BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c10359_g2_i1 len=1329 path=[1331:0-1328]

Length=1329
                                                                      Score     E

ref|XP_011070792.1|  PREDICTED: adenylate isopentenyltransferase-...    349   9e-114   
ref|XP_009762170.1|  PREDICTED: adenylate isopentenyltransferase ...    341   1e-110   
ref|XP_009762171.1|  PREDICTED: adenylate isopentenyltransferase ...    341   2e-110   
gb|AFV15392.1|  isopentenyl transferase 1 protein                       340   4e-110   
gb|EYU29989.1|  hypothetical protein MIMGU_mgv1a010491mg                336   5e-109   
ref|XP_009630789.1|  PREDICTED: adenylate isopentenyltransferase-...    335   4e-108   
ref|XP_009630791.1|  PREDICTED: adenylate isopentenyltransferase-...    335   6e-108   
ref|XP_009769551.1|  PREDICTED: adenylate isopentenyltransferase-...    335   6e-108   
ref|XP_011076680.1|  PREDICTED: adenylate isopentenyltransferase        332   1e-106   
ref|XP_009603978.1|  PREDICTED: adenylate isopentenyltransferase-...    330   2e-105   
ref|XP_006360459.1|  PREDICTED: adenylate isopentenyltransferase ...    327   5e-105   
ref|XP_006344131.1|  PREDICTED: adenylate isopentenyltransferase-...    327   8e-105   
emb|CDP00631.1|  unnamed protein product                                325   1e-104   
ref|NP_001244914.1|  adenylate isopentenyltransferase                   325   2e-104   
gb|EPS71073.1|  hypothetical protein M569_03686                         317   2e-101   
ref|NP_001244913.1|  adenylate isopentenyltransferase                   315   2e-100   
gb|EYU40761.1|  hypothetical protein MIMGU_mgv1a017953mg                305   3e-97    
gb|AAL83819.1|  unknown                                                 306   1e-96    Petunia x hybrida [garden petunia]
gb|AAX12424.1|  adenylate isopentenyltransferase                        303   3e-96    Morus alba
emb|CBI27009.3|  unnamed protein product                                299   3e-94    
gb|KCW64725.1|  hypothetical protein EUGRSUZ_G02313                     297   9e-94    
ref|XP_010066714.1|  PREDICTED: adenylate isopentenyltransferase        297   5e-93    
ref|XP_004497083.1|  PREDICTED: LOW QUALITY PROTEIN: adenylate is...    296   1e-92    
ref|XP_002279371.2|  PREDICTED: adenylate isopentenyltransferase        296   3e-92    Vitis vinifera
gb|KFK41258.1|  hypothetical protein AALP_AA2G106200                    292   6e-92    
emb|CAN73470.1|  hypothetical protein VITISV_000274                     293   2e-91    Vitis vinifera
ref|XP_010099238.1|  Adenylate isopentenyltransferase                   296   3e-91    
gb|EPS73689.1|  adenylate isopentenyltransferase                        290   4e-91    
gb|AES62904.2|  adenylate isopentenyltransferase                        291   6e-91    
gb|KDP29418.1|  hypothetical protein JCGZ_18339                         291   9e-91    
ref|XP_003592653.1|  Adenylate isopentenyltransferase                   291   1e-90    
ref|XP_002526982.1|  adenylate dimethylallyltransferase, putative       289   2e-90    Ricinus communis
gb|ABD93932.1|  adenylate isopentenyltransferase                        286   3e-89    Lotus japonicus
ref|XP_006391138.1|  hypothetical protein EUTSA_v10019632mg             287   3e-89    
sp|Q5GHF7.1|IPT_HUMLU  RecName: Full=Adenylate isopentenyltransfe...    285   5e-89    Humulus lupulus [common hop]
pdb|3A8T|A  Chain A, Plant Adenylate Isopentenyltransferase In Co...    285   1e-88    
ref|XP_002311463.1|  hypothetical protein POPTR_0008s12060g             286   1e-88    Populus trichocarpa [western balsam poplar]
emb|CDX95461.1|  BnaC01g33530D                                          284   2e-88    
ref|XP_004300976.1|  PREDICTED: adenylate isopentenyltransferase-...    285   2e-88    
ref|XP_007142919.1|  hypothetical protein PHAVU_007G028100g             285   3e-88    
ref|XP_010265118.1|  PREDICTED: adenylate isopentenyltransferase-...    283   8e-88    
emb|CDY07385.1|  BnaA07g24640D                                          282   9e-88    
emb|CDY04228.1|  BnaC06g25870D                                          282   1e-87    
dbj|BAE43826.1|  isopentenyltransferase                                 282   2e-87    Brassica rapa subsp. pekinensis [bai cai]
ref|XP_010470796.1|  PREDICTED: adenylate isopentenyltransferase ...    283   2e-87    
ref|XP_003536680.2|  PREDICTED: adenylate isopentenyltransferase-...    281   2e-87    
emb|CDY44896.1|  BnaA02g13860D                                          281   3e-87    
ref|XP_009105044.1|  PREDICTED: adenylate isopentenyltransferase ...    281   3e-87    
ref|XP_009127634.1|  PREDICTED: adenylate isopentenyltransferase ...    282   3e-87    
ref|XP_006448462.1|  hypothetical protein CICLE_v10015747mg             282   4e-87    
ref|XP_002888665.1|  cytokinin synthase                                 281   4e-87    
ref|XP_010264047.1|  PREDICTED: adenylate isopentenyltransferase-...    281   5e-87    
ref|XP_009112114.1|  PREDICTED: adenylate isopentenyltransferase ...    280   1e-86    
dbj|BAB59029.1|  cytokinin synthase                                     280   1e-86    Arabidopsis thaliana [mouse-ear cress]
emb|CDX81518.1|  BnaC02g18220D                                          280   2e-86    
ref|XP_009356860.1|  PREDICTED: adenylate isopentenyltransferase-...    281   2e-86    
ref|NP_001288044.1|  adenylate isopentenyltransferase-like              279   5e-86    
ref|XP_011022236.1|  PREDICTED: adenylate isopentenyltransferase        279   7e-86    
ref|XP_009356257.1|  PREDICTED: adenylate isopentenyltransferase-...    278   1e-85    
gb|ADY80561.1|  adenylate isopentenyltransferase                        278   2e-85    
ref|NP_177013.1|  adenylate isopentenyltransferase 1                    277   2e-85    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007044313.1|  Cytokinin biosynthetic isopentenyltransferas...    279   2e-85    
ref|XP_006469085.1|  PREDICTED: adenylate isopentenyltransferase-...    275   6e-85    
ref|XP_006406531.1|  hypothetical protein EUTSA_v10022249mg             275   7e-85    
ref|XP_008243241.1|  PREDICTED: adenylate isopentenyltransferase-...    276   8e-85    
ref|XP_011007793.1|  PREDICTED: adenylate isopentenyltransferase        276   9e-85    
ref|XP_006301434.1|  hypothetical protein CARUB_v10021852mg             275   1e-84    
ref|XP_004295673.1|  PREDICTED: adenylate isopentenyltransferase-...    273   2e-84    
ref|XP_007227090.1|  hypothetical protein PRUPE_ppa025556mg             273   3e-84    
ref|XP_008389284.1|  PREDICTED: adenylate isopentenyltransferase-...    273   1e-83    
ref|XP_010511839.1|  PREDICTED: adenylate isopentenyltransferase ...    271   2e-83    
ref|XP_010681483.1|  PREDICTED: adenylate isopentenyltransferase-...    272   3e-83    
ref|XP_010511841.1|  PREDICTED: adenylate isopentenyltransferase ...    271   7e-83    
ref|XP_010511840.1|  PREDICTED: adenylate isopentenyltransferase ...    271   1e-82    
ref|XP_004150914.1|  PREDICTED: adenylate isopentenyltransferase-...    268   3e-82    
gb|KCW81312.1|  hypothetical protein EUGRSUZ_C02687                     268   3e-82    
ref|XP_008445640.1|  PREDICTED: adenylate isopentenyltransferase-...    267   8e-82    
ref|XP_004174133.1|  PREDICTED: adenylate isopentenyltransferase-...    266   2e-81    
ref|XP_010415465.1|  PREDICTED: adenylate isopentenyltransferase ...    265   1e-80    
ref|XP_010051129.1|  PREDICTED: adenylate isopentenyltransferase-...    263   2e-80    
ref|XP_010051139.1|  PREDICTED: uncharacterized protein LOC104439822    270   1e-79    
ref|XP_010489934.1|  PREDICTED: adenylate isopentenyltransferase ...    259   6e-79    
ref|XP_004135400.1|  PREDICTED: adenylate isopentenyltransferase-...    258   6e-79    
ref|XP_004164161.1|  PREDICTED: LOW QUALITY PROTEIN: adenylate is...    258   1e-78    
ref|XP_010419888.1|  PREDICTED: adenylate isopentenyltransferase ...    259   1e-78    
gb|KGN52088.1|  hypothetical protein Csa_5G609740                       259   1e-78    
gb|KFK39236.1|  hypothetical protein AALP_AA3G218100                    257   2e-78    
ref|XP_002885297.1|  ATIPT8                                             258   3e-78    
ref|XP_010468282.1|  PREDICTED: adenylate isopentenyltransferase ...    257   4e-78    
ref|XP_010667107.1|  PREDICTED: adenylate isopentenyltransferase ...    255   1e-77    
gb|KCW81303.1|  hypothetical protein EUGRSUZ_C02671                     255   2e-77    
emb|CDY22984.1|  BnaC03g40850D                                          254   5e-77    
ref|XP_010051132.1|  PREDICTED: adenylate isopentenyltransferase-...    253   9e-77    
ref|XP_009782718.1|  PREDICTED: adenylate isopentenyltransferase ...    252   3e-76    
ref|XP_010554960.1|  PREDICTED: adenylate isopentenyltransferase ...    253   8e-76    
ref|NP_188547.1|  adenylate isopentenyltransferase 8                    250   2e-75    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009627634.1|  PREDICTED: adenylate isopentenyltransferase ...    249   4e-75    
emb|CDX82308.1|  BnaA03g35130D                                          247   4e-74    
gb|EYU46608.1|  hypothetical protein MIMGU_mgv1a026307mg                247   4e-74    
gb|KDO76979.1|  hypothetical protein CISIN_1g019312mg                   247   6e-74    
ref|XP_006415869.1|  hypothetical protein EUTSA_v10009876mg             246   9e-74    
ref|XP_009135619.1|  PREDICTED: adenylate isopentenyltransferase ...    243   9e-73    
ref|XP_009778781.1|  PREDICTED: adenylate isopentenyltransferase ...    243   1e-72    
ref|XP_008235248.1|  PREDICTED: adenylate isopentenyltransferase ...    241   5e-72    
ref|NP_173912.1|  adenylate isopentenyltransferase 6                    242   5e-72    Arabidopsis thaliana [mouse-ear cress]
ref|NP_197405.1|  isopentenyltransferase 5                              241   5e-72    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010090377.1|  Adenylate isopentenyltransferase 3                 241   8e-72    
gb|KCW81313.1|  hypothetical protein EUGRSUZ_C02688                     240   1e-71    
ref|XP_007200740.1|  hypothetical protein PRUPE_ppa023171mg             240   1e-71    
ref|XP_006842304.1|  hypothetical protein AMTR_s00079p00118940          241   3e-71    
dbj|BAB59032.1|  cytokinin synthase                                     239   3e-71    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006305994.1|  hypothetical protein CARUB_v10011273mg             239   8e-71    
ref|XP_009365803.1|  PREDICTED: adenylate isopentenyltransferase ...    238   1e-70    
ref|XP_009342172.1|  PREDICTED: adenylate isopentenyltransferase ...    238   1e-70    
ref|XP_002873926.1|  cytokinin synthase                                 237   2e-70    
ref|XP_002869707.1|  ATIPT4                                             237   3e-70    
ref|XP_006288171.1|  hypothetical protein CARUB_v10001408mg             237   3e-70    
ref|XP_010492943.1|  PREDICTED: adenylate isopentenyltransferase ...    236   5e-70    
ref|XP_010420690.1|  PREDICTED: adenylate isopentenyltransferase ...    236   6e-70    
ref|XP_010551259.1|  PREDICTED: LOW QUALITY PROTEIN: adenylate is...    237   6e-70    
ref|XP_008340912.1|  PREDICTED: LOW QUALITY PROTEIN: adenylate is...    236   6e-70    
ref|NP_194196.1|  adenylate isopentenyltransferase 4                    235   8e-70    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009406689.1|  PREDICTED: adenylate isopentenyltransferase-...    237   2e-69    
ref|XP_010454167.1|  PREDICTED: adenylate isopentenyltransferase ...    234   2e-69    
ref|NP_001281297.1|  adenylate isopentenyltransferase 5, chloropl...    234   3e-69    
gb|KCW81302.1|  hypothetical protein EUGRSUZ_C02668                     233   3e-69    
gb|ADY80560.1|  adenylate isopentenyltransferase                        234   3e-69    
ref|XP_002271962.1|  PREDICTED: adenylate isopentenyltransferase ...    234   4e-69    Vitis vinifera
gb|ADT82707.1|  adenylate isopentenyltransferase                        233   5e-69    
ref|XP_010927008.1|  PREDICTED: adenylate isopentenyltransferase-...    234   5e-69    
ref|XP_008368862.1|  PREDICTED: adenylate isopentenyltransferase ...    233   6e-69    
ref|XP_010477931.1|  PREDICTED: adenylate isopentenyltransferase ...    235   7e-69    
gb|ADY80558.1|  adenylate isopentenyltransferase                        233   9e-69    
gb|KCW81314.1|  hypothetical protein EUGRSUZ_C02690                     232   1e-68    
ref|XP_007034593.1|  Isopentenyltransferase 5, putative                 233   1e-68    
ref|XP_003553453.2|  PREDICTED: adenylate isopentenyltransferase ...    232   1e-68    
gb|KHN45368.1|  Adenylate isopentenyltransferase 3, chloroplastic       232   1e-68    
gb|KDP40100.1|  hypothetical protein JCGZ_02098                         233   1e-68    
gb|EPS59563.1|  hypothetical protein M569_15242                         230   1e-68    
ref|XP_011079824.1|  PREDICTED: adenylate isopentenyltransferase ...    232   1e-68    
ref|XP_006300023.1|  hypothetical protein CARUB_v10016248mg             234   2e-68    
ref|XP_006400459.1|  hypothetical protein EUTSA_v10015859mg             233   2e-68    
ref|XP_010551669.1|  PREDICTED: adenylate isopentenyltransferase ...    233   2e-68    
ref|XP_010051134.1|  PREDICTED: adenylate isopentenyltransferase-...    231   3e-68    
gb|ABG82043.1|  isopentenyltransferase                                  231   5e-68    Malus hupehensis
dbj|BAE43829.1|  isopentenyltransferase                                 231   5e-68    Brassica rapa subsp. pekinensis [bai cai]
ref|XP_003520560.2|  PREDICTED: adenylate isopentenyltransferase ...    230   7e-68    
ref|XP_007162406.1|  hypothetical protein PHAVU_001G149400g             229   1e-67    
ref|XP_007226947.1|  hypothetical protein PRUPE_ppa025177mg             231   1e-67    
ref|XP_009102596.1|  PREDICTED: adenylate isopentenyltransferase ...    230   1e-67    
emb|CDX85119.1|  BnaC07g07870D                                          230   1e-67    
emb|CAN64248.1|  hypothetical protein VITISV_032976                     229   1e-67    Vitis vinifera
ref|XP_009603455.1|  PREDICTED: adenylate isopentenyltransferase ...    230   1e-67    
ref|XP_009126292.1|  PREDICTED: adenylate isopentenyltransferase ...    230   2e-67    
emb|CDY13945.1|  BnaC09g38810D                                          230   2e-67    
ref|XP_010551776.1|  PREDICTED: adenylate isopentenyltransferase ...    230   2e-67    
emb|CDY47191.1|  BnaAnng08610D                                          230   2e-67    
ref|XP_006444118.1|  hypothetical protein CICLE_v10021361mg             228   2e-67    
ref|XP_010545085.1|  PREDICTED: adenylate isopentenyltransferase ...    229   3e-67    
ref|XP_006479751.1|  PREDICTED: adenylate isopentenyltransferase ...    229   3e-67    
ref|XP_008223011.1|  PREDICTED: LOW QUALITY PROTEIN: adenylate is...    229   3e-67    
ref|XP_009120925.1|  PREDICTED: adenylate isopentenyltransferase ...    229   4e-67    
ref|XP_006406003.1|  hypothetical protein EUTSA_v10022241mg             228   6e-67    
ref|XP_004495223.1|  PREDICTED: adenylate isopentenyltransferase ...    228   6e-67    
ref|XP_009356755.1|  PREDICTED: adenylate isopentenyltransferase ...    228   6e-67    
emb|CDY02590.1|  BnaC02g08450D                                          228   7e-67    
ref|XP_009394636.1|  PREDICTED: adenylate isopentenyltransferase        228   9e-67    
ref|XP_010653719.1|  PREDICTED: adenylate isopentenyltransferase ...    225   1e-66    
gb|AEQ30076.1|  adenylate isopentenyltransferase                        226   2e-66    
ref|XP_011082638.1|  PREDICTED: adenylate isopentenyltransferase ...    227   2e-66    
ref|XP_007050663.1|  Isopentenyltransferase 3, putative                 227   2e-66    
ref|XP_006355868.1|  PREDICTED: adenylate isopentenyltransferase ...    227   2e-66    
ref|XP_006285561.1|  hypothetical protein CARUB_v10007003mg             226   3e-66    
ref|XP_002321061.2|  hypothetical protein POPTR_0014s13540g             226   3e-66    Populus trichocarpa [western balsam poplar]
ref|XP_011033688.1|  PREDICTED: adenylate isopentenyltransferase ...    226   3e-66    
ref|NP_001244915.1|  adenylate isopentenyltransferase                   226   3e-66    
emb|CDX92563.1|  BnaA10g16020D                                          226   3e-66    
dbj|BAG55006.1|  adenylate isopentenyltransferase                       226   3e-66    Ipomoea nil [qian niu]
dbj|BAK64271.1|  isopentenyltransferase                                 223   4e-66    
ref|XP_006413406.1|  hypothetical protein EUTSA_v10026816mg             226   4e-66    
gb|AFI49626.1|  isopentenyl transferases protein                        226   5e-66    
dbj|BAB59033.1|  cytokinin synthase                                     226   6e-66    Arabidopsis thaliana [mouse-ear cress]
ref|NP_566735.1|  adenylate isopentenyltransferase 7                    226   6e-66    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004136062.1|  PREDICTED: adenylate isopentenyltransferase ...    226   7e-66    
ref|XP_006850780.1|  hypothetical protein AMTR_s00025p00094380          225   1e-65    
ref|XP_010051135.1|  PREDICTED: adenylate isopentenyltransferase-...    224   1e-65    
ref|XP_006293019.1|  hypothetical protein CARUB_v10019297mg             225   1e-65    
ref|XP_006419806.1|  hypothetical protein CICLE_v10005414mg             225   1e-65    
gb|KDO74822.1|  hypothetical protein CISIN_1g020362mg                   224   2e-65    
ref|XP_002883441.1|  cytokinin synthase                                 224   2e-65    
ref|XP_004148309.1|  PREDICTED: adenylate isopentenyltransferase ...    225   2e-65    
ref|XP_008447303.1|  PREDICTED: adenylate isopentenyltransferase ...    224   3e-65    
emb|CDY67797.1|  BnaCnng56440D                                          224   4e-65    
ref|XP_008451382.1|  PREDICTED: adenylate isopentenyltransferase ...    223   5e-65    
gb|KCW49921.1|  hypothetical protein EUGRSUZ_K03385                     224   6e-65    
ref|XP_002878496.1|  ATIPT3                                             223   7e-65    
ref|XP_011009688.1|  PREDICTED: adenylate isopentenyltransferase ...    223   7e-65    
ref|XP_010548779.1|  PREDICTED: adenylate isopentenyltransferase ...    223   9e-65    
ref|XP_002312745.1|  hypothetical protein POPTR_0008s20650g             223   1e-64    Populus trichocarpa [western balsam poplar]
gb|KFK35473.1|  hypothetical protein AALP_AA5G288800                    223   1e-64    
ref|XP_003590677.1|  Adenylate isopentenyltransferase                   222   1e-64    
ref|XP_011071664.1|  PREDICTED: adenylate isopentenyltransferase ...    222   2e-64    
ref|XP_009116977.1|  PREDICTED: adenylate isopentenyltransferase ...    222   2e-64    
ref|NP_001288042.1|  uncharacterized protein LOC103449027               221   2e-64    
emb|CBI26180.3|  unnamed protein product                                221   3e-64    
emb|CDX93935.1|  BnaC04g20940D                                          221   3e-64    
ref|XP_002277591.1|  PREDICTED: adenylate isopentenyltransferase ...    221   3e-64    Vitis vinifera
gb|ABD93934.1|  adenylate isopentenyltransferase                        221   4e-64    Lotus japonicus
ref|XP_002314413.1|  hypothetical protein POPTR_0010s03150g             221   4e-64    Populus trichocarpa [western balsam poplar]
ref|NP_567138.1|  adenylate isopentenyltransferase 3                    221   5e-64    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010684312.1|  PREDICTED: adenylate isopentenyltransferase ...    221   5e-64    
emb|CAB87756.1|  tRNA isopentenyl transferase-like protein              221   5e-64    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011012333.1|  PREDICTED: adenylate isopentenyltransferase ...    220   6e-64    
ref|XP_010103429.1|  Adenylate isopentenyltransferase 5                 221   6e-64    
ref|XP_011102015.1|  PREDICTED: adenylate isopentenyltransferase ...    219   6e-64    
ref|XP_002533064.1|  ATP binding protein, putative                      220   7e-64    Ricinus communis
ref|XP_010039257.1|  PREDICTED: adenylate isopentenyltransferase ...    224   7e-64    
ref|XP_010468886.1|  PREDICTED: adenylate isopentenyltransferase ...    220   8e-64    
gb|AAM65536.1|  cytokinin synthase                                      220   9e-64    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010051140.1|  PREDICTED: uncharacterized protein LOC104439824    227   1e-63    
emb|CAN64738.1|  hypothetical protein VITISV_007444                     221   1e-63    Vitis vinifera
ref|XP_010512718.1|  PREDICTED: adenylate isopentenyltransferase ...    220   1e-63    
ref|XP_008797668.1|  PREDICTED: adenylate isopentenyltransferase-...    220   2e-63    
ref|XP_010413197.1|  PREDICTED: adenylate isopentenyltransferase ...    219   2e-63    
ref|XP_011102016.1|  PREDICTED: adenylate isopentenyltransferase ...    219   2e-63    
emb|CDO98989.1|  unnamed protein product                                219   2e-63    
ref|XP_010512717.1|  PREDICTED: adenylate isopentenyltransferase ...    219   2e-63    
gb|EPS74194.1|  hypothetical protein M569_00558                         218   3e-63    
ref|XP_003550509.1|  PREDICTED: adenylate isopentenyltransferase ...    219   4e-63    
ref|XP_003528670.1|  PREDICTED: adenylate isopentenyltransferase ...    218   4e-63    
ref|XP_007144614.1|  hypothetical protein PHAVU_007G170100g             218   6e-63    
gb|AIN44214.1|  IPT3                                                    218   7e-63    
ref|XP_008229695.1|  PREDICTED: adenylate isopentenyltransferase ...    216   7e-63    
ref|XP_010532708.1|  PREDICTED: LOW QUALITY PROTEIN: adenylate is...    217   8e-63    
ref|XP_009413572.1|  PREDICTED: adenylate isopentenyltransferase-...    219   8e-63    
ref|XP_010278446.1|  PREDICTED: adenylate isopentenyltransferase ...    218   8e-63    
ref|XP_010693920.1|  PREDICTED: adenylate isopentenyltransferase ...    217   1e-62    
gb|ABD93933.1|  adenylate isopentenyltransferase                        218   1e-62    Lotus japonicus
ref|XP_009138635.1|  PREDICTED: adenylate isopentenyltransferase ...    217   1e-62    
ref|XP_010524014.1|  PREDICTED: adenylate isopentenyltransferase ...    217   1e-62    
ref|XP_004296948.1|  PREDICTED: adenylate isopentenyltransferase ...    217   2e-62    
ref|XP_002517150.1|  ATP binding protein, putative                      216   2e-62    Ricinus communis
ref|XP_004296947.1|  PREDICTED: adenylate isopentenyltransferase ...    217   5e-62    
ref|XP_004290672.1|  PREDICTED: adenylate isopentenyltransferase ...    215   6e-62    
ref|XP_006298111.1|  hypothetical protein CARUB_v10014152mg             215   7e-62    
ref|XP_004150320.1|  PREDICTED: adenylate isopentenyltransferase ...    215   8e-62    
ref|XP_008458554.1|  PREDICTED: adenylate isopentenyltransferase ...    215   9e-62    
ref|XP_008438727.1|  PREDICTED: adenylate isopentenyltransferase ...    214   1e-61    
gb|EYU45613.1|  hypothetical protein MIMGU_mgv1a022025mg                213   2e-61    
ref|XP_010488441.1|  PREDICTED: adenylate isopentenyltransferase ...    213   3e-61    
ref|XP_007210848.1|  hypothetical protein PRUPE_ppa015780mg             211   9e-61    
gb|KHN03782.1|  Adenylate isopentenyltransferase 3, chloroplastic       211   1e-60    
gb|KHN37566.1|  Adenylate isopentenyltransferase 5, chloroplastic       211   1e-60    
ref|XP_010096214.1|  Adenylate isopentenyltransferase 3                 211   2e-60    
gb|KEH26138.1|  adenylate isopentenyltransferase                        211   2e-60    
ref|XP_008803560.1|  PREDICTED: adenylate isopentenyltransferase-...    211   3e-60    
ref|XP_003536902.1|  PREDICTED: adenylate isopentenyltransferase ...    211   3e-60    
ref|XP_010512656.1|  PREDICTED: adenylate isopentenyltransferase ...    210   5e-60    
ref|XP_002268848.3|  PREDICTED: adenylate isopentenyltransferase ...    209   5e-60    Vitis vinifera
ref|XP_010932022.1|  PREDICTED: uncharacterized protein LOC105052792    216   7e-60    
ref|XP_007147775.1|  hypothetical protein PHAVU_006G154200g             210   7e-60    
ref|XP_011078654.1|  PREDICTED: adenylate isopentenyltransferase ...    208   7e-60    
ref|XP_006402308.1|  hypothetical protein EUTSA_v10006499mg             210   9e-60    
ref|XP_004134460.1|  PREDICTED: adenylate isopentenyltransferase ...    209   9e-60    
ref|XP_010466712.1|  PREDICTED: adenylate isopentenyltransferase ...    209   1e-59    
ref|XP_011092012.1|  PREDICTED: adenylate isopentenyltransferase ...    208   1e-59    
ref|XP_002457830.1|  hypothetical protein SORBIDRAFT_03g014490          210   2e-59    Sorghum bicolor [broomcorn]
ref|XP_004172767.1|  PREDICTED: LOW QUALITY PROTEIN: adenylate is...    208   2e-59    
ref|XP_002315938.1|  hypothetical protein POPTR_0010s13370g             206   2e-59    Populus trichocarpa [western balsam poplar]
gb|KDO51454.1|  hypothetical protein CISIN_1g044048mg                   206   3e-59    
ref|XP_011102039.1|  PREDICTED: adenylate isopentenyltransferase ...    207   3e-59    
gb|KHN18893.1|  Adenylate isopentenyltransferase 3, chloroplastic       207   3e-59    
ref|XP_003518930.1|  PREDICTED: adenylate isopentenyltransferase ...    207   4e-59    
ref|XP_011102013.1|  PREDICTED: adenylate isopentenyltransferase ...    207   5e-59    
gb|ABD93935.1|  adenylate isopentenyltransferase                        207   1e-58    Lotus japonicus
dbj|BAG55007.1|  adenylate isopentenyltransferase                       206   2e-58    Ipomoea nil [qian niu]
gb|EEC81655.1|  hypothetical protein OsI_25198                          204   3e-58    Oryza sativa Indica Group [Indian rice]
gb|KEH32922.1|  adenylate isopentenyltransferase                        204   3e-58    
dbj|BAE47449.1|  adenylate isopentenyltransferase                       204   3e-58    Oryza sativa Indica Group [Indian rice]
ref|XP_009418842.1|  PREDICTED: adenylate isopentenyltransferase-...    205   3e-58    
ref|XP_007045376.1|  TRNA delta(2)-isopentenylpyrophosphate trans...    205   3e-58    
ref|XP_009385519.1|  PREDICTED: adenylate isopentenyltransferase ...    205   4e-58    
gb|AAY29691.1|  putative cytokinin synthase 2                           201   4e-58    
gb|ACX55059.1|  isopentenyltransferase                                  202   4e-58    
dbj|BAE75937.1|  adenylate isopentenyltransferase                       205   5e-58    
ref|XP_007154132.1|  hypothetical protein PHAVU_003G093100g             205   5e-58    
ref|XP_006423200.1|  hypothetical protein CICLE_v10029953mg             204   6e-58    
ref|XP_004508369.1|  PREDICTED: adenylate isopentenyltransferase ...    204   6e-58    
ref|XP_010517205.1|  PREDICTED: adenylate isopentenyltransferase ...    203   7e-58    
ref|XP_009396727.1|  PREDICTED: adenylate isopentenyltransferase-...    204   9e-58    
ref|XP_006487203.1|  PREDICTED: adenylate isopentenyltransferase ...    204   9e-58    
ref|XP_007045420.1|  TRNA delta(2)-isopentenylpyrophosphate trans...    204   1e-57    
ref|XP_006653174.1|  PREDICTED: adenylate isopentenyltransferase ...    204   1e-57    
ref|XP_004972102.1|  PREDICTED: adenylate isopentenyltransferase-...    204   1e-57    
ref|XP_007045377.1|  TRNA delta(2)-isopentenylpyrophosphate trans...    203   2e-57    
ref|XP_004251342.1|  PREDICTED: adenylate isopentenyltransferase ...    202   2e-57    
ref|XP_003598773.1|  Isopentenyltransferase                             202   2e-57    
ref|XP_004486153.1|  PREDICTED: adenylate isopentenyltransferase ...    203   2e-57    
ref|XP_010068121.1|  PREDICTED: adenylate isopentenyltransferase ...    202   3e-57    
ref|XP_003598726.1|  Isopentenyltransferase                             202   3e-57    
ref|XP_006339408.1|  PREDICTED: adenylate isopentenyltransferase ...    203   3e-57    
ref|XP_008675872.1|  PREDICTED: adenylate isopentenyltransferase ...    204   3e-57    
ref|XP_010460385.1|  PREDICTED: adenylate isopentenyltransferase ...    202   5e-57    
gb|ADY80563.1|  adenylate isopentenyltransferase                        201   5e-57    
ref|XP_008786948.1|  PREDICTED: adenylate isopentenyltransferase ...    203   5e-57    
ref|XP_008373615.1|  PREDICTED: adenylate isopentenyltransferase ...    201   6e-57    
ref|XP_002459547.1|  hypothetical protein SORBIDRAFT_02g006400          202   8e-57    
gb|KEH36761.1|  adenylate isopentenyltransferase                        202   9e-57    
ref|XP_009618569.1|  PREDICTED: adenylate isopentenyltransferase ...    201   1e-56    
ref|XP_010024423.1|  PREDICTED: adenylate isopentenyltransferase ...    202   1e-56    
ref|XP_004250601.1|  PREDICTED: adenylate isopentenyltransferase ...    200   1e-56    
gb|KHN17317.1|  Adenylate isopentenyltransferase 5, chloroplastic       200   1e-56    
gb|KEH32204.1|  adenylate isopentenyltransferase                        202   1e-56    
ref|XP_002519099.1|  ATP binding protein, putative                      200   1e-56    
ref|XP_003598733.1|  Isopentenyltransferase                             200   1e-56    
ref|XP_009804222.1|  PREDICTED: adenylate isopentenyltransferase ...    201   2e-56    
ref|XP_003551849.2|  PREDICTED: adenylate isopentenyltransferase ...    201   2e-56    
gb|ADG96011.1|  isopentenyltransferase                                  201   2e-56    
gb|KEH21991.1|  adenylate isopentenyltransferase                        199   3e-56    
emb|CDM82045.1|  unnamed protein product                                201   3e-56    
gb|KHN33068.1|  Adenylate isopentenyltransferase 5, chloroplastic       201   3e-56    
ref|XP_011037608.1|  PREDICTED: adenylate isopentenyltransferase ...    201   3e-56    
dbj|BAE75936.1|  adenylate isopentenyltransferase                       200   3e-56    
ref|XP_002456169.1|  hypothetical protein SORBIDRAFT_03g031570          201   4e-56    
gb|KCW62877.1|  hypothetical protein EUGRSUZ_G00473                     197   4e-56    
gb|KDP46221.1|  hypothetical protein JCGZ_10061                         199   5e-56    
ref|XP_008671619.1|  PREDICTED: adenylate isopentenyltransferase ...    200   5e-56    
gb|AES68975.2|  adenylate isopentenyltransferase                        199   5e-56    
ref|XP_002306084.1|  hypothetical protein POPTR_0004s15810g             199   7e-56    
ref|XP_003598771.1|  tRNA dimethylallyltransferase                      198   7e-56    
ref|XP_010313572.1|  PREDICTED: adenylate isopentenyltransferase ...    198   8e-56    
ref|XP_009387145.1|  PREDICTED: adenylate isopentenyltransferase ...    201   9e-56    
ref|XP_011031808.1|  PREDICTED: adenylate isopentenyltransferase ...    199   9e-56    
ref|XP_011102233.1|  PREDICTED: adenylate isopentenyltransferase ...    198   1e-55    
ref|XP_010512976.1|  PREDICTED: adenylate isopentenyltransferase ...    197   1e-55    
ref|XP_008373754.1|  PREDICTED: adenylate isopentenyltransferase ...    197   1e-55    
ref|XP_003621856.1|  Adenylate isopentenyltransferase                   197   2e-55    
gb|EEC81657.1|  hypothetical protein OsI_25201                          196   2e-55    
ref|XP_008804944.1|  PREDICTED: adenylate isopentenyltransferase ...    199   2e-55    
ref|XP_008791009.1|  PREDICTED: adenylate isopentenyltransferase ...    197   2e-55    
ref|XP_008675172.1|  PREDICTED: adenylate isopentenyltransferase-...    199   2e-55    
ref|XP_003598724.1|  Isopentenyltransferase                             198   2e-55    
ref|XP_010255880.1|  PREDICTED: adenylate isopentenyltransferase ...    198   2e-55    
tpg|DAA58061.1|  TPA: hypothetical protein ZEAMMB73_324127              198   3e-55    
ref|XP_007139147.1|  hypothetical protein PHAVU_008G005300g             196   4e-55    
ref|NP_001237359.1|  isopentenyl transferase                            197   4e-55    
ref|XP_008780079.1|  PREDICTED: adenylate isopentenyltransferase ...    196   6e-55    
gb|KHN17318.1|  Adenylate isopentenyltransferase 5, chloroplastic       197   6e-55    
gb|AEV76969.1|  isopentenyltransferase 8                                196   8e-55    
ref|NP_001056250.2|  Os05g0551700                                       197   8e-55    
gb|AAT85187.1|  unknown protein                                         198   8e-55    
ref|XP_011091051.1|  PREDICTED: LOW QUALITY PROTEIN: adenylate is...    195   1e-54    
ref|XP_003598728.1|  Adenylate isopentenyltransferase                   194   2e-54    
ref|XP_010313571.1|  PREDICTED: adenylate isopentenyltransferase ...    194   2e-54    
ref|XP_004987245.1|  PREDICTED: adenylate isopentenyltransferase ...    196   2e-54    
gb|KDP21488.1|  hypothetical protein JCGZ_21959                         192   3e-54    
gb|KCW84294.1|  hypothetical protein EUGRSUZ_B01146                     193   5e-54    
ref|XP_003596250.1|  Adenylate isopentenyltransferase                   194   5e-54    
ref|XP_011102014.1|  PREDICTED: adenylate isopentenyltransferase ...    191   5e-54    
ref|XP_004980438.1|  PREDICTED: adenylate isopentenyltransferase-...    192   8e-54    
ref|XP_002440201.1|  hypothetical protein SORBIDRAFT_09g027683          193   8e-54    
ref|XP_010942491.1|  PREDICTED: adenylate isopentenyltransferase ...    193   9e-54    
ref|XP_010035694.1|  PREDICTED: adenylate isopentenyltransferase ...    193   1e-53    
ref|XP_010313569.1|  PREDICTED: LOW QUALITY PROTEIN: adenylate is...    192   2e-53    
ref|XP_010035684.1|  PREDICTED: adenylate isopentenyltransferase ...    193   2e-53    
ref|XP_010938767.1|  PREDICTED: adenylate isopentenyltransferase ...    192   2e-53    
gb|AFW83607.1|  hypothetical protein ZEAMMB73_928267                    193   2e-53    
ref|XP_008656764.1|  PREDICTED: adenylate isopentenyltransferase-...    194   2e-53    
ref|XP_004961311.1|  PREDICTED: adenylate isopentenyltransferase ...    194   3e-53    
ref|XP_009371878.1|  PREDICTED: adenylate isopentenyltransferase ...    191   4e-53    
ref|XP_003565950.1|  PREDICTED: adenylate isopentenyltransferase-...    192   4e-53    
ref|NP_001121195.1|  isopentenyl transferase IPT4                       192   6e-53    
ref|XP_009396609.1|  PREDICTED: adenylate isopentenyltransferase-...    192   9e-53    
ref|XP_011101071.1|  PREDICTED: adenylate isopentenyltransferase ...    190   9e-53    
ref|XP_003565777.1|  PREDICTED: adenylate isopentenyltransferase ...    191   1e-52    
ref|NP_001266270.1|  adenylate isopentenyltransferase 5, chloropl...    190   2e-52    
ref|XP_003561295.1|  PREDICTED: adenylate isopentenyltransferase ...    191   2e-52    
gb|ABY78885.1|  isopentenyl transferase IPT6                            190   3e-52    
ref|XP_008665655.1|  PREDICTED: adenylate isopentenyltransferase ...    190   3e-52    
ref|XP_010507619.1|  PREDICTED: adenylate isopentenyltransferase ...    188   4e-52    
dbj|BAE47446.1|  adenylate isopentenyltransferase                       189   4e-52    
gb|EYU43837.1|  hypothetical protein MIMGU_mgv1a020459mg                188   8e-52    
dbj|BAC84458.1|  putative cytokinin synthase                            187   3e-51    
ref|XP_004245333.1|  PREDICTED: adenylate isopentenyltransferase ...    185   4e-51    
ref|NP_001121194.1|  isopentenyl transferase IPT5                       186   1e-50    
gb|KEH21511.1|  adenylate isopentenyltransferase                        185   1e-50    
ref|XP_002519092.1|  tRNA delta(2)-isopentenylpyrophosphate trans...    186   1e-50    
ref|XP_003598720.1|  tRNA dimethylallyltransferase                      184   1e-50    
ref|XP_004955804.1|  PREDICTED: adenylate isopentenyltransferase ...    185   2e-50    
ref|XP_004954904.1|  PREDICTED: adenylate isopentenyltransferase-...    187   2e-50    
ref|XP_008649973.1|  PREDICTED: adenylate isopentenyltransferase-...    186   3e-50    
ref|XP_009400154.1|  PREDICTED: adenylate isopentenyltransferase ...    184   3e-50    
ref|XP_010940379.1|  PREDICTED: tRNA dimethylallyltransferase 2 i...    187   3e-50    
gb|EAY92293.1|  hypothetical protein OsI_14013                          184   5e-50    
gb|AAY29690.1|  putative cytokinin synthase 1                           181   6e-50    
gb|AES68971.2|  cytokinin biosynthetic isopentenyltransferase           182   6e-50    
ref|XP_002311062.2|  hypothetical protein POPTR_0008s033302g            181   8e-50    
gb|AEV76967.1|  isopentenyltransferase 3                                180   1e-49    
dbj|BAE47451.1|  adenylate isopentenyltransferase                       183   1e-49    
gb|EEE64610.1|  hypothetical protein OsJ_19462                          186   1e-49    
dbj|BAD82547.1|  cytokinin synthase-like                                183   2e-49    
dbj|BAN84023.1|  isopentenyltransferase 8                               184   2e-49    
ref|NP_001051662.1|  Os03g0810100                                       183   2e-49    
gb|KHN03044.1|  Adenylate isopentenyltransferase 5, chloroplastic       182   2e-49    
ref|XP_002466230.1|  hypothetical protein SORBIDRAFT_01g003950          182   4e-49    
ref|XP_004981325.1|  PREDICTED: adenylate isopentenyltransferase ...    181   8e-49    
ref|XP_009392057.1|  PREDICTED: adenylate isopentenyltransferase ...    182   1e-48    
gb|KHN24939.1|  Adenylate isopentenyltransferase 5, chloroplastic       179   2e-48    
ref|XP_010313578.1|  PREDICTED: uncharacterized protein LOC101253660    185   2e-48    
gb|AEV76968.1|  isopentenyltransferase 7                                176   2e-48    
ref|XP_010232162.1|  PREDICTED: adenylate isopentenyltransferase-...    178   8e-48    
ref|XP_010907505.1|  PREDICTED: adenylate isopentenyltransferase ...    176   2e-47    
ref|XP_003559269.1|  PREDICTED: adenylate isopentenyltransferase ...    175   2e-46    
ref|XP_008807489.1|  PREDICTED: tRNA dimethylallyltransferase 2 i...    176   2e-46    
gb|ADD60672.1|  putative adenylate isopentyneyl transferase protein     172   3e-46    
dbj|BAK06572.1|  predicted protein                                      174   5e-46    
ref|XP_010260619.1|  PREDICTED: tRNA dimethylallyltransferase 2 i...    174   7e-46    
gb|AEV76966.1|  isopentenyltransferase 2                                170   2e-45    
ref|XP_011101075.1|  PREDICTED: adenylate isopentenyltransferase ...    168   9e-45    
gb|ABR67048.1|  isopentenyltransferase                                  166   1e-44    
gb|AEA03283.1|  isopentenyltransferase                                  169   1e-44    
emb|CDY18104.1|  BnaA01g23650D                                          167   2e-44    
gb|EMT17399.1|  tRNA Delta(2)-isopentenylpyrophosphate transferase      167   4e-44    
emb|CDO97083.1|  unnamed protein product                                165   2e-43    
ref|XP_010313579.1|  PREDICTED: adenylate isopentenyltransferase ...    166   3e-43    
gb|EAY75421.1|  hypothetical protein OsI_03324                          165   7e-43    
ref|XP_011007543.1|  PREDICTED: LOW QUALITY PROTEIN: adenylate is...    160   2e-42    
emb|CAQ03485.1|  isopenteniltransferase                                 157   2e-42    
gb|AIN44215.1|  IPT5                                                    160   3e-42    
gb|EPS70125.1|  hypothetical protein M569_04646                         161   4e-42    
ref|XP_008669486.1|  PREDICTED: adenylate isopentenyltransferase ...    160   1e-41    
gb|EAY90057.1|  hypothetical protein OsI_11629                          160   2e-41    
ref|NP_001050141.1|  Os03g0356900                                       160   2e-41    
ref|XP_004245336.1|  PREDICTED: adenylate isopentenyltransferase ...    157   4e-41    
gb|KCW81305.1|  hypothetical protein EUGRSUZ_C02674                     156   8e-41    
ref|XP_004977963.1|  PREDICTED: adenylate isopentenyltransferase ...    157   3e-40    
ref|XP_004251331.1|  PREDICTED: adenylate isopentenyltransferase ...    154   3e-40    
ref|XP_010038904.1|  PREDICTED: adenylate isopentenyltransferase-...    154   4e-40    
ref|XP_010313570.1|  PREDICTED: adenylate isopentenyltransferase ...    155   4e-40    
dbj|BAE47444.1|  adenylate isopentenyltransferase                       156   7e-40    
gb|EAY90075.1|  hypothetical protein OsI_11645                          156   7e-40    
gb|ABF96060.1|  cytokinin synthase, putative                            156   7e-40    
gb|EAZ29011.1|  hypothetical protein OsJ_13058                          155   1e-39    
ref|XP_002447735.1|  hypothetical protein SORBIDRAFT_06g014810          155   2e-39    
ref|XP_003561619.1|  PREDICTED: adenylate isopentenyltransferase ...    155   7e-39    
ref|XP_004245335.2|  PREDICTED: adenylate isopentenyltransferase ...    152   1e-38    
gb|AIU94759.1|  isopentenyl transferase                                 147   7e-38    
gb|KHN03441.1|  Adenylate isopentenyltransferase 5, chloroplastic       149   9e-38    
gb|KHG27521.1|  tRNA dimethylallyltransferase 2 -like protein           153   1e-37    
gb|EAZ26974.1|  hypothetical protein OsJ_10901                          149   3e-37    
ref|XP_009782638.1|  PREDICTED: adenylate isopentenyltransferase ...    143   7e-37    
gb|EMT23388.1|  tRNA Delta(2)-isopentenylpyrophosphate transferase      148   9e-37    
gb|ABW77761.1|  tRNA isopentenyltransferase                             149   4e-36    
gb|AAT77806.1|  putative cytokinin synthase 3                           142   4e-36    
dbj|BAK64273.1|  isopentenyltransferase                                 139   7e-36    
ref|XP_003539178.1|  PREDICTED: tRNA dimethylallyltransferase 2-like    147   2e-35    
dbj|BAM93480.1|  isopentenyltransferase                                 137   2e-35    
gb|KHN38659.1|  tRNA dimethylallyltransferase 2                         146   2e-35    
ref|XP_006467172.1|  PREDICTED: adenylate isopentenyltransferase ...    143   3e-35    
ref|XP_009608927.1|  PREDICTED: adenylate isopentenyltransferase ...    143   5e-35    
ref|XP_010312939.1|  PREDICTED: adenylate isopentenyltransferase ...    144   6e-35    
ref|XP_006425405.1|  hypothetical protein CICLE_v10025914mg             143   8e-35    
ref|XP_010325227.1|  PREDICTED: adenylate isopentenyltransferase ...    134   2e-33    
gb|KEH26140.1|  IPP transferase                                         141   2e-32    
dbj|BAM93481.1|  isopentenyltransferase                                 127   2e-31    
ref|XP_010312950.1|  PREDICTED: adenylate isopentenyltransferase ...    127   3e-31    
ref|XP_011078661.1|  PREDICTED: adenylate isopentenyltransferase ...    126   3e-30    
gb|ABR24101.1|  isopentenyl transferase                                 126   5e-30    
ref|XP_010051141.1|  PREDICTED: adenylate isopentenyltransferase-...    121   2e-29    
ref|XP_011101725.1|  PREDICTED: adenylate isopentenyltransferase ...    124   3e-29    
gb|EYU24467.1|  hypothetical protein MIMGU_mgv1a025771mg                127   5e-29    
gb|EEE66793.1|  hypothetical protein OsJ_23538                          124   9e-29    
ref|XP_011078656.1|  PREDICTED: adenylate isopentenyltransferase ...    121   1e-28    
ref|XP_001631919.1|  predicted protein                                  125   3e-28    
ref|XP_009383465.1|  PREDICTED: tRNA dimethylallyltransferase 2 i...    125   3e-28    
ref|XP_002906245.1|  tRNA isopentenyltransferase, putative              125   3e-28    
ref|XP_009383464.1|  PREDICTED: tRNA dimethylallyltransferase 2 i...    125   4e-28    
emb|CBI32356.3|  unnamed protein product                                120   1e-27    
ref|XP_010313190.1|  PREDICTED: isopentenyltransferase isoform X1       122   2e-27    
ref|XP_009515231.1|  hypothetical protein PHYSODRAFT_554281             122   3e-27    
ref|XP_009598004.1|  PREDICTED: tRNA dimethylallyltransferase 2 i...    122   3e-27    
ref|XP_010260621.1|  PREDICTED: tRNA dimethylallyltransferase 2 i...    120   3e-27    
ref|XP_009598002.1|  PREDICTED: tRNA dimethylallyltransferase 2 i...    122   4e-27    
dbj|BAO40450.1|  tRNA isopentenyltransferase                            121   4e-27    
ref|XP_008910025.1|  tRNA dimethylallyltransferase                      120   5e-27    
ref|XP_006349089.1|  PREDICTED: tRNA dimethylallyltransferase 2-like    120   2e-26    
ref|XP_010313568.1|  PREDICTED: uncharacterized protein LOC101244836    121   6e-26    
dbj|BAK64272.1|  isopentenyltransferase                                 111   9e-26    
dbj|BAM93483.1|  isopentenyltransferase                                 110   2e-25    
ref|XP_010940388.1|  PREDICTED: tRNA dimethylallyltransferase 2 i...    116   3e-25    
ref|WP_026701137.1|  tRNA delta(2)-isopentenylpyrophosphate trans...    114   4e-25    
ref|XP_010940367.1|  PREDICTED: tRNA dimethylallyltransferase 2 i...    116   5e-25    
ref|XP_006606886.1|  PREDICTED: adenylate isopentenyltransferase-...    112   7e-25    
ref|XP_008807488.1|  PREDICTED: tRNA dimethylallyltransferase 2 i...    115   1e-24    
ref|WP_026692392.1|  tRNA delta(2)-isopentenylpyrophosphate trans...    113   1e-24    
gb|AIQ47637.1|  tRNA delta(2)-isopentenylpyrophosphate transferase      112   2e-24    
ref|XP_011105618.1|  mod5p                                              113   3e-24    
gb|ABR17233.1|  unknown                                                 114   3e-24    
ref|XP_011088853.1|  PREDICTED: tRNA dimethylallyltransferase 2 i...    113   3e-24    
ref|WP_003032920.1|  MULTISPECIES: tRNA delta(2)-isopentenylpyrop...    111   3e-24    



>ref|XP_011070792.1| PREDICTED: adenylate isopentenyltransferase-like [Sesamum indicum]
Length=318

 Score =   349 bits (895),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 177/298 (59%), Positives = 225/298 (76%), Gaps = 15/298 (5%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MG TG GKS+ SVDLA+R+F ++E+INSDKIQVY+GLDITTNKI +P+R+ V HHL+GEF
Sbjct  24    MGPTGCGKSKLSVDLASRFFPSSEIINSDKIQVYRGLDITTNKIPLPDRKNVPHHLLGEF  83

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             ++SES PEF+ +DFR++ +  IS I+ R K+PFIVGGSNS+IYALL ++FNPE+DVF  E
Sbjct  84    DSSESHPEFTPSDFRSSASLTISQILSRRKIPFIVGGSNSFIYALLAKKFNPEIDVFS-E  142

Query  696   CNSVGDS-FGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDP-SNP  523
              NS  DS F  ELRY CCF+WVDVSPPVLN+YL KRVDEM+DSGM EEL+ ++++P S  
Sbjct  143   SNSETDSVFCKELRYSCCFIWVDVSPPVLNQYLVKRVDEMLDSGMFEELAEYFANPVSGS  202

Query  522   LSRTGLAKAIGVPEFAAY---FRAPRGGERR-------ERLYAEAVREIKENTRLLAERQ  373
              S+ GL KAIGVPEF  Y   F+  +G + R       +  Y EAVR IK+NT  LA+RQ
Sbjct  203   ASQCGLKKAIGVPEFQRYLKRFQNEQGEDWRSEDDVEKKMAYEEAVRAIKDNTCQLAKRQ  262

Query  372   LRKIQRLREVGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
             L KI RLRE  GWE+ R+ AT +  AAMG       A+IWE QVV+PS+KIV++FL+E
Sbjct  263   LGKILRLREAAGWELKRVEATESLRAAMG--GGRRVADIWERQVVEPSVKIVKRFLME  318



>ref|XP_009762170.1| PREDICTED: adenylate isopentenyltransferase isoform X1 [Nicotiana 
sylvestris]
Length=337

 Score =   341 bits (875),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 179/292 (61%), Positives = 219/292 (75%), Gaps = 17/292 (6%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATGSGKS+ S+DLATR+F  +EVINSDKIQVY GL+ITTNKI+MPER+GV HHL+GEF
Sbjct  55    MGATGSGKSKLSIDLATRFF-PSEVINSDKIQVYNGLEITTNKISMPERKGVPHHLLGEF  113

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
              ASES PEFS +DFR+A + RI++I+ RGK+P IVGGSNS+IYALL +RFNP++D F   
Sbjct  114   NASESHPEFSPSDFRSAASCRINEIINRGKIPLIVGGSNSFIYALLAKRFNPKID-FLGP  172

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRW-----YSDP  532
              N V      ELRY CCF+WVDV   VLN+YL KRVDEM+ SGM+EEL  +     +SD 
Sbjct  173   SNPV-QWVSNELRYECCFIWVDVLGTVLNQYLDKRVDEMLSSGMVEELEEYFKKEGFSDS  231

Query  531   SNPLSRTGLAKAIGVPEFAAYFRAPRGGERRERLYAEAVREIKENTRLLAERQLRKIQRL  352
              +    +G+ KAIGVPEF  YF+        E LY EA +EIKENTR+LAERQ+ KI RL
Sbjct  232   KSGSRNSGIRKAIGVPEFERYFKG-------EGLYEEAAKEIKENTRVLAERQVGKIVRL  284

Query  351   REVGGWEMHRINATAAFAAAMGSES-ESETAEIWENQVVQPSMKIVEKFLLE  199
             RE  GW + R++ATAAF A M SES +S   EIWE QV++PS KIV++FLLE
Sbjct  285   RE-AGWNLQRVDATAAFTAVMTSESGKSAAKEIWEEQVLEPSAKIVKQFLLE  335



>ref|XP_009762171.1| PREDICTED: adenylate isopentenyltransferase isoform X2 [Nicotiana 
sylvestris]
Length=335

 Score =   341 bits (875),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 179/292 (61%), Positives = 219/292 (75%), Gaps = 17/292 (6%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATGSGKS+ S+DLATR+F  +EVINSDKIQVY GL+ITTNKI+MPER+GV HHL+GEF
Sbjct  55    MGATGSGKSKLSIDLATRFF-PSEVINSDKIQVYNGLEITTNKISMPERKGVPHHLLGEF  113

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
              ASES PEFS +DFR+A + RI++I+ RGK+P IVGGSNS+IYALL +RFNP++D F   
Sbjct  114   NASESHPEFSPSDFRSAASCRINEIINRGKIPLIVGGSNSFIYALLAKRFNPKID-FLGP  172

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRW-----YSDP  532
              N V      ELRY CCF+WVDV   VLN+YL KRVDEM+ SGM+EEL  +     +SD 
Sbjct  173   SNPV-QWVSNELRYECCFIWVDVLGTVLNQYLDKRVDEMLSSGMVEELEEYFKKEGFSDS  231

Query  531   SNPLSRTGLAKAIGVPEFAAYFRAPRGGERRERLYAEAVREIKENTRLLAERQLRKIQRL  352
              +    +G+ KAIGVPEF  YF+        E LY EA +EIKENTR+LAERQ+ KI RL
Sbjct  232   KSGSRNSGIRKAIGVPEFERYFKG-------EGLYEEAAKEIKENTRVLAERQVGKIVRL  284

Query  351   REVGGWEMHRINATAAFAAAMGSES-ESETAEIWENQVVQPSMKIVEKFLLE  199
             RE  GW + R++ATAAF A M SES +S   EIWE QV++PS KIV++FLLE
Sbjct  285   RE-AGWNLQRVDATAAFTAVMTSESGKSAAKEIWEEQVLEPSAKIVKQFLLE  335



>gb|AFV15392.1| isopentenyl transferase 1 protein [Nicotiana benthamiana]
Length=336

 Score =   340 bits (872),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 177/292 (61%), Positives = 224/292 (77%), Gaps = 17/292 (6%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATGSGKS+ S+DLATR+F  +E+INSDKIQVY GL+ITTNKI+MPER+G+ HHL+GEF
Sbjct  55    MGATGSGKSKLSIDLATRFF-PSEIINSDKIQVYNGLEITTNKISMPERKGIPHHLLGEF  113

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
              ASES PEFS +D+R+A + RI++I+ RGK+P IVGGSNS+IYALL +RFNP++D F + 
Sbjct  114   NASESHPEFSPSDYRSAASCRINEIINRGKIPLIVGGSNSFIYALLAKRFNPKID-FLEP  172

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYS----DPS  529
              N V      ELRY+CCF+WVDV   VLN+YL KRVDEM+ SGM+EEL  +++      S
Sbjct  173   FNPV-QWVSNELRYKCCFIWVDVLGTVLNKYLDKRVDEMLRSGMVEELEEYFNKEGFSDS  231

Query  528   NPLSR-TGLAKAIGVPEFAAYFRAPRGGERRERLYAEAVREIKENTRLLAERQLRKIQRL  352
             N +SR +G+ KAIGVPEF  YF+        E LY EA +EIKENTR+LAERQ+ KI RL
Sbjct  232   NSVSRNSGIRKAIGVPEFERYFKG-------EELYEEAAKEIKENTRVLAERQVGKILRL  284

Query  351   REVGGWEMHRINATAAFAAAMGSES-ESETAEIWENQVVQPSMKIVEKFLLE  199
             RE  GW++ R++ATAAF A M SES +S   +IWE QV +PS KIV++FLLE
Sbjct  285   RE-AGWDLQRVDATAAFTAVMTSESGKSAAMKIWEEQVSEPSEKIVKQFLLE  335



>gb|EYU29989.1| hypothetical protein MIMGU_mgv1a010491mg [Erythranthe guttata]
Length=310

 Score =   336 bits (862),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 172/293 (59%), Positives = 217/293 (74%), Gaps = 11/293 (4%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MG TG GKS+ SVDLATR+F ++E+INSDKIQVY+GLDITTNKI   ER+GV HHL+GEF
Sbjct  22    MGPTGCGKSKLSVDLATRFFPSSEIINSDKIQVYRGLDITTNKIPPHERKGVPHHLLGEF  81

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             + SES PEF+ +DFR++ +  IS+I+   KVPFIVGGSNS IYALL ++F+PELDVF   
Sbjct  82    DPSESHPEFTPSDFRSSASSTISEILSHRKVPFIVGGSNSLIYALLAKKFDPELDVFSGS  141

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDP-SNPL  520
              NSV   F  ELRY CCF+WVDVS PVLN YL KRVD+M+DSGM +EL+ +++DP S+ +
Sbjct  142   -NSV---FCKELRYSCCFIWVDVSLPVLNEYLVKRVDDMLDSGMFDELAEYFADPESDSV  197

Query  519   SRTGLAKAIGVPEFAAYFRAPRGGER------RERLYAEAVREIKENTRLLAERQLRKIQ  358
             S++GL KAIGVPEF  YFR  R   R      + R Y EA+  IKENT  LA+RQL KI 
Sbjct  198   SQSGLKKAIGVPEFERYFRRFRDDWRLDDDVAKRRAYEEALWAIKENTCRLAKRQLWKIL  257

Query  357   RLREVGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
             RLR+  GW++  ++ATA+  AA         A+IWE QVV+PS+KIV +FL+E
Sbjct  258   RLRDAAGWDIKSVDATASVTAAAMGGGGRRVADIWERQVVEPSVKIVRRFLME  310



>ref|XP_009630789.1| PREDICTED: adenylate isopentenyltransferase-like isoform X1 [Nicotiana 
tomentosiformis]
Length=337

 Score =   335 bits (859),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 176/292 (60%), Positives = 219/292 (75%), Gaps = 17/292 (6%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             +GATGSGKS+ S+DLAT +F  +EVINSDKIQVY GL+ITTNKI+MPER+GV HHL+GEF
Sbjct  55    VGATGSGKSKLSIDLATCFF-PSEVINSDKIQVYNGLEITTNKISMPERKGVPHHLLGEF  113

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
              ASES PEF  +DFR+A + RI++I+ RGK+P IVGGSNS+IYALL +RFNP +D F + 
Sbjct  114   NASESHPEFYPSDFRSAASCRINEIINRGKIPLIVGGSNSFIYALLAKRFNPRID-FLEP  172

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRW-----YSDP  532
              N V      ELRY+CCF+WVDV   VLN+YL KRVDEM++SGM+EEL  +     +SD 
Sbjct  173   SNPV-QWVSNELRYKCCFIWVDVLGTVLNQYLDKRVDEMLNSGMVEELEEYFKKEGFSDS  231

Query  531   SNPLSRTGLAKAIGVPEFAAYFRAPRGGERRERLYAEAVREIKENTRLLAERQLRKIQRL  352
              +    +G+ KAIGVPEF  YF+        E LY EA +EIKENTR+LAERQ+ KI RL
Sbjct  232   DSVSRNSGIRKAIGVPEFERYFKG-------EGLYEEAAKEIKENTRVLAERQVGKILRL  284

Query  351   REVGGWEMHRINATAAFAAAMGSES-ESETAEIWENQVVQPSMKIVEKFLLE  199
             RE  GW++ RI+ATAAF A M SES +S   EIWE  V++PS KIV++FLLE
Sbjct  285   RE-AGWDLQRIDATAAFTAVMTSESGKSAAKEIWEEHVLKPSAKIVKQFLLE  335



>ref|XP_009630791.1| PREDICTED: adenylate isopentenyltransferase-like isoform X2 [Nicotiana 
tomentosiformis]
Length=335

 Score =   335 bits (858),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 176/292 (60%), Positives = 219/292 (75%), Gaps = 17/292 (6%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             +GATGSGKS+ S+DLAT +F  +EVINSDKIQVY GL+ITTNKI+MPER+GV HHL+GEF
Sbjct  55    VGATGSGKSKLSIDLATCFF-PSEVINSDKIQVYNGLEITTNKISMPERKGVPHHLLGEF  113

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
              ASES PEF  +DFR+A + RI++I+ RGK+P IVGGSNS+IYALL +RFNP +D F + 
Sbjct  114   NASESHPEFYPSDFRSAASCRINEIINRGKIPLIVGGSNSFIYALLAKRFNPRID-FLEP  172

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRW-----YSDP  532
              N V      ELRY+CCF+WVDV   VLN+YL KRVDEM++SGM+EEL  +     +SD 
Sbjct  173   SNPV-QWVSNELRYKCCFIWVDVLGTVLNQYLDKRVDEMLNSGMVEELEEYFKKEGFSDS  231

Query  531   SNPLSRTGLAKAIGVPEFAAYFRAPRGGERRERLYAEAVREIKENTRLLAERQLRKIQRL  352
              +    +G+ KAIGVPEF  YF+        E LY EA +EIKENTR+LAERQ+ KI RL
Sbjct  232   DSVSRNSGIRKAIGVPEFERYFKG-------EGLYEEAAKEIKENTRVLAERQVGKILRL  284

Query  351   REVGGWEMHRINATAAFAAAMGSES-ESETAEIWENQVVQPSMKIVEKFLLE  199
             RE  GW++ RI+ATAAF A M SES +S   EIWE  V++PS KIV++FLLE
Sbjct  285   RE-AGWDLQRIDATAAFTAVMTSESGKSAAKEIWEEHVLKPSAKIVKQFLLE  335



>ref|XP_009769551.1| PREDICTED: adenylate isopentenyltransferase-like [Nicotiana sylvestris]
Length=350

 Score =   335 bits (859),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 200/359 (56%), Positives = 246/359 (69%), Gaps = 26/359 (7%)
 Frame = -1

Query  1224  LMRIVSSFLSPAIPAPTISHA-FLRSKSVSGKKVRGDLGWARA-----AIvggeekekvv  1063
             + R++ SF+S       + H+ +  SK+V    +   L W R       +VG   K K+V
Sbjct  1     MRRLLKSFVSTTHHCLLLQHSSYNHSKNVKFF-LPNHLTWVRNMATGRTVVGPTNKNKIV  59

Query  1062  vVMGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIG  883
             VVMGATGSGKS+ S+DLATRYF  +E+INSDKIQV KGLDITTNKI+M ERRGV HHL+G
Sbjct  60    VVMGATGSGKSKLSIDLATRYFPNSEIINSDKIQVSKGLDITTNKISMSERRGVVHHLLG  119

Query  882   EFEASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFD  703
             EF +     EFS +D+R+  ++RISDI+ R K+P IVGGSNS+IY LL  RF P LDVF 
Sbjct  120   EFSS-----EFSPSDYRSVASDRISDIISRNKLPLIVGGSNSFIYGLLSNRFEPVLDVF-  173

Query  702   DECNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYS----D  535
             D+ N V      ELRY CCF+WVDV  PVLN+YLYKRVDEMM SGM EEL  ++      
Sbjct  174   DKSNPV-QCVSKELRYNCCFIWVDVLTPVLNQYLYKRVDEMMKSGMYEELEEFFEENGFS  232

Query  534   PSNPLSR-TGLAKAIGVPEFAAYFRAPRGG--ERRERLYAEAVREIKENTRLLAERQLRK  364
              SN  SR +GL KAIGVPE   YF   +    E + RLY EAVREIKENTR LAE+Q+ K
Sbjct  233   GSNSASRHSGLRKAIGVPEMERYFEKYKNCTVEEKCRLYEEAVREIKENTRQLAEKQIWK  292

Query  363   IQRLREVGGWEMHRINATAAFAAAMGSES----ESETAEIWENQVVQPSMKIVEKFLLE  199
             IQRLRE  GW++ R++AT AF AAM +E+     +E A IWE QVVQPS+KIV+ FLL+
Sbjct  293   IQRLRE-AGWDLQRVDATEAFTAAMMTENGKIPATEVAAIWEKQVVQPSVKIVKSFLLD  350



>ref|XP_011076680.1| PREDICTED: adenylate isopentenyltransferase [Sesamum indicum]
Length=352

 Score =   332 bits (850),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 169/302 (56%), Positives = 225/302 (75%), Gaps = 18/302 (6%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MG TG GKS+ SVDLA+R+F ++E+INSDKIQVY+GLDITTNKI++PER+ V HHL+G+F
Sbjct  53    MGPTGCGKSKLSVDLASRFFPSSEIINSDKIQVYRGLDITTNKISLPERKNVRHHLLGDF  112

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             ++S+S PEF+ +DFR++ +  IS I+ R ++PFIVGGSNS+IYALL ++FNPELDVF  E
Sbjct  113   DSSDSHPEFTPSDFRSSASSVISQILSRRRLPFIVGGSNSFIYALLAKKFNPELDVFS-E  171

Query  696   CNSVGDS-FGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSD-PSNP  523
              N+  DS F  ELRY CCFLWVDVS PVLN+YL KRVD+M++SGMLEEL+ ++ +  S+ 
Sbjct  172   SNAGEDSVFCKELRYSCCFLWVDVSLPVLNQYLVKRVDDMLESGMLEELAEYFENGGSDS  231

Query  522   LSRTGLAKAIGVPEFAAYFRAPRGGERRE-RL-------------YAEAVREIKENTRLL  385
             +S+ GL KAIGVPE   YF+       +E R+             Y EAVR IK+NT  L
Sbjct  232   VSKCGLKKAIGVPELERYFQTYNKNNGKEWRMDDDDDEDEEKRVAYEEAVRAIKDNTCQL  291

Query  384   AERQLRKIQRLREVGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFL  205
             A+RQL KI RLR+  GW++ R+++TA+  AAM        A+IWE QVV+PS+KIV++FL
Sbjct  292   AKRQLGKILRLRDGAGWDLKRVDSTASLRAAMEGGGR-RMADIWERQVVEPSVKIVKQFL  350

Query  204   LE  199
             +E
Sbjct  351   ME  352



>ref|XP_009603978.1| PREDICTED: adenylate isopentenyltransferase-like [Nicotiana tomentosiformis]
Length=382

 Score =   330 bits (845),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 175/296 (59%), Positives = 213/296 (72%), Gaps = 18/296 (6%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATGSGKS+ S+DLATRYF  +E+INSDKIQ+ KGLDITTNKI+M ERRGV HHL+GEF
Sbjct  95    MGATGSGKSKLSIDLATRYFPNSEIINSDKIQISKGLDITTNKISMSERRGVFHHLLGEF  154

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
              +     EFS +DFR   ++RISDI+ R K+P IVGGSNS+IYA L  RF P LDVF +E
Sbjct  155   SS-----EFSPSDFRWVASDRISDIINRNKLPLIVGGSNSFIYAFLSNRFEPGLDVF-NE  208

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDP----S  529
              N V      EL Y CCF+WVDV  PVLN+YL+KRVDEMM SGM EEL  ++       +
Sbjct  209   SNPV-QCISKELLYNCCFIWVDVLTPVLNQYLFKRVDEMMKSGMYEELEEFFEKNGFSGA  267

Query  528   NPLSR-TGLAKAIGVPEFAAYFRAPRGG--ERRERLYAEAVREIKENTRLLAERQLRKIQ  358
             N  SR +GL KAIGVPE   YF+  +    E + RLY EAVREI+ENTR LAE+Q+ KIQ
Sbjct  268   NSASRHSGLRKAIGVPEMERYFQKYKNCTVEEKCRLYEEAVREIQENTRQLAEKQIWKIQ  327

Query  357   RLREVGGWEMHRINATAAFAAAM---GSESESETAEIWENQVVQPSMKIVEKFLLE  199
             RLRE  GW++ R++AT AF AAM    ++      EIWE QVV+PS+KIV++FL E
Sbjct  328   RLRE-AGWDLQRVDATEAFTAAMTPGNTKIPVPATEIWEKQVVKPSVKIVKRFLFE  382



>ref|XP_006360459.1| PREDICTED: adenylate isopentenyltransferase 1, chloroplastic-like 
[Solanum tuberosum]
Length=334

 Score =   327 bits (838),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 168/291 (58%), Positives = 211/291 (73%), Gaps = 18/291 (6%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG GKS+ S+DLAT +F + EVINSDKIQVY GL+ITTNKI+M ER G+ HHL+GEF
Sbjct  57    MGATGCGKSKLSIDLATHFFPSIEVINSDKIQVYNGLEITTNKISMTERCGIHHHLLGEF  116

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             + +ES PEFS +DFR+AG  RI++IV RGK+PFIVGGSNS+IYALLV++F+   D+F+  
Sbjct  117   KPTESHPEFSPSDFRSAGDFRINEIVNRGKIPFIVGGSNSFIYALLVKQFDSGFDIFES-  175

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPS-NPL  520
              N V +    ELRY+CCF+WVD   PVLN+YL KRVDEM+DS M EEL  ++     +  
Sbjct  176   LNPVIN----ELRYQCCFIWVDAIAPVLNQYLDKRVDEMLDSEMFEELKEYFEKEGFSDS  231

Query  519   SRTGLAKAIGVPEFAAYFRAPRGGERRERLYAEAVREIKENTRLLAERQLRKIQRLREVG  340
             S  G+ KAIGVPEF  YF+           Y EA  EIKENTR+LAE Q++KI RLRE G
Sbjct  232   SSDGIRKAIGVPEFEKYFKGKIS-------YEEAAMEIKENTRVLAEIQVKKIMRLRE-G  283

Query  339   GWEMHRINATAAFAAAMGSES----ESETAEIWENQVVQPSMKIVEKFLLE  199
             GW + R++ATA   A MGSE     E+   +IWE QV++PS KIV++FLLE
Sbjct  284   GWNIQRVDATATLTAKMGSEKIAGGENPARKIWEEQVLEPSAKIVKQFLLE  334



>ref|XP_006344131.1| PREDICTED: adenylate isopentenyltransferase-like [Solanum tuberosum]
Length=345

 Score =   327 bits (838),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 172/290 (59%), Positives = 209/290 (72%), Gaps = 11/290 (4%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATGSGKS+ S+DLATR+F  +E+INSDKIQV KG+DITTNKI++PER GV HHL+GEF
Sbjct  63    MGATGSGKSKLSIDLATRFF-PSEIINSDKIQVSKGIDITTNKISIPERGGVVHHLLGEF  121

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
                E    FS +DFR     RI+DI+ R K+P IVGGSNS+IYALL  +FNP +DVFD E
Sbjct  122   SGPEL---FSPSDFRYTADNRITDIINRRKLPLIVGGSNSFIYALLSNQFNPGVDVFD-E  177

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
              N V      ELRY CCF+WVDV  PVLNRYL++RVDEMM+SGM EEL  ++        
Sbjct  178   LNPV-QCISKELRYHCCFIWVDVFTPVLNRYLFQRVDEMMNSGMYEELEEFFEKNGFSDR  236

Query  516   RTGLAKAIGVPEFAAYFRAPRGG---ERRERLYAEAVREIKENTRLLAERQLRKIQRLRE  346
              TG+ KAIGVPE   YFR  +     + + RLY EAVREIK+NT+ LAE+Q+ KIQRLRE
Sbjct  237   NTGIRKAIGVPEMEGYFRNLKNCTTVQEKCRLYDEAVREIKQNTKELAEKQMWKIQRLRE  296

Query  345   VGGWEMHRINATAAFAAAMGSE-SESETAEIWENQVVQPSMKIVEKFLLE  199
               GW++ +++AT A  A M  E SE    EIWE QVV PSMKIV++FLLE
Sbjct  297   -SGWDLQKVDATEALQAKMSPENSEIPATEIWERQVVLPSMKIVKQFLLE  345



>emb|CDP00631.1| unnamed protein product [Coffea canephora]
Length=293

 Score =   325 bits (832),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 169/299 (57%), Positives = 214/299 (72%), Gaps = 19/299 (6%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATGSGKS+ SVDL TR+F  +E++NSDKIQVY+GLDI TNKI+M +RRGV HH +GEF
Sbjct  1     MGATGSGKSKLSVDLGTRFFPNSEIVNSDKIQVYRGLDIATNKISMHDRRGVPHHFLGEF  60

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             +      EF+ +DFR   ++ I+ I  R  +P IVGGSNS+IY+LL +RFN E DVFD+ 
Sbjct  61    DP---ETEFTPSDFRELASKTIAQITSRRNLPLIVGGSNSFIYSLLAKRFNSETDVFDE-  116

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYS----DPS  529
              +S  +S   ELRY CCFLWVDVS P+LN YL KRVDEM+DSGM EEL  +++      S
Sbjct  117   -SSAINSVSSELRYSCCFLWVDVSLPILNEYLDKRVDEMLDSGMYEELEEYFAREGFAES  175

Query  528   NPLSRTGLAKAIGVPEFAAYFR------APRGGERRERL-YAEAVREIKENTRLLAERQL  370
                SRTGL KAIGVPEF  YF+         G E  +RL Y EAV+ +KENT  LA+RQL
Sbjct  176   ESASRTGLGKAIGVPEFERYFKRVGLGGGADGSEVEKRLSYEEAVKAVKENTCTLAKRQL  235

Query  369   RKIQRLREVGGWEMHRINATAAFAAAMGSESES--ETAEIWENQVVQPSMKIVEKFLLE  199
              KIQRL++  GW++H+I+AT AF AAMG  S+S    ++IWE  VV+PS KIV++FL+E
Sbjct  236   EKIQRLKD-AGWDLHKIDATEAFRAAMGMTSDSGKRASDIWEKMVVEPSAKIVKRFLME  293



>ref|NP_001244914.1| adenylate isopentenyltransferase [Solanum lycopersicum]
 dbj|BAM08996.1| adenylate isopentenyltransferase [Solanum lycopersicum]
Length=325

 Score =   325 bits (834),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 166/291 (57%), Positives = 212/291 (73%), Gaps = 18/291 (6%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG GKS+ S++LAT +F + EVINSDKIQVY GLDITTNKI+M ER G+ HHL+GEF
Sbjct  48    MGATGCGKSKLSIELATHFFPSIEVINSDKIQVYNGLDITTNKISMNERCGIVHHLLGEF  107

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             +++ES+PEF+ +DFR+AG  RI++IV RGK+PFIVGGSNS+IYALLV+RF+   D+F+  
Sbjct  108   KSTESQPEFTPSDFRSAGDFRINEIVNRGKIPFIVGGSNSFIYALLVKRFDSRFDIFES-  166

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
              N V +    ELRY+CCF+WVD   PVLN+YL KRVDEM+DS M EEL  ++       S
Sbjct  167   LNPVSE----ELRYQCCFIWVDAIAPVLNQYLDKRVDEMLDSEMFEELKEYFEKEGFSDS  222

Query  516   RT-GLAKAIGVPEFAAYFRAPRGGERRERLYAEAVREIKENTRLLAERQLRKIQRLREVG  340
              + G+ KAIGVPEF  YF+           Y EA  EIKENTR+LAERQ++KI RLRE G
Sbjct  223   GSDGIRKAIGVPEFEKYFKGKIS-------YEEAAMEIKENTRVLAERQVKKIMRLRE-G  274

Query  339   GWEMHRINATAAFAAAMGSES----ESETAEIWENQVVQPSMKIVEKFLLE  199
             GW + R++AT    A M SE     E+   +IWE +V++PS KIV++FLLE
Sbjct  275   GWNIQRVDATETLTAKMVSEKMAGGENPAGKIWEEEVLKPSAKIVKQFLLE  325



>gb|EPS71073.1| hypothetical protein M569_03686 [Genlisea aurea]
Length=320

 Score =   317 bits (813),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 162/288 (56%), Positives = 207/288 (72%), Gaps = 7/288 (2%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTA-AEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGE  880
             MG TG GK++ S+DLA+R+F+  AE++N+DKIQVY+GLDITTNKI  P+RR V HHL+GE
Sbjct  38    MGPTGCGKTKLSIDLASRFFSPRAEIVNADKIQVYRGLDITTNKIPFPDRRDVPHHLLGE  97

Query  879   FEASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDD  700
             F  SE+RP F+AADFR +G+  I  IV R  VPF+VGGSNS++YA+L ERF+P +DVF  
Sbjct  98    FTPSEARPVFTAADFRGSGSAAIDRIVSRRGVPFVVGGSNSFLYAVLAERFDPGVDVF--  155

Query  699   ECNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPL  520
                + G  F  ELRY CCFLWVDVSP VLNRYL +RVDEM+  GM+EEL  ++    +  
Sbjct  156   --GAPGTEFCTELRYGCCFLWVDVSPAVLNRYLERRVDEMLGMGMVEELENYFRRNGDRS  213

Query  519   SRTGLAKAIGVPEFAAYFRAPRGG-ERRERLYAEAVREIKENTRLLAERQLRKIQRLREV  343
                    AIGV EF  YFR   GG E+ +  Y EAVR IK NT  LAERQL KI RLR+ 
Sbjct  214   GECVTEMAIGVTEFRDYFRFGGGGCEKNDAHYEEAVRAIKSNTCQLAERQLGKILRLRDA  273

Query  342   GGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
              GW+++R+ AT++ +AA+    ++E A IWE QV+QPS+KIV+KFL E
Sbjct  274   AGWKLNRVEATSSLSAAIAGR-KTEAAAIWEKQVLQPSVKIVKKFLTE  320



>ref|NP_001244913.1| adenylate isopentenyltransferase [Solanum lycopersicum]
 dbj|BAM08995.1| adenylate isopentenyltransferase [Solanum lycopersicum]
Length=328

 Score =   315 bits (806),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 167/290 (58%), Positives = 206/290 (71%), Gaps = 11/290 (4%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATGSGKS+ S+DLATR F + E+INSDKIQV KGLDITTNKI++ E+ GV HHL+GEF
Sbjct  46    MGATGSGKSKLSIDLATRGFNS-EIINSDKIQVSKGLDITTNKISINEQSGVVHHLLGEF  104

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
                E    FS +DFR     RI+DI+ R ++P IVGGSNS+IYALL  +FNP +DVFD E
Sbjct  105   SGPEL---FSPSDFRHTADNRITDIINRRRLPLIVGGSNSFIYALLSNQFNPGVDVFD-E  160

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
              N V      ELRY CCF+ VDV  PVLNRYL++RVDEMM+SGM EEL  +++       
Sbjct  161   INPV-QCISKELRYHCCFILVDVLTPVLNRYLFQRVDEMMNSGMYEELEEFFAKNGFSDR  219

Query  516   RTGLAKAIGVPEFAAYFRAPRGG---ERRERLYAEAVREIKENTRLLAERQLRKIQRLRE  346
              TG+ KAIGVPE   YFR  +     + + RLY  A+REIKENT+ LAE+Q+RKIQRLRE
Sbjct  220   NTGIRKAIGVPEMEGYFRNLKNCTTVQEKCRLYEAALREIKENTKELAEKQIRKIQRLRE  279

Query  345   VGGWEMHRINATAAFAAAMG-SESESETAEIWENQVVQPSMKIVEKFLLE  199
               GW++ +++AT A  A M    S+    EIWE QVV PSMKIV++FLLE
Sbjct  280   -SGWDLQKVDATEALRAKMTPGNSKIPATEIWERQVVLPSMKIVKQFLLE  328



>gb|EYU40761.1| hypothetical protein MIMGU_mgv1a017953mg [Erythranthe guttata]
Length=295

 Score =   305 bits (782),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 158/287 (55%), Positives = 210/287 (73%), Gaps = 11/287 (4%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG GK++ +VDLA+R+F ++E+INSDKIQVY+GLDITTNKI   +RR V HHL+G+F
Sbjct  19    MGATGCGKTKLAVDLASRFFPSSEIINSDKIQVYRGLDITTNKIPFADRRNVRHHLLGDF  78

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             + S+S PEF+ +DFRA+ +  ++ I+ R + PF+VGGSNS++YALL ERFNPE DVF  E
Sbjct  79    DPSDSHPEFTPSDFRASASSAVAHILSRRRTPFVVGGSNSFVYALLAERFNPESDVFAAE  138

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDP-SNPL  520
               S   +F  ELRY CCF+W+DVS PVLNR+L KRVD M+DSGM +EL+ ++ +  S+ +
Sbjct  139   --SPDSAFCRELRYSCCFIWIDVSLPVLNRHLAKRVDHMLDSGMADELAEYFKNQRSDSV  196

Query  519   SRTGLAKAIGVPEFAAYFRAPRGGERRERLYAEAVREIKENTRLLAERQLRKIQRLREVG  340
             S+ GL +AIGVPEF  YF+   G         EAV  IKENT  LAERQ+ KI RLR+  
Sbjct  197   SQRGLKRAIGVPEFERYFKWGMGD------VEEAVGAIKENTCQLAERQVGKILRLRDAA  250

Query  339   GWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
             GWE+ R+ ATA  A    +E     A+IWE +VV+PS+KIV++FL+E
Sbjct  251   GWELKRVEATA--AIRAAAEGGGGAADIWEREVVEPSVKIVKEFLME  295



>gb|AAL83819.1| unknown [Petunia x hybrida]
Length=350

 Score =   306 bits (783),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 162/292 (55%), Positives = 206/292 (71%), Gaps = 23/292 (8%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATGSGKS+ S+DL TR++  +E+INSDKIQ+ KGL+ITTNKIT+P+RRGV HHL+GE 
Sbjct  76    MGATGSGKSKLSIDLVTRHYPFSEIINSDKIQITKGLNITTNKITVPDRRGVVHHLLGEI  135

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             +   +   FS + FR+   +RI+ I+ R K+PF+VGGSNSYIYALL  RF+P+   F+ +
Sbjct  136   DPDFN---FSPSHFRSIAGQRINSIINRHKLPFLVGGSNSYIYALLTNRFDPD---FNPD  189

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRW-----YSDP  532
              N V      ELRY CCF+WVDV  PVLN YL KRVDEMM+SGM EEL ++     +SDP
Sbjct  190   SNPV-HFISNELRYNCCFIWVDVLNPVLNEYLDKRVDEMMNSGMYEELEQFFKENRFSDP  248

Query  531   S-NPLSRTGLAKAIGVPEFAAYFRAPRGGERRERLYAEAVREIKENTRLLAERQLRKIQR  355
                P   TGL KAIGVPE   YF       ++   Y EAVREIKENT  LA++Q+ KIQR
Sbjct  249   GLEPGRATGLRKAIGVPEMERYF-------KKSCTYEEAVREIKENTWRLAKKQMWKIQR  301

Query  354   LREVGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
             LRE  GW++ R++AT AF  AM ++ E     IWE QVV+PS+KIV +FLL+
Sbjct  302   LRE-AGWDLQRVDATEAFVEAMSNKKEK--GIIWEKQVVEPSVKIVNRFLLD  350



>gb|AAX12424.1| adenylate isopentenyltransferase [Morus alba]
Length=312

 Score =   303 bits (777),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 161/295 (55%), Positives = 211/295 (72%), Gaps = 14/295 (5%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR SV+LAT +    E+INSDK+QVYKGLD TTNKI + +R GV HHL+GE 
Sbjct  23    MGATGTGKSRLSVELATHF--NGEIINSDKMQVYKGLDTTTNKIPLDDRLGVPHHLLGEV  80

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             + SE+  E + ++FR+   + +S+I  R K+P + GGSNS+I+ALLV+RF+PE DVFD+ 
Sbjct  81    D-SEAHGELTRSEFRSLAGKAVSEITARRKLPVLAGGSNSFIHALLVDRFDPEYDVFDER  139

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSN---  526
              +   DS  + LRY CCFLWVDVS  VL  YL KRVD+M++SGM +EL+ +Y DP     
Sbjct  140   SDQPADSSKVLLRYNCCFLWVDVSLRVLEDYLLKRVDDMLNSGMFDELAEFY-DPEEDHG  198

Query  525   PLSRTGLAKAIGVPEFAAYFRAPRGGER------RERLYAEAVREIKENTRLLAERQLRK  364
             P + TGL KAIGVPEF  YF   R GE+      R   Y EAVREIKENT  LA+RQ+ K
Sbjct  199   PANWTGLRKAIGVPEFDRYFERCRPGEKGEWDRVRREAYEEAVREIKENTCQLAKRQIGK  258

Query  363   IQRLREVGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
             I RL+++ GW++ R++AT AF A M S+S    +EIWE QV++PS+KIV++FL E
Sbjct  259   ILRLKKL-GWDLRRLDATEAFRAVMTSDSGKRCSEIWERQVLEPSVKIVKRFLDE  312



>emb|CBI27009.3| unnamed protein product [Vitis vinifera]
Length=320

 Score =   299 bits (765),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 175/336 (52%), Positives = 225/336 (67%), Gaps = 39/336 (12%)
 Frame = -1

Query  1194  PAIPAPTISHAFLRSKSVSGKKVRGDLGWAR--AAIvggeekekvvvVMGATGSGKSRAS  1021
             P IPA  I   F RS            GWAR  + +     K KVVV+MGATG+GKS+ S
Sbjct  20    PLIPA--IKPTFRRS------------GWARMDSTVRRNRTKHKVVVIMGATGTGKSKLS  65

Query  1020  VDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEFEASESRPEFSAA  841
             +DLATR+   AE+INSDKIQ+Y GLDITTNKI M ER+GV HHL+G+F++S +  E + +
Sbjct  66    IDLATRF--PAEIINSDKIQIYSGLDITTNKIQMHERQGVPHHLLGDFDSSHA--EITPS  121

Query  840   DFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDECNSVGDSFGLEL  661
              FR+  A  ISDI  R K+P + GGSNS+I+ALLV+RF+ E D F+       DS   EL
Sbjct  122   QFRSVAAAAISDISSRRKLPVLAGGSNSFIHALLVDRFDSESDPFNG-----SDSVSTEL  176

Query  660   RYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLSR--TGLAKAIGV  487
             RYRCCFLWVDVS  VL+ YL KRVDEM+ SGMLEEL+++Y DP    SR  TGL KAIGV
Sbjct  177   RYRCCFLWVDVSFAVLSDYLSKRVDEMLGSGMLEELAKFY-DPDEDESRPKTGLRKAIGV  235

Query  486   PEFAAYFRAPRGGERRERLYAEAVREIKENTRLLAERQLRKIQRLREVGGWEMHRINATA  307
             PEF  +FR           + EAV+ IK+NT  LA++Q+ KI R+R   GW++ R++AT 
Sbjct  236   PEFDRHFRN----------FEEAVKAIKDNTCHLAKKQIEKILRMRG-AGWDLKRLDATE  284

Query  306   AFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
             AF   + S+S  +++EIWE QVV+PS+K V +FL E
Sbjct  285   AFRVLLSSDSGKKSSEIWEKQVVEPSVKFVRRFLEE  320



>gb|KCW64725.1| hypothetical protein EUGRSUZ_G02313, partial [Eucalyptus grandis]
Length=307

 Score =   297 bits (760),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 168/313 (54%), Positives = 205/313 (65%), Gaps = 37/313 (12%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG GKS  S+DLA+ +   +EVINSDK+QVY+GLDITTNKIT  ERRGV HHL+G F
Sbjct  5     MGATGCGKSGLSIDLASVF--PSEVINSDKMQVYRGLDITTNKITPAERRGVPHHLLGSF  62

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             +  +   E S + FR+ G   IS I  RG +P + GGSNS I+ALLVERF+PE+DVF   
Sbjct  63    DPDDG--EMSPSMFRSLGQSAISGIASRGNLPLLAGGSNSLIHALLVERFDPEVDVF---  117

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDP--SNP  523
                +     LELRY CCFLWVDVSPPVL  YL KRVD+M+D GM EEL+R+Y DP  ++P
Sbjct  118   -GGLTSPASLELRYNCCFLWVDVSPPVLEEYLSKRVDDMLDMGMFEELARYY-DPRRTDP  175

Query  522   LSRTGLAKAIGVPEFAAYF----------------RAPRGGER------RERLYAEAVRE  409
               RTGL KAIGVPEF  YF                R P  G        RE  Y EAV E
Sbjct  176   GGRTGLRKAIGVPEFDRYFKKHPPQRWAGQGQGDARRPEEGREGDDDRAREGAYEEAVWE  235

Query  408   IKENTRLLAERQLRKIQRLREVGGWEMHRINATAAFAAAMGSES---ESETAEIWENQVV  238
             IKENTR LA+RQ+ KI+RLRE  GWE+ +++AT  F  AM ++         ++WE QVV
Sbjct  236   IKENTRQLAKRQIEKIERLREC-GWELRKLDATETFLLAMATDEGGGGGRRRDVWERQVV  294

Query  237   QPSMKIVEKFLLE  199
              PS+KIV++FL E
Sbjct  295   GPSVKIVKRFLQE  307



>ref|XP_010066714.1| PREDICTED: adenylate isopentenyltransferase [Eucalyptus grandis]
Length=371

 Score =   297 bits (761),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 168/313 (54%), Positives = 205/313 (65%), Gaps = 37/313 (12%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG GKS  S+DLA+ +   +EVINSDK+QVY+GLDITTNKIT  ERRGV HHL+G F
Sbjct  69    MGATGCGKSGLSIDLASVF--PSEVINSDKMQVYRGLDITTNKITPAERRGVPHHLLGSF  126

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             +  +   E S + FR+ G   IS I  RG +P + GGSNS I+ALLVERF+PE+DVF   
Sbjct  127   DPDDG--EMSPSMFRSLGQSAISGIASRGNLPLLAGGSNSLIHALLVERFDPEVDVF---  181

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDP--SNP  523
                +     LELRY CCFLWVDVSPPVL  YL KRVD+M+D GM EEL+R+Y DP  ++P
Sbjct  182   -GGLTSPASLELRYNCCFLWVDVSPPVLEEYLSKRVDDMLDMGMFEELARYY-DPRRTDP  239

Query  522   LSRTGLAKAIGVPEFAAYF----------------RAPRGGER------RERLYAEAVRE  409
               RTGL KAIGVPEF  YF                R P  G        RE  Y EAV E
Sbjct  240   GGRTGLRKAIGVPEFDRYFKKHPPQRWAGQGQGDARRPEEGREGDDDRAREGAYEEAVWE  299

Query  408   IKENTRLLAERQLRKIQRLREVGGWEMHRINATAAFAAAMGSE---SESETAEIWENQVV  238
             IKENTR LA+RQ+ KI+RLRE  GWE+ +++AT  F  AM ++         ++WE QVV
Sbjct  300   IKENTRQLAKRQIEKIERLREC-GWELRKLDATETFLLAMATDEGGGGGRRRDVWERQVV  358

Query  237   QPSMKIVEKFLLE  199
              PS+KIV++FL E
Sbjct  359   GPSVKIVKRFLQE  371



>ref|XP_004497083.1| PREDICTED: LOW QUALITY PROTEIN: adenylate isopentenyltransferase-like 
[Cicer arietinum]
Length=370

 Score =   296 bits (758),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 163/300 (54%), Positives = 212/300 (71%), Gaps = 20/300 (7%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATGSGKSR SV+LAT  F  +E+INSDK+QVY+GLDITTNKI   +R GV HHL+G+ 
Sbjct  66    MGATGSGKSRLSVELAT-LFPFSEIINSDKMQVYRGLDITTNKIPFHQRNGVPHHLLGDV  124

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDD-  700
             + S    EFS +DFR    E ISDI  R K+P IVGGSNS+I+ALLVERF+PEL+VFD  
Sbjct  125   DHSHG--EFSPSDFRRHAGEIISDITSRRKLPIIVGGSNSFIHALLVERFDPELNVFDKS  182

Query  699   --ECNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSN  526
                 +S   S   +LRY+CCFLW+D+S PVL+ YL KRVDEM DSGM++EL++++   S 
Sbjct  183   SSSSSSSLSSISSDLRYKCCFLWMDISFPVLSEYLLKRVDEMFDSGMVDELAQFFEPDSE  242

Query  525   PLSRTGLAKAIGVPEFAAYFRAPRGGER--------RERLYAEAVREIKENTRLLAERQL  370
               +RTGL KAIGVPEF  +F      ++        RE  Y EAVR IK+NT  LA+RQ+
Sbjct  243   --NRTGLRKAIGVPEFDRFFNKYPPADKLEEGENPMREGAYEEAVRAIKDNTCQLAKRQI  300

Query  369   RKIQRLREVGGWEMHRINATAAFAAAMGSESESET---AEIWENQVVQPSMKIVEKFLLE  199
              KI RL+   GW++ RI+AT AF A + SES       +++W+NQV++PS+KIV++FL+E
Sbjct  301   GKILRLKR-AGWDLRRIDATEAFRAVLTSESRGGAGVFSDLWKNQVLEPSVKIVKRFLME  359



>ref|XP_002279371.2| PREDICTED: adenylate isopentenyltransferase [Vitis vinifera]
Length=381

 Score =   296 bits (757),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 176/350 (50%), Positives = 229/350 (65%), Gaps = 43/350 (12%)
 Frame = -1

Query  1194  PAIPAPTISHAFLRSKSVSGKKVRGDLGWAR--AAIvggeekekvvvVMGATGSGKSRAS  1021
             P IPA  I   F RS            GWAR  + +     K KVVV+MGATG+GKS+ S
Sbjct  57    PLIPA--IKPTFRRS------------GWARMDSTVRRNRTKHKVVVIMGATGTGKSKLS  102

Query  1020  VDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEFEASESRPEFSAA  841
             +DLATR+   AE+INSDKIQ+Y GLDITTNKI M ER+GV HHL+G+F++S +  E + +
Sbjct  103   IDLATRF--PAEIINSDKIQIYSGLDITTNKIQMHERQGVPHHLLGDFDSSHA--EITPS  158

Query  840   DFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDECNSVGDSFGLEL  661
              FR+  A  ISDI  R K+P + GGSNS+I+ALLV+RF+ E D F+       DS   EL
Sbjct  159   QFRSVAAAAISDISSRRKLPVLAGGSNSFIHALLVDRFDSESDPFNG-----SDSVSTEL  213

Query  660   RYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLSR--TGLAKAIGV  487
             RYRCCFLWVDVS  VL+ YL KRVDEM+ SGMLEEL+++Y DP    SR  TGL KAIGV
Sbjct  214   RYRCCFLWVDVSFAVLSDYLSKRVDEMLGSGMLEELAKFY-DPDEDESRPKTGLRKAIGV  272

Query  486   PEFAAYFRA------------PRGGERRERL--YAEAVREIKENTRLLAERQLRKIQRLR  349
             PEF  +FR             P+  +    +  + EAV+ IK+NT  LA++Q+ KI R+R
Sbjct  273   PEFDRHFRKYPPVDQGIIAGNPKKKKDDPEMESFEEAVKAIKDNTCHLAKKQIEKILRMR  332

Query  348   EVGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
                GW++ R++AT AF   + S+S  +++EIWE QVV+PS+K V +FL E
Sbjct  333   G-AGWDLKRLDATEAFRVLLSSDSGKKSSEIWEKQVVEPSVKFVRRFLEE  381



>gb|KFK41258.1| hypothetical protein AALP_AA2G106200 [Arabis alpina]
Length=293

 Score =   292 bits (747),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 149/286 (52%), Positives = 196/286 (69%), Gaps = 10/286 (3%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             +GATG+GKS+ SVDLATR+  ++E+INSDKIQVY+GL+ITTN+IT+ +R GV HHL+G  
Sbjct  17    LGATGAGKSKLSVDLATRF--SSEIINSDKIQVYQGLEITTNQITIQDRHGVPHHLLGYL  74

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
                ++  E +  DFR   A  +SDI  RGK+P I GGSNS+I+ALL E +NP++D F  E
Sbjct  75    RHDDT--ELTPGDFRLTAANTVSDITSRGKLPIIAGGSNSFIHALLTEHYNPKIDPFSSE  132

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                        LRY CCF+WVDVS  VL  YL KRVDEMMDSGM EELS +Y       +
Sbjct  133   SR-----ISKSLRYDCCFIWVDVSETVLFEYLVKRVDEMMDSGMFEELSGFYDPVKFNKT  187

Query  516   RTGLAKAIGVPEFAAYFRAPRGGERRERLYAEAVREIKENTRLLAERQLRKIQRLREVGG  337
             R G+ KAIGVPEF  YF+     E  +  Y +AV +IKENT  LA+RQ+RKI++LR+  G
Sbjct  188   RFGIRKAIGVPEFDEYFKTVEKREFDKTAYDKAVDDIKENTLRLAKRQIRKIEKLRD-AG  246

Query  336   WEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
             WE+ R++AT +F A + S       EIWE  V++PS+KIV +FL++
Sbjct  247   WEIKRVDATTSFKAVLMSFEGRRRREIWEMDVLEPSVKIVNRFLVK  292



>emb|CAN73470.1| hypothetical protein VITISV_000274 [Vitis vinifera]
Length=373

 Score =   293 bits (751),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 176/350 (50%), Positives = 228/350 (65%), Gaps = 43/350 (12%)
 Frame = -1

Query  1194  PAIPAPTISHAFLRSKSVSGKKVRGDLGWAR--AAIvggeekekvvvVMGATGSGKSRAS  1021
             P IPA  I   F RS            GWAR  +       K KVVV+MGATG+GKS+ S
Sbjct  49    PLIPA--IKPTFRRS------------GWARMDSTXRRNRXKHKVVVIMGATGTGKSKLS  94

Query  1020  VDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEFEASESRPEFSAA  841
             +DLATR+   AE+INSDKIQ+Y GLDITTNKI M ER+GV HHL+G+F++S +  E + +
Sbjct  95    IDLATRF--PAEIINSDKIQIYSGLDITTNKIQMHERQGVPHHLLGDFDSSHA--EITPS  150

Query  840   DFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDECNSVGDSFGLEL  661
              FR+  A  ISDI  R K+P + GGSNS+I+ALLV+RF+ E D F+       DS   EL
Sbjct  151   QFRSVAAAAISDISSRRKLPVLAGGSNSFIHALLVDRFDSESDPFNG-----SDSVSTEL  205

Query  660   RYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLSR--TGLAKAIGV  487
             RYRCCFLWVDVS  VL+ YL KRVDEM+ SGMLEEL+++Y DP    SR  TGL KAIGV
Sbjct  206   RYRCCFLWVDVSFAVLSDYLSKRVDEMLGSGMLEELAKFY-DPDEDESRPKTGLRKAIGV  264

Query  486   PEFAAYFRA------------PRGGERRERL--YAEAVREIKENTRLLAERQLRKIQRLR  349
             PEF  +FR             P+  +    +  + EAV+ IK+NT  LA++Q+ KI R+R
Sbjct  265   PEFDRHFRKYPPVDQGIIAGNPKKKKDDPEMESFEEAVKAIKDNTCHLAKKQIEKILRMR  324

Query  348   EVGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
                GW++ R++AT AF   + S+S  +++EIWE QVV+PS+K V +FL E
Sbjct  325   G-AGWDLKRLDATEAFRVLLSSDSGKKSSEIWEKQVVEPSVKFVRRFLEE  373



>ref|XP_010099238.1| Adenylate isopentenyltransferase [Morus notabilis]
 gb|EXB77502.1| Adenylate isopentenyltransferase [Morus notabilis]
Length=456

 Score =   296 bits (757),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 158/295 (54%), Positives = 207/295 (70%), Gaps = 14/295 (5%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR SV+LAT +    E+INSDK+QVYKGLD TTNKI + +R GV HHL+GE 
Sbjct  167   MGATGTGKSRLSVELATHF--NGEIINSDKMQVYKGLDTTTNKIPLDDRLGVPHHLLGEV  224

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             + SE+  E + ++FR+   + +S+I  R K+P + GGSNS+I+ALLV+RF+PE DVFD+ 
Sbjct  225   D-SEAHGELTRSEFRSLAGKAVSEITARRKLPVLAGGSNSFIHALLVDRFDPEYDVFDER  283

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDP---SN  526
              +   DS  + LRY CCFLWVDVS  VL  YL KRVD+M++SGM +EL+ +Y DP     
Sbjct  284   SDQPADSSKVLLRYNCCFLWVDVSLRVLEDYLVKRVDDMLNSGMFDELAEFY-DPEEDHG  342

Query  525   PLSRTGLAKAIGVPEFAAYFRAPRGGER------RERLYAEAVREIKENTRLLAERQLRK  364
             P + TGL KAIGVPEF  YF     GE+      R   Y  AVREIK NT  LA+RQ+ K
Sbjct  343   PANWTGLRKAIGVPEFDRYFERCTPGEKGEWDRVRREAYEVAVREIKANTCQLAKRQIGK  402

Query  363   IQRLREVGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
             I RL+ + GW++ R++AT AF A M S+S    +EIWE QV++PS+KIV++FL E
Sbjct  403   ILRLKGL-GWDLRRLDATEAFRAVMTSDSGKRCSEIWERQVLEPSVKIVKRFLDE  456



>gb|EPS73689.1| adenylate isopentenyltransferase [Genlisea aurea]
Length=319

 Score =   290 bits (743),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 150/297 (51%), Positives = 199/297 (67%), Gaps = 22/297 (7%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MG TG GK+R SVDLA+R++ + E+IN+DKIQVY+GLDITTNK+   +R+ V HH IGEF
Sbjct  33    MGPTGCGKTRLSVDLASRFYPSPEIINADKIQVYRGLDITTNKVPFRDRKNVAHHFIGEF  92

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
               +ESRPEF+ +DFR+A    +S I+ R ++P +VGGSNS+IYALL +R+ PE+DVF  +
Sbjct  93    RPTESRPEFTPSDFRSAAGLAVSRILSRRRLPLVVGGSNSFIYALLAKRYRPEVDVFGGD  152

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
              +SV      E RY CCF+ V VSPPVLNR+L KRVD+M++SGM +EL   ++DP+ P +
Sbjct  153   VDSV--VVCRETRYDCCFISVHVSPPVLNRHLEKRVDDMLESGMFDELGHHFADPTRP-N  209

Query  516   RTGLAKAIGVPEFAAYF-------RAPRGGERRERL----YAEAVREIKENTRLLAERQL  370
             + GL KAIGV EF  YF       R   G E   R+    Y  AVR IK NT  LA++Q 
Sbjct  210   QCGLEKAIGVAEFERYFSRFKTDWRRTNGTESEHRIKTQEYEAAVRSIKSNTLHLAKKQQ  269

Query  369   RKIQRLREVGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
              KI RLR   GW ++ ++AT A AA           + WE QVV+ S+KIV++FL E
Sbjct  270   EKIHRLRVAAGWNLNTVDATEATAAG--------ETDFWETQVVEESVKIVKRFLAE  318



>gb|AES62904.2| adenylate isopentenyltransferase [Medicago truncatula]
Length=361

 Score =   291 bits (746),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 161/299 (54%), Positives = 211/299 (71%), Gaps = 20/299 (7%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             +GATGSGKSR SV+LAT  F  +E+INSDKIQVY+GLDITTNKI   +R  V HHL+G+ 
Sbjct  70    VGATGSGKSRLSVELAT-LFPYSEIINSDKIQVYRGLDITTNKIPFHQRNNVPHHLLGDI  128

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             + S    EFS +DFR    + ISDI  R K+P IVGGSNS+I+ALLVERF+PE +VFD E
Sbjct  129   DPSHG--EFSPSDFRRHAGDIISDITSRRKLPIIVGGSNSFIHALLVERFDPESNVFD-E  185

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
              +S+  S   +LRY+CCFLW+D+S PVL+ YL KRVD+M DSGM+ EL+ +Y   ++  +
Sbjct  186   SSSLSTSISSDLRYKCCFLWMDISFPVLSEYLLKRVDDMFDSGMVNELAEFYEPDAD--N  243

Query  516   RTGLAKAIGVPEFAAYFR------APRGGER----RERLYAEAVREIKENTRLLAERQLR  367
             +TGL KAIGVPEF  +F+       P   ER    RE  Y EAV+ IK+NT  LA+RQ+ 
Sbjct  244   QTGLRKAIGVPEFDRFFKQYPPQVGPDESERHNPMREGAYIEAVKAIKDNTCQLAKRQIG  303

Query  366   KIQRLREVGGWEMHRINATAAFAAAMGSESE---SETAEIWENQVVQPSMKIVEKFLLE  199
             KI RL+   GW++ RI+AT AF A + SES     E   +W+ QV++PS+KIV++FL+E
Sbjct  304   KILRLKR-AGWDLQRIDATEAFRAVLTSESNGGGEEFTGVWKKQVLEPSVKIVKRFLME  361



>gb|KDP29418.1| hypothetical protein JCGZ_18339 [Jatropha curcas]
Length=359

 Score =   291 bits (745),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 162/308 (53%), Positives = 204/308 (66%), Gaps = 30/308 (10%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG GKS+ S+DLATR F  +E+INSDK+QVYKGLD+TTNKI++ ER GV+HHL+G F
Sbjct  60    MGATGCGKSKLSIDLATR-FQYSEIINSDKMQVYKGLDVTTNKISIHERLGVDHHLLGVF  118

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             +  +   E S + FR      ISDIV R ++P IVGGSNS+I+AL+V+RFNP +DVFD+ 
Sbjct  119   DPEDG--EVSPSKFRLTAGLAISDIVSRQRLPLIVGGSNSFIHALVVDRFNPGIDVFDE-  175

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
               S+ ++   +LRY CCFLWVDVS PVL  YL +RVDEM+DSGM EELS +Y    N  S
Sbjct  176   --SLNNAVSTQLRYNCCFLWVDVSLPVLCDYLCERVDEMLDSGMFEELSEFYRS-GNSAS  232

Query  516   RTGLAKAIGVPEFAAYFRA-PRG-------GERRERLYAEAVREIKENTRLLAERQLRKI  361
             + G+ KAIGVPEF  YF+  P G          R   Y EAVREIKENT  LA+RQL KI
Sbjct  233   QPGIGKAIGVPEFDQYFKKYPPGTGGGGAWDSVRRGAYEEAVREIKENTCQLAKRQLGKI  292

Query  360   QRLREVGGWEMHRINATAAFAAAMGSESES--------------ETAEIWENQVVQPSMK  223
              +L+   GW++ R++AT AF  AM     S                 E+WE  V++PSMK
Sbjct  293   MKLKG-AGWDLQRVDATEAFRVAMEVAPPSFDNKKKKKRKKKKKRWIEVWERDVLEPSMK  351

Query  222   IVEKFLLE  199
             IV +FL E
Sbjct  352   IVNRFLEE  359



>ref|XP_003592653.1| Adenylate isopentenyltransferase [Medicago truncatula]
Length=372

 Score =   291 bits (745),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 161/299 (54%), Positives = 211/299 (71%), Gaps = 20/299 (7%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             +GATGSGKSR SV+LAT  F  +E+INSDKIQVY+GLDITTNKI   +R  V HHL+G+ 
Sbjct  70    VGATGSGKSRLSVELAT-LFPYSEIINSDKIQVYRGLDITTNKIPFHQRNNVPHHLLGDI  128

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             + S    EFS +DFR    + ISDI  R K+P IVGGSNS+I+ALLVERF+PE +VFD E
Sbjct  129   DPSHG--EFSPSDFRRHAGDIISDITSRRKLPIIVGGSNSFIHALLVERFDPESNVFD-E  185

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
              +S+  S   +LRY+CCFLW+D+S PVL+ YL KRVD+M DSGM+ EL+ +Y   ++  +
Sbjct  186   SSSLSTSISSDLRYKCCFLWMDISFPVLSEYLLKRVDDMFDSGMVNELAEFYEPDAD--N  243

Query  516   RTGLAKAIGVPEFAAYFR------APRGGER----RERLYAEAVREIKENTRLLAERQLR  367
             +TGL KAIGVPEF  +F+       P   ER    RE  Y EAV+ IK+NT  LA+RQ+ 
Sbjct  244   QTGLRKAIGVPEFDRFFKQYPPQVGPDESERHNPMREGAYIEAVKAIKDNTCQLAKRQIG  303

Query  366   KIQRLREVGGWEMHRINATAAFAAAMGSESE---SETAEIWENQVVQPSMKIVEKFLLE  199
             KI RL+   GW++ RI+AT AF A + SES     E   +W+ QV++PS+KIV++FL+E
Sbjct  304   KILRLKR-AGWDLQRIDATEAFRAVLTSESNGGGEEFTGVWKKQVLEPSVKIVKRFLME  361



>ref|XP_002526982.1| adenylate dimethylallyltransferase, putative [Ricinus communis]
 gb|EEF35354.1| adenylate dimethylallyltransferase, putative [Ricinus communis]
Length=332

 Score =   289 bits (740),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 159/293 (54%), Positives = 197/293 (67%), Gaps = 25/293 (9%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG GK+R S+DLATR+   +E+IN+DK+QVYKGLDITTNKIT+ +R GV HHL+GE 
Sbjct  58    MGATGCGKTRLSIDLATRF--QSEIINTDKMQVYKGLDITTNKITLQDRLGVPHHLLGEV  115

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             +      EFS +DFR      ISDIV R K+P +VGGSNSYI+ALLV+RFNPE++VF   
Sbjct  116   DPDNC--EFSPSDFRLHAGLSISDIVSRQKLPLLVGGSNSYIHALLVDRFNPEINVFQQS  173

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
              NS  +S   +LRY CCF+WVDVS P+L  YL KRVDEM+DSGM EELS +Y+   NP S
Sbjct  174   KNS--ESVSTQLRYDCCFIWVDVSLPLLCDYLCKRVDEMLDSGMFEELSEYYAS-VNPES  230

Query  516   RTGLAKAIGVPEFAAYFRAPRGGER-------RERLYAEAVREIKENTRLLAERQLRKIQ  358
             + GL KAIGVPEF  YF+    G +       +  +Y EAVR IKENT  LA+RQ+ KI 
Sbjct  231   QPGLRKAIGVPEFDRYFKKYPPGYQGGKWDFVQRGVYEEAVRMIKENTCQLAKRQMGKIL  290

Query  357   RLREVGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
             RL+   GW++HR                 +  EIWE  V++PSMKIV  FL E
Sbjct  291   RLKS-AGWDLHRKKRKKK----------KKWMEIWERDVLKPSMKIVNHFLDE  332



>gb|ABD93932.1| adenylate isopentenyltransferase [Lotus japonicus]
Length=319

 Score =   286 bits (731),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 152/287 (53%), Positives = 207/287 (72%), Gaps = 13/287 (5%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATGSGKSR S+DLAT  F  +E+INSDK+QVYKGLD TTNKI   +R  V HHL+G+ 
Sbjct  45    MGATGSGKSRLSIDLAT-LFPFSEIINSDKMQVYKGLDTTTNKIPPHQRNNVPHHLLGDV  103

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             + S    +F+ +DFR    + ISDI  R K+P  VGGSNS+++ALLV+RF+PE +VF D+
Sbjct  104   DPSLG--DFTPSDFRRRAGDLISDITRRRKLPIFVGGSNSFVHALLVDRFDPESNVFRDD  161

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
               S   S   ELRYRCCFLW+D++ PVL+ YL KRVD+M+DSGM++EL++++   S+  +
Sbjct  162   SPSPVSS---ELRYRCCFLWMDIAFPVLSEYLLKRVDDMLDSGMVDELAQFFD--SDTAN  216

Query  516   RTGLAKAIGVPEFAAYFRAPRGGERRERLYAEAVREIKENTRLLAERQLRKIQRLREVGG  337
             +TGL KAIGVPEF  +F+ P    R    Y EAVR IKENT  LA+RQ+ KI RL+   G
Sbjct  217   QTGLRKAIGVPEFDRFFKDP---VREGAAYEEAVRAIKENTCQLAKRQIGKIMRLKR-AG  272

Query  336   WEMHRINATAAFAAAMGSESESET-AEIWENQVVQPSMKIVEKFLLE  199
             W++ RI+AT AF  A+ ++   E  ++ W+ QV++PS+KIV++FL+E
Sbjct  273   WDLRRIDATEAFRVALVADGGGERFSDEWKRQVLEPSVKIVKRFLME  319



>ref|XP_006391138.1| hypothetical protein EUTSA_v10019632mg [Eutrema salsugineum]
 gb|ESQ28424.1| hypothetical protein EUTSA_v10019632mg [Eutrema salsugineum]
Length=351

 Score =   287 bits (734),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 157/295 (53%), Positives = 204/295 (69%), Gaps = 15/295 (5%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             +GATG+GKSR SVDLATR+   +E+INSDKIQVY+GL+ITTN+IT+P+RRGV HHL+G  
Sbjct  62    LGATGAGKSRLSVDLATRF--PSEIINSDKIQVYEGLEITTNQITIPDRRGVPHHLLGYL  119

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
                +   E SA DFR A +  +SDI  R KVP I GGSNS+++ALL ERF+P+ D F   
Sbjct  120   RPEDG--ELSAGDFRIAASNAVSDITSRKKVPIIAGGSNSFVHALLAERFDPKSDPFASG  177

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
              +    S   +LRY CC LWVDVS  VL  YL KRVDEMMDSGM EELS +Y    + L 
Sbjct  178   SSDSS-SICRDLRYDCCLLWVDVSESVLFEYLLKRVDEMMDSGMFEELSGFYDAVKSGLP  236

Query  516   RTGLAKAIGVPEFAAYFRA-PRGGER------RERLYAEAVREIKENTRLLAERQLRKIQ  358
             R G+ +AIGVPEF  YF+  P   ++      ++  Y +AV +IKENT  LA+RQ+ KI+
Sbjct  237   RFGIRRAIGVPEFDGYFKMYPPENKKGKWDPAKKAAYDKAVEDIKENTLRLAKRQIGKIE  296

Query  357   RLREVGGWEMHRINATAAFAAAMGSESES--ETAEIWENQVVQPSMKIVEKFLLE  199
             +LR+  GWE+ R++ATA+F A M S  E   E  EIWE QV++PS+KIV + L++
Sbjct  297   KLRD-AGWEIKRVDATASFRAVMMSSPEKRREWREIWEEQVLEPSVKIVNQLLVD  350



>sp|Q5GHF7.1|IPT_HUMLU RecName: Full=Adenylate isopentenyltransferase; AltName: Full=Adenylate 
dimethylallyltransferase; AltName: Full=Cytokinin 
synthase [Humulus lupulus]
 gb|AAS94327.1| adenylate isopentenyltransferase [Humulus lupulus]
Length=329

 Score =   285 bits (730),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 160/302 (53%), Positives = 210/302 (70%), Gaps = 24/302 (8%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR S+DLA  +    EVINSDK+QVYKGLDITTNKI++P+R GV HHL+GE 
Sbjct  36    MGATGTGKSRLSIDLAAHF--PLEVINSDKMQVYKGLDITTNKISVPDRGGVPHHLLGEV  93

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPE-LDVFDD  700
             +   +R E + ADFR+   + +S+I GR K+P +VGGSNS+I+ALLV+RF+     VF++
Sbjct  94    DP--ARGELTPADFRSLAGKAVSEITGRRKLPVLVGGSNSFIHALLVDRFDSSGPGVFEE  151

Query  699   ECNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYS-----D  535
               +SV  S   ELRY CCFLWVDVS  VL  YL KRVD+M++ GM +EL+ +YS      
Sbjct  152   GSHSVVSS---ELRYDCCFLWVDVSVKVLTDYLAKRVDDMLELGMFDELAEFYSPEDEDH  208

Query  534   PSNPLSRTGLAKAIGVPEFAAYFRAPRGGE------RRERL----YAEAVREIKENTRLL  385
               +  +RTGL KAIGVPEF  YF   R G+       R+R+    + EAVR IKENT  L
Sbjct  209   DEDSATRTGLRKAIGVPEFDRYFEKFRPGDVEGEDPGRDRVRRGAFEEAVRAIKENTCHL  268

Query  384   AERQLRKIQRLREVGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFL  205
             A+RQ+ KI RL+   GW++ R++AT +F AAM S+S  +  EIWE QV++PS+KIV +FL
Sbjct  269   AKRQIGKILRLKG-AGWDLRRLDATESFRAAMTSDSGEKCTEIWEKQVLEPSVKIVSRFL  327

Query  204   LE  199
              E
Sbjct  328   DE  329



>pdb|3A8T|A Chain A, Plant Adenylate Isopentenyltransferase In Complex With 
Atp
Length=339

 Score =   285 bits (729),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 160/302 (53%), Positives = 210/302 (70%), Gaps = 24/302 (8%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR S+DLA  +    EVINSDK+QVYKGLDITTNKI++P+R GV HHL+GE 
Sbjct  46    MGATGTGKSRLSIDLAAHF--PLEVINSDKMQVYKGLDITTNKISVPDRGGVPHHLLGEV  103

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPE-LDVFDD  700
             +   +R E + ADFR+   + +S+I GR K+P +VGGSNS+I+ALLV+RF+     VF++
Sbjct  104   DP--ARGELTPADFRSLAGKAVSEITGRRKLPVLVGGSNSFIHALLVDRFDSSGPGVFEE  161

Query  699   ECNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYS-----D  535
               +SV  S   ELRY CCFLWVDVS  VL  YL KRVD+M++ GM +EL+ +YS      
Sbjct  162   GSHSVVSS---ELRYDCCFLWVDVSVKVLTDYLAKRVDDMLELGMFDELAEFYSPEDEDH  218

Query  534   PSNPLSRTGLAKAIGVPEFAAYFRAPRGGE------RRERL----YAEAVREIKENTRLL  385
               +  +RTGL KAIGVPEF  YF   R G+       R+R+    + EAVR IKENT  L
Sbjct  219   DEDSATRTGLRKAIGVPEFDRYFEKFRPGDVEGEDPGRDRVRRGAFEEAVRAIKENTCHL  278

Query  384   AERQLRKIQRLREVGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFL  205
             A+RQ+ KI RL+   GW++ R++AT +F AAM S+S  +  EIWE QV++PS+KIV +FL
Sbjct  279   AKRQIGKILRLKG-AGWDLRRLDATESFRAAMTSDSGEKCTEIWEKQVLEPSVKIVSRFL  337

Query  204   LE  199
              E
Sbjct  338   DE  339



>ref|XP_002311463.1| hypothetical protein POPTR_0008s12060g [Populus trichocarpa]
 gb|EEE88830.1| hypothetical protein POPTR_0008s12060g [Populus trichocarpa]
Length=362

 Score =   286 bits (731),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 159/306 (52%), Positives = 203/306 (66%), Gaps = 31/306 (10%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG GK+R S+DLATR+   +E+INSDK+QVY+GLDITTNKIT+ +R GV HHL+GEF
Sbjct  67    MGATGCGKTRVSIDLATRF--QSEIINSDKMQVYEGLDITTNKITIQDRLGVPHHLLGEF  124

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             +  +   E + +++R AG   IS IV R  +P +VGGSNS I+AL+V+RFNPEL+VFD  
Sbjct  125   DPDDG--ELTPSEYRLAGGLAISGIVSRQNLPIVVGGSNSLIHALVVDRFNPELNVFDG-  181

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
             CN V      +LRY CCFLWVDVS PVL  YL KRVDEM+DSGML+ELS +Y    +  S
Sbjct  182   CNPVS----TQLRYNCCFLWVDVSLPVLCDYLCKRVDEMLDSGMLDELSEYYGS-VDAAS  236

Query  516   RTGLAKAIGVPEFAAYFRA-PRGG-----------ERRERLYAEAVREIKENTRLLAERQ  373
             + GL KAIGVPEF  YF+  P G              R  +Y   VREIKENT  LA+RQ
Sbjct  237   QIGLRKAIGVPEFDRYFKKYPPGSGCGRGIGVEWDRVRRGVYEVCVREIKENTCQLAKRQ  296

Query  372   LRKIQRLREVGGWEMHRINATAAFAAAMGSESESETA--------EIWENQVVQPSMKIV  217
             + KI RL+   GW++ R++AT +F   M   S+            E+W   V++PSMKIV
Sbjct  297   IGKILRLKG-AGWDLKRVDATESFREVMTVTSDDHIKKRKKKRWMEVWGRDVMEPSMKIV  355

Query  216   EKFLLE  199
             ++FL E
Sbjct  356   KRFLEE  361



>emb|CDX95461.1| BnaC01g33530D [Brassica napus]
Length=324

 Score =   284 bits (727),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 152/296 (51%), Positives = 205/296 (69%), Gaps = 29/296 (10%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MG+TG+GKSR SVDLATR+  +AE+INSDK+Q YKGL+ITTN+IT+PE+ GV HHL+GE 
Sbjct  47    MGSTGTGKSRLSVDLATRF--SAEIINSDKMQFYKGLEITTNQITIPEKCGVPHHLLGEL  104

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
                   PE +A++FR+  +  ISD+  RGK+P I GGSNSYI+ALLVE F+PE + F   
Sbjct  105   PVDG--PELTASEFRSLASGSISDMTSRGKLPIIAGGSNSYIHALLVEHFDPETNPFSKP  162

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWY-SDPSNPL  520
                      +ELRY CCFLWVDVS  VL  YL KRVD+MM+SGM EEL+ +Y S  S   
Sbjct  163   L------IPIELRYDCCFLWVDVSVSVLYHYLSKRVDQMMESGMFEELADFYNSRDSRST  216

Query  519   SRTGLAKAIGVPEFAAYF--RAPRGGER-------RERLYAEAVREIKENTRLLAERQLR  367
             +RTG+ K+IGVPEF  YF    P   ++       R+  Y EAV+EIKENT  L+++Q+ 
Sbjct  217   TRTGIHKSIGVPEFDRYFGVYPPEKNDKVCGWDPARKVAYEEAVQEIKENTWRLSKKQID  276

Query  366   KIQRLREVGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
             +I +LR   GWE+HR++ATA+F A        ++ E+W+  V++ S+KIV++F+LE
Sbjct  277   RIMKLRS-SGWEIHRLDATASFRA--------QSREVWDKNVLEKSVKIVKRFVLE  323



>ref|XP_004300976.1| PREDICTED: adenylate isopentenyltransferase-like [Fragaria vesca 
subsp. vesca]
Length=347

 Score =   285 bits (728),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 152/292 (52%), Positives = 201/292 (69%), Gaps = 13/292 (4%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAA-EVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGE  880
             MGATG+GKSR S+DLA+R+ + + EVINSDKIQVYKGLDITTNKI  P+RRG+ HHL+GE
Sbjct  62    MGATGAGKSRLSIDLASRFPSCSFEVINSDKIQVYKGLDITTNKIPFPDRRGISHHLLGE  121

Query  879   FEASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDD  700
              +  +   E S ADFR      + DI  R +VP +VGGSNS I+ALLV+RF P ++VF++
Sbjct  122   LDPLDG--ELSPADFRRLAGRAVYDIATRKRVPMLVGGSNSLIHALLVDRFEPGVNVFEN  179

Query  699   ECNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPL  520
                        ELRY CCFLWVDVS  VL  YL KRVDEM++SGM EEL+ + +   +  
Sbjct  180   GAELASS----ELRYDCCFLWVDVSLVVLAEYLLKRVDEMLESGMYEELAEFCATEDDEE  235

Query  519   SRTGLAKAIGVPEFAAYFRAPRGGERRERL-----YAEAVREIKENTRLLAERQLRKIQR  355
              RTGL KAIGVPEF+ +F+    G   ++L     Y +AV+ IK+NT  LA++Q+ KI R
Sbjct  236   VRTGLRKAIGVPEFSRFFKQFPPGRVHDQLRRGAAYNDAVKAIKDNTCQLAKKQIGKILR  295

Query  354   LREVGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
             L+    W++ R++AT AF A + S+     +EIWE QVV+PS+KIV++FL E
Sbjct  296   LKGSAKWDLQRLDATEAFRAVLSSDGR-RWSEIWEEQVVEPSVKIVKQFLAE  346



>ref|XP_007142919.1| hypothetical protein PHAVU_007G028100g [Phaseolus vulgaris]
 gb|ESW14913.1| hypothetical protein PHAVU_007G028100g [Phaseolus vulgaris]
Length=357

 Score =   285 bits (728),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 152/295 (52%), Positives = 204/295 (69%), Gaps = 18/295 (6%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATGSGKSR S+DLAT  F  +E+INSDK+QVY+GLDITTNKI   +RR V HHL+G+ 
Sbjct  38    MGATGSGKSRLSIDLAT-LFPVSEIINSDKMQVYRGLDITTNKIPHAQRRAVPHHLLGDV  96

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             + S   PEFS ADFR      I DI  R  +P +VGGSNS+++ALLV+ F P+ +VF   
Sbjct  97    DPS--LPEFSPADFRRRAGHLIEDINRRDSLPIVVGGSNSFVHALLVQDFQPDSNVF---  151

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                  +    ELRYRCCFLWVD++ PVL++YL  RVD+M++SGM++EL++++   ++  S
Sbjct  152   -RQGEELISSELRYRCCFLWVDIAFPVLSQYLCDRVDDMLESGMVDELAQFFDPEASRES  210

Query  516   RTGLAKAIGVPEFAAYFR---------APRGGERRERLYAEAVREIKENTRLLAERQLRK  364
              +G+ KAIGVPEF  YF           P     RER Y EAVR IKENT  LAERQ+ K
Sbjct  211   ESGIRKAIGVPEFDRYFNKYPPWAGPAGPGQDPLRERAYEEAVRAIKENTCELAERQMEK  270

Query  363   IQRLREVGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
             I+RL+   GW++ RI+AT AF   + S S +  +++WE QV++PS+KIV++FL+E
Sbjct  271   IERLKR-AGWDLRRIDATEAFRMVLTSGS-NHGSDVWERQVLEPSVKIVKRFLME  323



>ref|XP_010265118.1| PREDICTED: adenylate isopentenyltransferase-like [Nelumbo nucifera]
Length=338

 Score =   283 bits (723),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 161/303 (53%), Positives = 206/303 (68%), Gaps = 34/303 (11%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MG TGSGKSR S+DLATR+   AEVINSDK+QVYKGLDITTNK+ M ER GV HHL+G  
Sbjct  53    MGVTGSGKSRLSIDLATRF--PAEVINSDKMQVYKGLDITTNKMPMHERLGVPHHLLGVV  110

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             ++S    EFS +D+R  GA  IS I  R ++P +VGGSNS+IYALL +RFNP+     D 
Sbjct  111   DSSYG--EFSPSDYRLFGASVISSICARRRLPLVVGGSNSFIYALLSDRFNPD----SDG  164

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWY-----SDP  532
              NSV      +LRY CCFLWVDVS  VL  YL +RVD+M+ +GM+EEL+ +Y     SDP
Sbjct  165   LNSV----SADLRYNCCFLWVDVSLTVLYEYLSQRVDDMLAAGMVEELAEFYDPEAESDP  220

Query  531   SNPLSRTGLAKAIGVPEFAAYFRA------------PRGGERRERLYAEAVREIKENTRL  388
                  + G+ KAIGVPEF  YFR              R G RRE L+ EAV+ IK+NT  
Sbjct  221   KR--DQVGIRKAIGVPEFDRYFRKFPPGGHFRSTDIERDGARRE-LFEEAVKAIKDNTNQ  277

Query  387   LAERQLRKIQRLREVGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKF  208
             LA+RQL+KI RLR   GW++ R++AT AF A + S++  +++EIWE +++ PS+KIV +F
Sbjct  278   LAKRQLKKIMRLRS-AGWDLRRLDATEAFRAVLASDT-GKSSEIWEEELLGPSVKIVNRF  335

Query  207   LLE  199
             L E
Sbjct  336   LEE  338



>emb|CDY07385.1| BnaA07g24640D [Brassica napus]
Length=320

 Score =   282 bits (722),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 147/286 (51%), Positives = 193/286 (67%), Gaps = 18/286 (6%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             +GATG+GKSR SVD+ATR    +E+INSDKIQ+YKGL+ITTN+IT+P+RRGV HHL+G  
Sbjct  52    LGATGAGKSRLSVDIATRL--PSEIINSDKIQLYKGLEITTNQITIPDRRGVPHHLLGYL  109

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
              + +   E +A  FR A +  +SDI  R K+P I GGSN+ ++ALL ERF+P++D F   
Sbjct  110   PSEDG--ELTARGFRIAASNAVSDITSRKKLPIIAGGSNTLVHALLAERFDPKIDPFG--  165

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                   S   ELRY CCF+WVDVS  VL  YL KRVD+MM SGM EELSR+Y       +
Sbjct  166   ----SSSISRELRYNCCFIWVDVSETVLFEYLLKRVDDMMGSGMFEELSRFYDPVKASTT  221

Query  516   RTGLAKAIGVPEFAAYFRAPRGGERRERLYAEAVREIKENTRLLAERQLRKIQRLREVGG  337
             R G+ KAIGVPEF  YF+           Y + V EIKENT  LA+RQ+ KI++LR+  G
Sbjct  222   RVGIRKAIGVPEFDGYFKMRAA-------YDKVVEEIKENTLRLAKRQVVKIEKLRD-AG  273

Query  336   WEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
             W++ R++ATA+F A +      E   IWE QV++PS+KIV + L+E
Sbjct  274   WDIKRVDATASFRAVLMGRRRREWRGIWEEQVLEPSVKIVNRLLVE  319



>emb|CDY04228.1| BnaC06g25870D [Brassica napus]
Length=319

 Score =   282 bits (721),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 149/286 (52%), Positives = 196/286 (69%), Gaps = 19/286 (7%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             +GATG+GKSR SVD+ATR    +E+INSDKIQ+YKGL+ITTN+IT+P+RRGV HHL+G  
Sbjct  52    LGATGAGKSRLSVDIATRL--PSEIINSDKIQLYKGLEITTNQITIPDRRGVPHHLLGYL  109

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
              + +   E +A  FR A +  +S I  R K+P I GGSN++++ALL ERF+P++D F   
Sbjct  110   RSEDG--ELTAGGFRIAASNAVSGITSRKKLPIIAGGSNTFVHALLAERFDPKIDSFG--  165

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                   S   ELRY CCF+WVDVS  VL  YL KRVDEMM SGM EELS +Y      ++
Sbjct  166   ----SGSICRELRYNCCFVWVDVSETVLFEYLLKRVDEMMGSGMFEELSGFYDPVKASMT  221

Query  516   RTGLAKAIGVPEFAAYFRAPRGGERRERLYAEAVREIKENTRLLAERQLRKIQRLREVGG  337
             R G+ KAIGVPEF  YF+           Y +AV EIKENT  LA+RQ+ KI++LR+  G
Sbjct  222   RFGIRKAIGVPEFDGYFKMRAA-------YDKAVEEIKENTLRLAKRQIVKIEKLRD-AG  273

Query  336   WEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
             W++ R++ATA+F+A M      E  EIWE QV++PS+KIV + L+E
Sbjct  274   WDIKRVDATASFSAVMMGR-RREWREIWEEQVLKPSVKIVNQLLVE  318



>dbj|BAE43826.1| isopentenyltransferase [Brassica rapa subsp. pekinensis]
Length=348

 Score =   282 bits (722),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 156/293 (53%), Positives = 201/293 (69%), Gaps = 18/293 (6%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             +GATG+GKSR SVDLATR+   +E+INSDKIQVY+GL+ITTN+IT+P+RRGV HHL+G  
Sbjct  66    LGATGAGKSRLSVDLATRF--PSEIINSDKIQVYEGLEITTNQITIPDRRGVPHHLLGYL  123

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
              + +   E +A DFRA  +  +SDI+ R K+P I GGSNS+++ALL ERF+P++D F   
Sbjct  124   PSEDG--ELTAGDFRADASNAVSDIISRKKLPIIAGGSNSFVHALLAERFDPKIDPF---  178

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                   S   +LRY  CF+WVDVS PVL  YL KRVDEMM SGM EELS +Y       +
Sbjct  179   ---ASSSICRDLRYDSCFIWVDVSEPVLFEYLLKRVDEMMGSGMFEELSGFYDPVKASRA  235

Query  516   RTGLAKAIGVPEFAAYFRA------PRGGERRERLYAEAVREIKENTRLLAERQLRKIQR  355
             R G+ KAIGVPEF  YF+        +    R   Y +AV +IKENT  LA RQ+ KI+R
Sbjct  236   RFGIRKAIGVPEFDGYFKMYPPEKEVKWDSGRRAAYDKAVEDIKENTLRLARRQVWKIER  295

Query  354   LREVGGWEMHRINATAAF-AAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
             LRE  GW++ R++ATA+F A  M S S  E  EIWE QV++PS+KIV + L+E
Sbjct  296   LRE-AGWDIKRVDATASFRAVMMSSSSSREWREIWEEQVLEPSVKIVNRLLVE  347



>ref|XP_010470796.1| PREDICTED: adenylate isopentenyltransferase 1, chloroplastic-like 
[Camelina sativa]
Length=367

 Score =   283 bits (723),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 150/298 (50%), Positives = 204/298 (68%), Gaps = 21/298 (7%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             +GATG+GKS+ SVDLATR+   +E+INSDKIQVY+GL+ITTN+IT+ ERRGV HHL+G  
Sbjct  78    LGATGAGKSKLSVDLATRF--PSEIINSDKIQVYEGLEITTNQITLQERRGVPHHLLGYL  135

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
                    E +AADFR+A +  + DI  R K+P I GGSNS+++ALL +RF+P++D F   
Sbjct  136   NPEHG--ELTAADFRSAASNAVEDITSRQKLPIIAGGSNSFVHALLSQRFDPKIDPFSSG  193

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                +      +LRY+CCF+WVDVS  VL  YL KRVDEMMDSGM EELS +Y    + L 
Sbjct  194   SGLISS----DLRYQCCFIWVDVSETVLYEYLLKRVDEMMDSGMFEELSGFYDPVKSGLE  249

Query  516   -RTGLAKAIGVPEFAAYFR--APRGGER----RERLYAEAVREIKENTRLLAERQLRKIQ  358
              R G+ KAIGVPEF  YF+   P G  +    R+  Y +AV +IK NT  LA+RQ++KI+
Sbjct  250   PRFGIRKAIGVPEFDGYFKEYPPAGTIKWDALRKAAYDKAVDDIKRNTWTLAKRQIKKIE  309

Query  357   RLREVGGWEMHRINATAAFAAAMGSESESETA-----EIWENQVVQPSMKIVEKFLLE  199
              L++  GW++ R++ATA+F   M   + SE       E+WE QV++PS+KIV++ L+E
Sbjct  310   MLKD-AGWKIQRVDATASFKEVMKMSTSSEKKTKKWREVWEEQVLEPSVKIVKRLLVE  366



>ref|XP_003536680.2| PREDICTED: adenylate isopentenyltransferase-like [Glycine max]
Length=328

 Score =   281 bits (720),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 159/313 (51%), Positives = 219/313 (70%), Gaps = 15/313 (5%)
 Frame = -1

Query  1110  WARAAIvggeekekvvvVMGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTN  931
             W R        K+KVVV+MGATGSGKSR S+DLAT  F  +E+INSDK+QVY+GLDITTN
Sbjct  22    WPRMDASFHRRKDKVVVIMGATGSGKSRLSIDLAT-LFPTSEIINSDKMQVYRGLDITTN  80

Query  930   KITMPERRGVEHHLIGEFEASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYI  751
             KI   +RRGV HHL+G+ + ++   EFS ADFR   A+ I+DI  R  +P +VGGSNS++
Sbjct  81    KIPTAQRRGVPHHLLGDVD-TDHYGEFSPADFRHHAADLIADITRRKNLPIVVGGSNSFV  139

Query  750   YALLVERFNPEL--DVFDDECNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMM  577
             +ALLV+ F+P    +VF  +          ELRYRCCFLWVD++ PVL++YL  RVD+M+
Sbjct  140   HALLVQNFDPHSHSNVFQQQQEEA--LISSELRYRCCFLWVDIAFPVLSQYLRDRVDDML  197

Query  576   DSGMLEELSRWYSDPSNPLSRTGLAKAIGVPEFAAYF-RAP----RGGER--RERLYAEA  418
             DSGM++EL++++   +   +  G+ KAIGVPEF  +F + P    +GG+   RER Y EA
Sbjct  198   DSGMVDELAQFFDPDAARRTGFGIRKAIGVPEFDRFFNKYPPSMGQGGDDPLRERAYEEA  257

Query  417   VREIKENTRLLAERQLRKIQRLREVGGWEMHRINATAAFAAAMGSESESETAEIWENQVV  238
             V+ IK+NT  LAERQ+ KI+RL+   GW++ RI+AT AF   + S S S  + +WE QV+
Sbjct  258   VKAIKDNTCELAERQIGKIERLKR-AGWDLRRIDATEAFRMVLTSGS-SNGSGVWERQVL  315

Query  237   QPSMKIVEKFLLE  199
             +PS+KIV++FL+E
Sbjct  316   EPSVKIVKRFLME  328



>emb|CDY44896.1| BnaA02g13860D [Brassica napus]
Length=335

 Score =   281 bits (719),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 154/287 (54%), Positives = 198/287 (69%), Gaps = 19/287 (7%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             +GATG+GKSR SVDLATR+   +E+INSDKIQVY+GL+ITTN+IT P+RRGV HHL+G  
Sbjct  66    LGATGAGKSRLSVDLATRF--PSEIINSDKIQVYEGLEITTNQITFPDRRGVPHHLLGYL  123

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
              + +   E +A DFRA  +  +SDI+ R K+P I GGSNS+++ALL ERF+P++D F   
Sbjct  124   PSEDG--ELTAGDFRADASNAVSDIISRKKLPIIAGGSNSFVHALLAERFDPKIDPF---  178

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                   S   +LRY  CF+WVDVS PVL  YL KRVDEMM SGM EELS +Y       +
Sbjct  179   ---ASSSICRDLRYDSCFVWVDVSEPVLFEYLLKRVDEMMGSGMFEELSGFYDPVKASRA  235

Query  516   RTGLAKAIGVPEFAAYFRAPRGGERRERLYAEAVREIKENTRLLAERQLRKIQRLREVGG  337
             R G+ KAIGVPEF  YF+           Y +AV +IKENT  LA RQ+ KI++LRE  G
Sbjct  236   RFGIRKAIGVPEFDGYFKMRAA-------YDKAVEDIKENTLRLARRQVWKIEKLRE-AG  287

Query  336   WEMHRINATAAF-AAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
             W++ R++ATA+F A  M S S  E  EIWE QV++PS+KIV + L+E
Sbjct  288   WDIKRVDATASFRAVMMSSSSSREWREIWEEQVLEPSVKIVNRLLVE  334



>ref|XP_009105044.1| PREDICTED: adenylate isopentenyltransferase 1, chloroplastic-like 
[Brassica rapa]
Length=333

 Score =   281 bits (719),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 150/292 (51%), Positives = 197/292 (67%), Gaps = 17/292 (6%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             +GATG+GKSR SVD+ATR    +E+INSDKIQ+YKGL+ITTN+IT+P+RRGV HHL+G  
Sbjct  52    LGATGAGKSRLSVDIATRL--PSEIINSDKIQLYKGLEITTNQITIPDRRGVPHHLLGYL  109

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
              + +   E +A  FR A +  +SDI  R K+P I GGSN+ ++ALL ERF+P++D F   
Sbjct  110   PSEDG--ELTARGFRIAASNAVSDITSRKKLPIIAGGSNTLVHALLAERFDPKIDPFG--  165

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                   S   ELRY CCF+WVDVS  VL  YL KRVD+MM SGM EELSR+Y       +
Sbjct  166   ----SSSISRELRYNCCFIWVDVSETVLFEYLLKRVDDMMGSGMFEELSRFYDPVKASTT  221

Query  516   RTGLAKAIGVPEFAAYFRA---PRGGE---RRERLYAEAVREIKENTRLLAERQLRKIQR  355
             R G+ KAIGVPEF  YF+     + GE    R   Y + V EIKENT  LA+RQ+ KI++
Sbjct  222   RVGIRKAIGVPEFDGYFKMYPPEKEGEWDSGRRAAYDKVVEEIKENTLRLAKRQVVKIEK  281

Query  354   LREVGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
             LR+  GW++ R++ATA+F A +      E   IWE QV++PS+KIV + L+E
Sbjct  282   LRD-AGWDIKRVDATASFRAVLMGRRRREWRGIWEEQVLEPSVKIVNRLLVE  332



>ref|XP_009127634.1| PREDICTED: adenylate isopentenyltransferase 1, chloroplastic 
[Brassica rapa]
Length=366

 Score =   282 bits (722),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 156/293 (53%), Positives = 201/293 (69%), Gaps = 18/293 (6%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             +GATG+GKSR SVDLATR+   +E+INSDKIQVY+GL+ITTN+IT+P+RRGV HHL+G  
Sbjct  66    LGATGAGKSRLSVDLATRF--PSEIINSDKIQVYEGLEITTNQITIPDRRGVPHHLLGYL  123

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
              + +   E +A DFRA  +  +SDI+ R K+P I GGSNS+++ALL ERF+P++D F   
Sbjct  124   PSEDG--ELTAGDFRADASNAVSDIISRKKLPIIAGGSNSFVHALLAERFDPKIDPF---  178

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                   S   +LRY  CF+WVDVS PVL  YL KRVDEMM SGM EELS +Y       +
Sbjct  179   ---ASSSICRDLRYDSCFIWVDVSEPVLFEYLLKRVDEMMGSGMFEELSGFYDPVKASRA  235

Query  516   RTGLAKAIGVPEFAAYFRA------PRGGERRERLYAEAVREIKENTRLLAERQLRKIQR  355
             R G+ KAIGVPEF  YF+        +    R   Y +AV +IKENT  LA RQ+ KI+R
Sbjct  236   RFGIRKAIGVPEFDGYFKMYPPEKEVKWDSGRRAAYDKAVEDIKENTLRLARRQVWKIER  295

Query  354   LREVGGWEMHRINATAAF-AAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
             LRE  GW++ R++ATA+F A  M S S  E  EIWE QV++PS+KIV + L+E
Sbjct  296   LRE-AGWDIKRVDATASFRAVMMSSSSSREWREIWEEQVLEPSVKIVNRLLVE  347



>ref|XP_006448462.1| hypothetical protein CICLE_v10015747mg [Citrus clementina]
 gb|ESR61702.1| hypothetical protein CICLE_v10015747mg [Citrus clementina]
Length=356

 Score =   282 bits (721),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 158/300 (53%), Positives = 201/300 (67%), Gaps = 22/300 (7%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKS  S+DLATR+F  +E+INSDK+QVYKGLDITTNKI   +R  V HHL+GEF
Sbjct  65    MGATGTGKSGLSIDLATRFF-PSEIINSDKMQVYKGLDITTNKIPSHKRHNVPHHLLGEF  123

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
                +   EF+  DFR      ISDI+ R K P +VGGSNS+IY+LLV+ ++P L+VFDD 
Sbjct  124   VPDDV--EFTPDDFRLQADNAISDIISRKKTPLLVGGSNSFIYSLLVQEYDPGLNVFDDR  181

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDP----S  529
              +S  DS    LRY CCFLWVD S  +L  YL KRVD+M++SGM EEL+ ++       +
Sbjct  182   FDS--DSVSSSLRYNCCFLWVDSSLQLLYDYLNKRVDDMLESGMFEELAEFFDSDRMRNN  239

Query  528   NPLSR-TGLAKAIGVPEFAAYFR--APRGGE-------RRERLYAEAVREIKENTRLLAE  379
             N +S   GL KAIGVPEF  YF+   P   E        R  +Y EAVREIKENTR LA+
Sbjct  240   NSVSLGVGLLKAIGVPEFERYFKMYPPASVEVKGEWDPVRRGVYQEAVREIKENTRRLAK  299

Query  378   RQLRKIQRLREVGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
             RQ+ KI +L E  GW++ R++AT AF   M  + E     +WE QVV+PS+KIV++FL E
Sbjct  300   RQIDKILKL-ERAGWDLRRLDATTAFRMLMNGDQEWRC--VWERQVVEPSVKIVKRFLDE  356



>ref|XP_002888665.1| cytokinin synthase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64924.1| cytokinin synthase [Arabidopsis lyrata subsp. lyrata]
Length=353

 Score =   281 bits (720),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 152/296 (51%), Positives = 205/296 (69%), Gaps = 20/296 (7%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             +GATG+GKSR SVDLATR+   +E+INSDKIQVY+GL+ITTN+IT+P+RRGV HHL+G  
Sbjct  67    LGATGAGKSRLSVDLATRF--PSEIINSDKIQVYEGLEITTNQITLPDRRGVPHHLLGVL  124

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
                    E +A +FR+A +  + +I  R K+P I GGSNS+++A+L +RF+P++D F   
Sbjct  125   NPEHG--ELTAGEFRSAASNVVKEITTRQKLPIIAGGSNSFVHAVLAQRFDPKIDPFSSG  182

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDP--SNP  523
                +      +LRY+CCF+WVDVS  VL  YL KRVDEMMDSGM EELS +Y DP  S  
Sbjct  183   SGLISS----DLRYKCCFIWVDVSETVLYDYLLKRVDEMMDSGMFEELSGFY-DPVKSGL  237

Query  522   LSRTGLAKAIGVPEFAAYFR--APRGGER-----RERLYAEAVREIKENTRLLAERQLRK  364
               R G+ KAIGVPEF  YF+   P    +     R+  Y +AV +IK NT  LA+RQ++K
Sbjct  238   KPRFGIRKAIGVPEFDGYFKEYPPEKMIKWDDALRKAAYDKAVEDIKRNTWTLAKRQIKK  297

Query  363   IQRLREVGGWEMHRINATAAFAAA-MGSESESETAEIWENQVVQPSMKIVEKFLLE  199
             I+ L++  GWE+ R++ATA+F A  M S SE +  EIWE QV++PS+KIV + L+E
Sbjct  298   IEMLKD-AGWEIERVDATASFKAVMMKSSSEKKWREIWEEQVLEPSVKIVNRHLVE  352



>ref|XP_010264047.1| PREDICTED: adenylate isopentenyltransferase-like [Nelumbo nucifera]
Length=347

 Score =   281 bits (719),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 155/301 (51%), Positives = 205/301 (68%), Gaps = 28/301 (9%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MG TG+GKSR S+++ATR+   AEVINSDK+QVY+GLDITTNKI M ER GV HHL+G  
Sbjct  57    MGVTGTGKSRLSIEIATRF--PAEVINSDKMQVYRGLDITTNKIPMHERLGVPHHLLGVV  114

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             + S+   E S++++R  GA  IS I  R ++P +VGGSNS+I+AL+ +RF+P  D  D  
Sbjct  115   DPSDG--ELSSSEYRLLGASAISAISARHRLPLVVGGSNSFIHALVSDRFDPGSDGLDG-  171

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSD----PS  529
              NSV      ELRY CCFLWVDVS PVL +YL +RVD+M+  GM EEL+ +Y       S
Sbjct  172   LNSVS----AELRYDCCFLWVDVSLPVLYKYLARRVDDMLHVGMFEELAVFYEQEGKRKS  227

Query  528   NPLSRTGLAKAIGVPEFAAYFRAPRGGE-------------RRERLYAEAVREIKENTRL  388
             +   R G+ KAIG+PEF  YFR  R G+              R  L+ EAV+ IK+NT  
Sbjct  228   HTARRVGIRKAIGLPEFVNYFRVFRPGDGMTSTLTQLEGEVERRVLFEEAVKAIKDNTNE  287

Query  387   LAERQLRKIQRLREVGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKF  208
             LA+RQL KIQRLR  GGW++ R++AT AF A + S+S  +++EIWE++V+ PS+KIV +F
Sbjct  288   LAKRQLEKIQRLRS-GGWDLQRLDATEAFRAVLASDS-VKSSEIWESEVLGPSVKIVSRF  345

Query  207   L  205
             L
Sbjct  346   L  346



>ref|XP_009112114.1| PREDICTED: adenylate isopentenyltransferase 8, chloroplastic-like 
[Brassica rapa]
 emb|CDY18571.1| BnaA01g26240D [Brassica napus]
Length=324

 Score =   280 bits (715),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 151/296 (51%), Positives = 204/296 (69%), Gaps = 29/296 (10%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MG+TG+GKSR SVDLATR+  +AE+INSDK+Q YKGL+ITTN+IT+PER GV HHL+GE 
Sbjct  47    MGSTGTGKSRLSVDLATRF--SAEIINSDKMQFYKGLEITTNQITIPERCGVPHHLLGEL  104

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
                   PE +A++FR+  +  IS++  RGK+P I GGSNS+I+ALLVE F+PE + F   
Sbjct  105   PVDG--PELTASEFRSLASGFISEMTSRGKLPIIAGGSNSFIHALLVEHFDPETNPFSKT  162

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWY-SDPSNPL  520
                       ELRY CCFLWVDVS  VL  YL KRVD+MM+SGM EEL+ +Y S  S   
Sbjct  163   L------IPTELRYDCCFLWVDVSVSVLYHYLSKRVDQMMESGMFEELADFYNSRDSRST  216

Query  519   SRTGLAKAIGVPEFAAYF--RAPRGGER-------RERLYAEAVREIKENTRLLAERQLR  367
             +RTG+ K+IGVPEF  YF    P   ++       R+  Y EAV+EIKENT  L+++Q+ 
Sbjct  217   TRTGIHKSIGVPEFDRYFGVYPPEKNDKVCGWDPARKVAYEEAVQEIKENTWRLSKKQID  276

Query  366   KIQRLREVGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
             +I +LR   GWE+HR++ATA+F A        ++ E+W+  V++ S+KIV++F+LE
Sbjct  277   RIMKLRS-SGWEIHRLDATASFRA--------QSREVWDKNVLEKSVKIVKRFVLE  323



>dbj|BAB59029.1| cytokinin synthase [Arabidopsis thaliana]
Length=357

 Score =   280 bits (717),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 151/296 (51%), Positives = 204/296 (69%), Gaps = 20/296 (7%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             +GATG+GKSR SVDLATR+   +E+INSDKIQVY+GL+ITTN+IT+ +RRGV HHL+G  
Sbjct  71    LGATGAGKSRLSVDLATRF--PSEIINSDKIQVYEGLEITTNQITLQDRRGVPHHLLGVI  128

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
                    E +A +FR+A +  + +I  R KVP I GGSNS+++ALL +RF+P+ D F   
Sbjct  129   NPEHG--ELTAGEFRSAASNVVKEITSRQKVPIIAGGSNSFVHALLAQRFDPKFDPFSSG  186

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDP--SNP  523
                +      +LRY CCF+WVDVS  VL  YL +RVDEMMDSGM EELSR+Y DP  S  
Sbjct  187   SCLISS----DLRYECCFIWVDVSETVLYEYLLRRVDEMMDSGMFEELSRFY-DPVKSGL  241

Query  522   LSRTGLAKAIGVPEFAAYF-------RAPRGGERRERLYAEAVREIKENTRLLAERQLRK  364
              +R G+ KAIGVPEF  YF       +  +    R+  Y +AV +IK NT  LA+RQ++K
Sbjct  242   ETRFGIRKAIGVPEFDGYFKEYPPEKKMIKWDALRKAAYDKAVDDIKRNTWTLAKRQVKK  301

Query  363   IQRLREVGGWEMHRINATAAFAAA-MGSESESETAEIWENQVVQPSMKIVEKFLLE  199
             I+ L++  GWE+ R++ATA+F A  M S SE +  EIWE QV++PS+KIV++ L++
Sbjct  302   IEMLKD-AGWEIERVDATASFKAVMMKSSSEKKWREIWEEQVLEPSVKIVKRHLVQ  356



>emb|CDX81518.1| BnaC02g18220D [Brassica napus]
Length=348

 Score =   280 bits (715),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 157/293 (54%), Positives = 201/293 (69%), Gaps = 18/293 (6%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             +GATG+GKSR SVDLATR+   +E+INSDKIQVY+GL+ITTN+IT+P+RRGV HHL+G  
Sbjct  66    LGATGAGKSRLSVDLATRF--PSEIINSDKIQVYEGLEITTNQITIPDRRGVPHHLLGYL  123

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
              + +   E +A DFR   +  +SDIV R K+P I GGSNS+++ALL ERF+P++D F   
Sbjct  124   PSEDG--ELTAGDFRVDASNAVSDIVSRKKLPIIAGGSNSFVHALLAERFDPKIDPFS--  179

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                   S   +LRY  CF+WVDVS PVL  YL KRVDEMM SGM EELS +Y       +
Sbjct  180   ----SSSICRDLRYDSCFIWVDVSEPVLFEYLLKRVDEMMGSGMFEELSGFYDPVKASRA  235

Query  516   RTGLAKAIGVPEFAAYFRA-PRGGE-----RRERLYAEAVREIKENTRLLAERQLRKIQR  355
             R G+ KAIGVPEF  YF+  P   E      R   Y +AV +IKENT  LA RQ+ KI++
Sbjct  236   RFGIRKAIGVPEFDGYFKMYPPEKEIKWDSGRRAAYDKAVGDIKENTLRLARRQVWKIEK  295

Query  354   LREVGGWEMHRINATAAF-AAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
             LRE  GW++ R++ATA+F A  M S S  E  EIWE QV++PS+KIV + L+E
Sbjct  296   LRE-AGWDIKRVDATASFRAVMMSSSSSREWREIWEEQVLEPSVKIVNRLLVE  347



>ref|XP_009356860.1| PREDICTED: adenylate isopentenyltransferase-like [Pyrus x bretschneideri]
Length=411

 Score =   281 bits (720),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 157/302 (52%), Positives = 204/302 (68%), Gaps = 26/302 (9%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR S+DLATR F   E++NSDKIQ+Y+GLDITTNK+ +PER GV HHL+GEF
Sbjct  75    MGATGAGKSRLSLDLATR-FPFFEIVNSDKIQLYRGLDITTNKLPLPERLGVPHHLLGEF  133

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             +  +   +F+ ADFRA   + +S I  R KVP +VGGSNS+I+A++ +RF P  +VF+  
Sbjct  134   DPRDG--DFTPADFRAVAGQVVSGITNRRKVPMLVGGSNSFIHAMVADRFEPGCNVFEPG  191

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDP-----  532
              ++   S   ELRY CCFLWVDVS  VL  YL KRVDEM+DSGM EEL+  + DP     
Sbjct  192   SDA---SLSAELRYNCCFLWVDVSMAVLTEYLSKRVDEMLDSGMFEELAE-FCDPDCQEK  247

Query  531   SNPLS-RTGLAKAIGVPEFAAYFRA-PRGGERRERL------YAEAVREIKENTRLLAER  376
              +P +  TGL KAIGVPEF  YF+  P+     +        Y EAVR IK+NT  LA+R
Sbjct  248   QDPAAVPTGLRKAIGVPEFTGYFKKYPQSKRDEDDDRERREAYEEAVRAIKDNTCQLAKR  307

Query  375   QLRKIQRLREVGGWEMHRINATAAFAAAMGSESESET-----AEIWENQVVQPSMKIVEK  211
             Q+ KI RLR  GGW++ R++AT AF A + + S         ++IWE QVV PS+KIV++
Sbjct  308   QIGKILRLRG-GGWDLRRLDATDAFRAVVATTSSDSDGGERWSDIWERQVVGPSVKIVKR  366

Query  210   FL  205
             FL
Sbjct  367   FL  368



>ref|NP_001288044.1| adenylate isopentenyltransferase-like [Malus domestica]
 gb|ADY80562.1| adenylate isopentenyltransferase [Malus domestica]
Length=370

 Score =   279 bits (714),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 156/303 (51%), Positives = 203/303 (67%), Gaps = 24/303 (8%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR S+DLATR F   E+INSDKIQ+Y+GLDITTNK+ +PER GV HHL+GE 
Sbjct  75    MGATGAGKSRLSLDLATR-FPFFEIINSDKIQLYRGLDITTNKLPLPERLGVPHHLLGEL  133

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             +  +   +F+ ADFRA   + +S I  R KVP +VGGSNS+I+A++ +RF P  +VF+  
Sbjct  134   DPRDG--DFTPADFRAVAGQVVSGITNRRKVPMLVGGSNSFIHAMVADRFEPGCNVFEPG  191

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWY----SDPS  529
              ++   S   ELRY CCFLWVDVS  VL  YL KRVDEM+DSGM EEL+ +      D  
Sbjct  192   SDA---SLSAELRYNCCFLWVDVSMAVLTEYLSKRVDEMLDSGMFEELAEFCDPDRQDKH  248

Query  528   NPLS-RTGLAKAIGVPEFAAYFRA-PRGGERRERL------YAEAVREIKENTRLLAERQ  373
             +P +  TGL KAIGVPEF  YF+  P+     +        Y EAVR IK+NT  LA+RQ
Sbjct  249   DPAAVPTGLRKAIGVPEFTRYFKKYPQSKRDEDDDRERRGAYEEAVRAIKDNTCQLAKRQ  308

Query  372   LRKIQRLREVGGWEMHRINATAAFAAAMGSESESET-----AEIWENQVVQPSMKIVEKF  208
             + K+ RLR  GGW++ R++AT AF A + + S         ++IWE QVV PS+KIV++F
Sbjct  309   IGKVLRLRG-GGWDLRRLDATDAFRAVVATTSSDSDGGERWSDIWERQVVGPSVKIVKRF  367

Query  207   LLE  199
             L E
Sbjct  368   LEE  370



>ref|XP_011022236.1| PREDICTED: adenylate isopentenyltransferase [Populus euphratica]
Length=363

 Score =   279 bits (713),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 154/306 (50%), Positives = 199/306 (65%), Gaps = 31/306 (10%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG GK+R S+DLATR+   +E+INSDK+QVY+GLDITTNKIT+ +R GV HHL+G F
Sbjct  67    MGATGCGKTRLSIDLATRF--QSEIINSDKMQVYEGLDITTNKITIQDRLGVPHHLLGAF  124

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             +  +   E + A++R AG   IS I  R  +P +VGGSNS I+AL+V+RFNPEL+VFD  
Sbjct  125   DPDDG--ELTPAEYRLAGGLAISGIFPRQNLPIVVGGSNSLIHALVVDRFNPELNVFDGS  182

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                  +    +LRY CCFLWVDVS PVL  YL KRVDEM+DSGML+ELS +Y    +  S
Sbjct  183   -----NPVSTQLRYNCCFLWVDVSLPVLCDYLCKRVDEMLDSGMLDELSEYYGS-VDAAS  236

Query  516   RTGLAKAIGVPEFAAYFR--APRGG----------ERRERLYAEAVREIKENTRLLAERQ  373
               GL KAIGVPEF  YF+   P  G            R  +Y + VREIKENT  LA+ Q
Sbjct  237   HIGLRKAIGVPEFDRYFKRYPPESGCGRGIGVEWDRVRRGVYEDCVREIKENTCQLAKGQ  296

Query  372   LRKIQRLREVGGWEMHRINATAAFAAAMGSESESETA--------EIWENQVVQPSMKIV  217
             + KI RL+   GW++ R++AT +F   M + S+            E+W   V++PSMKIV
Sbjct  297   IGKILRLKG-AGWDLKRVDATGSFREVMKATSDDHVKKRKKKRWMEVWGRDVLKPSMKIV  355

Query  216   EKFLLE  199
             ++FL E
Sbjct  356   KRFLEE  361



>ref|XP_009356257.1| PREDICTED: adenylate isopentenyltransferase-like [Pyrus x bretschneideri]
Length=370

 Score =   278 bits (712),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 159/303 (52%), Positives = 207/303 (68%), Gaps = 24/303 (8%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR S+DLATR F   E++NSDK+Q+Y+GLDITTNK+ +PER GV HHL+GEF
Sbjct  75    MGATGAGKSRLSLDLATR-FPFFEIVNSDKMQLYRGLDITTNKLPLPERLGVSHHLLGEF  133

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             +  +   +F+ ADFRA   + +S I  R KVP +VGGSNS+I+A++ ERF    +VF+  
Sbjct  134   DPLDG--DFTPADFRAVAGQVVSCITNRRKVPMLVGGSNSFIHAMVAERFELGSNVFEPG  191

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWY----SDPS  529
              ++   S   ELRY CCFLWVDVS  VL  YL KRVDEM+DSGM +EL+++      D  
Sbjct  192   FDA---SVSAELRYDCCFLWVDVSMAVLTEYLSKRVDEMLDSGMFDELAKFCEPDRQDKH  248

Query  528   NPLS-RTGLAKAIGVPEFAAYFRAPRGGER-------RERLYAEAVREIKENTRLLAERQ  373
             +P +  TGL KAIGVPEF  YF+     +R       R   Y EAVR IK+NT  LA+RQ
Sbjct  249   DPAAVPTGLRKAIGVPEFTRYFKKYPQSKRDEDDDLERRGAYEEAVRAIKDNTCQLAKRQ  308

Query  372   LRKIQRLREVGGWEMHRINATAAFAAAMG-SESESET----AEIWENQVVQPSMKIVEKF  208
             + KI RLR  GGW++ R++AT AF A +  S SE++     +EIWE QVV+PS KIV++F
Sbjct  309   IGKILRLRG-GGWDLRRLDATDAFRAVVATSTSENDGGERWSEIWERQVVEPSAKIVKRF  367

Query  207   LLE  199
             L E
Sbjct  368   LEE  370



>gb|ADY80561.1| adenylate isopentenyltransferase [Malus domestica]
Length=370

 Score =   278 bits (711),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 156/303 (51%), Positives = 204/303 (67%), Gaps = 24/303 (8%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR S+DLA+R F   E++NSDKIQ+Y+GLDITTNK+ +PER GV HHL+GEF
Sbjct  75    MGATGAGKSRLSLDLASR-FPFFEIVNSDKIQLYRGLDITTNKLPLPERLGVPHHLLGEF  133

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             +  +   +F+ ADFRA   + +S I  R KVP +VGGSNS+I+A++ ERF P  +VF+  
Sbjct  134   DPLDG--DFTPADFRAVAGQVVSGITNRRKVPMLVGGSNSFIHAMVAERFEPGSNVFEPG  191

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWY----SDPS  529
              ++   S   ELRY CCFLWVDVS  VL  YL KRVDEM+DSGM +EL+ +      D  
Sbjct  192   FDA---SVSAELRYNCCFLWVDVSMAVLTEYLSKRVDEMLDSGMFDELAEFCDPDRQDKK  248

Query  528   NPLS-RTGLAKAIGVPEFAAYFRA-PRGGERRERL------YAEAVREIKENTRLLAERQ  373
             +P +  TGL KAIGVPEF  YF+  P+     +        Y EAVR IK+NT  LA+RQ
Sbjct  249   DPAAVPTGLRKAIGVPEFTRYFKKYPQSKRDEDDDRERRGAYEEAVRVIKDNTCQLAKRQ  308

Query  372   LRKIQRLREVGGWEMHRINATAAFAAAMGSESESET-----AEIWENQVVQPSMKIVEKF  208
             + KI RLR  GGW++ R++AT AF A + + +         +EIWE QVV+PS KIV++F
Sbjct  309   IGKILRLRG-GGWDLRRLDATDAFRAVVATSTPENDGGERWSEIWERQVVEPSAKIVKRF  367

Query  207   LLE  199
             L E
Sbjct  368   LEE  370



>ref|NP_177013.1| adenylate isopentenyltransferase 1 [Arabidopsis thaliana]
 sp|Q94ID3.2|IPT1_ARATH RecName: Full=Adenylate isopentenyltransferase 1, chloroplastic; 
Short=AtIPT1; AltName: Full=Adenylate dimethylallyltransferase 
1; AltName: Full=Cytokinin synthase 1; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAG52395.1|AC011915_9 putative tRNA isopentenyl transferase; 11395-10322 [Arabidopsis 
thaliana]
 dbj|BAB59040.1| adenylate isopentenyltransferase [Arabidopsis thaliana]
 gb|AEE34796.1| adenylate isopentenyltransferase 1 [Arabidopsis thaliana]
Length=357

 Score =   277 bits (709),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 150/296 (51%), Positives = 203/296 (69%), Gaps = 20/296 (7%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             +GATG+GKSR SVDLATR+   +E+INSDKIQVY+GL+ITTN+IT+ +RRGV HHL+G  
Sbjct  71    LGATGAGKSRLSVDLATRF--PSEIINSDKIQVYEGLEITTNQITLQDRRGVPHHLLGVI  128

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
                    E +A +FR+A +  + +I  R KVP I GGSNS+++ALL +RF+P+ D F   
Sbjct  129   NPEHG--ELTAGEFRSAASNVVKEITSRQKVPIIAGGSNSFVHALLAQRFDPKFDPFSSG  186

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDP--SNP  523
                +      +LRY CCF+WVDVS  VL  YL +RVDEMMDSGM EELSR+Y DP  S  
Sbjct  187   SCLISS----DLRYECCFIWVDVSETVLYEYLLRRVDEMMDSGMFEELSRFY-DPVKSGL  241

Query  522   LSRTGLAKAIGVPEFAAYF-------RAPRGGERRERLYAEAVREIKENTRLLAERQLRK  364
              +R G+ KAIGVPEF  YF       +  +    R+  Y +AV +IK NT  LA+RQ++K
Sbjct  242   ETRFGIRKAIGVPEFDGYFKEYPPEKKMIKWDALRKAAYDKAVDDIKRNTWTLAKRQVKK  301

Query  363   IQRLREVGGWEMHRINATAAFAAA-MGSESESETAEIWENQVVQPSMKIVEKFLLE  199
             I+ L++  GWE+ R++ATA+F A  M S SE +  E WE QV++PS+KIV++ L++
Sbjct  302   IEMLKD-AGWEIERVDATASFKAVMMKSSSEKKWRENWEEQVLEPSVKIVKRHLVQ  356



>ref|XP_007044313.1| Cytokinin biosynthetic isopentenyltransferase, putative [Theobroma 
cacao]
 gb|EOY00145.1| Cytokinin biosynthetic isopentenyltransferase, putative [Theobroma 
cacao]
Length=409

 Score =   279 bits (713),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 158/303 (52%), Positives = 208/303 (69%), Gaps = 30/303 (10%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR S+DL++ +F  +++INSDK+Q+YKGLDITTNKI + ER+GV H L+GEF
Sbjct  117   MGATGTGKSRLSIDLSS-HFPHSQIINSDKMQLYKGLDITTNKIPIHERKGVPHFLLGEF  175

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             ++ ++  + + + FR+A    I++IV RG +PF+VGGSNS+I+ALLVE F+PE+DV    
Sbjct  176   DSIDA--DVAPSQFRSAAGLTIANIVSRGNLPFLVGGSNSFIHALLVETFDPEVDVL---  230

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                +G S    LRY CCFLWVDV+  VL  YL KRVDEM+DSGM EEL+++Y DP     
Sbjct  231   -AGLG-SVSHVLRYDCCFLWVDVAWSVLRDYLCKRVDEMLDSGMFEELAQFY-DPDRESV  287

Query  516   RTGLAKAIGVPEFAAYFR------------APRGG--ERRERLYAEAVREIKENTRLLAE  379
             R GL KAIGVPEF  YFR             P  G    R   Y EAVREIK+NT  LA+
Sbjct  288   RVGLRKAIGVPEFDGYFRKYPPWESEENGVVPEEGCDPVRREAYEEAVREIKDNTCRLAK  347

Query  378   RQLRKIQRLREVG-GWEMHRINATAAFAAAM----GSESESETAEIWENQVVQPSMKIVE  214
              Q+ KI RL  +G GW++ R++ATA F A M     S S+ E  +IWE +VV+PS+KIV+
Sbjct  348   SQIGKILRL--IGAGWDLRRLDATATFGAVMRKKKSSSSDLEWRDIWEREVVEPSVKIVK  405

Query  213   KFL  205
             +FL
Sbjct  406   RFL  408



>ref|XP_006469085.1| PREDICTED: adenylate isopentenyltransferase-like [Citrus sinensis]
Length=313

 Score =   275 bits (702),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 156/300 (52%), Positives = 199/300 (66%), Gaps = 22/300 (7%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKS  S+DLATR+F  +E+INSDK+QVYKGLDITTNKI   +R  V HHL+GEF
Sbjct  22    MGATGTGKSGLSIDLATRFF-PSEIINSDKMQVYKGLDITTNKIPSHKRHNVPHHLLGEF  80

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
                +   EF+  DFR      ISDI+ R K P +VGGSNS+IY+LLV+ ++  L VFDD 
Sbjct  81    VPDDV--EFTPDDFRLQADNAISDIISRKKTPLLVGGSNSFIYSLLVQEYDRGLSVFDDR  138

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDP----S  529
              +S  DS    LRY CCFLWVD S  +L  YL KRVD+M++SGM EEL+ ++       +
Sbjct  139   FDS--DSVSSSLRYNCCFLWVDSSLQLLYDYLNKRVDDMLESGMFEELAEFFDSDRMRNN  196

Query  528   NPLSR-TGLAKAIGVPEFAAYFRA--PRGGE-------RRERLYAEAVREIKENTRLLAE  379
             N +S   GL KAIGVPEF  YF+   P   E        R  +Y EAVREIKENTR LA+
Sbjct  197   NSVSLGVGLLKAIGVPEFERYFKMYPPASVEVKGEWDPVRRGVYQEAVREIKENTRRLAK  256

Query  378   RQLRKIQRLREVGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
             RQ+ KI +L E  GW++ R++AT AF   +  + E     +WE QVV+PS+KIV++FL E
Sbjct  257   RQIDKIFKL-ERAGWDLRRLDATTAFRMLVNGDQEWRC--VWERQVVEPSVKIVKRFLDE  313



>ref|XP_006406531.1| hypothetical protein EUTSA_v10022249mg [Eutrema salsugineum]
 gb|ESQ47984.1| hypothetical protein EUTSA_v10022249mg [Eutrema salsugineum]
Length=326

 Score =   275 bits (702),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 150/297 (51%), Positives = 196/297 (66%), Gaps = 31/297 (10%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR SV+LATR+  + E+INSDK+QVY GLDI TN+IT+ ER GV HHL+G  
Sbjct  49    MGATGTGKSRLSVELATRF--SGEIINSDKMQVYNGLDIATNQITILERCGVPHHLLGHL  106

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
                    E +A++FR   +  ISDI  RGK+P I GGSNS+I+ALLV+R+NPE + F   
Sbjct  107   PPDYG--ELTASNFRCLASRSISDIASRGKLPIIAGGSNSFIHALLVDRYNPETNPF---  161

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                 G     +LRY CCFLWVDVS  VL  YL  RVD+MM+SGM EEL+ +Y+   N   
Sbjct  162   --VYGSLVSSDLRYDCCFLWVDVSVSVLYHYLSTRVDQMMESGMFEELAGFYNPRDN---  216

Query  516   RTGLAKAIGVPEFAAYFRA--PRGGER---------RERLYAEAVREIKENTRLLAERQL  370
             RTG+ KAIGVPEF  YFR   P              R+  Y EAV+E+KENT LLA++Q+
Sbjct  217   RTGIYKAIGVPEFDWYFRVYPPENNNNDKACEWDTARKAAYEEAVQEVKENTWLLAKKQI  276

Query  369   RKIQRLREVGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
              +I +LR   GWE+ R++AT AF A++         E+WEN V++  +KIV++FLL+
Sbjct  277   ERIMQLRS-SGWEIQRLDATGAFKASLRD-------EVWENNVLEECVKIVKRFLLK  325



>ref|XP_008243241.1| PREDICTED: adenylate isopentenyltransferase-like [Prunus mume]
Length=379

 Score =   276 bits (707),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 165/305 (54%), Positives = 209/305 (69%), Gaps = 27/305 (9%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR S+DLATR F   E++NSDK+Q+Y GLDITTNK+ +P+R GV HHL+GEF
Sbjct  83    MGATGAGKSRLSLDLATR-FPFFEIVNSDKMQLYAGLDITTNKLPIPDRLGVPHHLLGEF  141

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             +      +F+   FRA   + IS I  R KVP +VGGSNS+I+ALLV+RF P  +VF+  
Sbjct  142   DPRHG--DFTPGQFRAVAGQAISSITNRRKVPMLVGGSNSFIHALLVDRFEPGSNVFEPG  199

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPS----  529
              N+   S   ELRY CCFLWVDVS  VL  YL KRVDEM+DSGML+EL+  + DP     
Sbjct  200   FNA---SVSSELRYNCCFLWVDVSLAVLTEYLCKRVDEMLDSGMLDELAE-FCDPDRQDE  255

Query  528   --NPLSRTGLAKAIGVPEFAAYF-RAP---RGGE----RRERLYAEAVREIKENTRLLAE  379
               +  S+T L KAIGVPEF  YF R P   RGGE     R + Y EAVREIK+NT  LA+
Sbjct  256   DESTTSQTALRKAIGVPEFTRYFKRYPPQGRGGEGDDRERRKAYEEAVREIKDNTCQLAK  315

Query  378   RQLRKIQRLREVGGWEMHRINATAAFAAAMGSESESET-----AEIWENQVVQPSMKIVE  214
             RQ+ KI RL+  GGW++ R++AT AF A + + S  E      +EIWE QVV+PS+K+V+
Sbjct  316   RQIEKILRLKG-GGWDLQRLDATEAFRAVVATTSSDEDDGKRWSEIWERQVVKPSVKVVK  374

Query  213   KFLLE  199
             +FL E
Sbjct  375   QFLEE  379



>ref|XP_011007793.1| PREDICTED: adenylate isopentenyltransferase [Populus euphratica]
Length=365

 Score =   276 bits (705),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 152/313 (49%), Positives = 200/313 (64%), Gaps = 38/313 (12%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG GK++ S+DLATR+ +  E+INSDK+QVYKGLDI TNKI + +R GV HHL+GEF
Sbjct  64    MGATGCGKTKVSIDLATRFHS--EIINSDKMQVYKGLDIITNKIPIQDRLGVPHHLLGEF  121

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             +  +   E + ++FR AG   IS IV R ++P +VGGSNS ++AL+V+RFNPEL+VFD  
Sbjct  122   DPDDG--ELTLSEFRLAGGRAISGIVSRQRLPIVVGGSNSLVHALVVDRFNPELNVFDGS  179

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                  +    +LRY CCFLWVDVS PVL  YL  RVDEM+DSGM +ELS +Y    +  S
Sbjct  180   -----NPVSTQLRYNCCFLWVDVSLPVLCDYLCMRVDEMLDSGMFDELSEYYGS-IDSAS  233

Query  516   RTGLAKAIGVPEFAAYFRA-PRGG-----------ERRERLYAEAVREIKENTRLLAERQ  373
             +T L KAIGVPEF  YF+  P G            + R  +Y E VREIKENT  LA+RQ
Sbjct  234   QTVLRKAIGVPEFDRYFKKYPPGSGCGRGIAGEWDQVRRGIYEECVREIKENTCQLAKRQ  293

Query  372   LRKIQRLREVGGWEMHRINATAAFAAAMGSESESET---------------AEIWENQVV  238
             + KI RL+   GW++ R++AT +F   M   +  E                 E+W   V+
Sbjct  294   IGKILRLKG-AGWDLQRVDATESFREVMMVRTSDEDDHRKNTKKRKKNKRWVEVWGRDVL  352

Query  237   QPSMKIVEKFLLE  199
             +PSMKIV++F+ E
Sbjct  353   EPSMKIVKRFMDE  365



>ref|XP_006301434.1| hypothetical protein CARUB_v10021852mg [Capsella rubella]
 gb|EOA34332.1| hypothetical protein CARUB_v10021852mg [Capsella rubella]
Length=362

 Score =   275 bits (704),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 151/297 (51%), Positives = 201/297 (68%), Gaps = 21/297 (7%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             +GATG+GKS+ SVDLATR+   +E+INSDKIQVY+GL+ITTN+IT+ +RRGV HHL+G  
Sbjct  75    LGATGAGKSKLSVDLATRF--PSEIINSDKIQVYEGLEITTNQITLQDRRGVPHHLLGYL  132

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
                    E +AA+FR+A +  +SDI  R K+P I GGSNS+I+ALL +RF+P++D F   
Sbjct  133   NPEHG--ELTAAEFRSAASNAVSDITSRQKLPIIAGGSNSFIHALLAQRFDPKIDPFSSG  190

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDP--SNP  523
                +      +LRY C F+WVDVS  VL  YL KRVDEMMDSGM EELS +Y DP  S  
Sbjct  191   SGLITS----DLRYECRFIWVDVSEIVLYEYLLKRVDEMMDSGMFEELSGFY-DPVKSGL  245

Query  522   LSRTGLAKAIGVPEFAAYFRA--------PRGGERRERLYAEAVREIKENTRLLAERQLR  367
               R G+ KAIGVPEF  YF+               R+  Y +AV +IK NT  LA+RQ++
Sbjct  246   TPRFGIRKAIGVPEFDGYFKEYPPETIKWDDDDGLRKAAYDKAVDDIKRNTWTLAKRQIK  305

Query  366   KIQRLREVGGWEMHRINATAAFAAAMGSESESET-AEIWENQVVQPSMKIVEKFLLE  199
             KI+ L++  GWE+ R++ATA+F   M   S SE   E+WE QV++PS+KIV++ L+E
Sbjct  306   KIEMLKD-AGWEIERVDATASFKEVMKMSSSSEKWREVWEEQVLEPSVKIVKRLLVE  361



>ref|XP_004295673.1| PREDICTED: adenylate isopentenyltransferase-like [Fragaria vesca 
subsp. vesca]
Length=304

 Score =   273 bits (697),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 149/298 (50%), Positives = 203/298 (68%), Gaps = 22/298 (7%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAA-EVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGE  880
             MGATGSGKSR S+DLA R+  A  EVIN+DK+Q+YKGLD+TTNK++  ERR V HHL+GE
Sbjct  14    MGATGSGKSRLSLDLAVRFPPATFEVINADKMQLYKGLDVTTNKLSDAERRVVPHHLLGE  73

Query  879   FEASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDD  700
             F++     + S ++FR   A+ +SD++ RGKVP +VGGSNS+I+ LLVERF P++DVFD 
Sbjct  74    FDSRHG--DVSPSEFRRLAAQAVSDVLSRGKVPVLVGGSNSFIHVLLVERFEPDVDVFDG  131

Query  699   ECNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPL  520
             E  +       +LRY CCFLWVDV  PVL  YL +RV+EM+D+GM +EL+ ++    N  
Sbjct  132   EVAASS-----QLRYDCCFLWVDVEFPVLTAYLSRRVEEMLDAGMFQELAEFHG--QNRA  184

Query  519   SRTGLAKAIGVPEFAAYFRAPRGGER------RERLYAEAVREIKENTRLLAERQLRKIQ  358
              +TG++KAIGV EF+ YF      E       R   Y EAV E+K NT  LA+RQ+ KI 
Sbjct  185   VQTGVSKAIGVAEFSRYFEEYAAAEVEEDDPVRRGAYEEAVGEVKRNTWQLAKRQMGKIA  244

Query  357   RLREVGGWEMHRINATAAFAAAMGSESESET-----AEIWENQVVQPSMKIVEKFLLE  199
             RLR+  GW++ R++AT    A + S+ + +      +EIWE +VV+PS+KIV+ FL E
Sbjct  245   RLRK-AGWDLKRLDATEVLRAVVTSDDDEDGGGKRWSEIWEREVVEPSVKIVKDFLEE  301



>ref|XP_007227090.1| hypothetical protein PRUPE_ppa025556mg [Prunus persica]
 gb|EMJ28289.1| hypothetical protein PRUPE_ppa025556mg [Prunus persica]
Length=321

 Score =   273 bits (698),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 163/305 (53%), Positives = 210/305 (69%), Gaps = 27/305 (9%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR S+DLATR F + E++NSDK+Q+Y GLDITTNK+ +P+R GV HHL+GEF
Sbjct  25    MGATGAGKSRLSLDLATR-FPSFEIVNSDKMQLYAGLDITTNKLPIPDRLGVPHHLLGEF  83

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             +      +F+ + FRA   + IS I  R KVP +VGGSNS+I+ALLV+RF P  +VF+  
Sbjct  84    DPRHG--DFTPSQFRAVAGQAISSITNRRKVPMLVGGSNSFIHALLVDRFEPGSNVFEPG  141

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPS----  529
              N    S   ELRY CCFLWVDVS  VL  YL KRVDEM+DSGML+EL+  + DP     
Sbjct  142   FNG---SVSSELRYNCCFLWVDVSLAVLTEYLCKRVDEMLDSGMLDELAE-FCDPDRQDE  197

Query  528   --NPLSRTGLAKAIGVPEFAAYFR--APRG----GERRER--LYAEAVREIKENTRLLAE  379
               +  S+T L KAIGVPEF  YF+   P+G    G+ RER   Y EAVR IK+NT  LA+
Sbjct  198   DESTASQTALRKAIGVPEFTRYFKRYPPQGRGGEGDDRERRGAYEEAVRAIKDNTCQLAK  257

Query  378   RQLRKIQRLREVGGWEMHRINATAAFAAAMGSESESET-----AEIWENQVVQPSMKIVE  214
             RQ+ KI RL+  GGW++ R++AT AF A + + S  E      +EIWE QVV+PS+K+V+
Sbjct  258   RQIGKILRLKG-GGWDLQRLDATDAFRAVVATTSSDEDDGKRWSEIWERQVVKPSVKVVK  316

Query  213   KFLLE  199
             +FL E
Sbjct  317   RFLEE  321



>ref|XP_008389284.1| PREDICTED: adenylate isopentenyltransferase-like [Malus domestica]
Length=370

 Score =   273 bits (699),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 154/303 (51%), Positives = 199/303 (66%), Gaps = 24/303 (8%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR S+DLA+R F   E++NSDKIQ+Y+GLDITTNK+ +PER GV HHL+GEF
Sbjct  75    MGATGAGKSRLSLDLASR-FPFFEIVNSDKIQLYRGLDITTNKLPLPERLGVPHHLLGEF  133

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             +  +   +F+ ADFRA   + +S I  R KVP +VGGSNS+I+A++ ERF P  +VF+  
Sbjct  134   DPLDG--DFTPADFRAVAGQVVSGITNRRKVPMLVGGSNSFIHAMVAERFEPGSNVFEPG  191

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
              ++   S   ELRY CCFLWVDVS  VL  YL KRVDEM+DSGM +EL+ +         
Sbjct  192   FDA---SVSAELRYNCCFLWVDVSMAVLTEYLSKRVDEMLDSGMFDELAEFCDPDXQDKX  248

Query  516   R-----TGLAKAIGVPEFAAYFRA-PRGGERRERL------YAEAVREIKENTRLLAERQ  373
                   TGL KAIGVPEF  YF+  P+     +        Y EAVR IK+NT  LA+RQ
Sbjct  249   DPAAVPTGLRKAIGVPEFTRYFKKYPQSKRDEDDDRERRGAYEEAVRVIKDNTCQLAKRQ  308

Query  372   LRKIQRLREVGGWEMHRINATAAFAAAMGSESESET-----AEIWENQVVQPSMKIVEKF  208
             + KI RLR  GGW++ R++AT AF A +   +         +EIWE QVV+PS KIV++F
Sbjct  309   IGKILRLRG-GGWDLRRLDATDAFRAVVAXSTPENDGGERWSEIWERQVVEPSAKIVKRF  367

Query  207   LLE  199
             L E
Sbjct  368   LEE  370



>ref|XP_010511839.1| PREDICTED: adenylate isopentenyltransferase 1, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=309

 Score =   271 bits (692),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 148/300 (49%), Positives = 203/300 (68%), Gaps = 23/300 (8%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             +GATG+GKS+ SVDLATR+   +E+INSDKIQVY+GL+ITTN+IT+ +RRGV HHL+G  
Sbjct  18    LGATGAGKSKLSVDLATRF--PSEIINSDKIQVYEGLEITTNQITLQDRRGVPHHLLGYL  75

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
                    E +AA+FR+A +  + DI  R K+P I GGSNS+++ALL +RF+P++D F   
Sbjct  76    NPEHG--ELTAAEFRSAASNAVEDITSRQKLPIIAGGSNSFVHALLSQRFDPKIDPFSSG  133

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                +      +LRY CCF+WVDVS  VL  YL KRVDEMMDSGM EELS +Y    + L 
Sbjct  134   SGLISS----DLRYNCCFIWVDVSETVLYEYLLKRVDEMMDSGMFEELSGFYDPVKSGLE  189

Query  516   -RTGLAKAIGVPEFAAYFRA-PRGGER-----RERLYAEAVREIKENTRLLAERQLRKIQ  358
              R G+ KAIGVPEF  YF+  P G  +     R+  Y +AV +IK NT  LA+RQ++KI+
Sbjct  190   PRFGIRKAIGVPEFDGYFKEYPPGTIKWDDALRKAAYDKAVDDIKRNTWTLAKRQIKKIE  249

Query  357   RLREVGGWEMHRINATAAFAAAMGSESESETA-------EIWENQVVQPSMKIVEKFLLE  199
              L++  GWE+ R++ATA+F   M   + S +        E+WE QV++PS+KIV++ L+E
Sbjct  250   MLKD-AGWEIQRVDATASFKEVMKMSTSSSSEKKTKKWREVWEEQVLEPSVKIVKRLLVE  308



>ref|XP_010681483.1| PREDICTED: adenylate isopentenyltransferase-like [Beta vulgaris 
subsp. vulgaris]
Length=375

 Score =   272 bits (696),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 158/289 (55%), Positives = 200/289 (69%), Gaps = 30/289 (10%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MG TGSGKSR SVD+A+R+   AE+INSDKIQ+YKGLDITTNKI   +R GV HHL+G  
Sbjct  114   MGPTGSGKSRLSVDIASRF--PAEIINSDKIQLYKGLDITTNKIPQEQRLGVPHHLLGCV  171

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             ++S ++ E +   +R   +  IS I  R K+P +VGGSNS I+ALL              
Sbjct  172   DSS-TQSELTPPHYRLLASSLISSIRSRNKLPLLVGGSNSLIHALLS-------------  217

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWY-SDPSNPL  520
                 G   GL LRYRCCFLW+DVSPPVLN YL KRVDEM+DSGML+EL+++Y S   N +
Sbjct  218   ----GSGPGLNLRYRCCFLWIDVSPPVLNAYLLKRVDEMLDSGMLDELAKFYNSGEVNKI  273

Query  519   SR-TGLAKAIGVPEFAAYFRAPRGGERRERLYAEAVREIKENTRLLAERQLRKIQRLREV  343
              R TGL KAIGVPEF  YF    GG+  + LY ++VR IKENT  LA+ Q+ KIQRL++ 
Sbjct  274   ERDTGLRKAIGVPEFETYFTM--GGD-DQVLYEKSVRMIKENTCQLAKIQMEKIQRLKD-  329

Query  342   GGWEMHRINATAAFAAAM-GSESESETAEIWENQVVQPSMKIVEKFLLE  199
             GGW +HR++ T +F A + GS+S S   +IWE QVV+PSMKIV++FL E
Sbjct  330   GGWGLHRLDGTESFRAVLEGSKSWS---DIWETQVVEPSMKIVKRFLEE  375



>ref|XP_010511841.1| PREDICTED: adenylate isopentenyltransferase 1, chloroplastic-like 
isoform X3 [Camelina sativa]
Length=366

 Score =   271 bits (693),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 148/300 (49%), Positives = 203/300 (68%), Gaps = 23/300 (8%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             +GATG+GKS+ SVDLATR+   +E+INSDKIQVY+GL+ITTN+IT+ +RRGV HHL+G  
Sbjct  75    LGATGAGKSKLSVDLATRF--PSEIINSDKIQVYEGLEITTNQITLQDRRGVPHHLLGYL  132

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
                    E +AA+FR+A +  + DI  R K+P I GGSNS+++ALL +RF+P++D F   
Sbjct  133   NPEHG--ELTAAEFRSAASNAVEDITSRQKLPIIAGGSNSFVHALLSQRFDPKIDPFSSG  190

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                +      +LRY CCF+WVDVS  VL  YL KRVDEMMDSGM EELS +Y    + L 
Sbjct  191   SGLISS----DLRYNCCFIWVDVSETVLYEYLLKRVDEMMDSGMFEELSGFYDPVKSGLE  246

Query  516   -RTGLAKAIGVPEFAAYFRA-PRGGER-----RERLYAEAVREIKENTRLLAERQLRKIQ  358
              R G+ KAIGVPEF  YF+  P G  +     R+  Y +AV +IK NT  LA+RQ++KI+
Sbjct  247   PRFGIRKAIGVPEFDGYFKEYPPGTIKWDDALRKAAYDKAVDDIKRNTWTLAKRQIKKIE  306

Query  357   RLREVGGWEMHRINATAAFAAAMGSESESETA-------EIWENQVVQPSMKIVEKFLLE  199
              L++  GWE+ R++ATA+F   M   + S +        E+WE QV++PS+KIV++ L+E
Sbjct  307   MLKD-AGWEIQRVDATASFKEVMKMSTSSSSEKKTKKWREVWEEQVLEPSVKIVKRLLVE  365



>ref|XP_010511840.1| PREDICTED: adenylate isopentenyltransferase 1, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=375

 Score =   271 bits (692),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 148/300 (49%), Positives = 203/300 (68%), Gaps = 23/300 (8%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             +GATG+GKS+ SVDLATR+   +E+INSDKIQVY+GL+ITTN+IT+ +RRGV HHL+G  
Sbjct  84    LGATGAGKSKLSVDLATRF--PSEIINSDKIQVYEGLEITTNQITLQDRRGVPHHLLGYL  141

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
                    E +AA+FR+A +  + DI  R K+P I GGSNS+++ALL +RF+P++D F   
Sbjct  142   NPEHG--ELTAAEFRSAASNAVEDITSRQKLPIIAGGSNSFVHALLSQRFDPKIDPFSSG  199

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                +      +LRY CCF+WVDVS  VL  YL KRVDEMMDSGM EELS +Y    + L 
Sbjct  200   SGLISS----DLRYNCCFIWVDVSETVLYEYLLKRVDEMMDSGMFEELSGFYDPVKSGLE  255

Query  516   -RTGLAKAIGVPEFAAYFRA-PRGGER-----RERLYAEAVREIKENTRLLAERQLRKIQ  358
              R G+ KAIGVPEF  YF+  P G  +     R+  Y +AV +IK NT  LA+RQ++KI+
Sbjct  256   PRFGIRKAIGVPEFDGYFKEYPPGTIKWDDALRKAAYDKAVDDIKRNTWTLAKRQIKKIE  315

Query  357   RLREVGGWEMHRINATAAFAAAMGSESESETA-------EIWENQVVQPSMKIVEKFLLE  199
              L++  GWE+ R++ATA+F   M   + S +        E+WE QV++PS+KIV++ L+E
Sbjct  316   MLKD-AGWEIQRVDATASFKEVMKMSTSSSSEKKTKKWREVWEEQVLEPSVKIVKRLLVE  374



>ref|XP_004150914.1| PREDICTED: adenylate isopentenyltransferase-like [Cucumis sativus]
 gb|KGN45943.1| hypothetical protein Csa_6G030440 [Cucumis sativus]
Length=320

 Score =   268 bits (684),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 155/296 (52%), Positives = 203/296 (69%), Gaps = 20/296 (7%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             +GATGSGKS  S+DLA R+   +E+INSDK+Q+Y+GLDITTNK+ +  RR V HHL+G+F
Sbjct  35    LGATGSGKSSLSIDLAARF--PSEIINSDKMQLYRGLDITTNKLPLSHRRAVPHHLLGDF  92

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             +      E S A FR+  +  IS ++ RG +P +VGGSNS+++AL+   F+   DVF   
Sbjct  93    DPLAG--EVSPAAFRSHASAVISGVISRGNLPLVVGGSNSFVHALVAADFDATQDVFCGS  150

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDP--SNP  523
              N V   F     YRCCFLWVDVS PVL RYL KRVDEM+D GM+EEL+++Y DP  ++ 
Sbjct  151   RNRVSTEF----LYRCCFLWVDVSFPVLKRYLSKRVDEMLDGGMVEELAKFY-DPEMADS  205

Query  522   LSRTGLAKAIGVPEFAAYFR--APRGGERRE------RLYAEAVREIKENTRLLAERQLR  367
              +R GL KAIGVPEF  YFR   P+G + RE      R + EAVR+IKENT  L +RQL 
Sbjct  206   ETRVGLRKAIGVPEFEEYFRRHHPKGRDYREGDPLQARAFEEAVRKIKENTWQLTKRQLW  265

Query  366   KIQRLREVGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
             KI RLR   GW++ R++ATAA  A + SE   + +EIWE QVV+PS+KIV+ F+ E
Sbjct  266   KIGRLRR-AGWDLKRVDATAAVVAVLASEVAEKRSEIWETQVVEPSVKIVKGFIQE  320



>gb|KCW81312.1| hypothetical protein EUGRSUZ_C02687 [Eucalyptus grandis]
Length=329

 Score =   268 bits (685),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 155/309 (50%), Positives = 201/309 (65%), Gaps = 32/309 (10%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             +GATG GKSR S+DLA+R+    EVINSDK+Q+Y+GLDITTNKI + ER GV HHL+  F
Sbjct  22    VGATGCGKSRLSMDLASRF--PCEVINSDKMQLYRGLDITTNKIPLAERHGVPHHLLSSF  79

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             + ++   E +   FR+ G   IS I  RGK+P +VGGSNS+I+ALLVERF+PE +VF   
Sbjct  80    DPNDG--EMTPLRFRSIGHAAISGIASRGKLPLLVGGSNSFIHALLVERFDPEAEVF---  134

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYS-DPSNPL  520
              + +G +   ELRY CCFLWVDVSPPVL  Y  KRVD+ +D G  +EL+ ++    +N  
Sbjct  135   -SGLGSAASPELRYDCCFLWVDVSPPVLEEYQSKRVDKKLDMGAFDELAGYHDLRRTNTG  193

Query  519   SRTGLAKAIGVPEFAAYFRA---PRG-----GERRER------------LYAEAVREIKE  400
               T L KAIGVPEF  YF     PRG     G RRE              Y EAVR+IK+
Sbjct  194   GWTCLRKAIGVPEFDRYFMTYPPPRGVGLGDGWRREDARMREDDPGRDGAYKEAVRKIKK  253

Query  399   NTRLLAERQLRKIQRLREVGGWEMHRINATAAFAAAMGSESE--SETAEIWENQVVQPSM  226
             N   LA+ Q+ KI+RLR   GWEMHR++AT A    M ++ E    + E+WE +VV+PS+
Sbjct  254   NAVELAKWQIMKIERLRG-SGWEMHRLDATEAVRLKMAAKEEGGGRSREVWEREVVEPSV  312

Query  225   KIVEKFLLE  199
             K VE+FLL+
Sbjct  313   KFVERFLLK  321



>ref|XP_008445640.1| PREDICTED: adenylate isopentenyltransferase-like [Cucumis melo]
Length=320

 Score =   267 bits (682),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 156/296 (53%), Positives = 204/296 (69%), Gaps = 20/296 (7%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             +GATGSGKS  S+DLA R+   +E+INSDK+Q+Y+GLDITTNK+ +  RR V HHL+G++
Sbjct  35    LGATGSGKSSLSIDLAARF--PSEIINSDKMQLYRGLDITTNKLPLSHRRAVPHHLLGDY  92

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             +      E S A FR+  +  IS ++ RG +P +VGGSNS+I+AL+   F+   DVF   
Sbjct  93    DPLAG--EVSPAAFRSHASAVISGVISRGNLPLVVGGSNSFIHALVAADFDDTQDVFCGS  150

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDP--SNP  523
              N V   F    RYRCCFLWVDVS PVL RYL KRVDEM+D GMLEEL+++Y DP  ++ 
Sbjct  151   RNRVSAEF----RYRCCFLWVDVSFPVLKRYLSKRVDEMLDGGMLEELAQFY-DPEMADL  205

Query  522   LSRTGLAKAIGVPEFAAYFR--APRGGERRE------RLYAEAVREIKENTRLLAERQLR  367
              +R GL KAIGVPEF  YFR   P+G + RE        + EAVR+IKENT  L +RQL 
Sbjct  206   ETRVGLRKAIGVPEFEEYFRRHHPKGRDYREGDPLQASAFEEAVRKIKENTWQLTKRQLW  265

Query  366   KIQRLREVGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
             KI RLR   GW++ R++ATAA  A + SE+  + +EIWE QVV+PS+KIV+ F+ E
Sbjct  266   KIGRLRR-AGWDLKRVDATAAVVAVLASEAAEKRSEIWETQVVEPSVKIVKGFIQE  320



>ref|XP_004174133.1| PREDICTED: adenylate isopentenyltransferase-like [Cucumis sativus]
Length=320

 Score =   266 bits (679),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 155/296 (52%), Positives = 202/296 (68%), Gaps = 20/296 (7%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             +GATGSGKS  S+DLA R+   +E+INSDK+Q+Y+GLDITTNK+ +  RR V HHL+G+F
Sbjct  35    LGATGSGKSSLSIDLAARF--PSEIINSDKMQLYRGLDITTNKLPLSHRRAVPHHLLGDF  92

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             +      E S A FR+  +  IS ++ RG +P +VGGSNS+I+AL+   F+   DVF   
Sbjct  93    DPLAG--EVSPAAFRSHASAVISGVISRGNLPLVVGGSNSFIHALVAADFDATQDVFCGA  150

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDP--SNP  523
              N V   F     YRCCFLWVDVS PVL RYL KRVDEM+D GM+EEL+++Y DP  ++ 
Sbjct  151   RNRVSTEF----LYRCCFLWVDVSFPVLKRYLSKRVDEMLDGGMVEELAKFY-DPEMADS  205

Query  522   LSRTGLAKAIGVPEFAAYFR--APRGGERRE------RLYAEAVREIKENTRLLAERQLR  367
              +R GL KAIGVPEF  YFR   P+G + RE        + EAVR+IKENT  L +RQL 
Sbjct  206   ETRVGLRKAIGVPEFEEYFRRHHPKGRDYREGDPLQASAFEEAVRKIKENTWQLTKRQLW  265

Query  366   KIQRLREVGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
             KI RLR   GW++ R++ATAA  A + SE   + +EIWE QVV+PS+KIV+ F+ E
Sbjct  266   KIGRLRR-AGWDLKRVDATAAVVAVLASEVAEKRSEIWETQVVEPSVKIVKGFIQE  320



>ref|XP_010415465.1| PREDICTED: adenylate isopentenyltransferase 1, chloroplastic-like 
[Camelina sativa]
Length=370

 Score =   265 bits (678),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 146/303 (48%), Positives = 201/303 (66%), Gaps = 26/303 (9%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             +GATG+GKS+ SVDLATR+   +E+INSDKIQVY+GL+ITTN+IT+ +RRGV HHL+G  
Sbjct  76    LGATGAGKSKLSVDLATRF--PSEIINSDKIQVYEGLEITTNQITLQDRRGVPHHLLGYL  133

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             +      E +AA+FR+A +  + DI  R K+P I GGSNS+++ALL +RF+P++D F   
Sbjct  134   DPEHG--ELTAAEFRSAASNAVEDITSRRKLPIIAGGSNSFVHALLSQRFDPKIDPFSSG  191

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                +      +LRY CCF+WVDVS  VL  YL KRVDEMMDSGM EELS +Y    + L 
Sbjct  192   SGLISS----DLRYECCFIWVDVSETVLYEYLLKRVDEMMDSGMFEELSGFYDPVKSGLE  247

Query  516   R-TGLAKAIGVPEFAAYFRAPRGGER-------RERLYAEAVREIKENTRLLAERQLRKI  361
                G+ KAIGVPEF  YF+    G         R+  Y +AV +IK NT  LA+RQ+ KI
Sbjct  248   PWLGIRKAIGVPEFDGYFKEYPPGTTIKWDDALRKAAYDKAVDDIKRNTWTLAKRQIEKI  307

Query  360   QRLREVGGWEMHRINATAAFAAAMGSESESETA---------EIWENQVVQPSMKIVEKF  208
             + L++  GWE+ R++ATA+F   M   + S ++         E+WE QV++PS+KIV++ 
Sbjct  308   EMLKD-AGWEIERVDATASFQEVMKMSTSSSSSSEKKTKKWREVWEEQVLEPSVKIVKRL  366

Query  207   LLE  199
             L+E
Sbjct  367   LVE  369



>ref|XP_010051129.1| PREDICTED: adenylate isopentenyltransferase-like [Eucalyptus 
grandis]
Length=322

 Score =   263 bits (672),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 152/309 (49%), Positives = 195/309 (63%), Gaps = 32/309 (10%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG GKSR S+DLA+ +  ++EVINSDK+QVY+GLD+TTNKI+  +R  V HHL+G F
Sbjct  22    MGATGCGKSRLSMDLASLF--SSEVINSDKMQVYRGLDLTTNKISRADRYRVPHHLLGSF  79

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             +  +   E + + FR+ G   IS +  RGK+P +VGGSNS+I+ALLVERF+P+ DV    
Sbjct  80    DPDDG--EMTPSQFRSLGHAAISGVASRGKMPLLVGGSNSFIHALLVERFDPDADVL---  134

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYS-DPSNPL  520
                +G     ELRY CCFLWVDVS PVL  Y  KRVDE+++ G  +EL+ +Y    +NP 
Sbjct  135   -GGIGSPASPELRYDCCFLWVDVSLPVLQEYQSKRVDELINMGTFDELTGYYDLRRTNPG  193

Query  519   SRTGLAKAIGVPEFAAYFRA---PRG------------GER-----RERLYAEAVREIKE  400
               TGL KAIGVPEF  YF     PRG             ER     RE  Y EAVREIK+
Sbjct  194   GWTGLRKAIGVPEFDRYFMKYPPPRGFGPGDAWWEEDARERDNDPVRESAYQEAVREIKK  253

Query  399   NTRLLAERQLRKIQRLREVGGWEMHRINATAAFAAAMGSESE--SETAEIWENQVVQPSM  226
             N   L  RQ+ KIQ+L    GWE+H + AT A   AM +E +    + ++WE QVV PS 
Sbjct  254   NVGQLIRRQIEKIQKLSR-SGWELHMLEATEAVRLAMAAEEKGCGRSRDVWERQVVGPSK  312

Query  225   KIVEKFLLE  199
             +IV +FL E
Sbjct  313   EIVSQFLQE  321



>ref|XP_010051139.1| PREDICTED: uncharacterized protein LOC104439822 [Eucalyptus grandis]
Length=620

 Score =   270 bits (690),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 156/309 (50%), Positives = 203/309 (66%), Gaps = 32/309 (10%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             +GATG GKSR S+DLA+R+    EVINSDK+Q+Y+GLDITTNKI + ER GV HHL+  F
Sbjct  22    VGATGCGKSRLSMDLASRF--PCEVINSDKMQLYRGLDITTNKIPLAERHGVPHHLLSSF  79

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             + ++   E +   FR+ G   IS I  RGK+P +VGGSNS+I+ALLVERF+PE +VF   
Sbjct  80    DPNDG--EMTPLRFRSIGHAAISGIASRGKLPLLVGGSNSFIHALLVERFDPEAEVF---  134

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYS-DPSNPL  520
              + +G +   ELRY CCFLWVDVSPPVL  Y  KRVD+ +D G  +EL+ ++    +N  
Sbjct  135   -SGLGSAASPELRYDCCFLWVDVSPPVLEEYQSKRVDKKLDMGAFDELAGYHDLRRTNTG  193

Query  519   SRTGLAKAIGVPEFAAYFRA---PRG-----GERRE--RL----------YAEAVREIKE  400
               T L KAIGVPEF  YF     PRG     G RRE  R+          Y EAVR+IK+
Sbjct  194   GWTCLRKAIGVPEFDRYFMTYPPPRGVGLGDGWRREDARMREDDPGRDGAYKEAVRKIKK  253

Query  399   NTRLLAERQLRKIQRLREVGGWEMHRINATAAFAAAMGSESE--SETAEIWENQVVQPSM  226
             N   LA+ Q+ KI+RLR   GWEMHR++AT A    M ++ E    + E+WE +VV+PS+
Sbjct  254   NAVELAKWQIMKIERLRG-SGWEMHRLDATEAVRLKMAAKEEGGGRSREVWEREVVEPSV  312

Query  225   KIVEKFLLE  199
             K VE+FLL+
Sbjct  313   KFVERFLLK  321



>ref|XP_010489934.1| PREDICTED: adenylate isopentenyltransferase 8, chloroplastic 
[Camelina sativa]
Length=332

 Score =   259 bits (663),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 140/300 (47%), Positives = 197/300 (66%), Gaps = 36/300 (12%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATGSGKSR S+DLATR+  + E+INSDKIQ YKGL+ITTN++++ ER GV HHL+G  
Sbjct  48    MGATGSGKSRLSIDLATRF--SGEIINSDKIQFYKGLEITTNQMSISERCGVPHHLLGVL  105

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
                +   E + +++R+  +  IS+I  RGK+P I GGSNSYI+ALLV RF+P    F   
Sbjct  106   PQDDG--ELTPSEYRSLASRSISEITARGKLPIIAGGSNSYIHALLVNRFDPLTHPF---  160

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPL-  520
               S   S   +LRY CCFLWVDV+ PVL  +L KRVD+MM+SGM EEL+ +Y    NP+ 
Sbjct  161   --SSNTSISSDLRYECCFLWVDVAVPVLFEHLSKRVDQMMESGMFEELASFY----NPVY  214

Query  519   ----SRTGLAKAIGVPEFAAYF---------RAPRGGERRERLYAEAVREIKENTRLLAE  379
                 +RTG+ K+IG+PEF  YF         +     + R+ +Y EAV+EI+ENT LLA+
Sbjct  215   ADSKNRTGIHKSIGIPEFDRYFSLYPPERNHKVSEWDQARKAVYDEAVQEIRENTWLLAK  274

Query  378   RQLRKIQRLREVGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
             +Q+ +I+ L+   GWE+ R++AT +          S + EIW   V+  S+KI+++FL++
Sbjct  275   KQIERIKMLKS-NGWEIQRLDATPSIG--------SSSREIWNKTVLDESVKIMKRFLVK  325



>ref|XP_004135400.1| PREDICTED: adenylate isopentenyltransferase-like [Cucumis sativus]
Length=301

 Score =   258 bits (660),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 143/292 (49%), Positives = 190/292 (65%), Gaps = 18/292 (6%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG GKS  SV LA+ Y   +E+IN DK+QVYKGLDITTNKI + ER  V HHL+G+ 
Sbjct  22    MGATGCGKSGLSVQLASHY--QSEIINCDKMQVYKGLDITTNKIPLHERHDVPHHLLGDV  79

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             ++     +F+   FR      +SDI  R K+P +VGGSNS+I+A+LV  FNP  DVF  +
Sbjct  80    DSIHQ--DFTPFHFRLRADNVVSDIASRNKLPILVGGSNSFIHAMLVNHFNPNHDVFTPK  137

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDP--SNP  523
               S+  S    LRYRCCFLW+DV  P+L  YL  RVDEM+  GM EEL+ +Y DP  +  
Sbjct  138   --SLISS---HLRYRCCFLWLDVEFPILAEYLSIRVDEMLQIGMFEELAEFY-DPHTAET  191

Query  522   LSRTGLAKAIGVPEFAAYFR----APRGGERRERLYAEAVREIKENTRLLAERQLRKIQR  355
             +  TG+ KAIGVPEF  YF+    + + G  RE  + EAV  IK NT +LAERQ+ KI +
Sbjct  192   MPYTGIRKAIGVPEFDKYFQKNPPSKKSGIDREA-FEEAVEAIKRNTHVLAERQIGKILK  250

Query  354   LREVGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
             L+E  GW+++ +NAT AF A +   +     EIWE ++++PS +IV +FL E
Sbjct  251   LKE-AGWDINVLNATEAFRAVVEPGTGRNRKEIWEKEILEPSFRIVNRFLKE  301



>ref|XP_004164161.1| PREDICTED: LOW QUALITY PROTEIN: adenylate isopentenyltransferase-like 
[Cucumis sativus]
Length=302

 Score =   258 bits (659),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 143/292 (49%), Positives = 190/292 (65%), Gaps = 18/292 (6%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG GKS  SV LA+ Y   +E+IN DK+QVYKGLDITTNKI + ER  V HHL+G+ 
Sbjct  23    MGATGCGKSGLSVQLASHY--QSEIINCDKMQVYKGLDITTNKIPLHERHDVPHHLLGDV  80

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             ++     +F+   FR      +SDI  R K+P +VGGSNS+I+A+LV  FNP  DVF  +
Sbjct  81    DSIHQ--DFTPFHFRLRADNVVSDIASRNKLPILVGGSNSFIHAMLVNHFNPNHDVFTPK  138

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDP--SNP  523
               S+  S    LRYRCCFLW+DV  P+L  YL  RVDEM+  GM EEL+ +Y DP  +  
Sbjct  139   --SLISS---HLRYRCCFLWLDVEFPILAEYLSIRVDEMLQIGMFEELAEFY-DPHTAET  192

Query  522   LSRTGLAKAIGVPEFAAYFR----APRGGERRERLYAEAVREIKENTRLLAERQLRKIQR  355
             +  TG+ KAIGVPEF  YF+    + + G  RE  + EAV  IK NT +LAERQ+ KI +
Sbjct  193   MPYTGIRKAIGVPEFDKYFQKNPPSKKSGIDRE-AFEEAVEAIKRNTHVLAERQIGKILK  251

Query  354   LREVGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
             L+E  GW+++ +NAT AF A +   +     EIWE ++++PS +IV +FL E
Sbjct  252   LKE-AGWDINVLNATEAFRAVVEPGTGRNRKEIWEKEILEPSFRIVNRFLKE  302



>ref|XP_010419888.1| PREDICTED: adenylate isopentenyltransferase 8, chloroplastic-like 
[Camelina sativa]
Length=332

 Score =   259 bits (662),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 140/300 (47%), Positives = 195/300 (65%), Gaps = 36/300 (12%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATGSGKSR S+DLATR+  + E+INSDKIQ YKGL+ITTN++++ ER GV HHL+G  
Sbjct  48    MGATGSGKSRLSIDLATRF--SGEIINSDKIQFYKGLEITTNQMSISERCGVPHHLLGVL  105

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
                +   E + +++R+  +  IS+I  RGK+P I GGSNSYI+ALLV RFNP    F   
Sbjct  106   PPDDG--ELTPSEYRSLASRSISEITARGKLPIIAGGSNSYIHALLVNRFNPLTHPFSSN  163

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPL-  520
                  D     LR+ CCFLWVDVS PVL  +L KRVD+MM+SGM EEL+ +Y    NP+ 
Sbjct  164   TFISSD-----LRFECCFLWVDVSVPVLFEHLSKRVDQMMESGMFEELASFY----NPIY  214

Query  519   ----SRTGLAKAIGVPEFAAYF---------RAPRGGERRERLYAEAVREIKENTRLLAE  379
                 +RTG+ K+IG+PEF  YF         +     + R+  Y EAV+EI+ENT LLA+
Sbjct  215   AGSKNRTGVHKSIGIPEFDRYFSLYLPERNHKVSEWDQARKAAYEEAVQEIRENTWLLAK  274

Query  378   RQLRKIQRLREVGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
             +Q+ +I+ L+   GWE+ R++AT +          S + EIW+  V+  S+KI+++FL++
Sbjct  275   KQIERIKMLKS-NGWEIQRLDATPSIG--------SSSREIWDKTVLDESVKIMKRFLVK  325



>gb|KGN52088.1| hypothetical protein Csa_5G609740 [Cucumis sativus]
Length=350

 Score =   259 bits (663),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 143/292 (49%), Positives = 190/292 (65%), Gaps = 18/292 (6%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG GKS  SV LA+ Y   +E+IN DK+QVYKGLDITTNKI + ER  V HHL+G+ 
Sbjct  71    MGATGCGKSGLSVQLASHY--QSEIINCDKMQVYKGLDITTNKIPLHERHDVPHHLLGDV  128

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             ++     +F+   FR      +SDI  R K+P +VGGSNS+I+A+LV  FNP  DVF  +
Sbjct  129   DSIHQ--DFTPFHFRLRADNVVSDIASRNKLPILVGGSNSFIHAMLVNHFNPNHDVFTPK  186

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDP--SNP  523
               S+  S    LRYRCCFLW+DV  P+L  YL  RVDEM+  GM EEL+ +Y DP  +  
Sbjct  187   --SLISS---HLRYRCCFLWLDVEFPILAEYLSIRVDEMLQIGMFEELAEFY-DPHTAET  240

Query  522   LSRTGLAKAIGVPEFAAYFR----APRGGERRERLYAEAVREIKENTRLLAERQLRKIQR  355
             +  TG+ KAIGVPEF  YF+    + + G  RE  + EAV  IK NT +LAERQ+ KI +
Sbjct  241   MPYTGIRKAIGVPEFDKYFQKNPPSKKSGIDREA-FEEAVEAIKRNTHVLAERQIGKILK  299

Query  354   LREVGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
             L+E  GW+++ +NAT AF A +   +     EIWE ++++PS +IV +FL E
Sbjct  300   LKE-AGWDINVLNATEAFRAVVEPGTGRNRKEIWEKEILEPSFRIVNRFLKE  350



>gb|KFK39236.1| hypothetical protein AALP_AA3G218100 [Arabis alpina]
Length=295

 Score =   257 bits (656),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 144/298 (48%), Positives = 194/298 (65%), Gaps = 32/298 (11%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR SVDLATR+  + E+INSDKIQ+Y GL+I TN+IT+PER GV HHL+G  
Sbjct  17    MGATGTGKSRLSVDLATRF--SGEIINSDKIQLYNGLEIATNQITIPERCGVPHHLLGVI  74

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
                E   E SA++FR+  +  IS+I  RGK+P I GGSNS+I+ LLVE F+PE + F   
Sbjct  75    PLDEG--EVSASEFRSLASRSISEIASRGKLPIIAGGSNSFIHTLLVEHFDPESNPF---  129

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
               S   S   ELRY CCFLWVDVS  VL  YL KRVD+MM+SGM EEL+ +Y  P +  S
Sbjct  130   --SSMPSISSELRYDCCFLWVDVSVSVLFHYLSKRVDQMMESGMFEELAGFYK-PRHSGS  186

Query  516   RT---GLAKAIGVPEFAAYFR--APRGGER-------RERLYAEAVREIKENTRLLAERQ  373
              T   G+ K IG+PEF  YF    P   ++       R+  Y EAV+ +K+NT  LA++Q
Sbjct  187   TTTLSGIHKTIGIPEFDRYFELYPPEKNDKVCEWDSARKAAYEEAVQAVKDNTWQLAKKQ  246

Query  372   LRKIQRLREVGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
             + +I +LR   GWE+ R++ATA+  +         + E+W+  V++ S+K V+ FLL+
Sbjct  247   VERIMKLR-CSGWEIQRLDATASLRS---------SREVWDKTVLEESIKTVKNFLLK  294



>ref|XP_002885297.1| ATIPT8 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61556.1| ATIPT8 [Arabidopsis lyrata subsp. lyrata]
Length=334

 Score =   258 bits (659),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 136/297 (46%), Positives = 194/297 (65%), Gaps = 29/297 (10%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATGSGKSR S+DLATR+  + EV+NSDKIQ Y GL +TTN++++PER GV HHL+GE 
Sbjct  49    MGATGSGKSRLSIDLATRF--SGEVVNSDKIQFYNGLKVTTNQMSIPERCGVPHHLLGEL  106

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
                +S  E + ++FR+  +  IS+I  RG +P + GGSNS+I+ALLV+RF+P+   F  E
Sbjct  107   PPDDS--ELTTSEFRSLASRSISEITARGNLPIVAGGSNSFIHALLVDRFDPQTYPFSSE  164

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSD--PSNP  523
                   S    LRY CCFLWVDVS  VL  YL KRVD+MM+SGM EEL+ +Y+     + 
Sbjct  165   V-----SISSNLRYECCFLWVDVSVSVLFEYLSKRVDQMMESGMFEELAGFYNPRYSGST  219

Query  522   LSRTGLAKAIGVPEFAAYF---------RAPRGGERRERLYAEAVREIKENTRLLAERQL  370
             +   G+ K IG+PEF  YF         + P   + R+  Y EAV+EIKENT  LA++Q+
Sbjct  220   IRTHGIHKTIGIPEFDRYFSLYPPENNHKMPEWDQARKAAYEEAVQEIKENTWRLAKKQI  279

Query  369   RKIQRLREVGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
              +I +L+   GW++ R++AT +F  +        + EIW+  V+  S+K+V++FL++
Sbjct  280   ERIVKLKS-SGWDIQRLDATPSFRRS--------SREIWDKTVLDESVKVVKRFLVK  327



>ref|XP_010468282.1| PREDICTED: adenylate isopentenyltransferase 8, chloroplastic-like 
[Camelina sativa]
Length=332

 Score =   257 bits (657),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 139/300 (46%), Positives = 196/300 (65%), Gaps = 36/300 (12%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATGSGKSR S+DLATR+  + E+INSDKIQ YKGL+ITTN++++ ER GV HHL+G  
Sbjct  48    MGATGSGKSRLSIDLATRF--SGEIINSDKIQFYKGLEITTNQMSISERCGVPHHLLGLL  105

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
                    E + +++R+  ++ IS+I  RGK+P I GGSNSYI+ALLV RF+P    F  +
Sbjct  106   PPDGG--ELTPSEYRSLASQSISEITARGKLPIIAGGSNSYIHALLVNRFDPLTHPFSSD  163

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPL-  520
                   S   +LRY CCFLWVDV+ PVL  +L KRVD+MM+SGM EEL+ +Y    NP+ 
Sbjct  164   T-----SISSDLRYECCFLWVDVAVPVLFEHLSKRVDQMMESGMFEELASFY----NPIY  214

Query  519   ----SRTGLAKAIGVPEFAAYF---------RAPRGGERRERLYAEAVREIKENTRLLAE  379
                 +RTG+ K+IG+PEF  YF         +     + R+ +Y EAV+EI+ENT LLA+
Sbjct  215   AGSKNRTGIHKSIGIPEFDRYFILYPPERNHKVSEWDQARKAVYEEAVQEIRENTWLLAK  274

Query  378   RQLRKIQRLREVGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
             +Q+ +I  L+   GWE+ R++AT +          S + EIW+  V+  S+KI+ +FL++
Sbjct  275   KQIERINMLKS-NGWEIQRLDATPSIG--------SWSREIWDKTVLAESVKIMNRFLVK  325



>ref|XP_010667107.1| PREDICTED: adenylate isopentenyltransferase 1, chloroplastic-like 
[Beta vulgaris subsp. vulgaris]
Length=298

 Score =   255 bits (651),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 133/294 (45%), Positives = 190/294 (65%), Gaps = 21/294 (7%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MG T SGKSR SV+LATR+  ++E+IN DK+QVYKGLDITTNKI   E+ G+ HHL+G  
Sbjct  14    MGPTASGKSRLSVELATRF--SSEIINCDKMQVYKGLDITTNKIPFEEQLGIPHHLLGNI  71

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             + S +  + S   +R   +  IS I  RG +P IVGGS S+IYALL + +NP+LD+F   
Sbjct  72    D-SATHGDMSPMQYRYMASSLISQITARGNLPIIVGGSTSFIYALLAKHYNPDLDIF---  127

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
               S       +LRY+CC LW DVS PVLN+Y+  R+++M+D+GML+EL+ ++      L 
Sbjct  128   --SGSSQMCSKLRYKCCLLWTDVSLPVLNQYISNRLEDMLDAGMLDELAEFHQSEMAKLE  185

Query  516   -RTGLAKAIGVPEFAAYFRAPRGGER---------RERLYAEAVREIKENTRLLAERQLR  367
               TG+AK+IGVPEF  YFR     ++         +  LY +AV+ ++ENT +LA+ Q+ 
Sbjct  186   PNTGVAKSIGVPEFEEYFRTYGCTKKSAVWEWDHMQRGLYKDAVKAVQENTCMLAKTQVE  245

Query  366   KIQRLREVGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFL  205
             KI+ L + GGW++ R++AT +F A +  E      E WE QV++PS+  V+ FL
Sbjct  246   KIKCL-QAGGWKIKRLDATKSFMALL--EGSGSWWESWETQVLEPSLNSVKNFL  296



>gb|KCW81303.1| hypothetical protein EUGRSUZ_C02671, partial [Eucalyptus grandis]
Length=314

 Score =   255 bits (651),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 148/302 (49%), Positives = 190/302 (63%), Gaps = 32/302 (11%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG GKSR S+DLA+ +  ++EVINSDK+QVY+GLD+TTNKI+  +R  V HHL+G F
Sbjct  22    MGATGCGKSRLSMDLASLF--SSEVINSDKMQVYRGLDLTTNKISRADRYRVPHHLLGSF  79

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             +  +   E + + FR+ G   IS +  RGK+P +VGGSNS+I+ALLVERF+P+ DV    
Sbjct  80    DPDDG--EMTPSQFRSLGHAAISGVASRGKMPLLVGGSNSFIHALLVERFDPDADVL---  134

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYS-DPSNPL  520
                +G     ELRY CCFLWVDVS PVL  Y  KRVDE+++ G  +EL+ +Y    +NP 
Sbjct  135   -GGIGSPASPELRYDCCFLWVDVSLPVLQEYQSKRVDELINMGTFDELTGYYDLRRTNPG  193

Query  519   SRTGLAKAIGVPEFAAYFRA---PRG------------GER-----RERLYAEAVREIKE  400
               TGL KAIGVPEF  YF     PRG             ER     RE  Y EAVREIK+
Sbjct  194   GWTGLRKAIGVPEFDRYFMKYPPPRGFGPGDAWWEEDARERDNDPVRESAYQEAVREIKK  253

Query  399   NTRLLAERQLRKIQRLREVGGWEMHRINATAAFAAAMGSESE--SETAEIWENQVVQPSM  226
             N   L  RQ+ KIQ+L    GWE+H + AT A   AM +E +    + ++WE QVV PS 
Sbjct  254   NVGQLIRRQIEKIQKLSR-SGWELHMLEATEAVRLAMAAEEKGCGRSRDVWERQVVGPSK  312

Query  225   KI  220
             +I
Sbjct  313   EI  314



>emb|CDY22984.1| BnaC03g40850D [Brassica napus]
Length=307

 Score =   254 bits (648),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 156/344 (45%), Positives = 214/344 (62%), Gaps = 40/344 (12%)
 Frame = -1

Query  1224  LMRIVSSFLSPAIPAPTISHAFLRSKSVSGKKVRGDLGWARAAIvggeekekvvvVMGAT  1045
             +  + S+F+S ++   T +   LR KS+    V  D       +V           MGAT
Sbjct  1     MQELTSTFVSRSLVPTTYTRPQLRPKSIVTMTVCMDQSRKEKVVVI----------MGAT  50

Query  1044  GSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEFEASE  865
             G+GKSR SV LA R+  + E+INSDK+Q Y GL+I TN+IT+PER GV HHL+GE    +
Sbjct  51    GTGKSRLSVALADRF--SGEIINSDKMQFYNGLEIATNQITIPERCGVPHHLLGELPVDD  108

Query  864   SRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDECNSV  685
             S  E +A++FR+  +  IS+I  RGK+P I GGSNS+++ALLV+RF+P  + F     S 
Sbjct  109   S--ELTASEFRSVASRSISEISSRGKLPIIAGGSNSFVHALLVDRFDPVTNPF-----SS  161

Query  684   GDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS--RT  511
               S   ELRY C FLWVDVS  VL  YL KRVD+MM+SGM EEL+ +Y +P N  S  RT
Sbjct  162   KPSISSELRYDCFFLWVDVSVSVLYDYLSKRVDQMMESGMFEELASFY-NPRNSRSTIRT  220

Query  510   GLAKAIGVPEFAAYFRAPRGGERRERLYAEAVREIKENTRLLAERQLRKIQRLREVGGWE  331
             G+ +AIGVPEF  YF A          Y EAV EIK+NT  LA++Q+ +I  LR   GWE
Sbjct  221   GIHRAIGVPEFDRYFGAA---------YEEAVHEIKDNTWRLAKKQIERIMMLRS-SGWE  270

Query  330   MHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
             +HR+++TA+  A+        + E+WE  V++ S+K V++FLL+
Sbjct  271   IHRLDSTASLRAS--------SREVWETNVLRESVKNVKRFLLK  306



>ref|XP_010051132.1| PREDICTED: adenylate isopentenyltransferase-like [Eucalyptus 
grandis]
 gb|KCW81308.1| hypothetical protein EUGRSUZ_C02679 [Eucalyptus grandis]
Length=320

 Score =   253 bits (647),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 149/309 (48%), Positives = 189/309 (61%), Gaps = 33/309 (11%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG GKS  S+DLA+ +F +AEVINSDK+QVY+GLDITTNKI   ERRGV HHL+G  
Sbjct  18    MGATGCGKSHLSIDLAS-HFRSAEVINSDKMQVYRGLDITTNKIPPDERRGVPHHLLGSL  76

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             +  +   E + + FR+ G   ISDI  RG +P +VGGS S I +LLVERF+ E DV    
Sbjct  77    DPDDG--EMTPSQFRSLGDAAISDITSRGSLPLLVGGSTSSILSLLVERFDQEEDVL---  131

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYS-DPSNPL  520
                +G     +LRY CCFLWVDVS PVL  +  KRVDEM+D G  +EL+ +Y    ++P 
Sbjct  132   -GRLGPPARPKLRYDCCFLWVDVSLPVLEEHQSKRVDEMLDKGAFDELAGYYDLRRTDPE  190

Query  519   SRTGLAKAIGVPEFAAYFR--APRGG------------------ERRERLYAEAVREIKE  400
               TGL KAIGVPEF  YF+   P GG                    R+  Y EAV EIK+
Sbjct  191   GWTGLRKAIGVPEFDRYFKKYPPPGGVCPDSPWRWQDARKRDDDPVRQGAYKEAVWEIKK  250

Query  399   NTRLLAERQLRKIQRLREVGGWEMHRINATAAFAAAMGSESESETA----EIWENQVVQP  232
             N   LA+RQ+ KIQRLR   GWE+ +++AT     AM +E E  +      +W+ QVV  
Sbjct  251   NACQLAKRQIEKIQRLRGC-GWELRKLDATEVVQLAMAAEEEGGSGVRWQGVWKRQVVGQ  309

Query  231   SMKIVEKFL  205
             S+ IV +FL
Sbjct  310   SVNIVRRFL  318



>ref|XP_009782718.1| PREDICTED: adenylate isopentenyltransferase 3, chloroplastic 
[Nicotiana sylvestris]
Length=322

 Score =   252 bits (644),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 138/290 (48%), Positives = 180/290 (62%), Gaps = 28/290 (10%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MG TG+GKSR S+DLAT++    E++NSDKIQVYKGLDI TNKIT  ER GV HHL+G  
Sbjct  31    MGVTGAGKSRLSIDLATQF--RGEIVNSDKIQVYKGLDIATNKITQEERCGVPHHLLGVI  88

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             +  +   EF+  +F    +  ++ I  RGK+P IVGGSNS+I AL+ +            
Sbjct  89    DPYK---EFTTKNFCNMASLAVNSITDRGKLPIIVGGSNSFIEALVHD------------  133

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                  +S     RY CCFLWVDVS  VLN +LY+RVD+MM+ GM +E+   + +P N   
Sbjct  134   -----NSHNFRTRYDCCFLWVDVSMNVLNSFLYERVDKMMEQGMTDEVRSMF-NPKNTDY  187

Query  516   RTGLAKAIGVPEFAAYFRAPRGG----ERRERLYAEAVREIKENTRLLAERQLRKIQRLR  349
               G+ KAIGVPEF +YFRA        E RERL  EA+ E+K N  +LA +QL KI+RL 
Sbjct  188   TKGIRKAIGVPEFDSYFRAELSNSVDVETRERLLKEAINEVKINNCILASKQLEKIKRLI  247

Query  348   EVGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
              V GW++ R++AT  F       +E E  EIW+N V+  S+KIV KFL E
Sbjct  248   NVKGWKIQRLDATEVFRRKQ-RNAEEEAEEIWKNMVMGQSIKIVGKFLCE  296



>ref|XP_010554960.1| PREDICTED: adenylate isopentenyltransferase 4-like [Tarenaya 
hassleriana]
Length=394

 Score =   253 bits (647),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 143/308 (46%), Positives = 196/308 (64%), Gaps = 33/308 (11%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATGSGKSR SVDLA  +  + E++NSDK+Q Y GL+ITTN++T+ ER+GV HHL+GE 
Sbjct  87    MGATGSGKSRLSVDLANIF--SGEIVNSDKLQFYNGLEITTNQMTVQERQGVPHHLLGEV  144

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             E  +   E +AA+FR+A A  IS IV RG +P + GGSNS+++ALL ER++PE   F+  
Sbjct  145   EPEDG--ELTAAEFRSAAARAISGIVSRGNLPILAGGSNSFVHALLAERWDPETYPFNGR  202

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWY---SDPSN  526
              +   D     LRY CCF+W+DV+PP+L  Y  +RVD+M++ GM EEL+  Y   +DP  
Sbjct  203   GSICSD-----LRYDCCFIWIDVAPPLLFEYHSRRVDKMLERGMFEELAELYDPKNDPGE  257

Query  525   PLSRTGLAKAIGVPEFAAYFRA-PRGGER-----------RERLYAEAVREIKENTRLLA  382
               +R GL K+IGVPEF  YFR  P    R           R+  Y  AVRE+KENT LLA
Sbjct  258   SWTRIGLWKSIGVPEFDRYFRKYPPQKTREAANRDDWDAARKSAYDRAVREVKENTFLLA  317

Query  381   ERQLRKIQRLREVGGWEMHRINATAAFAAAMGSESES------ETAEIWENQVVQPSMKI  220
              +Q+ KIQ+LR   GW++ R++A A F +A+ S             EIWE ++++P ++ 
Sbjct  318   MKQIEKIQKLRS-AGWDIRRVDAAAWFRSALSSPDGDGGSGGRRCKEIWEREILEPCVER  376

Query  219   V--EKFLL  202
             V  E F L
Sbjct  377   VRDEVFCL  384



>ref|NP_188547.1| adenylate isopentenyltransferase 8 [Arabidopsis thaliana]
 sp|Q9LJL4.1|IPT8_ARATH RecName: Full=Adenylate isopentenyltransferase 8, chloroplastic; 
Short=AtIPT8; AltName: Full=Adenylate dimethylallyltransferase 
8; AltName: Full=Cytokinin synthase 8; AltName: Full=Plant 
growth activator 22; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB02956.1| tRNA isopentenyl transferase-like protein [Arabidopsis thaliana]
 dbj|BAB59034.1| cytokinin synthase [Arabidopsis thaliana]
 dbj|BAB59047.1| adenylate isopentenyltransferase [Arabidopsis thaliana]
 gb|AEE76200.1| adenylate isopentenyltransferase 8 [Arabidopsis thaliana]
Length=330

 Score =   250 bits (639),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 137/299 (46%), Positives = 196/299 (66%), Gaps = 33/299 (11%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATGSGKS  S+DLATR+  + E++NSDKIQ Y GL +TTN++++ ER GV HHL+GE 
Sbjct  49    MGATGSGKSCLSIDLATRF--SGEIVNSDKIQFYDGLKVTTNQMSILERCGVPHHLLGEL  106

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
                +S  E + ++FR+  +  IS+I  RG +P I GGSNS+I+ALLV+RF+P+   F  E
Sbjct  107   PPDDS--ELTTSEFRSLASRSISEITARGNLPIIAGGSNSFIHALLVDRFDPKTYPFSSE  164

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDP---SN  526
                   S    LRY CCFLWVDVS  VL  YL KRVD+MM+SGM EEL+ +Y DP    +
Sbjct  165   T-----SISSGLRYECCFLWVDVSVSVLFEYLSKRVDQMMESGMFEELAGFY-DPRYSGS  218

Query  525   PLSRTGLAKAIGVPEFAAYFRAPRGGERRERL----------YAEAVREIKENTRLLAER  376
              +   G+ K IG+PEF  YF +    ER++++          Y EAV+EIKENT  LA++
Sbjct  219   AIRAHGIHKTIGIPEFDRYF-SLYPPERKQKMSEWDQARKGAYDEAVQEIKENTWRLAKK  277

Query  375   QLRKIQRLREVGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
             Q+ +I +L+   GW++ R++AT +F  +        + EIW+N V+  S+K+V++FL++
Sbjct  278   QIERIMKLKS-SGWDIQRLDATPSFGRS--------SREIWDNTVLDESIKVVKRFLVK  327



>ref|XP_009627634.1| PREDICTED: adenylate isopentenyltransferase 3, chloroplastic 
[Nicotiana tomentosiformis]
Length=325

 Score =   249 bits (637),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 138/290 (48%), Positives = 180/290 (62%), Gaps = 28/290 (10%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MG TG+GKSR S+DLAT++    EV+NSDKIQVYKGLDI TNKIT  ER  + HHL+G  
Sbjct  34    MGVTGAGKSRLSIDLATQF--RGEVVNSDKIQVYKGLDIATNKITQEERCNIPHHLLGVI  91

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             +  +   EF+  +F    +  +S I   GK+P IVGGSNS+I AL+ +            
Sbjct  92    DPYK---EFTTKNFCNMASLAVSSITDCGKLPIIVGGSNSFIEALVHD------------  136

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                  +S     RY CCFLWVDVS  VLN +LY+RVD+MM+ GM+EE+   + +P N   
Sbjct  137   -----NSHNFRTRYDCCFLWVDVSMNVLNSFLYERVDKMMEIGMIEEVRNMF-NPKNTDY  190

Query  516   RTGLAKAIGVPEFAAYFRAPRGG----ERRERLYAEAVREIKENTRLLAERQLRKIQRLR  349
               G+ KAIGVPEF +YFRA        E RERL  EA+ E+K N  +LA +QL KI+RL 
Sbjct  191   TKGIRKAIGVPEFDSYFRAELSNSVDVETRERLLKEAINEVKINNCILASKQLEKIKRLI  250

Query  348   EVGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
              V GW++ R++AT  F     + +E E  EIW+N V+  S+KIV KFL E
Sbjct  251   NVKGWKIQRLDATEVFRRKQRN-AEEEAEEIWKNIVMGQSIKIVGKFLCE  299



>emb|CDX82308.1| BnaA03g35130D [Brassica napus]
Length=326

 Score =   247 bits (630),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 146/297 (49%), Positives = 197/297 (66%), Gaps = 30/297 (10%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR SV LA R+  + E+INSDK+Q Y GL+I TN+IT+PER GV HHL+GE 
Sbjct  48    MGATGTGKSRLSVGLAARF--SGEIINSDKMQFYNGLEIATNQITIPERCGVAHHLLGEL  105

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
                +S  E +A++FR+  +  IS+I  RGK+P I GGSNS+++ALLV+RF+P  + F   
Sbjct  106   PVDDS--ELTASEFRSVASRSISEISSRGKLPIIAGGSNSFVHALLVDRFDPVTNPF---  160

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
               S   S   ELRY C FL VDVS  VL  YL KRVD+MM+SGM EEL+ +Y +P N  S
Sbjct  161   --SSKPSISSELRYDCFFLLVDVSASVLYHYLSKRVDQMMESGMFEELASFY-NPRNSRS  217

Query  516   --RTGLAKAIGVPEFAAYF--RAPRGG-------ERRERLYAEAVREIKENTRLLAERQL  370
               RTG+ +AIGVPEF  YF    P          + R+  Y E V EIK+NT  LA++Q+
Sbjct  218   TIRTGIHQAIGVPEFDRYFGVYPPEKSHNVFEWDQARKAAYEEVVHEIKDNTWRLAKKQI  277

Query  369   RKIQRLREVGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
              +I  LR   GWE+HR++ATA+  A+        + E+WEN+V++ S+K V++FLL+
Sbjct  278   ERIMMLRS-SGWEIHRLDATASLRAS--------SREVWENKVLRESVKNVKRFLLK  325



>gb|EYU46608.1| hypothetical protein MIMGU_mgv1a026307mg [Erythranthe guttata]
Length=320

 Score =   247 bits (630),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 140/288 (49%), Positives = 181/288 (63%), Gaps = 33/288 (11%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR S+DLATR+  AAEVINSDK+QVY+GLDI TNKIT  ERRGV HHL+G  
Sbjct  35    MGATGTGKSRLSIDLATRF--AAEVINSDKMQVYQGLDIATNKITDEERRGVPHHLLGVV  92

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
                E+  +FSA +FRA  +  +  I+GRG +P IVGGSNS++ AL+   F          
Sbjct  93    ADPET--DFSAGNFRAVASISMRSILGRGHLPIIVGGSNSFVEALVDMNF----------  140

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                       +LRY CCFLWVDV  PVL+ ++  RVD+M++ GM++E+  +Y  P+   S
Sbjct  141   ----------QLRYDCCFLWVDVGMPVLHSFVSDRVDKMVERGMIDEVRDFYR-PNADYS  189

Query  516   RTGLAKAIGVPEFAAYFRAPR--GGERRERLYAEAVREIKENTRLLAERQLRKIQRLREV  343
             R G+ +AIGVPE   +FR       E R R+ AEA+  IK NT  L+ RQL KI RLR +
Sbjct  190   R-GIRRAIGVPELDEFFRVESFCDDETRARILAEAIDSIKSNTSRLSRRQLEKIHRLRNI  248

Query  342   GGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
              GW MHR++AT  F    G   E+E A  WEN V  P   +V +FL +
Sbjct  249   KGWRMHRLDATDVFRKRGG---EAEAA--WENTVAGPGAALVSRFLYD  291



>gb|KDO76979.1| hypothetical protein CISIN_1g019312mg [Citrus sinensis]
Length=343

 Score =   247 bits (630),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 144/297 (48%), Positives = 188/297 (63%), Gaps = 29/297 (10%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKS  S+DLATR+F  +E+INSDK+QVYKGLDITTNKI   +R  V HHL+GEF
Sbjct  65    MGATGTGKSGLSIDLATRFF-PSEIINSDKMQVYKGLDITTNKIPSHKRHNVPHHLLGEF  123

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
                +   EF+  DFR      ISDI+ R K P +VGGSNS+IY+LLV+ ++  L VFDD 
Sbjct  124   VPDDV--EFTPDDFRLQADNAISDIISRKKTPLLVGGSNSFIYSLLVQEYDRGLSVFDDR  181

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDP----S  529
              +S  DS    LRY CCFLWVD S  +L  YL KRVD+M++SGM EEL+ ++       +
Sbjct  182   FDS--DSVSSSLRYNCCFLWVDSSLQLLYDYLNKRVDDMLESGMFEELAEFFDSDRMRNN  239

Query  528   NPLSR-TGLAKAIGVPEFAAYFRAPRGGERRERLYAEAVREIK---ENTR---LLAERQL  370
             N +S   GL KAIGVPEF  YF          ++Y  A  E+K   +  R       RQ+
Sbjct  240   NSVSLGVGLLKAIGVPEFERYF----------KMYPPASVEVKGEWDPVRRGVYQEARQI  289

Query  369   RKIQRLREVGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
              KI +L E  GW++ R++AT AF   +  + E     +WE QVV+PS+KIV++FL E
Sbjct  290   DKILKL-ERAGWDLRRLDATTAFRMLVNGDQEWRC--VWERQVVEPSVKIVKRFLDE  343



>ref|XP_006415869.1| hypothetical protein EUTSA_v10009876mg [Eutrema salsugineum]
 gb|ESQ34222.1| hypothetical protein EUTSA_v10009876mg [Eutrema salsugineum]
Length=338

 Score =   246 bits (629),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 140/296 (47%), Positives = 193/296 (65%), Gaps = 18/296 (6%)
 Frame = -1

Query  1053  GATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEFE  874
             G TG+GKSR S+DLATR+  +AE+INSDK+Q+YKGL+I TN I + E+ GV HHL+GEF+
Sbjct  49    GTTGTGKSRLSIDLATRF--SAEIINSDKMQIYKGLEIVTNLIPVNEQCGVSHHLLGEFQ  106

Query  873   ASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDEC  694
               +   E + A+FR+     IS ++  GK+P IVGGSNS+ +ALL ERF+PE D F  E 
Sbjct  107   PEDG--EVTPAEFRSLATLSISKVISNGKLPIIVGGSNSFNHALLAERFDPENDPFSPE-  163

Query  693   NSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLSR  514
              S   S   ELRY+CC L VDVS PVL ++L  RVD+M++ G+ E+L+ +Y    +   R
Sbjct  164   -SSLSSICSELRYKCCILCVDVSEPVLFQHLSNRVDQMIELGLFEQLAAFYDPVVDSGPR  222

Query  513   TGLAKAIGVPEFAAYFRA-PRGGER------RERLYAEAVREIKENTRLLAERQLRKIQR  355
              G+ K IGV EF  YFR  PR G +      R+  Y EAV+++KE T  L ++Q  KI +
Sbjct  223   VGVRKTIGVEEFDRYFRVYPREGNKGMWDSARKAAYEEAVKKMKERTCRLVKKQKEKIMK  282

Query  354   LREVGGWEMHRINATAAFAAAM---GSESESETA-EIWENQVVQPSMKIVEKFLLE  199
             L   GGWE+ R++ATAA  A +    +  E +   +IWE  VV+ S+KIV +FLL+
Sbjct  283   LIR-GGWEVKRLDATAAIMAELYQGTTLGEGKCKRDIWEKYVVEESVKIVNRFLLD  337



>ref|XP_009135619.1| PREDICTED: adenylate isopentenyltransferase 8, chloroplastic 
[Brassica rapa]
Length=327

 Score =   243 bits (621),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 148/297 (50%), Positives = 194/297 (65%), Gaps = 31/297 (10%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR SV LA R+  + E+INSDK+Q Y GL+I TN+IT+PER GV HHL+GE 
Sbjct  48    MGATGTGKSRLSVGLAARF--SGEIINSDKMQFYNGLEIATNQITIPERCGVAHHLLGEL  105

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
                +S  E  A++FR+  +  IS+I  RGK+P I GGSNS+++ALLV RF+P  + F   
Sbjct  106   PVDDS--ELIASEFRSVASRSISEISSRGKLPIIAGGSNSFVHALLVGRFDPVTNPF---  160

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
               S   S   ELRY C FLWVDVS  VL  YL KRVD+MM+SGM EEL+ +Y +P N  S
Sbjct  161   --SSKPSISSELRYDCFFLWVDVSASVLYHYLSKRVDKMMESGMFEELASFY-NPRNSRS  217

Query  516   --RTGLAKAIGVPEFAAYF--RAPRGG-------ERRERLYAE-AVREIKENTRLLAERQ  373
               RTG+ +AIGVPEF  YF    P          + R+  Y E AV EIK+NT  LA++Q
Sbjct  218   TIRTGIHRAIGVPEFDRYFGVYPPEKSHNVFEWDQARKAAYEELAVHEIKDNTWRLAKKQ  277

Query  372   LRKIQRLREVGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLL  202
             + +I  LR   GWE+HR+NATA+  A+        + E+WE  V++ S+K V++FLL
Sbjct  278   IERIMMLRS-SGWEIHRLNATASLRAS--------SREVWEKNVLRESVKNVKRFLL  325



>ref|XP_009778781.1| PREDICTED: adenylate isopentenyltransferase 3, chloroplastic-like 
[Nicotiana sylvestris]
Length=338

 Score =   243 bits (621),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 135/290 (47%), Positives = 180/290 (62%), Gaps = 28/290 (10%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR SVDLAT +    E++NSDKIQVYKGLD+ TNKIT  ER G+ HHL+G  
Sbjct  44    MGATGAGKSRLSVDLATHF--GGEIVNSDKIQVYKGLDVATNKITEEERCGIRHHLLG--  99

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
              A +   EF+A++F    +  I+ I  RGK+P IVGGSNS+I AL+ ++           
Sbjct  100   -AIDPHKEFTASNFCDMASLAINSITCRGKLPIIVGGSNSFIEALIYDK-----------  147

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                   ++ L  RY  CFLWVDVS  VLN +L KRVD+M++ G++ E+   + +P N   
Sbjct  148   ------TYELYTRYNFCFLWVDVSMHVLNSFLTKRVDKMIEKGLVNEVRNIF-NPKNEDY  200

Query  516   RTGLAKAIGVPEFAAYFRAPRGG----ERRERLYAEAVREIKENTRLLAERQLRKIQRLR  349
               G+ KAIGVPEF  YFRA        E R +L  EA+ E+K N   LA +QL KI+RL 
Sbjct  201   SKGIRKAIGVPEFDRYFRAESSNSIDEETRIKLLEEAINEVKINNCKLASQQLEKIKRLI  260

Query  348   EVGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
              V GW +HR++AT  +    G+E E    E+W+N VV  S +IV++FL E
Sbjct  261   NVKGWNVHRLDATEVYTKR-GNEEEVMVEELWKNLVVGQSKRIVDRFLCE  309



>ref|XP_008235248.1| PREDICTED: adenylate isopentenyltransferase 3, chloroplastic 
[Prunus mume]
Length=322

 Score =   241 bits (616),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 140/286 (49%), Positives = 183/286 (64%), Gaps = 31/286 (11%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR S+DLAT    AAE+INSDK+QVYKGLDI TNKIT  E+RGV HHL+G  
Sbjct  37    MGATGTGKSRLSIDLATH--LAAEIINSDKMQVYKGLDIATNKITEEEQRGVPHHLLG--  92

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
                +   +F+A DF    +  I  I+GR ++P IVGGSNSYI AL        +D +D  
Sbjct  93    -IHDPNADFTATDFCDETSLTIESILGRDRLPIIVGGSNSYIEAL--------IDDYD--  141

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                    +    +Y CCFLWV+VS PVL+ ++ KRVD+M+++GM++E+  ++  P+   S
Sbjct  142   -------YKFRSKYECCFLWVNVSTPVLHSFVSKRVDKMVENGMVDEVKEFFH-PNADYS  193

Query  516   RTGLAKAIGVPEFAAYFR-AP-RGGERRERLYAEAVREIKENTRLLAERQLRKIQRLREV  343
             + G+ +AIGVPEF  YFR  P    E R RL  +AV EIK+N   LA RQL KIQRLR V
Sbjct  194   K-GIRRAIGVPEFDKYFRYGPFLDEETRARLLEQAVEEIKKNNCKLASRQLEKIQRLRNV  252

Query  342   GGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFL  205
              GW +H ++AT  F    G ES+    E WE  V +PS +IV +FL
Sbjct  253   KGWNLHPLDATEVFRKR-GKESD----EAWEKFVYEPSAQIVRQFL  293



>ref|NP_173912.1| adenylate isopentenyltransferase 6 [Arabidopsis thaliana]
 sp|Q9C6L1.1|IPT6_ARATH RecName: Full=Adenylate isopentenyltransferase 6, chloroplastic; 
Short=AtIPT6; AltName: Full=Adenylate dimethylallyltransferase 
6; AltName: Full=Cytokinin synthase 6; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAG50809.1|AC079281_11 tRNA isopentenyl transferase, putative [Arabidopsis thaliana]
 dbj|BAB59045.1| adenylate isopentenyltransferase [Arabidopsis thaliana]
 gb|AEE30619.1| adenylate isopentenyltransferase 6 [Arabidopsis thaliana]
Length=342

 Score =   242 bits (617),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 132/296 (45%), Positives = 187/296 (63%), Gaps = 17/296 (6%)
 Frame = -1

Query  1053  GATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEFE  874
             G TG+GKSR SVDLATR+F  AE+INSDK+Q+YKG +I TN I + E+ GV HHL+G+F 
Sbjct  52    GTTGTGKSRLSVDLATRFF-PAEIINSDKMQIYKGFEIVTNLIPLHEQGGVPHHLLGQFH  110

Query  873   ASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDEC  694
               +   E + A+FR+     IS ++   K+P +VGGSNS+ +ALL ERF+P++D F    
Sbjct  111   PQDG--ELTPAEFRSLATLSISKLISSKKLPIVVGGSNSFNHALLAERFDPDIDPFSP--  166

Query  693   NSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLSR  514
              S   +   +LRY+CC LWVDV  PVL ++L  RVD+M++SG++E+L+  Y    +   R
Sbjct  167   GSSLSTICSDLRYKCCILWVDVLEPVLFQHLCNRVDQMIESGLVEQLAELYDPVVDSGRR  226

Query  513   TGLAKAIGVPEFAAYFRA-PRGGER------RERLYAEAVREIKENTRLLAERQLRKIQR  355
              G+ K IGV EF  YFR  P+  ++      R+  Y E V+ +KE T  L ++Q  KI +
Sbjct  227   LGVRKTIGVEEFDRYFRVYPKEMDKGIWDLARKAAYEETVKGMKERTCRLVKKQKEKIMK  286

Query  354   LREVGGWEMHRINATAAFAAAMGSESESETA----EIWENQVVQPSMKIVEKFLLE  199
             L   GGWE+ R++ATAA  A +   +         EIWE  +V  S++IV+KFLLE
Sbjct  287   LIR-GGWEIKRLDATAAIMAELNQSTAKGEGKNGREIWEKHIVDESVEIVKKFLLE  341



>ref|NP_197405.1| isopentenyltransferase 5 [Arabidopsis thaliana]
 sp|Q94ID2.2|IPT5_ARATH RecName: Full=Adenylate isopentenyltransferase 5, chloroplastic; 
Short=AtIPT5; AltName: Full=Adenylate dimethylallyltransferase 
5; AltName: Full=Cytokinin synthase 5; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAB59041.1| adenylate isopentenyltransferase [Arabidopsis thaliana]
 gb|AED92645.1| isopentenyltransferase 5 [Arabidopsis thaliana]
Length=330

 Score =   241 bits (616),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 136/287 (47%), Positives = 176/287 (61%), Gaps = 31/287 (11%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR ++DLATR+   AE++NSDKIQVYKGLDI TNK+T  E  GV HHL+G  
Sbjct  39    MGATGTGKSRLAIDLATRF--PAEIVNSDKIQVYKGLDIVTNKVTPEESLGVPHHLLGTV  96

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
                ++  +F+A DF+      +  IV R +VP I GGSNSYI AL               
Sbjct  97    H--DTYEDFTAEDFQREAIRAVESIVQRDRVPIIAGGSNSYIEAL---------------  139

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                V D     LRY CCFLWVDVS PVL+ ++ +RVD+M+D G+++E+ R + DPS+   
Sbjct  140   ---VNDCVDFRLRYNCCFLWVDVSRPVLHSFVSERVDKMVDMGLVDEVRRIF-DPSSSDY  195

Query  516   RTGLAKAIGVPEFAAYFRAPR---GGERRERLYAEAVREIKENTRLLAERQLRKIQRLRE  346
               G+ +AIGVPE   + R+       E  ERL   A+ +IKENT LLA RQL+KIQRL +
Sbjct  196   SAGIRRAIGVPELDEFLRSEMRNYPAETTERLLETAIEKIKENTCLLACRQLQKIQRLYK  255

Query  345   VGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFL  205
                W MHR++AT  F    G E++    E W+N V  PS   VEKFL
Sbjct  256   QWKWNMHRVDATEVFLRR-GEEAD----EAWDNSVAHPSALAVEKFL  297



>ref|XP_010090377.1| Adenylate isopentenyltransferase 3 [Morus notabilis]
 gb|EXB39347.1| Adenylate isopentenyltransferase 3 [Morus notabilis]
Length=317

 Score =   241 bits (614),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 138/286 (48%), Positives = 183/286 (64%), Gaps = 30/286 (10%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR SVDLATR+   AE++NSDK+QVY+GL+ITTNKIT  E+ GV HHL+G  
Sbjct  37    MGATGTGKSRLSVDLATRFH--AEIVNSDKMQVYEGLEITTNKITKEEQCGVPHHLLGAV  94

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             +   +  +FSA DF  A +  I  IV  G++P I GGSNSYI  L+        DV D  
Sbjct  95    QNPNA--DFSADDFSDAASIAIESIVDHGRLPIIAGGSNSYIEHLV--------DVLD--  142

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                    +    +Y CCFLWVDVS PVL+ Y+ KRVDEM+ +GM+EE+ + + DP+   S
Sbjct  143   -------YSFRAKYECCFLWVDVSMPVLHPYVSKRVDEMVRNGMVEEVRKMF-DPNASYS  194

Query  516   RTGLAKAIGVPEFAAYFRAPR--GGERRERLYAEAVREIKENTRLLAERQLRKIQRLREV  343
             + G+ +AIGVPEF  YFR  +    + R R+  EA+ EIK+NT  LA RQL KI RLR  
Sbjct  195   K-GIRRAIGVPEFDRYFRDEKLYDEKTRARVLQEAINEIKDNTCKLACRQLGKIHRLRNR  253

Query  342   GGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFL  205
              GW +HR++AT  +    G+E+E    + W+  V  PS  IV++FL
Sbjct  254   DGWTLHRLDATEVY-RRRGNEAE----QAWKRHVAAPSAAIVDEFL  294



>gb|KCW81313.1| hypothetical protein EUGRSUZ_C02688 [Eucalyptus grandis]
Length=299

 Score =   240 bits (612),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 144/300 (48%), Positives = 184/300 (61%), Gaps = 37/300 (12%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             +GATG GKS  S+DLA+ +F +AEVINSDK+QVY+GLDITTNKI   ERRGV HHL+G  
Sbjct  19    IGATGCGKSLLSIDLAS-FFRSAEVINSDKMQVYRGLDITTNKIPPDERRGVPHHLLGSL  77

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDV---F  706
             +  +   E + + FR+ G   ISD+  RG +P +VGGS S I ALL ERF+ E DV   F
Sbjct  78    DPDDG--EMTPSQFRSLGDAAISDVASRGSLPLLVGGSTSSILALLAERFDQEEDVLGRF  135

Query  705   DDECNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYS-DPS  529
             D            +LRY CCFLWVDVS PVL  +  KRVDEM+D G  +EL+ +Y    +
Sbjct  136   DPPARP-------KLRYDCCFLWVDVSLPVLEEHQSKRVDEMLDKGAFDELAGYYDLRRT  188

Query  528   NPLSRTGLAKAIGVPEFAAYFR---APRGGER-----RERLYAEAVREIKENTRLLAERQ  373
             +P   TGL KAIGVPEF  YF+    P GG+R     R+  Y EA          LA+RQ
Sbjct  189   DPEGWTGLRKAIGVPEFDRYFKKYPPPGGGKRDDDPVRQGAYKEA----------LAKRQ  238

Query  372   LRKIQRLREVGGWEMHRINATAAFAAAMGSESESETA----EIWENQVVQPSMKIVEKFL  205
             + KIQRLR   GWE+ +++AT     AM +E E  +      +W+ QVV  S+ IV +FL
Sbjct  239   IEKIQRLRGC-GWELRKLDATEVVQLAMAAEEEGGSGVRWQGVWKRQVVGRSVNIVRRFL  297



>ref|XP_007200740.1| hypothetical protein PRUPE_ppa023171mg [Prunus persica]
 gb|EMJ01939.1| hypothetical protein PRUPE_ppa023171mg [Prunus persica]
Length=322

 Score =   240 bits (613),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 140/286 (49%), Positives = 184/286 (64%), Gaps = 31/286 (11%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR S+DLAT    AAE+INSDK+QVYKGLDI TNKIT  E+RGV HHL+G  
Sbjct  37    MGATGTGKSRLSIDLATHL--AAEIINSDKMQVYKGLDIATNKITEEEQRGVPHHLLGIL  94

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             + +E   +F+A DF    +  I  I+GR ++P IVGGSNSYI AL        +D +D  
Sbjct  95    DPNE---DFTATDFCDETSLTIESILGRDRLPIIVGGSNSYIEAL--------IDDYD--  141

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                    +    +Y CCFLWV+VS PVL+ ++ KRVD+M+++GM++E+  ++  P+   S
Sbjct  142   -------YKFRSKYECCFLWVNVSTPVLHSFVSKRVDKMVENGMVDEVREFFH-PNADYS  193

Query  516   RTGLAKAIGVPEFAAYFR-AP-RGGERRERLYAEAVREIKENTRLLAERQLRKIQRLREV  343
             + G+ +AIGVPEF  YFR  P    E + RL  +AV EIK+N   LA RQL KIQRLR V
Sbjct  194   K-GIRRAIGVPEFDKYFRYGPFLDEETKARLLEQAVEEIKKNNCKLASRQLEKIQRLRNV  252

Query  342   GGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFL  205
              GW +H ++AT  F    G ES+    E WE  V  PS +IV +FL
Sbjct  253   KGWNLHPLDATEVFRKR-GKESD----EAWEKFVYGPSAQIVRQFL  293



>ref|XP_006842304.1| hypothetical protein AMTR_s00079p00118940 [Amborella trichopoda]
 gb|ERN03979.1| hypothetical protein AMTR_s00079p00118940 [Amborella trichopoda]
Length=358

 Score =   241 bits (614),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 139/312 (45%), Positives = 195/312 (63%), Gaps = 37/312 (12%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MG TG+GK++ S+DLATR+  +AE+IN DK+Q YKGLDI TNK+++ +RRGV HHL+GEF
Sbjct  54    MGPTGTGKTKLSLDLATRF--SAEIINCDKMQFYKGLDIATNKVSVEDRRGVRHHLLGEF  111

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             +  +   E SA +FR+  +E I+ +  RG++P +VGGSNSYI AL+ E   P  D  +  
Sbjct  112   DDRDG--EVSADNFRSLASEVIASVTERGRIPILVGGSNSYIQALVEEVPLPASD--ESA  167

Query  696   C------NSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSD  535
             C       +  D   L  RY CCF+WVDV  PVL  ++ +RVDEM+D+G+ EE++++Y  
Sbjct  168   CIELLRQKTENDLNRLAFRYDCCFIWVDVKMPVLYEWVSRRVDEMLDAGLFEEVAKFYEP  227

Query  534   PSNPLSRTGLAKAIGVPEFAAYFRA-PRG-------GERRERLYAEAVREIKENTRLLAE  379
              +N     G+ KAIGVPEF  + +  P G        E R+RL+ +AV  IK NT  LA+
Sbjct  228   GAN--YSQGVRKAIGVPEFDMFLQCFPPGSGQELSMAEERKRLFDKAVSAIKSNTCELAK  285

Query  378   RQLRKIQRLREVGGWEMHRINATAAF-------------AAAMGSESESE-TAEIWENQV  241
             +Q  +I  L E  GW++HRI+AT  F              +A+ S   S   A+IWE  V
Sbjct  286   KQRERIVGLEE-SGWKLHRIDATEVFFSGCLAHSGVSSQDSALSSPVSSRVVADIWEEMV  344

Query  240   VQPSMKIVEKFL  205
             VQP++KIV+KFL
Sbjct  345   VQPTVKIVKKFL  356



>dbj|BAB59032.1| cytokinin synthase [Arabidopsis thaliana]
Length=330

 Score =   239 bits (611),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 135/287 (47%), Positives = 176/287 (61%), Gaps = 31/287 (11%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR ++DLATR+   AE++NSDKIQVYKGLDI TNK+T  E  GV HHL+G  
Sbjct  39    MGATGTGKSRLAIDLATRF--PAEIVNSDKIQVYKGLDIVTNKVTPEESLGVPHHLLGT-  95

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
                ++  +F+A DF+      +  IV R +VP I GGSNSYI AL               
Sbjct  96    -VHDTYEDFTAEDFQREAIRAVESIVQRDRVPIIAGGSNSYIEAL---------------  139

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                V D     LRY CCFLWVDVS PVL+ ++ +RVD+M++ G+++E+ R + DPS+   
Sbjct  140   ---VNDCVDFRLRYNCCFLWVDVSRPVLHSFVSERVDKMVEMGLVDEVRRIF-DPSSSDY  195

Query  516   RTGLAKAIGVPEFAAYFRAPR---GGERRERLYAEAVREIKENTRLLAERQLRKIQRLRE  346
               G+ +AIGVPE   + R+       E  ERL   A+ +IKENT LLA RQL+KIQRL +
Sbjct  196   SAGIRRAIGVPELDEFLRSEMRNYPAETTERLLETAIEKIKENTCLLACRQLQKIQRLYK  255

Query  345   VGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFL  205
                W MHR++AT  F    G E++    E W+N V  PS   VEKFL
Sbjct  256   QWKWNMHRVDATEVFLRR-GEEAD----EAWDNSVAHPSALAVEKFL  297



>ref|XP_006305994.1| hypothetical protein CARUB_v10011273mg [Capsella rubella]
 gb|EOA38892.1| hypothetical protein CARUB_v10011273mg [Capsella rubella]
Length=339

 Score =   239 bits (609),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 139/297 (47%), Positives = 182/297 (61%), Gaps = 19/297 (6%)
 Frame = -1

Query  1053  GATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEFE  874
             G TG+GKSR SVDLA  +    E+INSDK+QVY GL+I TN I   E+ GV HHL+GEF 
Sbjct  49    GTTGTGKSRLSVDLANHF--TGEIINSDKMQVYSGLEIATNLIPDDEQGGVPHHLLGEFH  106

Query  873   ASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDEC  694
               +   E S A+FR+     IS++V RGK+P IVGGSNS+ +ALLVERF+PE D F    
Sbjct  107   PEDG--ELSPAEFRSLATLSISNVVSRGKLPIIVGGSNSFNHALLVERFDPETDPFAP--  162

Query  693   NSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLSR  514
              S   +   +LRY CC  WVDVS PVL ++L  RVD+M+DSG++E+L+ +Y    +   R
Sbjct  163   TSSLSTICSDLRYNCCIFWVDVSEPVLFQHLCNRVDKMIDSGLVEQLAAFYDPIVDSGPR  222

Query  513   TGLAKAIGVPEFAAYFRA-PRGGER------RERLYAEAVREIKENTRLLAERQLRKIQR  355
              G+ K IGV EF  YFR  PR   +      R+  Y EAV+ +KE T  L + Q  KI +
Sbjct  223   LGVRKTIGVEEFDRYFRVYPREMNKGTWDLGRKIAYEEAVKGMKERTCRLVKIQKEKIMK  282

Query  354   LREVGGWEMHRINATAAFAAAMGSESES-----ETAEIWENQVVQPSMKIVEKFLLE  199
             L   GGWE+ R++ATAA  A +   S        + EIWE  V   S+  V++FLLE
Sbjct  283   LIR-GGWEIKRLDATAAIMAGLNKRSGKLGEGMSSDEIWEKDVFNVSVDTVKRFLLE  338



>ref|XP_009365803.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic 
[Pyrus x bretschneideri]
Length=336

 Score =   238 bits (608),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 128/302 (42%), Positives = 183/302 (61%), Gaps = 31/302 (10%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR ++DLA R+   AE+INSDK+QVYKGLDI TNK+T  E +G+ HHLIG+ 
Sbjct  42    MGATGTGKSRLAIDLA-RHNPPAEIINSDKMQVYKGLDIVTNKVTEDECKGIPHHLIGKV  100

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             +      +F+A DF+   +  I  I+ R ++P I GGSNSYI AL               
Sbjct  101   DPDS---DFTANDFKHHASLAIESILERDRLPIIAGGSNSYIEAL---------------  142

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                V +     ++Y CCFLWVDV+ PVL+ ++ +RVD M+  G++EE+ R +   +    
Sbjct  143   ---VDEHSEFRMKYECCFLWVDVAIPVLHSFVSERVDRMVQMGLVEEVRRMFDSTTEKEY  199

Query  516   RTGLAKAIGVPEFAAYFRAPRGG----ERRERLYAEAVREIKENTRLLAERQLRKIQRLR  349
               G+ +AIGVPE   Y +    G    E +ERL   A+ +IKENT +LA RQL+KI+RL+
Sbjct  200   TRGIRRAIGVPEMDEYLQGEASGNNDDETQERLLQAAISKIKENTCILAYRQLQKIRRLQ  259

Query  348   EVGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE*VFQLFPALT  169
                GW MHR++AT AF      +  +ET + WE  V +P+ +IV +FLL+ +  L P   
Sbjct  260   ARRGWNMHRLDATEAFL-----KHHAETNQAWEKLVARPATRIVRQFLLDPIPSLLPTEN  314

Query  168   LS  163
             ++
Sbjct  315   IT  316



>ref|XP_009342172.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Pyrus x bretschneideri]
Length=336

 Score =   238 bits (607),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 128/302 (42%), Positives = 183/302 (61%), Gaps = 31/302 (10%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR ++DLA R+   AE+INSDK+QVYKGLDI TNK+T  E +G+ HHLIG+ 
Sbjct  42    MGATGTGKSRLAIDLA-RHNPPAEIINSDKMQVYKGLDIVTNKVTEDECKGIPHHLIGKV  100

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             +      +F+A DF+   +  I  I+ R ++P I GGSNSYI AL               
Sbjct  101   DPDS---DFTANDFKHHASLAIESILERDRLPIIAGGSNSYIEAL---------------  142

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                V +     ++Y CCFLWVDV+ PVL+ ++ +RVD M+  G++EE+ R +   +    
Sbjct  143   ---VDEHSEFRMKYECCFLWVDVAIPVLHSFVSERVDRMVKMGLVEEVRRMFDSTTEKEY  199

Query  516   RTGLAKAIGVPEFAAYFRAPRGG----ERRERLYAEAVREIKENTRLLAERQLRKIQRLR  349
               G+ +AIGVPE   Y +    G    E +ERL   A+ +IKENT +LA RQL+KI+RL+
Sbjct  200   TRGIRRAIGVPEMDEYLQGEASGNNDDETQERLLQAAISKIKENTCILAYRQLQKIRRLQ  259

Query  348   EVGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE*VFQLFPALT  169
                GW MHR++AT AF      +  +ET + WE  V +P+ +IV +FLL+ +  L P   
Sbjct  260   ARRGWNMHRLDATEAFL-----KHHAETNQAWEKLVARPATRIVRQFLLDPIPSLLPTEN  314

Query  168   LS  163
             ++
Sbjct  315   IT  316



>ref|XP_002873926.1| cytokinin synthase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50185.1| cytokinin synthase [Arabidopsis lyrata subsp. lyrata]
Length=329

 Score =   237 bits (605),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 134/287 (47%), Positives = 175/287 (61%), Gaps = 31/287 (11%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR ++DLATR+   AE++NSDKIQVYKGLDI TNK+T  E  G+ HHL+G  
Sbjct  38    MGATGTGKSRLAIDLATRF--PAEIVNSDKIQVYKGLDIVTNKVTPEESLGIPHHLLGTV  95

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
                ++  +F+A DF+      +  IV RG+VP I GGSNSYI AL               
Sbjct  96    H--DTYEDFTAEDFQREAIRAVESIVQRGRVPIIAGGSNSYIEAL---------------  138

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                V D     LRY CCFLWVDVS PVL+ ++ +RVD+M++ G++ E+ R +   S+  S
Sbjct  139   ---VNDCVDFRLRYNCCFLWVDVSRPVLHSFVSERVDKMVEMGLVGEVRRIFDSSSSDYS  195

Query  516   RTGLAKAIGVPEFAAYFRAP---RGGERRERLYAEAVREIKENTRLLAERQLRKIQRLRE  346
               G+ +AIGVPE   + RA       E  ERL   A+ +IKENT LLA RQL+KIQRL +
Sbjct  196   -AGIRRAIGVPELDEFLRAELRNNPAETTERLLETAIEKIKENTCLLACRQLQKIQRLYK  254

Query  345   VGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFL  205
                W MHR++AT  F    G E++    E W+N V  PS   VE+FL
Sbjct  255   QWKWNMHRVDATEVF-LRRGEEAD----EAWDNSVAHPSALAVERFL  296



>ref|XP_002869707.1| ATIPT4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45966.1| ATIPT4 [Arabidopsis lyrata subsp. lyrata]
Length=318

 Score =   237 bits (604),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 132/296 (45%), Positives = 179/296 (60%), Gaps = 21/296 (7%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATGSGKS  SVDLA  +   AE+INSDK+Q Y GL ITTN+ T+ +RRGV HHL+GE 
Sbjct  11    MGATGSGKSSLSVDLALHF--KAEIINSDKMQFYDGLKITTNQSTISDRRGVPHHLLGEL  68

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
                    E +AA+FR   A+ IS+I  R  +P + GGSNSYI+ALL + ++PE   F D 
Sbjct  69    NPEAG--EVTAAEFRVMAAKAISEITQRKTLPILAGGSNSYIHALLAKSYDPENYPFSDH  126

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
               S+      EL+Y CCF+W+DV  PVL  YL  R+D MM SGM EE++ ++     P  
Sbjct  127   KGSICS----ELKYDCCFIWIDVDQPVLFEYLSLRLDMMMKSGMFEEIAEFHRAKKAPKE  182

Query  516   RTGLAKAIGVPEFAAYFR-------APRGGERRERLYAEAVREIKENTRLLAERQLRKIQ  358
               GL KAIGV EF  Y +         +    R+  Y +AVR IKENT  L + Q++KI 
Sbjct  183   PLGLWKAIGVQEFDDYLKKYKWDDDMDKWDTMRKEAYEKAVRAIKENTFQLTKDQIKKID  242

Query  357   RLREVGGWEMHRINATAAFAAAMGSESESETA-----EIWENQVVQPSMKIVEKFL  205
             +LR   GW++ ++ ATA+F  A+ +  E E       +IW  +V++P +KIV+  L
Sbjct  243   KLRN-AGWDIKKVYATASFREAIRAAKEGEGVADMQRKIWNKEVLEPCVKIVKSHL  297



>ref|XP_006288171.1| hypothetical protein CARUB_v10001408mg [Capsella rubella]
 gb|EOA21069.1| hypothetical protein CARUB_v10001408mg [Capsella rubella]
Length=330

 Score =   237 bits (604),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 132/287 (46%), Positives = 176/287 (61%), Gaps = 31/287 (11%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR ++DLATR+   AE++NSDKIQVYKGLDI TNK+T  E  GV HHL+G  
Sbjct  39    MGATGTGKSRLAIDLATRF--PAEIVNSDKIQVYKGLDIVTNKVTPEESLGVPHHLLGT-  95

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
                ++  +F+A DF+      +  IV R +VP I GGSNSYI AL               
Sbjct  96    -VHDTYQDFTAEDFQREAIRAVESIVQRDRVPIIAGGSNSYIEAL---------------  139

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                V D     LRY CCFLWVDVS PVL+ ++ +RVD+M++ G+++E+ R + DPS+   
Sbjct  140   ---VNDCVDFRLRYNCCFLWVDVSKPVLHSFVSERVDKMVEMGLVDEVRRIF-DPSSSDY  195

Query  516   RTGLAKAIGVPEFAAYFRAPR---GGERRERLYAEAVREIKENTRLLAERQLRKIQRLRE  346
               G+ +AIGVPE   + R+       E  ERL   A+++IKEN  LLA RQL+KIQRL +
Sbjct  196   SAGIRRAIGVPELDEFLRSEMRNYPAETTERLLETAIKKIKENNCLLACRQLQKIQRLYK  255

Query  345   VGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFL  205
                W MHR++AT  F    G E++    E WEN V +P    V++FL
Sbjct  256   QWKWNMHRVDATEVFLRR-GEEAD----EAWENTVARPCAMAVDRFL  297



>ref|XP_010492943.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Camelina sativa]
 ref|XP_010492944.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Camelina sativa]
Length=330

 Score =   236 bits (603),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 133/287 (46%), Positives = 178/287 (62%), Gaps = 31/287 (11%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR ++DLATR+   AE++NSDKIQVYKGLDI TNK+T  E  GV HHL+G  
Sbjct  39    MGATGTGKSRLAIDLATRF--PAEIVNSDKIQVYKGLDIVTNKVTPEESLGVPHHLLG--  94

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
                ++  +F+A DF+      +  IV R +VP I GGSNSYI AL               
Sbjct  95    TVHDTYEDFTAEDFQREAIRAVESIVQRDRVPIIAGGSNSYIEAL---------------  139

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                V +     LRY CCFLWVDVS PVL+ ++ +RVD+M++ G+++E+ R + DPS+   
Sbjct  140   ---VNNCVDFRLRYNCCFLWVDVSRPVLHSFVSERVDKMVEMGLVDEVRRIF-DPSSSDY  195

Query  516   RTGLAKAIGVPEFAAYFRAPR---GGERRERLYAEAVREIKENTRLLAERQLRKIQRLRE  346
               G+ +AIGVPE   + R+       E  ERL   A+++IKENT LLA RQL+KIQRL +
Sbjct  196   SAGIRRAIGVPELDEFLRSEMRNYPAETTERLLETAIKKIKENTCLLACRQLQKIQRLYK  255

Query  345   VGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFL  205
                W MHR++AT  F    G E++    E WEN V +PS   V++FL
Sbjct  256   QWKWNMHRVDATEVFLRR-GEEAD----EAWENAVARPSALAVDRFL  297



>ref|XP_010420690.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Camelina sativa]
 ref|XP_010420691.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Camelina sativa]
Length=330

 Score =   236 bits (602),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 133/287 (46%), Positives = 177/287 (62%), Gaps = 31/287 (11%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR ++DLATR+   AE++NSDKIQVYKGLDI TNK+T  E  GV HHL+G  
Sbjct  39    MGATGTGKSRLAIDLATRF--PAEIVNSDKIQVYKGLDIVTNKVTPEESLGVPHHLLG--  94

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
                ++  +F+A DF+      +  IV R +VP I GGSNSYI AL               
Sbjct  95    TVHDTYEDFTAEDFQREAIRAVESIVQRDRVPIIAGGSNSYIEAL---------------  139

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                V +     LRY CCFLWVDVS PVL+ ++ +RVD+M++ G+++E+ R + DPS+   
Sbjct  140   ---VNNCVDFRLRYNCCFLWVDVSRPVLHSFVSERVDKMVEMGLVDEVRRIF-DPSSSDY  195

Query  516   RTGLAKAIGVPEFAAYFRAPR---GGERRERLYAEAVREIKENTRLLAERQLRKIQRLRE  346
               G+ +AIGVPE   + R+       E  ERL   A++ IKENT LLA RQL+KIQRL +
Sbjct  196   SAGIRRAIGVPELDEFLRSEMRNYPAETTERLLETAIKNIKENTCLLACRQLQKIQRLYK  255

Query  345   VGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFL  205
                W MHR++AT  F    G E++    E WEN V +PS   V++FL
Sbjct  256   QWKWNMHRVDATEVFLRR-GEEAD----EAWENAVARPSALAVDRFL  297



>ref|XP_010551259.1| PREDICTED: LOW QUALITY PROTEIN: adenylate isopentenyltransferase 
8, chloroplastic-like [Tarenaya hassleriana]
Length=352

 Score =   237 bits (604),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 155/304 (51%), Positives = 203/304 (67%), Gaps = 35/304 (12%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKS  SVDLAT +   AE+INSDK+ ++    +TTN+IT+P+RRGV HHL+GEF
Sbjct  66    MGATGAGKSSLSVDLATLF--PAEIINSDKMXLH----VTTNQITLPDRRGVPHHLLGEF  119

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             +  +   E +AADFR+A A  IS+I+ R KVP I GGSNS+I+ALL +RF+P +D F   
Sbjct  120   DPDDG--EVTAADFRSAAAATISEIISRAKVPIIAGGSNSFIHALLTQRFDPGIDPF---  174

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
               S   S   ELRY CCFLWVDVS PVL  YL KRV+EMM+ GM EEL+ +Y   S   +
Sbjct  175   --SGPGSICSELRYDCCFLWVDVSLPVLFEYLDKRVEEMMEMGMFEELAEFYDSGS---T  229

Query  516   RTGLAKAIGVPEFAAYFRAPRGGER----------RERLYAEAVREIKENTRLLAERQLR  367
             R G+ KAIGVPEF  YF     G+           R+  Y EAVREIKENT  LA++Q+ 
Sbjct  230   RKGIGKAIGVPEFDRYFGMHPPGKSNTNQQEWDPDRKAAYEEAVREIKENTCRLAKKQIG  289

Query  366   KIQRLREVGGWEMHRINATAAFAAAMGSESESETA--------EIWENQVVQPSMKIVEK  211
             KI +LR   GWEM R++ATA+F+AA+    E +          EIW+N++++ S+KIV++
Sbjct  290   KILKLRS-SGWEMTRLDATASFSAALSPAPEEKDGGGGGGRWREIWKNEILETSVKIVKQ  348

Query  210   FLLE  199
             FL E
Sbjct  349   FLEE  352



>ref|XP_008340912.1| PREDICTED: LOW QUALITY PROTEIN: adenylate isopentenyltransferase 
5, chloroplastic [Malus domestica]
Length=332

 Score =   236 bits (602),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 126/298 (42%), Positives = 177/298 (59%), Gaps = 32/298 (11%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR ++DLA  Y   AE+INSDK+QVYKGLDI TNK+T  E +G+ HHLIG+F
Sbjct  42    MGATGTGKSRLAIDLAMHY--PAEIINSDKMQVYKGLDIVTNKVTEEECKGIPHHLIGKF  99

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             + + +   F+A DF+   +  I  I+ R ++P I GGSNSYI AL               
Sbjct  100   DPNSN---FTANDFKNHASLAIESILERDRLPIIAGGSNSYIEAL---------------  141

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                V       ++Y CCFLWVDV+ PVL+ ++ KRVD M+  G+++E+ + +   +    
Sbjct  142   ---VDKHSEFRMKYECCFLWVDVAIPVLHSFVSKRVDRMVKVGLVDEVRKMFDSTTEAEY  198

Query  516   RTGLAKAIGVPEFAAYFRAPRGG----ERRERLYAEAVREIKENTRLLAERQLRKIQRLR  349
               G+ +AIGVPE   Y      G    E +ERL   A+ +IKENT +LA RQL+KI+RL+
Sbjct  199   TNGIRQAIGVPEMHEYLHCEASGSNDDETQERLLQAAISKIKENTCILAYRQLQKIRRLQ  258

Query  348   EVGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE*VFQLFPA  175
                GW MHR++AT  F    G     E  + WE  V  P+ ++V+KFLL+ +  + P 
Sbjct  259   ARRGWNMHRLDATEVFLKHQG-----EADQAWEKFVATPATRMVDKFLLBPIPSILPT  311



>ref|NP_194196.1| adenylate isopentenyltransferase 4 [Arabidopsis thaliana]
 sp|Q9SB60.1|IPT4_ARATH RecName: Full=Adenylate isopentenyltransferase 4; Short=AtIPT4; 
AltName: Full=Adenylate dimethylallyltransferase 4; AltName: 
Full=Cytokinin synthase 4 [Arabidopsis thaliana]
 emb|CAA22998.1| putative tRNA isopentenyltransferase [Arabidopsis thaliana]
 emb|CAB79375.1| putative tRNA isopentenyltransferase [Arabidopsis thaliana]
 dbj|BAB59031.1| cytokinin synthase [Arabidopsis thaliana]
 dbj|BAB59044.1| adenylate isopentenyltransferase [Arabidopsis thaliana]
 gb|ABB83385.1| AtIPT4 [Quorum Sensing Vector p413-SSRE-AtIPT4]
 gb|ABB83388.1| AtIPT4 [Quorum Sensing Vector p413-TR-SSRE-AtIPT4]
 gb|ABB83391.1| AtIPT4 [Quorum Sensing Vector p413-PGAL1-AtIPT4]
 gb|ABB83407.1| AtIPT4 [Sender Vector p416-GAL1-AtIPT4]
 gb|AEE84938.1| adenylate isopentenyltransferase 4 [Arabidopsis thaliana]
Length=318

 Score =   235 bits (600),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 132/296 (45%), Positives = 178/296 (60%), Gaps = 21/296 (7%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATGSGKS  SVDLA  +   AE+INSDK+Q Y GL ITTN+ T+ +RRGV HHL+GE 
Sbjct  11    MGATGSGKSSLSVDLALHF--KAEIINSDKMQFYDGLKITTNQSTIEDRRGVPHHLLGEL  68

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
                    E +AA+FR   AE IS+I  R K+P + GGSNSYI+ALL + ++PE   F D 
Sbjct  69    NPEAG--EVTAAEFRVMAAEAISEITQRKKLPILAGGSNSYIHALLAKSYDPENYPFSDH  126

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
               S+      EL+Y CCF+W+DV   VL  YL  R+D MM SGM EE++ ++     P  
Sbjct  127   KGSICS----ELKYDCCFIWIDVDQSVLFEYLSLRLDLMMKSGMFEEIAEFHRSKKAPKE  182

Query  516   RTGLAKAIGVPEFAAYFR-------APRGGERRERLYAEAVREIKENTRLLAERQLRKIQ  358
               G+ KAIGV EF  Y +         +    R+  Y +AVR IKENT  L + Q+ KI 
Sbjct  183   PLGIWKAIGVQEFDDYLKMYKWDNDMDKWDPMRKEAYEKAVRAIKENTFQLTKDQITKIN  242

Query  357   RLREVGGWEMHRINATAAFAAAMGSESESETA-----EIWENQVVQPSMKIVEKFL  205
             +LR   GW++ +++ATA+F  A+ +  E E       +IW  +V++P +KIV   L
Sbjct  243   KLRN-AGWDIKKVDATASFREAIRAAKEGEGVAEMQRKIWNKEVLEPCVKIVRSHL  297



>ref|XP_009406689.1| PREDICTED: adenylate isopentenyltransferase-like [Musa acuminata 
subsp. malaccensis]
Length=398

 Score =   237 bits (604),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 140/286 (49%), Positives = 174/286 (61%), Gaps = 9/286 (3%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKS+ SVDL+  +  + EV+NSDKIQVY+GLDITTNKI + ERRGV HHL+GE 
Sbjct  89    MGATGTGKSKLSVDLSVMF--SGEVVNSDKIQVYRGLDITTNKIPVVERRGVPHHLLGEL  146

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             + +    E     FRA     I DI  RG+VP + GGSNS+I+ALL +R++P  D F   
Sbjct  147   DPAAG--ELPPVGFRALAERAIGDISARGRVPVLAGGSNSFIHALLSDRYDPRRDPFGPA  204

Query  696   CNSVGDSFGLE-LRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPL  520
                      +E LRYRCC LWV V   VL  +L +RVDEM+  GM+EEL R+++      
Sbjct  205   GARWRRVTEVEGLRYRCCLLWVHVEAAVLAEHLDRRVDEMVGEGMVEELKRYFAAEGKAE  264

Query  519   SRTGLAKAIGVPEFAAYFRAPRGGERRERLYAEAVREIKENTRLLAERQLRKIQRLREVG  340
                GL KAIGVPEF  YF   RGG R    Y  AV  IK NTR LAE Q+RKI+RL  + 
Sbjct  265   RHPGLGKAIGVPEFRGYFTG-RGG-RTAAAYEAAVAAIKSNTRRLAEEQVRKIERLAAL-  321

Query  339   GWEMHRINATAAFAAAMGSESE-SETAEIWENQVVQPSMKIVEKFL  205
             GW +  +NAT   AA +  E   + T   W   V  PS   VE+FL
Sbjct  322   GWPLRLVNATNTVAARLAGEGPAAATTAPWRRDVAGPSAAAVERFL  367



>ref|XP_010454167.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic 
[Camelina sativa]
 ref|XP_010454169.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic 
[Camelina sativa]
Length=330

 Score =   234 bits (598),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 133/287 (46%), Positives = 177/287 (62%), Gaps = 31/287 (11%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR ++DLATR+   AE++NSDKIQVYKGLDI TNK+T  E  GV HHL+G  
Sbjct  39    MGATGTGKSRLAIDLATRF--PAEIVNSDKIQVYKGLDIVTNKVTPEESLGVPHHLLG--  94

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
                ++  +F+A DF+      +  IV R +VP I GGSNSYI AL               
Sbjct  95    TVHDTYEDFTAEDFQREAIRAVESIVQRDRVPIIAGGSNSYIEAL---------------  139

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                V +     LRY CCFLWVDVS PVL+ ++ +RVD+M++ G+++E+ R + DPS+   
Sbjct  140   ---VNNCVDFRLRYNCCFLWVDVSRPVLHSFVSERVDKMVEMGLVDEVRRIF-DPSSSDY  195

Query  516   RTGLAKAIGVPEFAAYFRAPR---GGERRERLYAEAVREIKENTRLLAERQLRKIQRLRE  346
               G+ +AIGVPE   + R+       E  ERL   A+ +IKENT LLA RQL+KIQRL +
Sbjct  196   SAGIRRAIGVPELDEFLRSEMRNYPAETTERLLETAIEKIKENTCLLACRQLQKIQRLYK  255

Query  345   VGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFL  205
                W MHR++AT  F    G E++    E WEN V +PS   V++FL
Sbjct  256   QWKWNMHRVDATEVFLRR-GIEAD----EAWENAVARPSALAVDRFL  297



>ref|NP_001281297.1| adenylate isopentenyltransferase 5, chloroplastic-like [Malus 
domestica]
 ref|XP_008390821.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Malus domestica]
 gb|ADN26573.1| isopentenyltransferase [Malus domestica]
 gb|ADY80559.1| adenylate isopentenyltransferase [Malus domestica]
Length=336

 Score =   234 bits (598),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 126/302 (42%), Positives = 182/302 (60%), Gaps = 31/302 (10%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR ++DLA R+   AE+INSDK+QVYKGLDI TNK+T  E +G+ HHLIG+ 
Sbjct  42    MGATGTGKSRLAIDLA-RHNPPAEIINSDKMQVYKGLDIVTNKVTEDECKGIPHHLIGKV  100

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             +      +F+A DF+   +  I  I+ R ++P I GGSNSYI AL               
Sbjct  101   DPDS---DFTANDFKHHASLAIESILERDRLPIIAGGSNSYIEAL---------------  142

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                V +     ++Y CCFLWVDV+ PVL+ ++ +RVD M+  G++EE+ R +   +    
Sbjct  143   ---VDEHSEFRMKYECCFLWVDVAIPVLHSFVSERVDRMVKMGLVEEVRRMFDSTTEKEY  199

Query  516   RTGLAKAIGVPEFAAYFRAP----RGGERRERLYAEAVREIKENTRLLAERQLRKIQRLR  349
               G+ +AIGVPE   Y +         E +ERL   A+ +IKENT +LA RQL+KI+RL+
Sbjct  200   TRGVRRAIGVPEMDEYLQGEASDNNDDETQERLLQAAISKIKENTCILAYRQLQKIRRLQ  259

Query  348   EVGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE*VFQLFPALT  169
                GW MHR++AT AF      +  +ET + WE  V +P+ +IV +FLL+ +  + P   
Sbjct  260   ARRGWNMHRLDATEAFL-----KHHAETNQAWEKLVARPATRIVRQFLLDPIPSILPTEN  314

Query  168   LS  163
             ++
Sbjct  315   IT  316



>gb|KCW81302.1| hypothetical protein EUGRSUZ_C02668 [Eucalyptus grandis]
Length=304

 Score =   233 bits (595),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 135/265 (51%), Positives = 172/265 (65%), Gaps = 30/265 (11%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG GKS  S+ LA+R+    EVINSDK+Q+Y+GLDITTNKI + ER GV HHL+  F
Sbjct  22    MGATGCGKSSLSMYLASRF--PCEVINSDKMQLYRGLDITTNKIPLAERHGVPHHLLSSF  79

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             + + +  E + ++FR+ G   IS +V  GK+P +VGGSNS+I+ALLVERF+PE +VF   
Sbjct  80    DPNGA--EMTPSEFRSRGHAAISGVVSGGKLPLVVGGSNSFIHALLVERFDPEAEVF---  134

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYS-DPSNPL  520
              + +G +   ELRY CCFLWVDVSPPVL  Y  KRVD+M+D G  +EL+ +Y    +NP 
Sbjct  135   -SGLGSAASPELRYDCCFLWVDVSPPVLEEYQSKRVDKMLDMGAFDELAGYYDLRRTNPG  193

Query  519   SRTGLAKAIGVPEFAAYFRA---PRG-----GERRER------------LYAEAVREIKE  400
               T L KAIGVPEF  YF     PRG     G RRE              Y E VR+IK+
Sbjct  194   GWTCLRKAIGVPEFDRYFMTYPPPRGVGPGDGWRREDAGMREDDPGREGAYKEVVRKIKK  253

Query  399   NTRLLAERQLRKIQRLREVGGWEMH  325
             N   LA+ Q+ KI+RLR   GWE+H
Sbjct  254   NAVELAKWQIMKIERLRGC-GWELH  277



>gb|ADY80560.1| adenylate isopentenyltransferase [Malus domestica]
Length=334

 Score =   234 bits (598),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 126/298 (42%), Positives = 176/298 (59%), Gaps = 32/298 (11%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR ++DLA  Y   AE+INSDK+QVYKGLDI TNK+T  E +G+ HHLIG+F
Sbjct  42    MGATGTGKSRLAIDLAMHY--PAEIINSDKMQVYKGLDIVTNKVTEEECKGIPHHLIGKF  99

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             + + +   F+A DF+   +  I  I+ R ++P I GGSNSYI AL               
Sbjct  100   DPNSN---FTANDFKNHASLAIESILERDRLPIIAGGSNSYIEAL---------------  141

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                V       ++Y CCFLWVDV+ PVL+ ++ KRVD M+  G+++E+ + +   +    
Sbjct  142   ---VDKHSEFRMKYECCFLWVDVAIPVLHSFVSKRVDRMVKVGLVDEVRKMFDSTTEAEY  198

Query  516   RTGLAKAIGVPEFAAYFRAPRGG----ERRERLYAEAVREIKENTRLLAERQLRKIQRLR  349
               G+ +AIGVPE   Y      G    E +ERL   A+ +IKENT +LA RQL+KI+RL+
Sbjct  199   TNGIRQAIGVPEMHEYLHCEASGSNDDETQERLLQAAISKIKENTCILAYRQLQKIRRLQ  258

Query  348   EVGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE*VFQLFPA  175
                GW MHR++AT  F    G     E  + WE  V  P+ ++V+KFLL  +  + P 
Sbjct  259   ARRGWNMHRLDATEVFLKHQG-----EADQAWEKFVATPATRMVDKFLLNPIPSILPT  311



>ref|XP_002271962.1| PREDICTED: adenylate isopentenyltransferase 3, chloroplastic 
[Vitis vinifera]
Length=327

 Score =   234 bits (596),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 134/287 (47%), Positives = 177/287 (62%), Gaps = 33/287 (11%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR S+DLATR+   AE++NSDK+QVY+GLDI TNKIT  E+RGV HHL+   
Sbjct  40    MGATGTGKSRLSIDLATRF--PAEIVNSDKMQVYEGLDIVTNKITEEEQRGVPHHLL---  94

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
               +    +F+A+DFR   +  I  I+GRG++P +VGGSNSYI AL               
Sbjct  95    RIAHPNVDFTASDFRDMASLSIESILGRGRLPIVVGGSNSYIEAL---------------  139

Query  696   CNSVGDSFG-LELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPL  520
                VGD +     RY CCFLWVDVS  VL+ ++ KRVD+M++ GM+EE+ + +  P+   
Sbjct  140   ---VGDEYSKFRSRYECCFLWVDVSRSVLHSFVSKRVDKMVEKGMVEEVQQLFH-PNADY  195

Query  519   SRTGLAKAIGVPEFAAYFRAP--RGGERRERLYAEAVREIKENTRLLAERQLRKIQRLRE  346
             +R G+ +AIGVPE   YFR       E R R+  EAV EIK NT  LA RQL KI RL+ 
Sbjct  196   TR-GIRRAIGVPELDLYFRTEGFLDEEARARVLQEAVHEIKANTCKLACRQLEKIHRLKN  254

Query  345   VGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFL  205
             V  W++HR+ AT         + + E  E WE  V +PS  +V +FL
Sbjct  255   VRKWKIHRLGATEVL-----RKCDREADEAWEKLVARPSTMMVAQFL  296



>gb|ADT82707.1| adenylate isopentenyltransferase [Malus domestica]
Length=320

 Score =   233 bits (595),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 139/297 (47%), Positives = 182/297 (61%), Gaps = 31/297 (10%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR S+DLAT +   AE+INSDK+QVY+GLDI TNKIT  E+RGV HHL+G  
Sbjct  39    MGATGTGKSRLSIDLATCF--PAEIINSDKMQVYEGLDIVTNKITKEEQRGVPHHLLGML  96

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             +  E   +F+A DF    +  I  I+GR ++P IVGGSNSYI AL        +D +D  
Sbjct  97    DPHE---DFTARDFCDLTSIAIESILGRDRLPIIVGGSNSYIEAL--------IDDYD--  143

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                    +    +Y CCFLWVDVS PVL+ ++ KRVD M+ +GM++E +R Y DP+   +
Sbjct  144   -------YKFRSKYDCCFLWVDVSTPVLHSFVSKRVDHMVHNGMVDE-AREYFDPNADYT  195

Query  516   RTGLAKAIGVPEFAAYFR-AP-RGGERRERLYAEAVREIKENTRLLAERQLRKIQRLREV  343
             + G+ +AIGVPEF  YFR  P    E R RL  +AV EIK+NT  LA RQL KI RLR +
Sbjct  196   K-GIRRAIGVPEFDKYFRYGPFLDEETRTRLLRQAVDEIKDNTCKLACRQLEKIHRLRNI  254

Query  342   GGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE*VFQLFPAL  172
              GW +H ++AT  F      +   E  E W+  V   S  IV +FL     ++ P L
Sbjct  255   KGWNLHPLDATEVF-----RKRGEEADEAWKKLVSGTSAMIVGQFLYNMTAEVPPHL  306



>ref|XP_010927008.1| PREDICTED: adenylate isopentenyltransferase-like [Elaeis guineensis]
Length=357

 Score =   234 bits (598),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 147/290 (51%), Positives = 185/290 (64%), Gaps = 23/290 (8%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKS+ S+DLATR+   +EV+NSDKIQVY+GLDITTNKI + +R GV HHL+GE 
Sbjct  75    MGATGTGKSKLSIDLATRF--PSEVVNSDKIQVYRGLDITTNKIPLADRCGVPHHLLGEL  132

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             + +    E  A  FR+  A  I  I  R ++P + GGSNS+I+ALL  R +P +D F   
Sbjct  133   DPAVG--ELPALKFRSLAASAIERIAARRRLPVVAGGSNSFIHALLAARHDPLVDPF---  187

Query  696   CNSVGDS---FGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYS-DPS  529
               + GDS       LRYRCCFLWVDV P VL  YL  RV+EM+ +GM+EEL  +++ + +
Sbjct  188   --AAGDSRRGRRERLRYRCCFLWVDVEPKVLAEYLDLRVEEMVAAGMVEELEAYFAGEGA  245

Query  528   NPLSRTGLAKAIGVPEFAAYFRAPRG-GERRERLYAEAVREIKENTRLLAERQLRKIQRL  352
              P    GL KAIGVPEF  YF+  +G GE     YA AV  IK N R LAE Q+RKI RL
Sbjct  246   EPGRHPGLEKAIGVPEFREYFKKGKGAGE-----YAAAVAAIKVNGRRLAEEQVRKIGRL  300

Query  351   REVG-GWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFL  205
              E G GW + R++ATAA  A +G    S     WE  VV PS+  VE FL
Sbjct  301   GEGGCGWALQRVDATAAVRARLGG---SAWVAAWERDVVGPSVAAVEGFL  347



>ref|XP_008368862.1| PREDICTED: adenylate isopentenyltransferase 3, chloroplastic 
[Malus domestica]
Length=320

 Score =   233 bits (595),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 139/297 (47%), Positives = 182/297 (61%), Gaps = 31/297 (10%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR S+DLAT +   AE+INSDK+QVY+GLDI TNKIT  E+RGV HHL+G  
Sbjct  39    MGATGTGKSRLSIDLATCF--PAEIINSDKMQVYEGLDIVTNKITKEEQRGVPHHLLGML  96

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             +  E   +F+A DF    +  I  I+GR ++P IVGGSNSYI AL        +D +D  
Sbjct  97    DPHE---DFTARDFCDLTSIAIESILGRDRLPIIVGGSNSYIEAL--------IDDYD--  143

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                    +    +Y CCFLWVDVS PVL+ ++ KRVD M+ +GM++E +R Y DP+   +
Sbjct  144   -------YKFRSKYDCCFLWVDVSTPVLHSFVSKRVDHMVQNGMVDE-AREYFDPNADYT  195

Query  516   RTGLAKAIGVPEFAAYFR-AP-RGGERRERLYAEAVREIKENTRLLAERQLRKIQRLREV  343
             + G+ +AIGVPEF  YFR  P    E R RL  +AV EIK+NT  LA RQL KI RLR +
Sbjct  196   K-GIRRAIGVPEFDKYFRYGPFLXEETRXRLLRQAVDEIKDNTCKLACRQLEKIHRLRNI  254

Query  342   GGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE*VFQLFPAL  172
              GW +H ++AT  F      +   E  E W+  V   S  IV +FL     ++ P L
Sbjct  255   KGWNLHPLDATEVF-----RKRGEEADEAWKKLVSGTSAMIVGQFLYNMTAEVPPHL  306



>ref|XP_010477931.1| PREDICTED: adenylate isopentenyltransferase 6, chloroplastic-like 
[Camelina sativa]
Length=390

 Score =   235 bits (600),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 135/300 (45%), Positives = 191/300 (64%), Gaps = 25/300 (8%)
 Frame = -1

Query  1053  GATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEFE  874
             G TG+GKSR SVDLA  +  + E+INSDK+QVY G++I TN I + E+ GV HHL+G+F 
Sbjct  100   GTTGTGKSRLSVDLAKHF--SGEIINSDKMQVYSGIEIATNLIPLHEQGGVPHHLLGDFR  157

Query  873   ASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDEC  694
               +   E S  +FR+  +  I+++V RGK+P IVGGSNS+ +ALL ERF+P +D F    
Sbjct  158   PEDG--ELSPGEFRSFASLSIAEVVSRGKLPIIVGGSNSFNHALLAERFDPTIDPFAP--  213

Query  693   NSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS-  517
             +S   +   +LRY CC  WVDVS P+L ++L  RVD+M++SG+ E+L+ +Y DP   L  
Sbjct  214   SSSLSTICPDLRYNCCIFWVDVSEPILFQHLRNRVDKMIESGLFEQLAAFY-DPIVDLGP  272

Query  516   RTGLAKAIGVPEFAAYFRA-PRGGER--------RERLYAEAVREIKENTRLLAERQLRK  364
             R G+ K IGV EF  YFR  PR  ER        R+  Y EAV+ +KE T LL ++Q  K
Sbjct  273   RLGVRKTIGVEEFDRYFRVYPR--ERNTGVWDLGRKAAYEEAVKGMKERTCLLVKKQKEK  330

Query  363   IQRLREVGGWEMHRINATAAFAAAMGSESES-----ETAEIWENQVVQPSMKIVEKFLLE  199
             I +L   GGWE+ R++ATAA  A +   S +      ++EIW+  +V+ S++ V  FLL+
Sbjct  331   IIKLIR-GGWEIQRLDATAAIMAELNKSSAALGEGKSSSEIWQKDIVEESVETVNSFLLQ  389



>gb|ADY80558.1| adenylate isopentenyltransferase [Malus domestica]
Length=320

 Score =   233 bits (593),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 139/297 (47%), Positives = 182/297 (61%), Gaps = 31/297 (10%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR S+DLAT +   AE+INSDK+QVY+GLDI TNKIT  E+RGV HHL+G  
Sbjct  39    MGATGTGKSRLSIDLATCF--PAEIINSDKMQVYEGLDIVTNKITKEEQRGVPHHLLGML  96

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             +  E   +F+A DF    +  I  I+GR ++P IVGGSNSYI AL        +D +D  
Sbjct  97    DPHE---DFTARDFCDLTSIAIESILGRDRLPIIVGGSNSYIEAL--------IDDYD--  143

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                    +    +Y CCFLWVDVS PVL+ ++ KRVD M+ +GM++E +R Y DP+   +
Sbjct  144   -------YKFRSKYDCCFLWVDVSTPVLHSFVSKRVDHMVQNGMVDE-AREYFDPNADYT  195

Query  516   RTGLAKAIGVPEFAAYFR-AP-RGGERRERLYAEAVREIKENTRLLAERQLRKIQRLREV  343
             + G+ +AIGVPEF  YFR  P    E R RL  +AV EIK+NT  LA RQL KI RLR +
Sbjct  196   K-GIRRAIGVPEFDKYFRYGPFLEEETRARLLRQAVDEIKDNTCKLACRQLEKIHRLRNI  254

Query  342   GGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE*VFQLFPAL  172
              GW +H ++AT  F      +   E  E W+  V   S  IV +FL     ++ P L
Sbjct  255   KGWNLHPLDATEVF-----RKRGEEADEAWKKLVSGTSAMIVGQFLYNMTAEVPPHL  306



>gb|KCW81314.1| hypothetical protein EUGRSUZ_C02690 [Eucalyptus grandis]
Length=290

 Score =   232 bits (591),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 136/294 (46%), Positives = 182/294 (62%), Gaps = 31/294 (11%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             +GATG GKSR S+DLA+ +   +EVINSDK+QVY+GLDITTNKI + +RRGV HHL+G  
Sbjct  19    IGATGCGKSRLSIDLASHF--PSEVINSDKMQVYRGLDITTNKIPLADRRGVPHHLLGSL  76

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             +      E + + F + G   ISD+  RG  P +VGGS S I ALL ERF+P+       
Sbjct  77    DPDHG--EMTPSQFCSLGDNAISDVASRGNFPILVGGSTSSILALLAERFDPQATP----  130

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYS-DPSNPL  520
                       +LRY CCFL VDV  PVL + L KRVD M+  G  +EL+ +Y    ++P 
Sbjct  131   ----------DLRYDCCFLCVDVLLPVLKKDLPKRVDRMLRMGAFDELAGYYDLRRTDPG  180

Query  519   SRTGLAKAIGVPEFAAYFR--APRGGER-----RERLYAEAVREIKENTRLLAERQLRKI  361
             +   L +AIGV EF  YF    P  GER     RE  Y EA+REIK+N   L  RQ++KI
Sbjct  181   AWAVLRRAIGVLEFDRYFEKYPPPRGERQNDPVREGAYQEALREIKKNAGQLMIRQVKKI  240

Query  360   QRLREVGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
             ++L E  GWE+HR++AT A   A   E E    ++W++QV++PS++IV +FL E
Sbjct  241   RQLSE-SGWELHRLDATEAVRLATAPEEE----DVWKSQVLEPSVEIVNQFLQE  289



>ref|XP_007034593.1| Isopentenyltransferase 5, putative [Theobroma cacao]
 gb|EOY05519.1| Isopentenyltransferase 5, putative [Theobroma cacao]
Length=326

 Score =   233 bits (594),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 134/288 (47%), Positives = 177/288 (61%), Gaps = 31/288 (11%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR ++DLAT  F  AE++NSDK+QVYKGLDI TNK+T  E RGV HHL+G  
Sbjct  38    MGATGTGKSRLAIDLAT-CFDPAEIVNSDKMQVYKGLDIVTNKVTEEECRGVPHHLLGIV  96

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             + + +   F++ DFR   +  +  IV +G +P I GGSNSYI AL+    +PE       
Sbjct  97    DPNSN---FTSMDFRHHASVAVKSIVSKGSLPIIAGGSNSYIEALV--NHDPE-------  144

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                       +LRY CCFLWVDVS PVL+ ++ +RVD M+ +GM++E+ + + DP    S
Sbjct  145   ---------FQLRYECCFLWVDVSLPVLHSFVAERVDRMVQAGMVDEVKQMF-DPKADYS  194

Query  516   RTGLAKAIGVPEFAAYFRAPR--GGERRERLYAEAVREIKENTRLLAERQLRKIQRLREV  343
             R G+ +AIGVPE   YFRA      + R RL   A+ +IKENT +LA RQL KI RL   
Sbjct  195   R-GIRRAIGVPEMDQYFRAESILDAKIRARLLETAISKIKENTCMLACRQLEKIDRLYNQ  253

Query  342   GGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
               W MHRI+AT  F    G E++    E W   V  PS  IV++FL +
Sbjct  254   WKWRMHRIDATEVFLKR-GEEAD----EAWHRLVAGPSTMIVDQFLYD  296



>ref|XP_003553453.2| PREDICTED: adenylate isopentenyltransferase 3, chloroplastic-like 
[Glycine max]
Length=312

 Score =   232 bits (592),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 135/286 (47%), Positives = 174/286 (61%), Gaps = 35/286 (12%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATGSGK+R S+DLAT +   +E+INSDK+QVY GLD+ TNK T  E+RG+ HHL+G  
Sbjct  41    MGATGSGKTRLSIDLATCF--PSEIINSDKMQVYSGLDVVTNKATKEEQRGIPHHLLGTQ  98

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
               ++   EF+A+DF    +  I  I  R KVP IVGGSNSY+ AL+              
Sbjct  99    NPNK---EFTASDFCDMASHAIESITNREKVPIIVGGSNSYMEALV--------------  141

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                  D FG   RY  C LWVDVS PVL+ Y+ +RVD+M+  GM+ EL  ++S P+   S
Sbjct  142   -----DKFG--TRYEWCCLWVDVSTPVLHSYVAQRVDQMIGGGMVNELRPFFS-PNGDYS  193

Query  516   RTGLAKAIGVPEFAAYFR--APRGGERRERLYAEAVREIKENTRLLAERQLRKIQRLREV  343
             + G+ KAIGVPEF  YFR  A    E R RL  +AVRE+K NT  LA +QL +IQ LR V
Sbjct  194   K-GIRKAIGVPEFHEYFRREAFSSTEMRMRLLQDAVREVKRNTCHLACKQLGRIQWLRSV  252

Query  342   GGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFL  205
              GW++HR+ AT  F      +   E  + W+N V QP   IV +FL
Sbjct  253   KGWKIHRVCATPVF-----QKRGQEANDAWKNVVAQPCASIVSQFL  293



>gb|KHN45368.1| Adenylate isopentenyltransferase 3, chloroplastic [Glycine soja]
Length=308

 Score =   232 bits (592),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 135/286 (47%), Positives = 174/286 (61%), Gaps = 35/286 (12%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATGSGK+R S+DLAT +   +E+INSDK+QVY GLD+ TNK T  E+RG+ HHL+G  
Sbjct  37    MGATGSGKTRLSIDLATCF--PSEIINSDKMQVYSGLDVVTNKATKEEQRGIPHHLLGTQ  94

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
               ++   EF+A+DF    +  I  I  R KVP IVGGSNSY+ AL+              
Sbjct  95    NPNK---EFTASDFCDMASHAIESITNREKVPIIVGGSNSYMEALV--------------  137

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                  D FG   RY  C LWVDVS PVL+ Y+ +RVD+M+  GM+ EL  ++S P+   S
Sbjct  138   -----DKFG--TRYEWCCLWVDVSTPVLHSYVAQRVDQMIGGGMVNELRPFFS-PNGDYS  189

Query  516   RTGLAKAIGVPEFAAYFR--APRGGERRERLYAEAVREIKENTRLLAERQLRKIQRLREV  343
             + G+ KAIGVPEF  YFR  A    E R RL  +AVRE+K NT  LA +QL +IQ LR V
Sbjct  190   K-GIRKAIGVPEFHEYFRREAFSSTEMRMRLLQDAVREVKRNTCHLACKQLGRIQWLRSV  248

Query  342   GGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFL  205
              GW++HR+ AT  F      +   E  + W+N V QP   IV +FL
Sbjct  249   KGWKIHRVCATPVF-----QKRGQEANDAWKNVVAQPCASIVSQFL  289



>gb|KDP40100.1| hypothetical protein JCGZ_02098 [Jatropha curcas]
Length=334

 Score =   233 bits (594),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 130/288 (45%), Positives = 174/288 (60%), Gaps = 31/288 (11%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             +G TG+GKSR ++DLATR    AEVIN DK+QVYKGLDI TNK+T  E RGV HHLIG  
Sbjct  39    VGPTGTGKSRLAIDLATR--IPAEVINCDKMQVYKGLDIVTNKVTEEECRGVPHHLIGIV  96

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             + + +   F++ DFR   ++ +  IV R ++P I GGSNS+I AL               
Sbjct  97    DPNSN---FTSDDFRHQASDSVKSIVARDRLPIIAGGSNSFIEAL---------------  138

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                V D     LRY CCFLWVDVS PVL+ ++ +RVD M+ +G++ E+ + + DP+N   
Sbjct  139   ---VNDDHEFRLRYECCFLWVDVSLPVLHSFVSERVDRMVKAGLVNEVKKVF-DPNNTNY  194

Query  516   RTGLAKAIGVPEFAAYFRAP--RGGERRERLYAEAVREIKENTRLLAERQLRKIQRLREV  343
               G+ +AIGVPE   YFR       + R +L   A+ +IKEN  +L+ RQL+KI RL   
Sbjct  195   SQGIRRAIGVPELDQYFRKEGIVDTKTRAKLLDLAIEKIKENNCILSCRQLQKIHRLYNR  254

Query  342   GGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
               W MHRI+AT  F    G E+E    E+WE QV  PS  I+E+FL +
Sbjct  255   WSWNMHRIDATEVFLKN-GKEAE----EVWEKQVAGPSTMILEQFLYD  297



>gb|EPS59563.1| hypothetical protein M569_15242, partial [Genlisea aurea]
Length=263

 Score =   230 bits (587),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 133/286 (47%), Positives = 179/286 (63%), Gaps = 32/286 (11%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             +GATG+GKSR S+DLA+ YF AAEVINSDK+Q+Y+GLDITTNKIT  E RGV HHL+G  
Sbjct  8     VGATGTGKSRLSIDLAS-YFGAAEVINSDKVQIYRGLDITTNKITEGESRGVPHHLLG--  64

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
               ++   EF+A +FRA     +  ++ RG +P I GGSNSYI AL+    +P        
Sbjct  65    -VADPFSEFTAGNFRAVAEASVKSVLTRGNLPLIAGGSNSYIEALI----DP--------  111

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                     G   RY CCFLWVDV+ P L+  L +RVD M+ +GM+EE+ ++Y   +   S
Sbjct  112   --------GFRSRYECCFLWVDVAMPELHTSLSERVDRMIGNGMIEEVQKFYQ-KNGDYS  162

Query  516   RTGLAKAIGVPEFAAYFRAPR--GGERRERLYAEAVREIKENTRLLAERQLRKIQRLREV  343
             R G+ K+IGVPE   +FR+    G E R +L +E +  +K NT  LA RQLRKI R R  
Sbjct  163   R-GILKSIGVPELHGFFRSDDDAGEEARMKLLSEGIDAVKLNTSRLACRQLRKILRFRTA  221

Query  342   GGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFL  205
             GGW +HR++AT AF A   +E+E+         VV P++ +V +FL
Sbjct  222   GGWRLHRLDATDAFKARAAAEAEAAWER----NVVAPAVSVVTRFL  263



>ref|XP_011079824.1| PREDICTED: adenylate isopentenyltransferase 3, chloroplastic 
[Sesamum indicum]
Length=317

 Score =   232 bits (592),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 130/288 (45%), Positives = 177/288 (61%), Gaps = 34/288 (12%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR SVDLATR+  +AE+INSDK+QVY GLDI TNKIT  ER GV HHL+G  
Sbjct  36    MGATGTGKSRLSVDLATRF--SAEIINSDKMQVYHGLDIVTNKITDEERSGVPHHLLG--  91

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
                +   +FSAA+FR   +  +  I+ RG++P IVGGSNS+I AL+   F          
Sbjct  92    -VVDPESDFSAANFRTMASITMKSILSRGQLPMIVGGSNSFIEALVDMNFRS--------  142

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                         +Y CCFLWVDV+ PVL+ ++  RVD+M++ GM++E+  +Y  P+   S
Sbjct  143   ------------KYECCFLWVDVAMPVLDSFVSDRVDKMVERGMVDEVREFYK-PNADYS  189

Query  516   RTGLAKAIGVPEFAAYFRAPR--GGERRERLYAEAVREIKENTRLLAERQLRKIQRLREV  343
             R G+ +AIGVPEF  +FR       E R R+  +A+  +K NT +LA  QL KI RLR++
Sbjct  190   R-GIRRAIGVPEFDNFFRVESFCDEETRARILTDAIESVKMNTSMLARIQLEKIHRLRKI  248

Query  342   GGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
              GW +HR++AT  F   M    ++E A  WE  V  P   +V +FL +
Sbjct  249   KGWRVHRLDATDVF---MKRGGKAEAA--WEKLVSGPGAAVVSRFLYD  291



>ref|XP_006300023.1| hypothetical protein CARUB_v10016248mg [Capsella rubella]
 gb|EOA32921.1| hypothetical protein CARUB_v10016248mg [Capsella rubella]
Length=377

 Score =   234 bits (596),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 135/324 (42%), Positives = 194/324 (60%), Gaps = 52/324 (16%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATGSGKSR S+DLATR+  + E+INSDKIQ Y GL+ITTN++++ ER GV HHL+G  
Sbjct  48    MGATGSGKSRLSIDLATRF--SGEIINSDKIQFYNGLEITTNQMSIHERCGVPHHLLGVL  105

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
                +   E +A+++R+  +  I+DI  RGK+P I GGSNS I+ALLV  F+P    F   
Sbjct  106   PPDDG--ELTASEYRSLASRSITDITARGKLPIIAGGSNSIIHALLVNSFDPLTYPFSPN  163

Query  696   CNSVGD---------------------------SFGLELRYRCCFLWVDVSPPVLNRYLY  598
              +   D                            F L  RY CCFLWVDVS  VL   L 
Sbjct  164   ASISSDLSAYFHVVNVKLKRKWKENLLFTLTIYVFALIKRYECCFLWVDVSVSVLFESLS  223

Query  597   KRVDEMMDSGMLEELSRWYSDP--SNPLSRTGLAKAIGVPEFAAYF---------RAPRG  451
             KRVD+MM+SGM EEL+ +Y +P  S   ++TG+ K+IG+PEF  YF         +    
Sbjct  224   KRVDQMMESGMFEELADFY-NPRYSGSKNQTGIYKSIGIPEFDRYFSLYPPERNHKVSEW  282

Query  450   GERRERLYAEAVREIKENTRLLAERQLRKIQRLREVGGWEMHRINATAAFAAAMGSESES  271
              + R+  Y EAV+ IKE+T LLA++Q+ +I++L+   GW++ R++AT +F          
Sbjct  283   DKARKAAYEEAVQAIKESTWLLAKKQIERIKQLKS-NGWDIQRLDATPSFGRP-------  334

Query  270   ETAEIWENQVVQPSMKIVEKFLLE  199
              + EIW+  V++ S+KI+++FL++
Sbjct  335   -SREIWDKTVMEESIKIMKRFLVK  357



>ref|XP_006400459.1| hypothetical protein EUTSA_v10015859mg [Eutrema salsugineum]
 gb|ESQ41912.1| hypothetical protein EUTSA_v10015859mg [Eutrema salsugineum]
Length=336

 Score =   233 bits (593),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 134/287 (47%), Positives = 174/287 (61%), Gaps = 31/287 (11%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR ++DLATR+   AE++NSDKIQVYKGLDI TNK+T  E  GV HHL+G  
Sbjct  45    MGATGTGKSRLAIDLATRF--PAEIVNSDKIQVYKGLDIVTNKVTPEESLGVPHHLLGTV  102

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             +      +F+A DF+      +  IV R +VP I GGSNSYI AL               
Sbjct  103   DNIYD--DFTAEDFQREAIRAVESIVERDRVPIIAGGSNSYIEAL---------------  145

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                V       LRY CCFLWVDVS PVL+ ++ +RVD+M++ G+++E+ R + DPS+   
Sbjct  146   ---VNGCVDFRLRYNCCFLWVDVSRPVLHSFVSERVDKMVEMGLVDEVRRIF-DPSSSDY  201

Query  516   RTGLAKAIGVPEFAAYFRAP---RGGERRERLYAEAVREIKENTRLLAERQLRKIQRLRE  346
               G+ +AIGVPE   + RA       E  ERL   A+ +IKEN  LLA RQ +KIQRL +
Sbjct  202   SAGIRRAIGVPELDEFLRAEMRNSPAETTERLLETAIEKIKENNCLLACRQRQKIQRLYK  261

Query  345   VGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFL  205
                W MHR++AT  F    G E+E    E WEN V +PS + VE+FL
Sbjct  262   QWKWNMHRVDATEVFRRR-GEEAE----EAWENTVARPSARAVERFL  303



>ref|XP_010551669.1| PREDICTED: adenylate isopentenyltransferase 7, mitochondrial-like 
[Tarenaya hassleriana]
Length=343

 Score =   233 bits (593),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 137/310 (44%), Positives = 191/310 (62%), Gaps = 23/310 (7%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR ++DLATR+   AE+INSDKIQV+KGLD+ TNK+T  E RG+ HHL+G  
Sbjct  38    MGATGTGKSRLAIDLATRF--PAEIINSDKIQVHKGLDVVTNKVTPQECRGIPHHLLGII  95

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             + + +   F++ DF    ++ I+ I  + ++P + GG+NSYI +L+       L   +  
Sbjct  96    DPNAN---FTSTDFSCLASQVIASITAKDRLPIVAGGANSYIESLVTRSAEFLLSGSNSY  152

Query  696   CNS-VGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPL  520
               S V  S    L Y+CCF+WVDVS PVLN ++ KRVD+M+++G+++E+   + DP    
Sbjct  153   IESLVTRSAEFLLNYQCCFIWVDVSLPVLNSFVSKRVDKMVETGLVDEVREMF-DPKADY  211

Query  519   SRTGLAKAIGVPEFAAYFRA----PRGGERRERLYAEAVREIKENTRLLAERQLRKIQRL  352
             S  G+ +AIGVPE   YF +     RG +R  ++ A AV  IK+NT +LA RQL+KI RL
Sbjct  212   S-VGIRRAIGVPELHEYFVSESLIDRGTQR--KMLALAVNNIKQNTEILACRQLQKIHRL  268

Query  351   REVGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE*VFQL----  184
                  W MHRI+AT  F    G E+E    E WEN V +PS +IV +FLL     L    
Sbjct  269   YNKRNWCMHRIDATEVFLRH-GDEAE----EAWENLVARPSTRIVNEFLLSEEDTLTSVA  323

Query  183   FPALTLSIQY  154
             FP  TL+  Y
Sbjct  324   FPESTLAAAY  333



>ref|XP_010051134.1| PREDICTED: adenylate isopentenyltransferase-like [Eucalyptus 
grandis]
 gb|KCW81309.1| hypothetical protein EUGRSUZ_C02680 [Eucalyptus grandis]
Length=304

 Score =   231 bits (588),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 138/307 (45%), Positives = 186/307 (61%), Gaps = 44/307 (14%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             +GATG GKSR S+DLA+ +   +EVINSDK+QVY+GLDITTNKI + +RRGV HHL+G  
Sbjct  20    IGATGCGKSRLSIDLASHF--PSEVINSDKMQVYRGLDITTNKIPLADRRGVPHHLLGSL  77

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             +      E + + F + G   ISD+  RG  P +VGGS S I ALL ERF+P+       
Sbjct  78    DPDHG--EMTPSQFCSLGDNAISDVASRGNFPILVGGSTSSILALLAERFDPQATP----  131

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYS-DPSNPL  520
                       +LRY CCFL VDV  PVL + L KRVD M+  G  +EL+ +Y+   ++P 
Sbjct  132   ----------DLRYDCCFLCVDVLLPVLKKDLPKRVDRMLRMGAFDELAGYYNLRQTDPG  181

Query  519   SRTGLAKAIGVPEFAAYFR---APRG-------GER----------RERLYAEAVREIKE  400
             +  GL KAIGV EF  YF     PRG       G+           RE  Y EA+REIK+
Sbjct  182   AWAGLRKAIGVLEFDRYFEKYPPPRGVRPGDAWGQEDARERQNDPVREGAYQEALREIKK  241

Query  399   NTRLLAERQLRKIQRLREVGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKI  220
             N   L  RQ++KI++L E  GWE+HR++AT A   A   E E    ++W++QV++PS++I
Sbjct  242   NAGQLMIRQVKKIRQLSE-SGWELHRLDATEAVRLATAPEEE----DVWKSQVLEPSVEI  296

Query  219   VEKFLLE  199
             V++FL E
Sbjct  297   VKQFLQE  303



>gb|ABG82043.1| isopentenyltransferase [Malus hupehensis]
Length=320

 Score =   231 bits (589),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 138/297 (46%), Positives = 181/297 (61%), Gaps = 31/297 (10%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR S+DLAT +   AE+INSDK+QVY+GLDI TNKIT  E+RGV HHL+G  
Sbjct  39    MGATGTGKSRLSIDLATCF--PAEIINSDKMQVYEGLDIVTNKITKEEQRGVPHHLLGML  96

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             +  E   +F+A DF    +  I  I+GR ++P IVGGSNSYI AL        +D +D  
Sbjct  97    DPHE---DFTARDFCDLTSIAIESILGRDRLPIIVGGSNSYIEAL--------IDDYD--  143

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                    +    +Y CCFLWVDVS P L+ ++ KRVD M+ +GM++E +R Y DP+   +
Sbjct  144   -------YKFRSKYDCCFLWVDVSTPALHSFVSKRVDHMVQNGMVDE-AREYFDPNADYT  195

Query  516   RTGLAKAIGVPEFAAYFR-AP-RGGERRERLYAEAVREIKENTRLLAERQLRKIQRLREV  343
             + G+ +AIGVPEF  YFR  P    E R RL  +AV EIK+NT  LA RQL KI RLR +
Sbjct  196   K-GIRRAIGVPEFDKYFRYGPFLEEETRARLLRQAVDEIKDNTCKLACRQLEKIHRLRNI  254

Query  342   GGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE*VFQLFPAL  172
              GW +H ++AT  F      +   E  E W+  V   S  IV +FL     ++ P L
Sbjct  255   KGWNLHPLDATEVF-----RKRGEEADEAWKKLVSGTSAMIVGQFLYNMTAEVPPHL  306



>dbj|BAE43829.1| isopentenyltransferase [Brassica rapa subsp. pekinensis]
 emb|CDX77492.1| BnaA07g06300D [Brassica napus]
Length=332

 Score =   231 bits (589),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 134/288 (47%), Positives = 174/288 (60%), Gaps = 35/288 (12%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATGSGKSR ++DLATR+ T  E+INSDKIQVYKGLD+ TNK+T  E RGV HHL+G F
Sbjct  40    MGATGSGKSRLAIDLATRFQT--EIINSDKIQVYKGLDVLTNKVTPQECRGVPHHLLGVF  97

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             ++       +A DF    ++ IS +    K+P + GGSNSYI AL               
Sbjct  98    DSEAG--NLTATDFCRLASQEISTLSANNKLPIVAGGSNSYIEAL---------------  140

Query  696   CNSVGDSFGLEL-RYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPL  520
                   S G  L +Y+CCF+WVDVS PVLN ++ KRVD MM++G+LEE+ R   DP    
Sbjct  141   ---ANHSSGFLLNKYQCCFIWVDVSLPVLNSFVSKRVDRMMEAGLLEEV-REVHDPKADY  196

Query  519   SRTGLAKAIGVPEFAAYF----RAPRGGERRERLYAEAVREIKENTRLLAERQLRKIQRL  352
             S  G+ +AIGVPE   Y        RG +R  ++   AV++IKENT +LA RQL KIQRL
Sbjct  197   S-VGIRRAIGVPELHEYLCYESLVDRGTQR--KMLDAAVKKIKENTEILACRQLLKIQRL  253

Query  351   REVGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKF  208
              +     MHR++AT  F       +E E  E WEN V + + +IV+KF
Sbjct  254   SKKWKLSMHRVDATEVFL----KRTEEEADEAWENLVARQTKRIVDKF  297



>ref|XP_003520560.2| PREDICTED: adenylate isopentenyltransferase 3, chloroplastic-like 
[Glycine max]
 gb|KHN19877.1| Adenylate isopentenyltransferase 3, chloroplastic [Glycine soja]
Length=309

 Score =   230 bits (587),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 135/286 (47%), Positives = 170/286 (59%), Gaps = 35/286 (12%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATGSGK+R S+DLAT +   +E+INSDKIQVY GLD+ TNK T  E+RGV HHL+G  
Sbjct  42    MGATGSGKTRLSIDLATCF--PSEIINSDKIQVYSGLDVVTNKATKEEQRGVPHHLLG--  97

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
                    EF+A+DF    +  I  I  R KVP IVGGSNSYI A LV++F P        
Sbjct  98    -TQNPNTEFTASDFCHMASHAIESITHREKVPIIVGGSNSYIEA-LVDKFGP--------  147

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                         RY  C LWVDVS  VL+ Y+ +RVD M+  GM+ EL  ++S P+   S
Sbjct  148   ------------RYDWCCLWVDVSTSVLHSYVAQRVDHMLGGGMVNELRPFFS-PNGDYS  194

Query  516   RTGLAKAIGVPEFAAYFR--APRGGERRERLYAEAVREIKENTRLLAERQLRKIQRLREV  343
             + G+ KAIGVPEF AYFR  A    E R  L  +AVR++K NT  LA +Q+ +I RLR V
Sbjct  195   K-GIRKAIGVPEFDAYFRREAFSSNETRVSLLQDAVRDVKRNTCHLACKQIGRIHRLRSV  253

Query  342   GGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFL  205
              GW++HR+ AT  F      +   E  + W+N V QP   IV  FL
Sbjct  254   KGWKIHRVCATPVF-----QKRGQEANDAWKNIVAQPCASIVSHFL  294



>ref|XP_007162406.1| hypothetical protein PHAVU_001G149400g [Phaseolus vulgaris]
 gb|ESW34400.1| hypothetical protein PHAVU_001G149400g [Phaseolus vulgaris]
Length=305

 Score =   229 bits (585),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 135/286 (47%), Positives = 170/286 (59%), Gaps = 35/286 (12%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATGSGK+R SVDLAT +   +E+INSDK+QVY+GL+I TNK T  E+RG+ HHL+G  
Sbjct  36    MGATGSGKTRLSVDLATCF--PSEIINSDKMQVYEGLEIVTNKATKEEQRGIPHHLLG--  91

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
                    EF+A+DF    +  I  I  R KVP +VGGSNSY+ A LVERF P        
Sbjct  92    -IQNPDTEFTASDFCDVASRAIESITRRDKVPIVVGGSNSYMEA-LVERFGP--------  141

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                         R+  CFLWVDVS PVL+ Y+ +RVD M+  GM+ EL  +++   N   
Sbjct  142   ------------RFEWCFLWVDVSVPVLHSYVAQRVDHMLRCGMVNELRPFFN--VNGDY  187

Query  516   RTGLAKAIGVPEFAAYFR--APRGGERRERLYAEAVREIKENTRLLAERQLRKIQRLREV  343
               G+ KAIGV EF AYFR  A   GE R RL  EAVR++K NT  LA +QL +I  LR V
Sbjct  188   ARGIRKAIGVSEFHAYFRREATASGETRMRLLQEAVRDVKRNTCHLACKQLGRIHMLRSV  247

Query  342   GGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFL  205
              GW++HR+ AT  F      +   +  E W N V QP   IV +FL
Sbjct  248   EGWKIHRVCATPVF-----QKRGHDANEAWNNMVAQPCASIVSQFL  288



>ref|XP_007226947.1| hypothetical protein PRUPE_ppa025177mg [Prunus persica]
 gb|EMJ28146.1| hypothetical protein PRUPE_ppa025177mg [Prunus persica]
Length=338

 Score =   231 bits (588),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 124/298 (42%), Positives = 179/298 (60%), Gaps = 32/298 (11%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR ++DLAT  F  AE+INSDK+QVYKGLDI TNK+T  E RG+ HHL+G+ 
Sbjct  42    MGATGTGKSRLAIDLAT--FHRAEIINSDKMQVYKGLDIVTNKVTEEECRGIPHHLLGQI  99

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             + + +   F+A DF+   +  I  I+ R ++P I GGSNSYI AL               
Sbjct  100   DPNFN---FTANDFKQHASLAIESILERDRLPIIAGGSNSYIEAL---------------  141

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                V D     ++Y CCF+WVDV+ PVLN ++ +RVD M+ +G+++E+ R +   +    
Sbjct  142   ---VDDHPEFRMKYECCFIWVDVALPVLNSFVSERVDRMVKAGLVDEVRRMFDSTAEAEY  198

Query  516   RTGLAKAIGVPEFAAYFRAPRGG----ERRERLYAEAVREIKENTRLLAERQLRKIQRLR  349
               G+ KAIG+PE   Y R+   G    E +ERL   A+ +IKENT +LA RQL+KI+RL 
Sbjct  199   THGIRKAIGMPELDEYLRSEACGINDEETQERLLQTAISKIKENTCILAHRQLKKIRRLC  258

Query  348   EVGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE*VFQLFPA  175
                 W MHR++AT  F      +   E  + WE  V +P+ ++V  FL++ +  + P+
Sbjct  259   SRRNWNMHRLDATEVFL-----KHRVEADQAWEKHVARPAKRMVGNFLVDPMPTILPS  311



>ref|XP_009102596.1| PREDICTED: adenylate isopentenyltransferase 7, mitochondrial 
[Brassica rapa]
Length=332

 Score =   230 bits (587),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 133/288 (46%), Positives = 174/288 (60%), Gaps = 35/288 (12%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATGSGKSR ++DLATR+ T  ++INSDKIQVYKGLD+ TNK+T  E RGV HHL+G F
Sbjct  40    MGATGSGKSRLAIDLATRFQT--DIINSDKIQVYKGLDVLTNKVTPQECRGVPHHLLGVF  97

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             ++       +A DF    ++ IS +    K+P + GGSNSYI AL               
Sbjct  98    DSEAG--NLTATDFCRLASQEISTLSANNKLPIVAGGSNSYIEAL---------------  140

Query  696   CNSVGDSFGLEL-RYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPL  520
                   S G  L +Y+CCF+WVDVS PVLN ++ KRVD MM++G+LEE+ R   DP    
Sbjct  141   ---ANHSSGFLLNKYQCCFIWVDVSLPVLNSFVSKRVDRMMEAGLLEEV-REVHDPKADY  196

Query  519   SRTGLAKAIGVPEFAAYF----RAPRGGERRERLYAEAVREIKENTRLLAERQLRKIQRL  352
             S  G+ +AIGVPE   Y        RG +R  ++   AV++IKENT +LA RQL KIQRL
Sbjct  197   S-VGIRRAIGVPELHEYLCYESLVDRGTQR--KMLDAAVKKIKENTEILACRQLLKIQRL  253

Query  351   REVGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKF  208
              +     MHR++AT  F       +E E  E WEN V + + +IV+KF
Sbjct  254   SKKWKLSMHRVDATEVFL----KRTEEEADEAWENLVARQTKRIVDKF  297



>emb|CDX85119.1| BnaC07g07870D [Brassica napus]
Length=332

 Score =   230 bits (587),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 132/286 (46%), Positives = 174/286 (61%), Gaps = 31/286 (11%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATGSGKSR ++DLATR+ T  E+INSDKIQVYKGLD+ TNK+T  E RGV HHL+G F
Sbjct  40    MGATGSGKSRLAIDLATRFQT--EIINSDKIQVYKGLDVLTNKVTPQECRGVPHHLLGVF  97

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             ++       +A DF    ++ IS +    K+P + GGSNSYI AL               
Sbjct  98    DSEAG--NLTATDFCRLASQEISTLSANNKLPIVAGGSNSYIEAL---------------  140

Query  696   CNSVGDSFGLEL-RYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPL  520
                   S G  L +Y+CCF+WVDVS PVLN ++ KRVD MM++G+LEE+ R   DP    
Sbjct  141   ---ANHSSGFLLNKYQCCFIWVDVSLPVLNSFVSKRVDRMMEAGLLEEV-REVHDPKADY  196

Query  519   SRTGLAKAIGVPEFAAYFRAPRGGER--RERLYAEAVREIKENTRLLAERQLRKIQRLRE  346
             S  G+ +AIGVPE   Y       +R  + ++   AV++IKENT +LA RQL KIQRL +
Sbjct  197   S-VGIRRAIGVPELHEYLCYESLVDRATQRKMLDAAVKKIKENTEILACRQLLKIQRLSK  255

Query  345   VGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKF  208
                  MHR++AT  F       +E E  + WEN V +P+ +IV+KF
Sbjct  256   KWKLSMHRVDATEVFL----KRNEEEADKAWENLVARPTKRIVDKF  297



>emb|CAN64248.1| hypothetical protein VITISV_032976 [Vitis vinifera]
Length=305

 Score =   229 bits (584),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 132/285 (46%), Positives = 175/285 (61%), Gaps = 33/285 (12%)
 Frame = -1

Query  1050  ATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEFEA  871
             ATG+GKSR S+DLATR+   AE++NSDK+QVY+GLDI TNKIT  E+RGV HHL+     
Sbjct  20    ATGTGKSRLSIDLATRF--PAEIVNSDKMQVYEGLDIVTNKITEEEQRGVPHHLL---RI  74

Query  870   SESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDECN  691
             +    +F+A+DFR   +  I  I+GRG++P +VGGSNSYI AL                 
Sbjct  75    AHPNVDFTASDFRDMASLSIESILGRGRLPIVVGGSNSYIEAL-----------------  117

Query  690   SVGDSFG-LELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLSR  514
              VGD +     RY CCFLWVDVS  VL+ ++ KRVD+M++ GM+EE+ + +  P+   +R
Sbjct  118   -VGDEYSKFRSRYECCFLWVDVSRSVLHSFVSKRVDKMVEKGMVEEVQQLFH-PNADYTR  175

Query  513   TGLAKAIGVPEFAAYFRAP--RGGERRERLYAEAVREIKENTRLLAERQLRKIQRLREVG  340
              G+ +AIGVPE   YFR       E R R+  EAV EIK NT  LA RQL KI RL+ V 
Sbjct  176   -GIRRAIGVPELDLYFRTEGFLDEEARARVLQEAVHEIKANTCKLACRQLEKIHRLKNVR  234

Query  339   GWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFL  205
              W++HR+ AT         + + E  E WE  V +PS  +V +FL
Sbjct  235   KWKIHRLGATEVL-----RKCDREADEAWEKLVARPSTMMVAQFL  274



>ref|XP_009603455.1| PREDICTED: adenylate isopentenyltransferase 3, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=337

 Score =   230 bits (587),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 132/290 (46%), Positives = 176/290 (61%), Gaps = 28/290 (10%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR SVDLAT +    E++NSDKIQVYKGLD+ TNKIT  ER G+ HHL+G  
Sbjct  44    MGATGAGKSRLSVDLATHF--GGEIVNSDKIQVYKGLDVATNKITEEERCGIPHHLLG--  99

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
              A +   EF A +F    +  I+ I  RGK+P IVGGSNS+I AL  ++           
Sbjct  100   -AIDPHKEFEAKNFCDMASLAINSITCRGKLPIIVGGSNSFIEALFYDK-----------  147

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                   ++ +  RY  CFLWVDVS  VLN +L KRVD+M++ G++ E+   + +P N   
Sbjct  148   ------TYEVYTRYNFCFLWVDVSMHVLNSFLTKRVDKMVEKGLVNEVRNMF-NPKNADY  200

Query  516   RTGLAKAIGVPEFAAYFRAPRGG----ERRERLYAEAVREIKENTRLLAERQLRKIQRLR  349
               G+ KAIGVPEF  YFRA        E R +L  E + E+K N   LA +QL KI+RL 
Sbjct  201   SKGIRKAIGVPEFDRYFRAELSNSVDEETRIKLLEEVINEVKINNCKLASQQLEKIKRLI  260

Query  348   EVGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
              V GW +HR++AT  +    G+E E    E+W+N VV  S +I+++FL E
Sbjct  261   NVKGWNVHRLDATEVYKKR-GNEEEEMVEELWKNLVVGQSKRIMDRFLCE  309



>ref|XP_009126292.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Brassica rapa]
 ref|XP_009126293.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Brassica rapa]
 dbj|BAE43828.1| isopentenyltransferase [Brassica rapa subsp. pekinensis]
Length=331

 Score =   230 bits (586),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 125/284 (44%), Positives = 176/284 (62%), Gaps = 28/284 (10%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR ++DLATR+   AE++NSDKIQVYKGLDI TNK+T  E  GV HHL+G  
Sbjct  43    MGATGTGKSRLAIDLATRF--PAEIVNSDKIQVYKGLDIVTNKVTPEESLGVPHHLLGTV  100

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             E  ++  +F+A DF+      +  IV R +VP I GGSNSYI AL               
Sbjct  101   E--DTHEDFTAEDFQREAIRAVKSIVERDRVPIIAGGSNSYIEAL---------------  143

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                V +     LRY CCFLWVDV  PVL+ ++ +RVD+M++ G+++E+ R + DP++   
Sbjct  144   ---VNNCVDFRLRYNCCFLWVDVDKPVLHSFVSERVDKMVEMGLVDEVRRIF-DPTSDDY  199

Query  516   RTGLAKAIGVPEFAAYFRAPRGGERRERLYAEAVREIKENTRLLAERQLRKIQRLREVGG  337
              TG+ +AIGVPE   + RA        +L   A+++IK++  LLA RQ +KIQRL +   
Sbjct  200   STGIRRAIGVPELDEFLRAELLNYPTSKLLETAIKKIKDSNCLLASRQYQKIQRLYKQWK  259

Query  336   WEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFL  205
             W MHR++AT  F    G E++    + WE++V +PS   V++FL
Sbjct  260   WNMHRLDATEVFLRR-GEEAD----DAWEDKVARPSALAVDRFL  298



>emb|CDY13945.1| BnaC09g38810D [Brassica napus]
Length=334

 Score =   230 bits (586),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 130/287 (45%), Positives = 174/287 (61%), Gaps = 31/287 (11%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR ++DLATR+   AE++NSDKIQVYKGLDI TNK+T  E  GV HHL+G  
Sbjct  43    MGATGTGKSRLAIDLATRF--PAEIVNSDKIQVYKGLDIVTNKVTPEESLGVPHHLLGTV  100

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             E +    +F+A D++      +  IV R +VP I GGSNSYI AL               
Sbjct  101   ENTHE--DFAAEDYQREALRAVKSIVERNRVPIIAGGSNSYIEAL---------------  143

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                V +     LRY+CCFLWVDV  PVLN ++  RVD+M++ G+++E+ R + DPS+   
Sbjct  144   ---VNNCVDFRLRYKCCFLWVDVDRPVLNSFVSDRVDKMVEMGLVDEVRRIF-DPSSSDY  199

Query  516   RTGLAKAIGVPEFAAYFRAPRG---GERRERLYAEAVREIKENTRLLAERQLRKIQRLRE  346
               G+ +AIGVPE   + RA       E  E+L   A+++IKEN  LLA RQ +KI+RL +
Sbjct  200   SAGIRRAIGVPELDEFLRAELCSYPAETTEKLLETAIKKIKENNCLLACRQYQKIKRLYK  259

Query  345   VGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFL  205
                W M RI+AT  F    G E++    E WEN V +PS   V++FL
Sbjct  260   QWKWNMRRIDATEVFLRR-GEEAD----EAWENMVARPSALAVDRFL  301



>ref|XP_010551776.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Tarenaya hassleriana]
Length=330

 Score =   230 bits (586),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 134/287 (47%), Positives = 175/287 (61%), Gaps = 33/287 (11%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR ++DLATR+   AE++NSDKIQVYKGLD+ TNK+T  E RGV HHL+G  
Sbjct  41    MGATGTGKSRLAIDLATRF--PAEIVNSDKIQVYKGLDVVTNKVTPEESRGVPHHLLGTV  98

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             +      +F+AADF       +  IV R +VP I GGSNSYI AL               
Sbjct  99    DPDA---DFTAADFAREATRAVQSIVERDRVPIIAGGSNSYIDAL---------------  140

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                V D     LRY+CCFLWVDVS PVL+ ++ +RVD+M++ G+++E+ R + DPS   S
Sbjct  141   ---VNDCVDFRLRYQCCFLWVDVSRPVLHSFVSERVDKMVEIGLVDEVRRIF-DPSADYS  196

Query  516   RTGLAKAIGVPEFAAYFRA---PRGGERRERLYAEAVREIKENTRLLAERQLRKIQRLRE  346
               G+ +AIGVPE   +  +       E R RL   A+ +IKENT  LA RQ++KIQRL +
Sbjct  197   -VGIRRAIGVPELDEFLLSELQESTDENRARLLETAIGKIKENTCSLACRQVQKIQRLYK  255

Query  345   VGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFL  205
                W MHRI+AT       G E++    E WE  V +PS  IVE+FL
Sbjct  256   QWKWNMHRIDATEV-VLRRGEEAD----EAWETIVARPSSLIVEQFL  297



>emb|CDY47191.1| BnaAnng08610D [Brassica napus]
Length=331

 Score =   230 bits (586),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 125/284 (44%), Positives = 176/284 (62%), Gaps = 28/284 (10%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR ++DLATR+   AE++NSDKIQVYKGLDI TNK+T  E  GV HHL+G  
Sbjct  43    MGATGTGKSRLAIDLATRF--PAEIVNSDKIQVYKGLDIVTNKVTPEESLGVPHHLLGTV  100

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             E  ++  +F+A DF+      +  IV R +VP I GGSNSYI AL               
Sbjct  101   E--DTHEDFTAEDFQREAIRAVKSIVERDRVPIIAGGSNSYIEAL---------------  143

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                V +     LRY CCFLWVDV  PVL+ ++ +RVD+M++ G+++E+ R + DP++   
Sbjct  144   ---VNNCVDFRLRYNCCFLWVDVDKPVLHSFVSERVDKMVEMGLVDEVRRIF-DPTSDDY  199

Query  516   RTGLAKAIGVPEFAAYFRAPRGGERRERLYAEAVREIKENTRLLAERQLRKIQRLREVGG  337
              TG+ +AIGVPE   + RA        +L   A+++IK++  LLA RQ +KIQRL +   
Sbjct  200   STGIRRAIGVPELDEFLRAELLNYPTSKLLETAIKKIKDSNCLLASRQYQKIQRLYKQWK  259

Query  336   WEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFL  205
             W MHR++AT  F    G E++    + WE++V +PS   V++FL
Sbjct  260   WNMHRLDATEVFLRR-GEEAD----DAWEDKVARPSALAVDRFL  298



>ref|XP_006444118.1| hypothetical protein CICLE_v10021361mg [Citrus clementina]
 gb|ESR57358.1| hypothetical protein CICLE_v10021361mg [Citrus clementina]
Length=300

 Score =   228 bits (582),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 131/296 (44%), Positives = 180/296 (61%), Gaps = 29/296 (10%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR S+D+ATR+   AE+INSDKIQVY+GLDI TNKIT  E+ G+ HHL+G  
Sbjct  17    MGATGTGKSRLSIDMATRF--PAEIINSDKIQVYEGLDIVTNKITEEEQCGIPHHLLG--  72

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
                    +F+A +F    +  I   + +GKVP IVGGSNSYI AL+           DDE
Sbjct  73    -IQHPNADFTAQNFCDMASFSIESTLNKGKVPIIVGGSNSYIEALV-----------DDE  120

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                    +G   +Y CCFLWVDVS PVL  ++ +RVD M+ +GM++E+ +++ DP+   S
Sbjct  121   ------DYGFRWKYDCCFLWVDVSMPVLRSFVSERVDRMVQNGMIDEVRKFF-DPNADYS  173

Query  516   RTGLAKAIGVPEFAAYFRAP--RGGERRERLYAEAVREIKENTRLLAERQLRKIQRLREV  343
             + G+ KAIGVPEF  YF+       E + +L  +A++ +K NT  LA RQL KI+RL  V
Sbjct  174   K-GVRKAIGVPEFDLYFKMEPFLDEENQAKLLQQAIQAVKYNTCKLAFRQLEKIRRLMNV  232

Query  342   GGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE*VFQLFPA  175
               W +HR +AT  F      ++  E    WE  V  PS ++VE+FL     ++ PA
Sbjct  233   KRWNIHRFDATQVFRIRQHGKAADEA---WEKFVAGPSTRLVEEFLYNVPVEVPPA  285



>ref|XP_010545085.1| PREDICTED: adenylate isopentenyltransferase 3, chloroplastic 
[Tarenaya hassleriana]
Length=321

 Score =   229 bits (583),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 136/289 (47%), Positives = 172/289 (60%), Gaps = 33/289 (11%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR SVDLATR+   AE+INSDKIQ ++GLDI TNKIT  E  GV HHL+G  
Sbjct  45    MGATGTGKSRLSVDLATRF--PAEIINSDKIQAHQGLDIVTNKITAEESCGVPHHLLGVL  102

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
               +    +F+AA+F+      +  IV RGK+P IVGGSNSY+ AL          V DD+
Sbjct  103   PPNA---DFTAANFQQMANLSVESIVSRGKLPIIVGGSNSYVEAL----------VDDDD  149

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
             C           +Y CCFLWVDVS PVL  ++ +RVD+M + GM+EE+   +    +  +
Sbjct  150   CK-------FRSKYDCCFLWVDVSMPVLQGFVSERVDKMAEKGMVEEVREMFDYSDSDYT  202

Query  516   RTGLAKAIGVPEFAAYFRAP---RGGERRERLYAEAVREIKENTRLLAERQLRKIQRLRE  346
             R G+ KAIGV EF  YFRA      GER E L  E + EIK NT  LA RQ  KI+RLR 
Sbjct  203   R-GIRKAIGVKEFDWYFRAEPFLNNGEREEMLR-EVIEEIKRNTCALACRQREKIERLRR  260

Query  345   VGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
             V GW + R++ATA F        + +    WE  V  PS   V +FLL+
Sbjct  261   VKGWSIQRLDATAVF------RQKGDADGTWERMVAAPSTPAVARFLLD  303



>ref|XP_006479751.1| PREDICTED: adenylate isopentenyltransferase 3, chloroplastic-like 
[Citrus sinensis]
 gb|KDO68788.1| hypothetical protein CISIN_1g020775mg [Citrus sinensis]
Length=321

 Score =   229 bits (583),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 131/296 (44%), Positives = 180/296 (61%), Gaps = 29/296 (10%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR S+D+ATR+   AE+INSDKIQVY+GLDI TNKIT  E+ G+ HHL+G  
Sbjct  38    MGATGTGKSRLSIDMATRF--PAEIINSDKIQVYEGLDIVTNKITEEEQCGIPHHLLG--  93

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
                    +F+A +F    +  I   + +GKVP IVGGSNSYI AL+           DDE
Sbjct  94    -IQHPNADFTAQNFCDMASFSIESTLNKGKVPIIVGGSNSYIEALV-----------DDE  141

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                    +G   +Y CCFLWVDVS PVL  ++ +RVD M+ +GM++E+ +++ DP+   S
Sbjct  142   ------DYGFRWKYDCCFLWVDVSMPVLRSFVSERVDRMVQNGMIDEVRKFF-DPNADYS  194

Query  516   RTGLAKAIGVPEFAAYFRAP--RGGERRERLYAEAVREIKENTRLLAERQLRKIQRLREV  343
             + G+ KAIGVPEF  YF+       E + +L  +A++ +K NT  LA RQL KI+RL  V
Sbjct  195   K-GVRKAIGVPEFDLYFKMEPFLDEENQAKLLQQAIQAVKYNTCKLAFRQLEKIRRLMNV  253

Query  342   GGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE*VFQLFPA  175
               W +HR +AT  F      ++  E    WE  V  PS ++VE+FL     ++ PA
Sbjct  254   KRWNIHRFDATQVFRIRQHGKAADEA---WEKFVAGPSTRLVEEFLYNVPVEVPPA  306



>ref|XP_008223011.1| PREDICTED: LOW QUALITY PROTEIN: adenylate isopentenyltransferase 
5, chloroplastic [Prunus mume]
Length=335

 Score =   229 bits (584),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 124/297 (42%), Positives = 177/297 (60%), Gaps = 32/297 (11%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR ++DLAT Y   AE+INSDK+QVYKGLDI TNK+T  E RG+ HHL+G+ 
Sbjct  42    MGATGTGKSRLAIDLATLY--RAEIINSDKMQVYKGLDIVTNKVTEEECRGIPHHLLGKI  99

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             + + +   F+A DF+   +  I  I+ R ++P I GGSNSYI AL               
Sbjct  100   DPNFN---FTANDFKQHASLAIESILERDRLPIIAGGSNSYIEAL---------------  141

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                V D     ++Y CCF+WVDV+ PVLN ++ +RVD M+ +G+++E+ R +   +    
Sbjct  142   ---VDDHPEFRMKYECCFIWVDVALPVLNSFVSERVDRMVKAGLVDEVRRMFDSTAEAEY  198

Query  516   RTGLAKAIGVPEFAAYFRAPRGG----ERRERLYAEAVREIKENTRLLAERQLRKIQRLR  349
               G+ KAIG+PE   Y R    G    E +ERL   A+ +IKENT +LA RQL+KI+RL 
Sbjct  199   THGIRKAIGMPEMDQYLRGEASGINDEETQERLLQTAISKIKENTCILAHRQLQKIRRLC  258

Query  348   EVGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE*VFQLFP  178
                 W MHR++AT  F      +   E  + WE  V +P+ ++V  FL++ +  + P
Sbjct  259   SRRNWNMHRLDATEVFL-----KHRVEADQAWEKHVARPAKRMVGNFLVDPMPTILP  310



>ref|XP_009120925.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic 
[Brassica rapa]
Length=334

 Score =   229 bits (583),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 129/287 (45%), Positives = 174/287 (61%), Gaps = 31/287 (11%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR ++DLATR+   AE++NSDKIQVYKGLDI TNK+T  E  GV HHL+G  
Sbjct  43    MGATGTGKSRLAIDLATRF--PAEIVNSDKIQVYKGLDIVTNKVTPEESLGVPHHLLGTV  100

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             E +    +F+A D++      +  IV R +VP I GGSNSYI AL               
Sbjct  101   ENTHE--DFTAEDYQREALRAVKSIVERDRVPIIAGGSNSYIEAL---------------  143

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                V +     LRY+CCFLWVDV  PVLN ++  RVD+M++ G+++E+ R + DPS+   
Sbjct  144   ---VNNCVDFRLRYKCCFLWVDVDRPVLNSFVSDRVDKMVEMGLVDEVRRIF-DPSSSDY  199

Query  516   RTGLAKAIGVPEFAAYFRAPR---GGERRERLYAEAVREIKENTRLLAERQLRKIQRLRE  346
              +G+ +AI VPE   + RA +     E   +L   A+++IKEN  LLA RQ +KI+RL +
Sbjct  200   SSGIRRAIAVPELDEFLRAEKRDYPAEVTGKLLETAIKKIKENNCLLACRQYQKIKRLYK  259

Query  345   VGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFL  205
                W MHRI+AT  F    G E++    E WEN V +PS   V +FL
Sbjct  260   QWKWNMHRIDATEVFLRR-GEEAD----EAWENMVARPSALAVNRFL  301



>ref|XP_006406003.1| hypothetical protein EUTSA_v10022241mg [Eutrema salsugineum]
 gb|ESQ47456.1| hypothetical protein EUTSA_v10022241mg [Eutrema salsugineum]
Length=332

 Score =   228 bits (582),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 132/286 (46%), Positives = 173/286 (60%), Gaps = 31/286 (11%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATGSGK+R ++DLATR+    E+INSDKIQ+YKGLD+ TNK+T  E RGV HHL+G F
Sbjct  40    MGATGSGKTRLAIDLATRF--RGEIINSDKIQLYKGLDVLTNKVTPQECRGVPHHLLGVF  97

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             ++       +A DF    ++ IS +    K+P + GGSNSYI AL               
Sbjct  98    DSEAG--NLTATDFSRLASQEISTLSANHKLPIVAGGSNSYIEAL---------------  140

Query  696   CNSVGDSFGLEL-RYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPL  520
                   S G  L  Y CCF+WVDVS PVLN ++ KRVD MM++G+LEE+   Y DP    
Sbjct  141   ---ANHSSGFLLNNYHCCFIWVDVSLPVLNSFVSKRVDRMMEAGLLEEVREIY-DPKADY  196

Query  519   SRTGLAKAIGVPEFAAYFRAPRGGER--RERLYAEAVREIKENTRLLAERQLRKIQRLRE  346
             S  G+ +AIGVPE   Y R     +R  + ++   AV++IKENT +LA RQL KI+RL +
Sbjct  197   S-VGIRRAIGVPELHEYLRYESLVDRATQRKMLDVAVKKIKENTEILACRQLLKIKRLSK  255

Query  345   VGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKF  208
                  MHR++AT  F    G E+E    E WEN V +PS +IV+KF
Sbjct  256   KWKLSMHRVDATEVFLRRNGEEAE----EAWENLVARPSERIVDKF  297



>ref|XP_004495223.1| PREDICTED: adenylate isopentenyltransferase 3, chloroplastic-like 
[Cicer arietinum]
Length=326

 Score =   228 bits (582),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 132/286 (46%), Positives = 175/286 (61%), Gaps = 31/286 (11%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKS+ S+DL+T YF  +E+INSDKIQ+Y+GLDI TNKIT  E+RGV HHL+G  
Sbjct  40    MGATGTGKSKLSIDLST-YF-PSEIINSDKIQIYEGLDIVTNKITKEEQRGVPHHLLGTH  97

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
               +    EF++ DFR      I  I  R  +P +VGGSNSY+ AL+           DD 
Sbjct  98    NPN---IEFTSNDFREKSTSAIDSITNREHLPIVVGGSNSYLEALV-----------DD-  142

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                  D +    RY  C LWVDVS PVL+ Y+ +RVD+M+++GM+ EL  +Y +P+   S
Sbjct  143   -----DDYKFRSRYNFCCLWVDVSMPVLHSYVEQRVDQMLNNGMVNELRPFY-NPNGDYS  196

Query  516   RTGLAKAIGVPEFAAYFRAPR--GGERRERLYAEAVREIKENTRLLAERQLRKIQRLREV  343
             + G+ KAIGVPEF  YFR       E R+ L  +AV E+K NT  LA +QLRKI  L+ V
Sbjct  197   K-GIRKAIGVPEFDEYFRMENLVDDESRKLLVEKAVSEMKMNTWKLARKQLRKIHWLKNV  255

Query  342   GGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFL  205
               WE+HR++AT  F      +S  E  E W+  V +PS  I+  FL
Sbjct  256   KRWEIHRLDATPVF-----KKSGKEADEAWKKIVAEPSAMILAHFL  296



>ref|XP_009356755.1| PREDICTED: adenylate isopentenyltransferase 3, chloroplastic 
[Pyrus x bretschneideri]
Length=310

 Score =   228 bits (580),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 135/286 (47%), Positives = 175/286 (61%), Gaps = 31/286 (11%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR S+DLAT +   AE+INSDK+QVY+GLDI TNKIT  E+RGV HHL+G  
Sbjct  27    MGATGTGKSRLSIDLATCF--PAEIINSDKMQVYEGLDIVTNKITKEEQRGVPHHLLGIL  84

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             + +E   +F+A DF    +  I  ++GR ++P IVGGSNSYI AL+           DD 
Sbjct  85    DPNE---DFTARDFCDLTSLAIESVLGRDRLPIIVGGSNSYIEALV-----------DDH  130

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                    +    +Y CCFLWVDVS PV++ ++  RVD M+ +GM++E +R + DP N   
Sbjct  131   ------DYKFRSKYECCFLWVDVSVPVMHSFVSGRVDRMVQNGMVDE-AREFFDP-NADY  182

Query  516   RTGLAKAIGVPEFAAYFR-AP-RGGERRERLYAEAVREIKENTRLLAERQLRKIQRLREV  343
               G+ +AIGVPEF  YFR  P    E R RL  +AV EIK+NT  LA RQL KI RLR +
Sbjct  183   MKGIRRAIGVPEFDKYFRYGPLLDEETRARLLQQAVDEIKDNTCKLACRQLEKIHRLRNI  242

Query  342   GGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFL  205
              GW +H ++AT  F      +   E  E WE  V  P   IV +FL
Sbjct  243   KGWNLHPLDATEVF-----RKRGKEADEAWEKLVSGPGAMIVGQFL  283



>emb|CDY02590.1| BnaC02g08450D [Brassica napus]
Length=334

 Score =   228 bits (582),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 128/287 (45%), Positives = 175/287 (61%), Gaps = 31/287 (11%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR ++DLATR+   AE+INSDKIQVYKGLDI TNK+T  E  GV HHL+G  
Sbjct  43    MGATGTGKSRLAIDLATRF--PAEIINSDKIQVYKGLDIVTNKVTPEESLGVPHHLLGTV  100

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             E +    +F A DF+      +  IV R +VP I GGSNSYI AL               
Sbjct  101   ENTHD--DFMAEDFQRDAIRAVKSIVERDRVPIIAGGSNSYIEAL---------------  143

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                V +     LRY CCFLWVDV  PVL+ ++ +RVD+M++ G+++E+ R + DPS+   
Sbjct  144   ---VNNCVDFRLRYNCCFLWVDVDKPVLHSFVSERVDKMVEMGLVDEVRRIF-DPSSSDY  199

Query  516   RTGLAKAIGVPEFAAYFRAP---RGGERRERLYAEAVREIKENTRLLAERQLRKIQRLRE  346
               G+ +AIGVPE   + RA       E  E+L   A+++IK++  LLA RQ +KIQRL +
Sbjct  200   SAGIRRAIGVPELDEFLRAELLNYPAETTEKLLETAIKKIKDSNCLLASRQYQKIQRLYK  259

Query  345   VGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFL  205
                W MHR++AT  F    G E++    + WE++V +PS   V++FL
Sbjct  260   QWKWNMHRLDATEVFLRR-GEEAD----DAWEDKVARPSALAVDRFL  301



>ref|XP_009394636.1| PREDICTED: adenylate isopentenyltransferase [Musa acuminata subsp. 
malaccensis]
Length=326

 Score =   228 bits (580),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 132/290 (46%), Positives = 176/290 (61%), Gaps = 11/290 (4%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKS+ S++LATR+  + EV+NSDKIQVY+GLD+TTNK+ + ER GV HHL+GE 
Sbjct  29    MGATGTGKSKLSIELATRF--SGEVVNSDKIQVYRGLDVTTNKMPVVERCGVPHHLLGEV  86

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             + +    E S A FR   A  I+ I GRG++P + GGSNS ++A +   ++PE   F  +
Sbjct  87    DPAAG--EVSPATFREMAARAIAGINGRGRLPVVAGGSNSMVHAAMAGSYDPERSPFAAD  144

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYS----DPS  529
                        LRYRCCFLWVDV    L   L +RV+EM+ +GM+EEL R+++      +
Sbjct  145   WRWRRKRREGALRYRCCFLWVDVEAAALADQLDRRVEEMVAAGMVEELGRYFAAEVESDA  204

Query  528   NPLSRTGLAKAIGVPEFAAYFRAPRGGERRERLYAEAVREIKENTRLLAERQLRKIQRLR  349
               L   GLAKAIGV E   YFR    G      Y  A+  IK NTR LAE Q+RKI+RL 
Sbjct  205   GELRHPGLAKAIGVAELREYFRGE--GRGTAAAYQAAMAAIKANTRRLAEEQVRKIERLE  262

Query  348   EVGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
             E+ GW + R++ATA   A +   +  +    WE  V  PS   VE+FL E
Sbjct  263   EM-GWPLRRLDATATVTARLAGSATEQAEAAWERDVAGPSSAAVEQFLKE  311



>ref|XP_010653719.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Vitis vinifera]
 emb|CBI32805.3| unnamed protein product [Vitis vinifera]
Length=258

 Score =   225 bits (573),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 129/286 (45%), Positives = 176/286 (62%), Gaps = 31/286 (11%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MG+TGSGKSR S+D+A+ Y    EVINSDK+QVYKGLDI TNK+   +RRGV HHLIGE 
Sbjct  1     MGSTGSGKSRLSIDIASHYL--GEVINSDKMQVYKGLDIITNKMAESDRRGVPHHLIGEV  58

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             E      +F+A DF  A    I  IV +G+VP IVGGSNS++ AL+    NP ++     
Sbjct  59    EPD---VDFTAEDFCMAATSAIERIVEQGRVPIIVGGSNSFVEALVQ---NPSVE-----  107

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                       + RY  CF+W++V+PP+L+ YL KRVD+M+  G++EE+   +S   N   
Sbjct  108   ---------FKSRYEPCFIWLNVAPPILDTYLSKRVDDMVRGGLVEEVKAVFS--PNLDY  156

Query  516   RTGLAKAIGVPEFAAYFRAPR--GGERRERLYAEAVREIKENTRLLAERQLRKIQRLREV  343
             + G+ ++IGVPE  AY RA R  G   RE L  EA+ +IK NT  LA +Q+ KI+ LR  
Sbjct  157   KRGIYRSIGVPEMDAYLRADRMVGYIERETLLKEAIDDIKANTCKLASKQVGKIETLRNK  216

Query  342   GGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFL  205
              GW MH+I+ T  F    G E+++     WE  V +P+  I++ FL
Sbjct  217   LGWNMHQIDTTPVFEKC-GEEADAA----WEMLVKKPTFGIIDSFL  257



>gb|AEQ30076.1| adenylate isopentenyltransferase [Orobanche ramosa]
Length=294

 Score =   226 bits (576),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 132/286 (46%), Positives = 175/286 (61%), Gaps = 38/286 (13%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR S+DLATR+  AAEVINSDK+QVY+GLDITTNKIT  ER  V HHL+G  
Sbjct  21    MGATGTGKSRLSIDLATRF--AAEVINSDKMQVYRGLDITTNKITEAERCNVPHHLLGII  78

Query  876   EASESRPE--FSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFD  703
             +     PE  FSA +FR      I  I+ R K+P IVGGSNS++ AL+   F        
Sbjct  79    D-----PEIDFSALNFRDMALISIRSILDRNKLPIIVGGSNSFLEALMDTNFTSN-----  128

Query  702   DECNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNP  523
                            Y+CCFLWVDV   +L+ ++  RVD+M++ GM+ E+  +Y  P+  
Sbjct  129   ---------------YQCCFLWVDVEMSILHSFVSDRVDKMIEQGMVNEVRNFYR-PNGD  172

Query  522   LSRTGLAKAIGVPEFAAYFRAPRGGERRERLYAEAVREIKENTRLLAERQLRKIQRLREV  343
              S+ G+ ++IGVPEF  +FR     +  ER+  EAV  IK NT  LA+RQL KI+RL+++
Sbjct  173   YSK-GIHRSIGVPEFDKFFRTESFRD-EERMLTEAVDLIKTNTNRLAQRQLEKIRRLKDM  230

Query  342   GGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFL  205
              GW MH ++AT  F    G E++    + W+N V  P  KIV KFL
Sbjct  231   -GWRMHHLDATDVFRKH-GIEAD----KAWDNTVAGPGAKIVSKFL  270



>ref|XP_011082638.1| PREDICTED: adenylate isopentenyltransferase 3, chloroplastic-like 
[Sesamum indicum]
Length=317

 Score =   227 bits (578),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 129/286 (45%), Positives = 179/286 (63%), Gaps = 34/286 (12%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             +GATG+GKSR S+DLATR+  AAEVINSDK+QVY+GLD+ TNKIT  ER GV HHL+G  
Sbjct  38    LGATGTGKSRLSIDLATRF--AAEVINSDKMQVYQGLDVATNKITDEERCGVPHHLLGIV  95

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             +      +FSA+DFRA  +  +  I+ R  +P +VGGSNS++ AL+ + F          
Sbjct  96    DPES---DFSASDFRAMASVSLKSILRRRHLPVVVGGSNSFVEALVDKSFRS--------  144

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                         RY CCFLWVDV+ PVL+ ++  RVD M++ GM++E+  ++  P+   S
Sbjct  145   ------------RYDCCFLWVDVARPVLDSFVSDRVDRMVERGMVKEVRDFFK-PNADYS  191

Query  516   RTGLAKAIGVPEFAAYFRAPR--GGERRERLYAEAVREIKENTRLLAERQLRKIQRLREV  343
             + G+ +AIGVPEF  +FRA      E + R +A+A+ +IK NT  LA RQL KI RLR  
Sbjct  192   K-GIRRAIGVPEFDMFFRAESFCDEETQARNFADAIDKIKTNTSRLARRQLEKIHRLRNT  250

Query  342   GGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFL  205
              GW MHR++AT  F    G   E++ A  WE+ V  P + +V +F+
Sbjct  251   KGWMMHRLDATDVFRKRGG---EADAA--WEDLVAGPGIAVVRRFI  291



>ref|XP_007050663.1| Isopentenyltransferase 3, putative [Theobroma cacao]
 gb|EOX94820.1| Isopentenyltransferase 3, putative [Theobroma cacao]
Length=322

 Score =   227 bits (578),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 128/286 (45%), Positives = 177/286 (62%), Gaps = 31/286 (11%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             +GATG+GKSR S+DLATR+   AE+INSDKIQ ++GLDI TNKIT  ER G+ HHL+G  
Sbjct  42    LGATGTGKSRLSIDLATRF--PAEIINSDKIQAHEGLDIATNKITEEERCGIPHHLLGVI  99

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
               +    +F+A +F       +  I+ R ++P I GGSNSYI AL+           DD+
Sbjct  100   NPN---TDFTATNFVDMATHAMDSILFRSQLPIIAGGSNSYIEALV-----------DDK  145

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                    +    +Y CCFLWVDV+ PVL+ Y+ +RVD+M+++GM++E+ +++   SN   
Sbjct  146   ------DYRFRSKYECCFLWVDVAMPVLHHYVSERVDKMVENGMVDEVRKYFD--SNANY  197

Query  516   RTGLAKAIGVPEFAAYFRAP--RGGERRERLYAEAVREIKENTRLLAERQLRKIQRLREV  343
               G+ KAIGVPEF  YFRA      + R +L  EA++EIK NT  LA RQL KI RLR  
Sbjct  198   TRGIRKAIGVPEFDRYFRAEPFLDKQSRAKLLQEAIQEIKRNTCKLASRQLEKIHRLRNK  257

Query  342   GGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFL  205
               W++HR++AT  F    G E++    E WE  V  PS ++V +FL
Sbjct  258   KNWKIHRLDATGVFLRR-GKEAD----EAWEEFVAGPSTEMVAEFL  298



>ref|XP_006355868.1| PREDICTED: adenylate isopentenyltransferase 3, chloroplastic-like 
[Solanum tuberosum]
Length=323

 Score =   227 bits (578),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 128/290 (44%), Positives = 175/290 (60%), Gaps = 27/290 (9%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MG TG+GKS+ S+DLAT++    E+INSDKIQVYKGL+I TNKIT  ER GV HH +G  
Sbjct  35    MGVTGAGKSKLSIDLATQF--NGEIINSDKIQVYKGLEIATNKITEEERCGVPHHCLGVI  92

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             +  +   EF+  +F    +  ++ I  RGK+P IVGGSNS+I A +              
Sbjct  93    DPYK---EFTTKNFCNMASFTVNSITNRGKLPIIVGGSNSFIEAFVHN------------  137

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                  +S+    RY  CFLWVD S  VLN +LY+RVD+M+D G+++E+ + + +P N   
Sbjct  138   ----NNSYNFSTRYDFCFLWVDASMNVLNSFLYERVDKMVDQGLVDEVRQMF-NPKNTDY  192

Query  516   RTGLAKAIGVPEFAAYFRAPRGG----ERRERLYAEAVREIKENTRLLAERQLRKIQRLR  349
               G+ KAIGVPEF +YFRA        + RER+  EA+ E+K N  +LA +QL KI RL 
Sbjct  193   TKGIRKAIGVPEFDSYFRAELSNSVDRQTRERMLKEAITEVKINNCILASKQLDKINRLI  252

Query  348   EVGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
              V GW++HR++AT  F     +E +      W+N V+  S KIV KFL E
Sbjct  253   NVKGWKIHRLDATEVFKKQRIAEEKEAEEI-WKNIVMGQSRKIVHKFLYE  301



>ref|XP_006285561.1| hypothetical protein CARUB_v10007003mg [Capsella rubella]
 gb|EOA18459.1| hypothetical protein CARUB_v10007003mg [Capsella rubella]
Length=304

 Score =   226 bits (576),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 128/297 (43%), Positives = 180/297 (61%), Gaps = 21/297 (7%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATGSGKS  SVDLA  +   AE+INSDK+Q Y GL ITTN+ T+ ERRGV HHL+GE 
Sbjct  11    MGATGSGKSSLSVDLALHF--DAEIINSDKMQFYDGLKITTNQSTIAERRGVPHHLLGEL  68

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
                    E +AA+FR    + IS+I  R K+P + GGSNSYI+AL  + ++P    F D+
Sbjct  69    HPEAG--EVTAAEFRVMVEKAISEITQRRKLPMLAGGSNSYIHALPADSYDPVNYPFSDD  126

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                   S   +LRY CCF+W+DV  PVL  YL  R+D MM SGM EE++ ++     P  
Sbjct  127   YMG---SICSKLRYDCCFIWIDVDQPVLFEYLSLRLDVMMKSGMFEEIAEFHRSNKAPEE  183

Query  516   RTGLAKAIGVPEFAAYFRAPRGGE--------RRERLYAEAVREIKENTRLLAERQLRKI  361
              +G+ KAIGV EF  Y +  +  +         R+  Y +A+R IKENT  L + Q+RKI
Sbjct  184   PSGIWKAIGVQEFDDYLKVYKLDDIDMKKWDPVRKEAYKKAMRAIKENTFQLTKDQIRKI  243

Query  360   QRLREVGGWEMHRINATAAFAAAMGSESESETA-----EIWENQVVQPSMKIVEKFL  205
              +L    GW++ +++ATA+F  A+ + +++E A      IW  ++++P + IV  FL
Sbjct  244   IKLTN-AGWDIKKVDATASFREAIRAANQAEGAAEMQRNIWNKELLEPCVNIVNIFL  299



>ref|XP_002321061.2| hypothetical protein POPTR_0014s13540g [Populus trichocarpa]
 gb|EEE99376.2| hypothetical protein POPTR_0014s13540g [Populus trichocarpa]
Length=324

 Score =   226 bits (577),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 129/286 (45%), Positives = 176/286 (62%), Gaps = 31/286 (11%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MG TG+GKSR S++LAT++   AE+INSDK+QVYKGLDI TNK+   E+ GV HHL+G  
Sbjct  41    MGPTGTGKSRLSIELATQF--PAEIINSDKMQVYKGLDIVTNKVAEEEKSGVPHHLLG--  96

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
               +    +F+A ++    +  +  I  RG +P IVGGSNSYI AL+           DDE
Sbjct  97    -IANPTVDFTATNYCHTASLAVESISTRGLLPIIVGGSNSYIEALM-----------DDE  144

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                    F L L Y CCFLWVDVS PVL++++ +RV++M+  GM++E+   + DP    S
Sbjct  145   ------DFRLRLNYDCCFLWVDVSMPVLHKFVSRRVEQMVSVGMIDEVRNIF-DPYADYS  197

Query  516   RTGLAKAIGVPEFAAYFRAPR--GGERRERLYAEAVREIKENTRLLAERQLRKIQRLREV  343
              TG+ ++IGVPEF  YFRA      E R RL  EA+ ++K+NT  LA RQ  KI RLR++
Sbjct  198   -TGIRRSIGVPEFDKYFRAEAFLDEENRARLLHEAICDVKKNTCKLACRQWEKINRLRKI  256

Query  342   GGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFL  205
              GW++HR++AT  F      +S  E    WE  V +PS  IV + L
Sbjct  257   KGWDIHRLDATEVF-----QKSGKEAEHAWEMLVARPSTAIVGQLL  297



>ref|XP_011033688.1| PREDICTED: adenylate isopentenyltransferase 3, chloroplastic-like 
[Populus euphratica]
Length=325

 Score =   226 bits (577),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 130/286 (45%), Positives = 176/286 (62%), Gaps = 31/286 (11%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MG TG+GKSR S++LAT++   AE+INSDK+QVYKGLDI TNK+   E+ GV HHL+G  
Sbjct  42    MGPTGTGKSRLSIELATQF--PAEIINSDKMQVYKGLDIVTNKVAEEEKSGVPHHLLG--  97

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
               +    +F+A ++    +  +  I  RG +P IVGGSNSYI AL+           DDE
Sbjct  98    -IANPNVDFTATNYCHTASLAVESISTRGLLPIIVGGSNSYIEALM-----------DDE  145

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                    F L L Y CCFLWVDVS PVL++++ +RV++M+  GM++E +R   DP    S
Sbjct  146   ------DFRLRLNYDCCFLWVDVSMPVLHKFVSRRVEQMVSMGMIDE-ARNIFDPYADYS  198

Query  516   RTGLAKAIGVPEFAAYFRAPR--GGERRERLYAEAVREIKENTRLLAERQLRKIQRLREV  343
              TG+ ++IGVPEF  YFRA      E R RL  EA+ ++K+NT  LA RQ  KI RLR++
Sbjct  199   -TGIRRSIGVPEFDKYFRAEAFLDEENRARLLHEAICDVKKNTCKLACRQWEKINRLRKI  257

Query  342   GGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFL  205
              GW++HR++AT  F      +S  E    WE  V +PS  IV + L
Sbjct  258   KGWDIHRLDATEVF-----QKSGKEAEHAWEMLVARPSTAIVGQLL  298



>ref|NP_001244915.1| adenylate isopentenyltransferase [Solanum lycopersicum]
 gb|AEE39459.1| isopentenyltransferase 1 [Solanum lycopersicum]
 dbj|BAM08997.1| adenylate isopentenyltransferase [Solanum lycopersicum]
Length=323

 Score =   226 bits (577),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 128/290 (44%), Positives = 174/290 (60%), Gaps = 27/290 (9%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MG TG+GKS+ S+DLAT++    E+INSDKIQVYKGLDI TNKIT  ER GV HH +G  
Sbjct  35    MGVTGAGKSKLSIDLATQF--DGEIINSDKIQVYKGLDIATNKITEEERCGVPHHCLGVI  92

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             +  +   EF+  +F    +  ++ I  RGK+P IVGGSNS+I A +              
Sbjct  93    DPYK---EFTTKNFCNMASFTVNSITNRGKLPIIVGGSNSFIEAFVHN------------  137

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                  +S+    RY  CFLWVD S  VLN +LY+RVD+M+D GM++E+ + + +P N   
Sbjct  138   ----SNSYNFSTRYDFCFLWVDASMNVLNSFLYERVDKMVDQGMVDEVRQIF-NPKNMDY  192

Query  516   RTGLAKAIGVPEFAAYFRAPRGG----ERRERLYAEAVREIKENTRLLAERQLRKIQRLR  349
               G+ KAIGVPEF +YFRA        +  ER+  EA+ EIK N  +LA +QL KI+RL 
Sbjct  193   TKGIRKAIGVPEFDSYFRAELSNSVDRQTLERMLEEAITEIKINNCILASKQLEKIKRLI  252

Query  348   EVGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
              V GW++HR++A+  F     +E +       +N V+  S KIV KFL E
Sbjct  253   SVKGWKIHRLDASEVFKKQRIAEEKEAEEIW-KNMVMGQSRKIVHKFLYE  301



>emb|CDX92563.1| BnaA10g16020D [Brassica napus]
Length=334

 Score =   226 bits (577),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 127/287 (44%), Positives = 175/287 (61%), Gaps = 31/287 (11%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR ++DLATR+   AE++NSDKIQVYKGLDI TNK+T  E  GV HHL+G  
Sbjct  43    MGATGTGKSRLAIDLATRF--PAEIVNSDKIQVYKGLDIVTNKVTPEESLGVPHHLLGTV  100

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             E +    +F+A D++      +  IV R +VP I GGSNSYI AL               
Sbjct  101   ENTHE--DFTAEDYQREALRAVKSIVERDRVPIIAGGSNSYIEAL---------------  143

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                V +     LRY+CCFLWVDV  PVLN ++  RVD+M++ G+++E+ R + DPS+   
Sbjct  144   ---VNNCVDFRLRYKCCFLWVDVDRPVLNSFVSDRVDKMVEMGLVDEVRRIF-DPSSSDY  199

Query  516   RTGLAKAIGVPEFAAYFRAPR---GGERRERLYAEAVREIKENTRLLAERQLRKIQRLRE  346
              +G+ +AI VPE   + RA +     E   +L   A+++IKEN  LLA RQ +KI+RL +
Sbjct  200   SSGIRRAIAVPELDEFLRAEKRDYPAEVTGKLLETAIKKIKENNCLLACRQYQKIKRLYK  259

Query  345   VGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFL  205
                W MHR++AT  F    G E++    E WE+ V +PS   V++FL
Sbjct  260   QWKWNMHRVDATEVFLRR-GEEAD----EAWESMVARPSALAVDRFL  301



>dbj|BAG55006.1| adenylate isopentenyltransferase [Ipomoea nil]
Length=332

 Score =   226 bits (577),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 127/284 (45%), Positives = 183/284 (64%), Gaps = 27/284 (10%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR SVDLATR+  +AE++N+DK+QVY+G D+ TNK+T  E  GV HHL+G  
Sbjct  43    MGATGAGKSRLSVDLATRF--SAEIVNADKMQVYQGFDVLTNKVTDEEAGGVPHHLLGII  100

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             +  +   +F+A +F  A +  I  I GRG++P I GGSNS+I AL+           +DE
Sbjct  101   DPEK---DFTAKNFCNAASRCIKSIAGRGRLPMIAGGSNSFIEALV-----------EDE  146

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                  DS  ++ +Y  CF+ VDV+ PVL+ ++ +RVD M++ GM+EE +R   +P++   
Sbjct  147   -----DS-KMKSKYDWCFICVDVALPVLHSFVSERVDRMVEKGMIEE-ARGMFNPASRDY  199

Query  516   RTGLAKAIGVPEFAAYFRAPRGGERRERLYAEAVREIKENTRLLAERQLRKIQRLREVGG  337
               GL +AIG+ E   YFR     E R RL  +A+ ++K+NTR LA RQL KI+RL+ V G
Sbjct  200   SKGLRRAIGMQELDRYFRIESDEEHRARLLEDAINDVKKNTRTLACRQLEKIKRLKHVKG  259

Query  336   WEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFL  205
             W++HR++AT AF    GSE++    + WEN VV P   I+ +FL
Sbjct  260   WKIHRLDATEAFLKRGGSEAD----QAWENLVVAPGTAILNRFL  299



>dbj|BAK64271.1| isopentenyltransferase [Salix japonica]
 dbj|BAM93482.1| isopentenyltransferase, partial [Salix japonica]
Length=250

 Score =   223 bits (569),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 127/278 (46%), Positives = 175/278 (63%), Gaps = 31/278 (11%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR S+DLAT++   AE+INSDK+QVYKGLDI TNK+   E+ G+ HHL+G  
Sbjct  2     MGATGTGKSRLSIDLATQF--PAEIINSDKMQVYKGLDIVTNKVGEEEKSGLPHHLLG--  57

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
               +    +F+AA++    +  +  I  RG +P I GGSNSYI AL+           DDE
Sbjct  58    -IANPNVDFTAANYCQMASSAVESISSRGLLPIIAGGSNSYIEALM-----------DDE  105

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                    F L LRY CCFLW+DVS PVL++++ +RV++M+  GM++E+   + DP    S
Sbjct  106   ------DFRLRLRYDCCFLWIDVSMPVLHKFVSRRVEQMVGMGMIDEVRNLF-DPRADYS  158

Query  516   RTGLAKAIGVPEFAAYFRAPR--GGERRERLYAEAVREIKENTRLLAERQLRKIQRLREV  343
              TG+ ++IGVPEF  +FRA      E R RL  EA+ ++K NT  LA RQ  KI RLR++
Sbjct  159   -TGIRRSIGVPEFDRFFRAEDFLDEENRARLLHEAICDVKRNTCKLACRQWEKINRLRKI  217

Query  342   GGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPS  229
              GW +HR++AT  F ++ G E+E      WE  V +PS
Sbjct  218   KGWNIHRVDATEVFRSS-GKEAE----HAWEKLVARPS  250



>ref|XP_006413406.1| hypothetical protein EUTSA_v10026816mg [Eutrema salsugineum]
 gb|ESQ54859.1| hypothetical protein EUTSA_v10026816mg [Eutrema salsugineum]
Length=312

 Score =   226 bits (575),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 130/302 (43%), Positives = 183/302 (61%), Gaps = 31/302 (10%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATGSGKS  SVDLA  +   AE+INSDK+Q Y GL ITTN+ TM ERRGV HHL+GE 
Sbjct  11    MGATGSGKSALSVDLALHF--KAEIINSDKMQFYDGLKITTNQSTMDERRGVPHHLLGEL  68

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             +  E   E +AA FR   A  I+ I  R K+P + GGSNSYI+ALL + ++       D+
Sbjct  69    DPEEG--EVTAAKFRNMAAHAIAGITHRKKLPILAGGSNSYIHALLAKSYH-------DQ  119

Query  696   CN---SVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSD---  535
              N   S   +   EL Y CCF+W+DV+ PVL  YL  R+++MM +GM EE++ ++     
Sbjct  120   GNYPFSKNGTICSELNYDCCFIWIDVAQPVLFEYLSLRLEKMMKTGMFEEIAEFHRTKKA  179

Query  534   PSNPLSRTGLAKAIGVPEFAAYFRAPRGGERRERL-------YAEAVREIKENTRLLAER  376
             P  P++  G+ KAIGV EF  Y +  +    +E         + +AVR IKENT  L + 
Sbjct  180   PKEPVA-VGIWKAIGVQEFDDYLKTYKWDNDKENWDPVRQEAFKKAVRAIKENTFQLTKD  238

Query  375   QLRKIQRLREVGGWEMHRINATAAFAAAMGSESESETAE-----IWENQVVQPSMKIVEK  211
             Q++KI++LR   GWE+ +++ATA F  A+ +  E +  +     IW  +VV+P + IV++
Sbjct  239   QIKKIRKLR-TAGWEIRKVDATATFREAIRAAKERDRGDEMQRMIWNREVVEPCVGIVKR  297

Query  210   FL  205
              L
Sbjct  298   HL  299



>gb|AFI49626.1| isopentenyl transferases protein [Chrysanthemum x morifolium]
Length=331

 Score =   226 bits (576),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 128/288 (44%), Positives = 179/288 (62%), Gaps = 33/288 (11%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR S+DLATRY   AE+INSDK+QVY+GLDI TNK+T  E  GV HHL+G  
Sbjct  41    MGATGTGKSRLSIDLATRY--PAEIINSDKMQVYEGLDIVTNKMTYEECEGVPHHLLG--  96

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
                +   +F+A +F +  +  +  IVGRGK+P I GGSNS+I AL+           DD+
Sbjct  97    -IVDPEADFTAQNFVSTASLTMKSIVGRGKLPIIAGGSNSFIEALI-----------DDQ  144

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                   ++    RY  CFLWVDV+ P+++R++  RVD M+ +G++EE+   Y +P++  S
Sbjct  145   ------NYEFRSRYDVCFLWVDVAMPLIHRFVSDRVDRMVSAGIVEEVREMY-NPNSDYS  197

Query  516   RTGLAKAIGVPEFAAYFR----APRGGERRERLYAEAVREIKENTRLLAERQLRKIQRLR  349
             + G+ +AIGVPEF AYFR    +    + R++L  EA+ + K NT  LA RQL KI+RL+
Sbjct  198   K-GIRRAIGVPEFDAYFREEYSSSSDEKNRKKLLEEAINQTKINTCKLACRQLEKIRRLQ  256

Query  348   EVGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFL  205
              V GWE+ R++AT  F      +   E  E+W   V  P   IV +FL
Sbjct  257   NVKGWEIRRLDATPVF-----QKQGQEADELWSKSVAGPGSLIVNQFL  299



>dbj|BAB59033.1| cytokinin synthase [Arabidopsis thaliana]
Length=329

 Score =   226 bits (575),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 127/286 (44%), Positives = 171/286 (60%), Gaps = 31/286 (11%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATGSGKSR ++DLATR+    E+INSDKIQ+YKGLD+ TNK+T  E RGV HHL+G F
Sbjct  40    MGATGSGKSRLAIDLATRF--QGEIINSDKIQLYKGLDVLTNKVTPKECRGVPHHLLGVF  97

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             ++       +A  +    ++ IS +    K+P + GGSNSYI AL               
Sbjct  98    DSEAG--NLTATQYSRLASQAISKLSANNKLPIVAGGSNSYIEAL---------------  140

Query  696   CNSVGDSFGLEL-RYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPL  520
                V  S G  L  Y CCF+WVDVS PVLN ++ KRVD MM++G+LEE+   ++  +N  
Sbjct  141   ---VNHSSGFLLNNYDCCFIWVDVSLPVLNSFVSKRVDRMMEAGLLEEVREVFNPKAN--  195

Query  519   SRTGLAKAIGVPEFAAYFRAPRGGER--RERLYAEAVREIKENTRLLAERQLRKIQRLRE  346
                G+ +AIGVPE   Y R     +R  + ++   AV+ IK+NT +LA RQL+KIQRL +
Sbjct  196   YSVGIRRAIGVPELHEYLRNESLVDRATKSKMLDVAVKNIKKNTEILACRQLKKIQRLHK  255

Query  345   VGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKF  208
                  MHR++AT  F       +  E  E WEN V +PS +IV+KF
Sbjct  256   KWKMSMHRVDATEVFL----KRNVEEQDEAWENLVARPSERIVDKF  297



>ref|NP_566735.1| adenylate isopentenyltransferase 7 [Arabidopsis thaliana]
 sp|Q94ID1.2|IPT7_ARATH RecName: Full=Adenylate isopentenyltransferase 7, mitochondrial; 
Short=AtIPT7; AltName: Full=Adenylate dimethylallyltransferase 
7; AltName: Full=Cytokinin synthase 7; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAB02782.1| tRNA isopentenyl transferase-like protein [Arabidopsis thaliana]
 dbj|BAB59046.1| adenylate isopentenyltransferase [Arabidopsis thaliana]
 dbj|BAE99312.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE76788.1| adenylate isopentenyltransferase 7 [Arabidopsis thaliana]
Length=329

 Score =   226 bits (575),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 127/286 (44%), Positives = 171/286 (60%), Gaps = 31/286 (11%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATGSGKSR ++DLATR+    E+INSDKIQ+YKGLD+ TNK+T  E RGV HHL+G F
Sbjct  40    MGATGSGKSRLAIDLATRF--QGEIINSDKIQLYKGLDVLTNKVTPKECRGVPHHLLGVF  97

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             ++       +A  +    ++ IS +    K+P + GGSNSYI AL               
Sbjct  98    DSEAG--NLTATQYSRLASQAISKLSANNKLPIVAGGSNSYIEAL---------------  140

Query  696   CNSVGDSFGLEL-RYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPL  520
                V  S G  L  Y CCF+WVDVS PVLN ++ KRVD MM++G+LEE+   ++  +N  
Sbjct  141   ---VNHSSGFLLNNYDCCFIWVDVSLPVLNSFVSKRVDRMMEAGLLEEVREVFNPKAN--  195

Query  519   SRTGLAKAIGVPEFAAYFRAPRGGER--RERLYAEAVREIKENTRLLAERQLRKIQRLRE  346
                G+ +AIGVPE   Y R     +R  + ++   AV+ IK+NT +LA RQL+KIQRL +
Sbjct  196   YSVGIRRAIGVPELHEYLRNESLVDRATKSKMLDVAVKNIKKNTEILACRQLKKIQRLHK  255

Query  345   VGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKF  208
                  MHR++AT  F       +  E  E WEN V +PS +IV+KF
Sbjct  256   KWKMSMHRVDATEVFL----KRNVEEQDEAWENLVARPSERIVDKF  297



>ref|XP_004136062.1| PREDICTED: adenylate isopentenyltransferase 3, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004158934.1| PREDICTED: adenylate isopentenyltransferase 3, chloroplastic-like 
[Cucumis sativus]
 gb|KGN44872.1| hypothetical protein Csa_7G392940 [Cucumis sativus]
Length=330

 Score =   226 bits (575),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 127/286 (44%), Positives = 174/286 (61%), Gaps = 34/286 (12%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             +G TG+GKSR S+D+ATR+   +EVINSDK+QVY GLDI TNKIT  E+ GV HHL+G  
Sbjct  45    IGPTGTGKSRLSIDIATRF--PSEVINSDKMQVYHGLDIVTNKITKQEQCGVPHHLLGII  102

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
                    +FSA++F       +  I    ++P I GGSNSYI AL+   F          
Sbjct  103   NPFL---DFSASNFSDMAMLSLDAISSHDRLPIIAGGSNSYIEALIDSNF----------  149

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                        LRY CCFLWVDVS  VL  ++ +RVD+M+ +GM++E  +++ DP+   S
Sbjct  150   ----------RLRYECCFLWVDVSMQVLQSFVSERVDKMVANGMVDEAEKFF-DPARDYS  198

Query  516   RTGLAKAIGVPEFAAYFR--APRGGERRERLYAEAVREIKENTRLLAERQLRKIQRLREV  343
             R G+ +AIGVPEF +YFR  +    E +E+L  E++ ++KE+T  LA RQL KIQRLR V
Sbjct  199   R-GIKRAIGVPEFDSYFRYRSLLDEEAQEKLLEESIAKVKEHTCKLALRQLGKIQRLRNV  257

Query  342   GGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFL  205
              GW +HR++AT AF     ++   E  E W   V  PS  I+++FL
Sbjct  258   KGWNIHRLDATEAF-----TKQGKEADEAWNKHVTIPSTTIIDQFL  298



>ref|XP_006850780.1| hypothetical protein AMTR_s00025p00094380 [Amborella trichopoda]
 gb|ERN12361.1| hypothetical protein AMTR_s00025p00094380 [Amborella trichopoda]
Length=332

 Score =   225 bits (574),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 127/300 (42%), Positives = 178/300 (59%), Gaps = 30/300 (10%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR S+DLA R+   AE+IN+DK+Q+Y+GLDI TNK+ + ERRGV HHL+G  
Sbjct  49    MGATGTGKSRLSIDLAARF--PAEIINADKMQLYQGLDIVTNKVPVEERRGVPHHLLGTL  106

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             +  +S  +F   DFR   ++ +  I  RG +P + GGSNSYI AL+              
Sbjct  107   D-PKSHQDFDCNDFRDLASQAVLSISSRGHLPIVAGGSNSYIDALV--------------  151

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                 G + G ++RY CCFLWVD + PVL++++  RV++M+++G++ ++   +      + 
Sbjct  152   ---SGPAPG-QMRYECCFLWVDAALPVLHQFVSDRVEDMVEAGLVADVRALFDTSGGRVD  207

Query  516   RT-GLAKAIGVPEFAAYFRAPRGG----ERRERLYAEAVREIKENTRLLAERQLRKIQRL  352
              + GL KAIGVPE     ++ R        R  L  EA+ EIK NT  LA  QL+KIQRL
Sbjct  208   FSRGLGKAIGVPEMDRLIKSERQASLSLHERAALIREAMEEIKANTCKLACCQLQKIQRL  267

Query  351   REVGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE*VFQLFPAL  172
             R + GWE+HR++ATA   AA          E WE  VVQPS ++V +FL        PAL
Sbjct  268   RSLRGWELHRLDATAVLDAA----DRPSADEAWERLVVQPSARVVRRFLTATAVAPMPAL  323



>ref|XP_010051135.1| PREDICTED: adenylate isopentenyltransferase-like [Eucalyptus 
grandis]
 gb|KCW81310.1| hypothetical protein EUGRSUZ_C02681 [Eucalyptus grandis]
Length=310

 Score =   224 bits (572),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 135/307 (44%), Positives = 181/307 (59%), Gaps = 38/307 (12%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG GKSR S+DLA+ +    EVIN+DK+QVY GLDITTNKI   ER GV HHL+  F
Sbjct  20    MGATGCGKSRLSIDLASHF--PFEVINADKMQVYWGLDITTNKIPPAERHGVPHHLLSSF  77

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             + ++   E + + F   G   IS +  RGK+P +VGGSNS+I+ALL +RF+PE +     
Sbjct  78    DPNDG--EMTPSQFSFHGDAAISGVASRGKLPLLVGGSNSFIHALLADRFDPEAEA----  131

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYS-DPSNPL  520
                       ELRY CC LWV VSPPVL + L KRV+ M+  G  +EL+ +Y    ++P 
Sbjct  132   --------SPELRYDCCILWVHVSPPVLKKGLPKRVNGMLRMGAFDELAGYYHLRQTDPG  183

Query  519   SRTGLAKAIGVPEFAAYF----------------RAPRGGERRERLYAEAVREIKENTRL  388
             +R GL KAIGV EF  YF                R  +    RE  Y EA+REI +N   
Sbjct  184   ARAGLRKAIGVLEFDRYFEKYPPLRGDAWGQEDARERQNDPVREGAYQEALREIMKNADH  243

Query  387   LAERQLRKIQRLREVGGWEMHRINATAAFAAAMGSESE----SETAEIWENQVVQPSMKI  220
             L + Q+ KI++L +  GW +HR++AT A   AM  + E      + E+WE +VV  S++I
Sbjct  244   LIKGQVEKIRQLSK-SGWVLHRLDATQAVRLAMAPKEEGGGDDRSREVWEREVVGRSVEI  302

Query  219   VEKFLLE  199
             V +FL E
Sbjct  303   VNQFLRE  309



>ref|XP_006293019.1| hypothetical protein CARUB_v10019297mg [Capsella rubella]
 gb|EOA25917.1| hypothetical protein CARUB_v10019297mg [Capsella rubella]
Length=339

 Score =   225 bits (574),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 133/289 (46%), Positives = 179/289 (62%), Gaps = 28/289 (10%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR S+DLATR F AAE+INSDKIQV++GLDI TNKIT  E  GV HHL+G  
Sbjct  48    MGATGTGKSRLSIDLATR-FRAAEIINSDKIQVHQGLDIVTNKITSEESCGVPHHLLGVL  106

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
                    + +AA++R      I  I+ RGK+P IVGGSNSY+ AL+           DDE
Sbjct  107   PPEA---DLTAANYRHMANVSIESILNRGKLPIIVGGSNSYVEALV-----------DDE  152

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
              N          RY CCFLWVDV+ PVL+ ++ +RVD+M+++GM+EE+   +    +  S
Sbjct  153   ENK------FRSRYDCCFLWVDVALPVLHGFVSERVDKMVENGMVEEVREIFDYSDSNYS  206

Query  516   RTGLAKAIGVPEFAAYFRAPR---GGERRERLYAEAVREIKENTRLLAERQLRKIQRLRE  346
             R G+ KAIGVPEF  +FR  R    G+R E L  + V EIK NT  LA +Q  KI+RLR+
Sbjct  207   R-GIKKAIGVPEFDKFFRNERFLNAGDRGE-LLRKVVEEIKRNTFGLACKQREKIERLRK  264

Query  345   VGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
             V  W + +++AT  F     S+++++ A  WE  V  P    V +F+L+
Sbjct  265   VKKWCIQKLDATPVFTKQRRSKTDADVA--WERLVAGPGTIAVSRFMLD  311



>ref|XP_006419806.1| hypothetical protein CICLE_v10005414mg [Citrus clementina]
 ref|XP_006489293.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Citrus sinensis]
 gb|ESR33046.1| hypothetical protein CICLE_v10005414mg [Citrus clementina]
Length=327

 Score =   225 bits (573),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 131/290 (45%), Positives = 179/290 (62%), Gaps = 35/290 (12%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR ++DLATR+   AE+INSDK+QVYKGLDI TNK+T  E  GV HHL+G  
Sbjct  38    MGATGTGKSRLAIDLATRF--PAEIINSDKMQVYKGLDIVTNKVTEEECHGVPHHLLGII  95

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             E + +   F+A DFR   +  I  I+ R ++P I GGS+SYI AL+              
Sbjct  96    EPNAN---FTATDFRNHASLAIESILSRDRLPIIAGGSSSYIKALV--------------  138

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                 GD+   +LRY C FLWVDVS PVL+ ++ +RVD M++ G++EE+ + + DP    S
Sbjct  139   ---NGDAAEFQLRYECFFLWVDVSLPVLHSFVSERVDRMVELGLVEEVKQMF-DPQADYS  194

Query  516   RTGLAKAIGVPEFAAYFRAPRGGERRERLYAE----AVREIKENTRLLAERQLRKIQRLR  349
             R G+ +AIGVPE   Y RA  G     +++A+    A+ +IKENT  L+ RQL+KI RL 
Sbjct  195   R-GVRRAIGVPELDQYIRA--GSLLDHKIHAKLLEAAINKIKENTCNLSCRQLQKIHRLN  251

Query  348   EVGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
             ++  W MHRI+AT  F    G E++    E WE  V+ PS   V +FL +
Sbjct  252   DIWNWNMHRIDATEVFLKR-GEEAD----EAWEKLVMLPSTMTVRQFLYD  296



>gb|KDO74822.1| hypothetical protein CISIN_1g020362mg [Citrus sinensis]
Length=327

 Score =   224 bits (572),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 131/288 (45%), Positives = 177/288 (61%), Gaps = 31/288 (11%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR ++DLATR+   AE+INSDK+QVYKGLDI TNK+T  E  GV HHL+G  
Sbjct  38    MGATGTGKSRLAIDLATRF--PAEIINSDKMQVYKGLDIVTNKVTEEECHGVPHHLLGII  95

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             E + +   F+A DFR   +  I  I+ R ++P I GGS+SYI AL+              
Sbjct  96    EPNAN---FTATDFRNHASLAIESILSRDRLPIIAGGSSSYIKALV--------------  138

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                 GD+   +LRY C FLWVDVS PVL+ ++ +RVD M++ G++EE+ + + DP    S
Sbjct  139   ---NGDAAEFQLRYECFFLWVDVSLPVLHSFVSERVDRMVELGLVEEVKQMF-DPQADYS  194

Query  516   RTGLAKAIGVPEFAAYFRAPR--GGERRERLYAEAVREIKENTRLLAERQLRKIQRLREV  343
             R G+ +AIGVPE   Y RA      + R +L   A+ +IKENT  L+ RQL+KI RL +V
Sbjct  195   R-GIRRAIGVPELDQYIRAGSLLDHKIRAKLLEAAINKIKENTCNLSCRQLQKIHRLNDV  253

Query  342   GGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
               W +HRI+AT  F    G E++    E WE  V+ PS   V +FL +
Sbjct  254   WNWNIHRIDATEVFLKR-GEEAD----EAWEKLVMLPSTMTVRQFLYD  296



>ref|XP_002883441.1| cytokinin synthase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59700.1| cytokinin synthase [Arabidopsis lyrata subsp. lyrata]
Length=328

 Score =   224 bits (572),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 126/286 (44%), Positives = 171/286 (60%), Gaps = 31/286 (11%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATGSGKSR ++DLATR+    E+INSDKIQ+YKGLD+ TNK+T  E RGV HHL+G F
Sbjct  40    MGATGSGKSRLAIDLATRF--QGEIINSDKIQLYKGLDVLTNKVTPKECRGVPHHLLGVF  97

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             ++       +A ++    ++ IS +    K+P + GGSNSYI AL               
Sbjct  98    DSEAG--NITATEYSRLASQEISKLSANNKLPIVAGGSNSYIEAL---------------  140

Query  696   CNSVGDSFGLEL-RYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPL  520
                   S G  L  Y CCF+WVDVS PVLN ++ KRVD MM++G+LEE+   ++  +N  
Sbjct  141   ---ANHSSGFLLNNYDCCFIWVDVSLPVLNSFVSKRVDRMMEAGLLEEVREMFNPKAN--  195

Query  519   SRTGLAKAIGVPEFAAYFRAPRGGER--RERLYAEAVREIKENTRLLAERQLRKIQRLRE  346
                G+ +AIGVPE   Y R     +R  + ++   AV+ IK+NT +LA RQL+KIQRL +
Sbjct  196   YSVGIRRAIGVPELHEYLRNESLVDRATQSKMLDVAVKNIKKNTEILACRQLKKIQRLHK  255

Query  345   VGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKF  208
                  MHR++AT  F       +  E  E WEN V +PS +IV+KF
Sbjct  256   KWKLSMHRVDATEVFL----KRNVEEQDEAWENLVARPSERIVDKF  297



>ref|XP_004148309.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004163632.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Cucumis sativus]
 gb|KGN44317.1| hypothetical protein Csa_7G253720 [Cucumis sativus]
Length=339

 Score =   225 bits (573),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 129/289 (45%), Positives = 177/289 (61%), Gaps = 31/289 (11%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MG+T +GKS+ SVDLAT  F  +E+INSDKIQ YKGLDI TNKI   +RRGV HHL+G  
Sbjct  20    MGSTATGKSKLSVDLAT--FFPSEIINSDKIQFYKGLDIITNKINQSDRRGVPHHLLGVI  77

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
                ++  + +A +F +   + I+D++ RG +P +VGGSN+YI AL+    NP  D     
Sbjct  78    HDPDA--DLTAGEFCSLVEDAIADVISRGCLPIVVGGSNNYIEALVE---NPITD-----  127

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                         R+ CCFLW DV+ PVL +Y+ KRVD+M++ G++EE+   +  P    S
Sbjct  128   ---------FRSRFDCCFLWTDVALPVLYKYIAKRVDQMVELGLVEEVREMFV-PGADYS  177

Query  516   RTGLAKAIGVPEFAAYFRAPRGGER---RERLYAEAVREIKENTRLLAERQLRKIQRLRE  346
             R G+ +AIG PE  +YF+A +  E    +  L    + EIKENT  LA RQ  KI RLR+
Sbjct  178   R-GIRRAIGAPELDSYFKAEKNNEEETYKNDLLKSGIHEIKENTCRLALRQFGKIHRLRD  236

Query  345   VGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
               GW +HRI+ATA F      +S  E A+ W N V++PS+ IV +FL E
Sbjct  237   EIGWGLHRIDATAVF-----EKSGEEAADEWMNGVLKPSLGIVGEFLNE  280



>ref|XP_008447303.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Cucumis melo]
Length=339

 Score =   224 bits (571),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 129/289 (45%), Positives = 175/289 (61%), Gaps = 31/289 (11%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             +G+T +GKS+ SVDLAT  F  +E+INSDKIQ YKGLDI TNKI   +RRGV HHL+G  
Sbjct  20    LGSTATGKSKLSVDLAT--FFPSEIINSDKIQFYKGLDIITNKINQSDRRGVPHHLLGVI  77

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
                E   + +A +F     + I+D++ RG +P +VGGSN+YI AL+    NP  D     
Sbjct  78    H--EPDADLTAGEFCRLVEDSIADVISRGCLPIVVGGSNNYIEALVE---NPITD-----  127

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                         R+ CCFLW DV+ PVL +Y+ KRVD+M++ G++EE+   +  P    S
Sbjct  128   ---------FRSRFDCCFLWTDVALPVLYKYIGKRVDQMVELGLVEEVGEMFV-PGADYS  177

Query  516   RTGLAKAIGVPEFAAYFRAPRGGER---RERLYAEAVREIKENTRLLAERQLRKIQRLRE  346
             R G+ +AIG PE  +YF+A +  E    ++ L   A+ EIKENT  LA RQ  KI RLR+
Sbjct  178   R-GIRRAIGAPELESYFKAEKNNEEETYKKELLKSAIHEIKENTCKLALRQFGKIHRLRD  236

Query  345   VGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
               GW +HRI+ TA F      +S  E A+ W N V++PS+ IV  FL E
Sbjct  237   ELGWGLHRIDVTAVF-----EKSGEEAADEWMNAVLKPSLGIVGDFLNE  280



>emb|CDY67797.1| BnaCnng56440D [Brassica napus]
Length=332

 Score =   224 bits (570),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 133/289 (46%), Positives = 178/289 (62%), Gaps = 30/289 (10%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR SVDLATR+   AE+INSDKIQV++GLDI TNKIT  ER GV HHL+   
Sbjct  47    MGATGTGKSRLSVDLATRF--QAEIINSDKIQVHQGLDIVTNKITTEERCGVPHHLLSVL  104

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
                  + + +AA+F       +  ++ RGK+P IVGGSNSY+ AL+           DD 
Sbjct  105   PP---QADLTAANFCHMANLSVESVLNRGKLPIIVGGSNSYVEALV-----------DD-  149

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                  D +    +Y CCFLWVDV+ PVLNR++ +RVD+M+ +GM+EE +R + D SN   
Sbjct  150   -----DDYKFRSKYDCCFLWVDVALPVLNRFVSERVDKMVQNGMVEE-ARNFFDYSNSDY  203

Query  516   RTGLAKAIGVPEFAAYFRAP---RGGERRERLYAEAVREIKENTRLLAERQLRKIQRLRE  346
               G+ KAIGVPEF  +FR       G+ RE L  + V EIK NT  LA RQ  KI+RLR+
Sbjct  204   SRGIKKAIGVPEFDIFFRNEPFLSVGD-REALLNKVVDEIKSNTFKLACRQREKIERLRK  262

Query  345   VGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
             +  W + R +AT        S+ +++ A  WE  V +PS + V +FLL+
Sbjct  263   IKKWCIQRFDATPVITRR-RSKVDADVA--WERLVARPSTEAVSRFLLD  308



>ref|XP_008451382.1| PREDICTED: adenylate isopentenyltransferase 3, chloroplastic 
[Cucumis melo]
Length=330

 Score =   223 bits (569),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 126/286 (44%), Positives = 175/286 (61%), Gaps = 34/286 (12%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             +GATG+GKSR S+D+AT++   +EVINSDK+QVY GLDI TNKIT  E+ GV HHL+G  
Sbjct  45    IGATGTGKSRLSIDIATQF--PSEVINSDKMQVYHGLDIVTNKITKQEQCGVPHHLLGII  102

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
                    +FSA++F       +  I    ++P I GGSNSYI AL+   F          
Sbjct  103   NPFL---DFSASNFSDMAMLSLDAISSHDRLPIIAGGSNSYIEALIDSNF----------  149

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                        L+Y CCFLWVDVS  VL  ++ +RVD+M+ +GM++E  +++ DP+   S
Sbjct  150   ----------RLKYECCFLWVDVSMQVLQSFVSERVDKMVANGMVDEAEKFF-DPARDYS  198

Query  516   RTGLAKAIGVPEFAAYFRAPR--GGERRERLYAEAVREIKENTRLLAERQLRKIQRLREV  343
             R G+ +AIGVPEF +YFR       E +E+L  E++ ++KE+T  LA +QL KIQRLR +
Sbjct  199   R-GIKRAIGVPEFDSYFRCRSLLDEEAQEKLLEESIAKVKEHTCKLALKQLGKIQRLRNI  257

Query  342   GGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFL  205
              GW +HR++AT AF    G E+E    E W   V  PS  I+++FL
Sbjct  258   KGWNIHRLDATEAF-TKQGKEAE----EAWNKLVTIPSTTIIDQFL  298



>gb|KCW49921.1| hypothetical protein EUGRSUZ_K03385, partial [Eucalyptus grandis]
Length=352

 Score =   224 bits (570),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 125/286 (44%), Positives = 169/286 (59%), Gaps = 30/286 (10%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             +G TG+GKSR S+D+A+ +   AE++NSDKIQV+KGLDI TNKIT  E+RG+ HHL+G  
Sbjct  71    LGVTGAGKSRLSIDIASHF--PAEIVNSDKIQVHKGLDIVTNKITEEEQRGIPHHLLGTI  128

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
                    +F+A++F  +    I  I  RG  P IVGGSNSYI  L+              
Sbjct  129   PPD---ADFTASEFSNSALLAIESIRARGNTPVIVGGSNSYIETLIASH-----------  174

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                    +  +  Y CCFLWVD + P+L+ +L KRVD+M++ GM+EE +R   DP+   S
Sbjct  175   ------DYRFQSNYECCFLWVDAAMPILHSFLSKRVDKMVERGMVEE-ARNAFDPNGQYS  227

Query  516   RTGLAKAIGVPEFAAYFRAPRGGERR--ERLYAEAVREIKENTRLLAERQLRKIQRLREV  343
             R G+ +AIG+PE    FR  +  +R+   RL  EA+ EIK NT  LA RQL KI RLR  
Sbjct  228   R-GIRRAIGLPELDLLFRTEKFLDRQAHARLLKEAMEEIKTNTCKLASRQLEKIHRLRNQ  286

Query  342   GGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFL  205
              GW +HR++AT  F        +++  E WE  V  PS KIV +FL
Sbjct  287   KGWNLHRMDATEVFC----KHGKADADEAWEELVAGPSTKIVAEFL  328



>ref|XP_002878496.1| ATIPT3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54755.1| ATIPT3 [Arabidopsis lyrata subsp. lyrata]
Length=336

 Score =   223 bits (568),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 131/288 (45%), Positives = 178/288 (62%), Gaps = 28/288 (10%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR SVD+ATR+   AE+INSDKIQV++GLDI TNKIT  E  GV HHL+G  
Sbjct  47    MGATGTGKSRLSVDIATRF--RAEIINSDKIQVHQGLDIVTNKITSEESCGVPHHLLGVL  104

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
                    + +A ++       I  ++ RGK+P IVGGSNSY+ AL+           DDE
Sbjct  105   PPEA---DLTAPNYCHMANLSIESVLNRGKLPIIVGGSNSYVEALV-----------DDE  150

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
              N          RY CCFLWVDV+ PVL+ ++ +RVD+M+++GM+EE+  ++    +  S
Sbjct  151   DNK------FRSRYDCCFLWVDVALPVLHGFVSERVDKMVENGMVEEVRDFFDFSDSDYS  204

Query  516   RTGLAKAIGVPEFAAYFRAPR--GGERRERLYAEAVREIKENTRLLAERQLRKIQRLREV  343
             R G+ KAIGVPEF  +FR  +    E RE L  + V +IK NT  LA RQ  KI+RLR+V
Sbjct  205   R-GIKKAIGVPEFDRFFRNEQFLNVEDREELLIKVVEDIKRNTFELACRQREKIERLRKV  263

Query  342   GGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
               W + R++AT  F     S+++++ A  WE  V  PS  IV +FLL+
Sbjct  264   KKWSIQRVDATPVFTKRR-SKTDADVA--WERLVAGPSTDIVSRFLLD  308



>ref|XP_011009688.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Populus euphratica]
 ref|XP_011009689.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Populus euphratica]
Length=327

 Score =   223 bits (568),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 123/288 (43%), Positives = 170/288 (59%), Gaps = 30/288 (10%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             +G TG+GKSR ++DLATR+   AEV+N DK+QVYKGLDI TNK+T  E RGV HHL+G  
Sbjct  39    VGPTGTGKSRLAIDLATRF--PAEVVNCDKMQVYKGLDIVTNKVTEKECRGVPHHLLG--  94

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
               ++ +  F++ DFR   +  +  IV R ++P I GGSNSYI AL  +  +PE  V    
Sbjct  95    -IADPKANFTSDDFRHHASFVVESIVTRDRLPIIAGGSNSYIEALAND--DPEFRV----  147

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                         RY CCFLWVDVS P+L  ++ +RVD M+++G+++E+   +        
Sbjct  148   ------------RYECCFLWVDVSLPILYSFVSERVDRMVEAGLIDEVRDMFDPNKFDDY  195

Query  516   RTGLAKAIGVPEFAAYFR--APRGGERRERLYAEAVREIKENTRLLAERQLRKIQRLREV  343
               G+ +AIGVPE   + R  A    + R +L  EA+ +IKENT +LA RQL+KI RL  +
Sbjct  196   SQGIKRAIGVPELDHFLRNEAIVDAKTRRKLLDEAIDKIKENTCMLASRQLQKIHRLHSI  255

Query  342   GGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
               W MHRI+AT  F       S  E   +W+  V  PS  IV +FL +
Sbjct  256   WNWNMHRIDATPVFLT-----SGKEVDNLWDKLVAGPSTMIVNQFLCD  298



>ref|XP_010548779.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic 
[Tarenaya hassleriana]
Length=335

 Score =   223 bits (568),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 133/289 (46%), Positives = 175/289 (61%), Gaps = 35/289 (12%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR +VDLA R+   AE++NSDKIQVY+GL + TNK+T  E RGV HHL+G  
Sbjct  43    MGATGTGKSRLAVDLAARF--PAEIVNSDKIQVYEGLGVVTNKVTPEESRGVPHHLLGTV  100

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             + +    +F+AADF       +  IV R +VP I GGSNSYI AL+              
Sbjct  101   DPN---TDFTAADFAREATRAVESIVERDRVPIIAGGSNSYIEALV--------------  143

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
              N   D     LRY+CCFLWVDVS PVL+ ++ +RVD+M++ G+++E+ R + DPS   S
Sbjct  144   -NGCAD---FRLRYQCCFLWVDVSKPVLHSFVSERVDKMVEMGLVDEVHRIF-DPSADYS  198

Query  516   RTGLAKAIGVPEFAAYFR-----APRGGERRERLYAEAVREIKENTRLLAERQLRKIQRL  352
               G+ +AIGV E   + R     +    E R RL   A+  IKENT  LA RQL+KIQRL
Sbjct  199   -VGIRRAIGVSELDEFLRSEFDESSGDEENRARLLQTAIETIKENTCSLACRQLQKIQRL  257

Query  351   REVGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFL  205
              +   W MHRI+AT  F    G +++    E WE  V +PS  IVE+FL
Sbjct  258   YKQWKWNMHRIDATEVF-LRRGEKAD----EAWETVVARPSSIIVEQFL  301



>ref|XP_002312745.1| hypothetical protein POPTR_0008s20650g [Populus trichocarpa]
 gb|EEE90112.1| hypothetical protein POPTR_0008s20650g [Populus trichocarpa]
Length=327

 Score =   223 bits (567),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 121/288 (42%), Positives = 171/288 (59%), Gaps = 30/288 (10%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             +G TG+GKSR ++DLAT +   AEV+N DK+QVYKGLDI TNK+T  E RGV HHL+G  
Sbjct  39    LGPTGTGKSRLAIDLATHF--PAEVVNCDKMQVYKGLDIVTNKVTEEECRGVPHHLLG--  94

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
               ++   +F++ DFR   +  +  IV R ++P I GGSNSY+ AL               
Sbjct  95    -IADPNADFTSDDFRHHASLVVESIVTRDRLPIIAGGSNSYVEAL---------------  138

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                  D     LRY CCFLWVDVS P+L+ ++  RVD M+ +G+++E+   +        
Sbjct  139   ---ANDDPEFRLRYECCFLWVDVSLPLLHSFVSDRVDRMVRAGLIDEVRDVFDPTKFDDY  195

Query  516   RTGLAKAIGVPEFAAYFRAPR--GGERRERLYAEAVREIKENTRLLAERQLRKIQRLREV  343
               G+ +AIGVPE   + R       + R +L  EA+ +IKENT +LA RQL+KI+RL  +
Sbjct  196   SQGIKRAIGVPELDQFLRNETIVDAKTRRKLLDEAIEKIKENTCMLARRQLQKIRRLHSI  255

Query  342   GGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
               W+MHRI+AT  F A+ G E+++    +W+  V  PS  IV +FL E
Sbjct  256   WNWKMHRIDATPVFLAS-GKEADN----LWDQIVAGPSTMIVNQFLCE  298



>gb|KFK35473.1| hypothetical protein AALP_AA5G288800 [Arabis alpina]
Length=339

 Score =   223 bits (567),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 132/288 (46%), Positives = 174/288 (60%), Gaps = 28/288 (10%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR SVDLATR+   AE+INSDKIQV++GLDI TNKIT  E  GV HHL+G  
Sbjct  47    MGATGTGKSRLSVDLATRF--PAEIINSDKIQVHQGLDIVTNKITTEESCGVPHHLLGVL  104

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
                    + +A++FR      +  I+ RGK+P IVGGSNSY+ AL+           DDE
Sbjct  105   PPEA---DLTASNFRHMANSSVESILSRGKLPIIVGGSNSYVEALV-----------DDE  150

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                    +    RY CCFLWVDV+ PVL+ ++ +RVD+M+D+GM++E+   +    +  S
Sbjct  151   ------DYKFRSRYDCCFLWVDVALPVLHGFVNERVDKMVDNGMVDEVREVFDFSDSDYS  204

Query  516   RTGLAKAIGVPEFAAYFRA-PRGGER-RERLYAEAVREIKENTRLLAERQLRKIQRLREV  343
             R G+ KAIGVPEF  +FR  P    R RE L ++ V EIK NT  LA +Q  KI+RLR+V
Sbjct  205   R-GIKKAIGVPEFDMFFRHEPFLNMRGREELLSKVVEEIKRNTFGLACKQREKIERLRKV  263

Query  342   GGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
               W + R++AT  F       S+      WE  V  PS   V +FLL+
Sbjct  264   KKWCIQRLDATPVFTR---RRSKVNADVAWERLVAGPSTDAVSRFLLD  308



>ref|XP_003590677.1| Adenylate isopentenyltransferase [Medicago truncatula]
 gb|AES60928.1| adenylate isopentenyltransferase [Medicago truncatula]
Length=327

 Score =   222 bits (566),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 130/286 (45%), Positives = 177/286 (62%), Gaps = 31/286 (11%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKS+ S+DLA  YF  +E+INSDKIQ+Y+GLDI TNKIT+ E++G+ HHL+G  
Sbjct  40    MGATGTGKSKLSIDLAN-YF-PSEIINSDKIQIYEGLDIVTNKITLEEQKGIPHHLLGTH  97

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
               +    EF++ DFR      I  I+  G +P IVGGSNSY+ AL+           DD 
Sbjct  98    NPN---IEFTSNDFREKSTSAIDLIMSGGNLPIIVGGSNSYLEALV-----------DD-  142

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                  D +    RY  C LWVDVS P+L  Y+ +RVD+M++SGM+ EL  +Y +P+   S
Sbjct  143   -----DDYNFRSRYNFCCLWVDVSMPILRSYIDQRVDQMLNSGMVNELRPFY-NPNGDYS  196

Query  516   RTGLAKAIGVPEFAAYFR--APRGGERRERLYAEAVREIKENTRLLAERQLRKIQRLREV  343
             + G+ KAIGVPEF  YFR  +    E R+ L  +AV E+K NT  LA++QL KI  L+ V
Sbjct  197   K-GIRKAIGVPEFDEYFRRESYVDDETRKMLLDKAVSEMKINTWKLAKKQLGKIDWLKNV  255

Query  342   GGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFL  205
               W +HR++AT  F    G E++    E W+  V +PS  IV +FL
Sbjct  256   KRWNIHRLDATPVFKKH-GKEAD----ETWKKIVAEPSAMIVAQFL  296



>ref|XP_011071664.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Sesamum indicum]
Length=327

 Score =   222 bits (565),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 126/288 (44%), Positives = 170/288 (59%), Gaps = 31/288 (11%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             +GATG+GKSR ++DLATR+   AEVINSDKIQVYKGLDI TNK++  E RGV HHL+G  
Sbjct  35    LGATGTGKSRLAIDLATRF--GAEVINSDKIQVYKGLDIVTNKVSNEECRGVPHHLLGII  92

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
                +   +F+  DF          IV + ++P I GGSNS++ AL               
Sbjct  93    ---DPEVDFTVHDFVHHALLAADAIVQKNRLPIIAGGSNSFVLAL---------------  134

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                V D      +Y CCFLW+DV+ PVL+ ++ KRVD+M+DSG++EE  + + DP     
Sbjct  135   ---VNDDTEFSSKYECCFLWMDVAIPVLHSHVSKRVDQMVDSGLVEE-GKAFFDPKIRDY  190

Query  516   RTGLAKAIGVPEFAAYFRAP--RGGERRERLYAEAVREIKENTRLLAERQLRKIQRLREV  343
               G+ +AIGVPE   +FR+     GE R +L   A+ EIK NT  LA RQ+ KI R+RE 
Sbjct  191   DYGIRRAIGVPEMDEFFRSEGLVDGETRAKLLKAAIDEIKMNTCKLACRQVEKILRMREE  250

Query  342   GGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
              GW++HR+NAT  F    G   E+     WE  V+ PS  IV +F+ +
Sbjct  251   LGWQIHRLNATEVFLRRGGDADEA-----WERLVLDPSTNIVARFICK  293



>ref|XP_009116977.1| PREDICTED: adenylate isopentenyltransferase 3, chloroplastic-like 
[Brassica rapa]
 dbj|BAE43827.1| isopentenyltransferase [Brassica rapa subsp. pekinensis]
 emb|CDY63340.1| BnaA09g55640D [Brassica napus]
Length=332

 Score =   222 bits (565),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 132/289 (46%), Positives = 179/289 (62%), Gaps = 30/289 (10%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR SVDLATR+   AE+INSDKIQV++GLDI TNKIT  ER GV HHL+   
Sbjct  47    MGATGTGKSRLSVDLATRF--QAEIINSDKIQVHQGLDIVTNKITTEERCGVPHHLLSVL  104

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
                  + + +AA+F       +  ++ RGK+P IVGGSNSY+ AL+           DD 
Sbjct  105   PP---QADLTAANFCHMANLSVESVLNRGKLPIIVGGSNSYVEALV-----------DD-  149

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                  D +    +Y CCFLWVDV+ PVLNR++ +RVD+M+ +GM+EE +R + D S+   
Sbjct  150   -----DDYKFRSKYDCCFLWVDVALPVLNRFVSERVDKMVQNGMVEE-ARDFFDYSDSDY  203

Query  516   RTGLAKAIGVPEFAAYFRAP---RGGERRERLYAEAVREIKENTRLLAERQLRKIQRLRE  346
               G+ KAIGVPEF  +FR       G+ RE L  + V EIK NT  LA RQ  KI+RLR+
Sbjct  204   SRGIKKAIGVPEFDIFFRNEPFLNLGD-REALLNKVVDEIKSNTFKLACRQREKIERLRK  262

Query  345   VGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
             +  W + R++AT        S+ +++ A  WE  V +PS + V +FLL+
Sbjct  263   IKKWCIQRLDATPVITRR-RSKVDADVA--WERLVARPSTEAVSRFLLD  308



>ref|NP_001288042.1| uncharacterized protein LOC103449027 [Malus domestica]
 gb|ADZ05814.1| adenylate isopentenyltransferase [Malus domestica]
Length=308

 Score =   221 bits (563),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 132/286 (46%), Positives = 173/286 (60%), Gaps = 31/286 (11%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR S+DLAT +   AE+INSDK+QVY+GLDI TNKIT  E+RGV HHL+G  
Sbjct  27    MGATGTGKSRLSIDLATCF--PAEIINSDKMQVYEGLDIVTNKITKEEQRGVPHHLLGIL  84

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             + +E   +F+A DF    +  I  ++GR ++P IVGGSNSYI AL+           DD 
Sbjct  85    DPNE---DFTARDFCDLTSLAIESVLGRDRLPIIVGGSNSYIEALV-----------DDH  130

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                    +    +Y CCFLWVDVS PV++ ++  RVD M+ +GM++E +R + DP N   
Sbjct  131   ------DYKFRSKYECCFLWVDVSVPVMHSFVSGRVDHMVQNGMVDE-AREFFDP-NADY  182

Query  516   RTGLAKAIGVPEFAAYFR-AP-RGGERRERLYAEAVREIKENTRLLAERQLRKIQRLREV  343
               G+ +AIGVPEF  YFR  P    E R RL  +AV +IK+NT  LA RQL KI  LR  
Sbjct  183   MKGIRRAIGVPEFDKYFRYGPLLDEETRARLLQQAVDKIKDNTCKLACRQLEKIHGLRNN  242

Query  342   GGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFL  205
              GW +H ++AT  F      +   +  E WE  V  P   IV +FL
Sbjct  243   KGWNLHPLDATEVF-----RKRGKDADEAWEKLVSGPGAMIVGQFL  283



>emb|CBI26180.3| unnamed protein product [Vitis vinifera]
Length=329

 Score =   221 bits (564),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 129/286 (45%), Positives = 175/286 (61%), Gaps = 32/286 (11%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             +GATG+GKS+ S+DLATR+   +E+INSDK+QVYKGL I TNK+T  E RGV HHL+G  
Sbjct  39    IGATGTGKSKLSIDLATRF--PSEIINSDKMQVYKGLHIVTNKVTEEECRGVPHHLLG--  94

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
               ++    F+A DF    +  I  I  R + P I GGSNS+I AL+ +   PE       
Sbjct  95    -IADPNTNFTAMDFCHHASLAIQSITARNRHPIIAGGSNSFIEALVTD--VPEF------  145

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                       + RY CCFLWVDVS PVL+R++ +RVD M+++G++EE+ R + DP    S
Sbjct  146   ----------KSRYECCFLWVDVSLPVLHRFVSERVDRMLEAGLVEEVRRIF-DPEADYS  194

Query  516   RTGLAKAIGVPEFAAYFRAPR--GGERRERLYAEAVREIKENTRLLAERQLRKIQRLREV  343
             R G+ +AIGVPE   + R  R  G +   +   +A+ +IKENT  LA  QL KI RL+ +
Sbjct  195   R-GIRRAIGVPEMDQFLRGERIVGDKIAAQYLRKAIAKIKENTCKLACSQLDKIHRLQNI  253

Query  342   GGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFL  205
              GW++HR++AT AF    G ++E    E WE  V  PSM IV  FL
Sbjct  254   RGWKIHRLDATEAF-LKRGDDAE----EAWEKHVAGPSMDIVGCFL  294



>emb|CDX93935.1| BnaC04g20940D [Brassica napus]
Length=334

 Score =   221 bits (564),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 130/289 (45%), Positives = 175/289 (61%), Gaps = 30/289 (10%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR SVDLATR+   AE+INSDKIQV++GLDI TNKIT  E  GV HHL+G  
Sbjct  47    MGATGTGKSRLSVDLATRF--PAEIINSDKIQVHQGLDIVTNKITTEESCGVPHHLLGVL  104

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
                    + +A +FR      +  I+ RGK+P IVGGSNSY+ AL+           DD 
Sbjct  105   PPEA---DLTAVNFRHMANLSVESILSRGKLPIIVGGSNSYVEALV-----------DD-  149

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                  D +    RY CCFLWVDV+ PVL+ ++ +RVD+M+++GM+EE+  ++    +  S
Sbjct  150   -----DDYKFRSRYDCCFLWVDVALPVLHGFVNERVDKMVENGMVEEVRDFFDYSDSNYS  204

Query  516   RTGLAKAIGVPEFAAYFRAP---RGGERRERLYAEAVREIKENTRLLAERQLRKIQRLRE  346
             R G+ KAIGVPEF  +FR       G+ RE L ++ V EIK NT  LA +Q  KI+RLR 
Sbjct  205   R-GIKKAIGVPEFDMFFRNEPFLNMGD-REELLSKVVDEIKRNTFGLACKQRNKIERLRR  262

Query  345   VGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
             +  W + R++AT  F      +S+ +    WE  V  PS   V +FLL+
Sbjct  263   IKKWCIQRLDATPVFTR---RKSKVDADVAWERLVAGPSTDAVSRFLLD  308



>ref|XP_002277591.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic 
[Vitis vinifera]
Length=330

 Score =   221 bits (563),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 129/286 (45%), Positives = 175/286 (61%), Gaps = 32/286 (11%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             +GATG+GKS+ S+DLATR+   +E+INSDK+QVYKGL I TNK+T  E RGV HHL+G  
Sbjct  40    IGATGTGKSKLSIDLATRF--PSEIINSDKMQVYKGLHIVTNKVTEEECRGVPHHLLG--  95

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
               ++    F+A DF    +  I  I  R + P I GGSNS+I AL+ +   PE       
Sbjct  96    -IADPNTNFTAMDFCHHASLAIQSITARNRHPIIAGGSNSFIEALVTDV--PEF------  146

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                       + RY CCFLWVDVS PVL+R++ +RVD M+++G++EE+ R + DP    S
Sbjct  147   ----------KSRYECCFLWVDVSLPVLHRFVSERVDRMLEAGLVEEVRRIF-DPEADYS  195

Query  516   RTGLAKAIGVPEFAAYFRAPR--GGERRERLYAEAVREIKENTRLLAERQLRKIQRLREV  343
             R G+ +AIGVPE   + R  R  G +   +   +A+ +IKENT  LA  QL KI RL+ +
Sbjct  196   R-GIRRAIGVPEMDQFLRGERIVGDKIAAQYLRKAIAKIKENTCKLACSQLDKIHRLQNI  254

Query  342   GGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFL  205
              GW++HR++AT AF    G ++E    E WE  V  PSM IV  FL
Sbjct  255   RGWKIHRLDATEAF-LKRGDDAE----EAWEKHVAGPSMDIVGCFL  295



>gb|ABD93934.1| adenylate isopentenyltransferase [Lotus japonicus]
 gb|ABG74607.1| isopentyl transferase [Lotus japonicus]
Length=324

 Score =   221 bits (563),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 134/288 (47%), Positives = 170/288 (59%), Gaps = 35/288 (12%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKS+ S+DLAT +   +E+INSDKIQ+Y GLDI TNKI+  E+RG+ HHL+G  
Sbjct  38    MGATGTGKSKLSIDLATCF--PSEIINSDKIQIYDGLDIVTNKISKEEQRGIPHHLLG--  93

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
                    +F+A DF       I  I  R  +P I GGSNSY+ AL+           DD 
Sbjct  94    -TQNPNTDFTAGDFSDCSTAAIDAITSRDHLPIIAGGSNSYLEALI-----------DD-  140

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                  D +    RY  C LWVDV+ PVL+ Y+  RVD+M+ SGM+EEL R + + +   S
Sbjct  141   -----DDYKFRSRYDFCCLWVDVAMPVLDSYVAARVDQMLRSGMVEEL-RPFFNANGDYS  194

Query  516   RTGLAKAIGVPEFAAYFRAPRGG----ERRERLYAEAVREIKENTRLLAERQLRKIQRLR  349
             R G+ +AIGVPEF  YFR  R G    E R+ L   AVRE+K NT  LA RQL KIQRLR
Sbjct  195   R-GIRRAIGVPEFDEYFR--REGFADEETRKLLLERAVREMKVNTCKLARRQLGKIQRLR  251

Query  348   EVGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFL  205
              V  WE+HR++AT  F      +   E  E W   V +PS  IV +FL
Sbjct  252   NVKRWEIHRVDATPVFW-----KRGEEADEAWRKVVAEPSAMIVAQFL  294



>ref|XP_002314413.1| hypothetical protein POPTR_0010s03150g [Populus trichocarpa]
 gb|EEF00584.1| hypothetical protein POPTR_0010s03150g [Populus trichocarpa]
Length=327

 Score =   221 bits (562),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 121/288 (42%), Positives = 166/288 (58%), Gaps = 30/288 (10%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             +G TG+GKSR ++DLATR+   AEV+N DK+QVYKGLDI TNK+T  E RGV HHL+G  
Sbjct  39    VGPTGTGKSRLAIDLATRF--PAEVVNCDKMQVYKGLDIVTNKVTEEECRGVPHHLLG--  94

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
               ++    F++ DFR   +  +  IV R ++P I GGSNSYI AL               
Sbjct  95    -IADPNANFTSDDFRHHASLVVESIVTRDRLPIIAGGSNSYIEAL---------------  138

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                  D     LRY CCFLWVDVS P+L  ++ +RVD M+++G+++E+   +        
Sbjct  139   ---ANDDPEFRLRYECCFLWVDVSLPILYSFVSERVDRMVEAGLIDEVRDMFDPNKFDDY  195

Query  516   RTGLAKAIGVPEFAAYFR--APRGGERRERLYAEAVREIKENTRLLAERQLRKIQRLREV  343
               G+ +AIGVPE   + R  A    + R +L  EA+ +IKENT +LA RQL+KI RL  +
Sbjct  196   SQGIKRAIGVPELDHFLRNEAIVDAKTRRKLLDEAIDKIKENTCMLASRQLQKIHRLHSI  255

Query  342   GGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
               W +HRI+AT  F       S  E   +W+  V  PS  IV +FL +
Sbjct  256   WNWNVHRIDATPVFLT-----SGKEVDNLWDKLVAGPSTMIVNQFLCD  298



>ref|NP_567138.1| adenylate isopentenyltransferase 3 [Arabidopsis thaliana]
 sp|Q93WC9.1|IPT3_ARATH RecName: Full=Adenylate isopentenyltransferase 3, chloroplastic; 
Short=AtIPT3; AltName: Full=Adenylate dimethylallyltransferase 
3; AltName: Full=Cytokinin synthase 3; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAB59030.1| cytokinin synthase [Arabidopsis thaliana]
 dbj|BAB59043.1| adenylate isopentenyltransferase [Arabidopsis thaliana]
 gb|AAM78100.1| AT3g63110/T20O10_210 [Arabidopsis thaliana]
 gb|AAN46854.1| At3g63110/T20O10_210 [Arabidopsis thaliana]
 gb|AEE80436.1| adenylate isopentenyltransferase 3 [Arabidopsis thaliana]
Length=336

 Score =   221 bits (563),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 131/288 (45%), Positives = 174/288 (60%), Gaps = 28/288 (10%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR SVD+ATR+   AE+INSDKIQV++GLDI TNKIT  E  GV HHL+G  
Sbjct  47    MGATGTGKSRLSVDIATRF--RAEIINSDKIQVHQGLDIVTNKITSEESCGVPHHLLGVL  104

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
                    + +AA++       I  ++ RGK+P IVGGSNSY+ AL+           DD+
Sbjct  105   PPEA---DLTAANYCHMANLSIESVLNRGKLPIIVGGSNSYVEALV-----------DDK  150

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
              N          RY CCFLWVDV+ PVL+ ++ +RVD+M++SGM+EE+ R + D SN   
Sbjct  151   ENK------FRSRYDCCFLWVDVALPVLHGFVSERVDKMVESGMVEEV-REFFDFSNSDY  203

Query  516   RTGLAKAIGVPEFAAYFRAPR--GGERRERLYAEAVREIKENTRLLAERQLRKIQRLREV  343
               G+ KAIG PEF  +FR  +    E RE L ++ + EIK NT  LA RQ  KI+RLR+V
Sbjct  204   SRGIKKAIGFPEFDRFFRNEQFLNVEDREELLSKVLEEIKRNTFELACRQREKIERLRKV  263

Query  342   GGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
               W + R++AT  F       S+ +    WE  V  PS   V +FLL+
Sbjct  264   KKWSIQRVDATPVFTK---RRSKMDANVAWERLVAGPSTDTVSRFLLD  308



>ref|XP_010684312.1| PREDICTED: adenylate isopentenyltransferase 3, chloroplastic-like 
[Beta vulgaris subsp. vulgaris]
Length=325

 Score =   221 bits (562),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 123/286 (43%), Positives = 172/286 (60%), Gaps = 29/286 (10%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR S+DLAT +   AE+INSDKIQVYKGLDI TNKIT  E+ GV HHL+   
Sbjct  37    MGATGTGKSRLSIDLATSF--PAEIINSDKIQVYKGLDIVTNKITRQEQCGVPHHLL---  91

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             +      ++ + DF       +  I+ + K+P IVGGSNSYI +L+ +   P+       
Sbjct  92    DIVNPNVDYKSKDFCLMATHAVESILQQDKLPIIVGGSNSYIESLVSD---PK-------  141

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                    +G +  Y CCFLWVDVS  VL++ +  RVD+M+ SG+++E+ R   DP N   
Sbjct  142   -------YGFKFNYDCCFLWVDVSVSVLHKSVSNRVDKMVQSGLVDEV-RGIFDPYNSDY  193

Query  516   RTGLAKAIGVPEFAAYFRAPRGGER--RERLYAEAVREIKENTRLLAERQLRKIQRLREV  343
               G+ +AIGVPEF  +FR     +   R++    A+ EIKENT  L  +QL+KI  L+ +
Sbjct  194   TRGIRQAIGVPEFDTFFRTEHHLDESDRDKQLQGAISEIKENTCKLVNKQLKKIHLLKHL  253

Query  342   GGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFL  205
               WE++R++AT  F    G+E  +  A  W   V QPS++IV +FL
Sbjct  254   KAWELYRLDATEVFNN--GNEDVANDA--WHKMVTQPSLEIVTQFL  295



>emb|CAB87756.1| tRNA isopentenyl transferase-like protein [Arabidopsis thaliana]
Length=330

 Score =   221 bits (562),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 131/288 (45%), Positives = 174/288 (60%), Gaps = 28/288 (10%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR SVD+ATR+   AE+INSDKIQV++GLDI TNKIT  E  GV HHL+G  
Sbjct  41    MGATGTGKSRLSVDIATRF--RAEIINSDKIQVHQGLDIVTNKITSEESCGVPHHLLGVL  98

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
                    + +AA++       I  ++ RGK+P IVGGSNSY+ AL+           DD+
Sbjct  99    PPEA---DLTAANYCHMANLSIESVLNRGKLPIIVGGSNSYVEALV-----------DDK  144

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
              N          RY CCFLWVDV+ PVL+ ++ +RVD+M++SGM+EE+ R + D SN   
Sbjct  145   ENK------FRSRYDCCFLWVDVALPVLHGFVSERVDKMVESGMVEEV-REFFDFSNSDY  197

Query  516   RTGLAKAIGVPEFAAYFRAPR--GGERRERLYAEAVREIKENTRLLAERQLRKIQRLREV  343
               G+ KAIG PEF  +FR  +    E RE L ++ + EIK NT  LA RQ  KI+RLR+V
Sbjct  198   SRGIKKAIGFPEFDRFFRNEQFLNVEDREELLSKVLEEIKRNTFELACRQREKIERLRKV  257

Query  342   GGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
               W + R++AT  F       S+ +    WE  V  PS   V +FLL+
Sbjct  258   KKWSIQRVDATPVFTK---RRSKMDANVAWERLVAGPSTDTVSRFLLD  302



>ref|XP_011012333.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Populus euphratica]
Length=327

 Score =   220 bits (561),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 122/288 (42%), Positives = 171/288 (59%), Gaps = 30/288 (10%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             +G TG+GKSR ++DLATR+   AEV+N DK+QVYKGLDI TNK T  E RGV HHL+G  
Sbjct  39    VGPTGTGKSRLAIDLATRF--PAEVVNCDKMQVYKGLDIVTNKATEEECRGVPHHLLG--  94

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
               ++   +F++ DFR   +  +  IV R ++P I GGSNSY+ AL               
Sbjct  95    -IADPNADFTSDDFRHHASLVVESIVTRDRLPIIAGGSNSYVEAL---------------  138

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                  D     LRY CCFLWVDVS P+L+ ++  RVD M+ +G+++E+   +        
Sbjct  139   ---ANDDPEFRLRYECCFLWVDVSLPLLHSFVSDRVDRMVRAGLIDEVRDVFDPTKFDDY  195

Query  516   RTGLAKAIGVPEFAAYFR--APRGGERRERLYAEAVREIKENTRLLAERQLRKIQRLREV  343
               G+ +AIGVPE   + R       + R +L  EA+ +IKENT +LA RQL+KI+RL  +
Sbjct  196   SQGIKRAIGVPELDQFLRNETIMDAKTRGKLLDEAIEKIKENTCILACRQLQKIRRLHSI  255

Query  342   GGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
               W+MHRI+AT  F A+ G E+++    +W+  V  PS  IV +FL E
Sbjct  256   WNWKMHRIDATPVFLAS-GKEADN----LWDQIVAGPSTMIVNQFLCE  298



>ref|XP_010103429.1| Adenylate isopentenyltransferase 5 [Morus notabilis]
 gb|EXB95832.1| Adenylate isopentenyltransferase 5 [Morus notabilis]
Length=348

 Score =   221 bits (563),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 130/286 (45%), Positives = 175/286 (61%), Gaps = 22/286 (8%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             +G TG+GKSR ++DLATR+   +E+INSDK+QVYKGL+I TNK+T  E RGV HHL+G  
Sbjct  44    IGPTGTGKSRLAIDLATRF--PSEIINSDKMQVYKGLEIATNKVTDEECRGVPHHLLG--  99

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
               +E    FSAADF    +  I  I+ RGK+P I GGSNSYI ALL +  +        +
Sbjct  100   -IAEPHSNFSAADFCLHASSAIKSILDRGKLPIIAGGSNSYIDALLNDHDHDHDHDQRSQ  158

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                         +Y CCFLWVDVS PVLN ++ +RVD M+ +G+++E+ R + DP+   S
Sbjct  159   ---------FRRQYECCFLWVDVSLPVLNAFVSERVDRMVAAGLIDEVRRMF-DPAADYS  208

Query  516   RTGLAKAIGVPEFAAYFRA-PRGGER--RERLYAEAVREIKENTRLLAERQLRKIQRLRE  346
             R G+ +AIGVPE    F A  RG  +  R+RL   A+ +IK NT LLA RQL+KI RL  
Sbjct  209   R-GIRRAIGVPELDELFGAEARGASKKTRDRLLQLAIEKIKVNTCLLARRQLQKIHRLHP  267

Query  345   VGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKF  208
                W +HR++AT AF   +      +  E WE  V +P+  IV +F
Sbjct  268   QWCWNVHRLDATEAF---LKRHRHQDADEAWEKLVAEPANMIVGEF  310



>ref|XP_011102015.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Sesamum indicum]
Length=286

 Score =   219 bits (558),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 124/288 (43%), Positives = 170/288 (59%), Gaps = 31/288 (11%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             +GATG+GKSR ++DLATR+   AEVINSDKIQVYKGLDI TNK++  E  GV HHL+G  
Sbjct  14    LGATGTGKSRLAIDLATRF--GAEVINSDKIQVYKGLDIVTNKVSNEECHGVPHHLLG--  69

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
                +   +F+  DF          IV + ++P I GGSNS+I AL               
Sbjct  70    -IIDPEVDFTVHDFGHHALLAADAIVQKNRLPIIAGGSNSFIQAL---------------  113

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                V D      +Y CCFLW+DV+ PVL+ Y+ KRVD+M+DSG++EE   ++ DP     
Sbjct  114   ---VTDYTEFSSKYECCFLWMDVAIPVLHSYVSKRVDQMVDSGLVEECKAFF-DPKIRDY  169

Query  516   RTGLAKAIGVPEFAAYFRAP--RGGERRERLYAEAVREIKENTRLLAERQLRKIQRLREV  343
               G+ +AIGVPE   +FR+     GE R +L   A+ EIK NT  LA RQ+ KI R RE 
Sbjct  170   DYGIRRAIGVPEMDEFFRSEGLVDGETRAKLLKAAIDEIKMNTCKLACRQVEKILRTREE  229

Query  342   GGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
              GW+++R+N T  F    G  +++     WEN V++PS  +V +F+ +
Sbjct  230   FGWQIYRLNPTEVFVRCGGDANDA-----WENLVLEPSTNMVARFICK  272



>ref|XP_002533064.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF29303.1| ATP binding protein, putative [Ricinus communis]
Length=328

 Score =   220 bits (561),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 126/286 (44%), Positives = 169/286 (59%), Gaps = 31/286 (11%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKS+ S+DLAT+    AE+INSDK+Q+YKGLDITTNKIT  E  G+ HHL+G  
Sbjct  46    MGATGTGKSKLSLDLATQ--CPAEIINSDKMQLYKGLDITTNKITEEEMSGIPHHLLGVV  103

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
               +    +F+A DF    ++ I  I  RG +P +VGGSNSYI AL+           DD 
Sbjct  104   NPN---VDFTAKDFCNMASQAIGSISTRGLLPIVVGGSNSYIEALV-----------DDP  149

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                    +    +Y CCFLWVDV    L  +L KRVD+M+  GM+EE+   + DP    S
Sbjct  150   ------DYRFRSKYDCCFLWVDVPMHALQEFLLKRVDQMVKKGMIEEVRNIF-DPRADYS  202

Query  516   RTGLAKAIGVPEFAAYFRAPRGGERRE--RLYAEAVREIKENTRLLAERQLRKIQRLREV  343
             + G+ K+IGVPEF  Y +A    + R   RL  +A+ E+K N   LA RQL KI RL+ V
Sbjct  203   K-GIRKSIGVPEFDKYLKAEAFSDERNCARLLQQAISEVKHNNCKLARRQLEKIHRLKYV  261

Query  342   GGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFL  205
              GW +HRI+AT  F      +   +  + W+  V +PS+ IV +FL
Sbjct  262   KGWNIHRIDATEVF-----RKRGKKADDAWKKLVARPSIDIVRQFL  302



>ref|XP_010039257.1| PREDICTED: adenylate isopentenyltransferase 3, chloroplastic-like 
[Eucalyptus grandis]
Length=443

 Score =   224 bits (570),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 125/286 (44%), Positives = 169/286 (59%), Gaps = 30/286 (10%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             +G TG+GKSR S+D+A+ +   AE++NSDKIQV+KGLDI TNKIT  E+RG+ HHL+G  
Sbjct  95    LGVTGAGKSRLSIDIASHF--PAEIVNSDKIQVHKGLDIVTNKITEEEQRGIPHHLLGTI  152

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
                    +F+A++F  +    I  I  RG  P IVGGSNSYI  L+              
Sbjct  153   PPD---ADFTASEFSNSALLAIESIRARGNTPVIVGGSNSYIETLIASH-----------  198

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                    +  +  Y CCFLWVD + P+L+ +L KRVD+M++ GM+EE +R   DP+   S
Sbjct  199   ------DYRFQSNYECCFLWVDAAMPILHSFLSKRVDKMVERGMVEE-ARNAFDPNGQYS  251

Query  516   RTGLAKAIGVPEFAAYFRAPRGGERR--ERLYAEAVREIKENTRLLAERQLRKIQRLREV  343
             R G+ +AIG+PE    FR  +  +R+   RL  EA+ EIK NT  LA RQL KI RLR  
Sbjct  252   R-GIRRAIGLPELDLLFRTEKFLDRQAHARLLKEAMEEIKTNTCKLASRQLEKIHRLRNQ  310

Query  342   GGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFL  205
              GW +HR++AT  F        +++  E WE  V  PS KIV +FL
Sbjct  311   KGWNLHRMDATEVFC----KHGKADADEAWEELVAGPSTKIVAEFL  352



>ref|XP_010468886.1| PREDICTED: adenylate isopentenyltransferase 3, chloroplastic 
[Camelina sativa]
Length=337

 Score =   220 bits (561),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 134/287 (47%), Positives = 172/287 (60%), Gaps = 27/287 (9%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR SVDLATR F AAE+INSDKIQV++GLDI TNKIT  E  GV HHL+G  
Sbjct  47    MGATGTGKSRLSVDLATR-FRAAEIINSDKIQVHQGLDIVTNKITSEESCGVPHHLLGVL  105

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
                    + +AA++R      I  I+ RGK+P IVGGSNSY+ AL+           DDE
Sbjct  106   PPEA---DLTAANYRQMANLSIESILNRGKLPIIVGGSNSYMEALV-----------DDE  151

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                         RY CCFLWVDV+ PVL+ ++ +RVD+M+++GM+EE+   +    +  S
Sbjct  152   DKQ------FRSRYDCCFLWVDVALPVLHGFVSERVDKMVENGMVEEVREIFDYSDSSYS  205

Query  516   RTGLAKAIGVPEFAAYFRAPR--GGERRERLYAEAVREIKENTRLLAERQLRKIQRLREV  343
             R G+ KAIGVPEF  +FR  +      RE L  + V EIK NT  LA RQ  KI+RLR+V
Sbjct  206   R-GIKKAIGVPEFDRFFRNEQFLNVGDREELLRKVVEEIKRNTFGLACRQREKIERLRKV  264

Query  342   GGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLL  202
               W + R++AT  F       S+ +    WE  V  PS   V +FLL
Sbjct  265   KKWCIQRLDATPVFTK---RRSKMDADVAWERLVAGPSTVAVSRFLL  308



>gb|AAM65536.1| cytokinin synthase [Arabidopsis thaliana]
Length=329

 Score =   220 bits (560),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 125/286 (44%), Positives = 169/286 (59%), Gaps = 31/286 (11%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             M ATGSGKSR ++DLATR+    E+INSDKIQ+YKGLD+ TNK+T  E RGV HHL+G F
Sbjct  40    MEATGSGKSRLAIDLATRF--QGEIINSDKIQLYKGLDVLTNKVTPKECRGVPHHLLGVF  97

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             ++       +A  +    ++ IS +    K+P + GGS SYI AL               
Sbjct  98    DSEAG--NLTATQYSRLASQAISKLSANNKLPIVAGGSKSYIEAL---------------  140

Query  696   CNSVGDSFGLEL-RYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPL  520
                V  S G  L  Y CCF+WVDVS PVLN ++ KRVD MM++G+LEE+   ++  +N  
Sbjct  141   ---VNHSSGFLLNNYDCCFIWVDVSLPVLNSFVSKRVDRMMEAGLLEEVREVFNPKAN--  195

Query  519   SRTGLAKAIGVPEFAAYFRAPRGGER--RERLYAEAVREIKENTRLLAERQLRKIQRLRE  346
                G+ +AIGVPE   Y R     +R  + ++   AV+ IK+NT +LA RQL+KIQRL +
Sbjct  196   YSVGIRRAIGVPELHEYLRNESLVDRATKSKMLDVAVKNIKKNTEILACRQLKKIQRLHK  255

Query  345   VGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKF  208
                  MHR++AT  F       +  E  E WEN V +PS +IV+KF
Sbjct  256   KWKMSMHRVDATEVFL----KRNVEEQDEAWENLVARPSERIVDKF  297



>ref|XP_010051140.1| PREDICTED: uncharacterized protein LOC104439824 [Eucalyptus grandis]
Length=580

 Score =   227 bits (578),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 137/307 (45%), Positives = 183/307 (60%), Gaps = 44/307 (14%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             +GATG GKSR S+DLA+ +   +EVINSDK+QVY+GLDITTNKI + +RRGV HHL+G  
Sbjct  296   IGATGCGKSRLSIDLASHF--PSEVINSDKMQVYRGLDITTNKIPLADRRGVPHHLLGSL  353

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             +      E + + F + G   ISD+  RG  P +VGGS S I ALL ERF+P+       
Sbjct  354   DPDHG--EMTPSQFCSLGDNAISDVASRGNFPILVGGSTSSILALLAERFDPQATP----  407

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYS-DPSNPL  520
                       +LRY CCFL VDV  PVL + L KRVD M+  G  +EL+ +Y    ++P 
Sbjct  408   ----------DLRYDCCFLCVDVLLPVLKKDLPKRVDRMLRMGAFDELAGYYDLRRTDPG  457

Query  519   SRTGLAKAIGVPEFAAYFR---APRG------------GER-----RERLYAEAVREIKE  400
             +   L +AIGV EF  YF     PRG             ER     RE  Y EA+REIK+
Sbjct  458   AWAVLRRAIGVLEFDRYFEKYPPPRGFGPGDAWGLEDARERQNDPVREGAYQEALREIKK  517

Query  399   NTRLLAERQLRKIQRLREVGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKI  220
             N   L  RQ++KI++L E  GWE+HR++AT A   A   E E    ++W++QV++PS++I
Sbjct  518   NAGQLMIRQVKKIRQLSE-SGWELHRLDATEAVRLATAPEEE----DVWKSQVLEPSVEI  572

Query  219   VEKFLLE  199
             V +FL E
Sbjct  573   VNQFLQE  579



>emb|CAN64738.1| hypothetical protein VITISV_007444 [Vitis vinifera]
Length=382

 Score =   221 bits (564),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 129/286 (45%), Positives = 175/286 (61%), Gaps = 32/286 (11%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             +GATG+GKS+ S+DLATR+   +E+INSDK+QVYKGL I TNK+T  E RGV HHL+G  
Sbjct  92    IGATGTGKSKLSIDLATRF--PSEIINSDKMQVYKGLHIVTNKVTEEECRGVPHHLLG--  147

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
               ++    F+A DF    +  I  I  R + P I GGSNS+I AL+ +   PE       
Sbjct  148   -IADPNTNFTAMDFCHHASLAIQSITARNRHPIIAGGSNSFIEALVTDV--PEF------  198

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                       + RY CCFLWVDVS PVL+R++ +RVD M+++G++EE+ R + DP    S
Sbjct  199   ----------KSRYECCFLWVDVSLPVLHRFVSERVDRMLEAGLVEEVRRIF-DPEADYS  247

Query  516   RTGLAKAIGVPEFAAYFRAPR--GGERRERLYAEAVREIKENTRLLAERQLRKIQRLREV  343
             R G+ +AIGVPE   + R  R  G +   +   +A+ +IKENT  LA  QL KI RL+ +
Sbjct  248   R-GIRRAIGVPEMDQFLRGERIVGDKIAAQYLRKAIAKIKENTCKLACSQLDKIHRLQNI  306

Query  342   GGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFL  205
              GW++HR++AT AF    G ++E    E WE  V  PSM IV  FL
Sbjct  307   RGWKIHRLDATEAF-LKRGDDAE----EAWEKHVAGPSMDIVGCFL  347



>ref|XP_010512718.1| PREDICTED: adenylate isopentenyltransferase 3, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=337

 Score =   220 bits (560),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 132/287 (46%), Positives = 173/287 (60%), Gaps = 27/287 (9%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR SVDLATR F AAE+INSDKIQV++GLDI TNKIT  E  GV HHL+G  
Sbjct  47    MGATGTGKSRLSVDLATR-FRAAEIINSDKIQVHQGLDIVTNKITSEESCGVPHHLLGVL  105

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
                    + +AA++R      I  I+ RGK+P IVGGSNSY+ AL+           DDE
Sbjct  106   PPEA---DLTAANYRQMANLSIESILNRGKLPIIVGGSNSYMEALV-----------DDE  151

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                         RY CCFLWVDV+ PVL+ ++ +RVD+M+++GM+EE+   +    +  S
Sbjct  152   DKQ------FRSRYDCCFLWVDVALPVLHGFVSERVDKMVENGMVEEVREIFDYSDSNYS  205

Query  516   RTGLAKAIGVPEFAAYFRAPR--GGERRERLYAEAVREIKENTRLLAERQLRKIQRLREV  343
             R G+ KAIGVPEF  +FR  +      RE L  + V +IK NT  LA RQ  KI+RLR+V
Sbjct  206   R-GIKKAIGVPEFDRFFRNEQFLNVGDREELLRKVVEDIKRNTFGLACRQREKIERLRKV  264

Query  342   GGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLL  202
               W + R++AT  F       S+++    WE  V  PS   V +F+L
Sbjct  265   KKWCIQRLDATPVFTK---RRSKTDADVAWERLVAGPSTAAVSRFML  308



>ref|XP_008797668.1| PREDICTED: adenylate isopentenyltransferase-like [Phoenix dactylifera]
Length=357

 Score =   220 bits (561),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 142/289 (49%), Positives = 180/289 (62%), Gaps = 21/289 (7%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKS+ S+DLATR+   +EV+NSDKIQVY+GLDITTNKI + ER GV HHL+GE 
Sbjct  75    MGATGTGKSKLSIDLATRF--PSEVVNSDKIQVYRGLDITTNKIPLAERCGVPHHLLGEL  132

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             +      E  A  FR+  A  I  I  R ++P + GGSNS+I+ALL  R +P +D F   
Sbjct  133   DPEAG--ELPALKFRSLAASAIEGIAARRRLPVVAGGSNSFIHALLAARHDPRVDPF---  187

Query  696   CNSVGDS---FGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWY-SDPS  529
               + GDS       LRYRCCFLWVDV   VL  YL +RV+EM+  GM+ EL  ++ ++ +
Sbjct  188   --AAGDSRRGRRERLRYRCCFLWVDVEKKVLAEYLDRRVEEMVADGMVAELEAYFAAEGA  245

Query  528   NPLSRTGLAKAIGVPEFAAYFRAPRGGERRERLYAEAVREIKENTRLLAERQLRKIQRLR  349
              P    GL KAIGVPEF  YF       +  + +A AV  IK NTR LAE Q+RKI RL 
Sbjct  246   EPGRHPGLEKAIGVPEFREYFEK----GKGAKKHAAAVAAIKANTRRLAEEQVRKIGRLG  301

Query  348   EVG-GWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFL  205
             E G GW + R++ATAA  A +     S  A  W+  VV PS+  VE FL
Sbjct  302   EGGCGWALQRVDATAAVRARL---EGSAWAAAWDRDVVGPSVAAVESFL  347



>ref|XP_010413197.1| PREDICTED: adenylate isopentenyltransferase 3, chloroplastic-like 
[Camelina sativa]
Length=337

 Score =   219 bits (559),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 134/287 (47%), Positives = 172/287 (60%), Gaps = 27/287 (9%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR SVDLATR F AAE+INSDKIQV++GLDI TNKIT  E  GV HHL+G  
Sbjct  47    MGATGTGKSRLSVDLATR-FRAAEIINSDKIQVHQGLDIVTNKITSEESCGVPHHLLGVL  105

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
                    + +AA++R      I  I+ RGK+P IVGGSNSY+ AL+           DDE
Sbjct  106   LPEA---DLTAANYRQMANLSIESILNRGKLPIIVGGSNSYMEALV-----------DDE  151

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                         RY CCFLWVDV+ PVL+ ++ +RVD+M+++GM+EE+   +    +  S
Sbjct  152   DKQ------FRSRYDCCFLWVDVALPVLHGFVSERVDKMVENGMVEEVREIFDYSDSNYS  205

Query  516   RTGLAKAIGVPEFAAYFRAPR--GGERRERLYAEAVREIKENTRLLAERQLRKIQRLREV  343
             R G+ KAIGVPEF  +FR  +      RE L  + V EIK NT  LA RQ  KI+RLR+V
Sbjct  206   R-GIKKAIGVPEFDRFFRNEQFLNVGDREELLRKVVEEIKRNTFGLACRQREKIERLRKV  264

Query  342   GGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLL  202
               W + R++AT  F       S+ +    WE  V  PS   V +FLL
Sbjct  265   KKWCIQRLDATPVFTK---RRSKMDADVAWERLVAGPSTVAVSRFLL  308



>ref|XP_011102016.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Sesamum indicum]
Length=307

 Score =   219 bits (557),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 125/288 (43%), Positives = 170/288 (59%), Gaps = 31/288 (11%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             +GATG+GKSR ++DLAT +   AEVINSDKIQVYKGLDI TNK++  E  GV HHL+G  
Sbjct  35    LGATGTGKSRLAIDLATCF--GAEVINSDKIQVYKGLDIVTNKVSNEECHGVPHHLLGII  92

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
                +   +F+  DF          IV + ++P I GGSNS+I AL               
Sbjct  93    ---DPEVDFTVHDFVHHALLAADAIVQKNRLPIIAGGSNSFIQAL---------------  134

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                V D+     +Y CCFLW+DV+ PVL+ Y+ KRVD+M+DSG++EE  + + DP     
Sbjct  135   ---VTDNTEFSSKYECCFLWMDVAIPVLHSYVSKRVDQMVDSGLVEE-GKAFFDPKIRDY  190

Query  516   RTGLAKAIGVPEFAAYFRAP--RGGERRERLYAEAVREIKENTRLLAERQLRKIQRLREV  343
               G+ +AIGVPE   +FR+     GE R +L   A+ EIK NT  LA RQ+ KI R+RE 
Sbjct  191   DYGIRRAIGVPEMDEFFRSEGLVDGETRAKLLKAAIDEIKMNTCKLACRQVEKILRMREE  250

Query  342   GGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
              GWE++R+NAT  F    G     E  + WE  V++PS  +V +F+ +
Sbjct  251   FGWEIYRLNATQVFLRCGG-----EANDAWEKLVLEPSTNMVARFICK  293



>emb|CDO98989.1| unnamed protein product [Coffea canephora]
Length=332

 Score =   219 bits (558),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 126/288 (44%), Positives = 176/288 (61%), Gaps = 32/288 (11%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR S+DLATR+   AE++NSDK+QVYKGLDI TNK+T  E  G+ HHL+G  
Sbjct  39    MGATGTGKSRLSIDLATRF--PAEIVNSDKMQVYKGLDIATNKVTEEECLGIPHHLLGFV  96

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             + +E   +F+A DF+   +  +  I+ +G++P I GGSNSYI AL               
Sbjct  97    DPNE---DFTAHDFQNHASLAVESIIRKGRLPIIAGGSNSYIKAL---------------  138

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                V D    + +Y CCFLWVD S  +L+ ++ KRVD+M+++G+++E+ R + +P    S
Sbjct  139   ---VNDDLEFQSKYDCCFLWVDASVSILHSFVTKRVDKMVEAGLVDEV-REFFNPKGDYS  194

Query  516   RTGLAKAIGVPEFAAYFRAPR--GGERRERLYAEAVREIKENTRLLAERQLRKIQRLREV  343
             R G+ +AIGVPE   +FR  +    E   +L  E + +IK NT  LA  QLR I RL+E 
Sbjct  195   R-GIRRAIGVPEMDQFFRNEKQVDEETGRKLLEEGIDKIKSNTCKLACCQLRNILRLQEQ  253

Query  342   GGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
              GW MH ++AT AF    G+ES+    E WE  V +P   IV +FL E
Sbjct  254   LGWNMHHLDATEAFLKR-GAESD----EAWERLVARPGTMIVGQFLEE  296



>ref|XP_010512717.1| PREDICTED: adenylate isopentenyltransferase 3, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=337

 Score =   219 bits (558),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 133/288 (46%), Positives = 175/288 (61%), Gaps = 29/288 (10%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR SVDLATR F AAE+INSDKIQV++GLDI TNKIT  E  GV HHL+G  
Sbjct  47    MGATGTGKSRLSVDLATR-FRAAEIINSDKIQVHQGLDIVTNKITSEESCGVPHHLLGVL  105

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
                    + +AA++R      I  I+ RGK+P IVGGSNSY+ AL+           DDE
Sbjct  106   PPEA---DLTAANYRQMANLSIESILNRGKLPIIVGGSNSYMEALV-----------DDE  151

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                         RY CCFLWVDV+ PVL+ ++ +RVD+M+++GM+EE+   +    +  S
Sbjct  152   DKQ------FRSRYDCCFLWVDVALPVLHGFVSERVDKMVENGMVEEVREIFDYSDSNYS  205

Query  516   RTGLAKAIGVPEFAAYFRAPR---GGERRERLYAEAVREIKENTRLLAERQLRKIQRLRE  346
             R G+ KAIGVPEF  +FR  +    G+R E L  + V +IK NT  LA RQ  KI+RLR+
Sbjct  206   R-GIKKAIGVPEFDRFFRNEQFLNVGDRXE-LLRKVVEDIKRNTFGLACRQREKIERLRK  263

Query  345   VGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLL  202
             V  W + R++AT  F       S+++    WE  V  PS   V +F+L
Sbjct  264   VKKWCIQRLDATPVFTK---RRSKTDADVAWERLVAGPSTAAVSRFML  308



>gb|EPS74194.1| hypothetical protein M569_00558, partial [Genlisea aurea]
Length=286

 Score =   218 bits (554),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 128/287 (45%), Positives = 167/287 (58%), Gaps = 35/287 (12%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR S+DLA  YF   EVINSDK+QV++GLDITTNKIT  ER  V HHL+G  
Sbjct  32    MGATGTGKSRLSIDLA-EYF-GGEVINSDKMQVFRGLDITTNKITDEERSCVPHHLLG--  87

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
               S+   EFSA +FR      +  I+ RG +P IVGGSNSY+ AL+   F          
Sbjct  88    -ISDPLSEFSAGNFRTLATAAVGSILSRGNLPLIVGGSNSYVEALIDSNFRS--------  138

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                         ++ CCFLWVDV+ P L+  L +RVD M+  GM+EE+  +Y  P    S
Sbjct  139   ------------KFECCFLWVDVALPELHVSLSERVDRMVHKGMIEEVKEFYR-PDGDYS  185

Query  516   RTGLAKAIGVPEFAAYFRAPR---GGERRERLYAEAVREIKENTRLLAERQLRKIQRLRE  346
               G+ K+IGVPE   +FR        E R ++  EA+  +K NT  LA RQL KI+RL+ 
Sbjct  186   -YGILKSIGVPELDRFFRVESLCDDQETRRKILTEAIDAVKINTSKLAFRQLEKIRRLKT  244

Query  345   VGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFL  205
             V GW +HR++AT A     G   ES+ A  W+  V  P+  +V +FL
Sbjct  245   VNGWRLHRLDATEALKKPAG---ESDAA--WDRNVSAPAFSVVSRFL  286



>ref|XP_003550509.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic 
[Glycine max]
Length=340

 Score =   219 bits (557),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 126/289 (44%), Positives = 171/289 (59%), Gaps = 28/289 (10%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKS+ ++DLAT+ F  AE++NSDK+QVY+GLDITTNK+T  ERRGV HHL+G  
Sbjct  46    MGATGTGKSKLAIDLATQ-FPPAEIVNSDKMQVYEGLDITTNKVTEEERRGVLHHLLGTV  104

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
               + +   F+A DF       +  I+GR  +P I GGSNS++ AL               
Sbjct  105   NPNTN---FTAQDFCDHATLAVGSILGRDGLPIIAGGSNSFLDAL---------------  146

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                V       LRY CCFLWVDVS PVL+  L  RVD M+ +G + E+ + +   ++  +
Sbjct  147   ---VNHHTEFRLRYECCFLWVDVSLPVLHSSLSARVDRMIHAGQVHEVRKSFQYHNDDYT  203

Query  516   RTGLAKAIGVPEFAAYFRAPRGG--ER-RERLYAEAVREIKENTRLLAERQLRKIQRLRE  346
               GL KAIGVPEF  +FRA   G  ER ++RL   A+  +K N   LA RQ++KI RL  
Sbjct  204   -VGLRKAIGVPEFHDFFRAEADGADERTKQRLLEAAIASLKTNNCSLANRQVQKIHRLYG  262

Query  345   VGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
             +    MHR++AT  F      + E+E  E WE+ V+  S +I+ KFL E
Sbjct  263   MWKRNMHRLDATEVFLKNATRQEEAE--EAWEDHVLSKSRRILNKFLYE  309



>ref|XP_003528670.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Glycine max]
Length=336

 Score =   218 bits (556),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 124/289 (43%), Positives = 168/289 (58%), Gaps = 30/289 (10%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKS+ +++LAT+ F  AE++NSDK+QVY+GL+ITTNK+T  ERRGV HHL+G  
Sbjct  45    MGATGTGKSKLAIELATQ-FPPAEIVNSDKMQVYEGLNITTNKVTEEERRGVPHHLLGTV  103

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
               + S   F+A DF       +  I+GR  +P I GGSNS++ AL               
Sbjct  104   NPNTS---FTAQDFCDQATLAVGSILGRDGLPIIAGGSNSFLDAL---------------  145

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                V       LRY CCFLWVDVS PVL+  L  RVD M+ SG L E+ + +   +   +
Sbjct  146   ---VNHHTEFRLRYDCCFLWVDVSLPVLHSSLSARVDRMIHSGQLHEVRQSFQYHNQDYT  202

Query  516   RTGLAKAIGVPEFAAYFRAPRGG---ERRERLYAEAVREIKENTRLLAERQLRKIQRLRE  346
               G+ KAIGVPEF  +FRA   G     ++RL   A+  +K N   LA+RQL+KI RL  
Sbjct  203   -LGIRKAIGVPEFHDFFRAEADGADQRTKQRLLQAAIASLKTNNCTLAKRQLQKIHRLYS  261

Query  345   VGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
             +    MHR++AT  F      E+E    E WE+ V+  + +I+ KFL E
Sbjct  262   MWKRNMHRLDATEVFLKTTRQEAE----EAWEDHVLSKTRRILHKFLYE  306



>ref|XP_007144614.1| hypothetical protein PHAVU_007G170100g [Phaseolus vulgaris]
 gb|ESW16608.1| hypothetical protein PHAVU_007G170100g [Phaseolus vulgaris]
Length=322

 Score =   218 bits (554),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 129/288 (45%), Positives = 170/288 (59%), Gaps = 31/288 (11%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR S+DLA  +   +E+INSDKIQVY+GLDI TNKI   ++RGV HHL+G  
Sbjct  38    MGATGAGKSRLSIDLAKCF--PSEIINSDKIQVYQGLDIVTNKIPKEDQRGVHHHLLGTI  95

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
                    +F+  DF    +  I  I    K+P IVGGSNSY+ AL+           DD 
Sbjct  96    NPDT---DFTPTDFIDTSSSAIETITRAQKLPIIVGGSNSYLEALI-----------DD-  140

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                  D +    RY    LWVDV+ PVL  Y+ +RVD+M  +GM++EL  +YS P+   S
Sbjct  141   -----DDYNFRSRYDFICLWVDVAMPVLQSYVAERVDDMFRNGMVDELRPFYS-PNGDYS  194

Query  516   RTGLAKAIGVPEFAAYFRAPR--GGERRERLYAEAVREIKENTRLLAERQLRKIQRLREV  343
             R G+ +AIGVPEF  YFR       E ++RL  +A++EIK NT  LA +QLRKI RLR V
Sbjct  195   R-GIRRAIGVPEFDEYFRREEFVDEETKQRLLEDAIKEIKLNTWKLAMKQLRKIHRLRNV  253

Query  342   GGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
               WE+HR++AT  F          E  E W+  V +PS  +V +FL +
Sbjct  254   KRWEIHRLDATPVF-----RRRGEEANEAWKKVVAEPSAMVVARFLYD  296



>gb|AIN44214.1| IPT3 [Rosa hybrid cultivar]
Length=330

 Score =   218 bits (554),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 130/286 (45%), Positives = 175/286 (61%), Gaps = 32/286 (11%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKS+ S+DLATR+   AE+INSDK+Q+Y+GLDI TNKI+  E+RGV HHL+G  
Sbjct  45    MGATGTGKSKLSIDLATRF--PAEIINSDKMQLYEGLDIATNKISPQEQRGVPHHLLGVL  102

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             + +    +FSA DF       +  I+ R ++P IVGGSNSYI AL        +D +D  
Sbjct  103   DPNA---DFSADDFCGITCLAVESILNRDRLPIIVGGSNSYIEAL--------IDGYDKM  151

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
               S         RY CCFLWVDVS PVL  ++  RVD+M+++GM+EE+ R + DP    +
Sbjct  152   FRS---------RYDCCFLWVDVSLPVLQSFVSDRVDQMVENGMVEEV-REFFDPKADYT  201

Query  516   RTGLAKAIGVPEFAAYFR--APRGGERRERLYAEAVREIKENTRLLAERQLRKIQRLREV  343
             + G+ +AIGVPEF  +FR       E R  L  +A+ E+K+NT  LA RQL KI+RLR  
Sbjct  202   K-GIRRAIGVPEFDDFFRYGPSLDEETRAWLLEQAINEVKDNTCKLACRQLEKIRRLRN-  259

Query  342   GGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFL  205
              GW +H ++AT  F      +   E  E W+  V  PS  IV +FL
Sbjct  260   KGWSLHPLDATEVF-----RKRGKEADEAWDRLVSGPSAVIVRQFL  300



>ref|XP_008229695.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Prunus mume]
Length=281

 Score =   216 bits (550),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 125/289 (43%), Positives = 176/289 (61%), Gaps = 36/289 (12%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             +G+TG GK++ S+DLATRY    E+INSDKIQVY+GLDI TNK T PE+RG+ HHL+G  
Sbjct  20    LGSTGCGKTKLSIDLATRY--NGEIINSDKIQVYEGLDIVTNKATKPEQRGILHHLLGSI  77

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             +  E+  +F+  DF     + + DI  R +VP I GGSN+YI AL+    +P L   D  
Sbjct  78    QDPEA--DFTVQDFCLQVPKALDDITKRNRVPIIAGGSNTYIEALVE---DPTLRFQD--  130

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                         +Y CCF+W+DVS PVL   + +RVDEM+D+G+++EL   +  P     
Sbjct  131   ------------KYDCCFIWLDVSLPVLYNRVSERVDEMVDAGLVDELREMFV-PGADYE  177

Query  516   RTGLAKAIGVPEFAAYFRAPRGGE----RRERLYAEAVREIKENTRLLAERQLRKIQRLR  349
             R G+ +AIG PE  AYF A         R+E L+ + +++ K+NT  LAE Q++KI+RLR
Sbjct  178   R-GIRRAIGAPEMHAYFMAEMDHSADEARKEFLFKDGIQKTKDNTLKLAESQVQKIERLR  236

Query  348   EVGGWEMHRINATAAFAAAMGSESESETAEI-WENQVVQPSMKIVEKFL  205
                 W++HRI+ TA        ES  + A + WEN V++PS  IV +FL
Sbjct  237   T--KWDIHRIDVTAV------HESCGKKAVVAWENLVLKPSFSIVSEFL  277



>ref|XP_010532708.1| PREDICTED: LOW QUALITY PROTEIN: adenylate isopentenyltransferase 
7, mitochondrial-like [Tarenaya hassleriana]
Length=319

 Score =   217 bits (553),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 127/289 (44%), Positives = 177/289 (61%), Gaps = 40/289 (14%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR +VDLATR+   AE+INSDKIQ+++GL + TNK+T  E     HH++G  
Sbjct  38    MGATGTGKSRLAVDLATRF--PAEIINSDKIQLHEGLHVATNKVTPQE----XHHMLGII  91

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             + + S   F++ DFR   ++ IS IV + K+P + GGSNSYI AL               
Sbjct  92    DPNAS---FTSFDFRCLASQVISSIVAKDKLPIVAGGSNSYIEAL---------------  133

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                V  S      Y+CCF+WVDVS PVLN ++ +RVD MM++G+++E+ + Y DP    S
Sbjct  134   ---VSQSTEFLRNYQCCFIWVDVSLPVLNSFISRRVDRMMEAGLVQEVRKMY-DPKADYS  189

Query  516   RTGLAKAIGVPEFAAYFR----APRGGERRERLYAEAVREIKENTRLLAERQLRKIQRLR  349
               G+ +AIGVPE   Y R      RG +R  ++   AV+ IK+NT +LA RQL+KI RL 
Sbjct  190   -VGIRRAIGVPELDQYLRMESLVDRGTQR--KMLDLAVKNIKQNTEILACRQLQKIHRLY  246

Query  348   EVGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLL  202
             +     MHRI+AT  F    G++++    E WEN V +PS +I+ KFLL
Sbjct  247   KNWNSCMHRIDATEVFLRH-GNDAD----EAWENLVARPSTRIINKFLL  290



>ref|XP_009413572.1| PREDICTED: adenylate isopentenyltransferase-like [Musa acuminata 
subsp. malaccensis]
Length=384

 Score =   219 bits (558),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 137/289 (47%), Positives = 174/289 (60%), Gaps = 14/289 (5%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKS+ S+DL+  +  + EV+NSDKIQVY+GLDITTNKI   ERRGV HHL+GE 
Sbjct  76    MGATGTGKSKLSIDLSAMF--SGEVVNSDKIQVYRGLDITTNKIPEAERRGVAHHLLGEL  133

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVF---  706
             + +    E   A FRA     I DI  R +VP + GGSNS+I+ALL + ++P+ D F   
Sbjct  134   DPAAG--ELPPAGFRALAGRAIGDISARHRVPVLAGGSNSFIHALLSDPYDPKRDPFCPA  191

Query  705   --DDECNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDP  532
                +            LRYRCCFLWV V   VL  +L +RVDEM+  GM++EL R++++ 
Sbjct  192   EAPERIRLTRQEAEEGLRYRCCFLWVHVDAAVLTEHLDRRVDEMVGEGMIKELERYFAEE  251

Query  531   SNPLSRTGLAKAIGVPEFAAYFRAPRGGERRERLYAEAVREIKENTRLLAERQLRKIQRL  352
                    GL KAIGVPEF  YF   RGG R    Y  A+  IK NTR LAE Q+RKI+RL
Sbjct  252   WEAGRHPGLGKAIGVPEFQGYFTG-RGG-RTAAAYEAALSAIKANTRRLAEEQVRKIKRL  309

Query  351   REVGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFL  205
                 GW + R++ATAA AA      E  T   W   V+ PS   V +FL
Sbjct  310   AAT-GWPLRRVDATAAVAAK--VAGEGGTTAPWRRDVLGPSAAAVGRFL  355



>ref|XP_010278446.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic 
[Nelumbo nucifera]
Length=329

 Score =   218 bits (554),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 126/288 (44%), Positives = 171/288 (59%), Gaps = 34/288 (12%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKS+ S+DLATR+   AE++NSDK+QVY+GLDI TNK+T  E+RG+ HHL+G  
Sbjct  41    MGATGTGKSKLSIDLATRF--PAEIVNSDKMQVYEGLDIVTNKVTEEEQRGIPHHLLG--  96

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
                +   +F+A DF  + +  I  IV R ++P IVGGSNSYI+AL               
Sbjct  97    -VVDPDADFTALDFCRSASHAIESIVSRDRLPIIVGGSNSYIHAL---------------  140

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                V D      RY CCFLWVDV  PVL+  + KRVD M+++G+++E+ R++ +P    S
Sbjct  141   ---VNDDLEFRSRYECCFLWVDVCLPVLHSSVSKRVDRMVEAGLVDEVRRFF-EPEADYS  196

Query  516   RTGLAKAIGVPEFAAYFRAPRGGERRERLYA----EAVREIKENTRLLAERQLRKIQRLR  349
             R G+ +AIGVPE   + R      + E + A    EA+ EIK NT  LA  QL+KI RL+
Sbjct  197   R-GIRRAIGVPEMDRFLRXEASALKDEEILAILLEEAIEEIKVNTCTLARCQLQKIYRLK  255

Query  348   EVGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFL  205
             E+   +MH ++AT  F    G E+E    E WE  V  P   IV  F 
Sbjct  256   ELLRGKMHCLDATEVFLKH-GKEAE----ETWEKLVAGPGTNIVRHFF  298



>ref|XP_010693920.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=328

 Score =   217 bits (553),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 127/286 (44%), Positives = 167/286 (58%), Gaps = 32/286 (11%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR S+DLAT +   AE+INSDKIQVYKGLDI TNK+T  E RGV HHL+G  
Sbjct  40    MGATGTGKSRLSIDLATHF--PAEIINSDKIQVYKGLDIVTNKVTEEECRGVTHHLLGII  97

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             +      +++AA FR      I  I+ + K+P I GGSNS+I +L               
Sbjct  98    DPD---VDYNAAHFRHDALSAIESIIEQDKLPIIAGGSNSFIESL---------------  139

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                V D      RY CCFLWVDV+  +L  ++ KRVD+M+ +G+++E+ R   DP    +
Sbjct  140   ---VNDDPYFASRYDCCFLWVDVNLHILRSFVSKRVDQMVKAGLIDEV-RGIFDPEANYT  195

Query  516   RTGLAKAIGVPEFAAYFRAP--RGGERRERLYAEAVREIKENTRLLAERQLRKIQRLREV  343
               G+ +AIGVPE   + RA      E  + L   A+ E+KENT  LA RQL+KI RLR+ 
Sbjct  196   H-GIRRAIGVPEIDRFLRAEGIVDKETLDTLLQIAIDEVKENTCKLASRQLQKIHRLRDF  254

Query  342   GGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFL  205
              GW +H INAT AF      +   +  E W+  VV PS  IV +FL
Sbjct  255   WGWNLHHINATEAFL-----KQGEDAHEAWDRLVVGPSAMIVAQFL  295



>gb|ABD93933.1| adenylate isopentenyltransferase [Lotus japonicus]
Length=342

 Score =   218 bits (554),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 127/290 (44%), Positives = 170/290 (59%), Gaps = 26/290 (9%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATGSGKS+ ++DLAT +F  AEV+NSDKIQ+Y GLDI TNK+T  E RGV HHL+G F
Sbjct  43    MGATGSGKSKLAIDLAT-HFPPAEVVNSDKIQMYSGLDIATNKVTEEECRGVPHHLLGTF  101

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             E       F+A+DF    +  I  IV R  +P I GGSNS+I AL+     PE       
Sbjct  102   E--NPNMNFTASDFCKQASSAIGSIVKRDGLPIIAGGSNSFIDALV--NHTPE-------  150

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                          Y CCFLWVDVS PVL+  L +RVD M+D+G ++E+ +++ +  +   
Sbjct  151   ---------FRFNYECCFLWVDVSLPVLHNSLSRRVDRMIDAGQVDEVRQFFLNAHHQSD  201

Query  516   RT-GLAKAIGVPEFAAYFRAPRGG--ERRER-LYAEAVREIKENTRLLAERQLRKIQRLR  349
              T G+ +AIGVPEF  + RA   G  ER +R L   A+ E+K N   LA RQ++KI RL 
Sbjct  202   YTRGIRRAIGVPEFDRFLRAEASGADERTKRKLLDTAIAELKVNNCNLASRQVQKIHRLY  261

Query  348   EVGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
              +    MHR++ T       G  S  E  ++WE+ V   S +I++KFL E
Sbjct  262   NMWKRSMHRLDPTEVLLKN-GCCSPEEAEKVWEDHVFSKSRRIIQKFLYE  310



>ref|XP_009138635.1| PREDICTED: adenylate isopentenyltransferase 3, chloroplastic-like 
[Brassica rapa]
 emb|CDX89173.1| BnaA04g00130D [Brassica napus]
Length=334

 Score =   217 bits (553),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 129/289 (45%), Positives = 173/289 (60%), Gaps = 30/289 (10%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR SVD+ATR+   AE+INSDKIQV++GLDI TNKIT  E  GV HHL+G  
Sbjct  47    MGATGTGKSRLSVDIATRF--PAEIINSDKIQVHQGLDIVTNKITTEESCGVPHHLLGVL  104

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
                    + +A +FR      +  I+ RGK+P IVGGSNSY+ AL+           DDE
Sbjct  105   PPEA---DLTAVNFRHMANLSVESILSRGKLPIIVGGSNSYVEALV-----------DDE  150

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                    +    RY CCFLWVDV+ PVL+  + +RVD+M+ +GM+EE+  ++    +  S
Sbjct  151   ------DYKFRSRYDCCFLWVDVALPVLHGSVNERVDKMVANGMVEEVRDFFDYSDSNYS  204

Query  516   RTGLAKAIGVPEFAAYFRAP---RGGERRERLYAEAVREIKENTRLLAERQLRKIQRLRE  346
             R G+ KAIGVPEF  +FR       G+ RE L ++ V EIK NT  LA +Q  KI+RLR+
Sbjct  205   R-GIKKAIGVPEFDMFFRNEPFLNTGD-REELLSKVVDEIKRNTFGLACKQRNKIERLRK  262

Query  345   VGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
             +  W + R++AT  F       S+ +    WE  V  PS   V +FLL+
Sbjct  263   IKKWCIQRLDATPVFTR---RRSKVDADVAWERLVAGPSTDAVSRFLLD  308



>ref|XP_010524014.1| PREDICTED: adenylate isopentenyltransferase 3, chloroplastic-like 
[Tarenaya hassleriana]
Length=320

 Score =   217 bits (552),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 129/287 (45%), Positives = 171/287 (60%), Gaps = 28/287 (10%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR SVDLATR+   AE+INSDKIQV++GLDI TNKIT  E  GV HHL+G  
Sbjct  45    MGATGTGKSRLSVDLATRF--PAEIINSDKIQVHQGLDILTNKITAEESCGVPHHLLGVL  102

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
               +    +F+AA+FR      +  I+ RGK+P IVGGSNS++ AL+           DDE
Sbjct  103   PPNA---DFTAANFRQMANLSVESILSRGKLPIIVGGSNSHVEALV-----------DDE  148

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                    +    +Y CCFLWVDVS PVL+ ++ +RVD+M++ GM+EE+   +       +
Sbjct  149   ------DYRFRSKYECCFLWVDVSMPVLHGFVSERVDKMVEKGMVEEVREIFDLWDTDYT  202

Query  516   RTGLAKAIGVPEFAAYFRAPRGGERRER--LYAEAVREIKENTRLLAERQLRKIQRLREV  343
             R G  KAIGVPE  +YFRA    + RER  L  E + ++K NT  LA RQ +KI+RL   
Sbjct  203   R-GSRKAIGVPELDSYFRAEPFLDSREREELLREVIEDVKRNTCALACRQRQKIERLVRA  261

Query  342   GGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLL  202
               W + R++ATA F       S  +    WE   V PS   + +FLL
Sbjct  262   KKWSIQRLDATAVFRQ---RRSTVDADVAWERLAVGPSTHALSRFLL  305



>ref|XP_004296948.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
isoform 2 [Fragaria vesca subsp. vesca]
Length=353

 Score =   217 bits (553),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 126/293 (43%), Positives = 172/293 (59%), Gaps = 34/293 (12%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             +GATG+GKSR ++DLA +Y  +AE+INSDK+QVYKGLD  TNK+T  E +GV HHL+G  
Sbjct  46    IGATGTGKSRLAIDLALKY--SAEIINSDKMQVYKGLDTLTNKVTEEECKGVPHHLLGTV  103

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             +   +   F+A DF+   +  I  I+ R ++P I GGSNSYI AL+ E            
Sbjct  104   DPDSN---FTATDFKHHASLAIESILERDRLPIIAGGSNSYIEALVDEHAE---------  151

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMD-SGMLEELSRWYSDPSNPL  520
                         RY CCFLWVDV+P VLN ++ +RVD M++  G+++E+ R + DP+   
Sbjct  152   ---------FRRRYECCFLWVDVAPRVLNSFVSERVDRMVEVGGLVDEVRRMF-DPTTAD  201

Query  519   SR---TGLAKAIGVPEFAAYFRAPRGG---ERRERLYAEAVREIKENTRLLAERQLRKIQ  358
                  TG+ KAIGVPE   Y      G   E +E L  EA+  IK+NT  LA RQL+KI 
Sbjct  202   EEDYSTGIRKAIGVPEMHHYLCGEACGNDKETQEALLLEAISNIKKNTCTLAHRQLQKIH  261

Query  357   RLREVGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
             RLR    W MH ++AT AF   +      E   +W+ QV +P+  IV KFL++
Sbjct  262   RLRSKWNWSMHCLDATEAF---LHRRRGREGELVWDKQVSRPATGIVSKFLVD  311



>ref|XP_002517150.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF45313.1| ATP binding protein, putative [Ricinus communis]
Length=314

 Score =   216 bits (550),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 125/288 (43%), Positives = 167/288 (58%), Gaps = 31/288 (11%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             +G TG+GKSR ++D+ATR    AEV+N DK+QVYKGLDI TNK+T  E RGV HHL+G  
Sbjct  29    VGPTGTGKSRLAIDIATR--IPAEVVNCDKMQVYKGLDIVTNKVTEEECRGVPHHLLGVV  86

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             E  +   +F++ DFR   +  +  I  R ++P I GGSNS+I AL               
Sbjct  87    EPDD---DFTSDDFRLHASNALDLIRARDRLPIIAGGSNSFIEAL---------------  128

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                  D     LRY CCFLWVDVS PVL  ++ +RVD M+ +G+++E+   + DP N   
Sbjct  129   ---ANDDPQFRLRYECCFLWVDVSLPVLYSFVSERVDRMVKAGLIDEVRNIF-DPINTNY  184

Query  516   RTGLAKAIGVPEFAAYFRAPR--GGERRERLYAEAVREIKENTRLLAERQLRKIQRLREV  343
               G+ +AIGVPE   +FR       + R +L   ++ +IKENT  LA RQL+KI RL   
Sbjct  185   SRGIKRAIGVPELDQFFRYEDIVDAKTRGKLLDTSIAKIKENTCTLACRQLQKIHRLHNR  244

Query  342   GGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
               W MHRI+AT  F    G E+E    E WE  V  PS  IVE+F+ +
Sbjct  245   WSWNMHRIDATEVFIRN-GEEAE----EAWEKLVAGPSAMIVEQFIYD  287



>ref|XP_004296947.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
isoform 1 [Fragaria vesca subsp. vesca]
Length=368

 Score =   217 bits (552),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 126/293 (43%), Positives = 172/293 (59%), Gaps = 34/293 (12%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             +GATG+GKSR ++DLA +Y  +AE+INSDK+QVYKGLD  TNK+T  E +GV HHL+G  
Sbjct  61    IGATGTGKSRLAIDLALKY--SAEIINSDKMQVYKGLDTLTNKVTEEECKGVPHHLLGTV  118

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             +   +   F+A DF+   +  I  I+ R ++P I GGSNSYI AL+ E            
Sbjct  119   DPDSN---FTATDFKHHASLAIESILERDRLPIIAGGSNSYIEALVDEHAE---------  166

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMD-SGMLEELSRWYSDPSNPL  520
                         RY CCFLWVDV+P VLN ++ +RVD M++  G+++E+ R + DP+   
Sbjct  167   ---------FRRRYECCFLWVDVAPRVLNSFVSERVDRMVEVGGLVDEVRRMF-DPTTAD  216

Query  519   SR---TGLAKAIGVPEFAAYFRAPRGG---ERRERLYAEAVREIKENTRLLAERQLRKIQ  358
                  TG+ KAIGVPE   Y      G   E +E L  EA+  IK+NT  LA RQL+KI 
Sbjct  217   EEDYSTGIRKAIGVPEMHHYLCGEACGNDKETQEALLLEAISNIKKNTCTLAHRQLQKIH  276

Query  357   RLREVGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
             RLR    W MH ++AT AF   +      E   +W+ QV +P+  IV KFL++
Sbjct  277   RLRSKWNWSMHCLDATEAF---LHRRRGREGELVWDKQVSRPATGIVSKFLVD  326



>ref|XP_004290672.1| PREDICTED: adenylate isopentenyltransferase 3, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=331

 Score =   215 bits (548),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 128/286 (45%), Positives = 176/286 (62%), Gaps = 32/286 (11%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKS+ S+DLATR+   AE+INSDK+Q Y+GLDI TNKIT  E+R V HHL+G  
Sbjct  48    MGATGTGKSKLSIDLATRF--PAEIINSDKMQFYEGLDIATNKITPQEQRDVPHHLLGVL  105

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             + +    +FSA DF       +  I+ R ++P IVGGSNSYI  L        +D +D+ 
Sbjct  106   DPN---VDFSADDFSNVTCLAVDSILNRNRLPIIVGGSNSYIETL--------VDGYDNM  154

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
               S         RY CCFLWVDVS  VL+ ++  RVD+M+++G++EE+ R + DP+   +
Sbjct  155   FRS---------RYDCCFLWVDVSLSVLHSFVSDRVDQMVENGLVEEV-REFFDPNADYT  204

Query  516   RTGLAKAIGVPEFAAYFR-AP-RGGERRERLYAEAVREIKENTRLLAERQLRKIQRLREV  343
             + G+ +AIGVPEF  +FR  P    E R  L   A+ E+K+NT  LA RQL KI+RLR  
Sbjct  205   K-GIRRAIGVPEFDDFFRYGPFLDDETRAGLLERAINEVKDNTCKLACRQLEKIRRLRN-  262

Query  342   GGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFL  205
              GW +H+++AT  F      +   E+ E W+  V  PS  IV +FL
Sbjct  263   KGWSLHQLDATEVF-----QKRGKESHEAWDRLVSGPSAMIVRQFL  303



>ref|XP_006298111.1| hypothetical protein CARUB_v10014152mg [Capsella rubella]
 gb|EOA31009.1| hypothetical protein CARUB_v10014152mg [Capsella rubella]
Length=331

 Score =   215 bits (548),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 125/286 (44%), Positives = 169/286 (59%), Gaps = 31/286 (11%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATGSGKSR ++DLATR+   +EVINSDKIQ+YKGLD+ TNK+T  E RGV HHL+G F
Sbjct  40    MGATGSGKSRLAIDLATRF--QSEVINSDKIQLYKGLDVLTNKVTPQECRGVPHHLLGVF  97

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             ++       +A  +    ++ I+ +    K+P + GGSNSYI AL               
Sbjct  98    DSEFG--NLTATQYSNLASQAITKLSANHKLPIVAGGSNSYIEAL---------------  140

Query  696   CNSVGDSFGLEL-RYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPL  520
                   S G  L  Y CCF+WVDVS PVLN ++ KRVD MM++G+LEE+   + +P    
Sbjct  141   ---ANHSAGFLLNNYECCFIWVDVSLPVLNSFVSKRVDRMMEAGLLEEVREVF-NPKADY  196

Query  519   SRTGLAKAIGVPEFAAYFR--APRGGERRERLYAEAVREIKENTRLLAERQLRKIQRLRE  346
             S  G+ +AIGVPE   Y R  +      +  +   AV+ IK+NT +LA RQL+KIQRL +
Sbjct  197   S-VGIRRAIGVPELHEYLRYESLVDSATQRMMLDVAVKNIKKNTEILACRQLKKIQRLNK  255

Query  345   VGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKF  208
                  MHR++AT  F       +  E  E WE+ V +PS +IV+KF
Sbjct  256   KWKLSMHRVDATEVFL----KRNVEEQDEAWESLVARPSERIVDKF  297



>ref|XP_004150320.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Cucumis sativus]
 gb|KGN47261.1| hypothetical protein Csa_6G237640 [Cucumis sativus]
Length=326

 Score =   215 bits (547),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 133/301 (44%), Positives = 181/301 (60%), Gaps = 37/301 (12%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR ++DLATR+   AE+INSDKIQVYKGL + TNK+T  E  GV HHL+G  
Sbjct  44    MGATGTGKSRLAIDLATRF--PAEIINSDKIQVYKGLKVLTNKVTEKECCGVPHHLLG--  99

Query  876   EASESRPEFSAADFRAAGAERISDI-VGRGKVPFIVGGSNSYIYALLVERFNPELDVFDD  700
               ++    F+ ADFR   +  I+ I VG+  +P + GGSNS+I +L+ E   PE      
Sbjct  100   -IADPNSNFTVADFRRHASSTINSIVVGKRCLPILAGGSNSFIESLVEEE--PE------  150

Query  699   ECNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPL  520
                          RY CCFLWVDVS P+LN ++ +RVD M+++G++ E+   + DP N L
Sbjct  151   ----------FRYRYDCCFLWVDVSLPILNSFVSERVDRMLENGLVNEVRSLF-DP-NGL  198

Query  519   SRT---GLAKAIGVPEFAAYFRA----PRGGERRERLYAEAVREIKENTRLLAERQLRKI  361
                   G+ +AIGVPE  A+ RA        + R R+   A+ +IKENT  LA RQ +KI
Sbjct  199   GNDYGHGIRRAIGVPELDAFLRAEMDSATDDKTRSRILKAAILKIKENTIKLACRQRQKI  258

Query  360   QRLR-EVGGW-EMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE*VFQ  187
              RL+ +  GW  +HRI+AT  F      +  S+ A  WE  VV+PS KIV++FL E  F+
Sbjct  259   HRLQSKWRGWNNLHRIDATEVFLQLDSEDYSSDNA--WETLVVKPSFKIVDQFLSENSFK  316

Query  186   L  184
             L
Sbjct  317   L  317



>ref|XP_008458554.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Cucumis melo]
Length=328

 Score =   215 bits (547),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 132/301 (44%), Positives = 182/301 (60%), Gaps = 36/301 (12%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR ++DLATR+   AE+INSDKIQVYKGL + TNK+T  E RGV HHL+G  
Sbjct  45    MGATGTGKSRLAIDLATRF--PAEIINSDKIQVYKGLKVLTNKVTEKECRGVPHHLLG--  100

Query  876   EASESRPEFSAADFRAAGAERI-SDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDD  700
               ++    F+ ADFR   +  I S IVG+ ++P + GGSNS+I +L+ E   PE      
Sbjct  101   -IADPNSNFTVADFRRHASSAINSIIVGKRRLPILAGGSNSFIESLVEEE--PE------  151

Query  699   ECNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPS---  529
                          RY CCFLWVDVS P+LN ++ +RVD M+++G++ E+   + DP+   
Sbjct  152   ----------FRYRYDCCFLWVDVSLPILNSFVSERVDRMLENGLVNEVRNLF-DPNGLG  200

Query  528   NPLSRTGLAKAIGVPEFAAYFRA----PRGGERRERLYAEAVREIKENTRLLAERQLRKI  361
             N   R G+ +AIGVPE  A+ RA        + R R+   A+ +IKENT  LA RQ +KI
Sbjct  201   NDYGR-GIRRAIGVPELDAFLRAEMDSTTDDKARSRILKAAILKIKENTIKLACRQQQKI  259

Query  360   QRLREVG-GW-EMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE*VFQ  187
              RL+    GW   HRI+AT AF   +G+     +   WE  VV+PS  I+++FL +  F+
Sbjct  260   HRLQNKWRGWNNFHRIDATEAF-LQLGNGENYSSDNAWETLVVEPSSMIIDQFLSKNSFK  318

Query  186   L  184
             L
Sbjct  319   L  319



>ref|XP_008438727.1| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like 
[Cucumis melo]
Length=324

 Score =   214 bits (545),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 123/289 (43%), Positives = 175/289 (61%), Gaps = 33/289 (11%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR +++LATR+   +E++NSDKIQVY+GLD+ TNK+T  ERRG+ HHL+   
Sbjct  42    MGATGTGKSRLAIELATRF--PSEIVNSDKIQVYEGLDVVTNKVTEEERRGIPHHLLSSI  99

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             +    +  FS+ DF    +  I  I+ R ++P I GGSNSYI AL               
Sbjct  100   DP---KSNFSSRDFTHHASVAIESILARDRLPIIAGGSNSYIEAL---------------  141

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
                V D      RY  CFLWVDVS P+L +++  RVD M+D G +EE+ + + DP    S
Sbjct  142   ---VNDYAEARFRYEFCFLWVDVSLPILQKFVSDRVDRMVDGGFVEEVRQIF-DPEGDYS  197

Query  516   RTGLAKAIGVPEFAAYFRAPRGG--ERRERLYAE-AVREIKENTRLLAERQLRKIQRLRE  346
             + G+ +AIGVPE   Y RA R G  ER  ++  E A+  IK+NT  LA RQL KI+ L  
Sbjct  198   Q-GIKRAIGVPELHEYLRAERDGADERVLKILLELAISRIKDNTCRLAFRQLEKIRLLHT  256

Query  345   VGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLLE  199
                W + R++AT AF     ++ E+ + ++WE  V++PS +IV++FL +
Sbjct  257   KWNWNLRRLDATGAFL----TDGEN-SVDVWEKLVLEPSSRIVDQFLCD  300



>gb|EYU45613.1| hypothetical protein MIMGU_mgv1a022025mg, partial [Erythranthe 
guttata]
Length=293

 Score =   213 bits (542),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 135/289 (47%), Positives = 175/289 (61%), Gaps = 33/289 (11%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATG+GKSR SVDLATR++   EVINSDK+QVYKGLD+ TNK T  +RRGV HHL+G  
Sbjct  12    MGATGTGKSRLSVDLATRFY--GEVINSDKMQVYKGLDVATNKSTAADRRGVPHHLLGIV  69

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             +  ++   F+AA+F    +    +I GRG++P I GGSNS + AL V          D +
Sbjct  70    DDPDA--AFTAAEFVRRSSMAAEEISGRGRLPIIAGGSNSLVEALTVA---------DRQ  118

Query  696   CNSVGDSFGLELRYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPLS  517
               S         RY CCFLWV VS PVL+  + +RVD M+  G++EE + ++ +PS   S
Sbjct  119   FRS---------RYECCFLWVYVSAPVLHSVVSERVDRMVAGGLVEEAAEFF-NPSGDYS  168

Query  516   RTGLAKAIGVPEFAAYFR-AP-RGGERR-ERLYAEAVREIKENTRLLAERQLRKIQRLRE  346
             R G+ +AIGVPE   +F+  P  GGE     L   A+ EIKENT  L  RQL KI RLRE
Sbjct  169   R-GIRRAIGVPELHEFFKNGPFVGGEAAGADLLEAAIVEIKENTCKLTRRQLGKIWRLRE  227

Query  345   -VGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKFLL  202
              + G  MHR++AT  F    G     E  E WE  VV PS +I+ +FL+
Sbjct  228   KLAGRRMHRLDATGVFLNRGG-----EAVEAWEKMVVGPSTRILARFLI  271



>ref|XP_010488441.1| PREDICTED: adenylate isopentenyltransferase 7, mitochondrial-like 
[Camelina sativa]
Length=331

 Score =   213 bits (543),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 124/286 (43%), Positives = 170/286 (59%), Gaps = 31/286 (11%)
 Frame = -1

Query  1056  MGATGSGKSRASVDLATRYFTAAEVINSDKIQVYKGLDITTNKITMPERRGVEHHLIGEF  877
             MGATGSGK+R ++DLATR+ T  E+INSDKIQ+YKGLD+ TNK+T  E RGV HHL+G  
Sbjct  40    MGATGSGKTRLAIDLATRFQT--EIINSDKIQLYKGLDVLTNKVTPQESRGVPHHLLGVL  97

Query  876   EASESRPEFSAADFRAAGAERISDIVGRGKVPFIVGGSNSYIYALLVERFNPELDVFDDE  697
             ++       +A  +    ++ IS +    K+P + GGSNSYI AL               
Sbjct  98    DSEFG--NLTAIQYSRLASQAISTLSANHKLPIVAGGSNSYIEAL---------------  140

Query  696   CNSVGDSFGLEL-RYRCCFLWVDVSPPVLNRYLYKRVDEMMDSGMLEELSRWYSDPSNPL  520
                   + G  L  Y CCF+WVDVS PVLN ++ KRVD MM++G+LEE+   + +P    
Sbjct  141   ---ANHTSGFLLNNYECCFIWVDVSLPVLNSFVSKRVDRMMETGLLEEVREVF-NPKADY  196

Query  519   SRTGLAKAIGVPEFAAYFRAPRGGER-RERLYAE-AVREIKENTRLLAERQLRKIQRLRE  346
             S  G+ +AIGVPE   Y R     +R  +R+  + AV+ IK+NT LLA RQ +KIQRL +
Sbjct  197   S-VGIRRAIGVPELHEYLRYESLVDRATQRMMLDVAVKNIKKNTELLACRQFKKIQRLNK  255

Query  345   VGGWEMHRINATAAFAAAMGSESESETAEIWENQVVQPSMKIVEKF  208
                  MHR++AT  F       +  E  E W++ V +PS +IV+KF
Sbjct  256   KWKLSMHRVDATEVFL----KHNVEEQDEAWDSLVARPSERIVDKF  297



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3476474534244