref|XP_010056098.1|  PREDICTED: rhodanese-like domain-containing ...    135   5e-36   
ref|XP_007217853.1|  hypothetical protein PRUPE_ppa024101mg             135   5e-36   
ref|XP_010933323.1|  PREDICTED: rhodanese-like domain-containing ...    134   1e-35   
ref|XP_008357978.1|  PREDICTED: rhodanese-like domain-containing ...    133   2e-35   
ref|XP_010920152.1|  PREDICTED: thiosulfate sulfurtransferase 18-...    132   5e-35   
ref|XP_010920153.1|  PREDICTED: thiosulfate sulfurtransferase 18-...    132   5e-35   
ref|XP_010920151.1|  PREDICTED: thiosulfate sulfurtransferase 18-...    133   6e-35   
ref|XP_008788413.1|  PREDICTED: rhodanese-like domain-containing ...    131   2e-34   
ref|XP_003517169.1|  PREDICTED: rhodanese-like domain-containing ...    131   3e-34   
ref|XP_011033562.1|  PREDICTED: rhodanese-like domain-containing ...    130   4e-34   
ref|XP_002321016.1|  senescence-associated family protein               130   4e-34   Populus trichocarpa [western balsam poplar]
ref|XP_010679917.1|  PREDICTED: thiosulfate sulfurtransferase 18-...    130   4e-34   
ref|XP_004956760.1|  PREDICTED: thiosulfate sulfurtransferase 16,...    130   4e-34   
ref|XP_003547926.1|  PREDICTED: rhodanese-like domain-containing ...    130   5e-34   
ref|XP_010266801.1|  PREDICTED: thiosulfate sulfurtransferase 18-...    130   5e-34   
ref|XP_010040077.1|  PREDICTED: thiosulfate sulfurtransferase 18-...    130   5e-34   
ref|XP_009363483.1|  PREDICTED: thiosulfate sulfurtransferase 18-...    130   6e-34   
gb|AFW57912.1|  hypothetical protein ZEAMMB73_085243                    130   8e-34   
ref|XP_008788415.1|  PREDICTED: rhodanese-like domain-containing ...    129   8e-34   
gb|ACG42642.1|  senescence-associated protein DIN1                      130   9e-34   Zea mays [maize]
ref|XP_009401908.1|  PREDICTED: rhodanese-like domain-containing ...    129   9e-34   
ref|NP_001152690.1|  senescence-associated protein DIN1 precursor       130   9e-34   Zea mays [maize]
ref|XP_010679915.1|  PREDICTED: thiosulfate sulfurtransferase 18-...    130   1e-33   
ref|XP_008781000.1|  PREDICTED: thiosulfate sulfurtransferase 18-...    129   1e-33   
ref|XP_008229745.1|  PREDICTED: rhodanese-like domain-containing ...    129   1e-33   
ref|XP_004956761.1|  PREDICTED: thiosulfate sulfurtransferase 16,...    129   2e-33   
ref|XP_009401907.1|  PREDICTED: thiosulfate sulfurtransferase 18-...    129   2e-33   
ref|XP_010246862.1|  PREDICTED: receptor homology region, transme...    134   5e-33   
ref|XP_006846543.1|  hypothetical protein AMTR_s00018p00204090          130   7e-33   
ref|NP_001240207.1|  uncharacterized protein LOC100803436 precursor     127   9e-33   
ref|XP_010246845.1|  PREDICTED: rhodanese-like domain-containing ...    127   9e-33   
ref|XP_010246847.1|  PREDICTED: rhodanese-like domain-containing ...    127   1e-32   
ref|XP_008457677.1|  PREDICTED: rhodanese-like domain-containing ...    125   2e-32   
ref|XP_009379383.1|  PREDICTED: thiosulfate sulfurtransferase 18-...    126   4e-32   
dbj|BAD07813.1|  putative senescence-associated protein                 125   5e-32   Oryza sativa Japonica Group [Japonica rice]
gb|EEC72290.1|  hypothetical protein OsI_05463                          125   6e-32   Oryza sativa Indica Group [Indian rice]
ref|NP_001052310.1|  Os04g0249600                                       125   6e-32   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006486856.1|  PREDICTED: LOW QUALITY PROTEIN: rhodanese-li...    125   6e-32   
ref|XP_009379384.1|  PREDICTED: thiosulfate sulfurtransferase 18-...    125   7e-32   
ref|XP_006652129.1|  PREDICTED: thiosulfate sulfurtransferase 18-...    125   9e-32   
ref|XP_006574329.1|  PREDICTED: uncharacterized protein LOC100305...    125   9e-32   
ref|XP_010531545.1|  PREDICTED: rhodanese-like domain-containing ...    124   1e-31   
ref|XP_007156171.1|  hypothetical protein PHAVU_003G264200g             125   2e-31   
ref|NP_001045596.1|  Os02g0102300                                       123   2e-31   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007202627.1|  hypothetical protein PRUPE_ppa011976mg             125   2e-31   
gb|KHN00466.1|  Senescence-associated protein DIN1                      124   2e-31   
ref|XP_002265009.1|  PREDICTED: thiosulfate sulfurtransferase 18 ...    122   4e-31   Vitis vinifera
ref|XP_010246846.1|  PREDICTED: rhodanese-like domain-containing ...    122   5e-31   
ref|XP_008457676.1|  PREDICTED: rhodanese-like domain-containing ...    122   5e-31   
ref|XP_006648201.1|  PREDICTED: rhodanese-like domain-containing ...    121   6e-31   
ref|XP_002300675.2|  hypothetical protein POPTR_0002s01630g             122   8e-31   Populus trichocarpa [western balsam poplar]
ref|XP_004509372.1|  PREDICTED: rhodanese-like domain-containing ...    121   1e-30   
ref|XP_010550490.1|  PREDICTED: thiosulfate sulfurtransferase 16,...    122   1e-30   
ref|XP_006409311.1|  hypothetical protein EUTSA_v10022902mg             121   1e-30   
ref|XP_008394158.1|  PREDICTED: thiosulfate sulfurtransferase 18 ...    122   1e-30   
ref|XP_010690386.1|  PREDICTED: rhodanese-like domain-containing ...    121   1e-30   
ref|XP_008363085.1|  PREDICTED: thiosulfate sulfurtransferase 18-...    121   2e-30   
ref|XP_010649014.1|  PREDICTED: thiosulfate sulfurtransferase 18 ...    121   2e-30   
ref|XP_006393790.1|  hypothetical protein EUTSA_v10005068mg             120   2e-30   
gb|KDO71244.1|  hypothetical protein CISIN_1g031752mg                   120   3e-30   
ref|NP_001236988.1|  uncharacterized protein LOC100305809               121   3e-30   
ref|XP_008394151.1|  PREDICTED: thiosulfate sulfurtransferase 18 ...    121   3e-30   
ref|XP_008363084.1|  PREDICTED: thiosulfate sulfurtransferase 18-...    121   3e-30   
gb|KDP29630.1|  hypothetical protein JCGZ_18792                         120   3e-30   
ref|XP_011078919.1|  PREDICTED: thiosulfate sulfurtransferase 18-...    121   4e-30   
ref|XP_006347264.1|  PREDICTED: rhodanese-like domain-containing ...    119   5e-30   
gb|KDO71245.1|  hypothetical protein CISIN_1g031752mg                   120   5e-30   
ref|XP_004951181.1|  PREDICTED: thiosulfate sulfurtransferase 18-...    119   7e-30   
ref|XP_010063091.1|  PREDICTED: thiosulfate sulfurtransferase 16,...    120   7e-30   
gb|ABK21219.1|  unknown                                                 119   7e-30   Picea sitchensis
ref|XP_010266068.1|  PREDICTED: thiosulfate sulfurtransferase 16,...    120   9e-30   
ref|XP_010112875.1|  hypothetical protein L484_017711                   119   1e-29   
gb|AAP37665.1|  At2g21045                                               119   1e-29   Arabidopsis thaliana [mouse-ear cress]
gb|KDP46782.1|  hypothetical protein JCGZ_06570                         118   1e-29   
ref|XP_002530729.1|  Senescence-associated protein DIN1, putative       120   1e-29   Ricinus communis
ref|XP_001766103.1|  predicted protein                                  120   2e-29   
emb|CBI35721.3|  unnamed protein product                                119   2e-29   
ref|XP_010466087.1|  PREDICTED: thiosulfate sulfurtransferase 16,...    117   2e-29   
ref|XP_011078998.1|  PREDICTED: thiosulfate sulfurtransferase 16,...    119   2e-29   
ref|XP_006466965.1|  PREDICTED: thiosulfate sulfurtransferase 18-...    119   2e-29   
ref|XP_004303928.1|  PREDICTED: rhodanese-like domain-containing ...    118   2e-29   
ref|NP_565497.3|  rhodanese-like domain-containing protein              119   2e-29   Arabidopsis thaliana [mouse-ear cress]
dbj|BAE99773.1|  hypothetical protein                                   119   2e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002271073.3|  PREDICTED: thiosulfate sulfurtransferase 16,...    119   3e-29   Vitis vinifera
ref|XP_010428997.1|  PREDICTED: rhodanese-like domain-containing ...    118   3e-29   
ref|XP_007046665.1|  Rhodanese/Cell cycle control phosphatase sup...    120   3e-29   
ref|XP_003629289.1|  Thiosulfate sulfurtransferase                      117   3e-29   
ref|XP_006828873.1|  hypothetical protein AMTR_s00001p00174820          117   4e-29   
ref|XP_009769190.1|  PREDICTED: thiosulfate sulfurtransferase 16,...    119   4e-29   
gb|KFK40167.1|  hypothetical protein AALP_AA3G339400                    117   5e-29   
ref|XP_009611850.1|  PREDICTED: thiosulfate sulfurtransferase 16,...    118   6e-29   
gb|KHG27807.1|  Thiosulfate sulfurtransferase, chloroplastic -lik...    117   7e-29   
ref|XP_009382056.1|  PREDICTED: thiosulfate sulfurtransferase 16,...    118   8e-29   
ref|XP_006393789.1|  hypothetical protein EUTSA_v10005068mg             115   9e-29   
ref|NP_851278.1|  thiosulfate sulfurtransferase 16                      115   1e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002878530.1|  predicted protein                                  116   1e-28   
gb|KHN46455.1|  Thiosulfate sulfurtransferase, chloroplastic            116   1e-28   
ref|XP_010444848.1|  PREDICTED: thiosulfate sulfurtransferase 16,...    115   1e-28   
ref|XP_004967296.1|  PREDICTED: senescence-associated protein DIN...    117   1e-28   
ref|XP_010472080.1|  PREDICTED: rhodanese-like domain-containing ...    115   2e-28   
ref|XP_010416844.1|  PREDICTED: rhodanese-like domain-containing ...    115   2e-28   
ref|XP_010683028.1|  PREDICTED: thiosulfate sulfurtransferase 16,...    117   2e-28   
gb|AFK36781.1|  unknown                                                 115   3e-28   
gb|AFK45976.1|  unknown                                                 115   3e-28   
gb|ACA79924.1|  chloroplast N receptor-interacting protein 1            116   3e-28   Nicotiana benthamiana
ref|XP_008812021.1|  PREDICTED: rhodanese-like domain-containing ...    114   3e-28   
ref|XP_009612115.1|  PREDICTED: rhodanese-like domain-containing ...    115   3e-28   
ref|XP_011034939.1|  PREDICTED: thiosulfate sulfurtransferase 16,...    116   3e-28   
ref|XP_010547424.1|  PREDICTED: thiosulfate sulfurtransferase 18-...    114   4e-28   
ref|XP_007017932.1|  Rhodanese/Cell cycle control phosphatase sup...    116   4e-28   
ref|XP_009124574.1|  PREDICTED: rhodanese-like domain-containing ...    115   4e-28   
ref|XP_006425437.1|  hypothetical protein CICLE_v10026691mg             114   4e-28   
emb|CDY07813.1|  BnaC03g48090D                                          115   5e-28   
gb|AII82181.1|  arsenate reductase                                      115   5e-28   
ref|XP_007131527.1|  hypothetical protein PHAVU_011G020400g             114   5e-28   
ref|XP_010547423.1|  PREDICTED: thiosulfate sulfurtransferase 18-...    114   5e-28   
gb|AFK48571.1|  unknown                                                 114   6e-28   
ref|XP_009803106.1|  PREDICTED: rhodanese-like domain-containing ...    114   6e-28   
ref|XP_009121118.1|  PREDICTED: rhodanese-like domain-containing ...    114   7e-28   
ref|XP_003612194.1|  Thiosulfate sulfurtransferase                      114   7e-28   
ref|XP_008241912.1|  PREDICTED: receptor homology region, transme...    120   8e-28   
ref|XP_006425434.1|  hypothetical protein CICLE_v10026691mg             114   8e-28   
ref|NP_565426.2|  rhodanese-like domain-containing protein 17           114   9e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010466093.1|  PREDICTED: thiosulfate sulfurtransferase 16,...    113   9e-28   
gb|AII82177.1|  arsenate reductase                                      114   9e-28   
gb|KHN41852.1|  Senescence-associated protein DIN1                      115   1e-27   
gb|AII82195.1|  arsenate reductase                                      114   1e-27   
emb|CDY49429.1|  BnaC07g06480D                                          114   1e-27   
ref|XP_002866770.1|  hypothetical protein ARALYDRAFT_496998             113   1e-27   
ref|XP_004147071.1|  PREDICTED: rhodanese-like domain-containing ...    113   1e-27   
ref|XP_004513263.1|  PREDICTED: rhodanese-like domain-containing ...    113   1e-27   
ref|XP_011100158.1|  PREDICTED: thiosulfate sulfurtransferase 18-...    113   1e-27   
gb|EYU23742.1|  hypothetical protein MIMGU_mgv1a018856mg                114   1e-27   
ref|XP_002265164.1|  PREDICTED: thiosulfate sulfurtransferase 18        113   1e-27   Vitis vinifera
ref|XP_003593790.1|  Thiosulfate sulfurtransferase                      113   1e-27   
ref|XP_009112268.1|  PREDICTED: thiosulfate sulfurtransferase 16,...    112   1e-27   
gb|KHG29017.1|  Senescence-associated DIN1                              114   2e-27   
ref|XP_006296348.1|  hypothetical protein CARUB_v10025520mg             113   2e-27   
ref|XP_010316446.1|  PREDICTED: thiosulfate sulfurtransferase 16,...    114   2e-27   
ref|XP_010905228.1|  PREDICTED: thiosulfate sulfurtransferase 16,...    114   2e-27   
ref|XP_004232533.1|  PREDICTED: thiosulfate sulfurtransferase 16,...    114   2e-27   
pdb|1TQ1|A  Chain A, Solution Structure Of At5g66040, A Putative ...    112   2e-27   
ref|XP_010905226.1|  PREDICTED: thiosulfate sulfurtransferase 16,...    114   2e-27   
ref|XP_011022238.1|  PREDICTED: thiosulfate sulfurtransferase 16,...    114   3e-27   
gb|AHI85731.1|  DIN1                                                    114   3e-27   
ref|XP_003573641.1|  PREDICTED: thiosulfate sulfurtransferase 18-...    112   3e-27   
ref|XP_006300239.1|  hypothetical protein CARUB_v10016479mg             113   3e-27   
gb|AII82187.1|  arsenate reductase                                      113   3e-27   
gb|AII82194.1|  arsenate reductase                                      112   3e-27   
ref|XP_006340791.1|  PREDICTED: rhodanese-like domain-containing ...    114   4e-27   
ref|XP_006340793.1|  PREDICTED: rhodanese-like domain-containing ...    113   4e-27   
ref|XP_006340792.1|  PREDICTED: rhodanese-like domain-containing ...    113   4e-27   
gb|KDP43713.1|  hypothetical protein JCGZ_22340                         113   4e-27   
ref|XP_006409238.1|  hypothetical protein EUTSA_v10022891mg             112   4e-27   
gb|AII82186.1|  arsenate reductase                                      113   4e-27   
gb|ACJ61492.1|  senescence-associated protein                           113   4e-27   
ref|XP_007157959.1|  hypothetical protein PHAVU_002G112600g             113   5e-27   
gb|AII82178.1|  arsenate reductase                                      112   5e-27   
ref|XP_006422627.1|  hypothetical protein CICLE_v10030310mg             111   6e-27   
gb|AII82179.1|  arsenate reductase                                      112   6e-27   
gb|KDO71380.1|  hypothetical protein CISIN_1g029759mg                   112   7e-27   
gb|KDO71381.1|  hypothetical protein CISIN_1g029759mg                   112   7e-27   
ref|NP_001241883.1|  uncharacterized protein LOC100794624               112   7e-27   
ref|XP_006425337.1|  hypothetical protein CICLE_v10026577mg             112   7e-27   
ref|XP_009414423.1|  PREDICTED: thiosulfate sulfurtransferase 16,...    112   7e-27   
gb|EYU18065.1|  hypothetical protein MIMGU_mgv1a014589mg                112   7e-27   
ref|XP_004289086.1|  PREDICTED: E3 ubiquitin-protein ligase RNF13...    117   8e-27   
dbj|BAJ99547.1|  predicted protein                                      112   8e-27   
ref|XP_002886131.1|  predicted protein                                  112   9e-27   
ref|XP_008440833.1|  PREDICTED: thiosulfate sulfurtransferase 18 ...    114   1e-26   
ref|XP_006383076.1|  hypothetical protein POPTR_0005s11330g             113   1e-26   
ref|NP_001235646.1|  uncharacterized protein LOC100305968               112   1e-26   
ref|XP_008811900.1|  PREDICTED: thiosulfate sulfurtransferase 16,...    112   1e-26   
ref|NP_001190631.1|  thiosulfate sulfurtransferase 18                   110   1e-26   
ref|XP_004135023.1|  PREDICTED: thiosulfate sulfurtransferase 18-...    111   2e-26   
ref|XP_007202638.1|  hypothetical protein PRUPE_ppa012088mg             111   2e-26   
ref|XP_010484678.1|  PREDICTED: thiosulfate sulfurtransferase 18-...    110   2e-26   
emb|CDP01831.1|  unnamed protein product                                111   2e-26   
dbj|BAJ92222.1|  predicted protein                                      112   2e-26   
gb|AFK38877.1|  unknown                                                 111   2e-26   
gb|AES65978.2|  rhodanese/cell cycle control phosphatase superfam...    110   3e-26   
ref|XP_006383026.1|  hypothetical protein POPTR_0005s10850g             112   3e-26   
ref|XP_006281331.1|  hypothetical protein CARUB_v10027386mg             109   3e-26   
ref|XP_002970904.1|  hypothetical protein SELMODRAFT_94192              109   3e-26   
emb|CDY18582.1|  BnaA09g08130D                                          109   3e-26   
gb|AAM64406.1|  senescence-associated protein                           110   3e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009382034.1|  PREDICTED: rhodanese-like domain-containing ...    109   3e-26   
ref|XP_008241997.1|  PREDICTED: thiosulfate sulfurtransferase 16,...    111   3e-26   
emb|CDY45212.1|  BnaA07g12780D                                          109   3e-26   
gb|KFK28263.1|  hypothetical protein AALP_AA8G494200                    109   4e-26   
ref|XP_009112267.1|  PREDICTED: thiosulfate sulfurtransferase 16,...    109   4e-26   
ref|XP_010465855.1|  PREDICTED: thiosulfate sulfurtransferase 18 ...    109   4e-26   
ref|XP_010557664.1|  PREDICTED: thiosulfate sulfurtransferase 18        109   4e-26   
ref|XP_010029615.1|  PREDICTED: thiosulfate sulfurtransferase 16,...    110   5e-26   
ref|XP_010413383.1|  PREDICTED: rhodanese-like domain-containing ...    109   6e-26   
ref|XP_010465862.1|  PREDICTED: thiosulfate sulfurtransferase 18 ...    108   7e-26   
ref|NP_001236607.1|  uncharacterized protein LOC100499831               110   7e-26   
gb|KDO68012.1|  hypothetical protein CISIN_1g041947mg                   108   7e-26   
ref|XP_004287760.1|  PREDICTED: rhodanese-like domain-containing ...    110   8e-26   
gb|ACG42699.1|  senescence-associated protein DIN1                      110   8e-26   Zea mays [maize]
gb|KGN48929.1|  hypothetical protein Csa_6G507040                       111   1e-25   
ref|XP_004158864.1|  PREDICTED: thiosulfate sulfurtransferase 18-...    111   1e-25   
ref|XP_001751240.1|  predicted protein                                  108   1e-25   
ref|XP_009103546.1|  PREDICTED: thiosulfate sulfurtransferase 18-...    108   1e-25   
emb|CAA61433.1|  ketoconazole resistent protein                         108   1e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011043231.1|  PREDICTED: receptor homology region, transme...    113   1e-25   
gb|AAX13288.1|  senescence-associated protein                           109   2e-25   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003612270.1|  Senescence-associated protein DIN1                 109   2e-25   
ref|XP_004966491.1|  PREDICTED: senescence-associated protein DIN...    109   2e-25   
emb|CDX81421.1|  BnaC09g08320D                                          107   2e-25   
gb|AAF61174.1|AF245222_1  OP1                                           108   2e-25   Cucumis sativus [cucumbers]
ref|XP_010467583.1|  PREDICTED: rhodanese-like domain-containing ...    108   2e-25   
ref|XP_002969639.1|  hypothetical protein SELMODRAFT_92035              106   2e-25   
ref|NP_001058618.1|  Os06g0725000                                       107   2e-25   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004512145.1|  PREDICTED: thiosulfate sulfurtransferase 18-...    107   3e-25   
ref|XP_002439047.1|  hypothetical protein SORBIDRAFT_10g030520          109   3e-25   Sorghum bicolor [broomcorn]
ref|XP_010239617.1|  PREDICTED: thiosulfate sulfurtransferase 16,...    108   3e-25   
emb|CDY57763.1|  BnaC02g45050D                                          107   3e-25   
ref|XP_003563268.2|  PREDICTED: thiosulfate sulfurtransferase 16,...    108   3e-25   
gb|KDO71378.1|  hypothetical protein CISIN_1g029759mg                   108   3e-25   
dbj|BAD61695.1|  putative Ntdin                                         108   3e-25   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004134838.1|  PREDICTED: rhodanese-like domain-containing ...    108   4e-25   
ref|XP_008344221.1|  PREDICTED: thiosulfate sulfurtransferase 16,...    108   4e-25   
ref|XP_009344812.1|  PREDICTED: thiosulfate sulfurtransferase 16,...    108   4e-25   
ref|XP_007157906.1|  hypothetical protein PHAVU_002G107700g             107   4e-25   
ref|XP_010531128.1|  PREDICTED: rhodanese-like domain-containing ...    107   5e-25   
ref|XP_002439046.1|  hypothetical protein SORBIDRAFT_10g030510          108   5e-25   Sorghum bicolor [broomcorn]
ref|XP_007046569.1|  Beta-galactosidase 3 isoform 1                     107   6e-25   
ref|NP_001032159.1|  thiosulfate sulfurtransferase 18                   106   7e-25   Arabidopsis thaliana [mouse-ear cress]
gb|KDO71377.1|  hypothetical protein CISIN_1g029759mg                   107   1e-24   
ref|XP_008393643.1|  PREDICTED: thiosulfate sulfurtransferase 16,...    107   1e-24   
ref|XP_006393804.1|  hypothetical protein EUTSA_v10005118mg             105   1e-24   
ref|XP_006393791.1|  hypothetical protein EUTSA_v10005068mg             105   2e-24   
ref|XP_003578352.1|  PREDICTED: thiosulfate sulfurtransferase 16,...    105   2e-24   
ref|XP_009337080.1|  PREDICTED: thiosulfate sulfurtransferase 16,...    106   2e-24   
gb|KFK28277.1|  hypothetical protein AALP_AA8G495600                    104   2e-24   
ref|XP_010649017.1|  PREDICTED: rhodanese-like domain-containing ...    105   3e-24   
ref|XP_007022460.1|  Rhodanese/Cell cycle control phosphatase sup...    104   3e-24   
ref|XP_010941376.1|  PREDICTED: rhodanese-like domain-containing ...    105   3e-24   
ref|XP_006412061.1|  hypothetical protein EUTSA_v10026337mg             105   4e-24   
gb|EAZ38327.1|  hypothetical protein OsJ_22702                          105   4e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009130573.1|  PREDICTED: thiosulfate sulfurtransferase 18-...    103   5e-24   
ref|XP_008352420.1|  PREDICTED: thiosulfate sulfurtransferase 16,...    105   7e-24   
ref|XP_010548272.1|  PREDICTED: rhodanese-like domain-containing ...    103   9e-24   
ref|XP_004951828.1|  PREDICTED: thiosulfate sulfurtransferase 18-...    102   1e-23   
ref|XP_008344251.1|  PREDICTED: thiosulfate sulfurtransferase 18-...    102   1e-23   
ref|XP_010446881.1|  PREDICTED: rhodanese-like domain-containing ...    103   1e-23   
ref|XP_006282185.1|  hypothetical protein CARUB_v10028451mg             102   2e-23   
ref|XP_006656506.1|  PREDICTED: rhodanese-like domain-containing ...    103   2e-23   
ref|XP_010935203.1|  PREDICTED: thiosulfate sulfurtransferase 16,...    103   2e-23   
ref|XP_010432233.1|  PREDICTED: rhodanese-like domain-containing ...    103   2e-23   
ref|XP_010935202.1|  PREDICTED: thiosulfate sulfurtransferase 16,...    103   2e-23   
gb|EMT07934.1|  hypothetical protein F775_13839                         102   2e-23   
ref|XP_006284610.1|  hypothetical protein CARUB_v10005841mg             103   2e-23   
ref|XP_010437426.1|  PREDICTED: rhodanese-like domain-containing ...    103   3e-23   
emb|CDX69162.1|  BnaC01g02910D                                          102   3e-23   
ref|XP_007046570.1|  Beta-galactosidase 3 isoform 2                     102   4e-23   
gb|EMS66626.1|  hypothetical protein TRIUR3_18768                       103   4e-23   
emb|CAN72959.1|  hypothetical protein VITISV_010789                     102   5e-23   Vitis vinifera
ref|XP_010322964.1|  PREDICTED: rhodanese-like domain-containing ...    100   5e-23   
ref|XP_006664523.1|  PREDICTED: thiosulfate sulfurtransferase 18-...    101   6e-23   
ref|NP_001045951.2|  Os02g0157600                                       101   6e-23   Oryza sativa Japonica Group [Japonica rice]
gb|AAM61743.1|  senescence-associated protein sen1                      102   6e-23   Arabidopsis thaliana [mouse-ear cress]
ref|NP_195302.1|  senescence-associated protein DIN1                    102   6e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002869062.1|  hypothetical protein ARALYDRAFT_491067             102   7e-23   
ref|XP_004512234.1|  PREDICTED: rhodanese-like domain-containing ...    102   7e-23   
ref|XP_002453123.1|  hypothetical protein SORBIDRAFT_04g000410          102   7e-23   Sorghum bicolor [broomcorn]
ref|XP_008344224.1|  PREDICTED: thiosulfate sulfurtransferase 18-...    100   8e-23   
gb|KFK30202.1|  hypothetical protein AALP_AA7G231500                    102   8e-23   
ref|XP_004512233.1|  PREDICTED: rhodanese-like domain-containing ...    102   8e-23   
ref|XP_008781235.1|  PREDICTED: thiosulfate sulfurtransferase 16,...    102   9e-23   
ref|XP_009150416.1|  PREDICTED: senescence-associated protein DIN...    102   9e-23   
ref|XP_010649016.1|  PREDICTED: thiosulfate sulfurtransferase 18-...    101   1e-22   
ref|XP_003595727.1|  Thiosulfate sulfurtransferase                      100   1e-22   
ref|XP_008677765.1|  PREDICTED: hypothetical protein isoform X1       99.8    2e-22   
dbj|BAD28022.1|  senescence-associated protein-like                     100   2e-22   
ref|XP_010266069.1|  PREDICTED: thiosulfate sulfurtransferase 16,...    100   2e-22   
dbj|BAA20356.1|  din1                                                   100   3e-22   
ref|NP_001232858.1|  hypothetical protein                             98.6    4e-22   
gb|AAA80302.1|  senescence-associated protein                         99.8    5e-22   
ref|XP_004951180.1|  PREDICTED: thiosulfate sulfurtransferase 18-...  98.6    7e-22   
ref|XP_006648324.1|  PREDICTED: rhodanese-like domain-containing ...  98.2    7e-22   
ref|XP_003570950.1|  PREDICTED: thiosulfate sulfurtransferase 16,...  98.2    8e-22   
ref|XP_009130572.1|  PREDICTED: thiosulfate sulfurtransferase 18-...  98.2    8e-22   
ref|NP_001151916.1|  senescence-associated protein DIN1               97.1    1e-21   
ref|XP_008677225.1|  PREDICTED: senescence-associated protein DIN...  96.7    1e-21   
ref|XP_009382033.1|  PREDICTED: rhodanese-like domain-containing ...  96.7    2e-21   
emb|CDX75524.1|  BnaA01g01780D                                        98.2    2e-21   
gb|KDO71248.1|  hypothetical protein CISIN_1g031752mg                 97.1    2e-21   
ref|XP_002451565.1|  hypothetical protein SORBIDRAFT_04g003965        96.3    3e-21   
ref|XP_008781234.1|  PREDICTED: thiosulfate sulfurtransferase 16,...  98.2    3e-21   
gb|EMS63124.1|  hypothetical protein TRIUR3_09958                     97.1    3e-21   
emb|CDY55100.1|  BnaA02g34850D                                        95.9    3e-21   
ref|XP_010466071.1|  PREDICTED: thiosulfate sulfurtransferase 16,...  96.3    3e-21   
sp|P27626.1|DIN1_RAPSA  RecName: Full=Senescence-associated prote...  97.8    3e-21   
emb|CAE03897.2|  OSJNBb0026I12.5                                      95.9    4e-21   
ref|XP_003564690.2|  PREDICTED: thiosulfate sulfurtransferase 18-...  97.8    4e-21   
gb|EEE60618.1|  hypothetical protein OsJ_14035                        95.9    4e-21   
ref|XP_008440882.1|  PREDICTED: thiosulfate sulfurtransferase 16,...  96.7    7e-21   
gb|EAY78001.1|  hypothetical protein OsI_33042                        95.5    9e-21   
ref|XP_001690324.1|  hypothetical protein CHLREDRAFT_144137           95.5    1e-20   
gb|KEH20374.1|  rhodanese-related sulfurtransferase                   93.6    2e-20   
ref|XP_010444847.1|  PREDICTED: thiosulfate sulfurtransferase 16,...  94.7    2e-20   
ref|XP_002952661.1|  hypothetical protein VOLCADRAFT_105650           94.4    3e-20   
ref|XP_010446305.1|  PREDICTED: thiosulfate sulfurtransferase 18-...  93.6    4e-20   
gb|EMS45480.1|  hypothetical protein TRIUR3_02217                     93.2    5e-20   
ref|XP_010466079.1|  PREDICTED: thiosulfate sulfurtransferase 16,...  92.0    1e-19   
ref|XP_002529649.1|  zinc finger protein, putative                    97.4    2e-19   
gb|EMT07933.1|  hypothetical protein F775_28046                       92.0    2e-19   
ref|XP_008442292.1|  PREDICTED: rhodanese-like domain-containing ...  90.9    2e-19   
gb|ABA97967.1|  Rhodanese-like domain containing protein, expressed   91.7    2e-19   
gb|AFW69558.1|  hypothetical protein ZEAMMB73_136647                  92.4    2e-19   
ref|NP_001066667.1|  Os12g0428000                                     92.0    3e-19   
ref|XP_008677227.1|  PREDICTED: senescence-associated protein DIN...  90.5    3e-19   
gb|KDO71383.1|  hypothetical protein CISIN_1g029759mg                 91.7    6e-19   
ref|NP_569030.2|  thiosulfate sulfurtransferase 18                    89.7    1e-18   
ref|XP_010649018.1|  PREDICTED: rhodanese-like domain-containing ...  88.6    2e-18   
gb|AES95229.2|  rhodanese-related sulfurtransferase                   88.6    5e-18   
ref|XP_010029614.1|  PREDICTED: rhodanese-like domain-containing ...  88.2    9e-18   
gb|KEH38050.1|  rhodanese/cell cycle control phosphatase superfam...  85.9    1e-17   
gb|KEH38049.1|  rhodanese/cell cycle control phosphatase superfam...  85.9    2e-17   
gb|KEH38048.1|  rhodanese/cell cycle control phosphatase superfam...  86.3    3e-17   
ref|NP_001148289.1|  senescence-associated protein DIN1               85.1    5e-17   
dbj|BAJ98906.1|  predicted protein                                    84.0    6e-17   
gb|KDO71382.1|  hypothetical protein CISIN_1g029759mg                 85.9    6e-17   
gb|EMT07932.1|  hypothetical protein F775_28045                       84.7    6e-17   
ref|XP_004512232.1|  PREDICTED: rhodanese-like domain-containing ...  85.1    1e-16   
gb|EMT07935.1|  hypothetical protein F775_28047                       82.8    1e-16   
ref|XP_004512231.1|  PREDICTED: rhodanese-like domain-containing ...  85.1    1e-16   
ref|NP_001078497.1|  senescence-associated protein DIN1               84.7    1e-16   
gb|EMT07936.1|  hypothetical protein F775_42974                       82.4    2e-16   
gb|AFW66845.1|  hypothetical protein ZEAMMB73_933749                  81.6    3e-16   
ref|NP_001078496.1|  senescence-associated protein DIN1               83.6    3e-16   
ref|XP_010432234.1|  PREDICTED: rhodanese-like domain-containing ...  83.6    4e-16   
ref|WP_012830578.1|  rhodanese                                        82.8    4e-16   
ref|XP_010437427.1|  PREDICTED: rhodanese-like domain-containing ...  83.2    5e-16   
ref|XP_003596987.1|  ATP-dependent RNA helicase dhh1                  86.7    5e-16   
ref|XP_009150484.1|  PREDICTED: senescence-associated protein DIN...  82.8    7e-16   
ref|XP_005845781.1|  hypothetical protein CHLNCDRAFT_25566            80.9    7e-16   
ref|XP_008440834.1|  PREDICTED: uncharacterized protein LOC103485...  82.4    2e-15   
ref|XP_004512146.1|  PREDICTED: thiosulfate sulfurtransferase 18-...  79.7    3e-15   
ref|XP_005707362.1|  senescence-associated protein Din1-like protein  80.1    4e-15   
ref|XP_008677224.1|  PREDICTED: senescence-associated protein DIN...  79.0    6e-15   
emb|CBI17359.3|  unnamed protein product                              79.0    7e-15   
ref|XP_010649019.1|  PREDICTED: rhodanese-like domain-containing ...  76.3    2e-14   
ref|WP_012233061.1|  rhodanese-like domain-containing protein         76.6    5e-14   
gb|EMS68434.1|  hypothetical protein TRIUR3_10076                     77.0    6e-14   
ref|WP_020732633.1|  hypothetical protein                             76.3    7e-14   
gb|EYF03350.1|  Hypothetical protein CAP_5682                         75.5    1e-13   
ref|XP_005644728.1|  Rhodanese-like protein                           75.1    1e-13   
ref|XP_002862441.1|  predicted protein                                73.6    2e-13   
gb|KDO71249.1|  hypothetical protein CISIN_1g031752mg                 73.9    2e-13   
gb|EMT19617.1|  hypothetical protein F775_23512                       72.8    5e-13   
gb|KEH27592.1|  rhodanese-related sulfurtransferase                   73.2    6e-13   
ref|XP_006466967.1|  PREDICTED: thiosulfate sulfurtransferase 18-...  72.4    7e-13   
ref|WP_034257106.1|  hypothetical protein                             72.0    8e-13   
gb|KCZ72772.1|  Rhodanese-related sulfurtransferase                   72.8    9e-13   
emb|CBJ27678.1|  putative Ntdin                                       72.4    9e-13   
gb|AFW66844.1|  hypothetical protein ZEAMMB73_933749                  70.1    2e-12   
ref|WP_011032304.1|  molybdopterin biosynthesis protein               73.2    3e-12   
ref|WP_015411038.1|  hypothetical protein                             73.2    3e-12   
ref|WP_012458886.1|  sulfurtransferase                                70.5    4e-12   
ref|XP_007046571.1|  Beta-galactosidase 3 isoform 3                   71.6    5e-12   
ref|XP_009777105.1|  PREDICTED: LOW QUALITY PROTEIN: rhodanese-li...  70.1    5e-12   
ref|WP_035801696.1|  hypothetical protein                             70.1    6e-12   
ref|WP_026744571.1|  hypothetical protein                             70.5    6e-12   
gb|EYU30415.1|  hypothetical protein MIMGU_mgv1a021411mg              68.9    6e-12   
ref|XP_005710468.1|  unnamed protein product                          73.6    6e-12   
ref|WP_033375876.1|  rhodanese                                        69.7    1e-11   
gb|EEC69177.1|  hypothetical protein OsI_38147                        68.9    1e-11   
ref|XP_005845895.1|  hypothetical protein CHLNCDRAFT_136465           68.6    2e-11   
ref|WP_007622610.1|  phage shock protein E                            68.9    2e-11   
ref|WP_011499608.1|  rhodanese-like protein                           69.3    2e-11   
ref|WP_017365499.1|  sulfurtransferase                                68.9    2e-11   
ref|WP_008488381.1|  sulfurtransferase                                68.9    2e-11   
ref|XP_002960531.1|  hypothetical protein SELMODRAFT_402869           68.9    2e-11   
gb|KDO71384.1|  hypothetical protein CISIN_1g029759mg                 68.9    2e-11   
ref|WP_034732058.1|  sulfurtransferase                                68.6    2e-11   
ref|WP_010961069.1|  sulfurtransferase                                68.2    3e-11   
ref|WP_026585657.1|  sulfurtransferase                                68.2    3e-11   
ref|WP_011033837.1|  hypothetical protein                             68.6    3e-11   
ref|WP_021903551.1|  rhodanese-like protein                           68.2    4e-11   
ref|XP_005845782.1|  hypothetical protein CHLNCDRAFT_136471           67.8    4e-11   
gb|EPB91577.1|  hypothetical protein HMPREF1544_01499                 67.8    4e-11   
ref|WP_013644966.1|  rhodanese-like protein                           67.8    4e-11   
ref|WP_011020791.1|  hypothetical protein                             68.2    5e-11   
ref|WP_028303498.1|  hypothetical protein                             67.4    7e-11   
ref|WP_033156781.1|  sulfurtransferase                                67.4    7e-11   
ref|WP_013683050.1|  sulfurtransferase                                67.4    9e-11   
ref|WP_006323419.1|  MULTISPECIES: rhodanese-related sulfurtransf...  66.6    1e-10   
ref|NP_569026.2|  thiosulfate sulfurtransferase 16                    65.1    1e-10   
ref|WP_025002655.1|  hypothetical protein                             66.6    1e-10   
ref|WP_023627365.1|  hypothetical protein                             66.6    1e-10   
ref|XP_010113274.1|  hypothetical protein L484_026603                 66.6    1e-10   
ref|XP_010484693.1|  PREDICTED: thiosulfate sulfurtransferase 16,...  65.1    1e-10   
ref|XP_009385251.1|  PREDICTED: thiosulfate sulfurtransferase 16,...  65.5    2e-10   
ref|XP_005538324.1|  similar to senescence-associated protein Din1    67.0    2e-10   
ref|XP_009034789.1|  hypothetical protein AURANDRAFT_8667             65.5    2e-10   
ref|WP_010331185.1|  sulfurtransferase                                65.9    2e-10   
ref|WP_007546673.1|  sulfurtransferase                                65.9    2e-10   
ref|WP_035383771.1|  rhodanese                                        65.9    2e-10   
ref|WP_007641487.1|  hypothetical protein                             65.9    3e-10   
gb|AFW66846.1|  hypothetical protein ZEAMMB73_933749                  64.7    3e-10   
ref|WP_008485862.1|  phage shock protein E                            65.5    3e-10   
ref|WP_006956686.1|  sulfurtransferase                                65.5    3e-10   
ref|WP_021843773.1|  rhodanese-like protein                           65.5    3e-10   
ref|WP_008865388.1|  Rhodanese domain protein                         64.7    4e-10   
ref|WP_039075764.1|  sulfurtransferase                                65.1    4e-10   
ref|WP_014146861.1|  sulfurtransferase                                65.1    4e-10   
ref|WP_036975627.1|  phage-shock protein                              64.7    5e-10   
ref|XP_011078927.1|  PREDICTED: thiosulfate sulfurtransferase 18-...  65.5    5e-10   
ref|WP_036278093.1|  sulfurtransferase                                65.1    5e-10   
ref|WP_013819274.1|  sulfurtransferase                                64.7    5e-10   
ref|WP_017839502.1|  sulfurtransferase                                64.7    6e-10   
gb|ESP94027.1|  rhodanese-related sulfurtransferase                   64.7    6e-10   
ref|XP_006648325.1|  PREDICTED: rhodanese-like domain-containing ...  63.9    6e-10   
ref|XP_009413779.1|  PREDICTED: thiosulfate sulfurtransferase 18-...  63.5    7e-10   
ref|WP_026161675.1|  rhodanese                                        64.3    7e-10   
ref|WP_027156589.1|  sulfurtransferase                                64.3    7e-10   
ref|WP_029938903.1|  sulfurtransferase                                64.3    8e-10   
ref|WP_012120024.1|  sulfurtransferase                                63.9    8e-10   
ref|WP_027405294.1|  hypothetical protein                             64.3    8e-10   
gb|AII59933.1|  sulfurtransferase                                     64.3    9e-10   
ref|XP_002867484.1|  hypothetical protein ARALYDRAFT_492014           65.5    1e-09   
ref|WP_019418266.1|  hypothetical protein                             63.9    1e-09   
ref|WP_019614665.1|  hypothetical protein                             63.9    1e-09   
ref|XP_005702906.1|  senescence-associated protein Din1-like protein  63.9    1e-09   
ref|NP_567785.1|  rhodanese-like domain-containing protein            65.5    1e-09   
dbj|GAM15345.1|  rhodanese-like domain protein                        63.9    1e-09   
ref|XP_006495283.1|  PREDICTED: senescence-associated protein DIN...  62.8    1e-09   
ref|WP_027078313.1|  sulfurtransferase                                63.9    1e-09   
ref|WP_037534069.1|  hypothetical protein                             65.1    1e-09   
gb|AAM62459.1|  unknown                                               65.5    1e-09   
gb|AGC71168.1|  rhodanese-like protein                                63.9    1e-09   
ref|XP_005838944.1|  hypothetical protein GUITHDRAFT_102576           63.5    1e-09   
ref|WP_019806791.1|  hypothetical protein                             63.9    1e-09   
ref|WP_003331485.1|  Rhodanese-related sulfurtransferase              63.9    1e-09   
dbj|BAO43284.1|  conserved hypothetical protein                       63.9    1e-09   
ref|WP_027853866.1|  sulfurtransferase                                63.5    1e-09   
ref|WP_022982702.1|  sulfurtransferase                                63.5    1e-09   
ref|XP_010520947.1|  PREDICTED: rhodanese-like domain-containing ...  65.1    1e-09   
ref|WP_010937078.1|  sulfurtransferase                                63.9    1e-09   
ref|WP_026860355.1|  sulfurtransferase                                63.5    1e-09   
ref|WP_039701973.1|  molybdopterin biosynthesis protein MoeB          67.0    2e-09   
ref|WP_012155839.1|  sulfurtransferase                                63.5    2e-09   
dbj|GAK49610.1|  Rhodanese domain protein                             63.9    2e-09   
ref|WP_037429453.1|  rhodanese                                        63.2    2e-09   
ref|WP_003398164.1|  Rhodanese-related sulfurtransferase              63.2    2e-09   
emb|CAB38282.1|  hypothetical protein                                 65.1    2e-09   
ref|WP_034335397.1|  hypothetical protein                             63.5    2e-09   
ref|WP_032099782.1|  sulfurtransferase                                63.2    2e-09   
ref|XP_004146237.1|  PREDICTED: rhodanese-like domain-containing ...  65.1    2e-09   
ref|WP_019577037.1|  hypothetical protein                             63.2    2e-09   
ref|WP_013818480.1|  sulfurtransferase                                63.2    2e-09   
ref|WP_035193481.1|  sulfurtransferase                                63.2    2e-09   
emb|CDP05019.1|  unnamed protein product                              65.1    2e-09   
ref|WP_036218576.1|  sulfurtransferase                                62.8    2e-09   
gb|KFK30939.1|  hypothetical protein AALP_AA6G046200                  64.3    3e-09   
ref|XP_001766240.1|  predicted protein                                63.5    3e-09   
ref|WP_014707364.1|  sulfurtransferase                                62.8    3e-09   
gb|KHG04011.1|  Thiosulfate sulfurtransferase, chloroplastic -lik...  64.7    3e-09   
ref|WP_028302334.1|  hypothetical protein                             62.8    3e-09   
ref|WP_035383499.1|  sulfurtransferase                                62.8    3e-09   
ref|WP_020211574.1|  hypothetical protein                             62.8    3e-09   
ref|XP_006480982.1|  PREDICTED: senescence-associated protein DIN...  61.2    3e-09   
ref|WP_015407911.1|  rhodanese-like domain containing protein         62.8    3e-09   
ref|WP_021094595.1|  Rhodanese-related sulfurtransferase              62.4    4e-09   
gb|EMT22157.1|  hypothetical protein F775_13880                       64.3    4e-09   
emb|CDY55347.1|  BnaAnng13830D                                        63.9    4e-09   
ref|WP_005599713.1|  thiosulfate sulfurtransferase                    62.0    4e-09   
ref|WP_027340357.1|  sulfurtransferase                                62.0    4e-09   
ref|WP_011309749.1|  sulfurtransferase                                62.8    4e-09   
ref|WP_013147271.1|  membrane protein                                 63.2    4e-09   
ref|WP_011234931.1|  MULTISPECIES: sulfurtransferase                  62.4    4e-09   
ref|WP_029387887.1|  hypothetical protein                             62.0    4e-09   
ref|WP_024304191.1|  sulfurtransferase                                62.4    4e-09   
ref|WP_012034144.1|  sulfurtransferase                                62.8    4e-09   
ref|WP_012008767.1|  sulfurtransferase                                62.0    4e-09   
ref|WP_019878608.1|  hypothetical protein                             62.4    4e-09   
ref|WP_014702801.1|  sulfurtransferase                                62.0    5e-09   
ref|WP_038146890.1|  hypothetical protein                             62.0    5e-09   
ref|WP_018278414.1|  hypothetical protein                             62.0    5e-09   
ref|WP_013029346.1|  sulfurtransferase                                62.4    5e-09   
gb|KHF29593.1|  Thiosulfate sulfurtransferase PspE precursor          62.0    5e-09   
ref|WP_020167816.1|  MULTISPECIES: membrane protein                   62.4    5e-09   
ref|WP_020483752.1|  sulfurtransferase                                62.4    5e-09   
gb|EMS63125.1|  hypothetical protein TRIUR3_09959                     61.6    5e-09   
ref|WP_012871157.1|  sulfurtransferase                                63.2    5e-09   



>ref|XP_009760407.1| PREDICTED: thiosulfate sulfurtransferase 18-like isoform X2 [Nicotiana 
sylvestris]
Length=129

 Score =   159 bits (401),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 89/117 (76%), Gaps = 1/117 (1%)
 Frame = +2

Query  227  RIDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQ  406
            ++  VDVH A+ LL  GHRYLDVRTEEEFKK HVEN+ NIPYM  N   GR KNPKFM Q
Sbjct  11   QVVTVDVHAARHLLRSGHRYLDVRTEEEFKKEHVENSENIPYMF-NTPQGRVKNPKFMEQ  69

Query  407  VLSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHYPN  577
            V +A GKEEKLVVGC+SGVRS+YA  DLL+ +FKHV NM GG+ AWV+ G  V+ P 
Sbjct  70   VSAAFGKEEKLVVGCQSGVRSLYATTDLLTVEFKHVSNMGGGYQAWVESGFAVNKPQ  126



>ref|XP_009760406.1| PREDICTED: thiosulfate sulfurtransferase 18-like isoform X1 [Nicotiana 
sylvestris]
Length=147

 Score =   159 bits (401),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 77/116 (66%), Positives = 89/116 (77%), Gaps = 1/116 (1%)
 Frame = +2

Query  227  RIDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQ  406
            ++  VDVH A+ LL  GHRYLDVRTEEEFKK HVEN+ NIPYM  N   GR KNPKFM Q
Sbjct  29   QVVTVDVHAARHLLRSGHRYLDVRTEEEFKKEHVENSENIPYMF-NTPQGRVKNPKFMEQ  87

Query  407  VLSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHYP  574
            V +A GKEEKLVVGC+SGVRS+YA  DLL+ +FKHV NM GG+ AWV+ G  V+ P
Sbjct  88   VSAAFGKEEKLVVGCQSGVRSLYATTDLLTVEFKHVSNMGGGYQAWVESGFAVNKP  143



>ref|XP_006340747.1| PREDICTED: thiosulfate sulfurtransferase 18-like [Solanum tuberosum]
Length=140

 Score =   158 bits (400),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 90/119 (76%), Gaps = 1/119 (1%)
 Frame = +2

Query  218  AGLRIDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKF  397
            +G  +  VDVH A++L+  GHRYLDVRTEEEFKKGHV N+LNIPYM  N   GR KNPKF
Sbjct  19   SGAEVVTVDVHAARQLIQSGHRYLDVRTEEEFKKGHVHNSLNIPYMF-NTPRGRVKNPKF  77

Query  398  MNQVLSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHYP  574
            + QV SA  KEEKL+VGC+SGVRS+YA  DLL+  FKHV NM GG+ AWV+ G  V+ P
Sbjct  78   IEQVSSACDKEEKLIVGCQSGVRSLYATTDLLNADFKHVSNMGGGYLAWVENGFAVNKP  136



>ref|XP_009607712.1| PREDICTED: thiosulfate sulfurtransferase 18-like isoform X3 [Nicotiana 
tomentosiformis]
Length=128

 Score =   156 bits (394),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 88/113 (78%), Gaps = 2/113 (2%)
 Frame = +2

Query  239  VDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLSA  418
            VDVH A+ LL  GHRYLDVRTEEEFKKGHVEN+LNIPYM  N   GR KN KFM QV +A
Sbjct  15   VDVHAARHLLRSGHRYLDVRTEEEFKKGHVENSLNIPYM-FNTPQGRVKNQKFMEQVSAA  73

Query  419  IGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHYPN  577
             GKEEKLVVGC+SGVRS+YA  DL +E FKHV NM GG++AW++ G  V+ P 
Sbjct  74   CGKEEKLVVGCQSGVRSLYATTDLTAE-FKHVSNMGGGYEAWLESGFAVNKPQ  125



>ref|XP_009607709.1| PREDICTED: thiosulfate sulfurtransferase 18-like isoform X1 [Nicotiana 
tomentosiformis]
Length=146

 Score =   156 bits (394),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 88/112 (79%), Gaps = 2/112 (2%)
 Frame = +2

Query  239  VDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLSA  418
            VDVH A+ LL  GHRYLDVRTEEEFKKGHVEN+LNIPYM  N   GR KN KFM QV +A
Sbjct  33   VDVHAARHLLRSGHRYLDVRTEEEFKKGHVENSLNIPYM-FNTPQGRVKNQKFMEQVSAA  91

Query  419  IGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHYP  574
             GKEEKLVVGC+SGVRS+YA  DL +E FKHV NM GG++AW++ G  V+ P
Sbjct  92   CGKEEKLVVGCQSGVRSLYATTDLTAE-FKHVSNMGGGYEAWLESGFAVNKP  142



>ref|XP_004232500.1| PREDICTED: thiosulfate sulfurtransferase 18 isoform X2 [Solanum 
lycopersicum]
Length=129

 Score =   154 bits (388),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 90/119 (76%), Gaps = 1/119 (1%)
 Frame = +2

Query  218  AGLRIDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKF  397
            +G  +  VDVH A++L+  G+RY+DVRTEEE+KKGHV N+LNIPYM  N   GR KNPKF
Sbjct  8    SGAEVVTVDVHAARQLIQSGYRYVDVRTEEEYKKGHVHNSLNIPYMF-NTPQGRVKNPKF  66

Query  398  MNQVLSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHYP  574
            M QV SA  KEEKL+VGC+SGVRS+YA  DL++ +FKH  NM GG+ AWV+ G  V+ P
Sbjct  67   MEQVSSACDKEEKLIVGCQSGVRSLYATTDLVNAEFKHASNMGGGYLAWVENGFAVNKP  125



>emb|CDP01882.1| unnamed protein product [Coffea canephora]
Length=147

 Score =   153 bits (387),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 92/125 (74%), Gaps = 2/125 (2%)
 Frame = +2

Query  218  AGLRIDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKF  397
            +G  +  VDVH A++LL  G+RYLDVRTEEEF+KGHV +ALNIPYM I    G+EKNPKF
Sbjct  24   SGAEVVTVDVHAAKDLLHSGYRYLDVRTEEEFEKGHVVDALNIPYMFITPE-GKEKNPKF  82

Query  398  MNQVLSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHYPN  577
            M QV SA  KE++LVVGC+SGVRS+YA  DLL+  FK+ CNM GG+  WVK G  V  P 
Sbjct  83   MEQVRSACNKEDRLVVGCQSGVRSVYATTDLLNADFKNACNMGGGYIEWVKNGFAVKKPE  142

Query  578  -KTEL  589
              TEL
Sbjct  143  PDTEL  147



>ref|XP_010316426.1| PREDICTED: thiosulfate sulfurtransferase 18 isoform X1 [Solanum 
lycopersicum]
Length=140

 Score =   153 bits (386),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 90/119 (76%), Gaps = 1/119 (1%)
 Frame = +2

Query  218  AGLRIDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKF  397
            +G  +  VDVH A++L+  G+RY+DVRTEEE+KKGHV N+LNIPYM  N   GR KNPKF
Sbjct  19   SGAEVVTVDVHAARQLIQSGYRYVDVRTEEEYKKGHVHNSLNIPYMF-NTPQGRVKNPKF  77

Query  398  MNQVLSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHYP  574
            M QV SA  KEEKL+VGC+SGVRS+YA  DL++ +FKH  NM GG+ AWV+ G  V+ P
Sbjct  78   MEQVSSACDKEEKLIVGCQSGVRSLYATTDLVNAEFKHASNMGGGYLAWVENGFAVNKP  136



>ref|XP_009607710.1| PREDICTED: thiosulfate sulfurtransferase 18-like isoform X2 [Nicotiana 
tomentosiformis]
Length=143

 Score =   148 bits (374),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 85/112 (76%), Gaps = 5/112 (4%)
 Frame = +2

Query  239  VDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLSA  418
            VDVH A+ LL  GHRYLDVRTEEEFKKGHVEN+LNIPYM  N   GR KN KFM QV +A
Sbjct  33   VDVHAARHLLRSGHRYLDVRTEEEFKKGHVENSLNIPYM-FNTPQGRVKNQKFMEQVSAA  91

Query  419  IGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHYP  574
             GKEEKLVVGC+SGVRS+YA  DL +    HV NM GG++AW++ G  V+ P
Sbjct  92   CGKEEKLVVGCQSGVRSLYATTDLTA----HVSNMGGGYEAWLESGFAVNKP  139



>ref|XP_010113335.1| hypothetical protein L484_026666 [Morus notabilis]
 gb|EXC35342.1| hypothetical protein L484_026666 [Morus notabilis]
Length=144

 Score =   142 bits (358),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 96/142 (68%), Gaps = 5/142 (4%)
 Frame = +2

Query  161  TIYTQSCSIPMACLLSSGVAGLRIDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENA-  337
            + +  SC I +  +L S  +G  +  +DVH A++L+  GH YLDVRT EE+KKGHVE A 
Sbjct  4    SCFGFSCGIVLLLMLCS--SGAEVVTIDVHAAKDLMKSGHGYLDVRTVEEYKKGHVEVAK  61

Query  338  -LNIPYMIINKSLGREKNPKFMNQVLSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHV  514
              NIPYM  N   GR KNP+F+ +VLSA  KE++LVVGC+SGVRS+ A  DL +  FKHV
Sbjct  62   IFNIPYMF-NSPQGRVKNPQFLTEVLSACNKEDRLVVGCQSGVRSLSATSDLQNAGFKHV  120

Query  515  CNMEGGFDAWVKKGLPVHYPNK  580
             N+ GG+ AWV  GLP+  P +
Sbjct  121  SNIGGGYLAWVDNGLPIEKPKE  142



>gb|EYU30797.1| hypothetical protein MIMGU_mgv1a022391mg, partial [Erythranthe 
guttata]
Length=125

 Score =   141 bits (355),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 82/109 (75%), Gaps = 1/109 (1%)
 Frame = +2

Query  239  VDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLSA  418
            VDV  A++LL  GHRYLDVRTEEEFK GHVENALNI YM  N   GR KNPKF++QVL+ 
Sbjct  9    VDVQTAKDLLNLGHRYLDVRTEEEFKNGHVENALNIAYMF-NTPKGRVKNPKFIDQVLAL  67

Query  419  IGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPV  565
              KE+ ++VGC+SGVRS+YA  DL+  +FKHV NM GG+ AWV  G  V
Sbjct  68   CAKEDHILVGCQSGVRSVYATIDLIHSEFKHVYNMGGGYIAWVGTGFAV  116



>gb|EPS59300.1| hypothetical protein M569_15510, partial [Genlisea aurea]
Length=121

 Score =   137 bits (345),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 83/113 (73%), Gaps = 3/113 (3%)
 Frame = +2

Query  236  NVDVHVAQELLAKG--HRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQV  409
            N+DV  A +LLA+   HRYLDVRTEEEFK GHV NA+NIPYM  N   GR KNP+F+++V
Sbjct  9    NIDVTRATDLLAQQSPHRYLDVRTEEEFKIGHVANAVNIPYMF-NTPRGRIKNPEFVDKV  67

Query  410  LSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVH  568
            L   GKE+ ++VGC+SGVRS  A  DL+   F+ V NM GG++AW++ G PVH
Sbjct  68   LGVFGKEDDIIVGCQSGVRSASAASDLMDAGFEKVVNMAGGYNAWIRGGFPVH  120



>ref|XP_010056098.1| PREDICTED: rhodanese-like domain-containing protein 19, mitochondrial 
[Eucalyptus grandis]
 gb|KCW72671.1| hypothetical protein EUGRSUZ_E01127 [Eucalyptus grandis]
Length=135

 Score =   135 bits (340),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 80/115 (70%), Gaps = 1/115 (1%)
 Frame = +2

Query  230  IDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQV  409
            + NVDV+ A+ LL  GHRYLDVRTEEEFKK HVENA+N+PYM      GR KNP F+ QV
Sbjct  10   VANVDVYTAKGLLTVGHRYLDVRTEEEFKKSHVENAVNVPYMFSTPD-GRVKNPDFLTQV  68

Query  410  LSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHYP  574
             +   KE+ LVVGC SG RS+ A  DLL+  +K+V NMEGG+ AWV KG     P
Sbjct  69   AAVCNKEDHLVVGCNSGGRSLRACVDLLNAGYKNVNNMEGGYSAWVDKGFAGDKP  123



>ref|XP_007217853.1| hypothetical protein PRUPE_ppa024101mg [Prunus persica]
 gb|EMJ19052.1| hypothetical protein PRUPE_ppa024101mg [Prunus persica]
Length=135

 Score =   135 bits (340),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 84/117 (72%), Gaps = 1/117 (1%)
 Frame = +2

Query  230  IDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQV  409
            + +VDV+ A+ LL+ GHRYLDVRT EEF K HVENALNIPYM I +  GR KNP+F+ Q+
Sbjct  10   VASVDVYTAKGLLSVGHRYLDVRTVEEFNKSHVENALNIPYMFITEE-GRVKNPEFLTQI  68

Query  410  LSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHYPNK  580
             S + K++ LVVGC SG RS+ A  DLL+E F+HV NMEGG+ AWV   L    P +
Sbjct  69   SSILKKQDHLVVGCNSGGRSLKACVDLLNEGFQHVTNMEGGYSAWVDSELAHDKPTE  125



>ref|XP_010933323.1| PREDICTED: rhodanese-like domain-containing protein 19, mitochondrial 
[Elaeis guineensis]
Length=146

 Score =   134 bits (338),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 82/117 (70%), Gaps = 1/117 (1%)
 Frame = +2

Query  230  IDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQV  409
            +  VDVH A+ L++ GHRYLDVRT EEF KGH+ENA+N+PY+      G+EKNPKF+ QV
Sbjct  29   VATVDVHAAKRLVSSGHRYLDVRTVEEFYKGHLENAMNVPYLFFTPQ-GKEKNPKFVEQV  87

Query  410  LSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHYPNK  580
                 K++ +VVGC SGVRS+ A  DLL+  F+HV NM GG+ AWV+ G  V  P +
Sbjct  88   SLVCDKDDHIVVGCLSGVRSLQAAADLLNAGFRHVQNMGGGYAAWVENGFAVKKPQE  144



>ref|XP_008357978.1| PREDICTED: rhodanese-like domain-containing protein 19, mitochondrial 
[Malus domestica]
Length=135

 Score =   133 bits (335),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 85/116 (73%), Gaps = 1/116 (1%)
 Frame = +2

Query  230  IDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQV  409
            + +VDV+ A+ LL+ GHRYLDVRT EEF K HVENA+NIP+M+I +  GR KNP+F+ Q+
Sbjct  10   VASVDVYTAKGLLSIGHRYLDVRTIEEFNKSHVENAMNIPFMLITEE-GRVKNPEFLTQI  68

Query  410  LSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHYPN  577
             S + KE+ LVVGC SG R++ A  DLL+E F+HV N EGG+ +WV  GL    P+
Sbjct  69   SSTLKKEDHLVVGCNSGGRALKACVDLLNEGFQHVTNXEGGYSSWVDSGLAGDKPS  124



>ref|XP_010920152.1| PREDICTED: thiosulfate sulfurtransferase 18-like isoform X2 [Elaeis 
guineensis]
Length=131

 Score =   132 bits (333),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 81/112 (72%), Gaps = 1/112 (1%)
 Frame = +2

Query  230  IDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQV  409
            ++ VDVH A+ L+  GHRYLDVRT +EF KGH+ENA+NIPYM     LGREKNPKF+ QV
Sbjct  11   VETVDVHAAKHLMCSGHRYLDVRTVDEFNKGHLENAINIPYMFFT-PLGREKNPKFVEQV  69

Query  410  LSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPV  565
                 K++ +VVGC+SG+RS+ A  DL++  FKH  NM GG+ AW++ G  V
Sbjct  70   SLVCHKDDHIVVGCQSGMRSLQATVDLVNAGFKHAKNMGGGYAAWLENGFVV  121



>ref|XP_010920153.1| PREDICTED: thiosulfate sulfurtransferase 18-like isoform X3 [Elaeis 
guineensis]
Length=130

 Score =   132 bits (333),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 81/112 (72%), Gaps = 1/112 (1%)
 Frame = +2

Query  230  IDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQV  409
            ++ VDVH A+ L+  GHRYLDVRT +EF KGH+ENA+NIPYM     LGREKNPKF+ QV
Sbjct  10   VETVDVHAAKHLMCSGHRYLDVRTVDEFNKGHLENAINIPYMFFT-PLGREKNPKFVEQV  68

Query  410  LSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPV  565
                 K++ +VVGC+SG+RS+ A  DL++  FKH  NM GG+ AW++ G  V
Sbjct  69   SLVCHKDDHIVVGCQSGMRSLQATVDLVNAGFKHAKNMGGGYAAWLENGFVV  120



>ref|XP_010920151.1| PREDICTED: thiosulfate sulfurtransferase 18-like isoform X1 [Elaeis 
guineensis]
Length=155

 Score =   133 bits (334),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 81/112 (72%), Gaps = 1/112 (1%)
 Frame = +2

Query  230  IDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQV  409
            ++ VDVH A+ L+  GHRYLDVRT +EF KGH+ENA+NIPYM     LGREKNPKF+ QV
Sbjct  35   VETVDVHAAKHLMCSGHRYLDVRTVDEFNKGHLENAINIPYMFFT-PLGREKNPKFVEQV  93

Query  410  LSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPV  565
                 K++ +VVGC+SG+RS+ A  DL++  FKH  NM GG+ AW++ G  V
Sbjct  94   SLVCHKDDHIVVGCQSGMRSLQATVDLVNAGFKHAKNMGGGYAAWLENGFVV  145



>ref|XP_008788413.1| PREDICTED: rhodanese-like domain-containing protein 19, mitochondrial 
isoform X1 [Phoenix dactylifera]
Length=129

 Score =   131 bits (329),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 88/133 (66%), Gaps = 5/133 (4%)
 Frame = +2

Query  191  MACLLSSGVAGLRIDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKS  370
            MA  LSS  A   +  VDVH A+ L+  GHRYLDVRT EEF KGH+ENA+N+PY+     
Sbjct  1    MAPTLSSSEA---VATVDVHAAKRLMCSGHRYLDVRTVEEFNKGHLENAINVPYLFFTPQ  57

Query  371  LGREKNPKFMNQVLSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVK  550
             GREKN KF+ QV     K++ +VVGC+SG+RS+ A  DL++  FKH  NM GG+ AWV+
Sbjct  58   -GREKNSKFVEQVSLVCNKDDHIVVGCQSGMRSLPATVDLVNAGFKHAKNMGGGYAAWVE  116

Query  551  KGLPVHYPNKTEL  589
             G  V  P K EL
Sbjct  117  NGFVVKKP-KGEL  128



>ref|XP_003517169.1| PREDICTED: rhodanese-like domain-containing protein 17-like [Glycine 
max]
 gb|KHN36025.1| Thiosulfate sulfurtransferase, chloroplastic [Glycine soja]
Length=149

 Score =   131 bits (329),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 67/125 (54%), Positives = 86/125 (69%), Gaps = 3/125 (2%)
 Frame = +2

Query  218  AGLRIDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHVE--NALNIPYMIINKSLGREKNP  391
            +G ++  +DVH A+ L+  G  YLDVRT EEFKKGHV+  N LNIPYM+ N   G+ KNP
Sbjct  24   SGAKVVAIDVHAAKRLIQTGSIYLDVRTVEEFKKGHVDAVNVLNIPYML-NTPKGKVKNP  82

Query  392  KFMNQVLSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHY  571
             F+ +V SA  KE+ L++GC+SGVRS+YA  DLLSE FK+V +M GG+  WVK   PV  
Sbjct  83   DFLKEVSSACNKEDHLILGCQSGVRSLYATADLLSEGFKNVKDMGGGYVDWVKNKFPVII  142

Query  572  PNKTE  586
            P   E
Sbjct  143  PVAKE  147



>ref|XP_011033562.1| PREDICTED: rhodanese-like domain-containing protein 19, mitochondrial 
[Populus euphratica]
Length=135

 Score =   130 bits (327),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 77/112 (69%), Gaps = 1/112 (1%)
 Frame = +2

Query  239  VDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLSA  418
            VDVH A+ L+A GHRYLDVRT EEF K HV+NALN+P+M      GR KNP+F+++V S 
Sbjct  13   VDVHKAKGLIASGHRYLDVRTAEEFNKSHVDNALNVPFMFKTDE-GRVKNPEFLSKVASI  71

Query  419  IGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHYP  574
              K++ LVVGC SG RS+ A  DLL   FKHV NMEGG+ AWV  G     P
Sbjct  72   CNKDDYLVVGCNSGGRSLRACIDLLGAGFKHVTNMEGGYSAWVDSGFAGDKP  123



>ref|XP_002321016.1| senescence-associated family protein [Populus trichocarpa]
 gb|EEE99331.1| senescence-associated family protein [Populus trichocarpa]
Length=135

 Score =   130 bits (327),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 77/112 (69%), Gaps = 1/112 (1%)
 Frame = +2

Query  239  VDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLSA  418
            VDVH A+ L+A GHRYLDVRT EEF K HV+NALN+P+M      GR KNP+F+++V S 
Sbjct  13   VDVHAAKGLIASGHRYLDVRTAEEFNKSHVDNALNVPFMFKTDE-GRVKNPEFLSKVASI  71

Query  419  IGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHYP  574
              K++ LVVGC SG RS+ A  DLL   F+HV NMEGG+ AWV  G     P
Sbjct  72   CSKDDYLVVGCNSGGRSLRACIDLLGAGFEHVTNMEGGYSAWVDSGFAGDKP  123



>ref|XP_010679917.1| PREDICTED: thiosulfate sulfurtransferase 18-like isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=153

 Score =   130 bits (328),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 83/123 (67%), Gaps = 4/123 (3%)
 Frame = +2

Query  227  RIDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHV--ENALNIPYMIINKSLGREKNPKFM  400
            +I  VDVH A  LL  GHRYLDVRTEEEFK+GHV  EN LNIPY + +   G  KN KF+
Sbjct  28   QITTVDVHAANSLLRSGHRYLDVRTEEEFKRGHVDVENCLNIPYFL-SIHEGMVKNSKFL  86

Query  401  NQVLSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHYPNK  580
             QV S   K++ ++VGCKSGVRS YA  DL+   FKHV NM GG+ +WV+  + +  P K
Sbjct  87   EQVSSVCSKDDHIIVGCKSGVRSAYATADLIQAGFKHVSNMGGGYVSWVENEMSLQKP-K  145

Query  581  TEL  589
             EL
Sbjct  146  VEL  148



>ref|XP_004956760.1| PREDICTED: thiosulfate sulfurtransferase 16, chloroplastic-like 
isoform X1 [Setaria italica]
Length=147

 Score =   130 bits (328),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 78/104 (75%), Gaps = 1/104 (1%)
 Frame = +2

Query  275  GHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLSAIGKEEKLVVGCK  454
            GHRYLDVRTEEEF+ GHVE++LN+PY+    S GREKNPKF+ QV +   K++ +VVGCK
Sbjct  43   GHRYLDVRTEEEFRNGHVEDSLNVPYLFFT-SQGREKNPKFIEQVAAHFDKQDSIVVGCK  101

Query  455  SGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHYPNKTE  586
            SGVRS  A  DL++  F++V N+EGG+DAWV+ GL V  P   +
Sbjct  102  SGVRSELACFDLMAAGFENVKNIEGGYDAWVENGLAVKKPQAQD  145



>ref|XP_003547926.1| PREDICTED: rhodanese-like domain-containing protein 17-like [Glycine 
max]
 gb|KHN08388.1| Senescence-associated protein DIN1 [Glycine soja]
Length=157

 Score =   130 bits (328),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 83/121 (69%), Gaps = 3/121 (2%)
 Frame = +2

Query  218  AGLRIDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHV--ENALNIPYMIINKSLGREKNP  391
            +G  +  VDVH  ++L+   H YLDVRT EEF+KGHV  E  +NIPYM  N   GR KNP
Sbjct  9    SGPEVVTVDVHATKDLIQTSHVYLDVRTVEEFQKGHVDAEKIINIPYMF-NTPEGRVKNP  67

Query  392  KFMNQVLSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHY  571
            +F+ +V SA  KE+ ++VGC+SGVRS+YA  DLL+E FK V NM GG+  WVKK  PV  
Sbjct  68   EFLKEVSSACKKEDHIIVGCQSGVRSLYATADLLTEGFKDVSNMGGGYMDWVKKEFPVKA  127

Query  572  P  574
            P
Sbjct  128  P  128



>ref|XP_010266801.1| PREDICTED: thiosulfate sulfurtransferase 18-like [Nelumbo nucifera]
 ref|XP_010266802.1| PREDICTED: thiosulfate sulfurtransferase 18-like [Nelumbo nucifera]
Length=143

 Score =   130 bits (327),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 69/121 (57%), Positives = 85/121 (70%), Gaps = 5/121 (4%)
 Frame = +2

Query  236  NVDVHVAQELL-AKGHRYLDVRTEEEFKKGHV--ENALNIPYMIINKSLGREKNPKFMNQ  406
             +DVH A++LL ++ HRYLDVRT EEF  GHV  EN LNIPYM+     GR KNP F+ Q
Sbjct  25   TIDVHAAKDLLRSRHHRYLDVRTTEEFNNGHVDVENPLNIPYMLFTAE-GRVKNPHFVEQ  83

Query  407  VLSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHYPNKTE  586
            VL+A  K++ LVVGC SGVRS++A  +L+   FKHV NM GG+ AWV+KG  V  P K E
Sbjct  84   VLAACSKDDHLVVGCLSGVRSLHASTELIKADFKHVSNMGGGYTAWVEKGFAVKKP-KEE  142

Query  587  L  589
            L
Sbjct  143  L  143



>ref|XP_010040077.1| PREDICTED: thiosulfate sulfurtransferase 18-like [Eucalyptus 
grandis]
 gb|KCW45508.1| hypothetical protein EUGRSUZ_L00782 [Eucalyptus grandis]
 gb|KCW45509.1| hypothetical protein EUGRSUZ_L00782 [Eucalyptus grandis]
 gb|KCW45510.1| hypothetical protein EUGRSUZ_L00782 [Eucalyptus grandis]
Length=152

 Score =   130 bits (328),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 90/135 (67%), Gaps = 6/135 (4%)
 Frame = +2

Query  191  MACLLSSGVAGLRIDNVDVHVAQELLAKGHRYLDVRTEEEFKKGH--VENALNIPYMIIN  364
            MA L SSG     +  +DV  A++L++ GHR+LDVRTEEEFK+GH   E+ LNIPY+ + 
Sbjct  1    MASLESSGP---EVVTIDVLAARDLVSTGHRFLDVRTEEEFKEGHPEAEDVLNIPYLFVT  57

Query  365  KSLGREKNPKFMNQVLSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAW  544
               GR  NP+F+ QV  A G E+++VVGC+SG RS+ A  D+L   +KHV NM GG  AW
Sbjct  58   PE-GRVNNPRFLEQVSLAYGLEDRIVVGCRSGARSLSAGADMLKAGYKHVWNMGGGHLAW  116

Query  545  VKKGLPVHYPNKTEL  589
              KGLPV  P + E+
Sbjct  117  ADKGLPVKKPLEEEM  131



>ref|XP_009363483.1| PREDICTED: thiosulfate sulfurtransferase 18-like [Pyrus x bretschneideri]
Length=155

 Score =   130 bits (328),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 86/129 (67%), Gaps = 3/129 (2%)
 Frame = +2

Query  206  SSGVAGLRIDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHVE--NALNIPYMIINKSLGR  379
            S G +G  +  VDV  A+ LL  G+ YLDVRTEEE+KKGHV+    LNIPYM  N   GR
Sbjct  3    SFGSSGSEVVTVDVQEAKHLLESGYGYLDVRTEEEYKKGHVDVKKILNIPYMF-NTPEGR  61

Query  380  EKNPKFMNQVLSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGL  559
             KNPKF+ +V SA  K++ LVVGC+SGVRS+YA  DL +  F+HV NM GG+ AWV+   
Sbjct  62   VKNPKFLEEVSSACKKDDLLVVGCQSGVRSLYATADLQAAGFEHVSNMGGGYLAWVEHNF  121

Query  560  PVHYPNKTE  586
            PV  P   +
Sbjct  122  PVTKPEDAD  130



>gb|AFW57912.1| hypothetical protein ZEAMMB73_085243 [Zea mays]
Length=152

 Score =   130 bits (326),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 75/97 (77%), Gaps = 1/97 (1%)
 Frame = +2

Query  275  GHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLSAIGKEEKLVVGCK  454
            GHRYLDVRTEEEF+ GHVE++LN+PY+    S GREKNPKF+ QV +   KE+ +VVGCK
Sbjct  48   GHRYLDVRTEEEFRSGHVEDSLNVPYLFFT-SQGREKNPKFIAQVAAGFDKEDNIVVGCK  106

Query  455  SGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPV  565
            SGVRS  A  DL++  F++V N+EGG+ AWV+ GL V
Sbjct  107  SGVRSELACADLMAAGFRNVKNIEGGYTAWVESGLAV  143



>ref|XP_008788415.1| PREDICTED: rhodanese-like domain-containing protein 19, mitochondrial 
isoform X2 [Phoenix dactylifera]
Length=128

 Score =   129 bits (324),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 87/133 (65%), Gaps = 6/133 (5%)
 Frame = +2

Query  191  MACLLSSGVAGLRIDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKS  370
            MA  LSS      +  VDVH A+ L+  GHRYLDVRT EEF KGH+ENA+N+PY+     
Sbjct  1    MAPTLSSEA----VATVDVHAAKRLMCSGHRYLDVRTVEEFNKGHLENAINVPYLFFTPQ  56

Query  371  LGREKNPKFMNQVLSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVK  550
             GREKN KF+ QV     K++ +VVGC+SG+RS+ A  DL++  FKH  NM GG+ AWV+
Sbjct  57   -GREKNSKFVEQVSLVCNKDDHIVVGCQSGMRSLPATVDLVNAGFKHAKNMGGGYAAWVE  115

Query  551  KGLPVHYPNKTEL  589
             G  V  P K EL
Sbjct  116  NGFVVKKP-KGEL  127



>gb|ACG42642.1| senescence-associated protein DIN1 [Zea mays]
Length=152

 Score =   130 bits (326),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 75/97 (77%), Gaps = 1/97 (1%)
 Frame = +2

Query  275  GHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLSAIGKEEKLVVGCK  454
            GHRYLDVRTEEEF+ GHVE++LN+PY+    S GREKNPKF+ QV +   KE+ +VVGCK
Sbjct  48   GHRYLDVRTEEEFRSGHVEDSLNVPYLFFT-SQGREKNPKFIAQVAAGFDKEDNIVVGCK  106

Query  455  SGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPV  565
            SGVRS  A  DL++  F++V N+EGG+ AWV+ GL V
Sbjct  107  SGVRSELACADLMAAGFRNVKNIEGGYTAWVESGLAV  143



>ref|XP_009401908.1| PREDICTED: rhodanese-like domain-containing protein 17 isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=127

 Score =   129 bits (324),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 85/125 (68%), Gaps = 5/125 (4%)
 Frame = +2

Query  191  MACLLSSGVAGLRIDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKS  370
            MA ++SS  A      VDVH A+  +  GH+YLDVRT EEFKKGH  NALN+PY+     
Sbjct  1    MAPIVSSESA----VTVDVHAAKGFVDSGHKYLDVRTVEEFKKGHPWNALNVPYVFFTPQ  56

Query  371  LGREKNPKFMNQVLSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVK  550
             GREKNP+F+ QV S   K++ +VVGC+SGVRS+ A E+LL   FKHV NM GG+ AWV+
Sbjct  57   -GREKNPEFLEQVSSICDKDDHIVVGCQSGVRSLQATEELLKAGFKHVKNMGGGYVAWVE  115

Query  551  KGLPV  565
             G  V
Sbjct  116  NGFLV  120



>ref|NP_001152690.1| senescence-associated protein DIN1 precursor [Zea mays]
 gb|ACG48993.1| senescence-associated protein DIN1 [Zea mays]
Length=152

 Score =   130 bits (326),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 75/97 (77%), Gaps = 1/97 (1%)
 Frame = +2

Query  275  GHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLSAIGKEEKLVVGCK  454
            GHRYLDVRTEEEF+ GHVE++LN+PY+    S GREKNPKF+ QV +   KE+ +VVGCK
Sbjct  48   GHRYLDVRTEEEFRSGHVEDSLNVPYLFFT-SQGREKNPKFIAQVAAGFDKEDNIVVGCK  106

Query  455  SGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPV  565
            SGVRS  A  DL++  F++V N+EGG+ AWV+ GL V
Sbjct  107  SGVRSELACADLMAAGFRNVKNIEGGYTAWVESGLAV  143



>ref|XP_010679915.1| PREDICTED: thiosulfate sulfurtransferase 18-like isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=165

 Score =   130 bits (327),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 80/118 (68%), Gaps = 3/118 (3%)
 Frame = +2

Query  227  RIDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHV--ENALNIPYMIINKSLGREKNPKFM  400
            +I  VDVH A  LL  GHRYLDVRTEEEFK+GHV  EN LNIPY + +   G  KN KF+
Sbjct  28   QITTVDVHAANSLLRSGHRYLDVRTEEEFKRGHVDVENCLNIPYFL-SIHEGMVKNSKFL  86

Query  401  NQVLSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHYP  574
             QV S   K++ ++VGCKSGVRS YA  DL+   FKHV NM GG+ +WV+  + +  P
Sbjct  87   EQVSSVCSKDDHIIVGCKSGVRSAYATADLIQAGFKHVSNMGGGYVSWVENEMSLQKP  144



>ref|XP_008781000.1| PREDICTED: thiosulfate sulfurtransferase 18-like [Phoenix dactylifera]
Length=151

 Score =   129 bits (325),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 79/117 (68%), Gaps = 1/117 (1%)
 Frame = +2

Query  230  IDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQV  409
            I  VDVH A+ L+  GHRYLDVRT EEF KGH+ENA+N+PY+      G+EKN KF+ QV
Sbjct  34   IATVDVHAAKRLVYSGHRYLDVRTVEEFNKGHLENAINVPYLFFTPQ-GKEKNLKFVEQV  92

Query  410  LSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHYPNK  580
                 K++ +VVGC SGVRS+ A  DLL   FKHV NM GG+ AWV+ G  V  P +
Sbjct  93   SLVCDKDDHIVVGCLSGVRSLQAAVDLLDAGFKHVQNMGGGYAAWVENGFAVKKPRE  149



>ref|XP_008229745.1| PREDICTED: rhodanese-like domain-containing protein 19, mitochondrial 
[Prunus mume]
Length=135

 Score =   129 bits (324),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 83/117 (71%), Gaps = 1/117 (1%)
 Frame = +2

Query  230  IDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQV  409
            + +VDV+ A+ LL+  HRYLDVRT EEF K HVENALNIPYM I +  GR KN +F+ ++
Sbjct  10   VASVDVYTAKGLLSVDHRYLDVRTVEEFNKSHVENALNIPYMFITEE-GRVKNHEFLTKI  68

Query  410  LSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHYPNK  580
             S + K++ LVVGC SG RS+ A  D+L+E F+HV NMEGG+ AWV  GL    P +
Sbjct  69   SSILKKQDHLVVGCNSGGRSLKACVDILNEGFQHVTNMEGGYSAWVDSGLAHDKPTE  125



>ref|XP_004956761.1| PREDICTED: thiosulfate sulfurtransferase 16, chloroplastic-like 
isoform X2 [Setaria italica]
Length=147

 Score =   129 bits (323),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 78/104 (75%), Gaps = 1/104 (1%)
 Frame = +2

Query  275  GHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLSAIGKEEKLVVGCK  454
            GHRYLDVRTEEEF+ GHVE++LN+PY+    S G+EKNPKF+ QV +   K++ +VVGCK
Sbjct  43   GHRYLDVRTEEEFRNGHVEDSLNVPYLFFT-SQGKEKNPKFIEQVAAHFDKQDSIVVGCK  101

Query  455  SGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHYPNKTE  586
            SGVRS  A  DL++  F++V N+EGG+DAWV+ GL V  P   +
Sbjct  102  SGVRSELACFDLMAAGFENVKNIEGGYDAWVENGLAVKKPQAQD  145



>ref|XP_009401907.1| PREDICTED: thiosulfate sulfurtransferase 18-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=144

 Score =   129 bits (323),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 78/110 (71%), Gaps = 1/110 (1%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLS  415
             VDVH A+  +  GH+YLDVRT EEFKKGH  NALN+PY+      GREKNP+F+ QV S
Sbjct  29   TVDVHAAKGFVDSGHKYLDVRTVEEFKKGHPWNALNVPYVFFTPQ-GREKNPEFLEQVSS  87

Query  416  AIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPV  565
               K++ +VVGC+SGVRS+ A E+LL   FKHV NM GG+ AWV+ G  V
Sbjct  88   ICDKDDHIVVGCQSGVRSLQATEELLKAGFKHVKNMGGGYVAWVENGFLV  137



>ref|XP_010246862.1| PREDICTED: receptor homology region, transmembrane domain- and 
RING domain-containing protein 1 [Nelumbo nucifera]
Length=484

 Score =   134 bits (338),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 83/121 (69%), Gaps = 4/121 (3%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHVE--NALNIPYMIINKSLGREKNPKFMNQV  409
             VDVH A++LL  GHRYLDVRT EEF KGHVE  N LNIPYM+     GR KNP F+ QV
Sbjct  365  TVDVHAAKDLLRSGHRYLDVRTTEEFNKGHVEVENVLNIPYMLFTPE-GRVKNPHFLEQV  423

Query  410  LSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHYP-NKTE  586
             +   K+  LVVGC+SGVRS++A  +LL   FKHV NM GG+  WV+KG  V  P  +TE
Sbjct  424  QAVCSKDGYLVVGCQSGVRSLHASTELLKADFKHVSNMGGGYADWVEKGFAVKKPAAETE  483

Query  587  L  589
            L
Sbjct  484  L  484



>ref|XP_006846543.1| hypothetical protein AMTR_s00018p00204090 [Amborella trichopoda]
 gb|ERN08218.1| hypothetical protein AMTR_s00018p00204090 [Amborella trichopoda]
Length=259

 Score =   130 bits (328),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 85/117 (73%), Gaps = 1/117 (1%)
 Frame = +2

Query  239  VDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLSA  418
            VDVH A+ LLA G RYLDVRT+EEF +GH+EN+LN+PY+  N   GREKN +F+ QV + 
Sbjct  144  VDVHRAKNLLASGWRYLDVRTKEEFSEGHLENSLNVPYLF-NSLQGREKNKQFVEQVKAL  202

Query  419  IGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHYPNKTEL  589
              K++ ++VGC+SGVRS+ A EDL++  FKHV NM GG+ AWV+ G  V     +EL
Sbjct  203  CCKDDDIIVGCRSGVRSLSASEDLINAGFKHVRNMGGGYLAWVENGFQVKNKFHSEL  259



>ref|NP_001240207.1| uncharacterized protein LOC100803436 precursor [Glycine max]
 gb|ACU19371.1| unknown [Glycine max]
 gb|KHN41891.1| Senescence-associated protein DIN1 [Glycine soja]
Length=149

 Score =   127 bits (319),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 89/137 (65%), Gaps = 3/137 (2%)
 Frame = +2

Query  182  SIPMACLLSSGVAGLRIDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHV--ENALNIPYM  355
            S+ +  L    ++G ++  +DV  A+ L+  G  YLDVRT EEFKKGHV  +N LNIPYM
Sbjct  12   SVFLLFLFVLCISGAKVVTIDVRAAKSLIQTGSIYLDVRTVEEFKKGHVYADNVLNIPYM  71

Query  356  IINKSLGREKNPKFMNQVLSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGF  535
            + N   G+ KN  F+ +V SA  KE+ LVVGC+SGVRS+YA  DLLS+ FK+  +M GG+
Sbjct  72   L-NTPKGKVKNGDFLKEVSSACNKEDHLVVGCQSGVRSLYATADLLSDGFKNAKDMGGGY  130

Query  536  DAWVKKGLPVHYPNKTE  586
              WVK   PV+ P   E
Sbjct  131  VDWVKNKFPVNIPEAKE  147



>ref|XP_010246845.1| PREDICTED: rhodanese-like domain-containing protein 19, mitochondrial 
isoform X1 [Nelumbo nucifera]
Length=139

 Score =   127 bits (318),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 76/107 (71%), Gaps = 0/107 (0%)
 Frame = +2

Query  239  VDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLSA  418
            V+VH A++LL  G+RYLDVRT EEF K H+ENALN+PYM I    G+  NP+F++QV + 
Sbjct  15   VNVHAAKDLLCSGYRYLDVRTGEEFNKSHIENALNVPYMFITPQAGKVVNPEFIDQVTAV  74

Query  419  IGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGL  559
              K++++VVGC SG RS+ A  +LL+  FKHV NM GG+  WV  G 
Sbjct  75   CSKDDQIVVGCNSGGRSLRACVELLNAGFKHVKNMGGGYSEWVDNGF  121



>ref|XP_010246847.1| PREDICTED: rhodanese-like domain-containing protein 19, mitochondrial 
isoform X3 [Nelumbo nucifera]
Length=138

 Score =   127 bits (318),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 76/107 (71%), Gaps = 0/107 (0%)
 Frame = +2

Query  239  VDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLSA  418
            V+VH A++LL  G+RYLDVRT EEF K H+ENALN+PYM I    G+  NP+F++QV + 
Sbjct  14   VNVHAAKDLLCSGYRYLDVRTGEEFNKSHIENALNVPYMFITPQAGKVVNPEFIDQVTAV  73

Query  419  IGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGL  559
              K++++VVGC SG RS+ A  +LL+  FKHV NM GG+  WV  G 
Sbjct  74   CSKDDQIVVGCNSGGRSLRACVELLNAGFKHVKNMGGGYSEWVDNGF  120



>ref|XP_008457677.1| PREDICTED: rhodanese-like domain-containing protein 19, mitochondrial 
isoform X2 [Cucumis melo]
Length=127

 Score =   125 bits (315),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 76/112 (68%), Gaps = 1/112 (1%)
 Frame = +2

Query  239  VDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLSA  418
            VDV VA++LL KGH YLDVRT EE+ KGHVENALN+PYM +    GR KNP F+ QV S 
Sbjct  5    VDVQVAKDLLEKGHLYLDVRTVEEYNKGHVENALNVPYMFLTPE-GRVKNPDFLAQVTSI  63

Query  419  IGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHYP  574
            + KE+ +VV C SG R + A  DLL+  F+HV NM GG+ AWV  G     P
Sbjct  64   LKKEDHIVVACNSGGRGLRACVDLLNAGFEHVNNMGGGYSAWVDSGFAGEKP  115



>ref|XP_009379383.1| PREDICTED: thiosulfate sulfurtransferase 18-like isoform X1 [Pyrus 
x bretschneideri]
Length=173

 Score =   126 bits (317),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 88/134 (66%), Gaps = 8/134 (6%)
 Frame = +2

Query  191  MACLLSSGVAGLRIDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENA--LNIPYMIIN  364
            + C   SGV       VDV  A+ LL  G+ +L+VRTEEE+KKGHV+    LNIPYM  N
Sbjct  20   LCCSSESGVV-----TVDVQEAKHLLESGYGFLEVRTEEEYKKGHVDTKKILNIPYMF-N  73

Query  365  KSLGREKNPKFMNQVLSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAW  544
               GR KNP+F+ +V SA  K++ +VVGC+SGVRS+YA  DLL+  FK+V NM GG+ AW
Sbjct  74   TPKGRVKNPQFLEEVSSACNKDDLIVVGCQSGVRSLYATADLLAAGFKNVSNMGGGYLAW  133

Query  545  VKKGLPVHYPNKTE  586
            V+   PV  P  T+
Sbjct  134  VEHDFPVTKPEDTD  147



>dbj|BAD07813.1| putative senescence-associated protein [Oryza sativa Japonica 
Group]
 dbj|BAD08196.1| putative senescence-associated protein [Oryza sativa Japonica 
Group]
 dbj|BAG90288.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE56128.1| hypothetical protein OsJ_04999 [Oryza sativa Japonica Group]
Length=137

 Score =   125 bits (313),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 79/116 (68%), Gaps = 2/116 (2%)
 Frame = +2

Query  239  VDVHVAQELL-AKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLS  415
            VDV  A +L+ + GHRY+DVRTEEE  KGH+ N+LN+P+M +    GREKNP F+ Q  S
Sbjct  21   VDVAAASDLITSAGHRYVDVRTEEEMNKGHLHNSLNVPFMFVTPQ-GREKNPLFVEQFSS  79

Query  416  AIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHYPNKT  583
             + KEE +VVGC+SG RS  A  DLL   FK+V NM GG+ AW+  G P++ P  T
Sbjct  80   LVSKEEHVVVGCQSGKRSELACVDLLEAGFKNVKNMGGGYAAWLDNGFPINTPPHT  135



>gb|EEC72290.1| hypothetical protein OsI_05463 [Oryza sativa Indica Group]
Length=137

 Score =   125 bits (313),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 79/116 (68%), Gaps = 2/116 (2%)
 Frame = +2

Query  239  VDVHVAQELL-AKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLS  415
            VDV  A +L+ + GHRY+DVRTEEE  KGH+ N+LN+P+M +    GREKNP F+ Q  S
Sbjct  21   VDVAAASDLITSAGHRYVDVRTEEEMNKGHLHNSLNVPFMFVTPQ-GREKNPLFVEQFSS  79

Query  416  AIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHYPNKT  583
             + KEE +VVGC+SG RS  A  DLL   FK+V NM GG+ AW+  G P++ P  T
Sbjct  80   LVSKEEHVVVGCQSGKRSELACVDLLEAGFKNVKNMGGGYAAWLDNGFPINTPPHT  135



>ref|NP_001052310.1| Os04g0249600 [Oryza sativa Japonica Group]
 dbj|BAF14224.1| Os04g0249600, partial [Oryza sativa Japonica Group]
Length=138

 Score =   125 bits (313),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 85/132 (64%), Gaps = 2/132 (2%)
 Frame = +2

Query  182  SIPMACLLSSGVAGLRIDNVDVHVAQELLAKG-HRYLDVRTEEEFKKGHVENALNIPYMI  358
            ++P+   L S      +  V V  A  L+  G H YLDVRTEEEFKKGHVEN+LN+P++ 
Sbjct  2    AVPLLPALGSEPPSTPVPTVGVTAASHLVGSGGHSYLDVRTEEEFKKGHVENSLNVPFLF  61

Query  359  INKSLGREKNPKFMNQVLSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFD  538
                 G+EKN KF+ QV     KE+ ++VGC SGVRS  A  DL++  FK+V NMEGG+ 
Sbjct  62   FTPQ-GKEKNTKFIEQVALHYDKEDNIIVGCLSGVRSELASADLIAAGFKNVKNMEGGYM  120

Query  539  AWVKKGLPVHYP  574
            AWV+ GL V+ P
Sbjct  121  AWVENGLAVNKP  132



>ref|XP_006486856.1| PREDICTED: LOW QUALITY PROTEIN: rhodanese-like domain-containing 
protein 19, mitochondrial-like [Citrus sinensis]
Length=156

 Score =   125 bits (314),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 80/110 (73%), Gaps = 1/110 (1%)
 Frame = +2

Query  230  IDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQV  409
            + +V V  A++LL+ GHR+LDVRT EEF + HV  ALN+PY+ I +  GR KNP+F+ QV
Sbjct  35   VASVGVDTAKDLLSSGHRFLDVRTTEEFNESHVHGALNVPYLFITQE-GRVKNPEFLTQV  93

Query  410  LSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGL  559
             S   KE+ ++VGCKSG+RS+ A  DLL+  ++HV +MEGG+ AW+ K L
Sbjct  94   ASVCSKEDHIIVGCKSGIRSLCACVDLLNAGYEHVTSMEGGYSAWLDKEL  143



>ref|XP_009379384.1| PREDICTED: thiosulfate sulfurtransferase 18-like isoform X2 [Pyrus 
x bretschneideri]
Length=156

 Score =   125 bits (313),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 83/118 (70%), Gaps = 3/118 (3%)
 Frame = +2

Query  239  VDVHVAQELLAKGHRYLDVRTEEEFKKGHVENA--LNIPYMIINKSLGREKNPKFMNQVL  412
            VDV  A+ LL  G+ +L+VRTEEE+KKGHV+    LNIPYM  N   GR KNP+F+ +V 
Sbjct  14   VDVQEAKHLLESGYGFLEVRTEEEYKKGHVDTKKILNIPYMF-NTPKGRVKNPQFLEEVS  72

Query  413  SAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHYPNKTE  586
            SA  K++ +VVGC+SGVRS+YA  DLL+  FK+V NM GG+ AWV+   PV  P  T+
Sbjct  73   SACNKDDLIVVGCQSGVRSLYATADLLAAGFKNVSNMGGGYLAWVEHDFPVTKPEDTD  130



>ref|XP_006652129.1| PREDICTED: thiosulfate sulfurtransferase 18-like [Oryza brachyantha]
Length=151

 Score =   125 bits (313),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 82/118 (69%), Gaps = 2/118 (2%)
 Frame = +2

Query  236  NVDVHVAQELLAKG-HRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVL  412
            +V V  A  L++ G HRYLDVRTEEEFKKGHVEN+LN+P++      G+EKN KF+ QV 
Sbjct  33   DVGVSAASHLVSSGGHRYLDVRTEEEFKKGHVENSLNVPFLFFTPQ-GKEKNTKFVEQVA  91

Query  413  SAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHYPNKTE  586
                KE+ ++VGC SGVRS  A  DL++  FK+V NMEGG+ AWV+ GL V+ P   +
Sbjct  92   LHYYKEDNIIVGCLSGVRSELASADLIAAGFKNVKNMEGGYTAWVENGLVVNKPQAND  149



>ref|XP_006574329.1| PREDICTED: uncharacterized protein LOC100305809 isoform X1 [Glycine 
max]
Length=155

 Score =   125 bits (313),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 63/122 (52%), Positives = 82/122 (67%), Gaps = 3/122 (2%)
 Frame = +2

Query  215  VAGLRIDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHV--ENALNIPYMIINKSLGREKN  388
            ++G  +  VDVH  ++L+   H YLDVRT EEF+KGHV  E  +N+ YM  N   GR KN
Sbjct  5    ISGPEVVTVDVHATKDLIQTSHVYLDVRTVEEFQKGHVDAEKIINVAYMF-NTPEGRVKN  63

Query  389  PKFMNQVLSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVH  568
            P+F+ +V  A  KE+ ++VGC+SGVRS+YA  DLL+E FK V NM GG+  WVK  LPV 
Sbjct  64   PEFLKEVSYACKKEDHIIVGCQSGVRSLYATADLLTEGFKDVSNMGGGYLDWVKNELPVK  123

Query  569  YP  574
             P
Sbjct  124  AP  125



>ref|XP_010531545.1| PREDICTED: rhodanese-like domain-containing protein 19, mitochondrial 
[Tarenaya hassleriana]
 ref|XP_010531546.1| PREDICTED: rhodanese-like domain-containing protein 19, mitochondrial 
[Tarenaya hassleriana]
Length=139

 Score =   124 bits (310),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 80/115 (70%), Gaps = 1/115 (1%)
 Frame = +2

Query  230  IDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQV  409
            ++ VDV+ A+ LL+ GHRYLDVRT+EEF K HVE+ALN+PY+ +++  GR KNP F+ QV
Sbjct  12   VETVDVYTAKGLLSVGHRYLDVRTKEEFDKSHVEDALNVPYLFLSEE-GRVKNPDFLAQV  70

Query  410  LSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHYP  574
             +   K++ LVVGC SG R+  A  DLL+E + HV NM GG+ AWV  G     P
Sbjct  71   AAVCKKDDHLVVGCNSGGRASRACVDLLNEGYIHVVNMGGGYSAWVDSGFAGGKP  125



>ref|XP_007156171.1| hypothetical protein PHAVU_003G264200g [Phaseolus vulgaris]
 gb|ESW28165.1| hypothetical protein PHAVU_003G264200g [Phaseolus vulgaris]
Length=181

 Score =   125 bits (313),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 80/121 (66%), Gaps = 3/121 (2%)
 Frame = +2

Query  218  AGLRIDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHV--ENALNIPYMIINKSLGREKNP  391
            +G  +  +DVH  + L+   H YLDVRT EEF+KGHV  E  +NIPYM  N   GR KN 
Sbjct  9    SGSEVVTIDVHATKGLIQTSHVYLDVRTVEEFEKGHVDAEKIINIPYMF-NTPEGRVKNL  67

Query  392  KFMNQVLSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHY  571
            +F+ +VLSA  KE+ ++VGC+SGVRS+YA  DLL E FK V NM GG+  WVK   PV  
Sbjct  68   EFLKEVLSACKKEDHIIVGCQSGVRSVYATSDLLKEGFKDVSNMGGGYLDWVKNQFPVKT  127

Query  572  P  574
            P
Sbjct  128  P  128



>ref|NP_001045596.1| Os02g0102300 [Oryza sativa Japonica Group]
 dbj|BAF07510.1| Os02g0102300 [Oryza sativa Japonica Group]
Length=137

 Score =   123 bits (309),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 79/116 (68%), Gaps = 2/116 (2%)
 Frame = +2

Query  239  VDVHVAQELL-AKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLS  415
            VDV  A +L+ + GHRY+DVRTEEE  KGH+ N+LN+P+M +    G+EKNP F+ Q  S
Sbjct  21   VDVAAASDLITSAGHRYVDVRTEEEMNKGHLHNSLNVPFMFVTPQ-GKEKNPLFVEQFSS  79

Query  416  AIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHYPNKT  583
             + KEE +VVGC+SG RS  A  DLL   FK+V NM GG+ AW+  G P++ P  T
Sbjct  80   LVSKEEHVVVGCQSGKRSELACVDLLEAGFKNVKNMGGGYAAWLDNGFPINTPPHT  135



>ref|XP_007202627.1| hypothetical protein PRUPE_ppa011976mg [Prunus persica]
 gb|EMJ03826.1| hypothetical protein PRUPE_ppa011976mg [Prunus persica]
Length=189

 Score =   125 bits (313),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 82/121 (68%), Gaps = 3/121 (2%)
 Frame = +2

Query  218  AGLRIDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHV--ENALNIPYMIINKSLGREKNP  391
            +G  +  +DV  A++LL  G+ Y+DVRT EE+KKGHV  E  LNIPY+  N   GR KNP
Sbjct  50   SGSEVVTIDVQAAKDLLKSGYGYVDVRTVEEYKKGHVDAEKILNIPYLF-NTPEGRVKNP  108

Query  392  KFMNQVLSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHY  571
            +F+ +V SA  KE+ LVVGC+SGVRS+ A  DLL+  FKH  NM GG+ AWV+   PV  
Sbjct  109  QFLQEVSSACNKEDLLVVGCQSGVRSLSATTDLLTAGFKHANNMGGGYHAWVEHHFPVTK  168

Query  572  P  574
            P
Sbjct  169  P  169



>gb|KHN00466.1| Senescence-associated protein DIN1 [Glycine soja]
Length=158

 Score =   124 bits (310),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 81/121 (67%), Gaps = 3/121 (2%)
 Frame = +2

Query  218  AGLRIDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHV--ENALNIPYMIINKSLGREKNP  391
            +G  +  VDVH  ++L+   H YLDVRT EEF+KGHV  E  +N+ YM  N   GR KNP
Sbjct  9    SGPEVVTVDVHATKDLIQTSHVYLDVRTVEEFQKGHVDAEKIINVAYMF-NTPEGRVKNP  67

Query  392  KFMNQVLSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHY  571
            +F+ +V  A  KE+ ++VGC+SGVRS+YA  DLL+E FK V NM GG+  WVK  LPV  
Sbjct  68   EFLKEVSYACKKEDHIIVGCQSGVRSLYATADLLTEGFKDVSNMGGGYLDWVKNELPVKA  127

Query  572  P  574
            P
Sbjct  128  P  128



>ref|XP_002265009.1| PREDICTED: thiosulfate sulfurtransferase 18 isoform X2 [Vitis 
vinifera]
 emb|CBI17358.3| unnamed protein product [Vitis vinifera]
Length=129

 Score =   122 bits (306),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 86/131 (66%), Gaps = 4/131 (3%)
 Frame = +2

Query  203  LSSGVAGLRIDNVDVHVAQELLAKGHRYLDVRTEEEFKKGH--VENALNIPYMIINKSLG  376
            + S  +   +  +DVH A++L+  G+RYLDVRT EEFKKGH  VEN LNIPY+      G
Sbjct  1    MDSQSSATEVVTIDVHAAKDLINSGYRYLDVRTVEEFKKGHADVENILNIPYLFTTPE-G  59

Query  377  REKNPKFMNQVLSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKG  556
            R KNP+F+ QV  A  KE+ L+VGC+SGVRS+ A   L+S  FK V ++ GG+ AWV+ G
Sbjct  60   RVKNPEFLEQVQFACSKEDHLIVGCQSGVRSLAATSVLVSAGFKDVKDIGGGYLAWVQNG  119

Query  557  LPVHYPNKTEL  589
            L    P K EL
Sbjct  120  LVATKP-KEEL  129



>ref|XP_010246846.1| PREDICTED: rhodanese-like domain-containing protein 19, mitochondrial 
isoform X2 [Nelumbo nucifera]
Length=138

 Score =   122 bits (307),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 76/107 (71%), Gaps = 1/107 (1%)
 Frame = +2

Query  239  VDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLSA  418
            V+VH A++LL  G+RYLDVRT EEF K H+ENALN+PYM I    G+  NP+F++QV + 
Sbjct  15   VNVHAAKDLLCSGYRYLDVRTGEEFNKSHIENALNVPYMFITPQ-GKVVNPEFIDQVTAV  73

Query  419  IGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGL  559
              K++++VVGC SG RS+ A  +LL+  FKHV NM GG+  WV  G 
Sbjct  74   CSKDDQIVVGCNSGGRSLRACVELLNAGFKHVKNMGGGYSEWVDNGF  120



>ref|XP_008457676.1| PREDICTED: rhodanese-like domain-containing protein 19, mitochondrial 
isoform X1 [Cucumis melo]
Length=135

 Score =   122 bits (306),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 76/119 (64%), Gaps = 7/119 (6%)
 Frame = +2

Query  239  VDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIIN-------KSLGREKNPKF  397
            VDV VA++LL KGH YLDVRT EE+ KGHVENALN+PYM +         S  R KNP F
Sbjct  5    VDVQVAKDLLEKGHLYLDVRTVEEYNKGHVENALNVPYMFLTPEGSNKWSSTCRVKNPDF  64

Query  398  MNQVLSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHYP  574
            + QV S + KE+ +VV C SG R + A  DLL+  F+HV NM GG+ AWV  G     P
Sbjct  65   LAQVTSILKKEDHIVVACNSGGRGLRACVDLLNAGFEHVNNMGGGYSAWVDSGFAGEKP  123



>ref|XP_006648201.1| PREDICTED: rhodanese-like domain-containing protein 19, mitochondrial-like, 
partial [Oryza brachyantha]
Length=123

 Score =   121 bits (304),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 76/111 (68%), Gaps = 2/111 (2%)
 Frame = +2

Query  239  VDVHVAQELL-AKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLS  415
            VDV  A EL+ + GHRY+DVRTEEE  KGH+ N+LN+P+M      GREKNP F+ Q  S
Sbjct  10   VDVTAASELIISAGHRYVDVRTEEEMSKGHLHNSLNVPFMFFTPQ-GREKNPLFVEQFSS  68

Query  416  AIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVH  568
             + KEE +VVGC+SG RS  A  DLL   FK+V NM GG+ AW+  G PV+
Sbjct  69   LVSKEEHVVVGCQSGKRSEQACVDLLEAGFKNVKNMGGGYAAWLGSGFPVN  119



>ref|XP_002300675.2| hypothetical protein POPTR_0002s01630g [Populus trichocarpa]
 gb|EEE79948.2| hypothetical protein POPTR_0002s01630g [Populus trichocarpa]
Length=135

 Score =   122 bits (305),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 77/112 (69%), Gaps = 5/112 (4%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGRE--KNPKFMNQV  409
            +V VHVA ELL  GH+YLDVRT +EF+ GH   A+NIPYM+ N   G E  KN KF+ +V
Sbjct  25   SVPVHVAHELLQVGHQYLDVRTHDEFRAGHPSGAINIPYMLNN---GAEMFKNSKFLEEV  81

Query  410  LSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPV  565
             S  GK++ +VVGCKSG RS+ A  DL S  F HV ++ GG+ AW + GLP+
Sbjct  82   SSQFGKDDDIVVGCKSGRRSLMAASDLQSAGFNHVTDVAGGYTAWTENGLPI  133



>ref|XP_004509372.1| PREDICTED: rhodanese-like domain-containing protein 17-like [Cicer 
arietinum]
Length=135

 Score =   121 bits (304),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 76/112 (68%), Gaps = 3/112 (3%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHV--ENALNIPYMIINKSLGREKNPKFMNQV  409
             VDV  A+ L+   H YLDVRT EEF+KGHV  E  +NIPYM  N   GR KNP F+ +V
Sbjct  15   TVDVVTAKSLIQTTHVYLDVRTVEEFQKGHVDAEKNINIPYMF-NTPDGRVKNPDFLKEV  73

Query  410  LSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPV  565
             S   KE+ L+VGC+SGVRS+YA  DLL+E FK V NM GG+  WVKK  PV
Sbjct  74   SSLCKKEDHLIVGCQSGVRSLYATADLLAEGFKDVYNMGGGYLEWVKKEFPV  125



>ref|XP_010550490.1| PREDICTED: thiosulfate sulfurtransferase 16, chloroplastic [Tarenaya 
hassleriana]
Length=167

 Score =   122 bits (306),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 76/117 (65%), Gaps = 1/117 (1%)
 Frame = +2

Query  221  GLRIDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFM  400
             +R  +V V VA ELL  GHRYLDVRT EEF+ GH   A+N+PYM+   S G  KNP F+
Sbjct  52   AVRATSVPVRVAHELLLAGHRYLDVRTPEEFRAGHASGAINVPYMVRVAS-GLSKNPDFV  110

Query  401  NQVLSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHY  571
             QV +   K ++++VGCK G RS+ A  DLL+  F  V ++ GG+DAW + GLP  +
Sbjct  111  QQVSAHFRKYDEIIVGCKIGKRSLMATTDLLAAGFTGVTDIAGGYDAWKQNGLPTQH  167



>ref|XP_006409311.1| hypothetical protein EUTSA_v10022902mg [Eutrema salsugineum]
 gb|ESQ50764.1| hypothetical protein EUTSA_v10022902mg [Eutrema salsugineum]
Length=140

 Score =   121 bits (303),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 75/115 (65%), Gaps = 1/115 (1%)
 Frame = +2

Query  230  IDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQV  409
            ++NVDV+ A+ LL  GHRY+DVRT EEF K H E+ALNIPYM      GR  NP F++QV
Sbjct  12   VENVDVYTAKGLLTVGHRYVDVRTNEEFAKSHFEDALNIPYMFKTDE-GRVVNPDFLSQV  70

Query  410  LSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHYP  574
             S   K++ L+V C SG R+  A  DLL+  ++HV NMEGG+ AWV  G     P
Sbjct  71   ASGCKKDDHLIVACNSGGRASRACVDLLNAGYEHVANMEGGYSAWVDAGFAGDKP  125



>ref|XP_008394158.1| PREDICTED: thiosulfate sulfurtransferase 18 isoform X2 [Malus 
domestica]
Length=156

 Score =   122 bits (305),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 85/129 (66%), Gaps = 3/129 (2%)
 Frame = +2

Query  206  SSGVAGLRIDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENA--LNIPYMIINKSLGR  379
            S G +   +  VDV  A+ LL  G+ YL+VRTEEE+KKGHV+    LNIPYM  N   G 
Sbjct  3    SIGSSESEVVTVDVQEAKHLLESGYGYLEVRTEEEYKKGHVDTKKILNIPYMF-NTPKGM  61

Query  380  EKNPKFMNQVLSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGL  559
             KNP+F+ +V SA  K++ +VVGC+SGVRS+YA  DLL+  FK+V NM GG+ AW++   
Sbjct  62   VKNPQFLEEVSSACNKDDLIVVGCQSGVRSLYATADLLAAGFKNVSNMGGGYLAWIEHDF  121

Query  560  PVHYPNKTE  586
            PV  P   +
Sbjct  122  PVTKPEDAD  130



>ref|XP_010690386.1| PREDICTED: rhodanese-like domain-containing protein 19, mitochondrial 
[Beta vulgaris subsp. vulgaris]
Length=133

 Score =   121 bits (303),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 72/107 (67%), Gaps = 1/107 (1%)
 Frame = +2

Query  239  VDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLSA  418
            VDV+ A+ LLA G+RYLDVRT EEF+KGHVE ALNIPYM I +   R KNP F+ QVL  
Sbjct  14   VDVYTAKGLLATGYRYLDVRTNEEFEKGHVEGALNIPYMFITEE-ARVKNPNFIGQVLEV  72

Query  419  IGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGL  559
              KE+ LVV C  G R + A  DL  E F+ V N+EGG+ AW+  G 
Sbjct  73   CKKEDHLVVACNKGGRGLKATIDLQHEGFEDVANIEGGYSAWIDAGF  119



>ref|XP_008363085.1| PREDICTED: thiosulfate sulfurtransferase 18-like isoform X2 [Malus 
domestica]
Length=156

 Score =   121 bits (304),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 85/129 (66%), Gaps = 3/129 (2%)
 Frame = +2

Query  206  SSGVAGLRIDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENA--LNIPYMIINKSLGR  379
            S G +   +  VDV  A+ LL  G+ YL+VRTEEE+KKGHV+    LNIPYM  N   G 
Sbjct  3    SIGSSESEVVTVDVQEAKHLLESGYGYLEVRTEEEYKKGHVDTKKILNIPYMF-NTPKGM  61

Query  380  EKNPKFMNQVLSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGL  559
             KNP+F+ +V SA  K++ +VVGC+SGVRS+YA  DLL+  FK+V NM GG+ AW++   
Sbjct  62   VKNPQFLEEVSSACNKDDLIVVGCQSGVRSLYATADLLAAGFKNVSNMGGGYLAWIEHDF  121

Query  560  PVHYPNKTE  586
            PV  P   +
Sbjct  122  PVTKPEDAD  130



>ref|XP_010649014.1| PREDICTED: thiosulfate sulfurtransferase 18 isoform X1 [Vitis 
vinifera]
Length=148

 Score =   121 bits (303),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 82/120 (68%), Gaps = 4/120 (3%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGH--VENALNIPYMIINKSLGREKNPKFMNQV  409
             +DVH A++L+  G+RYLDVRT EEFKKGH  VEN LNIPY+      GR KNP+F+ QV
Sbjct  31   TIDVHAAKDLINSGYRYLDVRTVEEFKKGHADVENILNIPYLFTTPE-GRVKNPEFLEQV  89

Query  410  LSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHYPNKTEL  589
              A  KE+ L+VGC+SGVRS+ A   L+S  FK V ++ GG+ AWV+ GL    P K EL
Sbjct  90   QFACSKEDHLIVGCQSGVRSLAATSVLVSAGFKDVKDIGGGYLAWVQNGLVATKP-KEEL  148



>ref|XP_006393790.1| hypothetical protein EUTSA_v10005068mg [Eutrema salsugineum]
 gb|ESQ31076.1| hypothetical protein EUTSA_v10005068mg [Eutrema salsugineum]
Length=122

 Score =   120 bits (301),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 72/111 (65%), Gaps = 0/111 (0%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLS  415
            +V V VA +LL  GHRYLDVRT EEF +GH   A+N+PYM    S G  KNP F+ QV S
Sbjct  10   SVSVIVAHDLLLAGHRYLDVRTPEEFSQGHACGAINVPYMKRGDSAGMSKNPSFLEQVSS  69

Query  416  AIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVH  568
              G+ +K++VGC+SG RS+ A  +LL   F  V ++ GG+ AW + GLP  
Sbjct  70   HFGEADKIIVGCQSGGRSLKATAELLDAGFTGVTDIAGGYAAWTQNGLPTQ  120



>gb|KDO71244.1| hypothetical protein CISIN_1g031752mg [Citrus sinensis]
Length=137

 Score =   120 bits (301),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 78/118 (66%), Gaps = 3/118 (3%)
 Frame = +2

Query  218  AGLRIDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENA--LNIPYMIINKSLGREKNP  391
            +G  +  VDV  A+ LL  G+ YLDVRT EEFK+GHV+ A   NIPYM  N   GR KNP
Sbjct  8    SGAEVITVDVRAAKNLLESGYGYLDVRTAEEFKEGHVDAAKIFNIPYMF-NTPEGRVKNP  66

Query  392  KFMNQVLSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPV  565
             F+ +V S   +E++LVVGC+SG RS++A  DLL   FKHV N  GG  AWV+ GL V
Sbjct  67   DFLKKVRSLCKEEDRLVVGCQSGARSLHATADLLGAGFKHVSNFGGGHMAWVQNGLKV  124



>ref|NP_001236988.1| uncharacterized protein LOC100305809 [Glycine max]
 gb|ACU13678.1| unknown [Glycine max]
Length=158

 Score =   121 bits (303),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 80/121 (66%), Gaps = 3/121 (2%)
 Frame = +2

Query  218  AGLRIDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHV--ENALNIPYMIINKSLGREKNP  391
            +G  +  VDVH  ++L+   H YLDVRT EEF+KGHV  E  +N+ YM  N   GR KNP
Sbjct  9    SGPEVVTVDVHATKDLIQTSHVYLDVRTVEEFQKGHVDAEKIINVAYMF-NTPEGRVKNP  67

Query  392  KFMNQVLSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHY  571
            +F+ +V  A  K + ++VGC+SGVRS+YA  DLL+E FK V NM GG+  WVK  LPV  
Sbjct  68   EFLKEVSYACKKGDHIIVGCQSGVRSLYATADLLTEGFKDVSNMGGGYLDWVKNELPVKA  127

Query  572  P  574
            P
Sbjct  128  P  128



>ref|XP_008394151.1| PREDICTED: thiosulfate sulfurtransferase 18 isoform X1 [Malus 
domestica]
Length=173

 Score =   121 bits (304),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 81/119 (68%), Gaps = 3/119 (3%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENA--LNIPYMIINKSLGREKNPKFMNQV  409
             VDV  A+ LL  G+ YL+VRTEEE+KKGHV+    LNIPYM  N   G  KNP+F+ +V
Sbjct  30   TVDVQEAKHLLESGYGYLEVRTEEEYKKGHVDTKKILNIPYMF-NTPKGMVKNPQFLEEV  88

Query  410  LSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHYPNKTE  586
             SA  K++ +VVGC+SGVRS+YA  DLL+  FK+V NM GG+ AW++   PV  P   +
Sbjct  89   SSACNKDDLIVVGCQSGVRSLYATADLLAAGFKNVSNMGGGYLAWIEHDFPVTKPEDAD  147



>ref|XP_008363084.1| PREDICTED: thiosulfate sulfurtransferase 18-like isoform X1 [Malus 
domestica]
Length=173

 Score =   121 bits (304),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 81/119 (68%), Gaps = 3/119 (3%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENA--LNIPYMIINKSLGREKNPKFMNQV  409
             VDV  A+ LL  G+ YL+VRTEEE+KKGHV+    LNIPYM  N   G  KNP+F+ +V
Sbjct  30   TVDVQEAKHLLESGYGYLEVRTEEEYKKGHVDTKKILNIPYMF-NTPKGMVKNPQFLEEV  88

Query  410  LSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHYPNKTE  586
             SA  K++ +VVGC+SGVRS+YA  DLL+  FK+V NM GG+ AW++   PV  P   +
Sbjct  89   SSACNKDDLIVVGCQSGVRSLYATADLLAAGFKNVSNMGGGYLAWIEHDFPVTKPEDAD  147



>gb|KDP29630.1| hypothetical protein JCGZ_18792 [Jatropha curcas]
Length=136

 Score =   120 bits (301),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 74/107 (69%), Gaps = 1/107 (1%)
 Frame = +2

Query  239  VDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLSA  418
            VDV  A++LL+ G+ YLDVRT EEF K H+ENALN+PYM   +  GR  NP+F++ V S 
Sbjct  13   VDVQAAKDLLSSGYYYLDVRTTEEFNKSHIENALNVPYMFKTQQ-GRVNNPQFLSLVASI  71

Query  419  IGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGL  559
              K + LV+GC SG RS+ A  DLL+  F+HV NMEGG+ AWV  G 
Sbjct  72   CKKHDYLVLGCNSGGRSLRACVDLLNAGFEHVRNMEGGYSAWVDSGF  118



>ref|XP_011078919.1| PREDICTED: thiosulfate sulfurtransferase 18-like isoform X1 [Sesamum 
indicum]
Length=179

 Score =   121 bits (304),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 71/100 (71%), Gaps = 1/100 (1%)
 Frame = +2

Query  290  DVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLSAIGKEEKLVVGCKSGVRS  469
            DVRT+EEFK G +EN+ NIPYM+ N S G  KNP F++QVLS   KE+ L+VGCKSGVRS
Sbjct  81   DVRTQEEFKNGQLENSFNIPYML-NTSQGMVKNPIFVDQVLSLCAKEDHLIVGCKSGVRS  139

Query  470  MYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHYPNKTEL  589
             YA  DLL+  FKHV NM GG+ AW + G  V  P+  EL
Sbjct  140  FYATTDLLNSGFKHVYNMGGGYIAWTQNGYDVKKPHTDEL  179



>ref|XP_006347264.1| PREDICTED: rhodanese-like domain-containing protein 19, mitochondrial-like 
[Solanum tuberosum]
Length=135

 Score =   119 bits (299),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 76/106 (72%), Gaps = 1/106 (1%)
 Frame = +2

Query  230  IDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQV  409
            + NVDV  A++LL+ GH YLDVRT EE+ +GH++ A+NIPYM +N+  GR KNP F+ QV
Sbjct  10   VSNVDVISAKDLLSLGHTYLDVRTVEEYNRGHIDKAINIPYMFLNEQ-GRVKNPDFLEQV  68

Query  410  LSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWV  547
             S   KE+ L+VGC SG R + A  DLL+  +K V N+EGG+ AWV
Sbjct  69   CSVCQKEDHLIVGCNSGGRGLRACVDLLNAGYKDVRNLEGGYSAWV  114



>gb|KDO71245.1| hypothetical protein CISIN_1g031752mg [Citrus sinensis]
 gb|KDO71246.1| hypothetical protein CISIN_1g031752mg [Citrus sinensis]
 gb|KDO71247.1| hypothetical protein CISIN_1g031752mg [Citrus sinensis]
Length=153

 Score =   120 bits (300),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 78/118 (66%), Gaps = 3/118 (3%)
 Frame = +2

Query  218  AGLRIDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENA--LNIPYMIINKSLGREKNP  391
            +G  +  VDV  A+ LL  G+ YLDVRT EEFK+GHV+ A   NIPYM  N   GR KNP
Sbjct  24   SGAEVITVDVRAAKNLLESGYGYLDVRTAEEFKEGHVDAAKIFNIPYMF-NTPEGRVKNP  82

Query  392  KFMNQVLSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPV  565
             F+ +V S   +E++LVVGC+SG RS++A  DLL   FKHV N  GG  AWV+ GL V
Sbjct  83   DFLKKVRSLCKEEDRLVVGCQSGARSLHATADLLGAGFKHVSNFGGGHMAWVQNGLKV  140



>ref|XP_004951181.1| PREDICTED: thiosulfate sulfurtransferase 18-like [Setaria italica]
Length=138

 Score =   119 bits (299),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 62/122 (51%), Positives = 80/122 (66%), Gaps = 6/122 (5%)
 Frame = +2

Query  236  NVDVHVAQELLAK--GHRYLDVRTEEEFKK-GHV---ENALNIPYMIINKSLGREKNPKF  397
             VDV  A+EL+A   GHRYLDVRTEEE  + GH+   + +LN+PYM      GREKN  F
Sbjct  16   TVDVTAARELMAPAGGHRYLDVRTEEELSRLGHLVELDRSLNVPYMFTTPQGGREKNAHF  75

Query  398  MNQVLSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHYPN  577
            + QV S   K+E ++VGC+SG RS  A  DL +  FK+V NM GG+ AW+  G PVH+P 
Sbjct  76   LEQVASLFTKDEHVLVGCQSGKRSELACLDLQAAGFKNVKNMGGGYLAWIDHGFPVHHPP  135

Query  578  KT  583
            +T
Sbjct  136  RT  137



>ref|XP_010063091.1| PREDICTED: thiosulfate sulfurtransferase 16, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW70273.1| hypothetical protein EUGRSUZ_F03525 [Eucalyptus grandis]
Length=171

 Score =   120 bits (301),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 77/118 (65%), Gaps = 5/118 (4%)
 Frame = +2

Query  218  AGLRIDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGRE--KNP  391
            A     +V V+VA +LL KGHRYLDVRT +EFK GH   ALNIPYM      G E  KNP
Sbjct  48   AAAESQSVTVNVAHDLLRKGHRYLDVRTCDEFKAGHPPGALNIPYMF---RTGAEMSKNP  104

Query  392  KFMNQVLSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPV  565
            +F+++V +   K++  VVGCKSG RS+ A+ DL S  F  V N+ GG+ AW +KGLP 
Sbjct  105  QFLDEVSAHFVKDDAFVVGCKSGRRSLMAVTDLQSAGFGRVANVAGGYSAWTEKGLPT  162



>gb|ABK21219.1| unknown [Picea sitchensis]
 gb|ABK25501.1| unknown [Picea sitchensis]
Length=117

 Score =   119 bits (297),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 76/110 (69%), Gaps = 1/110 (1%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLS  415
            +V V VA EL+  GHRYLDVRT EEF  GHVE+A+N+PYM      G  KNP F+ +VLS
Sbjct  7    SVTVQVAFELVQAGHRYLDVRTLEEFNAGHVEDAINVPYMF-KVGEGMVKNPNFIEEVLS  65

Query  416  AIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPV  565
               K++K+V+GC+SG RS+ A +DL+   F  V ++ GG+  WV+ GLPV
Sbjct  66   HFTKDDKIVIGCQSGRRSLMAAKDLIVVDFTGVTDVGGGYSTWVQSGLPV  115



>ref|XP_010266068.1| PREDICTED: thiosulfate sulfurtransferase 16, chloroplastic-like 
isoform X1 [Nelumbo nucifera]
Length=186

 Score =   120 bits (302),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 67/168 (40%), Positives = 91/168 (54%), Gaps = 16/168 (10%)
 Frame = +2

Query  62   FPCAILCNFTNQSTQPTGSELYSTPGSDFLTIPTIYTQSCSIPMACLLSSGVAGLRIDNV  241
            FP  +  NF      P G+++ +    +F +I        S P+A   S          V
Sbjct  33   FPSPVKVNF--PLVHPVGAKIRTW---NFRSISAAVGSESSEPIAVPRS----------V  77

Query  242  DVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLSAI  421
             V VA ELL  GHRYLDVRT EEF  GH   A+NIPYM      G  KNP F+ +V S  
Sbjct  78   PVRVAYELLQAGHRYLDVRTPEEFGGGHASAAINIPYMF-RAGAGMTKNPNFLKEVSSHF  136

Query  422  GKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPV  565
            GK+ +++VGC+SG RS+ A  +LLS+ F  + ++ GG+ AW + GLP 
Sbjct  137  GKDTEIIVGCQSGKRSLMAATELLSDGFTGITDIAGGYSAWTQNGLPT  184



>ref|XP_010112875.1| hypothetical protein L484_017711 [Morus notabilis]
 gb|EXC35010.1| hypothetical protein L484_017711 [Morus notabilis]
Length=153

 Score =   119 bits (299),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 78/116 (67%), Gaps = 1/116 (1%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLS  415
            NVDV+  + LL+ GHRYLDVRT EEF K HV+ A N+PYM I +  GR +NP F++QV +
Sbjct  30   NVDVYSVKGLLSVGHRYLDVRTPEEFNKSHVDGAFNVPYMFITQE-GRVENPDFLSQVSA  88

Query  416  AIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHYPNKT  583
               K++ LVVGC SG R+  A  +LL+  F+HV +MEGG+  WV  GL    P +T
Sbjct  89   ICKKDDHLVVGCNSGGRARRACVNLLNAGFEHVNSMEGGYSKWVDSGLAGDKPAET  144



>gb|AAP37665.1| At2g21045 [Arabidopsis thaliana]
Length=140

 Score =   119 bits (297),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 72/115 (63%), Gaps = 1/115 (1%)
 Frame = +2

Query  230  IDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQV  409
            ++ VDV+ A+  L+ GHRYLDVRT EEF K HVE ALNIPYM      GR  NP F++QV
Sbjct  12   VETVDVYTAKGFLSTGHRYLDVRTNEEFAKSHVEEALNIPYMFKTDE-GRVINPDFLSQV  70

Query  410  LSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHYP  574
             S   K+E L+V C +G R   A  DLL+E + HV NM GG+ AWV  G     P
Sbjct  71   ASVCKKDEHLIVACNAGGRGSRACVDLLNEGYDHVANMGGGYSAWVDAGFAGDKP  125



>gb|KDP46782.1| hypothetical protein JCGZ_06570 [Jatropha curcas]
Length=134

 Score =   118 bits (296),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 75/112 (67%), Gaps = 3/112 (3%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHV--ENALNIPYMIINKSLGREKNPKFMNQV  409
             +DV  A+ L   G+ YLDVRT EEFKKGHV  E   NIPYM  N   GR KNPKF+ +V
Sbjct  14   TIDVKAAKGLHESGYIYLDVRTVEEFKKGHVRAEKIFNIPYMF-NTPEGRVKNPKFLEEV  72

Query  410  LSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPV  565
             +   KE+ LVVGC+SGVRS+YA  DLL+  FK V NM GG+  WVK  LPV
Sbjct  73   SAICKKEDHLVVGCQSGVRSLYATADLLTAGFKDVSNMGGGYLDWVKNELPV  124



>ref|XP_002530729.1| Senescence-associated protein DIN1, putative [Ricinus communis]
 gb|EEF31635.1| Senescence-associated protein DIN1, putative [Ricinus communis]
Length=182

 Score =   120 bits (300),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 73/110 (66%), Gaps = 1/110 (1%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLS  415
            +V V VA ELL  GHRYLDVRT EEF  GHV  A+NIPYM    S G +KN KF+ QV S
Sbjct  72   SVPVRVAHELLLAGHRYLDVRTPEEFSAGHVVGAINIPYMYRVGS-GMKKNTKFLEQVSS  130

Query  416  AIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPV  565
              GK  ++++GC+SG RSM A  DLLS  +  V ++ GG+ AW + GLP 
Sbjct  131  HFGKYNEIIIGCQSGKRSMMAATDLLSAGYTAVTDIAGGYAAWTQNGLPT  180



>ref|XP_001766103.1| predicted protein [Physcomitrella patens]
 gb|EDQ69162.1| predicted protein [Physcomitrella patens]
Length=192

 Score =   120 bits (300),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 78/117 (67%), Gaps = 1/117 (1%)
 Frame = +2

Query  230  IDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQV  409
            I +V V VA ELL  GHR LDVRT EEF  GHV+ A+NIPY+I     G  KNPKF+ +V
Sbjct  76   IKSVPVQVAHELLNAGHRCLDVRTTEEFTAGHVKGAVNIPYLI-KTGHGMSKNPKFLAEV  134

Query  410  LSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHYPNK  580
                 K++++++GC+SG RS+ A  +L   KF  V +M GG+ AW + GLPV+ PN+
Sbjct  135  EKGFSKDDEILIGCQSGRRSLMAAAELRDAKFTGVIDMGGGYLAWKENGLPVNIPNQ  191



>emb|CBI35721.3| unnamed protein product [Vitis vinifera]
Length=177

 Score =   119 bits (299),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 75/110 (68%), Gaps = 1/110 (1%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLS  415
            +V V VA ELL  GHRYLDVRT EEF  GH   A+N+PYM+   S G  KNPKF+ +V S
Sbjct  67   SVPVRVALELLQAGHRYLDVRTPEEFSAGHASGAINVPYMLRFGS-GMAKNPKFLVEVSS  125

Query  416  AIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPV  565
               K+++++VGC+ G RS+ A+ DLL+  F  V ++ GG+DAW + GLP 
Sbjct  126  HFRKDDEIIVGCQKGKRSLMAVNDLLAAGFTAVTDIAGGYDAWSQNGLPT  175



>ref|XP_010466087.1| PREDICTED: thiosulfate sulfurtransferase 16, chloroplastic isoform 
X3 [Camelina sativa]
Length=121

 Score =   117 bits (294),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 70/111 (63%), Gaps = 0/111 (0%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLS  415
            +V V VA +LL  GHRYLDVRT EEF +GH   A+N+PY+    S G  KNP F+ QV S
Sbjct  10   SVSVTVAHDLLLAGHRYLDVRTPEEFSQGHPCGAINVPYLKRGPSAGMSKNPDFLEQVSS  69

Query  416  AIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVH  568
              G+ + ++VGC+SG RS  A  DLL   F  V ++ GG+ AW + GLP  
Sbjct  70   HFGQSDDIIVGCQSGGRSFIATTDLLDAGFTAVKDVSGGYAAWAQNGLPTQ  120



>ref|XP_011078998.1| PREDICTED: thiosulfate sulfurtransferase 16, chloroplastic [Sesamum 
indicum]
Length=168

 Score =   119 bits (298),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 73/110 (66%), Gaps = 1/110 (1%)
 Frame = +2

Query  233  DNVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVL  412
            ++V V VA ELL  GHRYLDVRT EEF  GHV  A+N+P+M+     G   NPKF+ Q L
Sbjct  57   NSVPVRVAYELLQAGHRYLDVRTTEEFSDGHVVGAVNVPFML-RVGPGMTTNPKFLEQTL  115

Query  413  SAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLP  562
            S  GK+++++VGC+ G RS  A   L+S  F  + +M GG+ AWV+ GLP
Sbjct  116  SHFGKDDEIIVGCQVGKRSFMAASQLVSAGFTGITDMAGGYAAWVQNGLP  165



>ref|XP_006466965.1| PREDICTED: thiosulfate sulfurtransferase 18-like isoform X1 [Citrus 
sinensis]
 ref|XP_006466966.1| PREDICTED: thiosulfate sulfurtransferase 18-like isoform X2 [Citrus 
sinensis]
Length=153

 Score =   119 bits (297),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 78/118 (66%), Gaps = 3/118 (3%)
 Frame = +2

Query  218  AGLRIDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENA--LNIPYMIINKSLGREKNP  391
            +G  +  VDV  A+ LL  G+ YLDVRT EEF++GHV+ A   NIPYM  N   GR KNP
Sbjct  24   SGAEVITVDVRAAKNLLESGYGYLDVRTAEEFEEGHVDAAKIFNIPYMF-NTPEGRVKNP  82

Query  392  KFMNQVLSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPV  565
             F+ +V S   +E++LVVGC+SG RS++A  DLL   FKHV N  GG  AWV+ GL V
Sbjct  83   DFLKKVRSLCKEEDRLVVGCQSGARSLHATADLLGAGFKHVSNFGGGHMAWVQNGLKV  140



>ref|XP_004303928.1| PREDICTED: rhodanese-like domain-containing protein 19, mitochondrial-like 
[Fragaria vesca subsp. vesca]
Length=137

 Score =   118 bits (295),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 78/112 (70%), Gaps = 1/112 (1%)
 Frame = +2

Query  221  GLRIDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFM  400
            G  + +VDV  A+ LL+ GH YLDVRT EEF   H+ENA+N+PYM   +  G+ KNP+F+
Sbjct  7    GEDVKSVDVFTAKGLLSTGHLYLDVRTSEEFNTSHIENAINVPYMFKTQE-GKVKNPEFL  65

Query  401  NQVLSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKG  556
             ++ S + K++ LVVGC SG RS+ A  DLL+E F+HV NME G+ +WV  G
Sbjct  66   IRISSILKKQDHLVVGCNSGGRSLKACVDLLNEGFEHVTNMERGYSSWVDNG  117



>ref|NP_565497.3| rhodanese-like domain-containing protein [Arabidopsis thaliana]
 sp|Q8RUD6.1|STR19_ARATH RecName: Full=Rhodanese-like domain-containing protein 19, mitochondrial; 
AltName: Full=Sulfurtransferase 19; Short=AtStr19; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAM15209.1| senescence-associated protein [Arabidopsis thaliana]
 gb|AAM15226.1| senescence-associated protein [Arabidopsis thaliana]
 gb|AEC07115.1| rhodanese-like domain-containing protein [Arabidopsis thaliana]
Length=169

 Score =   119 bits (298),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 72/115 (63%), Gaps = 1/115 (1%)
 Frame = +2

Query  230  IDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQV  409
            ++ VDV+ A+  L+ GHRYLDVRT EEF K HVE ALNIPYM      GR  NP F++QV
Sbjct  41   VETVDVYTAKGFLSTGHRYLDVRTNEEFAKSHVEEALNIPYMFKTDE-GRVINPDFLSQV  99

Query  410  LSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHYP  574
             S   K+E L+V C +G R   A  DLL+E + HV NM GG+ AWV  G     P
Sbjct  100  ASVCKKDEHLIVACNAGGRGSRACVDLLNEGYDHVANMGGGYSAWVDAGFAGDKP  154



>dbj|BAE99773.1| hypothetical protein [Arabidopsis thaliana]
Length=157

 Score =   119 bits (297),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 72/115 (63%), Gaps = 1/115 (1%)
 Frame = +2

Query  230  IDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQV  409
            ++ VDV+ A+  L+ GHRYLDVRT EEF K HVE ALNIPYM      GR  NP F++QV
Sbjct  29   VETVDVYTAKGFLSTGHRYLDVRTNEEFAKSHVEEALNIPYMFKTDE-GRVINPDFLSQV  87

Query  410  LSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHYP  574
             S   K+E L+V C +G R   A  DLL+E + HV NM GG+ AWV  G     P
Sbjct  88   ASVCKKDEHLIVACNAGGRGSRACVDLLNEGYDHVANMGGGYSAWVDAGFAGDKP  142



>ref|XP_002271073.3| PREDICTED: thiosulfate sulfurtransferase 16, chloroplastic [Vitis 
vinifera]
Length=181

 Score =   119 bits (298),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 75/110 (68%), Gaps = 1/110 (1%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLS  415
            +V V VA ELL  GHRYLDVRT EEF  GH   A+N+PYM+   S G  KNPKF+ +V S
Sbjct  71   SVPVRVALELLQAGHRYLDVRTPEEFSAGHASGAINVPYMLRFGS-GMAKNPKFLVEVSS  129

Query  416  AIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPV  565
               K+++++VGC+ G RS+ A+ DLL+  F  V ++ GG+DAW + GLP 
Sbjct  130  HFRKDDEIIVGCQKGKRSLMAVNDLLAAGFTAVTDIAGGYDAWSQNGLPT  179



>ref|XP_010428997.1| PREDICTED: rhodanese-like domain-containing protein 19, mitochondrial 
[Camelina sativa]
Length=139

 Score =   118 bits (295),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 72/115 (63%), Gaps = 1/115 (1%)
 Frame = +2

Query  230  IDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQV  409
            ++ VDV+ A+ LL+ GHRYLDVRT EEF K HVE ALNIPYM      GR  NP F+ QV
Sbjct  12   VETVDVYTAKGLLSTGHRYLDVRTNEEFAKSHVEEALNIPYMFKTDE-GRVINPDFLPQV  70

Query  410  LSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHYP  574
             S   K+E L+V C +G R   A  DLL+  ++HV NM GG+ AWV  G     P
Sbjct  71   ASVCKKDEHLIVACNAGGRGSRACVDLLNAGYEHVANMGGGYSAWVDAGFAGDKP  125



>ref|XP_007046665.1| Rhodanese/Cell cycle control phosphatase superfamily protein 
[Theobroma cacao]
 gb|EOX90822.1| Rhodanese/Cell cycle control phosphatase superfamily protein 
[Theobroma cacao]
Length=208

 Score =   120 bits (300),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 81/118 (69%), Gaps = 3/118 (3%)
 Frame = +2

Query  218  AGLRIDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHV--ENALNIPYMIINKSLGREKNP  391
            +G  +  +DV  A+ LL  G+ Y+DVRT EE+KKGHV  E  LNIPYM  N   GR KNP
Sbjct  76   SGSEVVTIDVIQAKSLLQSGYGYIDVRTVEEYKKGHVDAEKILNIPYMF-NTPEGRVKNP  134

Query  392  KFMNQVLSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPV  565
            +F+ QV S   +++ LVVGC+SGVRS+YA  DLL+  FK+V NM GG+ AWV  G P+
Sbjct  135  EFLKQVSSFCKEDDLLVVGCQSGVRSLYATADLLTIGFKNVSNMGGGYLAWVDNGFPL  192



>ref|XP_003629289.1| Thiosulfate sulfurtransferase [Medicago truncatula]
 gb|AET03765.1| rhodanese-related sulfurtransferase [Medicago truncatula]
Length=131

 Score =   117 bits (294),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 75/112 (67%), Gaps = 3/112 (3%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHV--ENALNIPYMIINKSLGREKNPKFMNQV  409
             VDV   + L+   H YLDVRT EEF+KGHV  E  +NI YM  N   GR KNP+F+ +V
Sbjct  15   TVDVLATKSLIKTTHVYLDVRTVEEFQKGHVDSEKIINIAYMF-NTPEGRVKNPEFLKEV  73

Query  410  LSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPV  565
             S   KE+ L+VGC+SGVRS+YA  DLL+E FK V NM GG+  WVKK  PV
Sbjct  74   SSLCNKEDHLIVGCQSGVRSVYATADLLAEGFKDVYNMGGGYLEWVKKEFPV  125



>ref|XP_006828873.1| hypothetical protein AMTR_s00001p00174820 [Amborella trichopoda]
 gb|ERM96289.1| hypothetical protein AMTR_s00001p00174820 [Amborella trichopoda]
Length=123

 Score =   117 bits (292),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 75/110 (68%), Gaps = 1/110 (1%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLS  415
            +V V VA EL   GHRYLDVRT EEF  GHVE A+NIPYM      G +KNP F+ +V +
Sbjct  14   SVPVQVAHELHNAGHRYLDVRTVEEFNAGHVEGAINIPYMF-RVGAGMKKNPNFLEEVSA  72

Query  416  AIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPV  565
             +G+++++++GC+ G RS+ A  DL S  F  V ++ GGF AW++ GLP+
Sbjct  73   QLGQDDEIIIGCQIGKRSLMAATDLSSAGFTGVTDIAGGFSAWLQSGLPL  122



>ref|XP_009769190.1| PREDICTED: thiosulfate sulfurtransferase 16, chloroplastic-like 
[Nicotiana sylvestris]
 gb|AAZ23261.1| senescence-associated protein [Nicotiana tabacum]
Length=185

 Score =   119 bits (297),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 71/110 (65%), Gaps = 1/110 (1%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLS  415
            +V V VA ELL  GHRYLDVRT EEF  GH   A+NIPYM    S G  KNP F+ QVL 
Sbjct  75   SVPVRVALELLQAGHRYLDVRTAEEFSDGHATGAINIPYMFRIGS-GMTKNPNFLEQVLK  133

Query  416  AIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPV  565
              GK+++++VGC+ G RS  A  DLL+  F  V ++ GG+ AW + GLP 
Sbjct  134  HFGKDDEIIVGCQLGKRSFMAATDLLAAGFTGVTDIAGGYAAWTENGLPT  183



>gb|KFK40167.1| hypothetical protein AALP_AA3G339400 [Arabis alpina]
Length=157

 Score =   117 bits (294),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 79/129 (61%), Gaps = 3/129 (2%)
 Frame = +2

Query  185  IPMACLLSSGVAGLRIDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHV--ENALNIPYMI  358
            IP    LSS      I  +DV  A +LL  G+ +LDVRT EEF+KGHV  E   N+PY  
Sbjct  21   IPRTISLSSKPRDNTIITIDVRQAHKLLDSGYTFLDVRTVEEFEKGHVDSERVFNVPYWF  80

Query  359  INKSLGREKNPKFMNQVLSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFD  538
                 G+E NP F+  V S     + LVVGCKSGVRS+YA +DL+S  FK V NM+GG+ 
Sbjct  81   FTPQ-GQEINPSFLKHVSSLCNLTDHLVVGCKSGVRSLYATKDLVSSGFKSVRNMDGGYI  139

Query  539  AWVKKGLPV  565
            AW++K  PV
Sbjct  140  AWIEKMFPV  148



>ref|XP_009611850.1| PREDICTED: thiosulfate sulfurtransferase 16, chloroplastic-like 
[Nicotiana tomentosiformis]
 dbj|BAA88985.2| Ntdin [Nicotiana tabacum]
Length=185

 Score =   118 bits (296),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 71/110 (65%), Gaps = 1/110 (1%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLS  415
            +V V VA ELL  GHRYLDVRT EEF  GH   A+NIPYM    S G  KNP F+ +VL 
Sbjct  75   SVPVRVALELLQAGHRYLDVRTAEEFSDGHAPGAINIPYMFRIGS-GMTKNPNFLEEVLE  133

Query  416  AIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPV  565
              GK+++++VGC+ G RS  A  DLL+  F  V ++ GG+ AW + GLP 
Sbjct  134  RFGKDDEIIVGCQLGKRSFMATSDLLAAGFTGVTDIAGGYAAWTENGLPT  183



>gb|KHG27807.1| Thiosulfate sulfurtransferase, chloroplastic -like protein [Gossypium 
arboreum]
Length=146

 Score =   117 bits (292),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 83/118 (70%), Gaps = 3/118 (3%)
 Frame = +2

Query  218  AGLRIDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHVE--NALNIPYMIINKSLGREKNP  391
            +G  +  + V+ A+ LL  G+RY+DVRT EEF+KGHVE  N LNIPY+ I    GR KNP
Sbjct  8    SGSEVVTIHVNEAKNLLQSGYRYIDVRTVEEFEKGHVEAENILNIPYLFITPE-GRVKNP  66

Query  392  KFMNQVLSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPV  565
            +F+ +V S   +E++L+VGC+SGVRS+ A  DLL   FK+V +M GG+ AWV+ G P+
Sbjct  67   EFLKEVSSLCKEEDRLIVGCQSGVRSLAATADLLKIDFKNVHDMGGGYLAWVENGHPI  124



>ref|XP_009382056.1| PREDICTED: thiosulfate sulfurtransferase 16, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=183

 Score =   118 bits (295),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 83/137 (61%), Gaps = 2/137 (1%)
 Frame = +2

Query  155  IPTIYTQSCSIPMACLLSSGVAGLRIDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHVEN  334
            IP     SC   M+   S+  AG+   +V V VA ELL  GHRYLDVRTE EF  GH   
Sbjct  47   IPRPNHLSCIRSMSSNASAEEAGVP-RSVPVAVAHELLEAGHRYLDVRTEGEFSSGHAVG  105

Query  335  ALNIPYMIINKSLGREKNPKFMNQVLSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHV  514
            A+NIPYM  + S G  KNP FM +VLS   K+++++VGC SG RS  A  +L +  F  +
Sbjct  106  AVNIPYMFKSNS-GMSKNPNFMQEVLSTFKKDDEIIVGCLSGKRSSMAATELSNAGFTGI  164

Query  515  CNMEGGFDAWVKKGLPV  565
             ++ GG+ AWV+ GLP 
Sbjct  165  TDISGGYSAWVENGLPT  181



>ref|XP_006393789.1| hypothetical protein EUTSA_v10005068mg [Eutrema salsugineum]
 gb|ESQ31075.1| hypothetical protein EUTSA_v10005068mg [Eutrema salsugineum]
Length=121

 Score =   115 bits (289),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 72/111 (65%), Gaps = 1/111 (1%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLS  415
            +V V VA +LL  GHRYLDVRT EEF +GH   A+N+PYM    S G  KNP F+ QV S
Sbjct  10   SVSVIVAHDLLLAGHRYLDVRTPEEFSQGHACGAINVPYMKRGDS-GMSKNPSFLEQVSS  68

Query  416  AIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVH  568
              G+ +K++VGC+SG RS+ A  +LL   F  V ++ GG+ AW + GLP  
Sbjct  69   HFGEADKIIVGCQSGGRSLKATAELLDAGFTGVTDIAGGYAAWTQNGLPTQ  119



>ref|NP_851278.1| thiosulfate sulfurtransferase 16 [Arabidopsis thaliana]
 sp|Q39129.2|STR16_ARATH RecName: Full=Thiosulfate sulfurtransferase 16, chloroplastic; 
AltName: Full=Rhodanese; AltName: Full=Senescence-associated 
protein; AltName: Full=Sulfurtransferase 16; Short=AtStr16 
[Arabidopsis thaliana]
 dbj|BAB10409.1| senescence-associated protein sen1-like protein; ketoconazole 
resistance protein-like [Arabidopsis thaliana]
 gb|AAK83644.1| AT5g66040/K2A18_11 [Arabidopsis thaliana]
 gb|AAM61332.1| senescence-associated protein [Arabidopsis thaliana]
 gb|AAN38701.1| At5g66040/K2A18_11 [Arabidopsis thaliana]
 gb|AED98146.1| thiosulfate sulfurtransferase 16 [Arabidopsis thaliana]
Length=120

 Score =   115 bits (289),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 71/110 (65%), Gaps = 1/110 (1%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLS  415
            +V V VA +LL  GHRYLDVRT EEF +GH   A+N+PYM    S G  KNP F+ QV S
Sbjct  10   SVSVTVAHDLLLAGHRYLDVRTPEEFSQGHACGAINVPYMNRGAS-GMSKNPDFLEQVSS  68

Query  416  AIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPV  565
              G+ + ++VGC+SG RS+ A  DLL   F  V ++ GG+ AW K GLP 
Sbjct  69   HFGQSDNIIVGCQSGGRSIKATTDLLHAGFTGVKDIVGGYSAWAKNGLPT  118



>ref|XP_002878530.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54789.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=140

 Score =   116 bits (291),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 73/117 (62%), Gaps = 1/117 (1%)
 Frame = +2

Query  230  IDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQV  409
            ++ VDV+ A+  L+ GHRYLDVRT EEF K HVE+ALNIPYM      GR  NP F+ QV
Sbjct  12   VETVDVYTAKGFLSTGHRYLDVRTNEEFAKSHVEDALNIPYM-FQTDEGRVINPDFLPQV  70

Query  410  LSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHYPNK  580
             S   K+E ++V C +G R   A  DLL+  ++HV NM GG+ AWV  G     P +
Sbjct  71   ASVCKKDEHMIVACNAGGRGSRACVDLLNAGYEHVANMGGGYSAWVDAGFAGDKPRE  127



>gb|KHN46455.1| Thiosulfate sulfurtransferase, chloroplastic [Glycine soja]
Length=145

 Score =   116 bits (291),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 77/113 (68%), Gaps = 2/113 (2%)
 Frame = +2

Query  239  VDVHVAQELL-AKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLS  415
            +DVH A++LL + G+RYLDVR+ EEF K HVENA N+PY+ I ++ GR KNP F++QV +
Sbjct  13   IDVHAAKDLLNSSGYRYLDVRSVEEFNKSHVENAHNVPYVFITEA-GRVKNPDFVDQVAA  71

Query  416  AIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHYP  574
                E+ L+V C SG RS+ A  DLL   FK++ NM GG+ AWV  G   + P
Sbjct  72   ICKTEDHLIVACNSGGRSLRASVDLLDSGFKNIVNMGGGYSAWVDAGFAGNKP  124



>ref|XP_010444848.1| PREDICTED: thiosulfate sulfurtransferase 16, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=120

 Score =   115 bits (289),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 70/111 (63%), Gaps = 1/111 (1%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLS  415
            +V V VA +LL  GHRYLDVRT EEF +GH   A+N+PY+    S G  KNP F+ QV S
Sbjct  10   SVSVTVAHDLLLAGHRYLDVRTPEEFSQGHPCGAINVPYLKRGAS-GMSKNPDFLEQVSS  68

Query  416  AIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVH  568
              GK + ++VGC+SG RS  A  DLL   F  V ++ GG+ AW + GLP  
Sbjct  69   HFGKSDDIIVGCQSGARSFIATTDLLDAGFTAVKDVSGGYAAWAQNGLPTQ  119



>ref|XP_004967296.1| PREDICTED: senescence-associated protein DIN1-like [Setaria italica]
Length=169

 Score =   117 bits (292),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 73/111 (66%), Gaps = 1/111 (1%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLS  415
            +V VH+A EL   GHRYLDVRTE EF+ GH E A+NIPYM    S G  KN  F+ QV  
Sbjct  59   SVPVHIAYELQQAGHRYLDVRTESEFRDGHPERAVNIPYMFKTGS-GMMKNSHFLEQVAR  117

Query  416  AIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVH  568
              GK++ ++VGC+SG RS+ A  +L S  F  V ++ GGF +W + GLP++
Sbjct  118  IFGKDDDIIVGCQSGRRSLMAATELYSAGFTAVTDIAGGFSSWRENGLPIN  168



>ref|XP_010472080.1| PREDICTED: rhodanese-like domain-containing protein 19, mitochondrial 
[Camelina sativa]
Length=140

 Score =   115 bits (289),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 71/115 (62%), Gaps = 1/115 (1%)
 Frame = +2

Query  230  IDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQV  409
            ++ VDV+ A+ LL+ GHRYLDVRT EEF K H E ALNIPYM      GR  NP F+  V
Sbjct  12   VETVDVYTAKGLLSTGHRYLDVRTNEEFAKSHAEEALNIPYM-FKTDQGRVINPDFLPPV  70

Query  410  LSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHYP  574
             S   K+E L+V C SG R+  A  DLL+  ++HV NM GG+ AWV  G     P
Sbjct  71   ASVCKKDEHLIVACNSGGRASRACVDLLNAGYEHVANMGGGYSAWVDAGFAGDKP  125



>ref|XP_010416844.1| PREDICTED: rhodanese-like domain-containing protein 19, mitochondrial 
[Camelina sativa]
Length=140

 Score =   115 bits (288),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 71/115 (62%), Gaps = 1/115 (1%)
 Frame = +2

Query  230  IDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQV  409
            ++ VD + A+ LL+ GHRYLDVRT EEF K H E ALNIPYM      GR  NP F+ QV
Sbjct  12   VETVDGYTAKGLLSTGHRYLDVRTNEEFAKSHAEEALNIPYMFKTDE-GRVINPDFLPQV  70

Query  410  LSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHYP  574
             S   K+E L+V C SG R+  A  DLL+  ++HV NM GG+ AWV  G     P
Sbjct  71   ASVCKKDEHLIVACNSGGRASRACVDLLNAGYEHVANMGGGYSAWVDAGFAGDKP  125



>ref|XP_010683028.1| PREDICTED: thiosulfate sulfurtransferase 16, chloroplastic-like 
[Beta vulgaris subsp. vulgaris]
Length=193

 Score =   117 bits (292),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 73/110 (66%), Gaps = 1/110 (1%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLS  415
            +V V VA ELL  GHRYLDVRT EEF  GHV  A+NIPYM+   S G  KNP F+ QV S
Sbjct  83   SVPVRVAHELLLAGHRYLDVRTMEEFTAGHVPGAVNIPYMLRIGS-GMTKNPDFLEQVSS  141

Query  416  AIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPV  565
              GK+++++VGC+SG RS+ A  DL S  +  + ++ GG+ AW +  LP 
Sbjct  142  LFGKDDEILVGCQSGKRSLMAANDLHSAGYSSIIDIAGGYSAWAQSELPT  191



>gb|AFK36781.1| unknown [Lotus japonicus]
Length=136

 Score =   115 bits (288),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 74/114 (65%), Gaps = 2/114 (2%)
 Frame = +2

Query  236  NVDVHVAQELL-AKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVL  412
            NVDV  A++LL + G+RYLDVRT EEF K HV+NALNI YM   ++ GR KNP F++QV 
Sbjct  12   NVDVEAAKDLLNSSGYRYLDVRTVEEFNKSHVDNALNIAYMFSTEA-GRVKNPDFLDQVA  70

Query  413  SAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHYP  574
            +    E+ L+V C SG R   A+ DLL   +KHV NM GG+ AWV  G     P
Sbjct  71   AVCKSEDHLLVACNSGGRGRKAVIDLLDSGYKHVFNMGGGYSAWVDAGFAGDKP  124



>gb|AFK45976.1| unknown [Lotus japonicus]
Length=152

 Score =   115 bits (289),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 76/112 (68%), Gaps = 3/112 (3%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENA--LNIPYMIINKSLGREKNPKFMNQV  409
             VDV  A+ L+   H YLDVRT EEF+KGHV+    +NIPYM  N   GR KN +F  ++
Sbjct  15   TVDVVAAKGLIQTTHVYLDVRTVEEFEKGHVDTVKIINIPYMF-NTPEGRVKNQEFRKEL  73

Query  410  LSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPV  565
            LSA  KE+ ++VGC+SGVRS+YA  DLL+E FK V NM GG+  W+K   PV
Sbjct  74   LSACKKEDHVIVGCQSGVRSLYATADLLAEGFKDVSNMGGGYVDWLKNEFPV  125



>gb|ACA79924.1| chloroplast N receptor-interacting protein 1 [Nicotiana benthamiana]
 gb|ACA79925.1| chloroplast N receptor-interacting protein 1 [Nicotiana benthamiana]
Length=185

 Score =   116 bits (291),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 70/110 (64%), Gaps = 1/110 (1%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLS  415
            +V V VA ELL  GHRYLDVRT EEF  GH   A+NIPYM    S G  KNP F  QVL 
Sbjct  75   SVPVRVALELLQAGHRYLDVRTAEEFSDGHAPGAINIPYMFRIGS-GMIKNPNFAEQVLE  133

Query  416  AIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPV  565
              GK+++++VGC+ G RS  A  DLL+  F  V ++ GG+ AW + GLP 
Sbjct  134  HFGKDDEIIVGCQLGKRSFMAATDLLAAGFSGVTDIAGGYAAWTENGLPT  183



>ref|XP_008812021.1| PREDICTED: rhodanese-like domain-containing protein 17 [Phoenix 
dactylifera]
Length=119

 Score =   114 bits (286),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 75/105 (71%), Gaps = 0/105 (0%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLS  415
            +VD H A++LL  GHRYLDVR  E+F+KGHVE A+N+P+       G+EKNP+F+  V S
Sbjct  8    SVDAHEARKLLNSGHRYLDVRMREDFEKGHVEGAINVPFYSSVTPQGKEKNPQFIEHVSS  67

Query  416  AIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVK  550
              GK++  +VGC+SGV+S  A  DLL+  FK+V NM+ G+ +WV+
Sbjct  68   IYGKDDHFIVGCQSGVQSKLATLDLLNSGFKNVKNMQRGYLSWVE  112



>ref|XP_009612115.1| PREDICTED: rhodanese-like domain-containing protein 19, mitochondrial 
[Nicotiana tomentosiformis]
Length=137

 Score =   115 bits (287),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 74/106 (70%), Gaps = 1/106 (1%)
 Frame = +2

Query  230  IDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQV  409
            + +VDV  A++LL+ GHRYLDVRT EEF +GH++ A+NIPYM + +  GR +NP F+ QV
Sbjct  10   VSHVDVISAKDLLSSGHRYLDVRTVEEFNRGHIDKAINIPYMFLTEE-GRVQNPNFLVQV  68

Query  410  LSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWV  547
             S   KE+ L+VGC SG R   A  DLL+  +K V N+EGG+  WV
Sbjct  69   SSVCQKEDHLIVGCNSGGRGRRACVDLLNAGYKDVINLEGGYSGWV  114



>ref|XP_011034939.1| PREDICTED: thiosulfate sulfurtransferase 16, chloroplastic-like 
[Populus euphratica]
Length=193

 Score =   116 bits (291),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 73/110 (66%), Gaps = 1/110 (1%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLS  415
            +V VHVA  LL  GH+YLDVRT +EF+ GH   A+NIPYM+ N      KN KF+ +V S
Sbjct  83   SVPVHVAHALLQVGHQYLDVRTHDEFRAGHPSGAINIPYML-NHGAEMFKNSKFLEEVSS  141

Query  416  AIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPV  565
              GK++ +VVGCKSG RS+ A  DL S  F  V ++ GG+ AW + GLP+
Sbjct  142  QFGKDDDIVVGCKSGRRSLMAANDLQSAGFNRVIDVAGGYTAWTENGLPI  191



>ref|XP_010547424.1| PREDICTED: thiosulfate sulfurtransferase 18-like isoform X2 [Tarenaya 
hassleriana]
Length=134

 Score =   114 bits (286),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 79/122 (65%), Gaps = 6/122 (5%)
 Frame = +2

Query  218  AGLRIDNVDVHVAQELL-AKGHRYLDVRTEEEFKKGHV----ENALNIPYMIINKSLGRE  382
            +G  +  VDV  A+ LL A GH YLDVRTEEEF  GH     +   N+PYM  +   GRE
Sbjct  4    SGSEVVTVDVTEAKNLLEAAGHVYLDVRTEEEFGSGHCLAPKDKIFNVPYMF-DTPHGRE  62

Query  383  KNPKFMNQVLSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLP  562
            KNP F+NQV S + + + ++VGC+SGVRS+ A  DL++  +K   N+ GG+ AWV K LP
Sbjct  63   KNPDFLNQVSSLLNQTDDILVGCRSGVRSLDATTDLMAAGYKKASNVGGGYLAWVNKMLP  122

Query  563  VH  568
            VH
Sbjct  123  VH  124



>ref|XP_007017932.1| Rhodanese/Cell cycle control phosphatase superfamily protein, 
putative [Theobroma cacao]
 gb|EOY15157.1| Rhodanese/Cell cycle control phosphatase superfamily protein, 
putative [Theobroma cacao]
Length=184

 Score =   116 bits (290),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 73/111 (66%), Gaps = 1/111 (1%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYM-IINKSLGREKNPKFMNQVL  412
            +V V VA ELL  GHRYLDVRT +EF  GH   A+NIPY  I+N      KN KF+ +V 
Sbjct  72   SVSVRVAYELLQAGHRYLDVRTCDEFDAGHPPAAINIPYFHILNGEGMSLKNSKFLEEVS  131

Query  413  SAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPV  565
            S  GKEEK++VGCK+G RS+ A  DL +  F HV ++ GG+ AW + GLP 
Sbjct  132  SEFGKEEKIIVGCKTGRRSLMAATDLHASGFTHVTDVAGGYTAWKENGLPT  182



>ref|XP_009124574.1| PREDICTED: rhodanese-like domain-containing protein 17 [Brassica 
rapa]
 emb|CDY29204.1| BnaA06g25530D [Brassica napus]
Length=153

 Score =   115 bits (287),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 74/111 (67%), Gaps = 3/111 (3%)
 Frame = +2

Query  239  VDVHVAQELLAKGHRYLDVRTEEEFKKGHV--ENALNIPYMIINKSLGREKNPKFMNQVL  412
            +DV+ A +LL +GH +LDVRT EEF+KGHV  E   N+PY       G+E NP F+  V 
Sbjct  35   IDVNQAHKLLHQGHTFLDVRTVEEFEKGHVNSEKVFNVPYWFYTPQ-GQENNPNFLKHVS  93

Query  413  SAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPV  565
            S   + + LVVGCKSGVRS+YA   L+S  FK V NM+GG+ AW++K  PV
Sbjct  94   SLFNQTDHLVVGCKSGVRSLYATRVLVSSGFKSVRNMDGGYIAWMEKRFPV  144



>ref|XP_006425437.1| hypothetical protein CICLE_v10026691mg [Citrus clementina]
 gb|ESR38677.1| hypothetical protein CICLE_v10026691mg [Citrus clementina]
Length=138

 Score =   114 bits (286),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 79/119 (66%), Gaps = 4/119 (3%)
 Frame = +2

Query  218  AGLRIDNVDVHVAQELL-AKGHRYLDVRTEEEFKKGHVENA--LNIPYMIINKSLGREKN  388
            +G  +  VDV  A+ LL + G+ YLDVRT EEF++GHV+ A   NIPYM  N   GR KN
Sbjct  8    SGAEVITVDVRAAKNLLESGGYGYLDVRTAEEFEEGHVDAAKIFNIPYMF-NTPEGRVKN  66

Query  389  PKFMNQVLSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPV  565
            P F+ +V S   +E++LVVGC+SG RS++A  DLL   FKHV N  GG  AWV+ GL V
Sbjct  67   PDFLKKVRSLCKEEDRLVVGCQSGARSLHATADLLGAGFKHVSNFGGGHMAWVQNGLKV  125



>emb|CDY07813.1| BnaC03g48090D [Brassica napus]
Length=153

 Score =   115 bits (287),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 74/111 (67%), Gaps = 3/111 (3%)
 Frame = +2

Query  239  VDVHVAQELLAKGHRYLDVRTEEEFKKGHV--ENALNIPYMIINKSLGREKNPKFMNQVL  412
            +DV+ A +LL +GH +LDVRT EEF+KGHV  E   N+PY       G+E NP F+  V 
Sbjct  35   IDVNQAHKLLHQGHTFLDVRTVEEFEKGHVNSEKVFNVPYWFYTPQ-GQENNPNFLKHVS  93

Query  413  SAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPV  565
            S   + + LVVGCKSGVRS+YA   L+S  FK V NM+GG+ AW++K  PV
Sbjct  94   SLFNQTDNLVVGCKSGVRSLYATRVLVSSGFKSVRNMDGGYIAWMEKRFPV  144



>gb|AII82181.1| arsenate reductase [Arabidopsis thaliana]
Length=168

 Score =   115 bits (288),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 72/115 (63%), Gaps = 2/115 (2%)
 Frame = +2

Query  230  IDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQV  409
            ++ VDV+ A+  L+ GHRYLDVRT EEF KGHVE ALNIPYM      GR  NP F++QV
Sbjct  41   VETVDVYTAKGFLSTGHRYLDVRTNEEFAKGHVEEALNIPYMFKTDE-GRVINPDFLSQV  99

Query  410  LSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHYP  574
             S   K+E L+  C +G R   A  DLL+E + HV NM GG+ AWV  G     P
Sbjct  100  ASVCKKDEHLIA-CNAGGRGSRACVDLLNEGYDHVANMGGGYSAWVDAGFAGDKP  153



>ref|XP_007131527.1| hypothetical protein PHAVU_011G020400g [Phaseolus vulgaris]
 gb|ESW03521.1| hypothetical protein PHAVU_011G020400g [Phaseolus vulgaris]
Length=136

 Score =   114 bits (286),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 72/113 (64%), Gaps = 2/113 (2%)
 Frame = +2

Query  239  VDVHVAQELL-AKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLS  415
            +DVH A+ LL +  + YLDVR+ EEF K HVENA N+PYM I ++ GR KNP F+ QV +
Sbjct  13   IDVHAAKNLLNSSDYSYLDVRSVEEFNKSHVENAYNVPYMFITEA-GRVKNPDFVEQVTA  71

Query  416  AIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHYP  574
                E+ L+V C SG RS+ A  DLL   FKH+ NM GG+ AWV  G     P
Sbjct  72   ICKNEDHLIVACNSGGRSLKASVDLLDSGFKHIVNMGGGYSAWVDAGFAGDKP  124



>ref|XP_010547423.1| PREDICTED: thiosulfate sulfurtransferase 18-like isoform X1 [Tarenaya 
hassleriana]
Length=138

 Score =   114 bits (286),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 79/122 (65%), Gaps = 6/122 (5%)
 Frame = +2

Query  218  AGLRIDNVDVHVAQELL-AKGHRYLDVRTEEEFKKGHV----ENALNIPYMIINKSLGRE  382
            +G  +  VDV  A+ LL A GH YLDVRTEEEF  GH     +   N+PYM  +   GRE
Sbjct  8    SGSEVVTVDVTEAKNLLEAAGHVYLDVRTEEEFGSGHCLAPKDKIFNVPYMF-DTPHGRE  66

Query  383  KNPKFMNQVLSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLP  562
            KNP F+NQV S + + + ++VGC+SGVRS+ A  DL++  +K   N+ GG+ AWV K LP
Sbjct  67   KNPDFLNQVSSLLNQTDDILVGCRSGVRSLDATTDLMAAGYKKASNVGGGYLAWVNKMLP  126

Query  563  VH  568
            VH
Sbjct  127  VH  128



>gb|AFK48571.1| unknown [Lotus japonicus]
Length=150

 Score =   114 bits (286),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 85/129 (66%), Gaps = 5/129 (4%)
 Frame = +2

Query  215  VAGLRIDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENA--LNIPYMIINKSLGREKN  388
            ++  ++  VDVH A+ L+  GH YLDVRT  EF +GHV+ A  +NIPYMI +   GR KN
Sbjct  23   ISAAKVVTVDVHAAKRLIQNGHTYLDVRTVNEFVEGHVDAAKIINIPYMI-DTPKGRVKN  81

Query  389  PKFMNQVLSAIG-KEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPV  565
              F+ +V S    KE+ L+VGCKSGVRS+ A  DLL+  +K+V +M GG+  WV+   PV
Sbjct  82   QDFLKEVSSVFSNKEDHLIVGCKSGVRSLSATADLLANGYKNVNDMGGGYMDWVRNKFPV  141

Query  566  HYP-NKTEL  589
            + P +K EL
Sbjct  142  NAPADKEEL  150



>ref|XP_009803106.1| PREDICTED: rhodanese-like domain-containing protein 19, mitochondrial 
[Nicotiana sylvestris]
Length=136

 Score =   114 bits (285),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 74/106 (70%), Gaps = 1/106 (1%)
 Frame = +2

Query  230  IDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQV  409
            + +VDV  A++LL+ GHRYLDVRT EEF +GH++ A+NIPYM + +  GR +NP F+ QV
Sbjct  10   VSHVDVISAKDLLSSGHRYLDVRTVEEFNRGHIDKAINIPYMFLTEE-GRVQNPDFLVQV  68

Query  410  LSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWV  547
             S   KE+ L+VGC SG R   A  DLL+  +  V N+EGG+ AWV
Sbjct  69   SSVCQKEDHLIVGCNSGGRGRRACVDLLNAGYTDVRNLEGGYSAWV  114



>ref|XP_009121118.1| PREDICTED: rhodanese-like domain-containing protein 19, mitochondrial 
[Brassica rapa]
 emb|CDY24335.1| BnaA07g02600D [Brassica napus]
Length=141

 Score =   114 bits (285),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 74/116 (64%), Gaps = 2/116 (2%)
 Frame = +2

Query  230  IDNVDVHVAQELLAKGH-RYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQ  406
            +++VDV+ A+ LL  GH RYLDVRT EEF K H ++ALNIPYM      GR  NP F+ Q
Sbjct  12   VESVDVYTAKGLLTIGHHRYLDVRTNEEFAKSHFDDALNIPYMFKTDE-GRIVNPDFLPQ  70

Query  407  VLSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHYP  574
            V S   K++ L+V C SG R+  A  DLL+  ++HV NMEGG+ AWV  G     P
Sbjct  71   VASVCKKDDNLIVACNSGGRATRACVDLLNAGYEHVANMEGGYSAWVDAGFAGDKP  126



>ref|XP_003612194.1| Thiosulfate sulfurtransferase [Medicago truncatula]
 gb|AES95152.1| rhodanese-related sulfurtransferase [Medicago truncatula]
 gb|AFK45003.1| unknown [Medicago truncatula]
Length=145

 Score =   114 bits (285),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 80/118 (68%), Gaps = 3/118 (3%)
 Frame = +2

Query  218  AGLRIDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENA--LNIPYMIINKSLGREKNP  391
            +G ++  +DVH A+ L+  GH YLDVRT EEF+KGHV+    +NIPY++ +   GR KN 
Sbjct  26   SGAKVVTIDVHAAKNLIQTGHIYLDVRTVEEFEKGHVDATKIINIPYLL-DTPKGRVKNL  84

Query  392  KFMNQVLSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPV  565
             F+ QV S+  KE+ LVVGC+SG RS  A  +LL++ FK+V NM GG+  WV   LPV
Sbjct  85   NFVKQVSSSCDKEDCLVVGCQSGKRSFSATSELLADGFKNVHNMGGGYMEWVSNKLPV  142



>ref|XP_008241912.1| PREDICTED: receptor homology region, transmembrane domain- and 
RING domain-containing protein 1 [Prunus mume]
Length=510

 Score =   120 bits (300),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 81/121 (67%), Gaps = 3/121 (2%)
 Frame = +2

Query  218  AGLRIDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENA--LNIPYMIINKSLGREKNP  391
            +G  +  +DV  A++LL  G+ Y+DVRT EE+KKGHV+    LNIPY+  N   GR KNP
Sbjct  371  SGSEVVTIDVQAAKDLLKSGYGYVDVRTVEEYKKGHVDTGKILNIPYLF-NTPEGRVKNP  429

Query  392  KFMNQVLSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHY  571
            +F+ +V SA  KE+ LVVGC+SGVRS+ A  DL +  FK V NM GG+ AW++   PV  
Sbjct  430  QFLREVSSACNKEDLLVVGCQSGVRSLSATADLRTAGFKQVNNMGGGYRAWLEHHFPVTK  489

Query  572  P  574
            P
Sbjct  490  P  490



>ref|XP_006425434.1| hypothetical protein CICLE_v10026691mg [Citrus clementina]
 ref|XP_006425435.1| hypothetical protein CICLE_v10026691mg [Citrus clementina]
 ref|XP_006425436.1| hypothetical protein CICLE_v10026691mg [Citrus clementina]
 gb|ESR38674.1| hypothetical protein CICLE_v10026691mg [Citrus clementina]
 gb|ESR38675.1| hypothetical protein CICLE_v10026691mg [Citrus clementina]
 gb|ESR38676.1| hypothetical protein CICLE_v10026691mg [Citrus clementina]
Length=154

 Score =   114 bits (286),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 79/119 (66%), Gaps = 4/119 (3%)
 Frame = +2

Query  218  AGLRIDNVDVHVAQELL-AKGHRYLDVRTEEEFKKGHVENA--LNIPYMIINKSLGREKN  388
            +G  +  VDV  A+ LL + G+ YLDVRT EEF++GHV+ A   NIPYM  N   GR KN
Sbjct  24   SGAEVITVDVRAAKNLLESGGYGYLDVRTAEEFEEGHVDAAKIFNIPYMF-NTPEGRVKN  82

Query  389  PKFMNQVLSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPV  565
            P F+ +V S   +E++LVVGC+SG RS++A  DLL   FKHV N  GG  AWV+ GL V
Sbjct  83   PDFLKKVRSLCKEEDRLVVGCQSGARSLHATADLLGAGFKHVSNFGGGHMAWVQNGLKV  141



>ref|NP_565426.2| rhodanese-like domain-containing protein 17 [Arabidopsis thaliana]
 sp|F4IPI4.1|STR17_ARATH RecName: Full=Rhodanese-like domain-containing protein 17; AltName: 
Full=Sulfurtransferase 17; Short=AtStr17 [Arabidopsis 
thaliana]
 gb|AEC06695.1| rhodanese-like domain-containing protein 17 [Arabidopsis thaliana]
Length=156

 Score =   114 bits (285),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 58/127 (46%), Positives = 84/127 (66%), Gaps = 3/127 (2%)
 Frame = +2

Query  206  SSGVAGLRIDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHV--ENALNIPYMIINKSLGR  379
            ++ ++  ++  +DV+ AQ+LL  G+ +LDVRT EEFKKGHV  EN  N+PY +     G+
Sbjct  24   TTSMSEPKVITIDVNQAQKLLDSGYTFLDVRTVEEFKKGHVDSENVFNVPYWLYTPQ-GQ  82

Query  380  EKNPKFMNQVLSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGL  559
            E NP F+  V S   + + L++GCKSGVRS++A + L+S  FK V NM+GG+ AWV K  
Sbjct  83   EINPNFLKHVSSLCNQTDHLILGCKSGVRSLHATKFLVSSGFKTVRNMDGGYIAWVNKRF  142

Query  560  PVHYPNK  580
            PV   +K
Sbjct  143  PVKVEHK  149



>ref|XP_010466093.1| PREDICTED: thiosulfate sulfurtransferase 16, chloroplastic isoform 
X4 [Camelina sativa]
Length=120

 Score =   113 bits (283),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 70/111 (63%), Gaps = 1/111 (1%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLS  415
            +V V VA +LL  GHRYLDVRT EEF +GH   A+N+PY+    S G  KNP F+ QV S
Sbjct  10   SVSVTVAHDLLLAGHRYLDVRTPEEFSQGHPCGAINVPYLKRGPS-GMSKNPDFLEQVSS  68

Query  416  AIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVH  568
              G+ + ++VGC+SG RS  A  DLL   F  V ++ GG+ AW + GLP  
Sbjct  69   HFGQSDDIIVGCQSGGRSFIATTDLLDAGFTAVKDVSGGYAAWAQNGLPTQ  119



>gb|AII82177.1| arsenate reductase [Arabidopsis thaliana]
Length=168

 Score =   114 bits (286),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 72/115 (63%), Gaps = 2/115 (2%)
 Frame = +2

Query  230  IDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQV  409
            ++ VDV+ A+  L+ GHRYLDVRT EEF K HVE ALNIPYM      GR  NP F++QV
Sbjct  41   VETVDVYTAKGFLSTGHRYLDVRTNEEFAKSHVEEALNIPYMFKTDE-GRVINPDFLSQV  99

Query  410  LSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHYP  574
             SA  K+E L+  C +G R   A  DLL+E + HV NM GG+ AWV  G     P
Sbjct  100  ASACKKDEHLIA-CNAGGRGSRACVDLLNEGYDHVANMGGGYSAWVDAGFAGDKP  153



>gb|KHN41852.1| Senescence-associated protein DIN1 [Glycine soja]
Length=185

 Score =   115 bits (287),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 70/110 (64%), Gaps = 1/110 (1%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLS  415
            +V V VA ELL  GHRYLDVRT EEF  GH   A+NIPYM    S G  KN  F+ QV S
Sbjct  75   SVPVRVAYELLLAGHRYLDVRTPEEFNAGHAPGAINIPYMFRVGS-GMTKNSNFIRQVSS  133

Query  416  AIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPV  565
               KE++++VGC+ G RSM A  DLL+  F  + +M GG+ AW + GLP 
Sbjct  134  NFRKEDEIIVGCELGKRSMMAASDLLAAGFTGLTDMAGGYAAWTQNGLPT  183



>gb|AII82195.1| arsenate reductase [Arabidopsis thaliana]
Length=139

 Score =   114 bits (284),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 72/115 (63%), Gaps = 2/115 (2%)
 Frame = +2

Query  230  IDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQV  409
            ++ VDV++A+  L+ GHRYLDVRT EEF K HVE ALNIPYM      GR  NP F++QV
Sbjct  12   VETVDVYIAKGFLSTGHRYLDVRTNEEFAKSHVEEALNIPYM-FQTDEGRVINPDFLSQV  70

Query  410  LSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHYP  574
             S   K+E L+  C +G R   A  DLL+E + HV NM GG+ AWV  G     P
Sbjct  71   ASVCKKDEHLIA-CNAGGRGSRACVDLLNEGYDHVANMGGGYSAWVDAGFAGDKP  124



>emb|CDY49429.1| BnaC07g06480D [Brassica napus]
Length=141

 Score =   114 bits (284),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 74/116 (64%), Gaps = 2/116 (2%)
 Frame = +2

Query  230  IDNVDVHVAQELLAKGH-RYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQ  406
            +++VDV+ A+ LL  GH RYLDVRT EEF K H ++ALNIPYM      GR  NP F+ Q
Sbjct  12   VESVDVYTAKGLLTIGHHRYLDVRTNEEFAKSHFDDALNIPYMFKTDE-GRIVNPDFLPQ  70

Query  407  VLSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHYP  574
            V S   K++ L+V C SG R+  A  DLL+  ++HV NMEGG+ AWV  G     P
Sbjct  71   VSSVCKKDDNLIVACNSGGRATRACVDLLNAGYEHVANMEGGYSAWVDAGFAGDKP  126



>ref|XP_002866770.1| hypothetical protein ARALYDRAFT_496998 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43029.1| hypothetical protein ARALYDRAFT_496998 [Arabidopsis lyrata subsp. 
lyrata]
Length=136

 Score =   113 bits (283),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 82/128 (64%), Gaps = 3/128 (2%)
 Frame = +2

Query  191  MACLLSSGVAGLRIDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENA--LNIPYMIIN  364
            M+  +SS      + +VDV  A+ LL  GH+YLDVRT+EEF++GH E A  +NIPYMI N
Sbjct  1    MSQSISSSTKAEEVVSVDVSEAKTLLQSGHQYLDVRTQEEFRRGHCEAAKIVNIPYMI-N  59

Query  365  KSLGREKNPKFMNQVLSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAW  544
               GR KN  F+ QV S +   + ++VGC+SG RS+ A  +L++  +K V NM GG+ AW
Sbjct  60   TPQGRVKNQDFLEQVSSLLDPADDILVGCQSGARSLKATTELVAAGYKKVRNMGGGYLAW  119

Query  545  VKKGLPVH  568
            V    P++
Sbjct  120  VDHSFPIN  127



>ref|XP_004147071.1| PREDICTED: rhodanese-like domain-containing protein 19, mitochondrial-like 
[Cucumis sativus]
 ref|XP_004158408.1| PREDICTED: rhodanese-like domain-containing protein 19, mitochondrial-like 
[Cucumis sativus]
 gb|KGN61922.1| hypothetical protein Csa_2G270150 [Cucumis sativus]
Length=130

 Score =   113 bits (283),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 72/112 (64%), Gaps = 1/112 (1%)
 Frame = +2

Query  239  VDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLSA  418
            VDV VA++LL KG   LDVRT EE+ KGHVENALN+PY+      G+ KNP F+ QV S 
Sbjct  5    VDVQVAKDLLEKGRLCLDVRTVEEYNKGHVENALNVPYVFFTPE-GQVKNPDFLAQVTSI  63

Query  419  IGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHYP  574
            + KE+ +VV C  G R + A  DLL+  F+HV NM GG+ AWV  G     P
Sbjct  64   LKKEDHIVVNCNRGGRGLRACVDLLNAGFEHVNNMGGGYSAWVDSGFAGEKP  115



>ref|XP_004513263.1| PREDICTED: rhodanese-like domain-containing protein 19, mitochondrial-like 
[Cicer arietinum]
Length=136

 Score =   113 bits (283),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 75/113 (66%), Gaps = 2/113 (2%)
 Frame = +2

Query  239  VDVHVAQELL-AKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLS  415
            +DVH A++LL + G+ YLDVR+ EEFKK HVENA+N+PYM I ++ GR +NP F+ QV  
Sbjct  13   LDVHAAKDLLDSSGYHYLDVRSVEEFKKSHVENAINVPYMFITEA-GRVQNPDFVKQVAE  71

Query  416  AIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHYP  574
                E+ L+V C SG RS  A  DLL+  ++H+ NM GG+  WV  G   + P
Sbjct  72   IYKSEDHLIVACNSGGRSSRACVDLLNSGYEHIINMGGGYSGWVDAGFAGNIP  124



>ref|XP_011100158.1| PREDICTED: thiosulfate sulfurtransferase 18-like [Sesamum indicum]
Length=129

 Score =   113 bits (283),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 72/99 (73%), Gaps = 2/99 (2%)
 Frame = +2

Query  200  LLSSGVAGLRIDNVDVHVAQELLAKG-HRYLDVRTEEEFKKGHVENALNIPYMIINKSLG  376
            L+    +G  +  VDV  A++LL +  +RYLDVRTEEEFK GHVEN  NIPYM  N   G
Sbjct  3    LIKKSSSGGEVITVDVLAAKDLLHQALYRYLDVRTEEEFKNGHVENTFNIPYMF-NTPKG  61

Query  377  REKNPKFMNQVLSAIGKEEKLVVGCKSGVRSMYAIEDLL  493
            R KNPKF++QVL+  GKE+ L+VGC+SGVRS+YA  DLL
Sbjct  62   RVKNPKFVDQVLAVSGKEDHLLVGCQSGVRSVYATTDLL  100



>gb|EYU23742.1| hypothetical protein MIMGU_mgv1a018856mg [Erythranthe guttata]
Length=153

 Score =   114 bits (284),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 74/106 (70%), Gaps = 2/106 (2%)
 Frame = +2

Query  239  VDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLSA  418
            +D   A+ LL+ G  Y+DVRT+EEF  GH+ENALNIPYM   K  G  KNPKF+++VL+ 
Sbjct  31   LDAFTAKYLLS-GSSYIDVRTKEEFNNGHLENALNIPYMFYTKK-GWVKNPKFVDKVLAV  88

Query  419  IGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKG  556
             GKE++L+VGC+ G RS +A  DL   +F+HV NM GG+ A V  G
Sbjct  89   CGKEDRLIVGCQDGARSEHACNDLRDAEFRHVSNMGGGYSALVANG  134



>ref|XP_002265164.1| PREDICTED: thiosulfate sulfurtransferase 18 [Vitis vinifera]
 emb|CBI17360.3| unnamed protein product [Vitis vinifera]
Length=127

 Score =   113 bits (282),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 75/112 (67%), Gaps = 3/112 (3%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHV--ENALNIPYMIINKSLGREKNPKFMNQV  409
            + D H A++L+A G+RYLDVR  E+F KGHV  E+  NI Y I+    GR KNP+F+ QV
Sbjct  13   SADAHEAKDLIASGYRYLDVRMVEDFNKGHVDVESVFNIAYFIMTPE-GRVKNPQFLEQV  71

Query  410  LSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPV  565
            LS   KE+ L+VGC +G RS  A  DLL+  FKHV NM GG+ +W + GL V
Sbjct  72   LSVCSKEDGLIVGCGTGDRSRLATVDLLNADFKHVRNMGGGYRSWHEAGLGV  123



>ref|XP_003593790.1| Thiosulfate sulfurtransferase [Medicago truncatula]
 gb|AES64041.1| rhodanese/cell cycle control phosphatase superfamily protein 
[Medicago truncatula]
Length=137

 Score =   113 bits (283),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 73/108 (68%), Gaps = 2/108 (2%)
 Frame = +2

Query  239  VDVHVAQELL-AKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLS  415
            +DVH A++LL + G+ YLDVR+ EEF K HVENA+N+PYM   +  GR KNP F+NQV +
Sbjct  13   LDVHAAKDLLHSSGYNYLDVRSVEEFNKSHVENAINVPYMFKTEE-GRVKNPDFVNQVAA  71

Query  416  AIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGL  559
                E+ L+V C SG RS+ A  DL +  F+H+ NM GG+ AWV  G 
Sbjct  72   ICKSEDHLIVACNSGGRSIRACVDLHNSGFQHIVNMGGGYSAWVDAGF  119



>ref|XP_009112268.1| PREDICTED: thiosulfate sulfurtransferase 16, chloroplastic isoform 
X2 [Brassica rapa]
Length=118

 Score =   112 bits (281),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 71/113 (63%), Gaps = 7/113 (6%)
 Frame = +2

Query  230  IDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQV  409
            +  +D H   ELL  GHRYLDVRT EEF +GH   A+N+PYM    + G  KNP F+ QV
Sbjct  12   VSAIDAH---ELLQAGHRYLDVRTPEEFSQGHATGAINVPYM----NRGMSKNPNFLEQV  64

Query  410  LSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVH  568
             S  GK ++++VGC+SG RS+ A  +LL   F  V ++ GG+ AW + GLP  
Sbjct  65   SSHFGKGDEVLVGCQSGGRSLRATAELLDAGFTGVKDISGGYSAWAQNGLPTQ  117



>gb|KHG29017.1| Senescence-associated DIN1 [Gossypium arboreum]
Length=185

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 72/109 (66%), Gaps = 1/109 (1%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLS  415
            +V V VA EL   GHRYLDVRT EEF  GHV  A+NIPYM    S G  KNP F+ +V S
Sbjct  76   SVPVRVAHELHQAGHRYLDVRTPEEFSAGHVPGAINIPYMYKVGS-GMAKNPSFVAEVSS  134

Query  416  AIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLP  562
             +GK ++L+VGC+ G RS+ A  +LL+  F  V ++ GG+ AW + GLP
Sbjct  135  HLGKYDELIVGCQLGKRSLMAATELLAAGFTAVTDIAGGYAAWTQNGLP  183



>ref|XP_006296348.1| hypothetical protein CARUB_v10025520mg [Capsella rubella]
 gb|EOA29246.1| hypothetical protein CARUB_v10025520mg [Capsella rubella]
Length=141

 Score =   113 bits (282),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 71/111 (64%), Gaps = 2/111 (2%)
 Frame = +2

Query  230  IDNVDVHVAQELLAK-GHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQ  406
            ++ VDV+ A+ LL+  GHRYLDVRT EEF K H E ALNIPYM      GR  NP F+ Q
Sbjct  12   VETVDVYTAKGLLSTTGHRYLDVRTNEEFAKSHFEEALNIPYMFKTDE-GRVINPDFLPQ  70

Query  407  VLSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGL  559
            V S   K+E L+V C SG R+  A  DLL+  ++HV NM GG+ AWV  G 
Sbjct  71   VASVCKKDEHLIVACNSGGRASRACVDLLNAGYEHVANMGGGYSAWVDAGF  121



>ref|XP_010316446.1| PREDICTED: thiosulfate sulfurtransferase 16, chloroplastic isoform 
X1 [Solanum lycopersicum]
Length=187

 Score =   114 bits (285),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 73/110 (66%), Gaps = 1/110 (1%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLS  415
            +V V VA ELL  GHRYLDVRT EE+  GH   A+NIPYM+   S G  KNP F+ +VL 
Sbjct  77   SVPVRVALELLQAGHRYLDVRTTEEYNDGHAAGAINIPYMLRIGS-GMIKNPNFLEEVLE  135

Query  416  AIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPV  565
              GK+++++VGC+ G RS  A  +LL+  F  V ++ GG+ AW + GLP+
Sbjct  136  QFGKDDEIIVGCQLGKRSFMAATELLAAGFTGVTDIAGGYAAWTESGLPI  185



>ref|XP_010905228.1| PREDICTED: thiosulfate sulfurtransferase 16, chloroplastic-like 
isoform X2 [Elaeis guineensis]
Length=180

 Score =   114 bits (285),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 69/111 (62%), Gaps = 1/111 (1%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLS  415
            +V V+VA ELL  GHRYLDVRT EEF+ G    A NIPYM     LG  KNP F+  V S
Sbjct  70   SVPVNVAHELLQAGHRYLDVRTPEEFQAGRPVGATNIPYMF-KSGLGMTKNPNFLKDVSS  128

Query  416  AIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVH  568
               K++ L+VGC SG RS+ A  +L S  F  + ++ GG+ AWV+ GLP  
Sbjct  129  VFEKDDALIVGCLSGKRSLMAATELSSAGFSGITDIAGGYSAWVQNGLPTE  179



>ref|XP_004232533.1| PREDICTED: thiosulfate sulfurtransferase 16, chloroplastic isoform 
X2 [Solanum lycopersicum]
Length=186

 Score =   114 bits (285),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 73/110 (66%), Gaps = 1/110 (1%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLS  415
            +V V VA ELL  GHRYLDVRT EE+  GH   A+NIPYM+   S G  KNP F+ +VL 
Sbjct  76   SVPVRVALELLQAGHRYLDVRTTEEYNDGHAAGAINIPYMLRIGS-GMIKNPNFLEEVLE  134

Query  416  AIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPV  565
              GK+++++VGC+ G RS  A  +LL+  F  V ++ GG+ AW + GLP+
Sbjct  135  QFGKDDEIIVGCQLGKRSFMAATELLAAGFTGVTDIAGGYAAWTESGLPI  184



>pdb|1TQ1|A Chain A, Solution Structure Of At5g66040, A Putative Protein 
From Arabidosis Thaliana
Length=129

 Score =   112 bits (281),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 70/110 (64%), Gaps = 1/110 (1%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLS  415
            +V V VA +LL  GHRYLDVRT EEF +GH   A+N+PYM    S G  KN  F+ QV S
Sbjct  19   SVSVTVAHDLLLAGHRYLDVRTPEEFSQGHACGAINVPYMNRGAS-GMSKNTDFLEQVSS  77

Query  416  AIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPV  565
              G+ + ++VGC+SG RS+ A  DLL   F  V ++ GG+ AW K GLP 
Sbjct  78   HFGQSDNIIVGCQSGGRSIKATTDLLHAGFTGVKDIVGGYSAWAKNGLPT  127



>ref|XP_010905226.1| PREDICTED: thiosulfate sulfurtransferase 16, chloroplastic-like 
isoform X1 [Elaeis guineensis]
Length=182

 Score =   114 bits (285),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 69/111 (62%), Gaps = 1/111 (1%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLS  415
            +V V+VA ELL  GHRYLDVRT EEF+ G    A NIPYM     LG  KNP F+  V S
Sbjct  72   SVPVNVAHELLQAGHRYLDVRTPEEFQAGRPVGATNIPYMF-KSGLGMTKNPNFLKDVSS  130

Query  416  AIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVH  568
               K++ L+VGC SG RS+ A  +L S  F  + ++ GG+ AWV+ GLP  
Sbjct  131  VFEKDDALIVGCLSGKRSLMAATELSSAGFSGITDIAGGYSAWVQNGLPTE  181



>ref|XP_011022238.1| PREDICTED: thiosulfate sulfurtransferase 16, chloroplastic-like 
[Populus euphratica]
Length=179

 Score =   114 bits (284),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 70/110 (64%), Gaps = 1/110 (1%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLS  415
            +V V VA EL   GHRYLDVRT +EF  GH   A+NIPYM    S G  KNPKF+ +V S
Sbjct  69   SVPVRVAHELHQAGHRYLDVRTPDEFSAGHAAGAINIPYMYRVGS-GMTKNPKFVEEVSS  127

Query  416  AIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPV  565
               K ++++VGC+ G RSM A  DLL+  F  V ++ GGF AW + GLP 
Sbjct  128  HFRKHDEIIVGCQLGKRSMMAATDLLAAGFTAVTDIAGGFAAWTQNGLPT  177



>gb|AHI85731.1| DIN1 [Capsicum annuum]
Length=179

 Score =   114 bits (284),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 70/110 (64%), Gaps = 1/110 (1%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLS  415
            +V V VA ELL  GHRYLDVRT EEF  GH   A+NIPYM    S G  KNP F  +VL 
Sbjct  69   SVPVRVALELLQAGHRYLDVRTVEEFSDGHAPGAINIPYMFRIGS-GMIKNPNFFAEVLE  127

Query  416  AIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPV  565
              GK+++++VGC+ G RS  A  DLL+  F  V ++ GG+ AW + GLP 
Sbjct  128  HFGKDDEIIVGCQLGKRSFMAATDLLAAGFTGVTDIAGGYAAWTESGLPT  177



>ref|XP_003573641.1| PREDICTED: thiosulfate sulfurtransferase 18-like [Brachypodium 
distachyon]
Length=144

 Score =   112 bits (281),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 68/98 (69%), Gaps = 0/98 (0%)
 Frame = +2

Query  281  RYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLSAIGKEEKLVVGCKSG  460
            +YLDVRTEEE  KGH+  +LN+PYM +     REKNP+F+ QV S   K++ ++VGC+SG
Sbjct  41   KYLDVRTEEEMSKGHLHGSLNVPYMFLTPQGSREKNPEFVEQVASLFTKDQHILVGCQSG  100

Query  461  VRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHYP  574
             RS  A  DLL+  F++V N+ GG+ AWV  G PVH P
Sbjct  101  KRSELACIDLLAAGFRNVKNVGGGYLAWVDNGFPVHTP  138



>ref|XP_006300239.1| hypothetical protein CARUB_v10016479mg [Capsella rubella]
 gb|EOA33137.1| hypothetical protein CARUB_v10016479mg [Capsella rubella]
Length=157

 Score =   113 bits (282),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 74/112 (66%), Gaps = 3/112 (3%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHV--ENALNIPYMIINKSLGREKNPKFMNQV  409
             +DV  AQ+LL  G+ +LDVRT EEF+KGHV  E   N+PY +     G+  NP F+  V
Sbjct  35   TIDVRQAQKLLDSGYTFLDVRTVEEFEKGHVDSEKVFNVPYWLYTPH-GQVINPNFLKHV  93

Query  410  LSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPV  565
             S   + ++LVVGCKSGVRS+YA + L+S  FK V NM+GG+ AWV K  PV
Sbjct  94   SSVCNQTDRLVVGCKSGVRSLYATKVLVSSGFKTVKNMDGGYIAWVNKSFPV  145



>gb|AII82187.1| arsenate reductase [Arabidopsis thaliana]
Length=166

 Score =   113 bits (282),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 71/115 (62%), Gaps = 2/115 (2%)
 Frame = +2

Query  230  IDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQV  409
            ++ VD++ A+  L+ GHRYLDVRT EEF K HVE ALNIPYM      GR  NP F++QV
Sbjct  39   VETVDIYTAKGFLSTGHRYLDVRTSEEFAKSHVEEALNIPYM-FQTDEGRVINPDFLSQV  97

Query  410  LSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHYP  574
             S   K+E L+  C +G R   A  DLL+E + HV NM GG+ AWV  G     P
Sbjct  98   ASVCKKDEHLIA-CNAGGRGSRACVDLLNEGYDHVANMGGGYSAWVDAGFAGDKP  151



>gb|AII82194.1| arsenate reductase [Arabidopsis thaliana]
Length=139

 Score =   112 bits (280),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 72/115 (63%), Gaps = 2/115 (2%)
 Frame = +2

Query  230  IDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQV  409
            ++ VD++ A+  L+ GHRYLDVRT EEF K HVE ALNIPYM      GR  NP+F++QV
Sbjct  12   VETVDIYTAKGFLSTGHRYLDVRTNEEFAKSHVEEALNIPYMFQTDE-GRVINPEFLSQV  70

Query  410  LSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHYP  574
             S   K+E L+  C +G R   A  DLL+E + HV NM GG+ AWV  G     P
Sbjct  71   ASLCKKDEHLIA-CNAGGRGSRACVDLLNEGYDHVANMGGGYSAWVDAGFAGDKP  124



>ref|XP_006340791.1| PREDICTED: rhodanese-like domain-containing protein 15, chloroplastic-like 
isoform X1 [Solanum tuberosum]
Length=187

 Score =   114 bits (284),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 72/110 (65%), Gaps = 1/110 (1%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLS  415
            +V V VA ELL  GHRYLDVRT EEF  GH   A+NIPYM+   S G  KNP F+ +VL 
Sbjct  77   SVPVRVALELLQAGHRYLDVRTAEEFSDGHAAGAINIPYMLRIGS-GMIKNPNFLEEVLE  135

Query  416  AIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPV  565
              GK+++++VGC+ G RS  A  +LL+  F  V ++ GG+  W + GLP+
Sbjct  136  HFGKDDEIIVGCQLGKRSFMAATELLAAGFTGVTDIAGGYATWTESGLPI  185



>ref|XP_006340793.1| PREDICTED: rhodanese-like domain-containing protein 15, chloroplastic-like 
isoform X3 [Solanum tuberosum]
Length=185

 Score =   113 bits (283),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 72/110 (65%), Gaps = 1/110 (1%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLS  415
            +V V VA ELL  GHRYLDVRT EEF  GH   A+NIPYM+   S G  KNP F+ +VL 
Sbjct  75   SVPVRVALELLQAGHRYLDVRTAEEFSDGHAAGAINIPYMLRIGS-GMIKNPNFLEEVLE  133

Query  416  AIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPV  565
              GK+++++VGC+ G RS  A  +LL+  F  V ++ GG+  W + GLP+
Sbjct  134  HFGKDDEIIVGCQLGKRSFMAATELLAAGFTGVTDIAGGYATWTESGLPI  183



>ref|XP_006340792.1| PREDICTED: rhodanese-like domain-containing protein 15, chloroplastic-like 
isoform X2 [Solanum tuberosum]
Length=186

 Score =   113 bits (283),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 72/110 (65%), Gaps = 1/110 (1%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLS  415
            +V V VA ELL  GHRYLDVRT EEF  GH   A+NIPYM+   S G  KNP F+ +VL 
Sbjct  76   SVPVRVALELLQAGHRYLDVRTAEEFSDGHAAGAINIPYMLRIGS-GMIKNPNFLEEVLE  134

Query  416  AIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPV  565
              GK+++++VGC+ G RS  A  +LL+  F  V ++ GG+  W + GLP+
Sbjct  135  HFGKDDEIIVGCQLGKRSFMAATELLAAGFTGVTDIAGGYATWTESGLPI  184



>gb|KDP43713.1| hypothetical protein JCGZ_22340 [Jatropha curcas]
Length=180

 Score =   113 bits (283),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 71/110 (65%), Gaps = 1/110 (1%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLS  415
            +V V VA ELL  GHRYLDVRT EEF  GHV  A+NIPYM    S G  KNPKF+ QV  
Sbjct  70   SVPVRVAHELLLAGHRYLDVRTPEEFSAGHVVGAINIPYMYKVGS-GMSKNPKFLEQVSQ  128

Query  416  AIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPV  565
              GK ++++VGC+ G RSM A  DL++  +  V ++ GG+ AW +  LP 
Sbjct  129  HFGKYDEILVGCQLGKRSMMAATDLVAAGYTGVTDIAGGYAAWTQNKLPT  178



>ref|XP_006409238.1| hypothetical protein EUTSA_v10022891mg [Eutrema salsugineum]
 gb|ESQ50691.1| hypothetical protein EUTSA_v10022891mg [Eutrema salsugineum]
Length=158

 Score =   112 bits (281),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 74/116 (64%), Gaps = 3/116 (3%)
 Frame = +2

Query  239  VDVHVAQELLAKGHRYLDVRTEEEFKKGHV--ENALNIPYMIINKSLGREKNPKFMNQVL  412
            +DV    +LL  G+ +LDVRT EEF+KGHV  E   N+PY       G+E NP F+  V 
Sbjct  37   IDVSQVHKLLHYGYTFLDVRTVEEFEKGHVDSEKVFNVPYWFYTPQ-GQENNPNFLKHVS  95

Query  413  SAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHYPNK  580
                + ++++VGCKSGVRS+YA  DL+S  FK V NM+GG+ AW++K  PV +  K
Sbjct  96   CLFNQSDRIIVGCKSGVRSLYATNDLVSSGFKSVRNMDGGYIAWIEKRFPVKFEQK  151



>gb|AII82186.1| arsenate reductase [Arabidopsis thaliana]
 gb|AII82188.1| arsenate reductase [Arabidopsis thaliana]
 gb|AII82189.1| arsenate reductase [Arabidopsis thaliana]
 gb|AII82190.1| arsenate reductase [Arabidopsis thaliana]
 gb|AII82191.1| arsenate reductase [Arabidopsis thaliana]
 gb|AII82192.1| arsenate reductase [Arabidopsis thaliana]
 gb|AII82193.1| arsenate reductase [Arabidopsis thaliana]
Length=166

 Score =   113 bits (282),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 71/115 (62%), Gaps = 2/115 (2%)
 Frame = +2

Query  230  IDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQV  409
            ++ VD++ A+  L+ GHRYLDVRT EEF K HVE ALNIPYM      GR  NP F++QV
Sbjct  39   VETVDIYTAKGFLSTGHRYLDVRTSEEFAKSHVEEALNIPYM-FQTDEGRVINPDFLSQV  97

Query  410  LSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHYP  574
             S   K+E L+  C +G R   A  DLL+E + HV NM GG+ AWV  G     P
Sbjct  98   ASVCKKDEHLIA-CNAGGRGSRACVDLLNEGYDHVANMGGGYSAWVDAGFAGDKP  151



>gb|ACJ61492.1| senescence-associated protein [Glycine max]
Length=185

 Score =   113 bits (283),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 70/110 (64%), Gaps = 1/110 (1%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLS  415
            +V V VA ELL  GHRYLDVRT EEF  GH   A+NIPYM    S G  KN  F+ +V S
Sbjct  75   SVPVRVAYELLLAGHRYLDVRTPEEFNAGHAPGAINIPYMFRVGS-GMTKNSNFIREVSS  133

Query  416  AIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPV  565
               KE++++VGC+ G RSM A  DLL+  F  + +M GG+ AW + GLP 
Sbjct  134  NFRKEDEIIVGCELGKRSMMAASDLLAAGFTGLTDMAGGYAAWTQNGLPT  183



>ref|XP_007157959.1| hypothetical protein PHAVU_002G112600g [Phaseolus vulgaris]
 gb|ESW29953.1| hypothetical protein PHAVU_002G112600g [Phaseolus vulgaris]
Length=186

 Score =   113 bits (283),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 73/110 (66%), Gaps = 1/110 (1%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLS  415
            +V V VA ELL  GHRYLDVRT EEF +GHV  A+NIP+M    S G  KN  F+ +V S
Sbjct  76   SVPVRVAYELLLAGHRYLDVRTTEEFVEGHVPGAINIPFMFRVGS-GMTKNSNFIREVSS  134

Query  416  AIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPV  565
               K+++++VGC+ G RS+ A  DLL+  F  + +M GGF+AW + GLP 
Sbjct  135  NFRKDDEIIVGCQLGKRSIMAASDLLAAGFTGITDMAGGFEAWTQNGLPT  184



>gb|AII82178.1| arsenate reductase [Arabidopsis thaliana]
 gb|AII82180.1| arsenate reductase [Arabidopsis thaliana]
 gb|AII82182.1| arsenate reductase [Arabidopsis thaliana]
 gb|AII82183.1| arsenate reductase [Arabidopsis thaliana]
 gb|AII82184.1| arsenate reductase [Arabidopsis thaliana]
 gb|AII82185.1| arsenate reductase [Arabidopsis thaliana]
Length=168

 Score =   112 bits (281),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 71/115 (62%), Gaps = 2/115 (2%)
 Frame = +2

Query  230  IDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQV  409
            ++ VDV+ A+  L+ GHRYLDVRT EEF K HVE ALNIPYM      GR  NP F++QV
Sbjct  41   VETVDVYTAKGFLSTGHRYLDVRTNEEFAKSHVEEALNIPYMFKTDE-GRVINPDFLSQV  99

Query  410  LSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHYP  574
             S   K+E L+  C +G R   A  DLL+E + HV NM GG+ AWV  G     P
Sbjct  100  ASVCKKDEHLIA-CNAGGRGSRACVDLLNEGYDHVANMGGGYSAWVDAGFAGDKP  153



>ref|XP_006422627.1| hypothetical protein CICLE_v10030310mg [Citrus clementina]
 gb|ESR35867.1| hypothetical protein CICLE_v10030310mg [Citrus clementina]
Length=126

 Score =   111 bits (278),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 74/115 (64%), Gaps = 9/115 (8%)
 Frame = +2

Query  230  IDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQV  409
            + +VDVH A++LL  GHRYLDVRT  EFKKGHV+ ALN PY      +  EKNP+F+ QV
Sbjct  10   VASVDVHAAKDLLGSGHRYLDVRTTAEFKKGHVDKALNAPY------IKSEKNPEFLTQV  63

Query  410  LSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHYP  574
             S   KE+  +V C SG R++ A  DL   +  HV  +EGG+ AWV +G+P   P
Sbjct  64   ASLCKKEDPSIVVCNSGGRALRACVDL---RNAHVTKLEGGYSAWVDEGVPGDKP  115



>gb|AII82179.1| arsenate reductase [Arabidopsis thaliana]
Length=168

 Score =   112 bits (281),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 72/115 (63%), Gaps = 2/115 (2%)
 Frame = +2

Query  230  IDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQV  409
            ++ VD++ A+  L+ GHRYLDVRT EEF K HVE ALNIPYM      GR  NP+F++QV
Sbjct  41   VETVDIYTAKGFLSTGHRYLDVRTNEEFAKSHVEEALNIPYMFQTDE-GRVINPEFLSQV  99

Query  410  LSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHYP  574
             S   K+E L+  C +G R   A  DLL+E + HV NM GG+ AWV  G     P
Sbjct  100  ASLCKKDEHLIA-CNAGGRGSRACVDLLNEGYDHVANMGGGYSAWVDAGFAGDKP  153



>gb|KDO71380.1| hypothetical protein CISIN_1g029759mg [Citrus sinensis]
Length=151

 Score =   112 bits (279),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 71/110 (65%), Gaps = 1/110 (1%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLS  415
            +V V VA ELL  GHRYLDVRT EEF  GH   A+N+PYM    S G  KN KF+ +V +
Sbjct  41   SVPVRVAHELLQAGHRYLDVRTPEEFSAGHATGAINVPYMYRVGS-GMTKNLKFVEEVST  99

Query  416  AIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPV  565
               K ++++VGC+SG RSM A  DLL+  F  + ++ GGF AW + GLP 
Sbjct  100  RFRKHDEIIVGCQSGKRSMMAATDLLNAGFAGITDIAGGFAAWRQNGLPT  149



>gb|KDO71381.1| hypothetical protein CISIN_1g029759mg [Citrus sinensis]
Length=161

 Score =   112 bits (280),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 71/110 (65%), Gaps = 1/110 (1%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLS  415
            +V V VA ELL  GHRYLDVRT EEF  GH   A+N+PYM    S G  KN KF+ +V +
Sbjct  51   SVPVRVAHELLQAGHRYLDVRTPEEFSAGHATGAINVPYMYRVGS-GMTKNLKFVEEVST  109

Query  416  AIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPV  565
               K ++++VGC+SG RSM A  DLL+  F  + ++ GGF AW + GLP 
Sbjct  110  RFRKHDEIIVGCQSGKRSMMAATDLLNAGFAGITDIAGGFAAWRQNGLPT  159



>ref|NP_001241883.1| uncharacterized protein LOC100794624 [Glycine max]
 gb|ACU20574.1| unknown [Glycine max]
Length=145

 Score =   112 bits (279),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 76/113 (67%), Gaps = 2/113 (2%)
 Frame = +2

Query  239  VDVHVAQELL-AKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLS  415
            ++V  A++LL + G+RYLDVR+ EEF K HVENA N+PY+ I ++ GR KNP F++QV +
Sbjct  13   INVRAAKDLLNSSGYRYLDVRSVEEFNKSHVENAHNVPYVFITEA-GRVKNPDFVDQVAA  71

Query  416  AIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHYP  574
                E+ L+V C SG RS+ A  DLL   FK++ NM GG+ AWV  G   + P
Sbjct  72   ICKTEDHLIVACNSGGRSLRASVDLLDSGFKNIVNMGGGYSAWVDAGFAGNKP  124



>ref|XP_006425337.1| hypothetical protein CICLE_v10026577mg [Citrus clementina]
 gb|ESR38577.1| hypothetical protein CICLE_v10026577mg [Citrus clementina]
 gb|KDO71379.1| hypothetical protein CISIN_1g029759mg [Citrus sinensis]
Length=184

 Score =   112 bits (281),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 71/110 (65%), Gaps = 1/110 (1%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLS  415
            +V V VA ELL  GHRYLDVRT EEF  GH   A+N+PYM    S G  KN KF+ +V +
Sbjct  74   SVPVRVAHELLQAGHRYLDVRTPEEFSAGHATGAINVPYMYRVGS-GMTKNLKFVEEVST  132

Query  416  AIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPV  565
               K ++++VGC+SG RSM A  DLL+  F  + ++ GGF AW + GLP 
Sbjct  133  RFRKHDEIIVGCQSGKRSMMAATDLLNAGFAGITDIAGGFAAWRQNGLPT  182



>ref|XP_009414423.1| PREDICTED: thiosulfate sulfurtransferase 16, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=183

 Score =   112 bits (281),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 72/110 (65%), Gaps = 1/110 (1%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLS  415
            +V V VA ELL  GH YLDVRT +EF  GH   A+NIPY ++    G  KNPKF+ +V S
Sbjct  73   SVPVRVAHELLQAGHHYLDVRTVDEFNAGHATGAINIPY-VLKVGSGMTKNPKFLVEVSS  131

Query  416  AIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPV  565
              GK++++++GC+SG RS+ A  +L S  F  + ++ GG+ AWV+  LP 
Sbjct  132  VFGKDDEIIIGCRSGKRSLMAAAELTSAGFTGITDIAGGYSAWVQNRLPT  181



>gb|EYU18065.1| hypothetical protein MIMGU_mgv1a014589mg [Erythranthe guttata]
Length=185

 Score =   112 bits (281),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 73/109 (67%), Gaps = 1/109 (1%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLS  415
            +V V VA ELL  GH YLDVRT +EF  GHV  A+N+P+M+     G  +NPKF+ QVL+
Sbjct  76   SVPVRVANELLQAGHHYLDVRTPDEFSDGHVVGAVNVPFML-RLGPGMARNPKFLEQVLA  134

Query  416  AIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLP  562
               ++++++VGC+ G RS  A  +L+S  F  + +M GG+ AW++ GLP
Sbjct  135  IFRQDDEIIVGCQLGKRSFTAASELVSAGFTGITDMAGGYAAWIQNGLP  183



>ref|XP_004289086.1| PREDICTED: E3 ubiquitin-protein ligase RNF133-like [Fragaria 
vesca subsp. vesca]
Length=515

 Score =   117 bits (293),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 58/125 (46%), Positives = 82/125 (66%), Gaps = 3/125 (2%)
 Frame = +2

Query  218  AGLRIDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHV--ENALNIPYMIINKSLGREKNP  391
            +G  +  +DV  A++L+  G+ Y+DVRT EEFK+G+V  E   NIPYM  N   GR KNP
Sbjct  368  SGAEVVTIDVQEAKDLIKSGYGYMDVRTVEEFKRGYVDAEKIYNIPYMF-NIPEGRVKNP  426

Query  392  KFMNQVLSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHY  571
             F+ +V S   KE+ ++VGC+SGVRS+YA+ DL +  +KH+ NM GG+ AW +K  PV  
Sbjct  427  DFLKEVESTCNKEDHIIVGCQSGVRSLYAVADLQNVGYKHLSNMGGGYLAWTEKHFPVVK  486

Query  572  PNKTE  586
            P   +
Sbjct  487  PEDAD  491



>dbj|BAJ99547.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ99862.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=192

 Score =   112 bits (281),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 59/129 (46%), Positives = 78/129 (60%), Gaps = 9/129 (7%)
 Frame = +2

Query  206  SSGVAGLRID--------NVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMII  361
            S+G A LR D        +V V VA EL   GHRYLDVRTE EF  GH   A+N+PYM  
Sbjct  63   SAGSAALRADEAEVAVPPSVPVRVAHELQLAGHRYLDVRTEGEFAGGHPAGAVNVPYMYS  122

Query  362  NKSLGREKNPKFMNQVLSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDA  541
              S G  KN  F+ QV +  GK++++++GC+SG RS+ A  +L S  F  V ++ GGF  
Sbjct  123  TGS-GMAKNSHFVKQVSAIFGKDDEIIIGCQSGKRSLMAAVELCSAGFTAVTDIAGGFST  181

Query  542  WVKKGLPVH  568
            W + GLPV+
Sbjct  182  WRENGLPVN  190



>ref|XP_002886131.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62390.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=158

 Score =   112 bits (279),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 58/120 (48%), Positives = 79/120 (66%), Gaps = 3/120 (3%)
 Frame = +2

Query  227  RIDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHV--ENALNIPYMIINKSLGREKNPKFM  400
            ++  +DV  AQ+LL  G+ +LDVRT EEF++GHV  E   N+PY + +   G+E NP F+
Sbjct  33   KVITIDVSQAQKLLDSGYTFLDVRTVEEFEEGHVDSEKVFNVPYWLYSPQ-GQEINPNFL  91

Query  401  NQVLSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHYPNK  580
              V S   +   LVVGCKSGVRS+YA + L+S  FK+V NM+GG+ AWV K  PV   +K
Sbjct  92   KHVSSLCNQTNHLVVGCKSGVRSLYATKVLVSSGFKNVKNMDGGYIAWVDKRFPVKVEHK  151



>ref|XP_008440833.1| PREDICTED: thiosulfate sulfurtransferase 18 isoform X1 [Cucumis 
melo]
Length=238

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 88/133 (66%), Gaps = 5/133 (4%)
 Frame = +2

Query  188  PMACLLSSGVAGLRIDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHV--ENALNIPYMII  361
            P+   L S  +G  I  VDV  A  LL  G+ +LDVRT EEFK+GHV  E  +NIPY++ 
Sbjct  92   PIMGSLDSSDSG--IVTVDVKTADNLLHSGYAFLDVRTVEEFKEGHVATERIVNIPYLL-  148

Query  362  NKSLGREKNPKFMNQVLSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDA  541
            N   GR KN +F+ +V +   K+++LVVGC+SGVRS+ AIE+L +  +KH+ ++ GG  A
Sbjct  149  NSPNGRMKNAQFLAEVSAVFKKDDRLVVGCRSGVRSLLAIEELQNNGYKHLKDLGGGHLA  208

Query  542  WVKKGLPVHYPNK  580
            W++  LPV  PN+
Sbjct  209  WLENALPVANPNE  221



>ref|XP_006383076.1| hypothetical protein POPTR_0005s11330g, partial [Populus trichocarpa]
 gb|ERP60873.1| hypothetical protein POPTR_0005s11330g, partial [Populus trichocarpa]
Length=209

 Score =   113 bits (282),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 75/123 (61%), Gaps = 3/123 (2%)
 Frame = +2

Query  218  AGLRIDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHV--ENALNIPYMIINKSLGREKNP  391
             G  +  VDV   + LL  G+ YLDVRT EE+ KGHV  E   NIPY+  N   GR KNP
Sbjct  83   TGAEVVTVDVKATKGLLESGYTYLDVRTVEEYNKGHVDGEKIFNIPYLF-NTPEGRVKNP  141

Query  392  KFMNQVLSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHY  571
             F+ +V     +E+KL+VGC+SGVRS+YA  DLLS  FK V N+ GG+ AW +   PV  
Sbjct  142  NFLKEVSGVCKEEDKLLVGCQSGVRSLYATADLLSAGFKDVSNVGGGYLAWTENVFPVKI  201

Query  572  PNK  580
              K
Sbjct  202  EKK  204



>ref|NP_001235646.1| uncharacterized protein LOC100305968 [Glycine max]
 gb|ACU13915.1| unknown [Glycine max]
 gb|KHN35988.1| Senescence-associated protein DIN1 [Glycine soja]
Length=186

 Score =   112 bits (280),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/122 (47%), Positives = 75/122 (61%), Gaps = 2/122 (2%)
 Frame = +2

Query  203  LSSGVAGLRI-DNVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGR  379
            L   +  +R+  +V V VA ELL  GHRYLDVRT EEF  GH   A+NIPYM    S G 
Sbjct  64   LQGNLEAIRVPTSVPVRVAYELLLAGHRYLDVRTPEEFDAGHAPGAINIPYMFRVGS-GM  122

Query  380  EKNPKFMNQVLSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGL  559
             KN  F+ +V S   K+++++VGC+ G RSM A  DLL+  F  + +M GG+ AW + GL
Sbjct  123  TKNSNFIREVSSQFRKDDEIIVGCELGKRSMMAASDLLAAGFTGLTDMAGGYAAWTQNGL  182

Query  560  PV  565
            P 
Sbjct  183  PT  184



>ref|XP_008811900.1| PREDICTED: thiosulfate sulfurtransferase 16, chloroplastic [Phoenix 
dactylifera]
Length=178

 Score =   112 bits (279),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 74/110 (67%), Gaps = 1/110 (1%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLS  415
            +V V VA ELL  G+RYLDVRT +EF  GH   A NIPYM+   S G+ KNP F+ +VL 
Sbjct  68   SVPVRVAHELLQAGYRYLDVRTVDEFNAGHAVGAKNIPYMLKVGS-GKTKNPNFLKEVLE  126

Query  416  AIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPV  565
              GK++++++GC+SG  S+ A  +L S  F  + ++ GG+ AW++ GLP+
Sbjct  127  VFGKDDEIIIGCQSGRLSLMATAELSSAGFTGITDIAGGYSAWIQNGLPI  176



>ref|NP_001190631.1| thiosulfate sulfurtransferase 18 [Arabidopsis thaliana]
 sp|Q9FKW8.1|STR18_ARATH RecName: Full=Thiosulfate sulfurtransferase 18; AltName: Full=Sulfurtransferase 
18; Short=AtStr18 [Arabidopsis thaliana]
 dbj|BAB10422.1| senescence-associated protein sen1-like protein [Arabidopsis 
thaliana]
 gb|AAL57692.1| AT5g66170/K2A18_25 [Arabidopsis thaliana]
 gb|AAM10268.1| AT5g66170/K2A18_25 [Arabidopsis thaliana]
 dbj|BAD95161.1| senescence-associated protein sen1-like protein [Arabidopsis 
thaliana]
 gb|AED98170.1| sulfurtransferase 18 [Arabidopsis thaliana]
Length=136

 Score =   110 bits (276),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 83/128 (65%), Gaps = 3/128 (2%)
 Frame = +2

Query  191  MACLLSSGVAGLRIDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENA--LNIPYMIIN  364
            M+  +SS      + +VDV  A+ LL  GH+YLDVRT++EF++GH E A  +NIPYM+ N
Sbjct  1    MSQSISSSTKAEEVVSVDVSQAKTLLQSGHQYLDVRTQDEFRRGHCEAAKIVNIPYML-N  59

Query  365  KSLGREKNPKFMNQVLSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAW  544
               GR KN +F+ QV S +   + ++VGC+SG RS+ A  +L++  +K V N+ GG+ AW
Sbjct  60   TPQGRVKNQEFLEQVSSLLNPADDILVGCQSGARSLKATTELVAAGYKKVRNVGGGYLAW  119

Query  545  VKKGLPVH  568
            V    P++
Sbjct  120  VDHSFPIN  127



>ref|XP_004135023.1| PREDICTED: thiosulfate sulfurtransferase 18-like [Cucumis sativus]
Length=161

 Score =   111 bits (277),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 84/130 (65%), Gaps = 3/130 (2%)
 Frame = +2

Query  191  MACLLSSGVAGLRIDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHV--ENALNIPYMIIN  364
            + C L    +   I  VDV  A  LL  G+ +LDVRT EEFK+GH+  E  +NIPY++ N
Sbjct  14   LFCFLVFSSSDSGIVTVDVKTADNLLHSGYAFLDVRTVEEFKEGHMATERIVNIPYLL-N  72

Query  365  KSLGREKNPKFMNQVLSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAW  544
               GR KN +F+ +V +   K+++LVVGC+SGVRS+ AIE+L ++ +KH+ ++ GG  AW
Sbjct  73   SPNGRVKNAQFLAEVSAVFKKDDRLVVGCRSGVRSLLAIEELQNDGYKHLKDLGGGHLAW  132

Query  545  VKKGLPVHYP  574
            +   LPV  P
Sbjct  133  LDNALPVANP  142



>ref|XP_007202638.1| hypothetical protein PRUPE_ppa012088mg [Prunus persica]
 gb|EMJ03837.1| hypothetical protein PRUPE_ppa012088mg [Prunus persica]
Length=183

 Score =   111 bits (278),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 71/110 (65%), Gaps = 1/110 (1%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLS  415
            +V V VA ELL  GH+YLDVRT +EF KGH   A+NIPY+    S G  KNP+F+ +V S
Sbjct  73   SVPVRVAHELLQAGHKYLDVRTPDEFSKGHAPGAVNIPYLYKLGS-GMSKNPEFLKEVAS  131

Query  416  AIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPV  565
               K ++++VGC  G RSM A  DLL+  F  + ++ GG+ AW + GLP 
Sbjct  132  HFRKHDEIIVGCHLGKRSMMAATDLLAAGFSGITDIAGGYAAWTQTGLPT  181



>ref|XP_010484678.1| PREDICTED: thiosulfate sulfurtransferase 18-like [Camelina sativa]
Length=133

 Score =   110 bits (274),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 76/116 (66%), Gaps = 3/116 (3%)
 Frame = +2

Query  227  RIDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENA--LNIPYMIINKSLGREKNPKFM  400
            ++ NVDV  A+ LL  GH+YLDVRT+EEFK+GH +    +NIPYM+ N   GR KN  F+
Sbjct  12   QVVNVDVSQAKALLQSGHQYLDVRTQEEFKRGHCQATKIVNIPYMV-NTPQGRGKNQDFL  70

Query  401  NQVLSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVH  568
             QV S +   + ++VGC+SG RS  A  +LL+  +K V N+ GG+ AWV    P++
Sbjct  71   EQVSSLLNPADDILVGCQSGARSFNATTELLAAGYKKVRNVGGGYMAWVDHSFPIN  126



>emb|CDP01831.1| unnamed protein product [Coffea canephora]
Length=190

 Score =   111 bits (278),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 72/110 (65%), Gaps = 1/110 (1%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLS  415
            +V V VA ELL  GHRYLDVRT EEF  GH   A+N+PYM    S G  KN  F+ +VL+
Sbjct  80   SVPVRVAHELLQAGHRYLDVRTAEEFSAGHAAGAVNVPYMFRVGS-GMIKNLNFVEEVLA  138

Query  416  AIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPV  565
              GK+++++VGC+ G RS+ A  DL+S  F  + ++ GG+ AWV+  LP 
Sbjct  139  IFGKDDEIIVGCQLGKRSLMAATDLISAGFTGITDIAGGYAAWVQNELPT  188



>dbj|BAJ92222.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=196

 Score =   112 bits (279),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 79/129 (61%), Gaps = 5/129 (4%)
 Frame = +2

Query  188  PMACLLSSGVAGLRIDNVDVHVAQELLAK---GHRYLDVRTEEEFKKGHVENALNIPYMI  358
            P A + ++  AG  +  VDV  A   L +   G  YLDVRTEEE  KGHV  +LN+PY  
Sbjct  57   PDAKIAATPAAG--VTTVDVQTAARELQEQQGGMAYLDVRTEEEMGKGHVGGSLNVPYFF  114

Query  359  INKSLGREKNPKFMNQVLSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFD  538
            +     REKNP+F+ QV S    ++ +++GC+SG RS  A  DLL+  F +V N+ GG+ 
Sbjct  115  VTPQGTREKNPRFVEQVASLFTTDQHILIGCQSGKRSELACVDLLAAGFMNVKNVGGGYA  174

Query  539  AWVKKGLPV  565
            AW++ GLPV
Sbjct  175  AWLQSGLPV  183



>gb|AFK38877.1| unknown [Lotus japonicus]
Length=179

 Score =   111 bits (277),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 71/114 (62%), Gaps = 1/114 (1%)
 Frame = +2

Query  221  GLRIDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFM  400
            G+   +V V VA ELL  GH+YLDVRT EEF  GH   A+NIPYM    S G  KN  F+
Sbjct  64   GVVPTSVPVRVAHELLLAGHKYLDVRTPEEFDAGHAPGAINIPYMFKVGS-GMTKNSNFV  122

Query  401  NQVLSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLP  562
             +  S   KE++++VGC+ G RSM A  DLL+  F  V ++ GG+ AW + GLP
Sbjct  123  KEASSQFRKEDEIIVGCQLGKRSMMAATDLLASGFTGVTDIAGGYAAWTQTGLP  176



>gb|AES65978.2| rhodanese/cell cycle control phosphatase superfamily protein 
[Medicago truncatula]
Length=137

 Score =   110 bits (274),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 71/108 (66%), Gaps = 2/108 (2%)
 Frame = +2

Query  239  VDVHVAQELL-AKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLS  415
            +DVH  ++LL + G+ YLDVRT EEF K HVENA+N+PY+   +  GR KNP F+NQV +
Sbjct  13   LDVHATKDLLDSSGYNYLDVRTVEEFNKSHVENAINVPYLFSTEE-GRVKNPDFVNQVEA  71

Query  416  AIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGL  559
                E+ L+V C +G RS  A  DL +  FKH+ NM GG+ AWV  G 
Sbjct  72   IYKSEDHLIVACNAGGRSSRAWVDLHNSGFKHIVNMGGGYSAWVDAGF  119



>ref|XP_006383026.1| hypothetical protein POPTR_0005s10850g [Populus trichocarpa]
 gb|ERP60823.1| hypothetical protein POPTR_0005s10850g [Populus trichocarpa]
Length=243

 Score =   112 bits (281),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 70/110 (64%), Gaps = 1/110 (1%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLS  415
            +V V VA EL   GHRYLDVRT +EF  GH   A+NIPYM    S G  KNPKF+ +V S
Sbjct  133  SVPVRVAHELHQAGHRYLDVRTPDEFSTGHAAGAINIPYMYRVGS-GMTKNPKFVEEVSS  191

Query  416  AIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPV  565
               K ++++VGC+ G RSM A  DLL+  F  V ++ GGF AW + GLP 
Sbjct  192  HFRKHDEIIVGCQLGKRSMMAATDLLAAGFTAVTDIAGGFAAWTQNGLPT  241



>ref|XP_006281331.1| hypothetical protein CARUB_v10027386mg [Capsella rubella]
 gb|EOA14229.1| hypothetical protein CARUB_v10027386mg [Capsella rubella]
Length=120

 Score =   109 bits (273),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 68/111 (61%), Gaps = 1/111 (1%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLS  415
            +V V VA +LL  GHRYLDVRT EEF +GH   A+N+PYM    S G  KNP F+ QV S
Sbjct  10   SVSVTVAHDLLLAGHRYLDVRTPEEFSQGHACGAINVPYMKRGAS-GMSKNPDFLEQVSS  68

Query  416  AIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVH  568
               + + ++VGC SG RS  A  DLL   F  V ++ GG+ AW + GLP  
Sbjct  69   HFRQSDDIIVGCLSGGRSFKATADLLDAGFTAVKDISGGYTAWDQNGLPTQ  119



>ref|XP_002970904.1| hypothetical protein SELMODRAFT_94192, partial [Selaginella moellendorffii]
 gb|EFJ28230.1| hypothetical protein SELMODRAFT_94192, partial [Selaginella moellendorffii]
Length=111

 Score =   109 bits (272),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 71/110 (65%), Gaps = 1/110 (1%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLS  415
            +V V VA +LL  GH YLDVRT EEF  GHVE A+NIP+M      G   N  F+ +V +
Sbjct  1    SVPVQVAHDLLKAGHHYLDVRTPEEFAAGHVEGAVNIPFMY-KSGTGMITNLDFVPEVST  59

Query  416  AIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPV  565
               KE+++VVGC+SG RSM A  +LL+  F  V +M GG+ AW++  LPV
Sbjct  60   RFNKEDEIVVGCQSGRRSMAAATELLASGFTGVTDMGGGYGAWIQSNLPV  109



>emb|CDY18582.1| BnaA09g08130D [Brassica napus]
Length=124

 Score =   109 bits (273),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 70/113 (62%), Gaps = 2/113 (2%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINK--SLGREKNPKFMNQV  409
            +V V  A ELL  GHRYLDVRT EEF +GH   A+N+PYM      +    KNP F+ QV
Sbjct  11   SVSVIDAHELLQAGHRYLDVRTPEEFSQGHATGAINVPYMNRGNFIAFWMSKNPNFLEQV  70

Query  410  LSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVH  568
             S  GK ++++VGC+SG RS+ A  +LL   F  V ++ GG+ AW + GLP  
Sbjct  71   SSHFGKGDEVLVGCQSGGRSLRATAELLDAGFTGVKDISGGYSAWAQNGLPTQ  123



>gb|AAM64406.1| senescence-associated protein [Arabidopsis thaliana]
Length=136

 Score =   110 bits (274),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 83/128 (65%), Gaps = 3/128 (2%)
 Frame = +2

Query  191  MACLLSSGVAGLRIDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENA--LNIPYMIIN  364
            M+  +SS      + +VDV  A+ LL  GH+YLDVRT++EF++GH E A  +NIPYM+ N
Sbjct  1    MSQSISSSTKAEEVVSVDVSQAKTLLQSGHQYLDVRTQDEFRRGHCEAAKIVNIPYML-N  59

Query  365  KSLGREKNPKFMNQVLSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAW  544
               GR KN +F+ QV S +   + ++VGC+SG RS+ A  +L++  +K V N+ GG+ AW
Sbjct  60   TPQGRVKNREFLEQVSSLLNPADDILVGCQSGARSLKATTELVAAGYKKVRNVGGGYLAW  119

Query  545  VKKGLPVH  568
            V    P++
Sbjct  120  VDHSFPIN  127



>ref|XP_009382034.1| PREDICTED: rhodanese-like domain-containing protein 19, mitochondrial 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=122

 Score =   109 bits (273),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 74/111 (67%), Gaps = 0/111 (0%)
 Frame = +2

Query  218  AGLRIDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKF  397
            + + I  VD H A+ L+A G+RYLDVR EE+F+KGHVE ALNIPY        + KNP+F
Sbjct  6    SAVDIVTVDGHEARGLVASGNRYLDVRLEEDFEKGHVEGALNIPYYSSVTPQEKVKNPRF  65

Query  398  MNQVLSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVK  550
            + QV S  GK+E  +VGC+SGVR+  A  DLL   F +V  + GG+ +W+K
Sbjct  66   IEQVSSLFGKDEVFIVGCRSGVRAKRATVDLLDAGFGNVKYLAGGYLSWLK  116



>ref|XP_008241997.1| PREDICTED: thiosulfate sulfurtransferase 16, chloroplastic-like 
[Prunus mume]
Length=183

 Score =   111 bits (277),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 72/110 (65%), Gaps = 1/110 (1%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLS  415
            +V V VA ELL  GH+YLDVRT +EF +GH   A+N+PY+    S G  KNP+F+ +V S
Sbjct  73   SVPVRVAHELLQAGHKYLDVRTPDEFSRGHAPGAVNVPYLYKLGS-GMSKNPEFLKEVAS  131

Query  416  AIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPV  565
               K ++++VGC+ G RSM A  DLL+  F  + ++ GG+ AW + GLP 
Sbjct  132  HFRKHDEIIVGCQLGKRSMMAATDLLAAGFSGITDIAGGYAAWTQTGLPT  181



>emb|CDY45212.1| BnaA07g12780D [Brassica napus]
 emb|CDY30783.1| BnaC07g16830D [Brassica napus]
Length=126

 Score =   109 bits (273),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 75/112 (67%), Gaps = 3/112 (3%)
 Frame = +2

Query  239  VDVHVAQELLAKGHRYLDVRTEEEFKKGH--VENALNIPYMIINKSLGREKNPKFMNQVL  412
            VDV  A+ LL   H+YLDVRTEEEF++GH      LN+PYM+ N   GR KNP F++QV 
Sbjct  8    VDVSQAKTLLQSDHQYLDVRTEEEFRRGHCVAPKILNVPYML-NTPQGRVKNPNFLDQVS  66

Query  413  SAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVH  568
            S +   + ++VGC+SG RS+ A  +L++  +K V N+ GG+ AWV +  P++
Sbjct  67   SLLSPTDYILVGCQSGARSLNATSELVAAGYKKVRNIGGGYLAWVDQSFPIN  118



>gb|KFK28263.1| hypothetical protein AALP_AA8G494200 [Arabis alpina]
Length=127

 Score =   109 bits (272),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 66/105 (63%), Gaps = 1/105 (1%)
 Frame = +2

Query  251  VAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLSAIGKE  430
            VA E L  GHRYLDVRT EEF +GH   A+N+PYM    S G  KNP F+ QV S  G+ 
Sbjct  20   VAHEHLLAGHRYLDVRTPEEFSQGHACEAINVPYMYRGAS-GMSKNPDFLEQVSSHFGQS  78

Query  431  EKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPV  565
            ++++VGCK G RS+ A   LL   F  V ++ GG+ AW + GLP 
Sbjct  79   DQILVGCKGGGRSLKATAQLLDAGFTGVKDVAGGYSAWTQNGLPT  123



>ref|XP_009112267.1| PREDICTED: thiosulfate sulfurtransferase 16, chloroplastic isoform 
X1 [Brassica rapa]
Length=124

 Score =   109 bits (272),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 52/115 (45%), Positives = 70/115 (61%), Gaps = 5/115 (4%)
 Frame = +2

Query  230  IDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINK--SLGREKNPKFMN  403
            +  +D H   ELL  GHRYLDVRT EEF +GH   A+N+PYM      +    KNP F+ 
Sbjct  12   VSAIDAH---ELLQAGHRYLDVRTPEEFSQGHATGAINVPYMNRGNFFAFWMSKNPNFLE  68

Query  404  QVLSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVH  568
            QV S  GK ++++VGC+SG RS+ A  +LL   F  V ++ GG+ AW + GLP  
Sbjct  69   QVSSHFGKGDEVLVGCQSGGRSLRATAELLDAGFTGVKDISGGYSAWAQNGLPTQ  123



>ref|XP_010465855.1| PREDICTED: thiosulfate sulfurtransferase 18 isoform X1 [Camelina 
sativa]
Length=134

 Score =   109 bits (272),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 52/116 (45%), Positives = 76/116 (66%), Gaps = 2/116 (2%)
 Frame = +2

Query  227  RIDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENA--LNIPYMIINKSLGREKNPKFM  400
            ++ +VDV  A+ LL  GH+YLDVRT+EEFK+GH +    +NIPYM+     GR KN  F+
Sbjct  12   QVVSVDVSQAKALLQSGHQYLDVRTQEEFKRGHCQATKIVNIPYMVNTPQGGRGKNQDFL  71

Query  401  NQVLSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVH  568
             QV S +   + ++VGC+SG RS+ A  +LL+  +K V N+ GG+ AWV    P++
Sbjct  72   EQVSSLLNPADDILVGCQSGARSLNATTELLAAGYKKVRNVGGGYMAWVDHSFPIN  127



>ref|XP_010557664.1| PREDICTED: thiosulfate sulfurtransferase 18 [Tarenaya hassleriana]
Length=129

 Score =   109 bits (272),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 77/121 (64%), Gaps = 4/121 (3%)
 Frame = +2

Query  212  GVAGLRIDNVDVHVAQELLAKG-HRYLDVRTEEEFKKGH--VENALNIPYMIINKSLGRE  382
            G +G  +  VDV  A+ L+  G H YLDVRT EEF++GH       N+PYM  N   GR 
Sbjct  2    GSSGSEVVTVDVAEAKRLVEAGRHSYLDVRTREEFRRGHCLAPKIFNVPYMF-NSPHGRV  60

Query  383  KNPKFMNQVLSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLP  562
            KNP+F++QV S + + + +VVGC+SGVRS +A  DL++  +K+  NM GG+ AWV    P
Sbjct  61   KNPEFLSQVSSLLDQTDHIVVGCQSGVRSFHAAADLIAAGYKNASNMGGGYVAWVSHIFP  120

Query  563  V  565
            V
Sbjct  121  V  121



>ref|XP_010029615.1| PREDICTED: thiosulfate sulfurtransferase 16, chloroplastic-like 
isoform X2 [Eucalyptus grandis]
 gb|KCW56556.1| hypothetical protein EUGRSUZ_I02289 [Eucalyptus grandis]
Length=186

 Score =   110 bits (275),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 57/126 (45%), Positives = 75/126 (60%), Gaps = 1/126 (1%)
 Frame = +2

Query  188  PMACLLSSGVAGLRIDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINK  367
            P A L S   A     +V V VA ELL  GH YLDVRT EEF  GH   A+NIPYM    
Sbjct  60   PKAALRSDLEAAGIPASVPVRVAHELLQAGHHYLDVRTPEEFSAGHASGAINIPYMYRVG  119

Query  368  SLGREKNPKFMNQVLSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWV  547
            S G  KN  F+ +V +   K++++++GC+ G RSM A +DLL+  F  V ++ GG+ AW 
Sbjct  120  S-GMTKNASFIKEVSAQFRKDDEIIIGCQLGKRSMMAAKDLLAAGFSAVIDIAGGYAAWT  178

Query  548  KKGLPV  565
            + GLP 
Sbjct  179  QNGLPT  184



>ref|XP_010413383.1| PREDICTED: rhodanese-like domain-containing protein 17 [Camelina 
sativa]
Length=158

 Score =   109 bits (273),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 57/116 (49%), Positives = 75/116 (65%), Gaps = 3/116 (3%)
 Frame = +2

Query  239  VDVHVAQELLAKGHRYLDVRTEEEFKKGHV--ENALNIPYMIINKSLGREKNPKFMNQVL  412
            +DV  A  L+  G+ +LDVRT EEF+KGHV  E   N+PY +     G++ NP F+  V 
Sbjct  37   IDVSQAYNLILSGYTFLDVRTVEEFEKGHVDSEKVFNVPYWLYTPQ-GQDINPNFLEHVS  95

Query  413  SAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHYPNK  580
            S   + + LVVGCKSGVRS+YA + L+S  FK V NM+GG+ AWV K LPV   +K
Sbjct  96   SFCNQTDHLVVGCKSGVRSLYATKVLVSSGFKTVKNMDGGYIAWVNKRLPVKVEHK  151



>ref|XP_010465862.1| PREDICTED: thiosulfate sulfurtransferase 18 isoform X2 [Camelina 
sativa]
Length=133

 Score =   108 bits (271),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 77/116 (66%), Gaps = 3/116 (3%)
 Frame = +2

Query  227  RIDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENA--LNIPYMIINKSLGREKNPKFM  400
            ++ +VDV  A+ LL  GH+YLDVRT+EEFK+GH +    +NIPYM+ N   GR KN  F+
Sbjct  12   QVVSVDVSQAKALLQSGHQYLDVRTQEEFKRGHCQATKIVNIPYMV-NTPQGRGKNQDFL  70

Query  401  NQVLSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVH  568
             QV S +   + ++VGC+SG RS+ A  +LL+  +K V N+ GG+ AWV    P++
Sbjct  71   EQVSSLLNPADDILVGCQSGARSLNATTELLAAGYKKVRNVGGGYMAWVDHSFPIN  126



>ref|NP_001236607.1| uncharacterized protein LOC100499831 [Glycine max]
 gb|ACU13840.1| unknown [Glycine max]
Length=185

 Score =   110 bits (275),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 69/110 (63%), Gaps = 1/110 (1%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLS  415
            +V V VA ELL  GHRYLDV T EEF  GH   A+NIPYM    S G  KN  F+ +V S
Sbjct  75   SVPVRVAYELLLAGHRYLDVGTPEEFNAGHAPGAINIPYMFRVGS-GMTKNSNFIREVSS  133

Query  416  AIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPV  565
               KE++++VGC+ G RSM A  DLL+  F  + +M GG+ AW + GLP 
Sbjct  134  NFRKEDEIIVGCELGKRSMMAASDLLAAGFTGLTDMAGGYAAWTQNGLPT  183



>gb|KDO68012.1| hypothetical protein CISIN_1g041947mg, partial [Citrus sinensis]
Length=126

 Score =   108 bits (270),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 75/115 (65%), Gaps = 4/115 (3%)
 Frame = +2

Query  230  IDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQV  409
            + +V V  A++LL+ GHR+LDVRT EEF + HV  ALN+PY+ I +  GR KNP+F+ QV
Sbjct  5    VASVGVDTAKDLLSSGHRFLDVRTTEEFNESHVHGALNVPYLFITQE-GRVKNPEFLTQV  63

Query  410  LSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHYP  574
             S   KE+ ++V C SG R++ A  DL   +  HV  +EGG+ AWV +G+    P
Sbjct  64   ASVCSKEDHIIVVCNSGGRALRACVDL---RNAHVTKLEGGYSAWVDEGVAGDKP  115



>ref|XP_004287760.1| PREDICTED: rhodanese-like domain-containing protein 15, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=180

 Score =   110 bits (274),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 73/117 (62%), Gaps = 2/117 (2%)
 Frame = +2

Query  215  VAGLRIDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPK  394
            VAGL   +V V VA ELL  GH YLDVRT EEF  GH   A+NIPY+    S G  KNP+
Sbjct  64   VAGLPT-SVPVRVAHELLLAGHHYLDVRTPEEFSAGHPSGAVNIPYLYRVGS-GMSKNPE  121

Query  395  FMNQVLSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPV  565
            F+ +V S   K ++++VGC+ G RSM A  DL++  F  + +M GG+  W + GLP 
Sbjct  122  FVKEVSSHFRKHDEIIVGCQLGKRSMMAATDLVAAGFTGITDMAGGYATWTQNGLPT  178



>gb|ACG42699.1| senescence-associated protein DIN1 [Zea mays]
 gb|AFW69559.1| senescence-associated protein DIN1 [Zea mays]
Length=191

 Score =   110 bits (274),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 69/110 (63%), Gaps = 1/110 (1%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLS  415
            +V V VA EL   GHRYLDVRTE EF  GH E A+NIPYM    S G  KN  F+ QV  
Sbjct  81   SVPVRVAYELQQAGHRYLDVRTEGEFSAGHPEGAVNIPYMNKTGS-GMTKNAHFLEQVSR  139

Query  416  AIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPV  565
            A GK+++++VGC+SG RS+ A  +L S  F  V ++ GGF  W +  LP 
Sbjct  140  AFGKDDEIIVGCQSGKRSLMAATELCSAGFTAVTDIAGGFSTWRENELPT  189



>gb|KGN48929.1| hypothetical protein Csa_6G507040 [Cucumis sativus]
Length=239

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 72/195 (37%), Positives = 102/195 (52%), Gaps = 31/195 (16%)
 Frame = +2

Query  68   CAILCNFTNQSTQPTGSELYSTPGSDF------LTIPTIYTQSCSIPMACLLSSG----V  217
            C   C  TNQ      SE Y T   +F        +P +       P +  L +      
Sbjct  31   CKTTCRPTNQQR----SESYLTIKRNFNVLLRHQNLPAVSAAVLLPPQSPTLKTAHGFRT  86

Query  218  AGLR--------------IDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHV--ENALNIP  349
            AG+R              I  VDV  A  LL  G+ +LDVRT EEFK+GH+  E  +NIP
Sbjct  87   AGIRPPIMGSLDSSSDSGIVTVDVKTADNLLHSGYAFLDVRTVEEFKEGHMATERIVNIP  146

Query  350  YMIINKSLGREKNPKFMNQVLSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEG  529
            Y++ N   GR KN +F+ +V +   K+++LVVGC+SGVRS+ AIE+L ++ +KH+ ++ G
Sbjct  147  YLL-NSPNGRVKNAQFLAEVSAVFKKDDRLVVGCRSGVRSLLAIEELQNDGYKHLKDLGG  205

Query  530  GFDAWVKKGLPVHYP  574
            G  AW+   LPV  P
Sbjct  206  GHLAWLDNALPVANP  220



>ref|XP_004158864.1| PREDICTED: thiosulfate sulfurtransferase 18-like [Cucumis sativus]
Length=239

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 72/195 (37%), Positives = 102/195 (52%), Gaps = 31/195 (16%)
 Frame = +2

Query  68   CAILCNFTNQSTQPTGSELYSTPGSDF------LTIPTIYTQSCSIPMACLLSSG----V  217
            C   C  TNQ      SE Y T   +F        +P +       P +  L +      
Sbjct  31   CKTTCRPTNQQR----SESYLTIKRNFNVLLRHQNLPAVSAAVLLPPQSPTLKTAHGFRT  86

Query  218  AGLR--------------IDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHV--ENALNIP  349
            AG+R              I  VDV  A  LL  G+ +LDVRT EEFK+GH+  E  +NIP
Sbjct  87   AGIRPPIMGSLDSSSDSGIVTVDVKTADNLLHSGYAFLDVRTVEEFKEGHMATERIVNIP  146

Query  350  YMIINKSLGREKNPKFMNQVLSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEG  529
            Y++ N   GR KN +F+ +V +   K+++LVVGC+SGVRS+ AIE+L ++ +KH+ ++ G
Sbjct  147  YLL-NSPNGRVKNAQFLAEVSAVFKKDDRLVVGCRSGVRSLLAIEELQNDGYKHLKDLGG  205

Query  530  GFDAWVKKGLPVHYP  574
            G  AW+   LPV  P
Sbjct  206  GHLAWLDNALPVANP  220



>ref|XP_001751240.1| predicted protein [Physcomitrella patens]
 gb|EDQ83557.1| predicted protein [Physcomitrella patens]
Length=129

 Score =   108 bits (269),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 76/112 (68%), Gaps = 1/112 (1%)
 Frame = +2

Query  230  IDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQV  409
            + +V V VA E++  GHR LDVRT+EE+  GHVE A+NIPY ++    G +KN +F+ +V
Sbjct  7    LRSVPVQVAHEMMNAGHRCLDVRTQEEYLAGHVEGAINIPY-LVKCGPGMKKNHRFLEEV  65

Query  410  LSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPV  565
             +  GK+ +++VGC+SG RSM A  +L +  F  V +M GG+ AW + GLPV
Sbjct  66   EAEFGKDAEIIVGCQSGRRSMMAAAELQAANFNGVTDMGGGYVAWKESGLPV  117



>ref|XP_009103546.1| PREDICTED: thiosulfate sulfurtransferase 18-like [Brassica rapa]
 emb|CDY45211.1| BnaA07g12790D [Brassica napus]
Length=130

 Score =   108 bits (269),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 75/112 (67%), Gaps = 3/112 (3%)
 Frame = +2

Query  239  VDVHVAQELLAKGHRYLDVRTEEEFKKGH--VENALNIPYMIINKSLGREKNPKFMNQVL  412
            VDV  A+ LL   H+YLDVRTEEEF++GH      LN+PYM+ +   GR KNP F++QV 
Sbjct  12   VDVSQAKTLLQSDHQYLDVRTEEEFRRGHCVAPKILNVPYML-STPQGRVKNPNFLDQVS  70

Query  413  SAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVH  568
            S +   + ++VGC+SG RS+ A  +L++  +K V N+ GG+ AWV +  P++
Sbjct  71   SLLSPTDDILVGCQSGARSLNATSELVAAGYKKVRNIGGGYLAWVDQSFPIN  122



>emb|CAA61433.1| ketoconazole resistent protein [Arabidopsis thaliana]
Length=140

 Score =   108 bits (269),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 70/109 (64%), Gaps = 2/109 (2%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHVE-NALNIPYMIINKSLGREKNPKFMNQVL  412
            +V V VA +LL  GHRYLDVRT EEF +GHV   ++N+PYM    S G  KNP F+ QV 
Sbjct  10   SVSVTVAHDLLLAGHRYLDVRTPEEFSQGHVPVGSINVPYMNRGAS-GMSKNPDFLEQVS  68

Query  413  SAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGL  559
            S  G+ + ++VGC+SG RS+ A  DLL   F  V ++ GG+ AW K G 
Sbjct  69   SHFGQSDNIIVGCQSGGRSIKATTDLLHAGFTGVKDIVGGYSAWAKNGF  117



>ref|XP_011043231.1| PREDICTED: receptor homology region, transmembrane domain- and 
RING domain-containing protein 1 [Populus euphratica]
Length=474

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 59/123 (48%), Positives = 75/123 (61%), Gaps = 3/123 (2%)
 Frame = +2

Query  218  AGLRIDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHV--ENALNIPYMIINKSLGREKNP  391
             G  +  +DV   + LL  G+ YLDVRT EE+ KGHV  E   NIPY+  N   GR KNP
Sbjct  348  TGAEVVTIDVKATKGLLESGYTYLDVRTVEEYNKGHVDGEKVFNIPYLF-NTPEGRVKNP  406

Query  392  KFMNQVLSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHY  571
             F+ +V     +E+KL+VGC+SGVRS+YA  DLLS  FK V N+ GG+ AW +   PV  
Sbjct  407  NFLKEVSGVCKEEDKLLVGCQSGVRSLYATADLLSAGFKDVSNVGGGYLAWTENVFPVKI  466

Query  572  PNK  580
              K
Sbjct  467  EKK  469



>gb|AAX13288.1| senescence-associated protein [Triticum aestivum]
Length=194

 Score =   109 bits (272),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 78/128 (61%), Gaps = 9/128 (7%)
 Frame = +2

Query  209  SGVAGLRID--------NVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIIN  364
            +GVA LR++        +V V VA EL   GHRYLDVRTE EF  GH   A+N+PYM   
Sbjct  66   AGVAALRVEEAGVAVPPSVPVRVAYELQLAGHRYLDVRTEGEFAGGHPAGAVNVPYMYST  125

Query  365  KSLGREKNPKFMNQVLSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAW  544
             S G  KN  F+ QV +   K+++++VGC+SG RS+ A  +L S  F  V ++ GG+  W
Sbjct  126  GS-GMAKNSHFVEQVSAIFRKDDEIIVGCQSGKRSLMAAAELCSAGFTAVTDIAGGYSTW  184

Query  545  VKKGLPVH  568
             + GLPV+
Sbjct  185  RENGLPVN  192



>ref|XP_003612270.1| Senescence-associated protein DIN1 [Medicago truncatula]
 gb|ACJ83983.1| unknown [Medicago truncatula]
 gb|AES95228.1| rhodanese-related sulfurtransferase [Medicago truncatula]
 gb|AFK35878.1| unknown [Medicago truncatula]
Length=185

 Score =   109 bits (272),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 70/110 (64%), Gaps = 1/110 (1%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLS  415
            +V V VA ELL  GH+YLDVRT EEF  GH   A+NIPYM    S G  KN  F+ +V S
Sbjct  75   SVPVRVAHELLLAGHKYLDVRTTEEFNAGHAPGAINIPYMYKVGS-GMTKNSNFVKEVSS  133

Query  416  AIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPV  565
               KE++++VGC+ G RSM A  DLL+  F  + ++ GG+ AW + GLP 
Sbjct  134  HFRKEDEVIVGCQLGKRSMMAATDLLAAGFTGLTDIAGGYAAWTQNGLPT  183



>ref|XP_004966491.1| PREDICTED: senescence-associated protein DIN1-like [Setaria italica]
Length=183

 Score =   109 bits (272),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 70/110 (64%), Gaps = 1/110 (1%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLS  415
            +V V VA EL   GHRYLDVRTE EF  GH E A+NIPYM    S G  KN  F+ QV  
Sbjct  73   SVPVRVAYELQQAGHRYLDVRTEGEFSAGHPEGAVNIPYMNKTGS-GMTKNTHFLEQVSR  131

Query  416  AIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPV  565
              GK+++++VGC+SG RS+ A  +L S  F  V ++ GGF +W +  LP+
Sbjct  132  IFGKDDEIIVGCQSGKRSLMAATELCSAGFTAVTDIAGGFSSWRENELPI  181



>emb|CDX81421.1| BnaC09g08320D [Brassica napus]
Length=124

 Score =   107 bits (267),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 69/113 (61%), Gaps = 2/113 (2%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINK--SLGREKNPKFMNQV  409
            +V V  A ELL  GHRYLDVRT EEF +GH   A+N+PYM      +    KNP F+ QV
Sbjct  11   SVSVIDAHELLQAGHRYLDVRTPEEFSQGHATGAINVPYMNRGNFIAFWMSKNPNFLEQV  70

Query  410  LSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVH  568
             S  GK ++++VGC+SG RS+ A  +LL   F  V ++ GG+ AW +  LP  
Sbjct  71   SSHFGKADEVLVGCQSGGRSLRATAELLDAGFTGVKDISGGYSAWAQNNLPTQ  123



>gb|AAF61174.1|AF245222_1 OP1 [Cucumis sativus]
Length=150

 Score =   108 bits (269),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 73/112 (65%), Gaps = 1/112 (1%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLS  415
            +V V VA ELL  G RYLDVRT EE+  GH   A+NIPYM    S G  +NP F+ +V  
Sbjct  40   SVPVRVALELLQAGQRYLDVRTPEEYSVGHAPGAINIPYMYRVGS-GMTRNPHFLAEVAI  98

Query  416  AIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHY  571
               K+++++VGC SG RS+ A  DLL+  + +V ++ GG++AW + GLP+ +
Sbjct  99   YFRKDDEIIVGCLSGKRSLMAAADLLASGYNYVTDIAGGYEAWSRNGLPMEF  150



>ref|XP_010467583.1| PREDICTED: rhodanese-like domain-containing protein 17 [Camelina 
sativa]
Length=157

 Score =   108 bits (269),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 75/117 (64%), Gaps = 3/117 (3%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHV--ENALNIPYMIINKSLGREKNPKFMNQV  409
             +DV  A +L+  G+ +LDVRT EEF+KGHV  E   N+PY +     G++ NP F+  V
Sbjct  35   TIDVSQAYKLIHSGYTFLDVRTVEEFEKGHVDSEKVFNVPYWLYTPQ-GQDINPNFLEHV  93

Query  410  LSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHYPNK  580
             S   + + LVVGCKSGVRS+YA + L+S  FK V NM+GG+ AWV K  PV   +K
Sbjct  94   SSFCNQTDHLVVGCKSGVRSLYATKVLVSSGFKTVKNMDGGYIAWVNKRFPVKVEHK  150



>ref|XP_002969639.1| hypothetical protein SELMODRAFT_92035, partial [Selaginella moellendorffii]
 gb|EFJ29727.1| hypothetical protein SELMODRAFT_92035, partial [Selaginella moellendorffii]
Length=111

 Score =   106 bits (265),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 71/110 (65%), Gaps = 1/110 (1%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLS  415
            +V V VA +LL  GH YLDVRT EEF  GHVE A+NIP+M      G   N  F+ +V +
Sbjct  1    SVPVQVAHDLLKAGHHYLDVRTPEEFAAGHVEGAVNIPFMY-KFGTGMITNLDFVPEVSA  59

Query  416  AIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPV  565
               K++++VVGC+SG RSM A  +LL+  F  V +M GG+ AW++  LPV
Sbjct  60   RFNKDDEIVVGCQSGRRSMAAATELLASGFTGVTDMGGGYGAWIQSNLPV  109



>ref|NP_001058618.1| Os06g0725000 [Oryza sativa Japonica Group]
 dbj|BAD61696.1| putative Ntdin [Oryza sativa Japonica Group]
 dbj|BAF20532.1| Os06g0725000 [Oryza sativa Japonica Group]
 dbj|BAG99422.1| unnamed protein product [Oryza sativa Japonica Group]
Length=116

 Score =   107 bits (266),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 70/111 (63%), Gaps = 1/111 (1%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLS  415
            +V V VA EL   GHRYLDVRTE EF  GH   A+NIPYM    S G  KN  F+ +V +
Sbjct  6    SVPVRVAHELQQAGHRYLDVRTEGEFAGGHPVGAVNIPYMYKTGS-GLTKNTHFLEKVST  64

Query  416  AIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVH  568
              GKE++++VGC+SG RS+ A  +L S  F  V ++ GGF AW +  LP +
Sbjct  65   TFGKEDEIIVGCQSGKRSLMAASELCSAGFTAVTDIAGGFSAWKENELPTN  115



>ref|XP_004512145.1| PREDICTED: thiosulfate sulfurtransferase 18-like isoform X1 [Cicer 
arietinum]
Length=147

 Score =   107 bits (268),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 77/116 (66%), Gaps = 3/116 (3%)
 Frame = +2

Query  227  RIDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENA--LNIPYMIINKSLGREKNPKFM  400
            ++  +DV  A+ L+  G+ YLDVRT EEF KGHV+ A  +NIPY++      R KN  F+
Sbjct  24   KVVTIDVQEAKNLIQAGYIYLDVRTVEEFVKGHVDAAKIINIPYLL-GAPKSRVKNQDFL  82

Query  401  NQVLSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVH  568
              V SA  KE+ L+VGC+ GVRS+ A  DLL++ FK+V NMEGG+  WV+   PV+
Sbjct  83   KDVSSACNKEDPLIVGCQIGVRSLNASIDLLADGFKNVKNMEGGYVEWVRNNFPVN  138



>ref|XP_002439047.1| hypothetical protein SORBIDRAFT_10g030520 [Sorghum bicolor]
 gb|EER90414.1| hypothetical protein SORBIDRAFT_10g030520 [Sorghum bicolor]
Length=207

 Score =   109 bits (272),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 61/141 (43%), Positives = 79/141 (56%), Gaps = 15/141 (11%)
 Frame = +2

Query  182  SIPMACLLSSGVAGLRID------------NVDVHVAQELLAKGHRYLDVRTEEEFKKGH  325
            S+ + C+   G   LR D            +V V VA EL   GHRYLDVRTE EF  GH
Sbjct  66   SVSVRCVGVGGTEALRSDAAEPPVPSSVPRSVPVRVAYELQQAGHRYLDVRTEGEFSAGH  125

Query  326  VENALNIPYMIINKS-LGREKNPKFMNQVLSAIGKEEKLVVGCKSGVRSMYAIEDLLSEK  502
             E A+NIPYM  NK+  G  KN  F+ QV    GK+++++VGC+SG RS+ A  +L S  
Sbjct  126  PEGAVNIPYM--NKTGSGMTKNTHFLEQVSRIFGKDDEIIVGCQSGKRSLMAATELCSAG  183

Query  503  FKHVCNMEGGFDAWVKKGLPV  565
            F  V ++ GGF  W +  LP 
Sbjct  184  FTAVTDIAGGFSTWRENELPT  204



>ref|XP_010239617.1| PREDICTED: thiosulfate sulfurtransferase 16, chloroplastic-like 
isoform X2 [Brachypodium distachyon]
Length=195

 Score =   108 bits (271),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 72/111 (65%), Gaps = 1/111 (1%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLS  415
            +V V VA EL   GHRYLDVRTE EF  GH   A+NIPY+    S G  KN +F+ QV +
Sbjct  84   SVPVRVAHELQLAGHRYLDVRTEGEFGGGHPAGAVNIPYLYKTGS-GMTKNSQFLEQVSA  142

Query  416  AIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVH  568
               +++++++GC+SG RS+ A  +L S  F  V ++ GGF AW + GLPV+
Sbjct  143  IFRRDDEIIIGCQSGRRSLMAAAELCSAGFTAVTDIAGGFSAWRENGLPVN  193



>emb|CDY57763.1| BnaC02g45050D [Brassica napus]
Length=132

 Score =   107 bits (266),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 73/111 (66%), Gaps = 3/111 (3%)
 Frame = +2

Query  239  VDVHVAQELLAKGHRYLDVRTEEEFKKGH--VENALNIPYMIINKSLGREKNPKFMNQVL  412
            VDV  A+ LL   H+YLDVRTEEEF++GH  V   LN+PYM+ N   GR KN  F++QV 
Sbjct  14   VDVSQAKILLQSDHQYLDVRTEEEFRRGHCFVPKILNVPYML-NSPQGRVKNQDFLDQVS  72

Query  413  SAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPV  565
            S +   + ++VGC+SG RS+ A  +L+S  FK V N+ GG+ AWV    P+
Sbjct  73   SLLNPTDDILVGCQSGARSLNATTELISAGFKKVRNVGGGYLAWVDHNFPI  123



>ref|XP_003563268.2| PREDICTED: thiosulfate sulfurtransferase 16, chloroplastic-like 
isoform X1 [Brachypodium distachyon]
Length=196

 Score =   108 bits (271),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 72/111 (65%), Gaps = 1/111 (1%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLS  415
            +V V VA EL   GHRYLDVRTE EF  GH   A+NIPY+    S G  KN +F+ QV +
Sbjct  85   SVPVRVAHELQLAGHRYLDVRTEGEFGGGHPAGAVNIPYLYKTGS-GMTKNSQFLEQVSA  143

Query  416  AIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVH  568
               +++++++GC+SG RS+ A  +L S  F  V ++ GGF AW + GLPV+
Sbjct  144  IFRRDDEIIIGCQSGRRSLMAAAELCSAGFTAVTDIAGGFSAWRENGLPVN  194



>gb|KDO71378.1| hypothetical protein CISIN_1g029759mg [Citrus sinensis]
Length=183

 Score =   108 bits (270),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 71/110 (65%), Gaps = 2/110 (2%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLS  415
            +V V VA ELL  GHRYLDVRT EEF  GH   A+N+PYM    S G  KN KF+ +V +
Sbjct  74   SVPVRVAHELLQAGHRYLDVRTPEEFSAGHATGAINVPYMYRVGS-GMTKNLKFVEEVST  132

Query  416  AIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPV  565
               K ++++VGC+SG RSM A  DLL+  F  + ++ GGF AW + GLP 
Sbjct  133  RFRKHDEIIVGCQSGKRSMMAATDLLN-GFAGITDIAGGFAAWRQNGLPT  181



>dbj|BAD61695.1| putative Ntdin [Oryza sativa Japonica Group]
 gb|EEC81333.1| hypothetical protein OsI_24507 [Oryza sativa Indica Group]
Length=170

 Score =   108 bits (269),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 70/111 (63%), Gaps = 1/111 (1%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLS  415
            +V V VA EL   GHRYLDVRTE EF  GH   A+NIPYM    S G  KN  F+ +V +
Sbjct  60   SVPVRVAHELQQAGHRYLDVRTEGEFAGGHPVGAVNIPYMYKTGS-GLTKNTHFLEKVST  118

Query  416  AIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVH  568
              GKE++++VGC+SG RS+ A  +L S  F  V ++ GGF AW +  LP +
Sbjct  119  TFGKEDEIIVGCQSGKRSLMAASELCSAGFTAVTDIAGGFSAWKENELPTN  169



>ref|XP_004134838.1| PREDICTED: rhodanese-like domain-containing protein 15, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004158850.1| PREDICTED: rhodanese-like domain-containing protein 15, chloroplastic-like 
[Cucumis sativus]
 gb|KGN48964.1| hypothetical protein Csa_6G507370 [Cucumis sativus]
Length=184

 Score =   108 bits (270),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 73/112 (65%), Gaps = 1/112 (1%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLS  415
            +V V VA ELL  G RYLDVRT EE+  GH   A+NIPYM    S G  +NP F+ +V  
Sbjct  74   SVPVRVALELLQAGQRYLDVRTPEEYSVGHAPGAINIPYMYRVGS-GMTRNPHFLAEVAI  132

Query  416  AIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHY  571
               K+++++VGC SG RS+ A  DLL+  + +V ++ GG++AW + GLP+ +
Sbjct  133  YFRKDDEIIVGCLSGKRSLMAAADLLASGYNYVTDIAGGYEAWSRNGLPMEF  184



>ref|XP_008344221.1| PREDICTED: thiosulfate sulfurtransferase 16, chloroplastic-like 
[Malus domestica]
Length=181

 Score =   108 bits (269),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 70/110 (64%), Gaps = 1/110 (1%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLS  415
            +V V VA ELL  GH+YLDVRT EEF  GH   A+NIPY+    S G  KN +F+ QV S
Sbjct  71   SVPVRVAHELLQAGHKYLDVRTPEEFSAGHAPGAVNIPYLYKVGS-GMTKNQEFLEQVSS  129

Query  416  AIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPV  565
               K ++++VGC+ G RSM A  DL++  F  + ++ GG+ AW + GLP 
Sbjct  130  HFRKHDEIIVGCQLGKRSMMAATDLVASGFTGITDIAGGYAAWTQSGLPT  179



>ref|XP_009344812.1| PREDICTED: thiosulfate sulfurtransferase 16, chloroplastic [Pyrus 
x bretschneideri]
Length=181

 Score =   108 bits (269),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 70/110 (64%), Gaps = 1/110 (1%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLS  415
            +V V VA ELL  GH+YLDVRT EEF  GH   A+NIPY+    S G  KN +F+ QV S
Sbjct  71   SVPVRVAHELLQAGHKYLDVRTPEEFSAGHAPGAVNIPYLYKVGS-GMSKNQEFLEQVSS  129

Query  416  AIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPV  565
               K ++++VGC+ G RSM A  DL++  F  + ++ GG+ AW + GLP 
Sbjct  130  HFRKHDEIIVGCQLGKRSMMAATDLVAAGFTGITDIAGGYAAWTQTGLPT  179



>ref|XP_007157906.1| hypothetical protein PHAVU_002G107700g [Phaseolus vulgaris]
 gb|ESW29900.1| hypothetical protein PHAVU_002G107700g [Phaseolus vulgaris]
Length=152

 Score =   107 bits (267),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 79/124 (64%), Gaps = 6/124 (5%)
 Frame = +2

Query  218  AGLRIDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHVE--NALNIPYMIINKSLGREK--  385
            +G ++  +DV  A++L+  G  YLDVRT EEF KGHV+  N +NIPYM+ N S GR    
Sbjct  24   SGAKVVTIDVRAAKDLIETGSIYLDVRTVEEFLKGHVDAVNIVNIPYML-NTSKGRAGKV  82

Query  386  -NPKFMNQVLSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLP  562
             NP F+ +V  A  KE+ L+VGC++G RS+YA   LLS+ FK+V +M GG+  W +    
Sbjct  83   MNPDFLKEVSLACNKEDHLIVGCQTGGRSLYATAALLSDGFKNVKDMGGGYAEWSQNKFA  142

Query  563  VHYP  574
            V  P
Sbjct  143  VKIP  146



>ref|XP_010531128.1| PREDICTED: rhodanese-like domain-containing protein 15, chloroplastic 
[Tarenaya hassleriana]
Length=173

 Score =   107 bits (268),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 70/112 (63%), Gaps = 1/112 (1%)
 Frame = +2

Query  230  IDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQV  409
            + +V V VA EL   GHRYLDVRT +EF  GH   ++N+PY     S G  KNP F+ QV
Sbjct  61   LTSVPVRVAHELAQAGHRYLDVRTPDEFSAGHPSGSINVPYFYRVGS-GLTKNPGFLRQV  119

Query  410  LSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPV  565
             S   K +++++G +SG RS+ A  DLLS  F  + ++ GG+ AW + GLPV
Sbjct  120  SSHFRKHDEIIIGSESGERSLMASADLLSSGFTSITDIAGGYTAWSQNGLPV  171



>ref|XP_002439046.1| hypothetical protein SORBIDRAFT_10g030510 [Sorghum bicolor]
 gb|EER90413.1| hypothetical protein SORBIDRAFT_10g030510 [Sorghum bicolor]
Length=185

 Score =   108 bits (269),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 66/104 (63%), Gaps = 1/104 (1%)
 Frame = +2

Query  254  AQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLSAIGKEE  433
            A EL   GHRYLDVRTE EF  GH E A+NIPY+      G  KN  F+ QV S  GK++
Sbjct  81   AYELQQAGHRYLDVRTESEFSAGHPERAVNIPYLF-RAVTGTTKNTCFLEQVASIFGKDD  139

Query  434  KLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPV  565
             +++GC+SG RS+ A  +L S  F  V ++ GGF +W + GLP+
Sbjct  140  GIIIGCQSGRRSLMAATELSSAGFTTVTDVAGGFSSWRENGLPI  183



>ref|XP_007046569.1| Beta-galactosidase 3 isoform 1 [Theobroma cacao]
 gb|EOX90726.1| Beta-galactosidase 3 isoform 1 [Theobroma cacao]
Length=179

 Score =   107 bits (268),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 68/110 (62%), Gaps = 1/110 (1%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLS  415
            +V V VA EL   GHRYLDVRT EEF  GH   A+NIPYM    S G  KNP F+ +V S
Sbjct  70   SVPVRVAHELHQAGHRYLDVRTPEEFSAGHAPGAINIPYMCKVGS-GMTKNPNFLAEVSS  128

Query  416  AIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPV  565
              G  ++++VGC+ G RS+ A  +LL+  F  V ++ GG+ AW +  LP 
Sbjct  129  HFGTYDEIIVGCQVGKRSLMAATELLAAGFTAVTDIAGGYAAWTQNQLPT  178



>ref|NP_001032159.1| thiosulfate sulfurtransferase 18 [Arabidopsis thaliana]
 gb|AED98169.1| sulfurtransferase 18 [Arabidopsis thaliana]
Length=138

 Score =   106 bits (264),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = +2

Query  191  MACLLSSGVAGLRIDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENA--LNIPYMIIN  364
            M+  +SS      + +VDV  A+ LL  GH+YLDVRT++EF++GH E A  +NIPYM +N
Sbjct  1    MSQSISSSTKAEEVVSVDVSQAKTLLQSGHQYLDVRTQDEFRRGHCEAAKIVNIPYM-LN  59

Query  365  KSLGREKNPKFMNQVLSAIGKEEKLVVGCKSGVRSMYAIEDLLS--EKFKHVCNMEGGFD  538
               GR KN +F+ QV S +   + ++VGC+SG RS+ A  +L++    +K V N+ GG+ 
Sbjct  60   TPQGRVKNQEFLEQVSSLLNPADDILVGCQSGARSLKATTELVAAVSGYKKVRNVGGGYL  119

Query  539  AWVKKGLPVH  568
            AWV    P++
Sbjct  120  AWVDHSFPIN  129



>gb|KDO71377.1| hypothetical protein CISIN_1g029759mg [Citrus sinensis]
Length=183

 Score =   107 bits (266),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 70/110 (64%), Gaps = 2/110 (2%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLS  415
            +V V VA ELL  GHRYLDVRT EEF  GH   A+N+PYM    S G  KN KF+ +V +
Sbjct  74   SVPVRVAHELLQAGHRYLDVRTPEEFSAGHATGAINVPYMYRVGS-GMTKNLKFVEEVST  132

Query  416  AIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPV  565
               K ++ ++GC+SG RSM A  DLL+  F  + ++ GGF AW + GLP 
Sbjct  133  RFRKHDE-IIGCQSGKRSMMAATDLLNAGFAGITDIAGGFAAWRQNGLPT  181



>ref|XP_008393643.1| PREDICTED: thiosulfate sulfurtransferase 16, chloroplastic [Malus 
domestica]
Length=181

 Score =   107 bits (266),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 70/110 (64%), Gaps = 1/110 (1%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLS  415
            +V V VA ELL  GH+YLDVRT EEF  GH   A+NIPY+    S G  KN +F+ QV S
Sbjct  71   SVPVRVAHELLQAGHKYLDVRTPEEFSAGHAPGAVNIPYLYKVGS-GMTKNQEFLEQVSS  129

Query  416  AIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPV  565
               K ++++VGC+ G RSM A  DL++  F  + ++ GG+ AW + GLP 
Sbjct  130  HFRKHDEIIVGCQLGKRSMMAATDLVASGFTGITDIAGGYAAWTQCGLPT  179



>ref|XP_006393804.1| hypothetical protein EUTSA_v10005118mg [Eutrema salsugineum]
 gb|ESQ31090.1| hypothetical protein EUTSA_v10005118mg [Eutrema salsugineum]
Length=133

 Score =   105 bits (262),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 74/112 (66%), Gaps = 3/112 (3%)
 Frame = +2

Query  239  VDVHVAQELLAKGHRYLDVRTEEEFKKGHVE--NALNIPYMIINKSLGREKNPKFMNQVL  412
            VDV  A+ LL  GH+YLDVRT+EEF+KGH +    LN+PYM+ +   GR KN  F++QV 
Sbjct  16   VDVSQAKTLLQFGHQYLDVRTQEEFRKGHCQAPQILNVPYML-STPQGRVKNQDFLDQVS  74

Query  413  SAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVH  568
            S +   + ++VGC+SG RS  A  +L++  FK V N+ GG+ AWV    P++
Sbjct  75   SLLNPTDDILVGCQSGARSFNATTELVAAGFKKVKNVGGGYLAWVDHSFPIN  126



>ref|XP_006393791.1| hypothetical protein EUTSA_v10005068mg [Eutrema salsugineum]
 gb|ESQ31077.1| hypothetical protein EUTSA_v10005068mg [Eutrema salsugineum]
Length=152

 Score =   105 bits (262),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/141 (39%), Positives = 73/141 (52%), Gaps = 30/141 (21%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYM--------------------  355
            +V V VA +LL  GHRYLDVRT EEF +GH   A+N+PYM                    
Sbjct  10   SVSVIVAHDLLLAGHRYLDVRTPEEFSQGHACGAINVPYMKRGDSGFTMLKLDLCVCICF  69

Query  356  ----------IINKSLGREKNPKFMNQVLSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKF  505
                      +I    G  KNP F+ QV S  G+ +K++VGC+SG RS+ A  +LL   F
Sbjct  70   FFLFLQKKKGVIVNEAGMSKNPSFLEQVSSHFGEADKIIVGCQSGGRSLKATAELLDAGF  129

Query  506  KHVCNMEGGFDAWVKKGLPVH  568
              V ++ GG+ AW + GLP  
Sbjct  130  TGVTDIAGGYAAWTQNGLPTQ  150



>ref|XP_003578352.1| PREDICTED: thiosulfate sulfurtransferase 16, chloroplastic-like 
[Brachypodium distachyon]
Length=135

 Score =   105 bits (261),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/105 (48%), Positives = 67/105 (64%), Gaps = 1/105 (1%)
 Frame = +2

Query  239  VDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMI-INKSLGREKNPKFMNQVLS  415
            VD   A+ LL+ GH YLD R  E+F KGH   A NIPY + +    GREKNP F  +V +
Sbjct  15   VDADEARALLSSGHGYLDARMPEDFDKGHAPGARNIPYYVYVAPGQGREKNPHFEQEVAA  74

Query  416  AIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVK  550
              GKE+ L+VGC +G RS  A  DLL   FK+V N++GG+ A+++
Sbjct  75   LYGKEDHLIVGCFTGTRSKLATSDLLKAGFKNVRNLQGGYRAFLQ  119



>ref|XP_009337080.1| PREDICTED: thiosulfate sulfurtransferase 16, chloroplastic-like 
[Pyrus x bretschneideri]
 ref|XP_009337081.1| PREDICTED: thiosulfate sulfurtransferase 16, chloroplastic-like 
[Pyrus x bretschneideri]
 ref|XP_009337082.1| PREDICTED: thiosulfate sulfurtransferase 16, chloroplastic-like 
[Pyrus x bretschneideri]
 ref|XP_009337083.1| PREDICTED: thiosulfate sulfurtransferase 16, chloroplastic-like 
[Pyrus x bretschneideri]
Length=182

 Score =   106 bits (264),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 70/110 (64%), Gaps = 1/110 (1%)
 Frame = +2

Query  236  NVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQVLS  415
            +V V VA ELL  GH+YLDVRT EEF  GH   A+NIPY+    S G  +NP+F+ +V S
Sbjct  72   SVPVRVAHELLQAGHKYLDVRTPEEFSAGHAPGAVNIPYLYKVGS-GISRNPEFLKEVSS  130

Query  416  AIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPV  565
               K ++++VGC+ G RSM A  DL++  F  + ++ GG+  W + GLP 
Sbjct  131  HFRKHDEIIVGCQLGKRSMMAATDLVAAGFTGITDIAGGYAVWTQTGLPT  180



>gb|KFK28277.1| hypothetical protein AALP_AA8G495600 [Arabis alpina]
Length=129

 Score =   104 bits (260),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 71/112 (63%), Gaps = 3/112 (3%)
 Frame = +2

Query  239  VDVHVAQELLAKGHRYLDVRTEEEFKKGH--VENALNIPYMIINKSLGREKNPKFMNQVL  412
            VDV  A+ L+  G++YLDVRT EEF +GH    N +NIPYM  N   GR KN  F+NQV 
Sbjct  12   VDVSQAKSLIESGYQYLDVRTPEEFGRGHCVASNIVNIPYMF-NTPQGRVKNQDFLNQVS  70

Query  413  SAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVH  568
              +   + ++VGC+SG RS+ A  +L++  FK V N+ GG+ AWV    P++
Sbjct  71   YLLNPADDILVGCQSGARSLNATTELVAAGFKKVRNVGGGYSAWVNHNFPIN  122



>ref|XP_010649017.1| PREDICTED: rhodanese-like domain-containing protein 17 isoform 
X2 [Vitis vinifera]
Length=159

 Score =   105 bits (262),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 65/159 (41%), Positives = 84/159 (53%), Gaps = 32/159 (20%)
 Frame = +2

Query  203  LSSGVAGLRIDNVDVHVAQELLAKGHRYLDVRTEEEFKKGH--VENALNIPYMIINKSLG  376
            ++S  +   +  +DVH A+EL   G+RYLDVRT EEFKKGH  VEN LNIPY+       
Sbjct  1    MASPSSATEVVTIDVHAAKELTNSGYRYLDVRTVEEFKKGHADVENILNIPYLFTTPE-E  59

Query  377  REKNPKFMNQVLSAIGKEEKLVV-----------------------------GCKSGVRS  469
            R K P+F+ QV SA  KE+ LVV                             GC  GVRS
Sbjct  60   RLKIPEFLEQVQSACSKEDHLVVVIFHLISGLNHNKYNLDEFSEIVYLFSMNGCLGGVRS  119

Query  470  MYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHYPNKTE  586
            + A   L++  FK V +M GG++AWV+ GL V  P + E
Sbjct  120  LAAASVLVNAGFKDVKDMGGGYEAWVETGLTVTKPKEEE  158



>ref|XP_007022460.1| Rhodanese/Cell cycle control phosphatase superfamily protein, 
putative [Theobroma cacao]
 gb|EOY13985.1| Rhodanese/Cell cycle control phosphatase superfamily protein, 
putative [Theobroma cacao]
Length=140

 Score =   104 bits (260),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 73/120 (61%), Gaps = 1/120 (1%)
 Frame = +2

Query  230  IDNVDVHVAQELLAKGHRYLDVRTEEEFKKGHVENALNIPYMIINKSLGREKNPKFMNQV  409
            I  V+VH A++LL   H YLDVRT  E  K H+ NA N+PYM I +  GR KN +F+ QV
Sbjct  14   IATVNVHAAKDLLGSSHCYLDVRTPAESCKSHITNASNVPYMFITQE-GRVKNLEFLTQV  72

Query  410  LSAIGKEEKLVVGCKSGVRSMYAIEDLLSEKFKHVCNMEGGFDAWVKKGLPVHYPNKTEL  589
             S + K++ +VVGC SG R + A  DLL+  ++ V NMEG +  WV  GL  H     EL
Sbjct  73   SSLLKKDDLIVVGCNSGGRFLGACVDLLNVGYEDVSNMEGSYSGWVDSGLVGHGKPSEEL  132



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1173402497230