BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c103598_g1_i1 len=270 path=[248:0-269]

Length=270
                                                                      Score     E

ref|XP_010672688.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    148   9e-40   
ref|XP_010673996.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    148   4e-39   
ref|XP_010674487.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    147   4e-39   
ref|XP_010669163.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    141   1e-38   
ref|XP_010675047.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    140   8e-38   
ref|XP_010679278.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    139   5e-37   
ref|XP_010681654.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    139   5e-37   
ref|XP_004292735.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    139   2e-36   
gb|KCW72771.1|  hypothetical protein EUGRSUZ_E01219                     126   1e-31   
gb|KCW63993.1|  hypothetical protein EUGRSUZ_G01680                     124   2e-31   
ref|XP_007219530.1|  hypothetical protein PRUPE_ppa022622mg             125   2e-31   
gb|KCW73916.1|  hypothetical protein EUGRSUZ_E02501                     125   2e-31   
ref|XP_007208744.1|  hypothetical protein PRUPE_ppa015375mg             125   2e-31   
ref|XP_008787110.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    125   4e-31   
gb|KCW54873.1|  hypothetical protein EUGRSUZ_I00824                     124   7e-31   
gb|KCW84786.1|  hypothetical protein EUGRSUZ_B01589                     124   8e-31   
gb|KCW73521.1|  hypothetical protein EUGRSUZ_E02037                     123   1e-30   
ref|XP_010056981.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    124   1e-30   
ref|XP_008241738.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    122   2e-30   
gb|KCW66792.1|  hypothetical protein EUGRSUZ_F00557                     120   3e-30   
ref|XP_007202195.1|  hypothetical protein PRUPE_ppa018832mg             120   1e-29   
ref|XP_010936518.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...    120   4e-29   
ref|XP_010936517.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...    120   4e-29   
ref|XP_010913807.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    119   4e-29   
gb|KCW84403.1|  hypothetical protein EUGRSUZ_B01259                     119   5e-29   
ref|XP_009339738.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    119   7e-29   
ref|XP_009360176.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    119   8e-29   
ref|XP_010027018.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    117   1e-28   
ref|XP_008781698.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    118   2e-28   
ref|XP_009123004.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    112   2e-28   
ref|XP_007204240.1|  hypothetical protein PRUPE_ppa002389mg             117   2e-28   
ref|XP_010070164.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 9-like    117   3e-28   
gb|KCW58772.1|  hypothetical protein EUGRSUZ_H01407                     116   4e-28   
gb|KCW80601.1|  hypothetical protein EUGRSUZ_C01967                     115   6e-28   
ref|XP_008660782.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    116   7e-28   
ref|XP_010028203.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...    116   8e-28   
ref|XP_010028196.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...    116   9e-28   
ref|XP_004289113.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 7-like    115   1e-27   
ref|XP_009339769.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    115   1e-27   
ref|NP_001174692.1|  Os06g0246700                                       115   1e-27   
gb|EEC80320.1|  hypothetical protein OsI_22363                          115   1e-27   Oryza sativa Indica Group [Indian rice]
ref|NP_001056912.1|  Os06g0166100                                       115   1e-27   Oryza sativa Japonica Group [Japonica rice]
gb|EEE65156.1|  hypothetical protein OsJ_20251                          115   2e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009355451.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    115   2e-27   
ref|XP_008353320.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    115   2e-27   
ref|XP_010665808.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    114   3e-27   
gb|EEC80328.1|  hypothetical protein OsI_22378                          114   3e-27   Oryza sativa Indica Group [Indian rice]
ref|XP_009615095.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    112   3e-27   
gb|KCW83084.1|  hypothetical protein EUGRSUZ_B00042                     114   3e-27   
gb|EEC80083.1|  hypothetical protein OsI_21811                          114   3e-27   Oryza sativa Indica Group [Indian rice]
ref|XP_010025987.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    114   3e-27   
ref|XP_010681849.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    114   4e-27   
ref|XP_010685218.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    112   4e-27   
ref|XP_008654144.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    113   5e-27   
ref|XP_010914593.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    114   5e-27   
ref|XP_008338060.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    113   8e-27   
ref|XP_008658616.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...    113   8e-27   
ref|XP_008658611.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...    113   8e-27   
dbj|BAJ89698.1|  predicted protein                                      113   8e-27   
ref|XP_003578884.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    113   8e-27   
ref|XP_008241736.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    112   9e-27   
ref|XP_008653248.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...    111   1e-26   
ref|NP_001047685.1|  Os02g0668200                                       112   2e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010507064.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    112   2e-26   
gb|EEE57540.1|  hypothetical protein OsJ_07864                          112   2e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010445346.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    112   2e-26   
ref|XP_009412131.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    112   3e-26   
ref|XP_010694768.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    107   3e-26   
ref|XP_006406281.1|  hypothetical protein EUTSA_v10021958mg             110   3e-26   
ref|XP_006281824.1|  hypothetical protein CARUB_v10028009mg             111   4e-26   
ref|XP_008338042.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    110   5e-26   
ref|XP_010924140.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...    111   5e-26   
ref|XP_010924139.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...    111   5e-26   
ref|XP_006406280.1|  hypothetical protein EUTSA_v10022007mg             110   6e-26   
gb|KCW51626.1|  hypothetical protein EUGRSUZ_J01116                     108   6e-26   
ref|XP_010696332.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    108   6e-26   
ref|XP_008809265.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    110   8e-26   
ref|XP_004967127.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    110   8e-26   
gb|EEE68621.1|  hypothetical protein OsJ_27177                          110   9e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010666753.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    108   1e-25   
ref|XP_004977727.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    110   1e-25   
ref|XP_003561049.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 9-like    110   1e-25   
gb|KCW79824.1|  hypothetical protein EUGRSUZ_C01167                     108   1e-25   
ref|XP_008670949.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...    110   1e-25   
ref|XP_010675549.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    107   1e-25   
ref|XP_010276947.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...    109   1e-25   
ref|XP_008670948.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...    110   1e-25   
ref|XP_010276948.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...    109   1e-25   
ref|XP_010276949.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...    109   1e-25   
gb|ABA92085.1|  transposon protein, putative, unclassified              109   2e-25   Oryza sativa Japonica Group [Japonica rice]
gb|KCW79823.1|  hypothetical protein EUGRSUZ_C01167                     108   2e-25   
ref|XP_009346054.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    108   2e-25   
ref|XP_010679286.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 6-like    109   2e-25   
ref|XP_004987222.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    107   2e-25   
ref|XP_008809356.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...    109   3e-25   
ref|XP_008809355.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...    109   3e-25   
ref|XP_008809351.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...    109   3e-25   
ref|XP_010495230.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    107   3e-25   
ref|XP_008809267.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    108   3e-25   
ref|XP_010229782.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    108   4e-25   
ref|XP_009403868.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...    108   4e-25   
ref|XP_009403859.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...    108   4e-25   
ref|XP_010914594.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    108   4e-25   
ref|XP_010246204.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    108   4e-25   
ref|XP_010236847.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 6-like    108   4e-25   
ref|XP_010047829.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 9-l...    108   4e-25   
ref|XP_010047831.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 9-l...    108   5e-25   
tpg|DAA62892.1|  TPA: FAR1-domain family sequence                       108   5e-25   
ref|XP_010227160.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    107   5e-25   
ref|XP_008653143.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...    108   5e-25   
ref|XP_002462925.1|  hypothetical protein SORBIDRAFT_02g034560          108   5e-25   Sorghum bicolor [broomcorn]
ref|XP_010047832.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...    108   5e-25   
ref|XP_010456530.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    108   5e-25   
ref|XP_008653142.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 9-l...    108   6e-25   
ref|XP_008653138.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 9-l...    108   6e-25   
ref|XP_007226784.1|  hypothetical protein PRUPE_ppa018163mg             107   7e-25   
ref|XP_008376001.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    108   7e-25   
ref|XP_010675037.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    107   8e-25   
gb|EAZ14299.1|  hypothetical protein OsJ_04225                          105   8e-25   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004304854.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    107   9e-25   
ref|XP_010236406.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    104   1e-24   
ref|XP_010692795.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    105   1e-24   
ref|XP_010675560.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    102   2e-24   
ref|XP_007224311.1|  hypothetical protein PRUPE_ppa020137mg             106   2e-24   
ref|XP_010418903.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    105   2e-24   
ref|XP_009103778.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    104   2e-24   
gb|KDO47576.1|  hypothetical protein CISIN_1g005927mg                   105   2e-24   
ref|XP_010681435.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    103   2e-24   
gb|KDO47577.1|  hypothetical protein CISIN_1g005927mg                   105   2e-24   
ref|XP_011039466.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 12-...    106   2e-24   
ref|XP_011039465.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 7-l...    106   2e-24   
ref|XP_011039464.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 7-l...    106   3e-24   
ref|XP_011039463.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 7-l...    106   3e-24   
ref|XP_008657613.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    105   3e-24   
ref|XP_011016614.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 7-l...    106   3e-24   
gb|KDO47575.1|  hypothetical protein CISIN_1g005927mg                   105   3e-24   
ref|XP_010665579.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    105   3e-24   
dbj|BAK02303.1|  predicted protein                                      105   3e-24   
ref|XP_008348691.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    105   4e-24   
ref|XP_008675775.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    104   4e-24   
ref|XP_009391987.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    105   5e-24   
ref|XP_010684208.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    102   5e-24   
ref|XP_004497701.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    105   5e-24   
ref|XP_004967151.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    104   5e-24   
ref|XP_004503202.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    105   6e-24   
gb|ABA95414.1|  transposon protein, putative, unclassified              105   6e-24   Oryza sativa Japonica Group [Japonica rice]
gb|EEE57168.1|  hypothetical protein OsJ_07098                          105   6e-24   Oryza sativa Japonica Group [Japonica rice]
gb|EEE52553.1|  hypothetical protein OsJ_34801                          105   6e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010263150.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...    105   7e-24   
ref|XP_010263131.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...    105   7e-24   
ref|XP_010468694.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    104   7e-24   
ref|XP_010686164.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    105   8e-24   
ref|NP_001047098.1|  Os02g0550900                                       104   8e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010229617.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    104   8e-24   
ref|XP_008662483.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    104   8e-24   
ref|XP_008392169.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    104   9e-24   
ref|XP_007200174.1|  hypothetical protein PRUPE_ppa016506mg             104   9e-24   
ref|XP_004955167.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    104   1e-23   
dbj|BAD15473.1|  putative far-red impaired response protein             104   1e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004295765.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    103   1e-23   
ref|XP_006655826.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...    104   1e-23   
ref|XP_006655825.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...    104   1e-23   
ref|XP_004974895.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    104   1e-23   
ref|XP_007213864.1|  hypothetical protein PRUPE_ppa016086mg             103   1e-23   
ref|XP_009391891.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 6-l...    104   1e-23   
ref|XP_010421147.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    101   2e-23   
gb|EMT21718.1|  Protein FAR1-RELATED SEQUENCE 5                         102   2e-23   
ref|XP_009116658.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...    104   2e-23   
ref|XP_009116657.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...    104   2e-23   
ref|XP_008381561.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    103   2e-23   
ref|XP_004505846.1|  PREDICTED: protein FAR-RED IMPAIRED RESPONSE...    102   2e-23   
gb|AAR87282.1|  hypothetical protein                                    102   2e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004289266.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    102   2e-23   
ref|XP_010923773.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    103   2e-23   
gb|ABF96373.1|  transposon protein, putative, unclassified              102   2e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002322730.2|  hypothetical protein POPTR_0016s05900g             103   2e-23   Populus trichocarpa [western balsam poplar]
ref|XP_010255612.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    103   2e-23   
ref|XP_002447845.1|  hypothetical protein SORBIDRAFT_06g016820          102   3e-23   Sorghum bicolor [broomcorn]
ref|XP_002444124.1|  hypothetical protein SORBIDRAFT_07g008830          100   3e-23   Sorghum bicolor [broomcorn]
ref|XP_010689813.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    102   3e-23   
ref|XP_008645783.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 12-...    103   3e-23   
ref|XP_008240644.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    103   3e-23   
gb|AFW71752.1|  FAR1-domain family sequence                             102   3e-23   
ref|XP_010941828.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    102   3e-23   
ref|XP_006647361.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 7-l...    103   3e-23   
ref|XP_010239385.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    100   4e-23   
ref|XP_004298288.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    102   4e-23   
ref|XP_007216405.1|  hypothetical protein PRUPE_ppa022645mg             102   4e-23   
ref|XP_008230452.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 12-...    102   4e-23   
ref|XP_009133360.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5         102   5e-23   
ref|XP_010257333.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...    102   5e-23   
ref|XP_010257327.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...    102   5e-23   
ref|XP_002444421.1|  hypothetical protein SORBIDRAFT_07g021690          102   5e-23   Sorghum bicolor [broomcorn]
ref|XP_010231561.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    102   6e-23   
ref|XP_009350481.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...    102   6e-23   
ref|XP_004289345.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  99.8    7e-23   
ref|XP_010236809.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 7-like    102   7e-23   
ref|XP_009350482.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...    102   7e-23   
ref|XP_008654819.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    101   8e-23   
ref|XP_003589508.1|  FAR1-related protein                               102   8e-23   
ref|XP_010463229.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  99.0    9e-23   
ref|XP_007212371.1|  hypothetical protein PRUPE_ppa014831mg             101   9e-23   
gb|AAL58182.1|AC027037_4  putative far-red impaired response protein    101   9e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004305654.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  97.8    1e-22   
ref|XP_010689192.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  97.8    1e-22   
ref|NP_001063309.1|  Os09g0446400                                       100   1e-22   Oryza sativa Japonica Group [Japonica rice]
gb|EEE69818.1|  hypothetical protein OsJ_29559                          100   1e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010250357.1|  PREDICTED: protein FAR-RED IMPAIRED RESPONSE...    101   1e-22   
ref|XP_006388581.1|  hypothetical protein POPTR_0149s00230g             101   1e-22   
ref|XP_008669590.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    100   1e-22   
ref|XP_006422378.1|  hypothetical protein CICLE_v10027888mg             101   1e-22   
ref|XP_006486554.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    101   2e-22   
ref|XP_002283202.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5         101   2e-22   Vitis vinifera
ref|XP_006663840.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    101   2e-22   
ref|XP_002446233.1|  hypothetical protein SORBIDRAFT_06g007340        98.6    2e-22   Sorghum bicolor [broomcorn]
ref|XP_006429377.1|  hypothetical protein CICLE_v10013423mg           99.4    2e-22   
ref|XP_010270684.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  98.2    2e-22   
emb|CAN68194.1|  hypothetical protein VITISV_036221                     101   2e-22   Vitis vinifera
ref|XP_003623738.1|  FAR1-related protein                               100   2e-22   
ref|XP_010682171.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 6-like    101   2e-22   
gb|EMS54139.1|  Vacuolar protein sorting-associated protein 11-li...    101   2e-22   
ref|XP_006373793.1|  hypothetical protein POPTR_0016s05920g             100   2e-22   
ref|XP_010265220.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...    100   2e-22   
ref|XP_007199084.1|  hypothetical protein PRUPE_ppa019160mg             100   2e-22   
ref|XP_010265223.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...    100   2e-22   
ref|XP_002464378.1|  hypothetical protein SORBIDRAFT_01g017200        99.8    3e-22   Sorghum bicolor [broomcorn]
ref|XP_009378028.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...    100   3e-22   
ref|XP_002443950.1|  hypothetical protein SORBIDRAFT_07g004960        98.2    3e-22   Sorghum bicolor [broomcorn]
ref|XP_008235836.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5         100   3e-22   
ref|XP_007200955.1|  hypothetical protein PRUPE_ppa001597mg             100   3e-22   
ref|XP_008338195.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  97.4    3e-22   
ref|XP_010675563.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 4-like    100   3e-22   
ref|XP_010265219.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...    100   3e-22   
ref|XP_010265222.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...    100   3e-22   
ref|XP_009378036.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...    100   3e-22   
ref|XP_008680369.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  98.6    3e-22   
dbj|BAD29488.1|  putative far-red impaired response protein             100   3e-22   Oryza sativa Japonica Group [Japonica rice]
emb|CAD40514.2|  OSJNBa0050F15.2                                        100   3e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008246383.1|  PREDICTED: uncharacterized protein LOC103344568  99.0    4e-22   
ref|XP_010273716.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...    100   4e-22   
ref|XP_010273714.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...    100   4e-22   
ref|XP_006655317.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like    100   4e-22   
ref|XP_008240566.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  97.4    4e-22   
ref|XP_010667744.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 6-like    100   4e-22   
ref|XP_008342648.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...    100   4e-22   
ref|XP_004295506.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  99.4    4e-22   
ref|XP_010028879.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5 i...  99.8    5e-22   
ref|XP_008233158.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  97.4    5e-22   
ref|XP_004959040.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  97.1    5e-22   
ref|XP_008653692.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  99.0    5e-22   
gb|ACF87445.1|  unknown                                               99.0    5e-22   Zea mays [maize]
ref|XP_008782893.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  99.8    5e-22   
emb|CAD40452.2|  OSJNBa0041M21.10                                       100   5e-22   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001141995.1|  uncharacterized protein LOC100274145               100   5e-22   Zea mays [maize]
ref|XP_008672513.1|  PREDICTED: uncharacterized protein LOC100274...    100   5e-22   
ref|XP_007049034.1|  FRS (FAR1 Related Sequences) transcription f...    100   5e-22   
ref|XP_010028878.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5 i...  99.8    5e-22   
ref|XP_008342649.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...    100   5e-22   
ref|XP_008672512.1|  PREDICTED: uncharacterized protein LOC100274...    100   5e-22   
ref|XP_008244497.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  97.4    5e-22   
gb|EEC74573.1|  hypothetical protein OsI_10136                          100   5e-22   Oryza sativa Indica Group [Indian rice]
gb|EEE63447.1|  hypothetical protein OsJ_18260                        99.8    5e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008679530.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  97.4    5e-22   
gb|ABD33026.2|  Cyclin-like F-box; FAR1; Zinc finger, SWIM-type         100   5e-22   Medicago truncatula
ref|XP_008782887.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  99.8    6e-22   
ref|XP_004297885.1|  PREDICTED: protein FAR-RED IMPAIRED RESPONSE...  99.4    6e-22   
ref|XP_008782870.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  99.8    6e-22   
ref|XP_007134998.1|  hypothetical protein PHAVU_010G093300g           99.8    6e-22   
ref|XP_008227658.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  99.0    6e-22   
tpg|DAA55614.1|  TPA: FAR1-domain family sequence                     99.8    6e-22   
ref|NP_001066217.1|  Os12g0160900                                     99.8    6e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011000845.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  99.8    6e-22   
ref|XP_010277381.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 12-...  99.8    6e-22   
ref|XP_010277380.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 12-...  99.8    6e-22   
ref|XP_004297991.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  97.1    7e-22   
ref|XP_006664437.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  99.4    7e-22   
ref|XP_008227616.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  97.1    7e-22   
ref|XP_008219733.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  99.4    7e-22   
ref|NP_001052447.2|  Os04g0316800                                     99.8    8e-22   Oryza sativa Japonica Group [Japonica rice]
gb|AAS79743.1|  putative Mutator-like transposase                     99.8    8e-22   
ref|XP_010268007.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  99.0    8e-22   
ref|XP_010690623.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  97.1    8e-22   
ref|XP_010690587.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5       99.4    9e-22   
ref|XP_010941614.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 3-like  99.4    1e-21   
ref|XP_010681755.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 6-like  98.6    1e-21   
ref|XP_008365189.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  96.3    1e-21   
ref|XP_004292935.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  99.0    1e-21   
ref|XP_010266716.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  99.0    1e-21   
ref|XP_003545054.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  99.0    1e-21   
ref|XP_007214218.1|  hypothetical protein PRUPE_ppa023217mg           99.0    1e-21   
gb|EAZ09297.1|  hypothetical protein OsI_31570                        97.1    1e-21   
ref|XP_008343658.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  97.8    1e-21   
ref|XP_007142582.1|  hypothetical protein PHAVU_008G293000g           99.0    1e-21   
ref|XP_008379783.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  97.8    1e-21   
ref|XP_008777505.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  98.6    1e-21   
ref|XP_007208966.1|  hypothetical protein PRUPE_ppb019935mg           98.6    1e-21   
ref|XP_008777503.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  98.6    1e-21   
ref|XP_010245238.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  98.6    1e-21   
ref|XP_004491651.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  98.6    1e-21   
ref|XP_008351541.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  96.3    1e-21   
ref|XP_007043118.1|  FAR1-related sequence 5                          98.6    1e-21   
ref|XP_006285782.1|  hypothetical protein CARUB_v10007256mg           98.6    1e-21   
ref|XP_010245899.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  98.6    1e-21   
gb|KHN32934.1|  Protein FAR1-RELATED SEQUENCE 5                       98.6    1e-21   
ref|XP_011088828.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5       98.6    1e-21   
gb|AAV31356.1|  hypothetical protein                                  98.6    1e-21   
ref|XP_006661165.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  98.6    2e-21   
ref|XP_004305530.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  98.2    2e-21   
ref|XP_008354517.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  97.8    2e-21   
ref|XP_010230235.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  96.7    2e-21   
ref|XP_006364336.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  98.2    2e-21   
ref|XP_004231108.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5       98.2    2e-21   
ref|XP_010694608.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  95.5    2e-21   
ref|XP_010277968.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  98.6    2e-21   
ref|XP_010277966.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  98.6    2e-21   
ref|XP_008652022.1|  PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1   98.2    2e-21   
ref|XP_010238603.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  98.2    2e-21   
gb|AAF66982.1|  transposase                                           97.8    2e-21   
ref|XP_010913167.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 6-like  98.2    2e-21   
gb|EEE65450.1|  hypothetical protein OsJ_20815                        96.7    2e-21   
ref|XP_008348184.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  97.8    2e-21   
ref|XP_006424144.1|  hypothetical protein CICLE_v10030168mg           95.1    2e-21   
ref|XP_004974618.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  97.1    2e-21   
ref|XP_011040842.1|  PREDICTED: LOW QUALITY PROTEIN: protein FAR1...  97.8    2e-21   
ref|XP_006384877.1|  hypothetical protein POPTR_0004s21880g           97.8    2e-21   
gb|KDP47038.1|  hypothetical protein JCGZ_10765                       97.8    2e-21   
ref|XP_002313567.1|  far-red impaired responsive family protein       97.8    3e-21   
ref|XP_010497176.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  97.4    3e-21   
ref|XP_008451177.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5       97.8    3e-21   
gb|EAZ03765.1|  hypothetical protein OsI_25894                        95.1    3e-21   
ref|XP_010937297.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  97.4    3e-21   
ref|XP_010937296.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  97.4    3e-21   
ref|XP_008229655.1|  PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1   97.8    3e-21   
ref|XP_008792111.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  97.4    3e-21   
ref|XP_008792107.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  97.4    3e-21   
ref|XP_004952839.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  97.4    3e-21   
ref|XP_008351321.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  97.4    3e-21   
ref|XP_010269017.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  97.4    3e-21   
ref|XP_010255614.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  97.4    3e-21   
ref|XP_008231820.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  94.0    3e-21   
ref|XP_010937295.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  97.4    3e-21   
ref|XP_003618131.1|  FAR1-related protein                             97.4    3e-21   
ref|XP_010937294.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  97.4    3e-21   
ref|XP_010930280.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 6-like  97.4    3e-21   
ref|XP_004977332.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  97.4    3e-21   
ref|XP_010271481.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  97.4    4e-21   
ref|XP_010436909.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  97.4    4e-21   
ref|XP_010446320.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5       97.4    4e-21   
ref|XP_010694613.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  97.1    4e-21   
ref|XP_008788240.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 6-like  97.4    4e-21   
ref|XP_006411599.1|  hypothetical protein EUTSA_v10024456mg           97.4    4e-21   
ref|XP_006487498.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  94.7    4e-21   
ref|XP_010245235.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  97.4    4e-21   
ref|XP_008245177.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  97.1    4e-21   
ref|XP_010266298.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  97.1    4e-21   
ref|XP_010254494.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 4-l...  97.4    4e-21   
ref|XP_010254493.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 4-l...  97.4    4e-21   
ref|XP_007217154.1|  hypothetical protein PRUPE_ppa001511mg           97.1    4e-21   
ref|XP_010245233.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  97.4    5e-21   
ref|XP_008359347.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  96.7    5e-21   
ref|NP_001066427.1|  Os12g0225300                                     97.1    5e-21   
gb|ABA96800.2|  transposon protein, putative, unclassified, expre...  97.1    5e-21   
ref|XP_010932383.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  96.7    5e-21   
gb|EAY82631.1|  hypothetical protein OsI_37851                        97.1    5e-21   
gb|EYU43726.1|  hypothetical protein MIMGU_mgv1a0034692mg             94.4    5e-21   
ref|XP_006379429.1|  hypothetical protein POPTR_0008s01240g           97.1    5e-21   
gb|EEE52964.1|  hypothetical protein OsJ_35610                        97.1    5e-21   
ref|XP_010436910.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  96.7    5e-21   
ref|XP_010930750.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  97.1    5e-21   
ref|XP_006379428.1|  hypothetical protein POPTR_0008s01240g           97.1    6e-21   
ref|XP_002308819.2|  hypothetical protein POPTR_0006s02140g           97.1    6e-21   
ref|XP_006379425.1|  hypothetical protein POPTR_0008s01240g           97.1    6e-21   
ref|XP_008246048.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  96.7    6e-21   
ref|XP_004301404.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  95.1    6e-21   
gb|KDP30425.1|  hypothetical protein JCGZ_16664                       97.1    6e-21   
ref|XP_010932381.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  96.7    6e-21   
ref|XP_003598469.1|  FAR1-related protein                             97.1    6e-21   
gb|EAY89425.1|  hypothetical protein OsI_10932                        94.0    6e-21   
gb|EPS62805.1|  hypothetical protein M569_11983                       96.7    6e-21   
ref|XP_009416288.1|  PREDICTED: protein FAR-RED IMPAIRED RESPONSE...  96.3    7e-21   
ref|XP_004144566.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  96.7    7e-21   
ref|NP_195531.1|  protein FAR1-related sequence 5                     96.7    7e-21   
ref|XP_010277289.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 4-like  96.7    7e-21   
ref|XP_010045143.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 3-l...  96.7    7e-21   
gb|KGN43377.1|  hypothetical protein Csa_7G029420                     96.7    7e-21   
ref|NP_001046234.1|  Os02g0202800                                     96.3    7e-21   
dbj|BAG95729.1|  unnamed protein product                              95.9    7e-21   
ref|XP_010045142.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 3-l...  96.7    8e-21   
ref|XP_008382516.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5       96.7    8e-21   
gb|KHN42330.1|  Protein FAR-RED IMPAIRED RESPONSE 1                   96.3    8e-21   
ref|XP_002282775.2|  PREDICTED: protein FAR1-RELATED SEQUENCE 6-like  96.3    8e-21   
ref|XP_010045140.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 3-l...  96.7    8e-21   
emb|CBI21061.3|  unnamed protein product                              95.5    8e-21   
ref|XP_008800847.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 6-like  96.7    8e-21   
ref|XP_007010682.1|  Far1-related sequence 3 isoform 1                96.7    8e-21   
ref|XP_004301415.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  94.0    8e-21   
ref|XP_006605996.1|  PREDICTED: protein FAR-RED IMPAIRED RESPONSE...  96.3    9e-21   
ref|XP_006605993.1|  PREDICTED: protein FAR-RED IMPAIRED RESPONSE...  96.3    9e-21   
gb|KDO38178.1|  hypothetical protein CISIN_1g046720mg                 94.7    9e-21   
ref|XP_003538916.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  96.3    9e-21   
ref|XP_002273089.3|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  95.9    9e-21   
ref|XP_010660320.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  95.9    9e-21   
ref|XP_010555162.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5       96.3    1e-20   
gb|EEC72703.1|  hypothetical protein OsI_06289                        95.9    1e-20   
ref|XP_009618370.1|  PREDICTED: protein FAR-RED IMPAIRED RESPONSE...  96.3    1e-20   
ref|XP_009618372.1|  PREDICTED: protein FAR-RED IMPAIRED RESPONSE...  96.3    1e-20   
ref|XP_010932932.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 6-like  95.9    1e-20   
ref|XP_006653766.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  96.3    1e-20   
ref|XP_009618373.1|  PREDICTED: protein FAR-RED IMPAIRED RESPONSE...  95.9    1e-20   
ref|XP_004496894.1|  PREDICTED: protein FAR-RED IMPAIRED RESPONSE...  95.9    1e-20   
ref|XP_002467387.1|  hypothetical protein SORBIDRAFT_01g026910        95.1    1e-20   
ref|XP_004496893.1|  PREDICTED: protein FAR-RED IMPAIRED RESPONSE...  95.9    1e-20   
ref|XP_004496892.1|  PREDICTED: protein FAR-RED IMPAIRED RESPONSE...  95.9    1e-20   
ref|XP_004496891.1|  PREDICTED: protein FAR-RED IMPAIRED RESPONSE...  95.9    1e-20   
ref|XP_006430508.1|  hypothetical protein CICLE_v10010993mg           96.3    1e-20   
ref|XP_010270590.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  95.9    1e-20   
ref|XP_004309932.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  94.4    1e-20   
gb|ABN05718.1|  FAR1; Zinc finger, SWIM-type                          95.9    1e-20   
ref|XP_004293046.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  95.9    1e-20   
gb|AAX96213.1|  transposon protein, putative, unclassified            96.3    1e-20   
ref|XP_010260535.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  92.4    1e-20   
ref|NP_001175190.1|  Os07g0461700                                     95.5    1e-20   
ref|XP_002445540.1|  hypothetical protein SORBIDRAFT_07g021130        94.7    1e-20   
ref|XP_011032969.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 3-like  95.9    1e-20   
ref|XP_004301632.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  94.7    1e-20   
gb|KHN46858.1|  Protein FAR1-RELATED SEQUENCE 5                       95.9    1e-20   
ref|XP_002459592.1|  hypothetical protein SORBIDRAFT_02g007217        95.5    1e-20   
ref|XP_006482039.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 7-l...  95.9    1e-20   
gb|KDO53664.1|  hypothetical protein CISIN_1g002062mg                 95.9    1e-20   
ref|XP_010279169.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  95.5    1e-20   
gb|KDP24914.1|  hypothetical protein JCGZ_24292                       95.9    1e-20   
emb|CBI30025.3|  unnamed protein product                              93.2    2e-20   
ref|XP_009358905.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5       95.5    2e-20   
ref|XP_010678267.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  92.8    2e-20   
gb|AAU10761.1|  unknown protein                                       95.5    2e-20   
dbj|BAD36174.1|  putative far-red impaired response protein           94.4    2e-20   
ref|XP_010927109.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 4-l...  95.9    2e-20   
ref|XP_009618369.1|  PREDICTED: protein FAR-RED IMPAIRED RESPONSE...  95.5    2e-20   
ref|XP_010927108.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 4-l...  95.9    2e-20   
ref|XP_009618368.1|  PREDICTED: protein FAR-RED IMPAIRED RESPONSE...  95.5    2e-20   
ref|XP_010927107.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 4-l...  95.9    2e-20   
gb|EEE51185.1|  hypothetical protein OsJ_31989                        94.7    2e-20   
ref|XP_009409125.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  95.1    2e-20   
emb|CAE02218.2|  OSJNBb0002N06.8                                      95.5    2e-20   
emb|CAH66594.1|  OSIGBa0092G14.5                                      95.5    2e-20   
ref|XP_010251622.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 3       95.5    2e-20   
ref|XP_010243044.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  95.1    2e-20   
ref|XP_009409124.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  95.1    2e-20   
ref|XP_004305953.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  95.5    2e-20   
ref|XP_009758605.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5       95.5    2e-20   
ref|XP_009612458.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5       95.5    2e-20   
ref|XP_009409120.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  95.1    2e-20   
ref|XP_009407252.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  95.1    2e-20   
ref|XP_003517928.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  95.1    2e-20   
ref|XP_011004446.1|  PREDICTED: protein FAR-RED IMPAIRED RESPONSE...  95.5    2e-20   
ref|XP_011004445.1|  PREDICTED: protein FAR-RED IMPAIRED RESPONSE...  95.5    2e-20   
ref|XP_010654817.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 8 i...  95.1    2e-20   
ref|XP_010654815.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 8 i...  95.1    2e-20   
emb|CAN78024.1|  hypothetical protein VITISV_031334                   95.1    2e-20   
ref|XP_006383797.1|  hypothetical protein POPTR_0005s27900g           95.1    2e-20   
ref|XP_002263391.2|  PREDICTED: protein FAR1-RELATED SEQUENCE 8 i...  95.1    2e-20   
ref|XP_004290092.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  95.1    2e-20   
emb|CBI36356.3|  unnamed protein product                              95.1    2e-20   
ref|XP_010654814.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 8 i...  95.1    2e-20   
ref|XP_006590934.1|  PREDICTED: protein FAR-RED IMPAIRED RESPONSE...  94.7    2e-20   
ref|XP_010233530.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  94.7    2e-20   
ref|XP_006435469.1|  hypothetical protein CICLE_v10000383mg           95.1    2e-20   
ref|XP_010940145.1|  PREDICTED: protein FAR-RED IMPAIRED RESPONSE...  95.1    2e-20   
ref|XP_010669724.1|  PREDICTED: protein FAR-RED IMPAIRED RESPONSE...  92.8    2e-20   
ref|XP_002439945.1|  hypothetical protein SORBIDRAFT_09g023170        95.1    2e-20   
gb|EYU36991.1|  hypothetical protein MIMGU_mgv1a0188031mg             94.7    3e-20   
gb|KDP46354.1|  hypothetical protein JCGZ_10194                       95.1    3e-20   
gb|EEE63476.1|  hypothetical protein OsJ_18290                        94.7    3e-20   
ref|XP_002463673.1|  hypothetical protein SORBIDRAFT_01g004013        94.7    3e-20   
ref|XP_004305996.1|  PREDICTED: protein FAR-RED IMPAIRED RESPONSE...  92.8    3e-20   
ref|XP_006391556.1|  hypothetical protein EUTSA_v10019760mg           93.6    3e-20   
ref|XP_009391893.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 2-l...  94.7    3e-20   
ref|XP_009415981.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 6-l...  95.1    3e-20   
emb|CAN71534.1|  hypothetical protein VITISV_018182                   94.7    3e-20   
ref|XP_010266300.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  94.7    3e-20   
ref|XP_009415980.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 6-l...  95.1    3e-20   
ref|XP_009415979.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 6-l...  95.1    3e-20   
ref|XP_009415978.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 6-l...  95.1    3e-20   
ref|XP_010649325.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  94.7    3e-20   
ref|XP_010327474.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 3-l...  94.7    3e-20   
ref|XP_003592163.1|  Cysteine-rich receptor-like protein kinase       95.5    3e-20   
ref|XP_009359644.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  94.7    3e-20   
ref|XP_010649324.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  94.7    3e-20   
ref|XP_010649323.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  94.7    3e-20   
emb|CAN63725.1|  hypothetical protein VITISV_039588                   94.7    3e-20   
ref|XP_008351540.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  94.4    3e-20   
dbj|BAC55610.1|  far-red impaired response protein-like               92.4    3e-20   
ref|XP_004230060.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 3-l...  94.7    3e-20   
ref|XP_006347699.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 3-l...  94.7    3e-20   
ref|XP_009772389.1|  PREDICTED: protein FAR-RED IMPAIRED RESPONSE...  94.7    3e-20   
ref|XP_009359643.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-l...  94.7    3e-20   
ref|XP_008238369.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  92.8    4e-20   
ref|XP_010649043.1|  PREDICTED: protein FAR-RED IMPAIRED RESPONSE...  94.7    4e-20   
ref|XP_010649039.1|  PREDICTED: protein FAR-RED IMPAIRED RESPONSE...  94.7    4e-20   
ref|XP_003571207.2|  PREDICTED: protein FAR1-RELATED SEQUENCE 3-like  94.4    4e-20   



>ref|XP_010672688.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Beta vulgaris 
subsp. vulgaris]
Length=659

 Score =   148 bits (374),  Expect = 9e-40, Method: Composition-based stats.
 Identities = 65/89 (73%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            MICGPFVGMNHH  N+MFG GFLLNE TDSFVWLF++FL++MGG+ P TIMTDQ AAM+ 
Sbjct  144  MICGPFVGMNHHQRNVMFGVGFLLNEDTDSFVWLFESFLKSMGGRSPITIMTDQDAAMAK  203

Query  182  AISLVFPSARHRLCIWHIGENSKKHIKCL  268
            AIS+VFP+  HRLCIWHIG+NS  +IK L
Sbjct  204  AISIVFPNVIHRLCIWHIGKNSINNIKGL  232



>ref|XP_010673996.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Beta vulgaris 
subsp. vulgaris]
Length=798

 Score =   148 bits (373),  Expect = 4e-39, Method: Composition-based stats.
 Identities = 65/89 (73%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            MICGPFVGMNHH  N+MFG GFLLNE TDSFVWLF +FL++MGG+ P TIMTDQ AAM+ 
Sbjct  283  MICGPFVGMNHHQRNVMFGVGFLLNEDTDSFVWLFDSFLKSMGGRSPITIMTDQDAAMAK  342

Query  182  AISLVFPSARHRLCIWHIGENSKKHIKCL  268
            AIS+VFP+  HRLCIWHIG+NS  +IK L
Sbjct  343  AISIVFPNVIHRLCIWHIGKNSINNIKGL  371



>ref|XP_010674487.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Beta vulgaris 
subsp. vulgaris]
Length=713

 Score =   147 bits (371),  Expect = 4e-39, Method: Composition-based stats.
 Identities = 65/89 (73%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            MICGPFVGMNHH  N+MFG GFLLNE TDSFVWLF +FL++MGG+ P TIMTDQ AAM+ 
Sbjct  198  MICGPFVGMNHHQRNVMFGVGFLLNEDTDSFVWLFDSFLKSMGGRSPITIMTDQDAAMAK  257

Query  182  AISLVFPSARHRLCIWHIGENSKKHIKCL  268
            AIS+VFP+  HRLCIWHIG+NS  +IK L
Sbjct  258  AISIVFPNVIHRLCIWHIGKNSINNIKGL  286



>ref|XP_010669163.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like, partial [Beta 
vulgaris subsp. vulgaris]
Length=310

 Score =   141 bits (356),  Expect = 1e-38, Method: Composition-based stats.
 Identities = 62/89 (70%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            MICGPFVGMNH+  N+MFG GF+LNE+  SF+WLF TFL++MGGK P TIMTDQ A+M+ 
Sbjct  194  MICGPFVGMNHNNKNVMFGIGFILNEKAVSFIWLFNTFLKSMGGKHPVTIMTDQSASMAK  253

Query  182  AISLVFPSARHRLCIWHIGENSKKHIKCL  268
            AI  VFP++R RLC WHIGENSKK+IK L
Sbjct  254  AIREVFPNSRQRLCTWHIGENSKKNIKKL  282



>ref|XP_010675047.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Beta vulgaris 
subsp. vulgaris]
Length=401

 Score =   140 bits (354),  Expect = 8e-38, Method: Composition-based stats.
 Identities = 62/89 (70%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            MICGPFVGMNH+  N+MFG GF+LNE+T SF+WLF TFL++M GK P TIMTDQ A+M+ 
Sbjct  194  MICGPFVGMNHNNKNVMFGIGFILNEKTVSFIWLFNTFLKSMSGKHPVTIMTDQSASMAK  253

Query  182  AISLVFPSARHRLCIWHIGENSKKHIKCL  268
            AI  VFP++R RLC WHIGENSKK+IK L
Sbjct  254  AIREVFPNSRQRLCTWHIGENSKKNIKKL  282



>ref|XP_010679278.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Beta vulgaris 
subsp. vulgaris]
Length=424

 Score =   139 bits (350),  Expect = 5e-37, Method: Composition-based stats.
 Identities = 59/89 (66%), Positives = 70/89 (79%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            ++C P VGMN+H  N MFGCGFLLNER  SFVWLF TFL++M    P+T+MTDQ  AM++
Sbjct  307  LVCAPLVGMNNHTHNCMFGCGFLLNERISSFVWLFTTFLKSMDNIHPKTVMTDQALAMAS  366

Query  182  AISLVFPSARHRLCIWHIGENSKKHIKCL  268
            AIS  FP A+HRLC WHIGENSKKHI+ L
Sbjct  367  AISSTFPDAKHRLCTWHIGENSKKHIRHL  395



>ref|XP_010681654.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Beta vulgaris 
subsp. vulgaris]
Length=414

 Score =   139 bits (349),  Expect = 5e-37, Method: Composition-based stats.
 Identities = 59/89 (66%), Positives = 70/89 (79%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            ++C P VGMN+H  N MFGCGFLLNER  SFVWLF TFL++M    P+T+MTDQ  AM++
Sbjct  297  LVCAPLVGMNNHTHNCMFGCGFLLNERISSFVWLFTTFLKSMDNIHPKTVMTDQALAMAS  356

Query  182  AISLVFPSARHRLCIWHIGENSKKHIKCL  268
            AIS  FP A+HRLC WHIGENSKKHI+ L
Sbjct  357  AISSTFPDAKHRLCTWHIGENSKKHIRHL  385



>ref|XP_004292735.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Fragaria vesca 
subsp. vesca]
Length=640

 Score =   139 bits (350),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 55/89 (62%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            MIC PFVG+NHH  N++FGC FLL+E TDSF+WLF+TFL+AM GK P+TI TD+C AM+ 
Sbjct  276  MICAPFVGVNHHWKNVLFGCAFLLDETTDSFIWLFETFLQAMEGKKPKTIFTDRCQAMAN  335

Query  182  AISLVFPSARHRLCIWHIGENSKKHIKCL  268
            AI  VFP +RHRLC+WHI +N+ +++ C+
Sbjct  336  AIEKVFPDSRHRLCLWHISKNAVQNLNCI  364



>gb|KCW72771.1| hypothetical protein EUGRSUZ_E01219, partial [Eucalyptus grandis]
Length=614

 Score =   126 bits (316),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 51/86 (59%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            +IC PFVG+NHH  N +FGC FLL+E  DSF+WLF+ FL++MG K P+TI TDQ  AM+ 
Sbjct  232  LICAPFVGVNHHWKNTLFGCAFLLDETADSFIWLFEVFLKSMGNKAPKTIFTDQDHAMAK  291

Query  182  AISLVFPSARHRLCIWHIGENSKKHI  259
            AI +VFP+ +HRLC WHI +N+ K+I
Sbjct  292  AIQIVFPNTQHRLCTWHIEKNANKNI  317



>gb|KCW63993.1| hypothetical protein EUGRSUZ_G01680 [Eucalyptus grandis]
Length=543

 Score =   124 bits (312),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 48/86 (56%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            +IC PFVG+NHH  N++FGC  LL+E  +SF+WLF+ FL++MG K P+TI TDQ  AM+ 
Sbjct  35   LICAPFVGVNHHWKNILFGCALLLDETAESFIWLFEVFLKSMGNKAPKTIFTDQDQAMAK  94

Query  182  AISLVFPSARHRLCIWHIGENSKKHI  259
            AI ++FP+ +HRLC WHIG+N+ ++I
Sbjct  95   AIRIMFPNTQHRLCTWHIGKNAHQNI  120



>ref|XP_007219530.1| hypothetical protein PRUPE_ppa022622mg [Prunus persica]
 gb|EMJ20729.1| hypothetical protein PRUPE_ppa022622mg [Prunus persica]
Length=613

 Score =   125 bits (314),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 50/86 (58%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            MIC PFVG+NHH  N++FGC FLL+E+ DSF+WLF+TFL +MGG+ P+TI TDQC AM+ 
Sbjct  215  MICAPFVGVNHHWKNVLFGCAFLLDEKIDSFIWLFETFLESMGGRKPKTIFTDQCQAMAN  274

Query  182  AISLVFPSARHRLCIWHIGENSKKHI  259
             I  VFP   H LC WHI +N+ +++
Sbjct  275  GIEKVFPGVCHHLCSWHISQNAARNL  300



>gb|KCW73916.1| hypothetical protein EUGRSUZ_E02501 [Eucalyptus grandis]
 gb|KCW73917.1| hypothetical protein EUGRSUZ_E02501 [Eucalyptus grandis]
Length=600

 Score =   125 bits (313),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 48/86 (56%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            +IC PFVG+NHH  N++FGC  LL+E  +SF+WLF+ FL++MG K P+TI TDQ  AM+ 
Sbjct  35   LICAPFVGVNHHWKNILFGCALLLDETAESFIWLFEVFLKSMGNKAPKTIFTDQDQAMAK  94

Query  182  AISLVFPSARHRLCIWHIGENSKKHI  259
            AI ++FP+ +HRLC WHIG+N+ ++I
Sbjct  95   AIRIMFPNTQHRLCTWHIGKNANQNI  120



>ref|XP_007208744.1| hypothetical protein PRUPE_ppa015375mg, partial [Prunus persica]
 gb|EMJ09943.1| hypothetical protein PRUPE_ppa015375mg, partial [Prunus persica]
Length=600

 Score =   125 bits (313),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 50/86 (58%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            MIC PFVG+NHH  N++FGC FLL+E+ DSF+WLF+TFL +MGG+ P+TI TDQC AM+ 
Sbjct  215  MICAPFVGVNHHWKNVLFGCAFLLDEKIDSFIWLFETFLESMGGRKPKTIFTDQCQAMAN  274

Query  182  AISLVFPSARHRLCIWHIGENSKKHI  259
             I  VFP   H LC WHI +N+ +++
Sbjct  275  GIEKVFPGVCHHLCSWHISQNAARNL  300



>ref|XP_008787110.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Phoenix dactylifera]
 ref|XP_008787111.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Phoenix dactylifera]
Length=872

 Score =   125 bits (315),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 51/85 (60%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = +2

Query  5    ICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAA  184
            IC PFVG+NHH  N++FGC FLL+E T SF+WLFK+FL++MG + P+TI TDQ  AM+ A
Sbjct  275  ICVPFVGVNHHWQNVIFGCAFLLDETTASFIWLFKSFLKSMGDRPPKTIFTDQNQAMTNA  334

Query  185  ISLVFPSARHRLCIWHIGENSKKHI  259
            I+ VFP+ RHRLC+WHI +N+  H+
Sbjct  335  ITEVFPNTRHRLCLWHIYKNAPSHL  359



>gb|KCW54873.1| hypothetical protein EUGRSUZ_I00824, partial [Eucalyptus grandis]
Length=622

 Score =   124 bits (310),  Expect = 7e-31, Method: Composition-based stats.
 Identities = 50/86 (58%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            +IC PFVG+N+H  N +FGC FLL+E  DSF+WLF+ FL++MG K P+TI TDQ  AM+ 
Sbjct  232  LICAPFVGVNYHWKNTLFGCAFLLDETADSFIWLFEVFLKSMGNKAPKTIFTDQDHAMAK  291

Query  182  AISLVFPSARHRLCIWHIGENSKKHI  259
            AI +VFP+ +HRLC WHI +N+ K+I
Sbjct  292  AIQIVFPNTQHRLCTWHIEKNANKNI  317



>gb|KCW84786.1| hypothetical protein EUGRSUZ_B01589, partial [Eucalyptus grandis]
Length=631

 Score =   124 bits (310),  Expect = 8e-31, Method: Composition-based stats.
 Identities = 54/89 (61%), Positives = 66/89 (74%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            MIC PFVG+NHH  N++FGC FL++E   SFVW F++FL AMG K P+TI TDQ  AM+ 
Sbjct  233  MICAPFVGVNHHWKNVLFGCAFLMDETIASFVWAFQSFLEAMGNKAPKTIFTDQDHAMAN  292

Query  182  AISLVFPSARHRLCIWHIGENSKKHIKCL  268
            AI  VFP++ HRLCIWHIG+N   HI  L
Sbjct  293  AIRTVFPNSDHRLCIWHIGKNDTHHIAHL  321



>gb|KCW73521.1| hypothetical protein EUGRSUZ_E02037 [Eucalyptus grandis]
Length=571

 Score =   123 bits (308),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            +IC PFVG++HH  N++FGC  LL+E  +SF+WLF+ FL++MG K P+TI TDQ  AM+ 
Sbjct  35   LICAPFVGVSHHWKNILFGCALLLDETIESFIWLFEVFLKSMGNKAPKTIFTDQDQAMAK  94

Query  182  AISLVFPSARHRLCIWHIGENSKKHI  259
            AI ++FP+ +HRLC WHIG+N+ ++I
Sbjct  95   AIRIMFPNTQHRLCTWHIGKNAHQNI  120



>ref|XP_010056981.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Eucalyptus grandis]
Length=824

 Score =   124 bits (311),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 48/86 (56%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            +IC PFVG+NHH  N++FGC  LL+E  +SF+WLF+ FL++MG K P+TI TDQ  AM+ 
Sbjct  259  LICAPFVGVNHHWKNILFGCALLLDETAESFIWLFEVFLKSMGNKAPKTIFTDQDQAMAK  318

Query  182  AISLVFPSARHRLCIWHIGENSKKHI  259
            AI ++FP+ +HRLC WHIG+N+ ++I
Sbjct  319  AIRIMFPNTQHRLCTWHIGKNANQNI  344



>ref|XP_008241738.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Prunus mume]
 ref|XP_008241739.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Prunus mume]
Length=668

 Score =   122 bits (307),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 50/86 (58%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            +IC PFVG+NHHC N++FGC F+ +E TDSFVWLF+TFL +MG K P+TI TD   AM+ 
Sbjct  261  LICAPFVGVNHHCKNVLFGCAFVSDESTDSFVWLFETFLESMGYKQPKTIFTDVGDAMAN  320

Query  182  AISLVFPSARHRLCIWHIGENSKKHI  259
            AI+++    RHRLCIWHI +N+ ++I
Sbjct  321  AIAVMLRETRHRLCIWHISKNATQYI  346



>gb|KCW66792.1| hypothetical protein EUGRSUZ_F00557 [Eucalyptus grandis]
Length=508

 Score =   120 bits (302),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 48/86 (56%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            +IC PFVG+NHH  N +FGC FLL+E  + F+WLF+ FL++MG K P+TI T+Q  AM+ 
Sbjct  163  LICAPFVGVNHHRKNTLFGCAFLLDETANLFIWLFEVFLKSMGNKAPKTIFTEQDHAMAK  222

Query  182  AISLVFPSARHRLCIWHIGENSKKHI  259
            AI +VFP+ +HRLC WHI +N+ K+I
Sbjct  223  AIQIVFPNTQHRLCTWHIEKNANKNI  248



>ref|XP_007202195.1| hypothetical protein PRUPE_ppa018832mg [Prunus persica]
 gb|EMJ03394.1| hypothetical protein PRUPE_ppa018832mg [Prunus persica]
Length=649

 Score =   120 bits (302),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 49/86 (57%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            +IC PFVG+NHHC N++FGC F+ +E TDSF+WLF+TFL +MG K P+TI TD   AM+ 
Sbjct  261  LICAPFVGVNHHCKNVLFGCAFVSDESTDSFIWLFETFLESMGYKQPKTIFTDVGNAMAN  320

Query  182  AISLVFPSARHRLCIWHIGENSKKHI  259
            AI ++    RHRLCIWHI +N+ ++I
Sbjct  321  AIVVMLRETRHRLCIWHISKNATQYI  346



>ref|XP_010936518.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X2 [Elaeis 
guineensis]
Length=839

 Score =   120 bits (300),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 47/85 (55%), Positives = 67/85 (79%), Gaps = 0/85 (0%)
 Frame = +2

Query  5    ICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAA  184
            IC PF+G+NHH  N++FGC FLL+E   SF+WLFK+FL++MG + P+TI TDQ  A++ A
Sbjct  274  ICVPFIGVNHHWQNVIFGCAFLLDETASSFIWLFKSFLKSMGDQPPKTIFTDQNQAITNA  333

Query  185  ISLVFPSARHRLCIWHIGENSKKHI  259
            I+ VFP+ RHRLC+WHI +N+  ++
Sbjct  334  ITEVFPNTRHRLCLWHIYKNAPSYL  358



>ref|XP_010936517.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1 [Elaeis 
guineensis]
Length=863

 Score =   120 bits (300),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 47/85 (55%), Positives = 67/85 (79%), Gaps = 0/85 (0%)
 Frame = +2

Query  5    ICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAA  184
            IC PF+G+NHH  N++FGC FLL+E   SF+WLFK+FL++MG + P+TI TDQ  A++ A
Sbjct  274  ICVPFIGVNHHWQNVIFGCAFLLDETASSFIWLFKSFLKSMGDQPPKTIFTDQNQAITNA  333

Query  185  ISLVFPSARHRLCIWHIGENSKKHI  259
            I+ VFP+ RHRLC+WHI +N+  ++
Sbjct  334  ITEVFPNTRHRLCLWHIYKNAPSYL  358



>ref|XP_010913807.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Elaeis guineensis]
Length=708

 Score =   119 bits (299),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 49/89 (55%), Positives = 66/89 (74%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            +IC PFVG+NHH  N+MFGC FL +E T SF+WLFK+FL +M  + P+TI TDQ  AM+ 
Sbjct  293  LICAPFVGVNHHRQNVMFGCAFLFDETTTSFIWLFKSFLESMDDRPPKTIFTDQDHAMAN  352

Query  182  AISLVFPSARHRLCIWHIGENSKKHIKCL  268
            AI+ VFP+ +H LC+WHI +N+  H+  L
Sbjct  353  AIAEVFPNTQHCLCLWHIYKNAPSHLSSL  381



>gb|KCW84403.1| hypothetical protein EUGRSUZ_B01259 [Eucalyptus grandis]
Length=619

 Score =   119 bits (297),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            +ICGPFVG+NHH  N +FGC FL +E   SF+WLF+ FL++MG K P+TI TDQ  A++ 
Sbjct  221  LICGPFVGVNHHWKNTLFGCAFLSDETAISFIWLFEVFLKSMGNKAPKTIFTDQDQAIAK  280

Query  182  AISLVFPSARHRLCIWHIGENSKKHI  259
            AI  VFP+ +HRLC WHIG+N+ ++I
Sbjct  281  AIRTVFPNTQHRLCTWHIGKNANQNI  306



>ref|XP_009339738.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Pyrus x bretschneideri]
Length=702

 Score =   119 bits (297),  Expect = 7e-29, Method: Composition-based stats.
 Identities = 52/89 (58%), Positives = 64/89 (72%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            +IC  FVG+NHH  N++ GC FLL+E T+SFVWLFKTFL +MG K P+TI TD+  AM+ 
Sbjct  208  LICAVFVGVNHHWKNVLLGCAFLLDESTESFVWLFKTFLESMGNKQPKTIFTDEDQAMAN  267

Query  182  AISLVFPSARHRLCIWHIGENSKKHIKCL  268
            AI  VF   RHRLC WHI  N+ K+I  L
Sbjct  268  AIEQVFTGPRHRLCTWHIAHNATKNISSL  296



>ref|XP_009360176.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Pyrus x bretschneideri]
Length=727

 Score =   119 bits (297),  Expect = 8e-29, Method: Composition-based stats.
 Identities = 52/89 (58%), Positives = 64/89 (72%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            +IC  FVG+NHH  N++ GC FLL+E T+SFVWLFKTFL +MG K P+TI TD+  AM+ 
Sbjct  243  LICAIFVGVNHHWKNVLLGCAFLLDESTESFVWLFKTFLESMGNKQPRTIFTDEDQAMAN  302

Query  182  AISLVFPSARHRLCIWHIGENSKKHIKCL  268
            AI  VF   RHRLC WHI  N+ K+I  L
Sbjct  303  AIEQVFTGTRHRLCTWHIAHNATKNISSL  331



>ref|XP_010027018.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Eucalyptus grandis]
Length=611

 Score =   117 bits (293),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 49/86 (57%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            +IC PFVG+NHH  N +FGC FLL+E  +SF+WLF  FL +MG K P+TI T+Q  AM+ 
Sbjct  259  LICAPFVGVNHHWKNTVFGCTFLLDETAESFIWLFNVFLESMGDKAPKTIFTNQDQAMAK  318

Query  182  AISLVFPSARHRLCIWHIGENSKKHI  259
            AI +VFP+ +HRLC WHI +N+ K+I
Sbjct  319  AIRVVFPNTQHRLCTWHIIQNAIKNI  344



>ref|XP_008781698.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Phoenix dactylifera]
Length=725

 Score =   118 bits (295),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 49/89 (55%), Positives = 65/89 (73%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            +IC PFVG+NHH  N+MFGC FL +E   SF+WLFK+FL +MG + P+TI TDQ  AM  
Sbjct  294  LICAPFVGVNHHWQNVMFGCAFLFDETMTSFIWLFKSFLESMGDQPPKTIFTDQDQAMVN  353

Query  182  AISLVFPSARHRLCIWHIGENSKKHIKCL  268
            AI+ VFP+ +H LC+WHI +N+  H+  L
Sbjct  354  AIAEVFPNTQHCLCLWHICKNAPSHLGSL  382



>ref|XP_009123004.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Brassica rapa]
Length=198

 Score =   112 bits (279),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 47/83 (57%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = +2

Query  11   GPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAIS  190
             PFVG+NHH  +++FG   L +E T+SF WLF TFL AM GK PQTI TDQCAAM+ +I 
Sbjct  75   APFVGVNHHKQSIVFGVALLYDETTESFEWLFLTFLGAMSGKQPQTIFTDQCAAMANSIE  134

Query  191  LVFPSARHRLCIWHIGENSKKHI  259
             VFP  +H+LC+WHI +N+ K +
Sbjct  135  KVFPETKHKLCVWHIYQNAAKRL  157



>ref|XP_007204240.1| hypothetical protein PRUPE_ppa002389mg [Prunus persica]
 gb|EMJ05439.1| hypothetical protein PRUPE_ppa002389mg [Prunus persica]
Length=678

 Score =   117 bits (293),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 50/91 (55%), Positives = 65/91 (71%), Gaps = 2/91 (2%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAM--  175
            ++C PF+G+NHH  N+ FGC FLL+E  DSFVWLF+TFL +MG K P+TI TD+  AM  
Sbjct  259  LVCSPFLGVNHHWKNISFGCAFLLDESADSFVWLFETFLESMGNKQPKTIFTDEDKAMEK  318

Query  176  SAAISLVFPSARHRLCIWHIGENSKKHIKCL  268
            + AI  VFP  RHRLC W I +N+ +H+  L
Sbjct  319  AKAIETVFPETRHRLCNWQISKNATQHLASL  349



>ref|XP_010070164.1| PREDICTED: protein FAR1-RELATED SEQUENCE 9-like [Eucalyptus grandis]
Length=806

 Score =   117 bits (293),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 46/86 (53%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            MIC  FVG+NHH  N++FGC FL++E  +SF+WLF+ FL++MG K P+T+ TDQ   M+ 
Sbjct  250  MICAHFVGVNHHWKNVLFGCAFLMDETVESFIWLFEAFLKSMGNKAPKTMFTDQDQVMAK  309

Query  182  AISLVFPSARHRLCIWHIGENSKKHI  259
            AI +VFP+ +HRLC WHI +N+ ++I
Sbjct  310  AIRMVFPNTQHRLCTWHIMKNANQNI  335



>gb|KCW58772.1| hypothetical protein EUGRSUZ_H01407, partial [Eucalyptus grandis]
Length=621

 Score =   116 bits (290),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 46/86 (53%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            MIC  FVG+NHH  N++FGC FL++E  +SF+WLF+ FL++MG K P+T+ TDQ   M+ 
Sbjct  233  MICAHFVGVNHHWKNVLFGCAFLMDETVESFIWLFEAFLKSMGNKAPKTMFTDQDQVMAK  292

Query  182  AISLVFPSARHRLCIWHIGENSKKHI  259
            AI +VFP+ +HRLC WHI +N+ ++I
Sbjct  293  AIRMVFPNTQHRLCTWHIMKNANQNI  318



>gb|KCW80601.1| hypothetical protein EUGRSUZ_C01967 [Eucalyptus grandis]
Length=636

 Score =   115 bits (289),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 62/86 (72%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            MIC PFVG+NHH  N++F C FLL+E   SFVW  ++FL AMG K P+TI TDQ  AM+ 
Sbjct  233  MICAPFVGLNHHWKNVLFDCAFLLDETIASFVWALQSFLEAMGNKAPKTIFTDQDHAMAN  292

Query  182  AISLVFPSARHRLCIWHIGENSKKHI  259
            AI  V P+  HRLC+WHIG+N+  HI
Sbjct  293  AIRTVLPNTSHRLCVWHIGKNATHHI  318



>ref|XP_008660782.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Zea mays]
Length=698

 Score =   116 bits (290),  Expect = 7e-28, Method: Composition-based stats.
 Identities = 49/86 (57%), Positives = 60/86 (70%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            M   P +G NHH   ++F    L NE  +SF+WLF TFL AM GK P TI TDQCAAMSA
Sbjct  278  MPFAPLLGTNHHKRTIIFRAALLYNETIESFIWLFNTFLAAMSGKHPSTIFTDQCAAMSA  337

Query  182  AISLVFPSARHRLCIWHIGENSKKHI  259
            AI +V P+ RHRLC+WHI +N+ KH+
Sbjct  338  AIRIVLPNTRHRLCLWHIYQNAAKHL  363



>ref|XP_010028203.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X2 [Eucalyptus 
grandis]
Length=811

 Score =   116 bits (290),  Expect = 8e-28, Method: Composition-based stats.
 Identities = 46/86 (53%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            M+C PFVG+NHH  N++FGC FL +E  +SF+WLF  FL++MG K  +T+ TDQ  AM+ 
Sbjct  245  MVCAPFVGVNHHWKNVLFGCAFLADETAESFIWLFDAFLKSMGNKALKTMFTDQDQAMAK  304

Query  182  AISLVFPSARHRLCIWHIGENSKKHI  259
            AI +VFP+ +HRLC WHI +N+ ++I
Sbjct  305  AIRMVFPNTQHRLCTWHIMKNANENI  330



>ref|XP_010028196.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1 [Eucalyptus 
grandis]
 ref|XP_010028197.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1 [Eucalyptus 
grandis]
 ref|XP_010028199.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1 [Eucalyptus 
grandis]
 ref|XP_010028200.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1 [Eucalyptus 
grandis]
 ref|XP_010028201.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1 [Eucalyptus 
grandis]
 ref|XP_010028202.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1 [Eucalyptus 
grandis]
Length=813

 Score =   116 bits (290),  Expect = 9e-28, Method: Composition-based stats.
 Identities = 46/86 (53%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            M+C PFVG+NHH  N++FGC FL +E  +SF+WLF  FL++MG K  +T+ TDQ  AM+ 
Sbjct  245  MVCAPFVGVNHHWKNVLFGCAFLADETAESFIWLFDAFLKSMGNKALKTMFTDQDQAMAK  304

Query  182  AISLVFPSARHRLCIWHIGENSKKHI  259
            AI +VFP+ +HRLC WHI +N+ ++I
Sbjct  305  AIRMVFPNTQHRLCTWHIMKNANENI  330



>ref|XP_004289113.1| PREDICTED: protein FAR1-RELATED SEQUENCE 7-like [Fragaria vesca 
subsp. vesca]
Length=660

 Score =   115 bits (288),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 44/86 (51%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            ++C PFVG++HH  N++FGC FLL+E TDSF WLF+ FL +MG K P+TI TD+  AM+ 
Sbjct  266  LVCAPFVGVDHHWKNVLFGCAFLLDESTDSFTWLFENFLESMGDKRPKTIFTDEDNAMAK  325

Query  182  AISLVFPSARHRLCIWHIGENSKKHI  259
            AI ++ P   HRLC W+I +N+ +++
Sbjct  326  AIEVILPGTHHRLCTWNISKNASQYL  351



>ref|XP_009339769.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Pyrus x bretschneideri]
Length=720

 Score =   115 bits (288),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 51/89 (57%), Positives = 62/89 (70%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            +IC  FVG+NHH  N++ GC FLL+E T+SFVWLFKTFL +MG K P+TI  D+  AM  
Sbjct  226  LICAIFVGVNHHRKNVLLGCAFLLDESTESFVWLFKTFLESMGNKQPKTIFIDEDQAMEN  285

Query  182  AISLVFPSARHRLCIWHIGENSKKHIKCL  268
            AI  VF   RHRLC WHI  N+ K+I  L
Sbjct  286  AIEQVFMGTRHRLCTWHIAHNATKNISSL  314



>ref|NP_001174692.1| Os06g0246700 [Oryza sativa Japonica Group]
 dbj|BAH93420.1| Os06g0246700 [Oryza sativa Japonica Group]
Length=821

 Score =   115 bits (289),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 49/86 (57%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            M C PF+G+N H  ++  GCGFL NE+T++FVWLF+ FL AM G  P  I+TDQ  AM A
Sbjct  359  MPCAPFIGLNKHGQSIQLGCGFLRNEKTETFVWLFQAFLEAMEGVEPTNIITDQDLAMKA  418

Query  182  AISLVFPSARHRLCIWHIGENSKKHI  259
            AI+LVFP A+HR C WHI +N++K I
Sbjct  419  AIALVFPHAKHRNCHWHIMQNAQKKI  444



>gb|EEC80320.1| hypothetical protein OsI_22363 [Oryza sativa Indica Group]
Length=829

 Score =   115 bits (289),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 49/86 (57%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            M C PF+G+N H  ++  GCGFL NE+T++FVWLF+ FL AM G  P  I+TDQ  AM A
Sbjct  367  MPCAPFIGLNKHGQSIQLGCGFLRNEKTETFVWLFQAFLEAMEGVEPTNIITDQDLAMKA  426

Query  182  AISLVFPSARHRLCIWHIGENSKKHI  259
            AI+LVFP A+HR C WHI +N++K I
Sbjct  427  AIALVFPHAKHRNCHWHIMQNAQKKI  452



>ref|NP_001056912.1| Os06g0166100 [Oryza sativa Japonica Group]
 dbj|BAD67598.1| putative far-red impaired response protein [Oryza sativa Japonica 
Group]
 dbj|BAD67861.1| putative far-red impaired response protein [Oryza sativa Japonica 
Group]
 dbj|BAF18826.1| Os06g0166100 [Oryza sativa Japonica Group]
Length=780

 Score =   115 bits (288),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 44/86 (51%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            ++C PFVG+NHH  N++FGC FLL+E + S+VWLFK+FL +MGG+ P++I TDQ  A++ 
Sbjct  275  LVCAPFVGVNHHWQNIVFGCAFLLDESSASYVWLFKSFLESMGGRSPKSIFTDQDDAITQ  334

Query  182  AISLVFPSARHRLCIWHIGENSKKHI  259
            A+ LVFP+ +H    WHI +N++ H+
Sbjct  335  AVELVFPNTQHCFSYWHILKNAQSHL  360



>gb|EEE65156.1| hypothetical protein OsJ_20251 [Oryza sativa Japonica Group]
Length=792

 Score =   115 bits (288),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 44/86 (51%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            ++C PFVG+NHH  N++FGC FLL+E + S+VWLFK+FL +MGG+ P++I TDQ  A++ 
Sbjct  275  LVCAPFVGVNHHWQNIVFGCAFLLDESSASYVWLFKSFLESMGGRSPKSIFTDQDDAITQ  334

Query  182  AISLVFPSARHRLCIWHIGENSKKHI  259
            A+ LVFP+ +H    WHI +N++ H+
Sbjct  335  AVELVFPNTQHCFSYWHILKNAQSHL  360



>ref|XP_009355451.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Pyrus x bretschneideri]
Length=703

 Score =   115 bits (287),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 50/89 (56%), Positives = 64/89 (72%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            +IC  FVG+NHH  N++ GC FLL++ T+SFVWLFKTFL +MG K P+TI TD+  AM+ 
Sbjct  243  LICVVFVGVNHHWKNVLLGCAFLLDKSTESFVWLFKTFLESMGNKQPKTIFTDEDQAMAN  302

Query  182  AISLVFPSARHRLCIWHIGENSKKHIKCL  268
            AI  VF   RHRLC WHI  N+ ++I  L
Sbjct  303  AIEQVFTGTRHRLCTWHIAHNATRNISSL  331



>ref|XP_008353320.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Malus domestica]
Length=844

 Score =   115 bits (288),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 47/89 (53%), Positives = 61/89 (69%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            MIC PFVG+NHH  N++FGC FLL+E+T++F WLF TF  + GG+ P+TI T QC AM+ 
Sbjct  285  MICAPFVGVNHHWKNVLFGCAFLLDEKTETFTWLFDTFXESXGGQKPKTIFTXQCQAMAN  344

Query  182  AISLVFPSARHRLCIWHIGENSKKHIKCL  268
             I  VF    H LC WHI +N  K++  L
Sbjct  345  GIEKVFSXVCHXLCSWHISQNCXKNMSSL  373



>ref|XP_010665808.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Beta vulgaris 
subsp. vulgaris]
Length=789

 Score =   114 bits (286),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 49/89 (55%), Positives = 63/89 (71%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            +ICG FVG+N+H  N+MFGC FL +E  D+FVWLF+ F + MGG CP +I TDQ  AMS 
Sbjct  330  LICGAFVGINNHWKNIMFGCCFLSDETIDTFVWLFEVFKKCMGGVCPVSIFTDQDQAMSN  389

Query  182  AISLVFPSARHRLCIWHIGENSKKHIKCL  268
            A+S VFP+ R RLC WH+ +N+  H   L
Sbjct  390  ALSQVFPNTRARLCQWHLYQNAVSHFGTL  418



>gb|EEC80328.1| hypothetical protein OsI_22378 [Oryza sativa Indica Group]
Length=692

 Score =   114 bits (285),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 49/86 (57%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            M C PF+G+N H  ++  GCGFL NE+T++FVWLF+ FL AM G  P  I+TDQ  AM A
Sbjct  264  MPCAPFIGINRHGQSIQLGCGFLRNEKTETFVWLFQEFLEAMEGVEPINIITDQDLAMKA  323

Query  182  AISLVFPSARHRLCIWHIGENSKKHI  259
            AI+LVFP A+HR C WHI +N++K I
Sbjct  324  AIALVFPHAKHRNCRWHIMQNAQKKI  349



>ref|XP_009615095.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Nicotiana tomentosiformis]
Length=412

 Score =   112 bits (279),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 46/86 (53%), Positives = 59/86 (69%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            MIC PF+G+NHH  N++FGC FL +E  +SF WLF TFL++MG   P+TI+TDQ  AM+ 
Sbjct  163  MICAPFIGINHHWRNIIFGCAFLSDESAESFKWLFSTFLKSMGDIAPKTIITDQIQAMAI  222

Query  182  AISLVFPSARHRLCIWHIGENSKKHI  259
            AI  V    RH LC WHI  N+  H+
Sbjct  223  AIREVMSGTRHGLCQWHISHNAPSHL  248



>gb|KCW83084.1| hypothetical protein EUGRSUZ_B00042 [Eucalyptus grandis]
Length=806

 Score =   114 bits (286),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 48/86 (56%), Positives = 62/86 (72%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            +IC PFVG+NHH  N +FGC FLL+E  +SF WLF  FL +M  K P+TI TDQ  AM+ 
Sbjct  283  LICAPFVGVNHHWKNTLFGCAFLLDETAESFTWLFDVFLESMENKAPKTIFTDQDQAMAK  342

Query  182  AISLVFPSARHRLCIWHIGENSKKHI  259
            AI  VFP+ +HRLC WHI +N+ ++I
Sbjct  343  AIRRVFPNTQHRLCPWHIIKNANQNI  368



>gb|EEC80083.1| hypothetical protein OsI_21811 [Oryza sativa Indica Group]
Length=819

 Score =   114 bits (286),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 44/86 (51%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            ++C PFVG+NHH  N++FGC FLL+E + S+VWLFK+FL +MGG+ P++I TDQ  A++ 
Sbjct  275  LVCAPFVGVNHHWQNIVFGCAFLLDESSASYVWLFKSFLESMGGRSPKSIFTDQDDAITQ  334

Query  182  AISLVFPSARHRLCIWHIGENSKKHI  259
            A+ LVFP+ +H    WHI +N++ H+
Sbjct  335  AVELVFPNTQHCFSYWHILKNAQSHL  360



>ref|XP_010025987.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Eucalyptus grandis]
 ref|XP_010025992.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Eucalyptus grandis]
Length=825

 Score =   114 bits (286),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 48/86 (56%), Positives = 62/86 (72%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            +IC PFVG+NHH  N +FGC FLL+E  +SF WLF  FL +M  K P+TI TDQ  AM+ 
Sbjct  253  LICAPFVGVNHHWKNTLFGCAFLLDETAESFTWLFDVFLESMENKAPKTIFTDQDQAMAK  312

Query  182  AISLVFPSARHRLCIWHIGENSKKHI  259
            AI  VFP+ +HRLC WHI +N+ ++I
Sbjct  313  AIRRVFPNTQHRLCPWHIIKNANQNI  338



>ref|XP_010681849.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Beta vulgaris 
subsp. vulgaris]
Length=789

 Score =   114 bits (285),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 49/89 (55%), Positives = 63/89 (71%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            +ICG FVG+N+H  N+MFGC FL +E  D+FVWLF+ F + MGG CP +I TDQ  AMS 
Sbjct  330  LICGAFVGINNHWKNIMFGCCFLSDETIDTFVWLFEVFKKCMGGVCPVSIFTDQDQAMSN  389

Query  182  AISLVFPSARHRLCIWHIGENSKKHIKCL  268
            A+S VFP+ R RLC WH+ +N+  H   L
Sbjct  390  ALSQVFPNTRARLCQWHLYQNAVSHFGTL  418



>ref|XP_010685218.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Beta vulgaris 
subsp. vulgaris]
Length=491

 Score =   112 bits (280),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 47/85 (55%), Positives = 62/85 (73%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            +ICG FVG+N+H  N+MFGC FL +E  D+FVWLF+ F + MGG CP +I TDQ  AMS 
Sbjct  107  LICGAFVGINNHWKNVMFGCCFLSDETIDTFVWLFEVFKKCMGGVCPMSIFTDQDQAMSN  166

Query  182  AISLVFPSARHRLCIWHIGENSKKH  256
            A+S VFP+ R RLC WH+ +++  H
Sbjct  167  ALSQVFPNTRTRLCQWHLYQDAVSH  191



>ref|XP_008654144.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Zea mays]
Length=653

 Score =   113 bits (283),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 48/86 (56%), Positives = 62/86 (72%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            M   P +G NHH   ++FG   L NE ++SF WLFK FL+AM GK P+TI TDQCAA++ 
Sbjct  194  MPFAPIIGTNHHRQTIVFGAALLFNESSESFAWLFKAFLKAMSGKKPKTIFTDQCAAIAK  253

Query  182  AISLVFPSARHRLCIWHIGENSKKHI  259
            AI +VFPS+ HRL IWHI +N+ KH+
Sbjct  254  AIMMVFPSSCHRLYIWHIYQNAGKHL  279



>ref|XP_010914593.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Elaeis guineensis]
Length=802

 Score =   114 bits (284),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 48/83 (58%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = +2

Query  11   GPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAIS  190
             PF+G+NHH   ++FG   LL+E T+SFVWLFKTFL AM GK P+TI TD CAAMS AI+
Sbjct  384  APFIGINHHKQIVIFGAALLLDETTESFVWLFKTFLDAMSGKQPKTIFTDWCAAMSKAIA  443

Query  191  LVFPSARHRLCIWHIGENSKKHI  259
            +  P + H+LC+WHI +N  KH+
Sbjct  444  ISLPDSCHQLCLWHILQNVPKHL  466



>ref|XP_008338060.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Malus domestica]
Length=679

 Score =   113 bits (282),  Expect = 8e-27, Method: Composition-based stats.
 Identities = 49/91 (54%), Positives = 64/91 (70%), Gaps = 2/91 (2%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAM--  175
            +IC PF+G+NHH  N+ FGC FLL+E T SF+WLF+TFL +MG K P TI TD+  AM  
Sbjct  260  LICAPFLGVNHHWKNISFGCAFLLDESTASFMWLFETFLESMGNKQPVTIFTDENKAMEK  319

Query  176  SAAISLVFPSARHRLCIWHIGENSKKHIKCL  268
            + AI +VFP  RH LC W I +N+ +H+  L
Sbjct  320  ARAIEIVFPETRHLLCNWQISKNATQHLGSL  350



>ref|XP_008658616.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X2 [Zea 
mays]
Length=853

 Score =   113 bits (283),  Expect = 8e-27, Method: Composition-based stats.
 Identities = 49/86 (57%), Positives = 60/86 (70%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            M   P +G NHH   ++FG   L NE  +SFVWLF+TFL AM GK P TI TDQ AAM+ 
Sbjct  320  MPFAPLLGTNHHKQTIVFGAALLFNETIESFVWLFQTFLTAMSGKHPSTIFTDQDAAMAC  379

Query  182  AISLVFPSARHRLCIWHIGENSKKHI  259
            AI+ VFP+ RHRLC+WHI  N+ KH+
Sbjct  380  AIAYVFPNTRHRLCLWHIYLNAAKHL  405



>ref|XP_008658611.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1 [Zea 
mays]
Length=854

 Score =   113 bits (283),  Expect = 8e-27, Method: Composition-based stats.
 Identities = 49/86 (57%), Positives = 60/86 (70%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            M   P +G NHH   ++FG   L NE  +SFVWLF+TFL AM GK P TI TDQ AAM+ 
Sbjct  321  MPFAPLLGTNHHKQTIVFGAALLFNETIESFVWLFQTFLTAMSGKHPSTIFTDQDAAMAC  380

Query  182  AISLVFPSARHRLCIWHIGENSKKHI  259
            AI+ VFP+ RHRLC+WHI  N+ KH+
Sbjct  381  AIAYVFPNTRHRLCLWHIYLNAAKHL  406



>dbj|BAJ89698.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=773

 Score =   113 bits (282),  Expect = 8e-27, Method: Composition-based stats.
 Identities = 46/86 (53%), Positives = 60/86 (70%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            MIC PFVG+NHH  N+MFGC F+L+E   S+ WL K+FL +MGG  P+TI TDQ   +S 
Sbjct  307  MICAPFVGINHHMQNVMFGCAFMLDESLTSYEWLLKSFLESMGGCPPKTIFTDQNETISK  366

Query  182  AISLVFPSARHRLCIWHIGENSKKHI  259
            AI ++ P  RH LC WHI +N + H+
Sbjct  367  AIEVILPETRHCLCQWHIEKNLQAHL  392



>ref|XP_003578884.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Brachypodium 
distachyon]
Length=823

 Score =   113 bits (283),  Expect = 8e-27, Method: Composition-based stats.
 Identities = 45/89 (51%), Positives = 62/89 (70%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            M+C PFVG+NHH  N+MFGC F+L+E   S+ WLFK+FL +MGG  P+TI+TDQ   +S 
Sbjct  307  MVCAPFVGINHHMQNVMFGCAFMLDESLTSYEWLFKSFLDSMGGNPPKTILTDQNDTISN  366

Query  182  AISLVFPSARHRLCIWHIGENSKKHIKCL  268
            AI ++FP   H  C WHI +N + ++  L
Sbjct  367  AIEVIFPETHHCFCSWHIEKNLQSYLDTL  395



>ref|XP_008241736.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Prunus mume]
 ref|XP_008241737.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Prunus mume]
Length=678

 Score =   112 bits (281),  Expect = 9e-27, Method: Composition-based stats.
 Identities = 47/88 (53%), Positives = 63/88 (72%), Gaps = 2/88 (2%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAM--  175
            ++C PF+G+NHH  N+ FGC FLL+E   SF+WLF+TFL +MG K P+TI TD+  AM  
Sbjct  259  LVCSPFLGVNHHWKNISFGCAFLLDESAGSFIWLFETFLESMGNKQPKTIFTDEDKAMEK  318

Query  176  SAAISLVFPSARHRLCIWHIGENSKKHI  259
            + AI  VFP  RHRLC W I +N+ +H+
Sbjct  319  AKAIETVFPETRHRLCNWQISKNATQHL  346



>ref|XP_008653248.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1 [Zea 
mays]
Length=528

 Score =   111 bits (278),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 48/86 (56%), Positives = 60/86 (70%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            M   P +G NHH   ++FG   L NE  +SFVWLF+TFL+AM GK P TI TDQ AAM+ 
Sbjct  23   MPFAPLLGTNHHKQTIIFGAALLFNETIESFVWLFQTFLKAMSGKHPSTIFTDQDAAMAG  82

Query  182  AISLVFPSARHRLCIWHIGENSKKHI  259
            AI+ VFP+  HRLC+WHI  N+ KH+
Sbjct  83   AIAYVFPNTCHRLCLWHIYLNAAKHL  108



>ref|NP_001047685.1| Os02g0668200 [Oryza sativa Japonica Group]
 dbj|BAF09599.1| Os02g0668200 [Oryza sativa Japonica Group]
Length=766

 Score =   112 bits (280),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 48/86 (56%), Positives = 60/86 (70%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            MI  PF G+NHH  ++ +G  FL NE+  ++VWLFKTFLRAMGGK P  I+TD+ A+M A
Sbjct  328  MIFAPFTGVNHHLQSVFYGAAFLANEKIPAYVWLFKTFLRAMGGKAPTLIITDEDASMKA  387

Query  182  AISLVFPSARHRLCIWHIGENSKKHI  259
            AI  VFP+  HRLC+WHI E     I
Sbjct  388  AIEKVFPTTVHRLCMWHIMEKMSDKI  413



>ref|XP_010507064.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Camelina sativa]
Length=684

 Score =   112 bits (279),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 46/83 (55%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = +2

Query  11   GPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAIS  190
             PFVG+NHH   ++FG   L +E  +S+ WLF+TFL AM GK P+TI+TDQCAAM+ AI 
Sbjct  280  APFVGVNHHKQTVVFGAALLYDETIESYKWLFETFLGAMSGKQPKTILTDQCAAMANAIV  339

Query  191  LVFPSARHRLCIWHIGENSKKHI  259
             VFP  +HRLC+WHI +N+ K +
Sbjct  340  KVFPETKHRLCVWHIYQNAAKKL  362



>gb|EEE57540.1| hypothetical protein OsJ_07864 [Oryza sativa Japonica Group]
Length=805

 Score =   112 bits (279),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 48/86 (56%), Positives = 60/86 (70%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            MI  PF G+NHH  ++ +G  FL NE+  ++VWLFKTFLRAMGGK P  I+TD+ A+M A
Sbjct  328  MIFAPFTGVNHHLQSVFYGAAFLANEKIPAYVWLFKTFLRAMGGKAPTLIITDEDASMKA  387

Query  182  AISLVFPSARHRLCIWHIGENSKKHI  259
            AI  VFP+  HRLC+WHI E     I
Sbjct  388  AIEKVFPTTVHRLCMWHIMEKMSDKI  413



>ref|XP_010445346.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Camelina sativa]
Length=761

 Score =   112 bits (279),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 46/83 (55%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = +2

Query  11   GPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAIS  190
             PFVG+NHH   ++FG   L +E  +S+ WLF+TFL AM GK P+TI+TDQCAAM+ AI 
Sbjct  280  APFVGVNHHKQTVVFGAALLYDETIESYRWLFETFLGAMSGKQPKTILTDQCAAMANAIV  339

Query  191  LVFPSARHRLCIWHIGENSKKHI  259
             VFP  +HRLC+WHI +N+ K +
Sbjct  340  KVFPETKHRLCVWHIYQNAAKKL  362



>ref|XP_009412131.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009412133.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Musa acuminata 
subsp. malaccensis]
Length=775

 Score =   112 bits (279),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 44/82 (54%), Positives = 60/82 (73%), Gaps = 0/82 (0%)
 Frame = +2

Query  11   GPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAIS  190
             PF+G+NHH   ++FG   LL+E  +SF+WLF+TF+ AM G+ P+TI TD+CA MS AI+
Sbjct  359  APFIGVNHHKQIVIFGAALLLDESIESFIWLFRTFMAAMSGRQPKTIFTDRCAEMSKAIT  418

Query  191  LVFPSARHRLCIWHIGENSKKH  256
            + FP   HRLC+WHI +N  KH
Sbjct  419  MTFPDTCHRLCLWHILQNVPKH  440



>ref|XP_010694768.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Beta vulgaris 
subsp. vulgaris]
Length=239

 Score =   107 bits (267),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 60/89 (67%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            +IC PFVG+N+H    MF C F+ NE+ +SF WL +TF RAM  + P+TI TDQ  AM  
Sbjct  112  LICAPFVGINYHWQTTMFACAFITNEKEESFEWLLETFKRAMCQQEPKTIFTDQDKAMGN  171

Query  182  AISLVFPSARHRLCIWHIGENSKKHIKCL  268
            AI  VFP++RHRLC+WHI +N   H   L
Sbjct  172  AIEKVFPNSRHRLCLWHIEKNFVSHFGSL  200



>ref|XP_006406281.1| hypothetical protein EUTSA_v10021958mg, partial [Eutrema salsugineum]
 gb|ESQ47734.1| hypothetical protein EUTSA_v10021958mg, partial [Eutrema salsugineum]
Length=573

 Score =   110 bits (276),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 46/83 (55%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = +2

Query  11   GPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAIS  190
             PF+G+NHH   ++FG   L +E T+SF WLF+TFL AM GK P+TI+TDQ AAM+ AI 
Sbjct  223  APFIGVNHHKQTVVFGAALLYDETTESFKWLFETFLGAMSGKQPKTILTDQSAAMANAIV  282

Query  191  LVFPSARHRLCIWHIGENSKKHI  259
             VFP  +HRLC+WHI +N+ K +
Sbjct  283  NVFPETKHRLCVWHIYQNAAKKL  305



>ref|XP_006281824.1| hypothetical protein CARUB_v10028009mg [Capsella rubella]
 gb|EOA14722.1| hypothetical protein CARUB_v10028009mg [Capsella rubella]
Length=809

 Score =   111 bits (278),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 46/83 (55%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = +2

Query  11   GPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAIS  190
             PFVG+NHH   ++FG   L +E T+S+ WLF+TFL AM GK P+TI+TDQCAAM+ AI 
Sbjct  327  APFVGVNHHKQTIVFGAALLYDETTESYKWLFETFLGAMSGKQPKTILTDQCAAMANAIM  386

Query  191  LVFPSARHRLCIWHIGENSKKHI  259
             VFP  + RLC+WHI +N+ K +
Sbjct  387  KVFPETKQRLCVWHIYQNAAKKL  409



>ref|XP_008338042.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Malus domestica]
Length=658

 Score =   110 bits (276),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 43/86 (50%), Positives = 61/86 (71%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            +IC PFVG+NHHC N++FGC F+ +   DS  WL +TF+ +MG K P+TI TD+  AM  
Sbjct  261  LICAPFVGVNHHCKNVLFGCAFMSDVSADSITWLLETFMVSMGNKQPKTIFTDEDIAMGN  320

Query  182  AISLVFPSARHRLCIWHIGENSKKHI  259
            A+  + P  RHRLCIWHI +N+ +++
Sbjct  321  AMVSILPETRHRLCIWHISKNAAQYL  346



>ref|XP_010924140.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X2 [Elaeis 
guineensis]
Length=918

 Score =   111 bits (277),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 47/83 (57%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = +2

Query  11   GPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAIS  190
             PF+G+NHH   ++FG   LL+E T+SFVWLFKTF+ AM G+ P+TI TD C A+  AIS
Sbjct  324  APFIGINHHKQIVVFGAALLLDETTESFVWLFKTFMVAMSGRQPKTIFTDHCPALLRAIS  383

Query  191  LVFPSARHRLCIWHIGENSKKHI  259
               P A HRLC+WHI +NS  HI
Sbjct  384  FTLPEACHRLCLWHILQNSAIHI  406



>ref|XP_010924139.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1 [Elaeis 
guineensis]
Length=955

 Score =   111 bits (277),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 47/83 (57%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = +2

Query  11   GPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAIS  190
             PF+G+NHH   ++FG   LL+E T+SFVWLFKTF+ AM G+ P+TI TD C A+  AIS
Sbjct  324  APFIGINHHKQIVVFGAALLLDETTESFVWLFKTFMVAMSGRQPKTIFTDHCPALLRAIS  383

Query  191  LVFPSARHRLCIWHIGENSKKHI  259
               P A HRLC+WHI +NS  HI
Sbjct  384  FTLPEACHRLCLWHILQNSAIHI  406



>ref|XP_006406280.1| hypothetical protein EUTSA_v10022007mg, partial [Eutrema salsugineum]
 gb|ESQ47733.1| hypothetical protein EUTSA_v10022007mg, partial [Eutrema salsugineum]
Length=685

 Score =   110 bits (276),  Expect = 6e-26, Method: Composition-based stats.
 Identities = 46/83 (55%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = +2

Query  11   GPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAIS  190
             PF+G+NHH   ++FG   L +E T+SF WLF+TFL AM GK P+TI+TDQ AAM+ AI 
Sbjct  219  APFIGVNHHKQTVVFGAALLYDETTESFKWLFETFLGAMSGKQPKTILTDQSAAMANAIV  278

Query  191  LVFPSARHRLCIWHIGENSKKHI  259
             VFP  +HRLC+WHI +N+ K +
Sbjct  279  NVFPETKHRLCVWHIYQNAAKKL  301



>gb|KCW51626.1| hypothetical protein EUGRSUZ_J01116 [Eucalyptus grandis]
Length=472

 Score =   108 bits (271),  Expect = 6e-26, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 62/86 (72%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            +IC PFVG+NHH  N +FGC FLL+E  +SF+WLF  FL +M  K  +TI TDQ   M+ 
Sbjct  195  LICAPFVGVNHHWKNTVFGCAFLLDETAESFIWLFNVFLESMRDKALKTIFTDQDQVMAK  254

Query  182  AISLVFPSARHRLCIWHIGENSKKHI  259
            AI +VFP+ +HRLC WHI +N+ K+I
Sbjct  255  AIRVVFPNTQHRLCTWHIIQNAIKNI  280



>ref|XP_010696332.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Beta vulgaris 
subsp. vulgaris]
Length=443

 Score =   108 bits (270),  Expect = 6e-26, Method: Composition-based stats.
 Identities = 48/89 (54%), Positives = 59/89 (66%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            +IC PFVG+N HC   MF C F+ NE+ +SF WL +TF RAM  + P+TI TDQ  AM  
Sbjct  112  LICAPFVGINCHCKTTMFACAFITNEKEESFEWLLETFKRAMCQQEPKTIFTDQDKAMGN  171

Query  182  AISLVFPSARHRLCIWHIGENSKKHIKCL  268
            AI  VFP+ RHRLC+WHI +N   H   L
Sbjct  172  AIEKVFPNTRHRLCLWHIEKNFVSHFGSL  200



>ref|XP_008809265.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Phoenix dactylifera]
Length=801

 Score =   110 bits (275),  Expect = 8e-26, Method: Composition-based stats.
 Identities = 45/83 (54%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = +2

Query  11   GPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAIS  190
             PF+G+NHH   ++FG   LL+E T+SFVWLFKTFL AM  + P+TI TD CAAMS AI+
Sbjct  384  APFIGINHHKQIVIFGAALLLDETTESFVWLFKTFLAAMSARQPKTIFTDWCAAMSKAIT  443

Query  191  LVFPSARHRLCIWHIGENSKKHI  259
            +  P   H+LC+WH+ +N  KH+
Sbjct  444  ISLPDTCHKLCLWHVVQNVPKHL  466



>ref|XP_004967127.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Setaria italica]
Length=771

 Score =   110 bits (275),  Expect = 8e-26, Method: Composition-based stats.
 Identities = 48/86 (56%), Positives = 59/86 (69%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            M   PF+G NHH   ++FG   L +E   SFVWLF+TFL AM GK P TI TDQ AAM+ 
Sbjct  303  MPFAPFLGTNHHKQTIIFGAALLFDETIPSFVWLFETFLTAMSGKHPSTIFTDQDAAMAG  362

Query  182  AISLVFPSARHRLCIWHIGENSKKHI  259
            AI+ VFP+  HRLC+WHI  N+ KH+
Sbjct  363  AIAYVFPNTSHRLCLWHIYLNAAKHL  388



>gb|EEE68621.1| hypothetical protein OsJ_27177 [Oryza sativa Japonica Group]
Length=757

 Score =   110 bits (275),  Expect = 9e-26, Method: Composition-based stats.
 Identities = 48/86 (56%), Positives = 60/86 (70%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            M   P +G NHH   ++FG   L N+  +SFVWLF+TFL AM GK P TI TDQ  AM+A
Sbjct  253  MPFAPLLGTNHHKQTVIFGVALLFNQTIESFVWLFETFLTAMSGKHPSTIFTDQDTAMAA  312

Query  182  AISLVFPSARHRLCIWHIGENSKKHI  259
            AI+LVFP+ RHRLC+WHI  N  K++
Sbjct  313  AIALVFPNTRHRLCLWHIYLNGGKNL  338



>ref|XP_010666753.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Beta vulgaris 
subsp. vulgaris]
Length=536

 Score =   108 bits (271),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 48/89 (54%), Positives = 62/89 (70%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            +ICG FVG+N+H  N+MFGC FL +E  D+FVWLF+ F + MGG CP  + TDQ  AMS 
Sbjct  107  LICGAFVGINNHWKNVMFGCCFLSDETIDTFVWLFEVFKKCMGGVCPVLLFTDQDQAMSN  166

Query  182  AISLVFPSARHRLCIWHIGENSKKHIKCL  268
            A+S VFP+ R RLC WH+ +N+  H   L
Sbjct  167  ALSQVFPNTRARLCQWHLYQNAVSHFGTL  195



>ref|XP_004977727.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Setaria italica]
Length=850

 Score =   110 bits (275),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 48/86 (56%), Positives = 59/86 (69%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            M   PF+G NHH   ++FG   L +E   SFVWLF+TFL AM GK P TI TDQ AAM+ 
Sbjct  328  MPFAPFLGTNHHKQTIIFGAALLFDETIPSFVWLFETFLTAMSGKHPSTIFTDQDAAMAG  387

Query  182  AISLVFPSARHRLCIWHIGENSKKHI  259
            AI+ VFP+  HRLC+WHI  N+ KH+
Sbjct  388  AIAYVFPNTSHRLCLWHIYLNAAKHL  413



>ref|XP_003561049.1| PREDICTED: protein FAR1-RELATED SEQUENCE 9-like [Brachypodium 
distachyon]
Length=761

 Score =   110 bits (274),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 44/86 (51%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            +IC PFVG+NHH  N++FGC FLL++ T S+VWLFK+FL +MGG+ P++I TDQ  A+  
Sbjct  269  LICAPFVGVNHHWHNIVFGCAFLLDDSTASYVWLFKSFLESMGGRSPKSIFTDQDEAIMQ  328

Query  182  AISLVFPSARHRLCIWHIGENSKKHI  259
            A   VFP+ +H    WHI +N++ H+
Sbjct  329  AAEQVFPNTQHCFSYWHILKNAQSHL  354



>gb|KCW79824.1| hypothetical protein EUGRSUZ_C01167 [Eucalyptus grandis]
Length=508

 Score =   108 bits (270),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 46/89 (52%), Positives = 62/89 (70%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            MIC PF+G+NHH  N +FGC  LL+E  +SF+WLF+TFL AMG + P+TI TDQ  A+  
Sbjct  56   MICAPFLGVNHHWKNTLFGCALLLDETVNSFIWLFETFLEAMGNRAPRTIFTDQDQAIEK  115

Query  182  AISLVFPSARHRLCIWHIGENSKKHIKCL  268
            A+  VFP+A+H +C   I +N+ K I  L
Sbjct  116  AVEKVFPNAQHCVCTSQIAKNAAKKIPNL  144



>ref|XP_008670949.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X2 [Zea 
mays]
Length=817

 Score =   110 bits (274),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 49/86 (57%), Positives = 58/86 (67%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            M   P +G NHH   ++FG   L +E   SFVWLF+TFL AM GK P TI TDQ AAM+ 
Sbjct  290  MPFAPILGTNHHKQTIIFGAALLFDETIPSFVWLFETFLTAMSGKHPSTIFTDQDAAMAG  349

Query  182  AISLVFPSARHRLCIWHIGENSKKHI  259
            AIS VFP+  HRLCIWHI  N+ KH+
Sbjct  350  AISYVFPNTSHRLCIWHIYLNAAKHL  375



>ref|XP_010675549.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Beta vulgaris 
subsp. vulgaris]
Length=316

 Score =   107 bits (266),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 47/89 (53%), Positives = 59/89 (66%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            +IC PFVG+N H    MF C F+ NE+ +SF WL +TF RAM  + P+TI TDQ  AM  
Sbjct  188  LICAPFVGINCHWKTTMFACAFITNEKEESFEWLLETFKRAMCQQEPKTIFTDQDKAMGN  247

Query  182  AISLVFPSARHRLCIWHIGENSKKHIKCL  268
            AI  VFP++RHRLC+WHI +N   H   L
Sbjct  248  AIEKVFPNSRHRLCLWHIEKNFVSHFGSL  276



>ref|XP_010276947.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1 [Nelumbo 
nucifera]
Length=739

 Score =   109 bits (273),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 44/84 (52%), Positives = 64/84 (76%), Gaps = 0/84 (0%)
 Frame = +2

Query  17   FVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAISLV  196
            FVG+N++   ++FG   L +E  D+F WLFKTF++ MGGK P+TI+TD  AAM+ AI+LV
Sbjct  323  FVGVNNYKNLIIFGAALLYDETVDTFEWLFKTFIKTMGGKKPKTILTDDDAAMAKAINLV  382

Query  197  FPSARHRLCIWHIGENSKKHIKCL  268
            FP   HRLC+WH+ +N+ KH++C+
Sbjct  383  FPETHHRLCVWHMFQNTTKHLRCV  406



>ref|XP_008670948.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1 [Zea 
mays]
Length=842

 Score =   110 bits (274),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 49/86 (57%), Positives = 58/86 (67%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            M   P +G NHH   ++FG   L +E   SFVWLF+TFL AM GK P TI TDQ AAM+ 
Sbjct  315  MPFAPILGTNHHKQTIIFGAALLFDETIPSFVWLFETFLTAMSGKHPSTIFTDQDAAMAG  374

Query  182  AISLVFPSARHRLCIWHIGENSKKHI  259
            AIS VFP+  HRLCIWHI  N+ KH+
Sbjct  375  AISYVFPNTSHRLCIWHIYLNAAKHL  400



>ref|XP_010276948.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X2 [Nelumbo 
nucifera]
Length=713

 Score =   109 bits (273),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 44/84 (52%), Positives = 64/84 (76%), Gaps = 0/84 (0%)
 Frame = +2

Query  17   FVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAISLV  196
            FVG+N++   ++FG   L +E  D+F WLFKTF++ MGGK P+TI+TD  AAM+ AI+LV
Sbjct  297  FVGVNNYKNLIIFGAALLYDETVDTFEWLFKTFIKTMGGKKPKTILTDDDAAMAKAINLV  356

Query  197  FPSARHRLCIWHIGENSKKHIKCL  268
            FP   HRLC+WH+ +N+ KH++C+
Sbjct  357  FPETHHRLCVWHMFQNTTKHLRCV  380



>ref|XP_010276949.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X3 [Nelumbo 
nucifera]
Length=656

 Score =   109 bits (272),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 44/84 (52%), Positives = 64/84 (76%), Gaps = 0/84 (0%)
 Frame = +2

Query  17   FVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAISLV  196
            FVG+N++   ++FG   L +E  D+F WLFKTF++ MGGK P+TI+TD  AAM+ AI+LV
Sbjct  240  FVGVNNYKNLIIFGAALLYDETVDTFEWLFKTFIKTMGGKKPKTILTDDDAAMAKAINLV  299

Query  197  FPSARHRLCIWHIGENSKKHIKCL  268
            FP   HRLC+WH+ +N+ KH++C+
Sbjct  300  FPETHHRLCVWHMFQNTTKHLRCV  323



>gb|ABA92085.1| transposon protein, putative, unclassified [Oryza sativa Japonica 
Group]
Length=677

 Score =   109 bits (272),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 45/83 (54%), Positives = 63/83 (76%), Gaps = 0/83 (0%)
 Frame = +2

Query  11   GPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAIS  190
            G  VG+++H  +++FG   L +E  DSFVWLFKTFL+AM GK PQTI+TD+ AAM+ AI 
Sbjct  257  GLLVGVDNHKKSVVFGAALLYDETADSFVWLFKTFLKAMSGKKPQTILTDEDAAMAKAIK  316

Query  191  LVFPSARHRLCIWHIGENSKKHI  259
            LV P + HR+C+WH+ +N+ KH+
Sbjct  317  LVMPESHHRICVWHMNQNACKHL  339



>gb|KCW79823.1| hypothetical protein EUGRSUZ_C01167 [Eucalyptus grandis]
Length=578

 Score =   108 bits (270),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 46/89 (52%), Positives = 62/89 (70%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            MIC PF+G+NHH  N +FGC  LL+E  +SF+WLF+TFL AMG + P+TI TDQ  A+  
Sbjct  56   MICAPFLGVNHHWKNTLFGCALLLDETVNSFIWLFETFLEAMGNRAPRTIFTDQDQAIEK  115

Query  182  AISLVFPSARHRLCIWHIGENSKKHIKCL  268
            A+  VFP+A+H +C   I +N+ K I  L
Sbjct  116  AVEKVFPNAQHCVCTSQIAKNAAKKIPNL  144



>ref|XP_009346054.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Pyrus x bretschneideri]
Length=679

 Score =   108 bits (271),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 48/91 (53%), Positives = 62/91 (68%), Gaps = 2/91 (2%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAM--  175
            +IC PF+G+NHH  N+ FGC FLL+E T SF WLF+TFL +MG K P TI TD+  AM  
Sbjct  260  LICAPFLGVNHHWKNISFGCAFLLDESTASFTWLFETFLESMGNKQPVTIFTDENKAMEK  319

Query  176  SAAISLVFPSARHRLCIWHIGENSKKHIKCL  268
            + AI +VFP  RH L  W I +N+ +H+  L
Sbjct  320  AKAIEIVFPETRHLLSNWQISKNATQHLGSL  350



>ref|XP_010679286.1| PREDICTED: protein FAR1-RELATED SEQUENCE 6-like [Beta vulgaris 
subsp. vulgaris]
Length=882

 Score =   109 bits (272),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 43/82 (52%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = +2

Query  14   PFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAISL  193
            PF+G+NHH  +++ GC  +  E T ++VWLFKT+L  M GK P  I+TDQC A+  AI  
Sbjct  331  PFIGVNHHNQSILLGCALISGEDTSNYVWLFKTWLACMSGKAPNGIITDQCMAIGNAIKE  390

Query  194  VFPSARHRLCIWHIGENSKKHI  259
            VFP+++HR CIWHI  N+KKH+
Sbjct  391  VFPNSKHRWCIWHILRNAKKHL  412



>ref|XP_004987222.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Setaria italica]
Length=442

 Score =   107 bits (266),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 45/83 (54%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = +2

Query  11   GPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAIS  190
             P +G NHH   ++FG   L NE  +SFVWLF+TFL  M GK P TI T+Q AAM+ AI+
Sbjct  220  APLLGTNHHKQTIIFGAALLFNETIESFVWLFETFLTVMSGKHPSTIFTNQDAAMAGAIA  279

Query  191  LVFPSARHRLCIWHIGENSKKHI  259
             VFP+  HRLC+WHI  N+ KH+
Sbjct  280  YVFPNISHRLCLWHIYLNAAKHL  302



>ref|XP_008809356.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X3 [Phoenix 
dactylifera]
 ref|XP_008809357.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X3 [Phoenix 
dactylifera]
Length=894

 Score =   109 bits (272),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 47/83 (57%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = +2

Query  11   GPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAIS  190
             PF+G+NHH   ++FG   LL+E T+SFVWLFKTF+ AM G+ P+TI TD   A+S AIS
Sbjct  293  APFIGINHHKQIVVFGAALLLDETTESFVWLFKTFMVAMSGRQPKTIFTDHFPALSRAIS  352

Query  191  LVFPSARHRLCIWHIGENSKKHI  259
            L  P   HRLC+WHI +NS  HI
Sbjct  353  LTLPETCHRLCLWHILQNSAVHI  375



>ref|XP_008809355.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X2 [Phoenix 
dactylifera]
Length=911

 Score =   109 bits (272),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 47/83 (57%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = +2

Query  11   GPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAIS  190
             PF+G+NHH   ++FG   LL+E T+SFVWLFKTF+ AM G+ P+TI TD   A+S AIS
Sbjct  322  APFIGINHHKQIVVFGAALLLDETTESFVWLFKTFMVAMSGRQPKTIFTDHFPALSRAIS  381

Query  191  LVFPSARHRLCIWHIGENSKKHI  259
            L  P   HRLC+WHI +NS  HI
Sbjct  382  LTLPETCHRLCLWHILQNSAVHI  404



>ref|XP_008809351.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008809352.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008809353.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1 [Phoenix 
dactylifera]
Length=923

 Score =   109 bits (272),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 47/83 (57%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = +2

Query  11   GPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAIS  190
             PF+G+NHH   ++FG   LL+E T+SFVWLFKTF+ AM G+ P+TI TD   A+S AIS
Sbjct  322  APFIGINHHKQIVVFGAALLLDETTESFVWLFKTFMVAMSGRQPKTIFTDHFPALSRAIS  381

Query  191  LVFPSARHRLCIWHIGENSKKHI  259
            L  P   HRLC+WHI +NS  HI
Sbjct  382  LTLPETCHRLCLWHILQNSAVHI  404



>ref|XP_010495230.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Camelina sativa]
Length=519

 Score =   107 bits (267),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 45/83 (54%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = +2

Query  11   GPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAIS  190
             PFVG+NHH   ++FG   L +E T+S+ WLF+TFL AM GK P+TI+TDQ AAM+ AI 
Sbjct  46   APFVGVNHHKQTVVFGAALLYDETTESYKWLFETFLGAMSGKQPKTILTDQSAAMANAIE  105

Query  191  LVFPSARHRLCIWHIGENSKKHI  259
             VF   +HRLC+WHI +N+ K +
Sbjct  106  KVFSETKHRLCVWHIYQNAAKKL  128



>ref|XP_008809267.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Phoenix dactylifera]
Length=722

 Score =   108 bits (270),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 44/83 (53%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = +2

Query  11   GPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAIS  190
             PF+G+N+H   ++FG   LL+E  +SFVWLFKTFL  M GK P+TI TDQC AMS AI+
Sbjct  304  APFIGINNHKQIVIFGAALLLDESVESFVWLFKTFLATMSGKQPKTIFTDQCLAMSKAIT  363

Query  191  LVFPSARHRLCIWHIGENSKKHI  259
            +  P+  HR C+WHI +N++ H+
Sbjct  364  MCLPNTCHRFCLWHILQNAQIHL  386



>ref|XP_010229782.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Brachypodium 
distachyon]
Length=686

 Score =   108 bits (270),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 60/86 (70%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            M C PF+G+N+H  ++ FGCGF+ NE T SFVWLFKTFL AM G  P  I+TDQ  AM  
Sbjct  267  MPCAPFIGINNHGQSVQFGCGFMRNEDTGSFVWLFKTFLEAMDGIAPVNIITDQDFAMRN  326

Query  182  AISLVFPSARHRLCIWHIGENSKKHI  259
             I+ VFP ARHR C WHI + +++ +
Sbjct  327  GIAEVFPDARHRNCRWHIMKRAQEKL  352



>ref|XP_009403868.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=914

 Score =   108 bits (271),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 45/83 (54%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = +2

Query  11   GPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAIS  190
             PF+G+NHH   ++FG   LL+E T+SFVWLF+TF+ AM G  PQTI+TD C A+S AIS
Sbjct  317  APFIGINHHRQIVLFGAAILLDETTESFVWLFRTFMVAMSGLQPQTILTDNCPALSRAIS  376

Query  191  LVFPSARHRLCIWHIGENSKKHI  259
            +  P   HR C+WHI + S  HI
Sbjct  377  MTLPETCHRFCLWHIIQTSTVHI  399



>ref|XP_009403859.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=921

 Score =   108 bits (271),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 45/83 (54%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = +2

Query  11   GPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAIS  190
             PF+G+NHH   ++FG   LL+E T+SFVWLF+TF+ AM G  PQTI+TD C A+S AIS
Sbjct  317  APFIGINHHRQIVLFGAAILLDETTESFVWLFRTFMVAMSGLQPQTILTDNCPALSRAIS  376

Query  191  LVFPSARHRLCIWHIGENSKKHI  259
            +  P   HR C+WHI + S  HI
Sbjct  377  MTLPETCHRFCLWHIIQTSTVHI  399



>ref|XP_010914594.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Elaeis guineensis]
 ref|XP_010914595.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Elaeis guineensis]
 ref|XP_010914596.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Elaeis guineensis]
 ref|XP_010914597.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Elaeis guineensis]
 ref|XP_010914598.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Elaeis guineensis]
Length=716

 Score =   108 bits (270),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 44/83 (53%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = +2

Query  11   GPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAIS  190
             PF+G+N+H   ++FG   LL+E  +SFVWL KTFL AM GK P+TI TDQC AMS AI+
Sbjct  304  APFIGINNHKQIVIFGAALLLDESEESFVWLLKTFLAAMSGKQPKTIFTDQCLAMSKAIT  363

Query  191  LVFPSARHRLCIWHIGENSKKHI  259
            +  P+ RH+ C+WHI +N+  H+
Sbjct  364  MCLPNTRHQFCLWHILQNAPIHL  386



>ref|XP_010246204.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Nelumbo nucifera]
Length=851

 Score =   108 bits (270),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 44/81 (54%), Positives = 58/81 (72%), Gaps = 0/81 (0%)
 Frame = +2

Query  17   FVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAISLV  196
            FVG+NHH   ++FG   L +E  +SF W+F++FL AMGGK P+TI+TDQC  M  AI  V
Sbjct  274  FVGVNHHRQIVIFGAALLYDETIESFKWVFESFLNAMGGKMPKTILTDQCEVMEKAIEHV  333

Query  197  FPSARHRLCIWHIGENSKKHI  259
            FP   HRLC+WHI +N+ KH+
Sbjct  334  FPKVNHRLCVWHIYQNAAKHL  354



>ref|XP_010236847.1| PREDICTED: protein FAR1-RELATED SEQUENCE 6-like [Brachypodium 
distachyon]
Length=748

 Score =   108 bits (270),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 45/78 (58%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            M   PFVG+NHH  +++ GCG L NE T++F+WLFK++L  M  K P  I+TDQC AM  
Sbjct  272  MPFAPFVGVNHHGESVLLGCGLLSNEDTETFIWLFKSWLCCMSNKAPNAIITDQCKAMQN  331

Query  182  AISLVFPSARHRLCIWHI  235
            AI  VFP ARHR CIWHI
Sbjct  332  AIEEVFPQARHRWCIWHI  349



>ref|XP_010047829.1| PREDICTED: protein FAR1-RELATED SEQUENCE 9-like isoform X1 [Eucalyptus 
grandis]
 ref|XP_010047830.1| PREDICTED: protein FAR1-RELATED SEQUENCE 9-like isoform X1 [Eucalyptus 
grandis]
Length=792

 Score =   108 bits (270),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 46/89 (52%), Positives = 62/89 (70%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            MIC PF+G+NHH  N +FGC  LL+E  +SF+WLF+TFL AMG + P+TI TDQ  A+  
Sbjct  270  MICAPFLGVNHHWKNTLFGCALLLDETVNSFIWLFETFLEAMGNRAPRTIFTDQDQAIEK  329

Query  182  AISLVFPSARHRLCIWHIGENSKKHIKCL  268
            A+  VFP+A+H +C   I +N+ K I  L
Sbjct  330  AVEKVFPNAQHCVCTSQIAKNAAKKIPNL  358



>ref|XP_010047831.1| PREDICTED: protein FAR1-RELATED SEQUENCE 9-like isoform X2 [Eucalyptus 
grandis]
Length=791

 Score =   108 bits (270),  Expect = 5e-25, Method: Composition-based stats.
 Identities = 46/89 (52%), Positives = 62/89 (70%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            MIC PF+G+NHH  N +FGC  LL+E  +SF+WLF+TFL AMG + P+TI TDQ  A+  
Sbjct  269  MICAPFLGVNHHWKNTLFGCALLLDETVNSFIWLFETFLEAMGNRAPRTIFTDQDQAIEK  328

Query  182  AISLVFPSARHRLCIWHIGENSKKHIKCL  268
            A+  VFP+A+H +C   I +N+ K I  L
Sbjct  329  AVEKVFPNAQHCVCTSQIAKNAAKKIPNL  357



>tpg|DAA62892.1| TPA: FAR1-domain family sequence [Zea mays]
Length=690

 Score =   108 bits (269),  Expect = 5e-25, Method: Composition-based stats.
 Identities = 42/89 (47%), Positives = 63/89 (71%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            +IC PFVG++HH  N++FGC FLL+E   S+ W+FK+FL +MGG+ P++I TDQ  A+  
Sbjct  274  LICAPFVGVDHHWQNVVFGCAFLLDESVTSYAWVFKSFLESMGGRSPKSIFTDQDEAIMQ  333

Query  182  AISLVFPSARHRLCIWHIGENSKKHIKCL  268
            A+  VFP+ +H    WHI +N++ H+  L
Sbjct  334  AVKQVFPNTQHCFSYWHILKNAQSHLGSL  362



>ref|XP_010227160.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Brachypodium 
distachyon]
Length=612

 Score =   107 bits (268),  Expect = 5e-25, Method: Composition-based stats.
 Identities = 44/86 (51%), Positives = 61/86 (71%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            MI  PF G+NHH  ++ FG  FLLNE+ +S+VWLFKTFLRA+GG  P+ I+TD+  ++  
Sbjct  237  MIFAPFTGVNHHLQSVFFGAAFLLNEKAESYVWLFKTFLRAIGGVAPKLIITDEAGSIKN  296

Query  182  AISLVFPSARHRLCIWHIGENSKKHI  259
            A + VFP+  HRLC+WH+ E   + I
Sbjct  297  ASAEVFPTTAHRLCMWHMMEKLPEKI  322



>ref|XP_008653143.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X3 [Zea 
mays]
Length=692

 Score =   108 bits (269),  Expect = 5e-25, Method: Composition-based stats.
 Identities = 42/89 (47%), Positives = 63/89 (71%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            +IC PFVG++HH  N++FGC FLL+E   S+ W+FK+FL +MGG+ P++I TDQ  A+  
Sbjct  274  LICAPFVGVDHHWQNVVFGCAFLLDESVTSYAWVFKSFLESMGGRSPKSIFTDQDEAIMQ  333

Query  182  AISLVFPSARHRLCIWHIGENSKKHIKCL  268
            A+  VFP+ +H    WHI +N++ H+  L
Sbjct  334  AVKQVFPNTQHCFSYWHILKNAQSHLGSL  362



>ref|XP_002462925.1| hypothetical protein SORBIDRAFT_02g034560 [Sorghum bicolor]
 gb|EER99446.1| hypothetical protein SORBIDRAFT_02g034560 [Sorghum bicolor]
Length=781

 Score =   108 bits (269),  Expect = 5e-25, Method: Composition-based stats.
 Identities = 42/89 (47%), Positives = 63/89 (71%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            +IC PFVG++HH  N++FGC FLL+E   S+ W+FK+FL +MGG+ P++I TDQ  A+  
Sbjct  274  LICAPFVGVDHHWQNVVFGCAFLLDESVTSYAWVFKSFLESMGGRSPKSIFTDQDEAIMQ  333

Query  182  AISLVFPSARHRLCIWHIGENSKKHIKCL  268
            A+  VFP+ +H    WHI +N++ H+  L
Sbjct  334  AVEQVFPNTQHCFSYWHIVKNAQSHLGSL  362



>ref|XP_010047832.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X3 [Eucalyptus 
grandis]
Length=766

 Score =   108 bits (269),  Expect = 5e-25, Method: Composition-based stats.
 Identities = 46/89 (52%), Positives = 62/89 (70%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            MIC PF+G+NHH  N +FGC  LL+E  +SF+WLF+TFL AMG + P+TI TDQ  A+  
Sbjct  270  MICAPFLGVNHHWKNTLFGCALLLDETVNSFIWLFETFLEAMGNRAPRTIFTDQDQAIEK  329

Query  182  AISLVFPSARHRLCIWHIGENSKKHIKCL  268
            A+  VFP+A+H +C   I +N+ K I  L
Sbjct  330  AVEKVFPNAQHCVCTSQIAKNAAKKIPNL  358



>ref|XP_010456530.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Camelina sativa]
Length=761

 Score =   108 bits (269),  Expect = 5e-25, Method: Composition-based stats.
 Identities = 45/83 (54%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = +2

Query  11   GPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAIS  190
             PFVG+NHH   ++FG   L +E  +S+ WLF+TFL AM GK P+TI+TDQCAAM+ AI 
Sbjct  280  APFVGVNHHKQTVVFGAALLYDETIESYKWLFETFLGAMSGKQPKTILTDQCAAMANAIV  339

Query  191  LVFPSARHRLCIWHIGENSKKHI  259
             VF   +HRLC+WHI +N+ K +
Sbjct  340  KVFNETKHRLCVWHIYQNAAKKL  362



>ref|XP_008653142.1| PREDICTED: protein FAR1-RELATED SEQUENCE 9-like isoform X2 [Zea 
mays]
 tpg|DAA62893.1| TPA: FAR1-domain family sequence isoform 1 [Zea mays]
 tpg|DAA62894.1| TPA: FAR1-domain family sequence isoform 2 [Zea mays]
Length=779

 Score =   108 bits (269),  Expect = 6e-25, Method: Composition-based stats.
 Identities = 42/89 (47%), Positives = 63/89 (71%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            +IC PFVG++HH  N++FGC FLL+E   S+ W+FK+FL +MGG+ P++I TDQ  A+  
Sbjct  274  LICAPFVGVDHHWQNVVFGCAFLLDESVTSYAWVFKSFLESMGGRSPKSIFTDQDEAIMQ  333

Query  182  AISLVFPSARHRLCIWHIGENSKKHIKCL  268
            A+  VFP+ +H    WHI +N++ H+  L
Sbjct  334  AVKQVFPNTQHCFSYWHILKNAQSHLGSL  362



>ref|XP_008653138.1| PREDICTED: protein FAR1-RELATED SEQUENCE 9-like isoform X1 [Zea 
mays]
 ref|XP_008653139.1| PREDICTED: protein FAR1-RELATED SEQUENCE 9-like isoform X1 [Zea 
mays]
 ref|XP_008653140.1| PREDICTED: protein FAR1-RELATED SEQUENCE 9-like isoform X1 [Zea 
mays]
 ref|XP_008653141.1| PREDICTED: protein FAR1-RELATED SEQUENCE 9-like isoform X1 [Zea 
mays]
Length=780

 Score =   108 bits (269),  Expect = 6e-25, Method: Composition-based stats.
 Identities = 42/89 (47%), Positives = 63/89 (71%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            +IC PFVG++HH  N++FGC FLL+E   S+ W+FK+FL +MGG+ P++I TDQ  A+  
Sbjct  274  LICAPFVGVDHHWQNVVFGCAFLLDESVTSYAWVFKSFLESMGGRSPKSIFTDQDEAIMQ  333

Query  182  AISLVFPSARHRLCIWHIGENSKKHIKCL  268
            A+  VFP+ +H    WHI +N++ H+  L
Sbjct  334  AVKQVFPNTQHCFSYWHILKNAQSHLGSL  362



>ref|XP_007226784.1| hypothetical protein PRUPE_ppa018163mg, partial [Prunus persica]
 gb|EMJ27983.1| hypothetical protein PRUPE_ppa018163mg, partial [Prunus persica]
Length=650

 Score =   107 bits (267),  Expect = 7e-25, Method: Composition-based stats.
 Identities = 44/81 (54%), Positives = 60/81 (74%), Gaps = 0/81 (0%)
 Frame = +2

Query  17   FVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAISLV  196
            FVG+NHH   ++FG   L +E   +F WLF TF++AM GK P++I+TDQ AAMSAA++L 
Sbjct  239  FVGVNHHKQTIIFGAALLYDETIQTFTWLFDTFVKAMSGKKPKSILTDQDAAMSAALALK  298

Query  197  FPSARHRLCIWHIGENSKKHI  259
            +P   HRLCIWHI +N+ KH+
Sbjct  299  WPETSHRLCIWHIYQNAAKHL  319



>ref|XP_008376001.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Malus domestica]
Length=856

 Score =   108 bits (269),  Expect = 7e-25, Method: Composition-based stats.
 Identities = 44/89 (49%), Positives = 58/89 (65%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            MIC PF G+NHH  N++FGC FLL+ +T++F WLF TF  + GG+ P+TI   QC AM+ 
Sbjct  297  MICAPFXGVNHHWKNVLFGCAFLLDXKTETFTWLFDTFXESXGGQKPKTIFXXQCQAMAN  356

Query  182  AISLVFPSARHRLCIWHIGENSKKHIKCL  268
             I  VF    H LC WHI +N  K++  L
Sbjct  357  GIEKVFSXVCHXLCSWHISQNCXKNMSSL  385



>ref|XP_010675037.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010686159.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Beta vulgaris 
subsp. vulgaris]
Length=615

 Score =   107 bits (267),  Expect = 8e-25, Method: Composition-based stats.
 Identities = 47/89 (53%), Positives = 58/89 (65%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            +IC PFVG+N H    MF C F+ NE+ +SF WL +TF RAM  + P+TI TDQ  AM  
Sbjct  284  LICAPFVGINCHWKTTMFACAFITNEKEESFEWLLETFKRAMCQQEPKTIFTDQDKAMGN  343

Query  182  AISLVFPSARHRLCIWHIGENSKKHIKCL  268
            AI  VFP+ RHRLC+WHI +N   H   L
Sbjct  344  AIEKVFPNTRHRLCLWHIEKNFVSHFGSL  372



>gb|EAZ14299.1| hypothetical protein OsJ_04225 [Oryza sativa Japonica Group]
Length=357

 Score =   105 bits (261),  Expect = 8e-25, Method: Composition-based stats.
 Identities = 43/77 (56%), Positives = 58/77 (75%), Gaps = 0/77 (0%)
 Frame = +2

Query  17   FVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAISLV  196
            FVG+NHH   ++FG   L +E T +F WLF+TF RAM GK P+TI+TDQCAA+  AI  V
Sbjct  278  FVGVNHHKQTVVFGAALLYDETTSTFEWLFETFKRAMSGKEPRTILTDQCAAIINAIGTV  337

Query  197  FPSARHRLCIWHIGENS  247
            FP++ HRLC+WH+ +N+
Sbjct  338  FPNSTHRLCVWHMYQNA  354



>ref|XP_004304854.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Fragaria vesca 
subsp. vesca]
Length=786

 Score =   107 bits (268),  Expect = 9e-25, Method: Composition-based stats.
 Identities = 47/83 (57%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = +2

Query  11   GPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAIS  190
            G FVG NHH   ++FG   + +E  DSF+WLF+TFL AM GK P+TI TDQ AAM+ AIS
Sbjct  227  GVFVGFNHHREVIIFGAALMYDEMADSFIWLFETFLDAMFGKSPKTIFTDQDAAMAKAIS  286

Query  191  LVFPSARHRLCIWHIGENSKKHI  259
            +V P   HRLCIWHI +N+ K +
Sbjct  287  VVMPDTYHRLCIWHIMQNAMKKV  309



>ref|XP_010236406.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Brachypodium 
distachyon]
Length=336

 Score =   104 bits (259),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 50/86 (58%), Positives = 62/86 (72%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            M   P +G NH    ++FGC F+ NE  +SFVWLF+TFL AM GK P TI TDQ AAM+A
Sbjct  84   MPFAPILGTNHQKQTIIFGCAFIFNETIESFVWLFETFLTAMSGKHPSTIFTDQDAAMAA  143

Query  182  AISLVFPSARHRLCIWHIGENSKKHI  259
            AI+ VFP+  HRLC+WHIG N+ KH+
Sbjct  144  AIAYVFPNTAHRLCLWHIGLNAAKHL  169



>ref|XP_010692795.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Beta vulgaris 
subsp. vulgaris]
Length=494

 Score =   105 bits (262),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 46/89 (52%), Positives = 59/89 (66%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            +IC PFVG+N HC   MF C F+ NE+ +SF WL +TF RAM  + P+TI TDQ  A+  
Sbjct  163  LICAPFVGINCHCKTTMFACAFITNEKEESFEWLLETFKRAMCQQEPKTIFTDQDKAIGN  222

Query  182  AISLVFPSARHRLCIWHIGENSKKHIKCL  268
            AI  VFP++RHR C+WHI +N   H   L
Sbjct  223  AIEKVFPNSRHRHCLWHIEKNFVSHFGSL  251



>ref|XP_010675560.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010696065.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Beta vulgaris 
subsp. vulgaris]
Length=225

 Score =   102 bits (254),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 59/89 (66%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            +IC PFVG+N H    MF C F+ NE+ +SF WL +TF RAM  + P+TI TDQ  +M  
Sbjct  112  LICAPFVGINCHWKTTMFACAFITNEKEESFEWLLETFKRAMCQQDPKTIFTDQDKSMGN  171

Query  182  AISLVFPSARHRLCIWHIGENSKKHIKCL  268
            AI  VFP++RHRLC+WHI +N   H   L
Sbjct  172  AIEKVFPNSRHRLCLWHIEKNFVSHFGSL  200



>ref|XP_007224311.1| hypothetical protein PRUPE_ppa020137mg, partial [Prunus persica]
 gb|EMJ25510.1| hypothetical protein PRUPE_ppa020137mg, partial [Prunus persica]
Length=697

 Score =   106 bits (265),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 44/86 (51%), Positives = 62/86 (72%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            M+C P +G+N+H   ++FGCG L  E TD+  WLFK FL+A  GK P+TI TDQ  +++A
Sbjct  255  MVCAPIIGLNNHGQTILFGCGLLDGESTDACEWLFKVFLQANEGKEPKTIFTDQAQSIAA  314

Query  182  AISLVFPSARHRLCIWHIGENSKKHI  259
            AI  VFP+  HRLC+WHI +N+ K++
Sbjct  315  AIIEVFPNCHHRLCLWHIYQNAAKNL  340



>ref|XP_010418903.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Camelina sativa]
Length=539

 Score =   105 bits (263),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 45/83 (54%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = +2

Query  11   GPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAIS  190
             PFVG+NHH   ++FG   L +E T+S+ WLF+TFL AM  K P+TI TDQ AAM+ AI 
Sbjct  253  APFVGVNHHKKTVVFGAALLYDETTESYKWLFETFLGAMSRKQPKTIFTDQSAAMANAIV  312

Query  191  LVFPSARHRLCIWHIGENSKKHI  259
             VFP  +HRLC+WHI +N+ K +
Sbjct  313  KVFPGTKHRLCVWHIYQNAAKKL  335



>ref|XP_009103778.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Brassica rapa]
Length=429

 Score =   104 bits (259),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 46/83 (55%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = +2

Query  11   GPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAIS  190
             PFVG+NHH   ++FG   L +E T+SF WLF+TFL AM GK P+TI+TDQ AAM  AI 
Sbjct  72   APFVGVNHHKQTVVFGAALLYDETTESFKWLFETFLGAMSGKQPRTILTDQSAAMVNAIV  131

Query  191  LVFPSARHRLCIWHIGENSKKHI  259
             VFP  +HRL +WHI  N+ K++
Sbjct  132  KVFPETKHRLYVWHIYVNAAKNL  154



>gb|KDO47576.1| hypothetical protein CISIN_1g005927mg [Citrus sinensis]
Length=587

 Score =   105 bits (263),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 45/86 (52%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            +IC PFVG+NHH  NM+FGC FLL+E T S+VWLF++FL +MG   P+TI T++  AMS 
Sbjct  155  LICAPFVGVNHHWKNMLFGCAFLLDESTHSYVWLFESFLESMGNTQPKTIFTNENEAMSK  214

Query  182  AISLVFPSARHRLCIWHIGENSKKHI  259
            AI  VF   RHRL   HI +++++++
Sbjct  215  AIETVFMKTRHRLSTGHIVKDARRNL  240



>ref|XP_010681435.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Beta vulgaris 
subsp. vulgaris]
Length=312

 Score =   103 bits (257),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 46/85 (54%), Positives = 58/85 (68%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            +IC PFVG+N H    MF C F+ NE+ +SF WL +TF RAM  + P+TI TDQ  AM  
Sbjct  112  LICAPFVGINCHWKTTMFACAFVTNEKEESFEWLLETFKRAMCQQEPKTIFTDQDKAMGN  171

Query  182  AISLVFPSARHRLCIWHIGENSKKH  256
            AI  VFP++RHRLC+WHI +N   H
Sbjct  172  AIEKVFPNSRHRLCLWHIEKNFVSH  196



>gb|KDO47577.1| hypothetical protein CISIN_1g005927mg [Citrus sinensis]
Length=573

 Score =   105 bits (263),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 45/86 (52%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            +IC PFVG+NHH  NM+FGC FLL+E T S+VWLF++FL +MG   P+TI T++  AMS 
Sbjct  155  LICAPFVGVNHHWKNMLFGCAFLLDESTHSYVWLFESFLESMGNTQPKTIFTNENEAMSK  214

Query  182  AISLVFPSARHRLCIWHIGENSKKHI  259
            AI  VF   RHRL   HI +++++++
Sbjct  215  AIETVFMKTRHRLSTGHIVKDARRNL  240



>ref|XP_011039466.1| PREDICTED: protein FAR1-RELATED SEQUENCE 12-like isoform X4 [Populus 
euphratica]
Length=998

 Score =   106 bits (265),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 45/89 (51%), Positives = 59/89 (66%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            +IC P  G+NHH   ++FGC FLLNE TDSFVWL +TF+ AM    P+TI TD+   M  
Sbjct  394  IICAPLWGLNHHRQQVLFGCAFLLNESTDSFVWLLETFMEAMDRHQPKTIFTDENELMVD  453

Query  182  AISLVFPSARHRLCIWHIGENSKKHIKCL  268
            A+  V P A HR+ IW+I +N+ KH+  L
Sbjct  454  AVKAVLPDAEHRIGIWYIRQNALKHLSAL  482



>ref|XP_011039465.1| PREDICTED: protein FAR1-RELATED SEQUENCE 7-like isoform X3 [Populus 
euphratica]
Length=1005

 Score =   106 bits (265),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 45/89 (51%), Positives = 59/89 (66%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            +IC P  G+NHH   ++FGC FLLNE TDSFVWL +TF+ AM    P+TI TD+   M  
Sbjct  411  IICAPLWGLNHHRQQVLFGCAFLLNESTDSFVWLLETFMEAMDRHQPKTIFTDENELMVD  470

Query  182  AISLVFPSARHRLCIWHIGENSKKHIKCL  268
            A+  V P A HR+ IW+I +N+ KH+  L
Sbjct  471  AVKAVLPDAEHRIGIWYIRQNALKHLSAL  499



>ref|XP_011039464.1| PREDICTED: protein FAR1-RELATED SEQUENCE 7-like isoform X2 [Populus 
euphratica]
Length=1009

 Score =   106 bits (265),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 45/89 (51%), Positives = 59/89 (66%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            +IC P  G+NHH   ++FGC FLLNE TDSFVWL +TF+ AM    P+TI TD+   M  
Sbjct  411  IICAPLWGLNHHRQQVLFGCAFLLNESTDSFVWLLETFMEAMDRHQPKTIFTDENELMVD  470

Query  182  AISLVFPSARHRLCIWHIGENSKKHIKCL  268
            A+  V P A HR+ IW+I +N+ KH+  L
Sbjct  471  AVKAVLPDAEHRIGIWYIRQNALKHLSAL  499



>ref|XP_011039463.1| PREDICTED: protein FAR1-RELATED SEQUENCE 7-like isoform X1 [Populus 
euphratica]
 ref|XP_011016615.1| PREDICTED: protein FAR1-RELATED SEQUENCE 7-like isoform X2 [Populus 
euphratica]
Length=1015

 Score =   106 bits (265),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 45/89 (51%), Positives = 59/89 (66%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            +IC P  G+NHH   ++FGC FLLNE TDSFVWL +TF+ AM    P+TI TD+   M  
Sbjct  411  IICAPLWGLNHHRQQVLFGCAFLLNESTDSFVWLLETFMEAMDRHQPKTIFTDENELMVD  470

Query  182  AISLVFPSARHRLCIWHIGENSKKHIKCL  268
            A+  V P A HR+ IW+I +N+ KH+  L
Sbjct  471  AVKAVLPDAEHRIGIWYIRQNALKHLSAL  499



>ref|XP_008657613.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Zea mays]
Length=644

 Score =   105 bits (263),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 44/78 (56%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            MI  PF G+NHH   ++FG   L NE T+++ WLF+TFLRAMGG  P+ I+TD+  +M  
Sbjct  171  MIFTPFTGINHHKSCVLFGAALLSNETTEAYTWLFRTFLRAMGGVAPRLIITDEANSMRN  230

Query  182  AISLVFPSARHRLCIWHI  235
            AIS+VFPS+ HRLC+WHI
Sbjct  231  AISIVFPSSTHRLCMWHI  248



>ref|XP_011016614.1| PREDICTED: protein FAR1-RELATED SEQUENCE 7-like isoform X1 [Populus 
euphratica]
Length=1022

 Score =   106 bits (265),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 45/89 (51%), Positives = 59/89 (66%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            +IC P  G+NHH   ++FGC FLLNE TDSFVWL +TF+ AM    P+TI TD+   M  
Sbjct  411  IICAPLWGLNHHRQQVLFGCAFLLNESTDSFVWLLETFMEAMDRHQPKTIFTDENELMVD  470

Query  182  AISLVFPSARHRLCIWHIGENSKKHIKCL  268
            A+  V P A HR+ IW+I +N+ KH+  L
Sbjct  471  AVKAVLPDAEHRIGIWYIRQNALKHLSAL  499



>gb|KDO47575.1| hypothetical protein CISIN_1g005927mg [Citrus sinensis]
Length=669

 Score =   105 bits (263),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 45/86 (52%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            +IC PFVG+NHH  NM+FGC FLL+E T S+VWLF++FL +MG   P+TI T++  AMS 
Sbjct  251  LICAPFVGVNHHWKNMLFGCAFLLDESTHSYVWLFESFLESMGNTQPKTIFTNENEAMSK  310

Query  182  AISLVFPSARHRLCIWHIGENSKKHI  259
            AI  VF   RHRL   HI +++++++
Sbjct  311  AIETVFMKTRHRLSTGHIVKDARRNL  336



>ref|XP_010665579.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Beta vulgaris 
subsp. vulgaris]
Length=647

 Score =   105 bits (262),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 42/85 (49%), Positives = 59/85 (69%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            +IC  FVG+N+H  N MF C FL +E   SF WLF+TF ++M GKC  TI +DQ AA++ 
Sbjct  368  LICPSFVGINNHWKNTMFACAFLADETIPSFEWLFETFKKSMKGKCSITIFSDQDAAIAG  427

Query  182  AISLVFPSARHRLCIWHIGENSKKH  256
             I   FP++RHRLC+WH+ +N+ + 
Sbjct  428  TIKKAFPTSRHRLCLWHLSQNANQQ  452



>dbj|BAK02303.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=777

 Score =   105 bits (263),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 43/86 (50%), Positives = 62/86 (72%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            +IC PFVG+NHH  N++FG  FLL++ T S+VWLFK+FL +MGG+ P++I TDQ  A+  
Sbjct  275  LICAPFVGVNHHWHNIVFGFAFLLDDSTASYVWLFKSFLESMGGRSPKSIFTDQDEAIMQ  334

Query  182  AISLVFPSARHRLCIWHIGENSKKHI  259
            A   VFP+ +H    WHI +N++ H+
Sbjct  335  AAEQVFPNTQHCFSYWHILKNAQSHL  360



>ref|XP_008348691.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Malus domestica]
Length=588

 Score =   105 bits (261),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 44/78 (56%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            M   PFVG+NHH  +++ GCG +  E TDSF+WLFKT+L  M G  P  I+TDQ  AM  
Sbjct  1    MPFAPFVGVNHHGQSILLGCGLISREDTDSFIWLFKTWLACMSGHAPCGIITDQDKAMKK  60

Query  182  AISLVFPSARHRLCIWHI  235
            AI +VFP+ RHRLC+WHI
Sbjct  61   AIEVVFPNTRHRLCLWHI  78



>ref|XP_008675775.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Zea mays]
Length=538

 Score =   104 bits (260),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 50/86 (58%), Positives = 62/86 (72%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            M   P +G NHH   ++FGC  + NE   SFVWLF+TFL AM GK P TI TDQ AAM+A
Sbjct  285  MPFAPILGTNHHKQTIIFGCALMFNETIPSFVWLFQTFLTAMSGKHPSTIFTDQDAAMAA  344

Query  182  AISLVFPSARHRLCIWHIGENSKKHI  259
            AI+ VFP+  HRLC+WHIG+N+ KH+
Sbjct  345  AIAHVFPNTAHRLCLWHIGQNAVKHL  370



>ref|XP_009391987.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Musa acuminata 
subsp. malaccensis]
Length=688

 Score =   105 bits (262),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 43/86 (50%), Positives = 59/86 (69%), Gaps = 0/86 (0%)
 Frame = +2

Query  11   GPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAIS  190
             PF+G NHH   ++FG   LL+E  +SFVWLF+TFL AM G+ P+TI TD CAA+S AI+
Sbjct  273  APFIGTNHHKQIVIFGAALLLDETLESFVWLFRTFLVAMSGRQPKTIFTDNCAAISEAIA  332

Query  191  LVFPSARHRLCIWHIGENSKKHIKCL  268
               P   HRLC+W++ ++   H+ CL
Sbjct  333  TALPDTCHRLCLWNLLQSVSTHLPCL  358



>ref|XP_010684208.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Beta vulgaris 
subsp. vulgaris]
Length=286

 Score =   102 bits (253),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 46/89 (52%), Positives = 59/89 (66%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            +IC PFVG+N H    MF C F+ NE+ +SF WL +TF RAM  + P+TI TDQ  AM  
Sbjct  26   LICAPFVGINCHWKTTMFACAFITNEKEESFEWLLETFKRAMCQQEPKTIFTDQDKAMGN  85

Query  182  AISLVFPSARHRLCIWHIGENSKKHIKCL  268
            AI  VFP++RHRLC+WHI ++   H   L
Sbjct  86   AIEKVFPNSRHRLCLWHIEKHFVSHFGSL  114



>ref|XP_004497701.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like, partial [Cicer 
arietinum]
Length=678

 Score =   105 bits (261),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 0/86 (0%)
 Frame = +2

Query  11   GPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAIS  190
            G FVG+N+H   ++FG   L +E   SF WLF+TFL+AMGG+ P+TI+TDQ AAM+ AIS
Sbjct  227  GVFVGLNNHRQTIIFGVALLYDETIPSFQWLFETFLKAMGGEKPKTILTDQDAAMAKAIS  286

Query  191  LVFPSARHRLCIWHIGENSKKHIKCL  268
            LV P   H LC WHI +N+ KH+  L
Sbjct  287  LVVPETFHGLCTWHIRQNALKHVNHL  312



>ref|XP_004967151.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Setaria italica]
Length=546

 Score =   104 bits (259),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 43/80 (54%), Positives = 56/80 (70%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            MI  PF G+NHH  ++  G  FL NE+ +S+VWLF TFL+AMGG  P  I+TD+ A+M A
Sbjct  268  MIFVPFTGVNHHLQSVFLGAAFLANEKIESYVWLFNTFLKAMGGVAPHLIITDEDASMKA  327

Query  182  AISLVFPSARHRLCIWHIGE  241
            AI+ + P   HRLC+WHI E
Sbjct  328  AIAQILPDTTHRLCMWHIME  347



>ref|XP_004503202.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Cicer arietinum]
Length=790

 Score =   105 bits (262),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 0/86 (0%)
 Frame = +2

Query  11   GPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAIS  190
            G FVG+N+H   ++FG   L +E   SF WLF+TFL+AMGG+ P+TI+TDQ AAM+ AIS
Sbjct  274  GGFVGLNNHRQTIIFGAALLYDETIPSFQWLFETFLKAMGGEKPKTILTDQDAAMAKAIS  333

Query  191  LVFPSARHRLCIWHIGENSKKHIKCL  268
            LV P   H LC WHI +N+ KH+  L
Sbjct  334  LVVPETFHGLCTWHIRQNALKHVNHL  359



>gb|ABA95414.1| transposon protein, putative, unclassified [Oryza sativa Japonica 
Group]
Length=862

 Score =   105 bits (262),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 43/78 (55%), Positives = 54/78 (69%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            M   PFVG+NHH  +++ GC  L NE T++FVWLF+++L  M  K P  I+TDQC AM  
Sbjct  256  MPFAPFVGVNHHGESVLLGCALLSNEETETFVWLFRSWLSCMSNKAPNAIITDQCRAMQN  315

Query  182  AISLVFPSARHRLCIWHI  235
            AI  VFP ARHR C+WHI
Sbjct  316  AIMEVFPEARHRWCLWHI  333



>gb|EEE57168.1| hypothetical protein OsJ_07098 [Oryza sativa Japonica Group]
Length=835

 Score =   105 bits (262),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 45/89 (51%), Positives = 59/89 (66%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            +IC PFVG+NHH  N M+GC  L +E   SFVWLFK+FL AMG + P++I T+Q   MS 
Sbjct  437  LICAPFVGVNHHWQNTMYGCALLADESMSSFVWLFKSFLEAMGNRHPRSIFTNQDQVMSK  496

Query  182  AISLVFPSARHRLCIWHIGENSKKHIKCL  268
            AI  VFP+  HR+  WHI +N+   +  L
Sbjct  497  AIEEVFPNTCHRISRWHIQKNAASRLGTL  525



>gb|EEE52553.1| hypothetical protein OsJ_34801 [Oryza sativa Japonica Group]
Length=965

 Score =   105 bits (262),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 43/78 (55%), Positives = 54/78 (69%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            M   PFVG+NHH  +++ GC  L NE T++FVWLF+++L  M  K P  I+TDQC AM  
Sbjct  256  MPFAPFVGVNHHGESVLLGCALLSNEETETFVWLFRSWLSCMSNKAPNAIITDQCRAMQN  315

Query  182  AISLVFPSARHRLCIWHI  235
            AI  VFP ARHR C+WHI
Sbjct  316  AIMEVFPEARHRWCLWHI  333



>ref|XP_010263150.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X2 [Nelumbo 
nucifera]
Length=1071

 Score =   105 bits (262),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 41/81 (51%), Positives = 62/81 (77%), Gaps = 0/81 (0%)
 Frame = +2

Query  17   FVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAISLV  196
            FVG+N+H  +++FG  FL +E  ++F WLFKTF++ MGGK P+TI+TD  A+++ AI LV
Sbjct  527  FVGVNNHKQSIIFGAAFLYDETVETFEWLFKTFIKTMGGKRPKTILTDDDASIAKAIGLV  586

Query  197  FPSARHRLCIWHIGENSKKHI  259
             P + HRLC+WH+ +N+ KH+
Sbjct  587  LPGSHHRLCVWHVFQNATKHL  607



>ref|XP_010263131.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010263142.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1 [Nelumbo 
nucifera]
Length=1091

 Score =   105 bits (262),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 41/81 (51%), Positives = 62/81 (77%), Gaps = 0/81 (0%)
 Frame = +2

Query  17   FVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAISLV  196
            FVG+N+H  +++FG  FL +E  ++F WLFKTF++ MGGK P+TI+TD  A+++ AI LV
Sbjct  527  FVGVNNHKQSIIFGAAFLYDETVETFEWLFKTFIKTMGGKRPKTILTDDDASIAKAIGLV  586

Query  197  FPSARHRLCIWHIGENSKKHI  259
             P + HRLC+WH+ +N+ KH+
Sbjct  587  LPGSHHRLCVWHVFQNATKHL  607



>ref|XP_010468694.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Camelina sativa]
Length=693

 Score =   104 bits (260),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 45/86 (52%), Positives = 59/86 (69%), Gaps = 0/86 (0%)
 Frame = +2

Query  11   GPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAIS  190
             PFVG+NHH   ++FG   L +E T+S+ WLF+TFL AM GK P+TI+ DQ AAM+ AI 
Sbjct  263  APFVGVNHHKQTVVFGAALLYDETTESYKWLFETFLGAMSGKQPKTILNDQSAAMTNAIE  322

Query  191  LVFPSARHRLCIWHIGENSKKHIKCL  268
             VF   +HRLC+WHI +N  K +  L
Sbjct  323  KVFSETKHRLCVWHIYQNVAKKLSHL  348



>ref|XP_010686164.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Beta vulgaris 
subsp. vulgaris]
Length=834

 Score =   105 bits (261),  Expect = 8e-24, Method: Composition-based stats.
 Identities = 43/82 (52%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            +IC P VG+N+H  N+MFGC F+ NE  ++F W+  TF ++MGG  P +I TDQ  AMS 
Sbjct  368  LICAPIVGINNHWQNVMFGCAFIANETQETFEWVLNTFKKSMGGLDPISIFTDQDLAMSK  427

Query  182  AISLVFPSARHRLCIWHIGENS  247
            AI  V P+ RHRLCIWH+ +N+
Sbjct  428  AIQKVLPNTRHRLCIWHLIKNA  449



>ref|NP_001047098.1| Os02g0550900 [Oryza sativa Japonica Group]
 dbj|BAF09012.1| Os02g0550900 [Oryza sativa Japonica Group]
Length=681

 Score =   104 bits (260),  Expect = 8e-24, Method: Composition-based stats.
 Identities = 45/89 (51%), Positives = 59/89 (66%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            +IC PFVG+NHH  N M+GC  L +E   SFVWLFK+FL AMG + P++I T+Q   MS 
Sbjct  301  LICAPFVGVNHHWQNTMYGCALLADESMSSFVWLFKSFLEAMGNRHPRSIFTNQDQVMSK  360

Query  182  AISLVFPSARHRLCIWHIGENSKKHIKCL  268
            AI  VFP+  HR+  WHI +N+   +  L
Sbjct  361  AIEEVFPNTCHRISRWHIQKNAASRLGTL  389



>ref|XP_010229617.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Brachypodium 
distachyon]
Length=692

 Score =   104 bits (260),  Expect = 8e-24, Method: Composition-based stats.
 Identities = 46/86 (53%), Positives = 57/86 (66%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            M C PF+G+N+HC ++ FGCGFL NE T SF+WLF TFL AM G  P  I TDQ  AM  
Sbjct  281  MPCVPFIGVNNHCQSVQFGCGFLRNEDTLSFIWLFNTFLEAMDGIAPANITTDQDFAMRN  340

Query  182  AISLVFPSARHRLCIWHIGENSKKHI  259
             I  VFP  RHR C WHI + +++ +
Sbjct  341  TILEVFPETRHRNCRWHIMKKAQEKM  366



>ref|XP_008662483.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Zea mays]
Length=739

 Score =   104 bits (260),  Expect = 8e-24, Method: Composition-based stats.
 Identities = 50/86 (58%), Positives = 62/86 (72%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            M   P +G NHH   ++FGC  + NE   SFVWLF+TFL AM GK P TI TDQ AAM+A
Sbjct  285  MPFAPILGTNHHKQTIIFGCALMFNETIPSFVWLFQTFLTAMSGKHPSTIFTDQDAAMAA  344

Query  182  AISLVFPSARHRLCIWHIGENSKKHI  259
            AI+ VFP+  HRLC+WHIG+N+ KH+
Sbjct  345  AIAHVFPNTAHRLCLWHIGQNAVKHL  370



>ref|XP_008392169.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Malus domestica]
Length=600

 Score =   104 bits (259),  Expect = 9e-24, Method: Composition-based stats.
 Identities = 42/86 (49%), Positives = 61/86 (71%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            M+C P VG+N+H   ++FGCG +  E TD+  WLFK FL+AM  K P TI T Q  +++A
Sbjct  92   MVCAPIVGINNHGQTILFGCGLVDGEITDACEWLFKAFLQAMDEKTPGTIFTXQAQSITA  151

Query  182  AISLVFPSARHRLCIWHIGENSKKHI  259
            AIS +FP+  HRLC+WHI +N+ +++
Sbjct  152  AISEIFPNCHHRLCLWHIYQNAARNL  177



>ref|XP_007200174.1| hypothetical protein PRUPE_ppa016506mg, partial [Prunus persica]
 gb|EMJ01373.1| hypothetical protein PRUPE_ppa016506mg, partial [Prunus persica]
Length=658

 Score =   104 bits (259),  Expect = 9e-24, Method: Composition-based stats.
 Identities = 43/81 (53%), Positives = 58/81 (72%), Gaps = 0/81 (0%)
 Frame = +2

Query  17   FVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAISLV  196
            FVG+NHH   ++FG   L +E   +F WLF TF++AM GK P++I+TDQ  A SAA+SL 
Sbjct  223  FVGVNHHKQTIIFGAALLYDETIQTFTWLFDTFVKAMSGKKPKSILTDQDVATSAALSLK  282

Query  197  FPSARHRLCIWHIGENSKKHI  259
            +P   HRLCIWHI +N+ KH+
Sbjct  283  WPETSHRLCIWHIYQNAAKHL  303



>ref|XP_004955167.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Setaria italica]
Length=825

 Score =   104 bits (260),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 45/81 (56%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = +2

Query  17   FVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAISLV  196
            F+G NHH   ++FG   L +E   SFVWLF+TFL AM GK P TI TDQ AAM+ AI+ V
Sbjct  308  FLGTNHHKQTIIFGAALLFDETIPSFVWLFETFLTAMSGKHPSTIFTDQDAAMAGAIAYV  367

Query  197  FPSARHRLCIWHIGENSKKHI  259
            FP+  +RLC+WHI  N+ KH+
Sbjct  368  FPNTSYRLCLWHIYLNAAKHL  388



>dbj|BAD15473.1| putative far-red impaired response protein [Oryza sativa Japonica 
Group]
 dbj|BAD33269.1| putative far-red impaired response protein [Oryza sativa Japonica 
Group]
 dbj|BAG95725.1| unnamed protein product [Oryza sativa Japonica Group]
Length=699

 Score =   104 bits (259),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 45/89 (51%), Positives = 59/89 (66%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            +IC PFVG+NHH  N M+GC  L +E   SFVWLFK+FL AMG + P++I T+Q   MS 
Sbjct  301  LICAPFVGVNHHWQNTMYGCALLADESMSSFVWLFKSFLEAMGNRHPRSIFTNQDQVMSK  360

Query  182  AISLVFPSARHRLCIWHIGENSKKHIKCL  268
            AI  VFP+  HR+  WHI +N+   +  L
Sbjct  361  AIEEVFPNTCHRISRWHIQKNAASRLGTL  389



>ref|XP_004295765.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Fragaria vesca 
subsp. vesca]
Length=562

 Score =   103 bits (258),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 42/78 (54%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            M   PF+G+NHH  ++ FGC  L +E   +F+WLF+T+L AMGG+ P +I+TDQ  AM  
Sbjct  298  MPFAPFMGVNHHFQSIQFGCALLQDETELTFLWLFETWLEAMGGRYPSSIITDQDLAMKG  357

Query  182  AISLVFPSARHRLCIWHI  235
            AI+ +FP+ RHRLCIWHI
Sbjct  358  AIAKIFPTTRHRLCIWHI  375



>ref|XP_006655826.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X2 [Oryza 
brachyantha]
Length=762

 Score =   104 bits (260),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 41/86 (48%), Positives = 62/86 (72%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            ++C PFVG+NHH  N++FG  FLL+E + S+VWLFK+FL +MGG+ P++I TDQ  A+  
Sbjct  275  LVCAPFVGVNHHWQNIVFGWAFLLDESSASYVWLFKSFLESMGGRSPKSIFTDQDEAIVQ  334

Query  182  AISLVFPSARHRLCIWHIGENSKKHI  259
            A+  VFP+ +H    WHI +N++  +
Sbjct  335  AVEQVFPNTQHCFSYWHILKNAQSQL  360



>ref|XP_006655825.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1 [Oryza 
brachyantha]
Length=779

 Score =   104 bits (260),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 41/86 (48%), Positives = 62/86 (72%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            ++C PFVG+NHH  N++FG  FLL+E + S+VWLFK+FL +MGG+ P++I TDQ  A+  
Sbjct  275  LVCAPFVGVNHHWQNIVFGWAFLLDESSASYVWLFKSFLESMGGRSPKSIFTDQDEAIVQ  334

Query  182  AISLVFPSARHRLCIWHIGENSKKHI  259
            A+  VFP+ +H    WHI +N++  +
Sbjct  335  AVEQVFPNTQHCFSYWHILKNAQSQL  360



>ref|XP_004974895.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Setaria italica]
Length=767

 Score =   104 bits (259),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 44/83 (53%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = +2

Query  11   GPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAIS  190
            G  VG+N+H    +FG   L +E  +SFVWLFKTFL  M GK P+TI+TD+ AAM+ AI 
Sbjct  284  GLLVGVNNHKKTTIFGAALLYDETAESFVWLFKTFLAVMSGKKPKTILTDEDAAMAKAIK  343

Query  191  LVFPSARHRLCIWHIGENSKKHI  259
            LV P + HR+CIWH+ +N+ KH+
Sbjct  344  LVLPESHHRICIWHMNQNACKHL  366



>ref|XP_007213864.1| hypothetical protein PRUPE_ppa016086mg, partial [Prunus persica]
 gb|EMJ15063.1| hypothetical protein PRUPE_ppa016086mg, partial [Prunus persica]
Length=618

 Score =   103 bits (257),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 43/81 (53%), Positives = 58/81 (72%), Gaps = 0/81 (0%)
 Frame = +2

Query  17   FVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAISLV  196
            F G+NHH   ++FG   L +E   +F WLF TF++AM GK P++I+TDQ A MSAA++L 
Sbjct  195  FAGVNHHKQTIIFGASLLYDETIQTFTWLFDTFVKAMSGKKPKSILTDQDAVMSAALALK  254

Query  197  FPSARHRLCIWHIGENSKKHI  259
            +P A HRLCIWHI  N+ KH+
Sbjct  255  WPEASHRLCIWHIYHNAAKHL  275



>ref|XP_009391891.1| PREDICTED: protein FAR1-RELATED SEQUENCE 6-like isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009391892.1| PREDICTED: protein FAR1-RELATED SEQUENCE 6-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=817

 Score =   104 bits (259),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 42/74 (57%), Positives = 51/74 (69%), Gaps = 0/74 (0%)
 Frame = +2

Query  14   PFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAISL  193
            PFVG+NHH  +++FGCG L NE T +F WLF+ FL  M G+ P  I+TDQ  AM  AI  
Sbjct  278  PFVGVNHHGQSILFGCGLLSNEDTMTFTWLFRAFLSCMSGRAPNAIITDQDKAMQKAIET  337

Query  194  VFPSARHRLCIWHI  235
            VFP  RHR C+WHI
Sbjct  338  VFPGIRHRWCLWHI  351



>ref|XP_010421147.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Camelina sativa]
Length=323

 Score =   101 bits (251),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 42/83 (51%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = +2

Query  11   GPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAIS  190
             PF+G+NHH   ++FG   L +E  +S+ WLF+TFL AM GK P+TI+TDQ AAM+ AI 
Sbjct  46   APFLGVNHHKQTVVFGAALLYDETKESYKWLFETFLGAMSGKQPKTILTDQSAAMANAIE  105

Query  191  LVFPSARHRLCIWHIGENSKKHI  259
             VF   ++RLC+WHI +N+ K +
Sbjct  106  KVFSETKNRLCVWHIYQNAAKKL  128



>gb|EMT21718.1| Protein FAR1-RELATED SEQUENCE 5 [Aegilops tauschii]
Length=465

 Score =   102 bits (254),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 44/84 (52%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            M C PF+G+N+H  ++  GCG + NE TD +VWLFKTFL  MGG  P  I+TDQ  +M A
Sbjct  60   MPCAPFIGINNHNQSLQSGCGLVRNEDTDGYVWLFKTFLECMGGLAPMNIITDQDFSMRA  119

Query  182  AISLVFPSARHRLCIWHIGENSKK  253
            +I  VFP A HR C WHI + +K+
Sbjct  120  SIEEVFPLAVHRHCRWHIIKKAKE  143



>ref|XP_009116658.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X2 [Brassica 
rapa]
Length=867

 Score =   104 bits (259),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 46/83 (55%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = +2

Query  11   GPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAIS  190
             PFVG+NHH   ++FG   L +E T+SF WLF+TFL AM GK P+TI+TDQ AAM+ AI 
Sbjct  322  APFVGVNHHKQTVVFGAALLYDETTESFKWLFETFLGAMSGKQPKTILTDQSAAMANAIV  381

Query  191  LVFPSARHRLCIWHIGENSKKHI  259
             VFP   HRLC+W I  N+ K++
Sbjct  382  KVFPETIHRLCVWPIYVNAAKNL  404



>ref|XP_009116657.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1 [Brassica 
rapa]
Length=897

 Score =   104 bits (259),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 46/83 (55%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = +2

Query  11   GPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAIS  190
             PFVG+NHH   ++FG   L +E T+SF WLF+TFL AM GK P+TI+TDQ AAM+ AI 
Sbjct  322  APFVGVNHHKQTVVFGAALLYDETTESFKWLFETFLGAMSGKQPKTILTDQSAAMANAIV  381

Query  191  LVFPSARHRLCIWHIGENSKKHI  259
             VFP   HRLC+W I  N+ K++
Sbjct  382  KVFPETIHRLCVWPIYVNAAKNL  404



>ref|XP_008381561.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Malus domestica]
Length=705

 Score =   103 bits (257),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 42/78 (54%), Positives = 54/78 (69%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            M   PFVG+NHH  +++ GCG +  E  DSF+WLF+T+L  M G  P  I+TDQ  AM  
Sbjct  343  MPFAPFVGVNHHRQSILLGCGLISREDNDSFIWLFRTWLACMSGHAPSGIITDQDKAMKK  402

Query  182  AISLVFPSARHRLCIWHI  235
            AI +VFP+ RHRLC+WHI
Sbjct  403  AIEVVFPNTRHRLCLWHI  420



>ref|XP_004505846.1| PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1-like [Cicer arietinum]
Length=514

 Score =   102 bits (255),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 0/86 (0%)
 Frame = +2

Query  11   GPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAIS  190
            G FVG+N+H   ++FG   L +E   SF WLF+TFL+AMGG+ P+TI+TDQ AAM+ AIS
Sbjct  64   GGFVGLNNHRQTIIFGAALLYDETIPSFQWLFETFLKAMGGEKPKTILTDQDAAMAKAIS  123

Query  191  LVFPSARHRLCIWHIGENSKKHIKCL  268
            LV P   H LC WHI +N+ KH+  L
Sbjct  124  LVVPETFHGLCTWHIRQNALKHVNHL  149



>gb|AAR87282.1| hypothetical protein [Oryza sativa Japonica Group]
Length=471

 Score =   102 bits (253),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 43/83 (52%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = +2

Query  11   GPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAIS  190
            G  VG+N+H   ++FG   L +E  +SF WLFKTFL  M GK PQTI+TD+ AAM+ AI 
Sbjct  22   GLIVGVNNHKKTIVFGASLLYDETAESFAWLFKTFLNVMSGKQPQTILTDEDAAMAKAIK  81

Query  191  LVFPSARHRLCIWHIGENSKKHI  259
            LV   A HR+C+WH+ +N+ KH+
Sbjct  82   LVLTKAHHRICVWHMNQNACKHL  104



>ref|XP_004289266.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Fragaria vesca 
subsp. vesca]
Length=481

 Score =   102 bits (254),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 42/78 (54%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            M   PF G+NHH  ++ FGC  L +E   +F+WLF+T+L AMGG+ P  I+ DQ  AM  
Sbjct  297  MPFAPFTGVNHHFQSIQFGCALLQDETESTFLWLFETWLEAMGGRHPLCIIIDQDLAMKG  356

Query  182  AISLVFPSARHRLCIWHI  235
            AI+ +FP+ARHRLCIWHI
Sbjct  357  AIAKIFPTARHRLCIWHI  374



>ref|XP_010923773.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Elaeis guineensis]
Length=919

 Score =   103 bits (258),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 44/83 (53%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = +2

Query  11   GPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAIS  190
             PF+G+NHH   ++FG   LL+E T+SFVWLFKTF+ AM  + P+TI TD   A+S A+S
Sbjct  321  APFIGINHHKQIVVFGSALLLDETTESFVWLFKTFMVAMSRRQPKTIFTDHFPALSRAVS  380

Query  191  LVFPSARHRLCIWHIGENSKKHI  259
            L  P   HRLC+WHI +NS  H+
Sbjct  381  LTLPETCHRLCLWHILQNSAIHM  403



>gb|ABF96373.1| transposon protein, putative, unclassified [Oryza sativa Japonica 
Group]
Length=483

 Score =   102 bits (253),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 43/83 (52%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = +2

Query  11   GPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAIS  190
            G  VG+N+H   ++FG   L +E  +SF WLFKTFL  M GK PQTI+TD+ AAM+ AI 
Sbjct  22   GLIVGVNNHKKTIVFGASLLYDETAESFAWLFKTFLNVMSGKQPQTILTDEDAAMAKAIK  81

Query  191  LVFPSARHRLCIWHIGENSKKHI  259
            LV   A HR+C+WH+ +N+ KH+
Sbjct  82   LVLTKAHHRICVWHMNQNACKHL  104



>ref|XP_002322730.2| hypothetical protein POPTR_0016s05900g [Populus trichocarpa]
 gb|EEF04491.2| hypothetical protein POPTR_0016s05900g [Populus trichocarpa]
Length=859

 Score =   103 bits (258),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 44/89 (49%), Positives = 58/89 (65%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            +IC P  G+NHH   ++FGC FLLNE TDSFVWL +TF+ AM    P+TI TD+   M  
Sbjct  374  IICAPLWGLNHHRQQVLFGCAFLLNESTDSFVWLLETFMEAMDRHQPKTIFTDENELMVD  433

Query  182  AISLVFPSARHRLCIWHIGENSKKHIKCL  268
            A+  V P A HR+ IW+I +N+ K +  L
Sbjct  434  AVKAVLPDAEHRIGIWYIRQNALKQLSAL  462



>ref|XP_010255612.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Nelumbo nucifera]
 ref|XP_010255613.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Nelumbo nucifera]
Length=654

 Score =   103 bits (256),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 42/82 (51%), Positives = 60/82 (73%), Gaps = 0/82 (0%)
 Frame = +2

Query  17   FVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAISLV  196
            FVG+NHH   ++FG   L +E  +SF WLFKTF+  M GK P+TI++D+C A+S AI+LV
Sbjct  271  FVGVNHHKQAIIFGVALLYDETVESFTWLFKTFVMVMSGKEPRTILSDKCEAISKAIALV  330

Query  197  FPSARHRLCIWHIGENSKKHIK  262
             P A  RLC+WH+ +NS K+++
Sbjct  331  LPKACCRLCVWHVHQNSAKYLR  352



>ref|XP_002447845.1| hypothetical protein SORBIDRAFT_06g016820 [Sorghum bicolor]
 gb|EES12173.1| hypothetical protein SORBIDRAFT_06g016820 [Sorghum bicolor]
Length=596

 Score =   102 bits (255),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 45/86 (52%), Positives = 57/86 (66%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            M   P +G NHH   ++FG   + NE  + FVWLF+TFL AM GK P TI TDQ AAM+ 
Sbjct  218  MPFAPLLGTNHHKQTIIFGAALIFNETIELFVWLFETFLIAMSGKHPNTIFTDQDAAMAG  277

Query  182  AISLVFPSARHRLCIWHIGENSKKHI  259
            AI+ VF +  HRLC+WHI  N+ KH+
Sbjct  278  AIAYVFRNTSHRLCLWHIYLNAAKHL  303



>ref|XP_002444124.1| hypothetical protein SORBIDRAFT_07g008830 [Sorghum bicolor]
 gb|EES13619.1| hypothetical protein SORBIDRAFT_07g008830 [Sorghum bicolor]
Length=331

 Score =   100 bits (249),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 40/74 (54%), Positives = 53/74 (72%), Gaps = 0/74 (0%)
 Frame = +2

Query  14   PFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAISL  193
            PF G++HH  ++  G  FL NE+ +S+VWLFKTFL+AMGG  PQ I TD+ A+M AAI+ 
Sbjct  84   PFTGVSHHLQSVFLGAAFLANEKIESYVWLFKTFLKAMGGVAPQLITTDEDASMIAAIAE  143

Query  194  VFPSARHRLCIWHI  235
            + P   HR C+WHI
Sbjct  144  ILPETSHRFCMWHI  157



>ref|XP_010689813.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Beta vulgaris 
subsp. vulgaris]
Length=499

 Score =   102 bits (253),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 45/85 (53%), Positives = 62/85 (73%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            +IC PFVG+N+H  N MF C FL +E   SF WLF+TF ++M GKCP TI +DQ AA++ 
Sbjct  157  LICAPFVGINNHWKNTMFACAFLADETIPSFEWLFETFKKSMKGKCPITIFSDQDAAIAG  216

Query  182  AISLVFPSARHRLCIWHIGENSKKH  256
            AI   FP++RHRLC+WH+ +N+ + 
Sbjct  217  AIKKAFPTSRHRLCLWHLSQNANQQ  241



>ref|XP_008645783.1| PREDICTED: protein FAR1-RELATED SEQUENCE 12-like [Zea mays]
Length=715

 Score =   103 bits (256),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 42/89 (47%), Positives = 60/89 (67%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            +IC PFVG+NHH    M+GC  L +E T +FVWLFK+FL +MG + PQ+I T+    ++ 
Sbjct  318  LICAPFVGVNHHWQTTMYGCALLADESTSAFVWLFKSFLESMGNRHPQSIFTNLDQVVTK  377

Query  182  AISLVFPSARHRLCIWHIGENSKKHIKCL  268
            A+  VFP+ARHR+  WHI +N+   +  L
Sbjct  378  AVEEVFPNARHRIAHWHIQKNAHSRLGAL  406



>ref|XP_008240644.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Prunus mume]
Length=733

 Score =   103 bits (256),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 43/81 (53%), Positives = 59/81 (73%), Gaps = 0/81 (0%)
 Frame = +2

Query  17   FVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAISLV  196
            FVG+NHH   ++FG   L +E   +F WLF TF++AM GK P++I+TDQ AAMSAA++L 
Sbjct  236  FVGVNHHKQTIIFGTALLYDETIQTFTWLFDTFVKAMSGKKPKSILTDQDAAMSAALALK  295

Query  197  FPSARHRLCIWHIGENSKKHI  259
            +    HRLCIWHI +N+ KH+
Sbjct  296  WLETSHRLCIWHIYQNAAKHL  316



>gb|AFW71752.1| FAR1-domain family sequence [Zea mays]
Length=687

 Score =   102 bits (255),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 42/89 (47%), Positives = 60/89 (67%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            +IC PFVG+NHH    M+GC  L +E T +FVWLFK+FL +MG + PQ+I T+    ++ 
Sbjct  290  LICAPFVGVNHHWQTTMYGCALLADESTSAFVWLFKSFLESMGNRHPQSIFTNLDQVVTK  349

Query  182  AISLVFPSARHRLCIWHIGENSKKHIKCL  268
            A+  VFP+ARHR+  WHI +N+   +  L
Sbjct  350  AVEEVFPNARHRIAHWHIQKNAHSRLGAL  378



>ref|XP_010941828.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Elaeis guineensis]
Length=533

 Score =   102 bits (253),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 41/82 (50%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = +2

Query  14   PFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAISL  193
            P +G++HH   ++FG   L +ER +SF W+F T+++AM GK P+ I+TDQ +A+  AISL
Sbjct  413  PIIGIDHHYQTIIFGGALLFDEREESFAWVFSTWMKAMEGKRPKVILTDQESAIGGAISL  472

Query  194  VFPSARHRLCIWHIGENSKKHI  259
            V P +RHR CIWHI  N  K+I
Sbjct  473  VLPESRHRFCIWHIMRNGLKNI  494



>ref|XP_006647361.1| PREDICTED: protein FAR1-RELATED SEQUENCE 7-like isoform X1 [Oryza 
brachyantha]
Length=727

 Score =   103 bits (256),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 44/89 (49%), Positives = 59/89 (66%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            +IC PFVG+NHH  + M+GC  L +E   SFVWLFK+FL AMG + P++I T+Q   MS 
Sbjct  329  LICAPFVGVNHHWQSTMYGCALLADESMSSFVWLFKSFLEAMGNRHPRSIFTNQDQVMSK  388

Query  182  AISLVFPSARHRLCIWHIGENSKKHIKCL  268
            AI  VFP+  HR+  WHI +N+   +  L
Sbjct  389  AIEEVFPNTCHRISRWHIQKNAASRLGAL  417



>ref|XP_010239385.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Brachypodium 
distachyon]
Length=371

 Score =   100 bits (249),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 44/78 (56%), Positives = 54/78 (69%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            M   PF+G+N+H  ++ FGCGFL NE T+ FVWLF+TFL A+ G  P  I+TDQ  AM A
Sbjct  202  MPFAPFIGINNHGQSIQFGCGFLRNELTERFVWLFRTFLEAVDGLVPINIITDQDFAMRA  261

Query  182  AISLVFPSARHRLCIWHI  235
             I  VFP+ RHR C WHI
Sbjct  262  GIDEVFPNTRHRNCRWHI  279



>ref|XP_004298288.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Fragaria vesca 
subsp. vesca]
Length=599

 Score =   102 bits (254),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 43/83 (52%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = +2

Query  11   GPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAIS  190
             PFVG+NHH    +FG   L +E  +SF WLF+TFL AM GK P TI+TDQ AAM+ AI 
Sbjct  229  APFVGVNHHKQTTLFGAALLYDETIESFKWLFETFLSAMSGKQPLTILTDQSAAMARAIQ  288

Query  191  LVFPSARHRLCIWHIGENSKKHI  259
               P A HRLC+W++ +N+ K++
Sbjct  289  EALPQATHRLCVWYLYQNAAKNL  311



>ref|XP_007216405.1| hypothetical protein PRUPE_ppa022645mg [Prunus persica]
 gb|EMJ17604.1| hypothetical protein PRUPE_ppa022645mg [Prunus persica]
Length=556

 Score =   102 bits (254),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 41/82 (50%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = +2

Query  14   PFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAISL  193
            PF+G+NHH   ++FG   L +E  +S+ WLF+TFL AM GK P+TI+TDQ A M+ AI  
Sbjct  239  PFIGINHHKQMLIFGAALLYDESVESYKWLFQTFLEAMSGKKPKTILTDQDALMAEAIDK  298

Query  194  VFPSARHRLCIWHIGENSKKHI  259
            VFP   HR+C+WH+ +N+ K +
Sbjct  299  VFPETMHRICVWHVYQNALKQL  320



>ref|XP_008230452.1| PREDICTED: protein FAR1-RELATED SEQUENCE 12-like [Prunus mume]
 ref|XP_008230453.1| PREDICTED: protein FAR1-RELATED SEQUENCE 12-like [Prunus mume]
Length=843

 Score =   102 bits (255),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 41/82 (50%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = +2

Query  14   PFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAISL  193
            PF+G+NHH   ++FG   L +E  +S+ WLF+TFL AM GK P+TI+TDQ A M+ AI  
Sbjct  526  PFIGINHHKQMLIFGAALLYDESVESYKWLFQTFLEAMSGKKPKTILTDQDALMAEAIDK  585

Query  194  VFPSARHRLCIWHIGENSKKHI  259
            VFP   HR+C+WH+ +N+ K +
Sbjct  586  VFPETLHRICVWHVYQNALKQL  607



>ref|XP_009133360.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5 [Brassica rapa]
Length=767

 Score =   102 bits (255),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 42/75 (56%), Positives = 52/75 (69%), Gaps = 0/75 (0%)
 Frame = +2

Query  11   GPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAIS  190
             PF G+NHH   ++FGC F++NE   SFVWLFKT+L AM G+ P +I TD  A + AA+ 
Sbjct  293  APFTGVNHHGQPILFGCAFIVNENEASFVWLFKTWLSAMSGRSPVSITTDHDAVIRAAVM  352

Query  191  LVFPSARHRLCIWHI  235
             VFP ARHR C WHI
Sbjct  353  QVFPEARHRFCKWHI  367



>ref|XP_010257333.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X2 [Nelumbo 
nucifera]
 ref|XP_010257334.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X2 [Nelumbo 
nucifera]
 ref|XP_010257335.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X2 [Nelumbo 
nucifera]
Length=767

 Score =   102 bits (255),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 43/83 (52%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = +2

Query  11   GPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAIS  190
            G FVG+NHH  +++FG   L +E T+SF WL  TF++AM GK P+TI+TDQ AAM+ AI 
Sbjct  280  GLFVGVNHHKQSIVFGGALLYDETTESFEWLLHTFVKAMSGKMPRTIITDQGAAMANAIK  339

Query  191  LVFPSARHRLCIWHIGENSKKHI  259
             V P+  HR+C+WH+ +N+ K+I
Sbjct  340  TVLPTTDHRICVWHMYQNALKNI  362



>ref|XP_010257327.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010257328.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010257329.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010257330.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010257332.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1 [Nelumbo 
nucifera]
Length=787

 Score =   102 bits (255),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 43/83 (52%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = +2

Query  11   GPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAIS  190
            G FVG+NHH  +++FG   L +E T+SF WL  TF++AM GK P+TI+TDQ AAM+ AI 
Sbjct  300  GLFVGVNHHKQSIVFGGALLYDETTESFEWLLHTFVKAMSGKMPRTIITDQGAAMANAIK  359

Query  191  LVFPSARHRLCIWHIGENSKKHI  259
             V P+  HR+C+WH+ +N+ K+I
Sbjct  360  TVLPTTDHRICVWHMYQNALKNI  382



>ref|XP_002444421.1| hypothetical protein SORBIDRAFT_07g021690 [Sorghum bicolor]
 gb|EES13916.1| hypothetical protein SORBIDRAFT_07g021690 [Sorghum bicolor]
Length=852

 Score =   102 bits (255),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 46/87 (53%), Positives = 59/87 (68%), Gaps = 1/87 (1%)
 Frame = +2

Query  11   GPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAIS  190
             PFVG+  H     FGC F+ +E TD+F WLF+TF+ AMGGK P TI+TDQ AAM AAI 
Sbjct  343  APFVGVTGHGHTCFFGCAFICDETTDTFKWLFETFIEAMGGKHPVTIITDQDAAMKAAIQ  402

Query  191  LVFPSARHRLCIWHIGENS-KKHIKCL  268
             VFP  +HR C++HI +    K++KC 
Sbjct  403  QVFPDTKHRNCLFHIKKKCYNKNLKCF  429



>ref|XP_010231561.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Brachypodium 
distachyon]
Length=840

 Score =   102 bits (254),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 58/86 (67%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            M C PF+G+N+H  ++ FGCGFL NE T SFVWLFKTFL AM G  P  I+TDQ  AM  
Sbjct  298  MPCAPFIGINNHGQSVQFGCGFLRNEDTLSFVWLFKTFLEAMDGIAPVNIITDQDFAMRN  357

Query  182  AISLVFPSARHRLCIWHIGENSKKHI  259
             IS VF  A HR C WHI + +++ +
Sbjct  358  GISEVFLDATHRNCRWHIMKKAQEKL  383



>ref|XP_009350481.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1 [Pyrus 
x bretschneideri]
Length=836

 Score =   102 bits (254),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 44/83 (53%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = +2

Query  11   GPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAIS  190
             P +G+NHH   ++FG   L ++  DSF WLF+TFL AM GK P+TI+TDQ AAM+ AI 
Sbjct  284  APLIGVNHHKQIVVFGAALLYDDSRDSFKWLFETFLAAMSGKQPKTILTDQSAAMAEAIL  343

Query  191  LVFPSARHRLCIWHIGENSKKHI  259
             VFP A HRLC WHI + + K++
Sbjct  344  EVFPEANHRLCAWHIYQKAAKNL  366



>ref|XP_004289345.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Fragaria vesca 
subsp. vesca]
Length=359

 Score = 99.8 bits (247),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 40/78 (51%), Positives = 56/78 (72%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            M   PF G+NHH  ++ FGC  L +E   +F+WLF+T+L+AMGG+ P +I+TDQ  AM  
Sbjct  23   MPFAPFTGVNHHWQSIQFGCALLQDETETNFLWLFETWLQAMGGRHPISIITDQDLAMKG  82

Query  182  AISLVFPSARHRLCIWHI  235
            AI+ +FP+  HRLC+WHI
Sbjct  83   AIAKIFPNTHHRLCLWHI  100



>ref|XP_010236809.1| PREDICTED: protein FAR1-RELATED SEQUENCE 7-like [Brachypodium 
distachyon]
Length=723

 Score =   102 bits (253),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 44/89 (49%), Positives = 58/89 (65%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            +IC PFVG+NHH    ++GC  L +E   SFVWLFK+FL AMG + P++I T+Q   MS 
Sbjct  325  LICAPFVGVNHHWQTAIYGCALLADESLSSFVWLFKSFLEAMGNRHPRSIFTNQDQVMSK  384

Query  182  AISLVFPSARHRLCIWHIGENSKKHIKCL  268
            AI  VFPS  HR+  WHI +N+   +  L
Sbjct  385  AIEEVFPSTCHRIAHWHIQKNAASRLGAL  413



>ref|XP_009350482.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X2 [Pyrus 
x bretschneideri]
Length=810

 Score =   102 bits (254),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 44/83 (53%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = +2

Query  11   GPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAIS  190
             P +G+NHH   ++FG   L ++  DSF WLF+TFL AM GK P+TI+TDQ AAM+ AI 
Sbjct  284  APLIGVNHHKQIVVFGAALLYDDSRDSFKWLFETFLAAMSGKQPKTILTDQSAAMAEAIL  343

Query  191  LVFPSARHRLCIWHIGENSKKHI  259
             VFP A HRLC WHI + + K++
Sbjct  344  EVFPEANHRLCAWHIYQKAAKNL  366



>ref|XP_008654819.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Zea mays]
Length=589

 Score =   101 bits (252),  Expect = 8e-23, Method: Composition-based stats.
 Identities = 41/80 (51%), Positives = 56/80 (70%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            MI  PF G+NHH  ++ FG  F+ NE+ +S+ WLF+TFL AMGGK P+ I+TD+ A+M +
Sbjct  346  MIFAPFTGVNHHMQSVFFGAAFIANEKIESYEWLFRTFLSAMGGKDPRLIITDEDASMKS  405

Query  182  AISLVFPSARHRLCIWHIGE  241
            AI  + P   HR C+WHI E
Sbjct  406  AIRTILPHTIHRFCMWHIME  425



>ref|XP_003589508.1| FAR1-related protein [Medicago truncatula]
Length=793

 Score =   102 bits (253),  Expect = 8e-23, Method: Composition-based stats.
 Identities = 45/86 (52%), Positives = 60/86 (70%), Gaps = 0/86 (0%)
 Frame = +2

Query  11   GPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAIS  190
            G FVG+N+H   ++FG   L +E   SF WLF+TFL+A+GGK P+TI+TDQ AAM+  IS
Sbjct  277  GVFVGLNNHRQTIIFGATLLYDETIPSFQWLFETFLKAIGGKKPKTILTDQDAAMAKGIS  336

Query  191  LVFPSARHRLCIWHIGENSKKHIKCL  268
            LV P   H LC WHI +N+ +H+  L
Sbjct  337  LVMPETFHGLCTWHIRQNALRHVNHL  362



>ref|XP_010463229.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Camelina sativa]
Length=299

 Score = 99.0 bits (245),  Expect = 9e-23, Method: Composition-based stats.
 Identities = 40/82 (49%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = +2

Query  14   PFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAISL  193
            PFVG+NHH   ++FG   L +E  +S+ WLF+TFL  +  K P+TI+TDQC  M+  I  
Sbjct  142  PFVGVNHHKQTIVFGAPLLYDETIESYKWLFETFLGEISRKQPKTILTDQCTTMANGIVK  201

Query  194  VFPSARHRLCIWHIGENSKKHI  259
            VFP  +HRLC+WHI +N+ K +
Sbjct  202  VFPEKKHRLCVWHIYQNAAKKL  223



>ref|XP_007212371.1| hypothetical protein PRUPE_ppa014831mg [Prunus persica]
 ref|XP_007221097.1| hypothetical protein PRUPE_ppa017176mg [Prunus persica]
 gb|EMJ13570.1| hypothetical protein PRUPE_ppa014831mg [Prunus persica]
 gb|EMJ22296.1| hypothetical protein PRUPE_ppa017176mg [Prunus persica]
Length=665

 Score =   101 bits (252),  Expect = 9e-23, Method: Composition-based stats.
 Identities = 41/78 (53%), Positives = 56/78 (72%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            M   PF G+NHH  ++ FGC  L +E   +F+WLF+T+L AMGG+ P +I+TDQ  AM  
Sbjct  250  MPFAPFTGVNHHLQSIQFGCALLQDETEVTFLWLFETWLEAMGGRHPVSIITDQDLAMKG  309

Query  182  AISLVFPSARHRLCIWHI  235
            AI+ +FP+ RHRLC+WHI
Sbjct  310  AIAKIFPNTRHRLCLWHI  327



>gb|AAL58182.1|AC027037_4 putative far-red impaired response protein [Oryza sativa Japonica 
Group]
Length=721

 Score =   101 bits (252),  Expect = 9e-23, Method: Composition-based stats.
 Identities = 43/83 (52%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = +2

Query  14   PFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAISL  193
            PFVG NHH   ++FGCG L NE   S+VWL +T L AM  K P++++TD  A+M+ AI  
Sbjct  261  PFVGANHHRSTVIFGCGILSNESVSSYVWLLQTLLEAMHQKHPKSLITDGDASMAKAIRK  320

Query  194  VFPSARHRLCIWHIGENSKKHIK  262
            V P+  HRLC WHI EN K+H++
Sbjct  321  VMPNTDHRLCSWHIEENMKRHLR  343



>ref|XP_004305654.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Fragaria vesca 
subsp. vesca]
Length=226

 Score = 97.8 bits (242),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            M   PF G+NHH  ++ FGC  L +E   +F+WLF+T+L AMGG+ P  I+TDQ  AM  
Sbjct  95   MPFAPFTGLNHHFQSIQFGCALLQDETESTFLWLFETWLEAMGGRHPLCIITDQDLAMKG  154

Query  182  AISLVFPSARHRLCIWHI  235
            AI+ +FP+A HRLCIWHI
Sbjct  155  AIAKIFPTASHRLCIWHI  172



>ref|XP_010689192.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Beta vulgaris 
subsp. vulgaris]
Length=226

 Score = 97.8 bits (242),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 57/89 (64%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            +IC  FVG+N H    MF C F+ NE+ +SF WL +TF RAM  + P+T  TDQ  AM  
Sbjct  112  LICTQFVGINCHWKTAMFACAFITNEKEESFEWLLETFKRAMCQQEPKTFFTDQDKAMGN  171

Query  182  AISLVFPSARHRLCIWHIGENSKKHIKCL  268
            AI  VFP++RHRLC+WHI +N   H   L
Sbjct  172  AIEKVFPNSRHRLCLWHIEKNFVSHFGSL  200



>ref|NP_001063309.1| Os09g0446400 [Oryza sativa Japonica Group]
 dbj|BAF25223.1| Os09g0446400 [Oryza sativa Japonica Group]
Length=561

 Score =   100 bits (250),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 42/80 (53%), Positives = 55/80 (69%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            MI  PF G+NHH  ++  G  FL NE+ +S+VWLFKTFL+AM G  P  I+TD+  +M A
Sbjct  281  MIFVPFTGVNHHLQSVFLGAAFLANEKIESYVWLFKTFLKAMRGVAPHLIITDEDMSMKA  340

Query  182  AISLVFPSARHRLCIWHIGE  241
            AI+ + P   HRLC+WHI E
Sbjct  341  AIAQILPDTAHRLCMWHIME  360



>gb|EEE69818.1| hypothetical protein OsJ_29559 [Oryza sativa Japonica Group]
Length=562

 Score =   100 bits (250),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 42/80 (53%), Positives = 55/80 (69%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            MI  PF G+NHH  ++  G  FL NE+ +S+VWLFKTFL+AM G  P  I+TD+  +M A
Sbjct  282  MIFVPFTGVNHHLQSVFLGAAFLANEKIESYVWLFKTFLKAMRGVAPHLIITDEDMSMKA  341

Query  182  AISLVFPSARHRLCIWHIGE  241
            AI+ + P   HRLC+WHI E
Sbjct  342  AIAQILPDTAHRLCMWHIME  361



>ref|XP_010250357.1| PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1-like [Nelumbo 
nucifera]
 ref|XP_010250363.1| PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1-like [Nelumbo 
nucifera]
Length=654

 Score =   101 bits (251),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 42/78 (54%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            M   PF+G+N+HC   + GC  + +  T  +VWL KT+LRAMGG  P+ I+TDQ  A+ A
Sbjct  276  MPFAPFIGVNNHCQPTLLGCALIADGTTSRYVWLMKTWLRAMGGVAPKVIVTDQDDAIKA  335

Query  182  AISLVFPSARHRLCIWHI  235
            AI+ VFPSARHR C+WHI
Sbjct  336  AITQVFPSARHRFCLWHI  353



>ref|XP_006388581.1| hypothetical protein POPTR_0149s00230g [Populus trichocarpa]
 gb|ERP47495.1| hypothetical protein POPTR_0149s00230g [Populus trichocarpa]
Length=625

 Score =   101 bits (251),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 44/86 (51%), Positives = 58/86 (67%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            MIC PF G+NHH   +MFGC FLL+E  +SFVWLF+TFL AMG K P+TI+TD+   M  
Sbjct  244  MICAPFWGLNHHRQYVMFGCAFLLDESKESFVWLFETFLEAMGRKQPKTIVTDENQVMVD  303

Query  182  AISLVFPSARHRLCIWHIGENSKKHI  259
            A+ +V   A H   +W I + + KH+
Sbjct  304  AVKVVLLDAEHLFGVWFIRQKALKHL  329



>ref|XP_008669590.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Zea mays]
 ref|XP_008670829.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Zea mays]
 ref|XP_008662561.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Zea mays]
Length=499

 Score =   100 bits (248),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 39/82 (48%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = +2

Query  14   PFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAISL  193
            PF G+NHH  ++ FG  F++NE+ +S+ WLF+TFL AMG K P+ I+TD+ A+M +AI  
Sbjct  371  PFTGVNHHMQSVFFGAAFIVNEKIESYEWLFRTFLSAMGEKAPRLIITDEDASMRSAIRS  430

Query  194  VFPSARHRLCIWHIGENSKKHI  259
            +FP   HR C+WHI E   + +
Sbjct  431  IFPDTIHRFCMWHIMEKMSEKV  452



>ref|XP_006422378.1| hypothetical protein CICLE_v10027888mg [Citrus clementina]
 gb|ESR35618.1| hypothetical protein CICLE_v10027888mg [Citrus clementina]
Length=736

 Score =   101 bits (251),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 42/75 (56%), Positives = 52/75 (69%), Gaps = 0/75 (0%)
 Frame = +2

Query  11   GPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAIS  190
             PF G+NHH   ++FGC FL+NE   SFVWLFKT+L AM G+ P +I TD  A + +AI+
Sbjct  307  APFTGVNHHGQPVLFGCAFLINESEASFVWLFKTWLMAMSGRPPVSITTDHDAVIRSAIN  366

Query  191  LVFPSARHRLCIWHI  235
             VFP  RHR C WHI
Sbjct  367  QVFPETRHRFCKWHI  381



>ref|XP_006486554.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Citrus sinensis]
Length=786

 Score =   101 bits (251),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 42/75 (56%), Positives = 52/75 (69%), Gaps = 0/75 (0%)
 Frame = +2

Query  11   GPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAIS  190
             PF G+NHH   ++FGC FL+NE   SFVWLFKT+L AM G+ P +I TD  A + +AI+
Sbjct  307  APFTGVNHHGQPVLFGCAFLINESEASFVWLFKTWLMAMSGRPPVSITTDHDAVIRSAIN  366

Query  191  LVFPSARHRLCIWHI  235
             VFP  RHR C WHI
Sbjct  367  QVFPETRHRFCKWHI  381



>ref|XP_002283202.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5 [Vitis vinifera]
 ref|XP_010645572.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5 [Vitis vinifera]
 ref|XP_010645577.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5 [Vitis vinifera]
Length=783

 Score =   101 bits (251),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 42/75 (56%), Positives = 51/75 (68%), Gaps = 0/75 (0%)
 Frame = +2

Query  11   GPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAIS  190
             PF G+NHH   ++FGC FL+NE   SF+WLFKT+L AM G+ P +I TD  A +  AIS
Sbjct  304  APFTGVNHHGQPVLFGCAFLINESEASFIWLFKTWLMAMSGRPPVSITTDHDAVIGLAIS  363

Query  191  LVFPSARHRLCIWHI  235
             VFP  RHR C WHI
Sbjct  364  QVFPETRHRFCKWHI  378



>ref|XP_006663840.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Oryza brachyantha]
Length=818

 Score =   101 bits (251),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 43/89 (48%), Positives = 58/89 (65%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            MIC PFVG+NHH  N++FGC FLL+E + S+ WLFK+FL +MGG+ P+TI T +   +S 
Sbjct  308  MICAPFVGVNHHGQNVIFGCAFLLDESSTSYEWLFKSFLDSMGGRPPKTIFTVKDETISK  367

Query  182  AISLVFPSARHRLCIWHIGENSKKHIKCL  268
             I  VFP   H +C W I    + H+  L
Sbjct  368  VIDGVFPETHHCICEWSIENTLQSHLGTL  396



>ref|XP_002446233.1| hypothetical protein SORBIDRAFT_06g007340 [Sorghum bicolor]
 gb|EES10561.1| hypothetical protein SORBIDRAFT_06g007340 [Sorghum bicolor]
Length=371

 Score = 98.6 bits (244),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 42/75 (56%), Positives = 51/75 (68%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            M   P +G NHH   ++FG   + NE  ++FVWLF TFL AM  K P TI TDQCAAMSA
Sbjct  297  MPFAPLLGTNHHKQTIIFGAALIYNETIETFVWLFNTFLTAMSSKHPSTIFTDQCAAMSA  356

Query  182  AISLVFPSARHRLCI  226
            AI +VFP+  HRLC+
Sbjct  357  AIRIVFPNTAHRLCL  371



>ref|XP_006429377.1| hypothetical protein CICLE_v10013423mg, partial [Citrus clementina]
 gb|ESR42617.1| hypothetical protein CICLE_v10013423mg, partial [Citrus clementina]
Length=448

 Score = 99.4 bits (246),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 40/74 (54%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = +2

Query  14   PFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAISL  193
            PF+G+N+H  ++   C  L +E T +FVWL +T+LRAMGGK P  I+T+Q  AM A+IS+
Sbjct  5    PFIGVNNHFQSISLVCALLADETTSTFVWLMQTWLRAMGGKHPIAILTNQDKAMKASISI  64

Query  194  VFPSARHRLCIWHI  235
            VFP++RHR C+WHI
Sbjct  65   VFPNSRHRFCMWHI  78



>ref|XP_010270684.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Nelumbo nucifera]
Length=291

 Score = 98.2 bits (243),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 41/81 (51%), Positives = 58/81 (72%), Gaps = 0/81 (0%)
 Frame = +2

Query  17   FVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAISLV  196
            FVG+N++   ++FG   L +E T SF WLF+ FL+ MGGK PQTI+TD   AM+ AISLV
Sbjct  165  FVGVNNYRQAIIFGVALLYDETTASFEWLFEVFLKTMGGKPPQTILTDDDVAMAKAISLV  224

Query  197  FPSARHRLCIWHIGENSKKHI  259
             P + H+LC+WH+ ++  KH+
Sbjct  225  LPQSHHQLCVWHMFQSVSKHL  245



>emb|CAN68194.1| hypothetical protein VITISV_036221 [Vitis vinifera]
Length=841

 Score =   101 bits (251),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 42/75 (56%), Positives = 51/75 (68%), Gaps = 0/75 (0%)
 Frame = +2

Query  11   GPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAIS  190
             PF G+NHH   ++FGC FL+NE   SF+WLFKT+L AM G+ P +I TD  A +  AIS
Sbjct  294  APFTGVNHHGQPVLFGCAFLINESEASFIWLFKTWLMAMSGRPPVSITTDHDAVIGLAIS  353

Query  191  LVFPSARHRLCIWHI  235
             VFP  RHR C WHI
Sbjct  354  QVFPETRHRFCKWHI  368



>ref|XP_003623738.1| FAR1-related protein [Medicago truncatula]
Length=793

 Score =   100 bits (250),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 45/86 (52%), Positives = 59/86 (69%), Gaps = 0/86 (0%)
 Frame = +2

Query  11   GPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAIS  190
            G  VG+N+H   ++FG   L +E   SF WLF+TFL+AMGGK P+TI+TDQ AAM+  IS
Sbjct  277  GVVVGLNNHRQTIIFGATLLYDETIPSFQWLFETFLKAMGGKKPKTILTDQDAAMAKGIS  336

Query  191  LVFPSARHRLCIWHIGENSKKHIKCL  268
            LV P   H LC WHI +N+ +H+  L
Sbjct  337  LVMPETFHGLCTWHIRQNALRHVNHL  362



>ref|XP_010682171.1| PREDICTED: protein FAR1-RELATED SEQUENCE 6-like [Beta vulgaris 
subsp. vulgaris]
Length=907

 Score =   101 bits (251),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 41/75 (55%), Positives = 53/75 (71%), Gaps = 0/75 (0%)
 Frame = +2

Query  17   FVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAISLV  196
            FVG+NHH  +++ GC  L +E T++F WLF T+L  MGGK P  I+TDQCAAM  A+   
Sbjct  319  FVGVNHHGQSILLGCALLSHEHTETFEWLFSTWLSCMGGKAPLGILTDQCAAMRKALLTS  378

Query  197  FPSARHRLCIWHIGE  241
             P+ARHR C+WHI E
Sbjct  379  MPTARHRWCLWHITE  393



>gb|EMS54139.1| Vacuolar protein sorting-associated protein 11-like protein [Triticum 
urartu]
Length=1686

 Score =   101 bits (252),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 42/83 (51%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = +2

Query  11   GPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAIS  190
            G  VG+N+H   ++FG   L +E   SF WLF+TFL+ M GK P+TI+TD+ AAM+ AI 
Sbjct  228  GLIVGVNNHKKTIVFGAALLYDETAASFAWLFRTFLKVMSGKHPRTILTDEDAAMAKAIR  287

Query  191  LVFPSARHRLCIWHIGENSKKHI  259
             VFP + HRLC+WH+ +N+ KH+
Sbjct  288  EVFPHSHHRLCVWHMNQNTCKHL  310



>ref|XP_006373793.1| hypothetical protein POPTR_0016s05920g, partial [Populus trichocarpa]
 gb|ERP51590.1| hypothetical protein POPTR_0016s05920g, partial [Populus trichocarpa]
Length=607

 Score =   100 bits (249),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 44/86 (51%), Positives = 58/86 (67%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            MIC PF G+NHH   +MFGC FLL+E  +SFVWLF+TFL AMG K P+TI+TD+   M  
Sbjct  239  MICAPFWGLNHHRQYVMFGCAFLLDESKESFVWLFETFLEAMGRKQPKTIVTDENQVMVD  298

Query  182  AISLVFPSARHRLCIWHIGENSKKHI  259
            A+ +V   A H   +W I + + KH+
Sbjct  299  AVKVVLLDAEHLFGVWFIRQKALKHL  324



>ref|XP_010265220.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X2 [Nelumbo 
nucifera]
 ref|XP_010265221.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X2 [Nelumbo 
nucifera]
Length=848

 Score =   100 bits (250),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 42/81 (52%), Positives = 59/81 (73%), Gaps = 0/81 (0%)
 Frame = +2

Query  17   FVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAISLV  196
            FVG+NHH  +++FG   L +E T+SF WLF+TF+ AM GK P+TI+TDQ  AM+ AI  V
Sbjct  295  FVGVNHHKQSIIFGGALLYDETTESFEWLFQTFVEAMSGKRPKTILTDQSVAMANAIKSV  354

Query  197  FPSARHRLCIWHIGENSKKHI  259
             P+  HR+C+WHI +N+ + I
Sbjct  355  LPNTCHRICVWHIFQNAMRKI  375



>ref|XP_007199084.1| hypothetical protein PRUPE_ppa019160mg, partial [Prunus persica]
 gb|EMJ00283.1| hypothetical protein PRUPE_ppa019160mg, partial [Prunus persica]
Length=662

 Score =   100 bits (249),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 43/87 (49%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            M   PFVG+NHH  +++ GCG + +E TD+FVWLFK +L  M G  P  I+TDQ  AM  
Sbjct  262  MPFAPFVGVNHHGHSILLGCGLISSEDTDTFVWLFKVWLACMSGLAPCGIITDQDRAMKN  321

Query  182  AISLVFPSARHRLCIWHIGENSKKHIK  262
            AI +VFP+ RHR C+WHI +   + +K
Sbjct  322  AIEIVFPNTRHRWCLWHIMKKLHEKLK  348



>ref|XP_010265223.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X4 [Nelumbo 
nucifera]
Length=791

 Score =   100 bits (250),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 42/81 (52%), Positives = 59/81 (73%), Gaps = 0/81 (0%)
 Frame = +2

Query  17   FVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAISLV  196
            FVG+NHH  +++FG   L +E T+SF WLF+TF+ AM GK P+TI+TDQ  AM+ AI  V
Sbjct  238  FVGVNHHKQSIIFGGALLYDETTESFEWLFQTFVEAMSGKRPKTILTDQSVAMANAIKSV  297

Query  197  FPSARHRLCIWHIGENSKKHI  259
             P+  HR+C+WHI +N+ + I
Sbjct  298  LPNTCHRICVWHIFQNAMRKI  318



>ref|XP_002464378.1| hypothetical protein SORBIDRAFT_01g017200 [Sorghum bicolor]
 gb|EER91376.1| hypothetical protein SORBIDRAFT_01g017200 [Sorghum bicolor]
Length=518

 Score = 99.8 bits (247),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 43/75 (57%), Positives = 54/75 (72%), Gaps = 0/75 (0%)
 Frame = +2

Query  11   GPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAIS  190
             PFVG+  H    +FGC FL +E T +F W+F+TFL AMGGK P+TI+TDQ  AM AAI 
Sbjct  340  APFVGITGHAQTCIFGCAFLHDETTTTFKWVFETFLEAMGGKHPKTIITDQDKAMKAAIE  399

Query  191  LVFPSARHRLCIWHI  235
             VFP+ RHR C++HI
Sbjct  400  DVFPNTRHRNCLFHI  414



>ref|XP_009378028.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1 [Pyrus 
x bretschneideri]
Length=836

 Score =   100 bits (250),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 43/83 (52%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = +2

Query  11   GPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAIS  190
             P +G+NHH   ++FG   L ++  DSF WLF+TFL AM GK P+TI+TDQ AAM+ AI 
Sbjct  284  APLIGVNHHKQIVVFGAALLYDDSRDSFKWLFETFLAAMSGKQPKTILTDQSAAMAEAIL  343

Query  191  LVFPSARHRLCIWHIGENSKKHI  259
             VFP A H+LC WHI + + K++
Sbjct  344  EVFPEANHQLCAWHIYQKAAKNL  366



>ref|XP_002443950.1| hypothetical protein SORBIDRAFT_07g004960 [Sorghum bicolor]
 gb|EES13445.1| hypothetical protein SORBIDRAFT_07g004960 [Sorghum bicolor]
Length=414

 Score = 98.2 bits (243),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 40/76 (53%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +2

Query  14   PFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAISL  193
            PF G+NHH  ++  G  FL +E+ +SFVWLF+TFL+A GG  P  I+TD+ A+M AAI+ 
Sbjct  243  PFTGVNHHLQSVFLGAAFLADEKIESFVWLFQTFLKANGGVAPHLIITDEDASMKAAIAQ  302

Query  194  VFPSARHRLCIWHIGE  241
            + P+  HRLC+WHI E
Sbjct  303  ILPNTVHRLCMWHIME  318



>ref|XP_008235836.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5 [Prunus mume]
Length=795

 Score =   100 bits (249),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 42/75 (56%), Positives = 51/75 (68%), Gaps = 0/75 (0%)
 Frame = +2

Query  11   GPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAIS  190
             PF G+NHH   ++FGC FL+NE   SFVWLFKT+L AM G+ P +I TD  A + +AI 
Sbjct  318  APFTGVNHHGQPVLFGCAFLINESEASFVWLFKTWLMAMSGRHPVSITTDHDAVIQSAIM  377

Query  191  LVFPSARHRLCIWHI  235
             VFP  RHR C WHI
Sbjct  378  QVFPQTRHRFCKWHI  392



>ref|XP_007200955.1| hypothetical protein PRUPE_ppa001597mg [Prunus persica]
 gb|EMJ02154.1| hypothetical protein PRUPE_ppa001597mg [Prunus persica]
Length=795

 Score =   100 bits (249),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 42/75 (56%), Positives = 51/75 (68%), Gaps = 0/75 (0%)
 Frame = +2

Query  11   GPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAIS  190
             PF G+NHH   ++FGC FL+NE   SFVWLFKT+L AM G+ P +I TD  A + +AI 
Sbjct  318  APFTGVNHHGQPVLFGCAFLINESEASFVWLFKTWLMAMSGRHPVSITTDHDAVIQSAIM  377

Query  191  LVFPSARHRLCIWHI  235
             VFP  RHR C WHI
Sbjct  378  QVFPQTRHRFCKWHI  392



>ref|XP_008338195.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Malus domestica]
Length=294

 Score = 97.4 bits (241),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 41/83 (49%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = +2

Query  11   GPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAIS  190
             P +G+NHH   ++F    L  E  +SF WLF+TFL AM  K P+TI+TDQ AAM+ AIS
Sbjct  72   APILGVNHHKQTVVFSAALLYEESANSFTWLFETFLEAMSRKQPKTILTDQSAAMAKAIS  131

Query  191  LVFPSARHRLCIWHIGENSKKHI  259
             VF  + H LC+WHI +N+ K++
Sbjct  132  EVFNESHHHLCVWHIYQNAAKNL  154



>ref|XP_010675563.1| PREDICTED: protein FAR1-RELATED SEQUENCE 4-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010696068.1| PREDICTED: protein FAR1-RELATED SEQUENCE 4-like [Beta vulgaris 
subsp. vulgaris]
Length=798

 Score =   100 bits (249),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 40/75 (53%), Positives = 54/75 (72%), Gaps = 0/75 (0%)
 Frame = +2

Query  17   FVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAISLV  196
            FVG+NHH  +++ GC  + +E T++F WLF+T+L  MGGK P  I+TDQCAAM  A+   
Sbjct  308  FVGVNHHGQSILLGCALVSHENTETFEWLFRTWLLCMGGKSPGGILTDQCAAMRKALRTS  367

Query  197  FPSARHRLCIWHIGE  241
             P+ARHR C+WHI E
Sbjct  368  MPNARHRWCLWHITE  382



>ref|XP_010265219.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1 [Nelumbo 
nucifera]
Length=874

 Score =   100 bits (249),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 42/81 (52%), Positives = 59/81 (73%), Gaps = 0/81 (0%)
 Frame = +2

Query  17   FVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAISLV  196
            FVG+NHH  +++FG   L +E T+SF WLF+TF+ AM GK P+TI+TDQ  AM+ AI  V
Sbjct  321  FVGVNHHKQSIIFGGALLYDETTESFEWLFQTFVEAMSGKRPKTILTDQSVAMANAIKSV  380

Query  197  FPSARHRLCIWHIGENSKKHI  259
             P+  HR+C+WHI +N+ + I
Sbjct  381  LPNTCHRICVWHIFQNAMRKI  401



>ref|XP_010265222.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X3 [Nelumbo 
nucifera]
Length=846

 Score =   100 bits (249),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 42/81 (52%), Positives = 59/81 (73%), Gaps = 0/81 (0%)
 Frame = +2

Query  17   FVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAISLV  196
            FVG+NHH  +++FG   L +E T+SF WLF+TF+ AM GK P+TI+TDQ  AM+ AI  V
Sbjct  321  FVGVNHHKQSIIFGGALLYDETTESFEWLFQTFVEAMSGKRPKTILTDQSVAMANAIKSV  380

Query  197  FPSARHRLCIWHIGENSKKHI  259
             P+  HR+C+WHI +N+ + I
Sbjct  381  LPNTCHRICVWHIFQNAMRKI  401



>ref|XP_009378036.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X2 [Pyrus 
x bretschneideri]
Length=810

 Score =   100 bits (249),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 43/83 (52%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = +2

Query  11   GPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAIS  190
             P +G+NHH   ++FG   L ++  DSF WLF+TFL AM GK P+TI+TDQ AAM+ AI 
Sbjct  284  APLIGVNHHKQIVVFGAALLYDDSRDSFKWLFETFLAAMSGKQPKTILTDQSAAMAEAIL  343

Query  191  LVFPSARHRLCIWHIGENSKKHI  259
             VFP A H+LC WHI + + K++
Sbjct  344  EVFPEANHQLCAWHIYQKAAKNL  366



>ref|XP_008680369.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Zea mays]
Length=460

 Score = 98.6 bits (244),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 39/76 (51%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +2

Query  14   PFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAISL  193
            PF G+NHH  ++  G GFL+NER +S+ WLFKTFL AMGG+ P+ I+TD+ A++ ++I  
Sbjct  334  PFTGVNHHMQSIFLGGGFLINERIESYEWLFKTFLVAMGGRAPRLIITDEDASLKSSIGS  393

Query  194  VFPSARHRLCIWHIGE  241
            + P   HR C+WHI E
Sbjct  394  ILPETIHRFCMWHILE  409



>dbj|BAD29488.1| putative far-red impaired response protein [Oryza sativa Japonica 
Group]
 dbj|BAD29601.1| putative far-red impaired response protein [Oryza sativa Japonica 
Group]
Length=688

 Score =   100 bits (248),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 42/83 (51%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = +2

Query  14   PFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAISL  193
            PF+G+NHH    +FGCG L NE  +S+ WL +TFL AM    P++++TD   AM+ AIS 
Sbjct  259  PFIGVNHHRSTTIFGCGILSNESVNSYCWLLETFLEAMRQVHPKSLITDGDLAMAKAISK  318

Query  194  VFPSARHRLCIWHIGENSKKHIK  262
            V P A HRLC WHI EN  +H++
Sbjct  319  VMPGAYHRLCTWHIEENMSRHLR  341



>emb|CAD40514.2| OSJNBa0050F15.2 [Oryza sativa Japonica Group]
Length=688

 Score =   100 bits (248),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 42/83 (51%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = +2

Query  14   PFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAISL  193
            PF+G+NHH    +FGCG L NE  +S+ WL +TFL AM    P++++TD   AM+ AIS 
Sbjct  259  PFIGVNHHRSTTIFGCGILSNESVNSYCWLLETFLEAMRQVHPKSLITDGDLAMAKAISK  318

Query  194  VFPSARHRLCIWHIGENSKKHIK  262
            V P A HRLC WHI EN  +H++
Sbjct  319  VMPGAYHRLCTWHIEENMSRHLR  341



>ref|XP_008246383.1| PREDICTED: uncharacterized protein LOC103344568 [Prunus mume]
Length=482

 Score = 99.0 bits (245),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 42/78 (54%), Positives = 53/78 (68%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    MICGPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSA  181
            M+  P VG+N+H   ++FGCGFL NE T+SF+WLF+ F +AM    P+ I+TDQ  AM  
Sbjct  69   MVFAPLVGVNNHGQTILFGCGFLSNETTESFLWLFEQFKKAMPAGPPKIIITDQDPAMGN  128

Query  182  AISLVFPSARHRLCIWHI  235
            AIS  FP   HR CIWHI
Sbjct  129  AISQAFPGVFHRYCIWHI  146



>ref|XP_010273716.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X2 [Nelumbo 
nucifera]
Length=740

 Score =   100 bits (248),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 41/81 (51%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = +2

Query  17   FVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAISLV  196
            FVG+N++   ++FG   L +E  DSF WLFK FL+ MGGK P TI+T   A +  AI+LV
Sbjct  331  FVGVNNYRQTIIFGAALLYDETVDSFEWLFKVFLKTMGGKKPNTILTGDDATIEKAINLV  390

Query  197  FPSARHRLCIWHIGENSKKHI  259
            FP + HRLC+WH+ +N+ KH+
Sbjct  391  FPESHHRLCVWHMFQNATKHL  411



>ref|XP_010273714.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010273715.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1 [Nelumbo 
nucifera]
Length=742

 Score =   100 bits (248),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 41/81 (51%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = +2

Query  17   FVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAISLV  196
            FVG+N++   ++FG   L +E  DSF WLFK FL+ MGGK P TI+T   A +  AI+LV
Sbjct  331  FVGVNNYRQTIIFGAALLYDETVDSFEWLFKVFLKTMGGKKPNTILTGDDATIEKAINLV  390

Query  197  FPSARHRLCIWHIGENSKKHI  259
            FP + HRLC+WH+ +N+ KH+
Sbjct  391  FPESHHRLCVWHMFQNATKHL  411



>ref|XP_006655317.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Oryza brachyantha]
 ref|XP_006658608.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Oryza brachyantha]
Length=729

 Score =   100 bits (248),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 40/76 (53%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = +2

Query  14   PFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAISL  193
            PF G+NHH  ++  G  FL +E+ +SFVWLF+TFL+A GG  P+ I+TD+ A+M AAI+ 
Sbjct  332  PFTGVNHHLQSVFLGAAFLADEKIESFVWLFQTFLKATGGVVPRLIITDEDASMKAAIAQ  391

Query  194  VFPSARHRLCIWHIGE  241
            + P+  HRLC+WHI E
Sbjct  392  ILPNTIHRLCMWHIME  407



>ref|XP_008240566.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Prunus mume]
Length=332

 Score = 97.4 bits (241),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 40/75 (53%), Positives = 54/75 (72%), Gaps = 0/75 (0%)
 Frame = +2

Query  11   GPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAIS  190
             P +G+N+H   ++  C FL  E T+SF+W+F+ F +AM G  P+TI+TDQ AAMS AIS
Sbjct  242  APMLGVNNHGQTIVLACAFLSKETTESFIWMFEEFKKAMPGGEPKTIITDQDAAMSRAIS  301

Query  191  LVFPSARHRLCIWHI  235
            + FP+  HRLCIWHI
Sbjct  302  IAFPTTFHRLCIWHI  316



>ref|XP_010667744.1| PREDICTED: protein FAR1-RELATED SEQUENCE 6-like [Beta vulgaris 
subsp. vulgaris]
Length=880

 Score =   100 bits (248),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 40/75 (53%), Positives = 54/75 (72%), Gaps = 0/75 (0%)
 Frame = +2

Query  17   FVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAISLV  196
            FVG+NHH  +++ GC  + +E T++F WLF+T+L  MGGK P  I+TDQCAAM  A+   
Sbjct  302  FVGVNHHGQSILLGCALVSHENTETFEWLFRTWLICMGGKSPGGILTDQCAAMRKALRTS  361

Query  197  FPSARHRLCIWHIGE  241
             P+ARHR C+WHI E
Sbjct  362  MPNARHRWCLWHITE  376



>ref|XP_008342648.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1 [Malus 
domestica]
Length=836

 Score =   100 bits (248),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 43/83 (52%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = +2

Query  11   GPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAIS  190
             P +G+NHH   ++FG   L ++  DSF WLF+TFL AM GK P+TI+TDQ AA + AI 
Sbjct  284  APLIGVNHHKQIVVFGAALLYDDSRDSFKWLFETFLAAMSGKQPKTILTDQSAATAEAIL  343

Query  191  LVFPSARHRLCIWHIGENSKKHI  259
             VFP A HRLC WHI + + K++
Sbjct  344  EVFPEANHRLCAWHIYQKAAKNL  366



>ref|XP_004295506.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Fragaria vesca 
subsp. vesca]
Length=587

 Score = 99.4 bits (246),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 41/80 (51%), Positives = 55/80 (69%), Gaps = 0/80 (0%)
 Frame = +2

Query  17   FVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAISLV  196
            FVG NHH   ++FG   + +E  +SF+WLF+TFL+AM GK P+TI TDQ  AM+ A+  V
Sbjct  30   FVGFNHHREIIIFGAALMYDETAESFIWLFETFLKAMSGKAPKTIFTDQDVAMAKALRQV  89

Query  197  FPSARHRLCIWHIGENSKKH  256
             P   HRLC WH+ +N+ KH
Sbjct  90   MPDVYHRLCKWHMMQNALKH  109



>ref|XP_010028879.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5 isoform X2 [Eucalyptus 
grandis]
 gb|KCW55697.1| hypothetical protein EUGRSUZ_I01547 [Eucalyptus grandis]
Length=747

 Score = 99.8 bits (247),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 40/75 (53%), Positives = 51/75 (68%), Gaps = 0/75 (0%)
 Frame = +2

Query  11   GPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAIS  190
             PF G+NHH   ++FGC F++NE   SFVWLFKT+L AM G+ P +I TD    + +AI+
Sbjct  314  APFTGVNHHGQPILFGCAFMINESESSFVWLFKTWLMAMSGRPPVSITTDHDTVVGSAIA  373

Query  191  LVFPSARHRLCIWHI  235
             VFP  RHR C WHI
Sbjct  374  QVFPETRHRFCKWHI  388



>ref|XP_008233158.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Prunus mume]
Length=359

 Score = 97.4 bits (241),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 40/75 (53%), Positives = 54/75 (72%), Gaps = 0/75 (0%)
 Frame = +2

Query  11   GPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAIS  190
             P +G+N+H   ++  C FL  E T+SF+W+F+ F +AM G  P+TI+TDQ AAMS AIS
Sbjct  261  APMLGVNNHGQTIVLACAFLSKETTESFIWMFEEFKKAMPGGEPKTIITDQDAAMSRAIS  320

Query  191  LVFPSARHRLCIWHI  235
            + FP+  HRLCIWHI
Sbjct  321  IAFPTTFHRLCIWHI  335



>ref|XP_004959040.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Setaria italica]
Length=328

 Score = 97.1 bits (240),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 41/75 (55%), Positives = 54/75 (72%), Gaps = 0/75 (0%)
 Frame = +2

Query  11   GPFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAIS  190
             PFVG+  H    MFGC F+ +E T SF W+F+TFL++MGGK P+TI+TDQ  AM AAI 
Sbjct  216  APFVGVTRHGHTCMFGCAFISDESTLSFAWIFETFLKSMGGKQPKTIITDQDKAMKAAIK  275

Query  191  LVFPSARHRLCIWHI  235
            ++FP+  HR C +HI
Sbjct  276  MMFPNIVHRNCFFHI  290



>ref|XP_008653692.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Zea mays]
Length=517

 Score = 99.0 bits (245),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 41/76 (54%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +2

Query  14   PFVGMNHHCMNMMFGCGFLLNERTDSFVWLFKTFLRAMGGKCPQTIMTDQCAAMSAAISL  193
            PF G+NHH  ++ FG GFLLNE+ +S+ WL KTFL AMGGK P  ++TD+ A+M +AI+ 
Sbjct  304  PFTGVNHHMQSVFFGAGFLLNEKIESYEWLLKTFLLAMGGKAPILMVTDEDASMKSAIAS  363

Query  194  VFPSARHRLCIWHIGE  241
              P   HR C+WHI E
Sbjct  364  NLPDTVHRFCMWHILE  379



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 518068334520