BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c10354_g1_i2 len=1507 path=[1850:0-841 366:842-1506]

Length=1507
                                                                      Score     E

ref|XP_009610450.1|  PREDICTED: vinorine synthase-like                  260   4e-77   
ref|XP_007030134.1|  3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransf...    257   8e-76   
ref|XP_007037900.1|  3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransf...    255   2e-75   
ref|XP_011008627.1|  PREDICTED: vinorine synthase-like                  254   5e-75   
ref|XP_006482086.1|  PREDICTED: vinorine synthase-like                  253   1e-74   
ref|XP_002308780.1|  hypothetical protein POPTR_0006s01190g             253   2e-74   Populus trichocarpa [western balsam poplar]
ref|XP_006430560.1|  hypothetical protein CICLE_v10011796mg             252   4e-74   
gb|KDO53588.1|  hypothetical protein CISIN_1g048249mg                   251   1e-73   
ref|XP_009359305.1|  PREDICTED: vinorine synthase                       248   1e-72   
ref|XP_007030131.1|  3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransf...    246   7e-72   
ref|XP_006345618.1|  PREDICTED: vinorine synthase-like                  243   1e-70   
ref|XP_002511243.1|  3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransf...    241   5e-70   Ricinus communis
ref|XP_007037899.1|  3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransf...    240   1e-69   
ref|XP_008340164.1|  PREDICTED: vinorine synthase-like                  236   4e-68   
ref|XP_002323910.2|  hypothetical protein POPTR_0017s04320g             236   4e-68   Populus trichocarpa [western balsam poplar]
ref|XP_004310025.1|  PREDICTED: vinorine synthase-like                  234   3e-67   
ref|XP_006443122.1|  hypothetical protein CICLE_v10020052mg             234   6e-67   
gb|KDP36802.1|  hypothetical protein JCGZ_08093                         233   1e-66   
gb|KDO46443.1|  hypothetical protein CISIN_1g043811mg                   233   1e-66   
ref|XP_006443123.1|  hypothetical protein CICLE_v10024067mg             231   4e-66   
ref|XP_011001807.1|  PREDICTED: vinorine synthase-like                  231   5e-66   
gb|KDO45520.1|  hypothetical protein CISIN_1g039563mg                   231   1e-65   
ref|XP_006372816.1|  hypothetical protein POPTR_0017s05330g             229   1e-65   
ref|XP_011070326.1|  PREDICTED: vinorine synthase-like                  229   4e-65   
ref|XP_006435345.1|  hypothetical protein CICLE_v10001106mg             229   5e-65   
ref|XP_006443121.1|  hypothetical protein CICLE_v10023671mg             228   8e-65   
gb|KDP40899.1|  hypothetical protein JCGZ_24898                         227   2e-64   
ref|XP_008389785.1|  PREDICTED: vinorine synthase-like                  226   2e-64   
ref|XP_004294207.1|  PREDICTED: vinorine synthase-like                  226   3e-64   
ref|XP_002271612.1|  PREDICTED: vinorine synthase-like                  226   4e-64   Vitis vinifera
ref|XP_010046662.1|  PREDICTED: vinorine synthase-like                  226   5e-64   
ref|XP_006380880.1|  hypothetical protein POPTR_0006s01180g             224   5e-64   
ref|XP_008390114.1|  PREDICTED: vinorine synthase-like                  225   7e-64   
gb|KDP26741.1|  hypothetical protein JCGZ_17899                         224   2e-63   
gb|KDP38750.1|  hypothetical protein JCGZ_04103                         224   3e-63   
ref|XP_010051001.1|  PREDICTED: vinorine synthase-like                  223   3e-63   
ref|XP_002284817.2|  PREDICTED: vinorine synthase-like                  223   4e-63   Vitis vinifera
emb|CDP14000.1|  unnamed protein product                                223   5e-63   
ref|XP_008226170.1|  PREDICTED: vinorine synthase-like                  223   7e-63   
ref|XP_008353036.1|  PREDICTED: vinorine synthase-like                  221   2e-62   
gb|KDP30964.1|  hypothetical protein JCGZ_11340                         221   2e-62   
ref|XP_008368264.1|  PREDICTED: vinorine synthase-like                  221   2e-62   
ref|XP_010554168.1|  PREDICTED: vinorine synthase                       221   3e-62   
gb|KDP26742.1|  hypothetical protein JCGZ_17900                         220   5e-62   
ref|XP_009342764.1|  PREDICTED: vinorine synthase-like                  220   5e-62   
ref|XP_002267341.1|  PREDICTED: vinorine synthase                       220   5e-62   Vitis vinifera
ref|XP_006427936.1|  hypothetical protein CICLE_v10027290mg             220   7e-62   
ref|XP_010050993.1|  PREDICTED: vinorine synthase-like                  219   2e-61   
ref|XP_007018004.1|  Anthranilate N-benzoyltransferase protein, p...    218   3e-61   
ref|XP_011037141.1|  PREDICTED: vinorine synthase-like                  218   4e-61   
ref|XP_002511241.1|  Anthranilate N-benzoyltransferase protein, p...    218   5e-61   Ricinus communis
ref|XP_010048659.1|  PREDICTED: vinorine synthase-like                  218   6e-61   
ref|XP_009780612.1|  PREDICTED: vinorine synthase-like                  217   7e-61   
ref|XP_010044504.1|  PREDICTED: vinorine synthase-like                  217   1e-60   
ref|XP_009773462.1|  PREDICTED: vinorine synthase-like                  216   1e-60   
ref|XP_011041297.1|  PREDICTED: vinorine synthase-like                  216   1e-60   
ref|XP_006429944.1|  hypothetical protein CICLE_v10011699mg             217   2e-60   
ref|XP_002511244.1|  Anthranilate N-benzoyltransferase protein, p...    216   4e-60   Ricinus communis
ref|XP_002300646.2|  hypothetical protein POPTR_0002s01180g             215   6e-60   Populus trichocarpa [western balsam poplar]
gb|KDP30966.1|  hypothetical protein JCGZ_11342                         215   7e-60   
ref|XP_009602470.1|  PREDICTED: vinorine synthase-like                  214   9e-60   
emb|CDP07885.1|  unnamed protein product                                214   1e-59   
ref|XP_011071304.1|  PREDICTED: vinorine synthase-like                  213   2e-59   
ref|XP_006379530.1|  hypothetical protein POPTR_0008s03350g             213   2e-59   
ref|XP_008240680.1|  PREDICTED: vinorine synthase-like                  214   2e-59   
ref|XP_008222013.1|  PREDICTED: vinorine synthase-like                  212   6e-59   
gb|KCW81000.1|  hypothetical protein EUGRSUZ_C02376                     212   6e-59   
gb|KDO85081.1|  hypothetical protein CISIN_1g015400mg                   211   6e-59   
ref|XP_002514976.1|  3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransf...    212   7e-59   Ricinus communis
ref|XP_010094574.1|  Salutaridinol 7-O-acetyltransferase                212   8e-59   
ref|XP_006292162.1|  hypothetical protein CARUB_v10018368mg             211   1e-58   
ref|XP_002517535.1|  Anthranilate N-benzoyltransferase protein, p...    211   2e-58   Ricinus communis
ref|XP_007044963.1|  HXXXD-type acyl-transferase family protein, ...    211   2e-58   
ref|XP_011034885.1|  PREDICTED: vinorine synthase-like                  211   2e-58   
ref|XP_009359286.1|  PREDICTED: vinorine synthase-like                  211   2e-58   
ref|XP_008437382.1|  PREDICTED: BAHD acyltransferase At5g47980-like     211   2e-58   
ref|XP_008222012.1|  PREDICTED: vinorine synthase-like                  211   2e-58   
ref|XP_010050981.1|  PREDICTED: vinorine synthase-like                  211   2e-58   
ref|XP_011071181.1|  PREDICTED: vinorine synthase-like isoform X1       210   2e-58   
ref|XP_008222021.1|  PREDICTED: BAHD acyltransferase At5g47980-like     211   3e-58   
ref|XP_010044502.1|  PREDICTED: vinorine synthase-like                  210   3e-58   
ref|XP_004239499.1|  PREDICTED: vinorine synthase                       210   3e-58   
ref|XP_010090836.1|  Vinorine synthase                                  211   3e-58   
ref|XP_004295709.1|  PREDICTED: BAHD acyltransferase At5g47980-like     210   3e-58   
ref|XP_006484023.1|  PREDICTED: vinorine synthase-like                  211   3e-58   
emb|CDY04190.1|  BnaA09g19680D                                          211   4e-58   
ref|XP_006438136.1|  hypothetical protein CICLE_v10033777mg             210   4e-58   
ref|XP_006430562.1|  hypothetical protein CICLE_v10013397mg             209   4e-58   
ref|XP_008340165.1|  PREDICTED: deacetylvindoline O-acetyltransfe...    209   5e-58   
ref|XP_006464646.1|  PREDICTED: salutaridinol 7-O-acetyltransfera...    211   5e-58   
ref|XP_011031655.1|  PREDICTED: vinorine synthase-like                  210   5e-58   
ref|XP_009361768.1|  PREDICTED: BAHD acyltransferase At5g47980-like     210   6e-58   
ref|XP_006432232.1|  hypothetical protein CICLE_v10001086mg             210   6e-58   
ref|XP_009114100.1|  PREDICTED: vinorine synthase                       210   7e-58   
ref|XP_002510627.1|  Anthranilate N-benzoyltransferase protein, p...    209   7e-58   Ricinus communis
ref|XP_011101100.1|  PREDICTED: vinorine synthase-like                  209   8e-58   
ref|XP_008222084.1|  PREDICTED: BAHD acyltransferase At5g47980-like     209   1e-57   
ref|XP_007044964.1|  HXXXD-type acyl-transferase family protein, ...    208   2e-57   
ref|XP_010040717.1|  PREDICTED: vinorine synthase-like                  208   2e-57   
gb|KCW86595.1|  hypothetical protein EUGRSUZ_B03227                     208   3e-57   
ref|XP_008226167.1|  PREDICTED: vinorine synthase-like                  208   3e-57   
ref|XP_008222018.1|  PREDICTED: vinorine synthase-like                  207   3e-57   
ref|XP_010044505.1|  PREDICTED: vinorine synthase-like                  207   3e-57   
ref|XP_006473916.1|  PREDICTED: vinorine synthase-like                  208   4e-57   
ref|XP_002514980.1|  Anthranilate N-benzoyltransferase protein, p...    207   5e-57   Ricinus communis
ref|XP_006432229.1|  hypothetical protein CICLE_v10001082mg             207   7e-57   
gb|KDP35375.1|  hypothetical protein JCGZ_10359                         206   7e-57   
gb|KDO58317.1|  hypothetical protein CISIN_1g037128mg                   207   8e-57   
ref|XP_009359304.1|  PREDICTED: deacetylvindoline O-acetyltransfe...    206   9e-57   
ref|XP_007135112.1|  hypothetical protein PHAVU_010G102000g             207   9e-57   
ref|XP_011029622.1|  PREDICTED: BAHD acyltransferase At5g47980          206   1e-56   
ref|XP_008383113.1|  PREDICTED: vinorine synthase-like                  207   1e-56   
ref|XP_010100293.1|  Vinorine synthase                                  206   1e-56   
ref|XP_010040066.1|  PREDICTED: vinorine synthase-like                  206   2e-56   
gb|KDO46444.1|  hypothetical protein CISIN_1g037811mg                   205   2e-56   
ref|XP_006482379.1|  PREDICTED: salutaridinol 7-O-acetyltransfera...    205   2e-56   
gb|KDO85073.1|  hypothetical protein CISIN_1g044625mg                   206   3e-56   
ref|XP_006853006.1|  hypothetical protein AMTR_s00174p00025490          205   3e-56   
ref|XP_009361769.1|  PREDICTED: BAHD acyltransferase At5g47980-like     205   3e-56   
dbj|BAB01067.1|  acetyltranferase-like protein                          205   4e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006341810.1|  PREDICTED: vinorine synthase-like                  204   4e-56   
ref|XP_011101142.1|  PREDICTED: vinorine synthase-like                  204   4e-56   
ref|XP_002875299.1|  transferase family protein                         204   5e-56   
ref|XP_010044501.1|  PREDICTED: vinorine synthase-like                  204   6e-56   
ref|NP_189233.1|  HXXXD-type acyl-transferase-like protein              204   7e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004485524.1|  PREDICTED: vinorine synthase-like                  204   8e-56   
ref|XP_009588476.1|  PREDICTED: vinorine synthase-like                  204   8e-56   
ref|XP_010050974.1|  PREDICTED: vinorine synthase-like                  204   9e-56   
ref|XP_002314561.1|  transferase family protein                         204   1e-55   Populus trichocarpa [western balsam poplar]
gb|KDO50293.1|  hypothetical protein CISIN_1g012496mg                   204   1e-55   
ref|XP_006387729.1|  hypothetical protein POPTR_0640s00200g             204   1e-55   
ref|XP_010050979.1|  PREDICTED: vinorine synthase-like                  203   1e-55   
ref|XP_008446186.1|  PREDICTED: vinorine synthase-like                  203   1e-55   
gb|KCW44979.1|  hypothetical protein EUGRSUZ_L01434                     203   1e-55   
ref|XP_002317521.2|  hypothetical protein POPTR_0011s12510g             203   2e-55   Populus trichocarpa [western balsam poplar]
ref|XP_008222017.1|  PREDICTED: vinorine synthase-like                  203   2e-55   
ref|XP_010506970.1|  PREDICTED: vinorine synthase-like                  203   2e-55   
ref|XP_006479029.1|  PREDICTED: vinorine synthase-like                  203   2e-55   
ref|XP_010046626.1|  PREDICTED: vinorine synthase-like                  202   2e-55   
ref|XP_008383117.1|  PREDICTED: vinorine synthase-like                  203   2e-55   
ref|XP_010100286.1|  Deacetylvindoline O-acetyltransferase              203   2e-55   
ref|XP_004240930.1|  PREDICTED: vinorine synthase-like                  202   2e-55   
gb|KCW80998.1|  hypothetical protein EUGRSUZ_C02374                     202   2e-55   
ref|XP_006377777.1|  hypothetical protein POPTR_0011s12490g             202   2e-55   
emb|CDP13291.1|  unnamed protein product                                202   2e-55   
ref|XP_007039558.1|  Anthranilate N-benzoyltransferase protein, p...    202   3e-55   
ref|XP_011013913.1|  PREDICTED: salutaridinol 7-O-acetyltransfera...    202   3e-55   
emb|CDY39174.1|  BnaC09g21700D                                          202   3e-55   
ref|XP_007037901.1|  Anthranilate N-benzoyltransferase protein, p...    202   3e-55   
ref|XP_010064604.1|  PREDICTED: vinorine synthase-like                  202   4e-55   
ref|XP_006464983.1|  PREDICTED: salutaridinol 7-O-acetyltransfera...    202   4e-55   
ref|XP_010514234.1|  PREDICTED: vinorine synthase-like                  202   4e-55   
ref|XP_011021361.1|  PREDICTED: BAHD acyltransferase At5g47980-like     202   4e-55   
ref|XP_008446094.1|  PREDICTED: vinorine synthase-like                  201   5e-55   
ref|XP_002515007.1|  3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransf...    201   5e-55   Ricinus communis
gb|KCW86588.1|  hypothetical protein EUGRSUZ_B03220                     201   6e-55   
ref|XP_008372831.1|  PREDICTED: BAHD acyltransferase At5g47980-like     201   8e-55   
ref|XP_004310028.1|  PREDICTED: vinorine synthase-like                  201   9e-55   
ref|XP_006387730.1|  hypothetical protein POPTR_0640s00210g             201   1e-54   
gb|KGN64382.1|  hypothetical protein Csa_1G050210                       201   1e-54   
ref|XP_006429945.1|  hypothetical protein CICLE_v10011714mg             201   1e-54   
ref|XP_002315639.2|  transferase family protein                         201   1e-54   Populus trichocarpa [western balsam poplar]
ref|XP_004292913.1|  PREDICTED: vinorine synthase-like                  202   1e-54   
ref|XP_007134122.1|  hypothetical protein PHAVU_010G020900g             201   1e-54   
ref|XP_008377211.1|  PREDICTED: vinorine synthase-like                  202   1e-54   
gb|KCW45515.1|  hypothetical protein EUGRSUZ_L00759                     200   1e-54   
ref|XP_002533732.1|  3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransf...    200   1e-54   Ricinus communis
gb|KDP36822.1|  hypothetical protein JCGZ_08113                         205   1e-54   
ref|XP_010682887.1|  PREDICTED: vinorine synthase-like                  200   2e-54   
ref|XP_009359355.1|  PREDICTED: vinorine synthase-like                  200   2e-54   
gb|AES72092.2|  anthranilate N-benzoyltransferase                       199   2e-54   
ref|XP_006395599.1|  hypothetical protein EUTSA_v10005565mg             200   3e-54   
ref|XP_007029093.1|  HXXXD-type acyl-transferase family protein, ...    202   3e-54   
gb|AFK43775.1|  unknown                                                 199   3e-54   
ref|XP_006420178.1|  hypothetical protein CICLE_v10006986mg             199   4e-54   
ref|XP_008222020.1|  PREDICTED: BAHD acyltransferase At5g47980-like     199   5e-54   
ref|XP_010044503.1|  PREDICTED: vinorine synthase-like                  199   5e-54   
emb|CDP08574.1|  unnamed protein product                                199   5e-54   
ref|XP_009780317.1|  PREDICTED: vinorine synthase-like                  199   5e-54   
ref|XP_006430561.1|  hypothetical protein CICLE_v10011733mg             199   5e-54   
ref|XP_008392421.1|  PREDICTED: salutaridinol 7-O-acetyltransfera...    199   5e-54   
ref|XP_011042323.1|  PREDICTED: vinorine synthase-like                  198   6e-54   
ref|XP_007018005.1|  3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransf...    199   6e-54   
ref|XP_004135298.1|  PREDICTED: vinorine synthase-like                  198   7e-54   
ref|XP_009371390.1|  PREDICTED: vinorine synthase-like                  199   8e-54   
ref|XP_006342247.1|  PREDICTED: salutaridinol 7-O-acetyltransfera...    198   8e-54   
ref|XP_011041291.1|  PREDICTED: vinorine synthase-like                  199   9e-54   
ref|XP_002514981.1|  Salutaridinol 7-O-acetyltransferase, putative      198   9e-54   Ricinus communis
ref|XP_011071305.1|  PREDICTED: vinorine synthase-like                  197   1e-53   
ref|XP_004301957.1|  PREDICTED: BAHD acyltransferase At5g47980-like     198   1e-53   
ref|XP_003538872.1|  PREDICTED: vinorine synthase-like                  197   1e-53   
ref|XP_007018014.1|  HXXXD-type acyl-transferase family protein, ...    202   1e-53   
gb|KCW86592.1|  hypothetical protein EUGRSUZ_B03224                     197   1e-53   
ref|XP_008372859.1|  PREDICTED: BAHD acyltransferase At5g47980-like     198   2e-53   
ref|XP_006598680.1|  PREDICTED: uncharacterized protein LOC100305...    198   2e-53   
gb|KDO36951.1|  hypothetical protein CISIN_1g045540mg                   197   2e-53   
ref|XP_011071306.1|  PREDICTED: vinorine synthase-like                  197   2e-53   
ref|XP_003521961.1|  PREDICTED: vinorine synthase-like                  197   2e-53   
ref|XP_003601841.1|  Vinorine synthase                                  199   2e-53   
ref|XP_008240535.1|  PREDICTED: vinorine synthase-like                  197   2e-53   
ref|XP_008222015.1|  PREDICTED: vinorine synthase-like                  197   2e-53   
ref|XP_004152528.1|  PREDICTED: BAHD acyltransferase At5g47980-like     197   3e-53   
ref|XP_006427943.1|  hypothetical protein CICLE_v10027036mg             198   3e-53   
gb|KDO40774.1|  hypothetical protein CISIN_1g037323mg                   197   3e-53   
gb|KCW86594.1|  hypothetical protein EUGRSUZ_B03226                     196   3e-53   
emb|CBI18889.3|  unnamed protein product                                201   3e-53   
ref|XP_008389788.1|  PREDICTED: vinorine synthase-like                  197   3e-53   
ref|XP_008222087.1|  PREDICTED: vinorine synthase-like                  196   4e-53   
ref|XP_008240679.1|  PREDICTED: vinorine synthase-like                  197   5e-53   
ref|XP_008459937.1|  PREDICTED: BAHD acyltransferase At5g47980-like     196   5e-53   
ref|XP_002305585.1|  hypothetical protein POPTR_0004s01720g             196   6e-53   Populus trichocarpa [western balsam poplar]
ref|NP_001238226.1|  uncharacterized protein LOC100305374               196   9e-53   
ref|XP_008446095.1|  PREDICTED: vinorine synthase-like                  195   1e-52   
ref|XP_011037677.1|  PREDICTED: acetyl-CoA-benzylalcohol acetyltr...    196   1e-52   
ref|XP_004135508.1|  PREDICTED: vinorine synthase-like                  195   1e-52   
ref|XP_004165031.1|  PREDICTED: BAHD acyltransferase At5g47980-like     195   1e-52   
ref|XP_002311734.1|  hypothetical protein POPTR_0008s18070g             195   1e-52   Populus trichocarpa [western balsam poplar]
ref|XP_010100292.1|  Vinorine synthase                                  195   1e-52   
gb|KDP45585.1|  hypothetical protein JCGZ_17192                         195   1e-52   
ref|XP_004310187.1|  PREDICTED: salutaridinol 7-O-acetyltransfera...    195   1e-52   
ref|XP_008226064.1|  PREDICTED: BAHD acyltransferase At5g47980-like     195   2e-52   
ref|XP_004298111.1|  PREDICTED: salutaridinol 7-O-acetyltransfera...    195   2e-52   
ref|XP_002514983.1|  Anthranilate N-benzoyltransferase protein, p...    195   2e-52   Ricinus communis
ref|XP_008226093.1|  PREDICTED: BAHD acyltransferase At5g47980-like     195   2e-52   
ref|XP_010061156.1|  PREDICTED: vinorine synthase-like                  195   2e-52   
emb|CDP15027.1|  unnamed protein product                                194   2e-52   
ref|XP_002514982.1|  3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransf...    194   2e-52   Ricinus communis
ref|XP_009371382.1|  PREDICTED: BAHD acyltransferase At5g47980-li...    195   2e-52   
ref|XP_004152282.1|  PREDICTED: salutaridinol 7-O-acetyltransfera...    195   3e-52   
ref|XP_004310183.1|  PREDICTED: vinorine synthase-like                  194   3e-52   
ref|XP_008360182.1|  PREDICTED: vinorine synthase-like                  194   3e-52   
gb|ADD71922.1|  BAHD-type acyltransferase                               194   3e-52   Actaea racemosa
ref|XP_007134037.1|  hypothetical protein PHAVU_010G014100g             194   3e-52   
ref|XP_010061158.1|  PREDICTED: vinorine synthase-like                  195   3e-52   
gb|KCW81026.1|  hypothetical protein EUGRSUZ_C02399                     192   4e-52   
gb|KHN36442.1|  Vinorine synthase                                       194   4e-52   
ref|XP_004140566.1|  PREDICTED: BAHD acyltransferase At5g47980-like     193   5e-52   
ref|XP_004301806.1|  PREDICTED: vinorine synthase-like                  193   6e-52   
emb|CDP10330.1|  unnamed protein product                                193   6e-52   
ref|XP_008383035.1|  PREDICTED: vinorine synthase-like                  194   7e-52   
gb|KDP36817.1|  hypothetical protein JCGZ_08108                         193   7e-52   
ref|XP_010046625.1|  PREDICTED: vinorine synthase-like                  191   8e-52   
ref|XP_009783396.1|  PREDICTED: acetyl-CoA-benzylalcohol acetyltr...    193   8e-52   
ref|XP_010528792.1|  PREDICTED: BAHD acyltransferase At5g47980-like     193   8e-52   
ref|XP_006423966.1|  hypothetical protein CICLE_v10028504mg             192   9e-52   
ref|XP_008383040.1|  PREDICTED: BAHD acyltransferase At5g47980-like     194   9e-52   
ref|XP_004238629.1|  PREDICTED: vinorine synthase-like                  192   9e-52   
gb|KCW86591.1|  hypothetical protein EUGRSUZ_B03223                     191   1e-51   
gb|KCW68080.1|  hypothetical protein EUGRSUZ_F01765                     193   1e-51   
ref|XP_007134039.1|  hypothetical protein PHAVU_010G014300g             192   1e-51   
gb|KDO41287.1|  hypothetical protein CISIN_1g044243mg                   192   1e-51   
ref|XP_007028226.1|  HXXXD-type acyl-transferase family protein, ...    192   2e-51   
ref|XP_006487765.1|  PREDICTED: vinorine synthase-like                  192   2e-51   
ref|XP_008226063.1|  PREDICTED: BAHD acyltransferase At5g47980-like     193   2e-51   
ref|XP_009342768.1|  PREDICTED: vinorine synthase-like                  192   2e-51   
ref|XP_010460459.1|  PREDICTED: vinorine synthase-like                  192   2e-51   
ref|XP_010682956.1|  PREDICTED: BAHD acyltransferase At5g47980          193   2e-51   
ref|XP_006427935.1|  hypothetical protein CICLE_v10027530mg             193   2e-51   
ref|XP_008226094.1|  PREDICTED: BAHD acyltransferase At5g47980-like     192   2e-51   
ref|XP_009371381.1|  PREDICTED: BAHD acyltransferase At5g47980-li...    193   2e-51   
ref|XP_003537018.2|  PREDICTED: vinorine synthase-like                  194   2e-51   
ref|XP_008389833.1|  PREDICTED: vinorine synthase-like                  192   2e-51   
ref|XP_006378283.1|  hypothetical protein POPTR_0010s06650g             192   2e-51   
ref|XP_006435339.1|  hypothetical protein CICLE_v10003197mg             191   2e-51   
ref|XP_009361770.1|  PREDICTED: vinorine synthase-like                  192   3e-51   
ref|XP_011041559.1|  PREDICTED: BAHD acyltransferase At5g47980-like     191   3e-51   
gb|KCW68078.1|  hypothetical protein EUGRSUZ_F01763                     191   3e-51   
ref|XP_006428006.1|  hypothetical protein CICLE_v10025515mg             192   4e-51   
ref|XP_004138261.1|  PREDICTED: vinorine synthase-like                  191   4e-51   
emb|CDP12986.1|  unnamed protein product                                191   4e-51   
ref|XP_008346587.1|  PREDICTED: BAHD acyltransferase At5g47980-like     191   4e-51   
ref|XP_008389789.1|  PREDICTED: vinorine synthase-like                  191   4e-51   
ref|XP_006446155.1|  hypothetical protein CICLE_v10015146mg             191   4e-51   
ref|XP_003532711.2|  PREDICTED: vinorine synthase-like                  191   5e-51   
ref|XP_011000149.1|  PREDICTED: pelargonidin 3-O-(6-caffeoylgluco...    191   5e-51   
gb|KCW68076.1|  hypothetical protein EUGRSUZ_F01760                     191   5e-51   
ref|XP_010499177.1|  PREDICTED: vinorine synthase-like                  191   5e-51   
ref|XP_006470642.1|  PREDICTED: BAHD acyltransferase At5g47980-like     191   5e-51   
ref|XP_006432225.1|  hypothetical protein CICLE_v10003243mg             191   6e-51   
ref|XP_007212426.1|  hypothetical protein PRUPE_ppa016640mg             191   7e-51   
ref|XP_011011265.1|  PREDICTED: pelargonidin 3-O-(6-caffeoylgluco...    190   7e-51   
ref|XP_008222079.1|  PREDICTED: vinorine synthase-like                  190   8e-51   
ref|XP_008377073.1|  PREDICTED: vinorine synthase-like                  192   8e-51   
ref|XP_002314550.2|  hypothetical protein POPTR_0010s06640g             190   9e-51   
ref|XP_008390113.1|  PREDICTED: BAHD acyltransferase At5g47980          190   9e-51   
ref|XP_008797275.1|  PREDICTED: salutaridinol 7-O-acetyltransfera...    189   9e-51   
ref|XP_011041560.1|  PREDICTED: BAHD acyltransferase At5g47980-like     190   1e-50   
ref|XP_009371379.1|  PREDICTED: vinorine synthase-like                  191   1e-50   
ref|XP_008372855.1|  PREDICTED: BAHD acyltransferase At5g47980-like     191   1e-50   
gb|KEH19742.1|  HXXXD-type acyl-transferase family protein              190   1e-50   
gb|KDO37672.1|  hypothetical protein CISIN_1g0394691mg                  187   1e-50   
ref|XP_008382276.1|  PREDICTED: BAHD acyltransferase At5g47980-like     191   1e-50   
sp|Q70PR7.2|VINSY_RAUSE  RecName: Full=Vinorine synthase                189   1e-50   
ref|XP_010531415.1|  PREDICTED: BAHD acyltransferase At5g47980-like     189   1e-50   
emb|CDP21452.1|  unnamed protein product                                189   2e-50   
ref|XP_008226591.1|  PREDICTED: BAHD acyltransferase At5g47980-like     190   2e-50   
ref|XP_006414522.1|  hypothetical protein EUTSA_v10025210mg             189   2e-50   
gb|KCW81023.1|  hypothetical protein EUGRSUZ_C02397                     189   2e-50   
ref|XP_006422067.1|  hypothetical protein CICLE_v10004997mg             189   2e-50   
ref|XP_008226087.1|  PREDICTED: BAHD acyltransferase At5g47980-like     189   2e-50   
ref|XP_011041557.1|  PREDICTED: BAHD acyltransferase At5g47980-like     189   2e-50   
ref|XP_002533378.1|  Anthranilate N-benzoyltransferase protein, p...    189   2e-50   
ref|XP_010025917.1|  PREDICTED: vinorine synthase-like                  189   2e-50   
ref|XP_006582966.1|  PREDICTED: vinorine synthase-like                  189   2e-50   
ref|XP_010027285.1|  PREDICTED: BAHD acyltransferase At5g47980-like     189   2e-50   
ref|XP_008453950.1|  PREDICTED: salutaridinol 7-O-acetyltransfera...    189   3e-50   
ref|XP_008226172.1|  PREDICTED: BAHD acyltransferase At5g47980-like     188   3e-50   
ref|XP_006370897.1|  hypothetical protein POPTR_0019s01520g             188   4e-50   
gb|KEH20540.1|  HXXXD-type acyl-transferase family protein              188   4e-50   
ref|XP_007044970.1|  HXXXD-type acyl-transferase family protein, ...    188   4e-50   
ref|XP_010064606.1|  PREDICTED: BAHD acyltransferase At5g47980-like     193   5e-50   
gb|KDO53587.1|  hypothetical protein CISIN_1g040754mg                   187   5e-50   
ref|XP_010514622.1|  PREDICTED: BAHD acyltransferase At5g47980-like     187   5e-50   
ref|XP_008383041.1|  PREDICTED: BAHD acyltransferase At5g47980-like     188   5e-50   
ref|XP_004301008.1|  PREDICTED: vinorine synthase-like                  188   6e-50   
ref|XP_010025920.1|  PREDICTED: vinorine synthase-like                  188   6e-50   
ref|XP_008226085.1|  PREDICTED: BAHD acyltransferase At5g47980-like     189   6e-50   
ref|XP_008226086.1|  PREDICTED: BAHD acyltransferase At5g47980-like     189   7e-50   
ref|XP_008226162.1|  PREDICTED: vinorine synthase-like                  189   7e-50   
ref|XP_006282607.1|  hypothetical protein CARUB_v10004825mg             187   7e-50   
ref|XP_007158727.1|  hypothetical protein PHAVU_002G177000g             188   8e-50   
ref|XP_006380275.1|  hypothetical protein POPTR_0007s00980g             186   8e-50   
ref|XP_010100291.1|  Salutaridinol 7-O-acetyltransferase                187   9e-50   
gb|KDP36818.1|  hypothetical protein JCGZ_08109                         187   9e-50   
ref|XP_004310024.1|  PREDICTED: vinorine synthase-like                  187   1e-49   
ref|XP_009355133.1|  PREDICTED: BAHD acyltransferase At5g47980-like     187   1e-49   
ref|XP_009359423.1|  PREDICTED: salutaridinol 7-O-acetyltransfera...    187   1e-49   
ref|XP_004310026.1|  PREDICTED: vinorine synthase-like                  187   1e-49   
ref|XP_009606783.1|  PREDICTED: vinorine synthase-like                  186   1e-49   
ref|XP_011091913.1|  PREDICTED: vinorine synthase-like                  187   1e-49   
ref|XP_003616843.1|  Salutaridinol 7-O-acetyltransferase                187   1e-49   
ref|XP_006432226.1|  hypothetical protein CICLE_v10001111mg             187   2e-49   
ref|XP_006443317.1|  hypothetical protein CICLE_v10020331mg             186   2e-49   
ref|XP_008226171.1|  PREDICTED: BAHD acyltransferase At5g47980-like     187   2e-49   
ref|XP_006432227.1|  hypothetical protein CICLE_v10001125mg             187   2e-49   
ref|XP_011085818.1|  PREDICTED: vinorine synthase-like                  186   2e-49   
emb|CDP08578.1|  unnamed protein product                                186   2e-49   
emb|CDP15032.1|  unnamed protein product                                186   3e-49   
ref|XP_010025365.1|  PREDICTED: vinorine synthase-like                  186   3e-49   
ref|XP_009609711.1|  PREDICTED: vinorine synthase-like                  183   3e-49   
emb|CDP13085.1|  unnamed protein product                                186   3e-49   
ref|XP_006348577.1|  PREDICTED: salutaridinol 7-O-acetyltransfera...    186   3e-49   
ref|XP_009606831.1|  PREDICTED: vinorine synthase-like                  186   4e-49   
ref|XP_010097637.1|  Salutaridinol 7-O-acetyltransferase                186   4e-49   
ref|XP_008222036.1|  PREDICTED: deacetylvindoline O-acetyltransfe...    186   4e-49   
ref|XP_006427934.1|  hypothetical protein CICLE_v10027010mg             186   5e-49   
gb|KCW44307.1|  hypothetical protein EUGRSUZ_L02250                     184   5e-49   
ref|XP_008226065.1|  PREDICTED: BAHD acyltransferase At5g47980-like     185   5e-49   
ref|XP_010514678.1|  PREDICTED: BAHD acyltransferase At5g47980-like     185   5e-49   
ref|XP_008444410.1|  PREDICTED: vinorine synthase                       185   6e-49   
gb|KDP30483.1|  hypothetical protein JCGZ_16162                         185   6e-49   
ref|XP_004295693.1|  PREDICTED: BAHD acyltransferase At5g47980-like     185   7e-49   
ref|XP_010502924.1|  PREDICTED: BAHD acyltransferase At5g47980-li...    185   8e-49   
ref|XP_004294209.1|  PREDICTED: BAHD acyltransferase At5g47980-like     185   8e-49   
ref|XP_004514780.1|  PREDICTED: vinorine synthase-like                  185   8e-49   
ref|XP_006415801.1|  hypothetical protein EUTSA_v10007650mg             185   9e-49   
gb|AFF19204.1|  BAHD acyltransferase                                    184   9e-49   
gb|KDP30484.1|  hypothetical protein JCGZ_16163                         185   1e-48   
ref|XP_006423655.1|  hypothetical protein CICLE_v10028515mg             184   1e-48   
ref|XP_010466664.1|  PREDICTED: BAHD acyltransferase At5g47980-li...    184   1e-48   
ref|XP_004504492.1|  PREDICTED: vinorine synthase-like                  184   1e-48   
ref|XP_006372866.1|  hypothetical protein POPTR_0017s05810g             184   1e-48   
ref|XP_010088398.1|  Salutaridinol 7-O-acetyltransferase                184   1e-48   
ref|XP_008385235.1|  PREDICTED: uncharacterized protein LOC103447811    190   1e-48   
ref|XP_011069600.1|  PREDICTED: vinorine synthase-like                  184   2e-48   
ref|XP_009371383.1|  PREDICTED: BAHD acyltransferase At5g47980-like     184   2e-48   
ref|XP_008444409.1|  PREDICTED: vinorine synthase-like                  184   2e-48   
ref|XP_004496315.1|  PREDICTED: vinorine synthase-like                  184   2e-48   
gb|KDP36806.1|  hypothetical protein JCGZ_08097                         184   2e-48   
ref|XP_010425699.1|  PREDICTED: BAHD acyltransferase At5g47980-like     183   2e-48   
ref|XP_006351852.1|  PREDICTED: acetyl-CoA-benzylalcohol acetyltr...    184   2e-48   
ref|XP_002534423.1|  Anthranilate N-benzoyltransferase protein, p...    184   2e-48   
ref|XP_009365957.1|  PREDICTED: BAHD acyltransferase At5g47980-like     184   2e-48   
ref|XP_009361854.1|  PREDICTED: BAHD acyltransferase At5g47980-like     183   2e-48   
gb|KDP36821.1|  hypothetical protein JCGZ_08112                         184   2e-48   
ref|XP_002307785.2|  hypothetical protein POPTR_0005s27190g             183   3e-48   
ref|XP_002308878.2|  hypothetical protein POPTR_0006s03450g             183   3e-48   
ref|XP_010097635.1|  Salutaridinol 7-O-acetyltransferase                183   3e-48   
gb|KDO40654.1|  hypothetical protein CISIN_1g035869mg                   183   3e-48   
gb|KHN12420.1|  Vinorine synthase                                       184   4e-48   
ref|XP_010100296.1|  Vinorine synthase                                  183   4e-48   
ref|XP_006465504.1|  PREDICTED: vinorine synthase-like                  183   5e-48   
ref|XP_010502923.1|  PREDICTED: BAHD acyltransferase At5g47980-li...    182   5e-48   
gb|KDO37664.1|  hypothetical protein CISIN_1g045515mg                   183   6e-48   
ref|XP_010502921.1|  PREDICTED: BAHD acyltransferase At5g47980-li...    182   6e-48   
ref|XP_011083978.1|  PREDICTED: vinorine synthase-like                  182   6e-48   
ref|XP_008363049.1|  PREDICTED: salutaridinol 7-O-acetyltransfera...    182   6e-48   
ref|XP_008358908.1|  PREDICTED: vinorine synthase-like                  183   6e-48   
ref|XP_004298096.1|  PREDICTED: vinorine synthase-like                  182   7e-48   
ref|XP_009147434.1|  PREDICTED: BAHD acyltransferase At5g47980-like     182   7e-48   
ref|XP_006427933.1|  hypothetical protein CICLE_v10026950mg             183   8e-48   
ref|XP_011091743.1|  PREDICTED: pelargonidin 3-O-(6-caffeoylgluco...    182   8e-48   
ref|XP_006414524.1|  hypothetical protein EUTSA_v10027507mg             182   9e-48   
ref|XP_010502922.1|  PREDICTED: BAHD acyltransferase At5g47980-li...    182   9e-48   
ref|XP_006493396.1|  PREDICTED: vinorine synthase-like                  181   9e-48   
emb|CDY22927.1|  BnaA01g18650D                                          182   9e-48   
ref|NP_173852.4|  HXXXD-type acyl-transferase-like protein              182   9e-48   
ref|XP_008365512.1|  PREDICTED: BAHD acyltransferase At5g47980-like     182   1e-47   
gb|KDP26743.1|  hypothetical protein JCGZ_17901                         182   1e-47   
ref|XP_003616845.1|  Vinorine synthase                                  182   1e-47   
ref|XP_003547065.2|  PREDICTED: vinorine synthase-like                  181   1e-47   
ref|XP_006464857.1|  PREDICTED: vinorine synthase-like                  182   1e-47   
ref|XP_006370899.1|  hypothetical protein POPTR_0019s01540g             181   1e-47   
ref|XP_010514628.1|  PREDICTED: BAHD acyltransferase At5g47980-like     181   1e-47   
ref|XP_009375401.1|  PREDICTED: salutaridinol 7-O-acetyltransfera...    182   1e-47   
ref|XP_009620257.1|  PREDICTED: vinorine synthase-like                  181   2e-47   
ref|XP_004143047.1|  PREDICTED: salutaridinol 7-O-acetyltransfera...    181   2e-47   
gb|AGT56097.1|  cocaine synthase                                        181   2e-47   
ref|XP_004172751.1|  PREDICTED: vinorine synthase-like                  180   2e-47   
ref|NP_189647.1|  HXXXD-type acyl-transferase-like protein              181   2e-47   
ref|XP_002524038.1|  3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransf...    181   3e-47   
ref|XP_002312000.2|  hypothetical protein POPTR_0008s03430g             180   3e-47   
ref|XP_006422064.1|  hypothetical protein CICLE_v10006464mg             180   3e-47   
ref|XP_002266054.1|  PREDICTED: acetyl-CoA-benzylalcohol acetyltr...    180   3e-47   
ref|XP_008379851.1|  PREDICTED: BAHD acyltransferase At5g47980-like     181   4e-47   
ref|XP_011098395.1|  PREDICTED: vinorine synthase-like                  180   4e-47   
ref|XP_002529587.1|  Anthranilate N-benzoyltransferase protein, p...    180   4e-47   
ref|XP_010647391.1|  PREDICTED: vinorine synthase-like                  180   4e-47   
ref|XP_004152093.1|  PREDICTED: salutaridinol 7-O-acetyltransfera...    181   4e-47   
ref|XP_004292912.1|  PREDICTED: salutaridinol 7-O-acetyltransfera...    181   5e-47   
ref|XP_010092011.1|  BAHD acyltransferase                               180   5e-47   
ref|XP_009759141.1|  PREDICTED: salutaridinol 7-O-acetyltransfera...    179   6e-47   
gb|KFK33809.1|  hypothetical protein AALP_AA5G062900                    179   6e-47   
ref|XP_002875533.1|  transferase family protein                         179   7e-47   
gb|AET80687.1|  putative spermidine hydroxycinnamoyl transferase        179   7e-47   
ref|XP_003593106.1|  Deacetylvindoline O-acetyltransferase              180   7e-47   
ref|XP_010088399.1|  Salutaridinol 7-O-acetyltransferase                179   8e-47   
gb|KDP35166.1|  hypothetical protein JCGZ_10700                         180   8e-47   
gb|AAW51126.1|  putative alcohol acyl-transferases                      180   8e-47   
ref|XP_008372858.1|  PREDICTED: BAHD acyltransferase At5g47980-like     179   9e-47   
ref|XP_009358370.1|  PREDICTED: BAHD acyltransferase At5g47980-like     179   9e-47   
ref|XP_011091857.1|  PREDICTED: vinorine synthase-like                  179   1e-46   
ref|XP_011040773.1|  PREDICTED: acetyl-CoA-benzylalcohol acetyltr...    179   1e-46   
ref|XP_010041510.1|  PREDICTED: vinorine synthase-like                  177   1e-46   
emb|CAN73739.1|  hypothetical protein VITISV_023236                     178   1e-46   
ref|XP_010425703.1|  PREDICTED: BAHD acyltransferase At5g47980-like     179   1e-46   
ref|XP_008226163.1|  PREDICTED: BAHD acyltransferase At5g47980-like     181   1e-46   
ref|XP_004301469.1|  PREDICTED: vinorine synthase-like                  179   1e-46   
ref|XP_008231723.1|  PREDICTED: BAHD acyltransferase At5g47980-like     179   1e-46   
ref|XP_004310027.1|  PREDICTED: vinorine synthase-like                  178   1e-46   
ref|XP_002868208.1|  hypothetical protein ARALYDRAFT_915274             178   2e-46   
ref|XP_002514985.1|  3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransf...    178   2e-46   
ref|XP_009768370.1|  PREDICTED: acetyl-CoA-benzylalcohol acetyltr...    179   2e-46   
ref|XP_011031654.1|  PREDICTED: vinorine synthase-like                  178   2e-46   
ref|XP_006431929.1|  hypothetical protein CICLE_v10003910mg             178   2e-46   
gb|KEH20541.1|  3'-N-debenzoyl-2'-deoxytaxol benzoyltransferase         178   2e-46   
ref|XP_010907772.1|  PREDICTED: salutaridinol 7-O-acetyltransfera...    177   3e-46   
ref|XP_009375404.1|  PREDICTED: BAHD acyltransferase At5g47980-like     179   3e-46   
gb|KDO61210.1|  hypothetical protein CISIN_1g015205mg                   177   3e-46   
ref|XP_006292868.1|  hypothetical protein CARUB_v10019128mg             178   3e-46   
ref|XP_006345840.1|  PREDICTED: BAHD acyltransferase At5g47980-like     178   3e-46   
ref|XP_008382277.1|  PREDICTED: BAHD acyltransferase At5g47980-like     178   3e-46   
emb|CDP10332.1|  unnamed protein product                                177   3e-46   
ref|XP_006491900.1|  PREDICTED: BAHD acyltransferase At5g47980-like     178   4e-46   
ref|XP_009371380.1|  PREDICTED: BAHD acyltransferase At5g47980-like     177   4e-46   
ref|XP_002267080.1|  PREDICTED: vinorine synthase-like                  177   4e-46   
gb|KEH20539.1|  HXXXD-type acyl-transferase family protein              177   4e-46   
emb|CDP15031.1|  unnamed protein product                                177   5e-46   
ref|XP_004511244.1|  PREDICTED: vinorine synthase-like                  177   5e-46   
ref|XP_007029096.1|  HXXXD-type acyl-transferase family protein         176   5e-46   
ref|XP_002533002.1|  3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransf...    177   5e-46   
ref|XP_006469323.1|  PREDICTED: BAHD acyltransferase At5g47980-like     177   7e-46   
gb|EYU26239.1|  hypothetical protein MIMGU_mgv1a020677mg                177   7e-46   
emb|CBI37948.3|  unnamed protein product                                184   7e-46   
gb|AES62129.2|  HXXXD-type acyl-transferase family protein              177   8e-46   
ref|XP_011085805.1|  PREDICTED: vinorine synthase-like                  176   8e-46   
gb|KDP20131.1|  hypothetical protein JCGZ_05900                         177   9e-46   
ref|XP_002300198.1|  hypothetical protein POPTR_0001s31750g             177   9e-46   
gb|KFK44501.1|  hypothetical protein AALP_AA1G265200                    176   1e-45   
ref|XP_006415694.1|  hypothetical protein EUTSA_v10007649mg             176   1e-45   
ref|XP_007042887.1|  HXXXD-type acyl-transferase family protein, ...    177   1e-45   
ref|XP_007148464.1|  hypothetical protein PHAVU_006G211000g             176   1e-45   
ref|XP_004295692.1|  PREDICTED: BAHD acyltransferase At5g47980-like     176   1e-45   
emb|CAN63243.1|  hypothetical protein VITISV_028808                     176   1e-45   
ref|XP_008241213.1|  PREDICTED: BAHD acyltransferase At5g47980-like     176   1e-45   
ref|XP_006379531.1|  hypothetical protein POPTR_0008s03410g             176   1e-45   
gb|KDO50294.1|  hypothetical protein CISIN_1g048605mg                   176   1e-45   
ref|XP_010065678.1|  PREDICTED: acetyl-CoA-benzylalcohol acetyltr...    176   2e-45   
ref|XP_006379532.1|  hypothetical protein POPTR_0008s03420g             177   2e-45   
ref|XP_011031656.1|  PREDICTED: vinorine synthase-like                  176   2e-45   
ref|XP_011037156.1|  PREDICTED: acetyl-CoA-benzylalcohol acetyltr...    176   2e-45   
ref|XP_009782261.1|  PREDICTED: pelargonidin 3-O-(6-caffeoylgluco...    176   2e-45   
ref|XP_009628337.1|  PREDICTED: pelargonidin 3-O-(6-caffeoylgluco...    176   2e-45   
ref|XP_003591878.1|  BAHD acyltransferase                               177   2e-45   
ref|XP_011045716.1|  PREDICTED: acetyl-CoA-benzylalcohol acetyltr...    175   2e-45   
ref|XP_008226164.1|  PREDICTED: vinorine synthase-like                  176   2e-45   
gb|KEH19743.1|  alcohol acyltransferase                                 175   3e-45   
ref|XP_002322397.2|  hypothetical protein POPTR_0015s14800g             175   3e-45   
gb|KDO82048.1|  hypothetical protein CISIN_1g012688mg                   175   3e-45   
ref|XP_007227141.1|  hypothetical protein PRUPE_ppa026262mg             175   3e-45   
ref|XP_006484024.1|  PREDICTED: BAHD acyltransferase At5g47980-like     175   4e-45   
ref|XP_006414538.1|  hypothetical protein EUTSA_v10025255mg             174   4e-45   
ref|XP_006431936.1|  hypothetical protein CICLE_v10001158mg             175   4e-45   
gb|EYU22560.1|  hypothetical protein MIMGU_mgv1a020007mg                174   4e-45   
ref|XP_006351755.1|  PREDICTED: acetyl-CoA-benzylalcohol acetyltr...    174   4e-45   
ref|XP_006438135.1|  hypothetical protein CICLE_v10031490mg             175   4e-45   
ref|XP_010100294.1|  Vinorine synthase                                  175   4e-45   
ref|XP_004253033.1|  PREDICTED: acetyl-CoA-benzylalcohol acetyltr...    174   4e-45   
ref|XP_009790148.1|  PREDICTED: vinorine synthase-like                  174   5e-45   
ref|XP_006431838.1|  hypothetical protein CICLE_v10001160mg             174   5e-45   



>ref|XP_009610450.1| PREDICTED: vinorine synthase-like [Nicotiana tomentosiformis]
Length=434

 Score =   260 bits (665),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 160/446 (36%), Positives = 237/446 (53%), Gaps = 26/446 (6%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVDEL  223
             MK+E+  +D IKPSSPTP S R Y  S++DQL+    +P V FYDS           D L
Sbjct  3     MKVEITHKDTIKPSSPTPLSQRDYKLSLIDQLTPGPYVPIVLFYDS-----TTKFCHDLL  57

Query  224   KKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAE-SLSSFLENPDFEMIREMV  400
             KKSLS+TL+ MYPLAGRIK+D  +IECND+GV+F+E +V+  +LS+ + +P    + +++
Sbjct  58    KKSLSKTLNYMYPLAGRIKDDF-TIECNDKGVDFLEANVSNITLSNIVNDPKIGTLSQLL  116

Query  401   PCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRGC  580
             PC+P   + EP+ D  +L +QV +F CGGIS+G+ + H I D +++     TWA +N+  
Sbjct  117   PCHPHARSKEPS-DQVLLAVQVTKFPCGGISIGVCVWHLIADASTLVTLVKTWATMNQEN  175

Query  581   ---AVVDDGGFIFDASKIFPPVKNTADL--DQFARVARGAAESQEKYVVRRFYIPASAID  745
                + V   G+I + + IFPP     DL  +    +     E   K  ++RF    S + 
Sbjct  176   GQESNVIGNGYIVNVTGIFPP----RDLSNNPLLTMVPIPEELPFKISMKRFIFDNSKLA  231

Query  746   QLREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPFP  925
              L +   +     P+R EAL A +W A+I+   K  K  I + +L + +NLR RM P  P
Sbjct  232   ALIQSCPIC----PTRFEALSAFLWSAIIST-WKDKKSEIKVCILMTSINLRKRMIPNLP  286

Query  926   ENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTALPI  1105
              N +GN  Y     W    EG      L  + +++IR V D   RR + K G++     I
Sbjct  287   TNSMGNLIYPTMAKWEVEEEGVIDYKKLVERVQESIRMVEDSYIRRIHEKNGYIDYLNSI  346

Query  1106  MSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQVMKDSVVFMEGRFG-G  1282
             +   I          C+   S   +    ADFGWGKP W  N          ++   G G
Sbjct  347   LELCITRGNEVGIAGCI---SWCKLPFDEADFGWGKPIWIANPMKFPCGFNLLDTVDGKG  403

Query  1283  VDLWMGLPEELMNIVMKNPQFVEFVS  1360
             +++WMGLPEE M ++ KN  F+ +VS
Sbjct  404   IEVWMGLPEEEMQLLEKNKDFLSYVS  429



>ref|XP_007030134.1| 3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase, putative [Theobroma 
cacao]
 gb|EOY10636.1| 3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase, putative [Theobroma 
cacao]
Length=439

 Score =   257 bits (656),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 148/443 (33%), Positives = 240/443 (54%), Gaps = 27/443 (6%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRD---YNGVV  214
             M++++  R+ IKPSSPTP  LRT+   + D L+  + IP + FY    S+RD    N + 
Sbjct  1     MEVQIIDRETIKPSSPTPDHLRTHKLCLFDLLASPIYIPTLLFY----SARDGSPTNSIS  56

Query  215   DELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIRE  394
             D LKKSLS+ L+  YPLAGRIK+D + I+CND G  FIE  VA  +S  LE PD E++++
Sbjct  57    DNLKKSLSKALTHFYPLAGRIKDDLT-IDCNDDGATFIEAQVARDMSFVLEEPDIEVLQQ  115

Query  395   MVPCNPFTG--AFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARI  568
             ++PC+P       +P+ D  +L +QVN F+CGG+++ + +SH + D ++ + F   WA +
Sbjct  116   LLPCDPLQHLPQTQPSTDQVLLAVQVNHFACGGMAICVCISHVVADASAAANFLKGWAEV  175

Query  569   NRGCAVVDDGGFIFDASKIFPPVKNTADLDQFARVA----RGAAESQEKYVVRRFYIPAS  736
               G  +++  G I+D S +FP      D+  F RV             + + +RF    S
Sbjct  176   ACGADIIE--GVIYDCSSLFP----LRDMSLFYRVMEILLHKTNSGSPEVITKRFLFDGS  229

Query  737   AIDQLREQL-RLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRME  913
              I  LR ++   ++ Y P+R EA+ A++W+A++AA  +       L   ++I+NLR RM 
Sbjct  230   KIAALRNEMGDELNSYHPTRVEAVTALIWEALVAATAENVTTSPILEA-SNIVNLRKRMN  288

Query  914   PPFPENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHT  1093
             PP P  C+GN  + + V  + PTE   +R +LA K  ++I+ ++D+  R+ +        
Sbjct  289   PPLPPQCIGNVCFVSMV--STPTENIENRTSLARKIHESIKEIDDDYIRKIFTSDAECFH  346

Query  1094  ALPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQVMKDSVVFMEGR  1273
              L  M +I +      N+     SS      Y  +FGWGKP W   A  +  +   ++  
Sbjct  347   NL--MEKIFEEMKKSSNIGMFRFSSWCRFPFYETNFGWGKPIWFGTAFAINRNGCLLDTS  404

Query  1274  FG-GVDLWMGLPEELMNIVMKNP  1339
              G G++ W+ L +E M  + + P
Sbjct  405   DGEGIEAWISLTKEEMAQLEQQP  427



>ref|XP_007037900.1| 3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase, putative [Theobroma 
cacao]
 gb|EOY22401.1| 3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase, putative [Theobroma 
cacao]
Length=434

 Score =   255 bits (652),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 146/443 (33%), Positives = 248/443 (56%), Gaps = 16/443 (4%)
 Frame = +2

Query  38    ITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVD  217
             + MK+ +  R+ IKPSSPTP   RT+  S+ DQL+  + IP + FY S  S  + +   D
Sbjct  1     MEMKVHIISRETIKPSSPTPHHQRTHKLSLFDQLAPPLYIPILLFY-SATSETNPSKKSD  59

Query  218   ELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREM  397
              LK SLS+ L+  YP AGR+KE   +I+CND G  ++E  V   +   L+ P  +++ ++
Sbjct  60    LLKDSLSKILTHFYPFAGRVKEG-CTIDCNDDGAAYVEAQVDSDMFLVLKEPGIDLLLQL  118

Query  398   VPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRG  577
             +PC P     EP+    +L +QVN F+CGG+++ + + H + D ++ + F  +WA +  G
Sbjct  119   LPCEPLEKLPEPSAQ-VILAVQVNYFACGGMAICVCLRHVVSDASAAAGFVKSWAAVASG  177

Query  578   CAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQLRE  757
               +V D   I+D + +FPP ++ + L +    ++ A  ++   V +RF    S I  LR 
Sbjct  178   VDMVLD-AVIYDCTSLFPP-QDLSGLWKTIEKSQNALLAE--VVTKRFIFYGSKIAALRN  233

Query  758   QL-RLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPFPENC  934
             ++   +S YRP+R EAL +++W+A+IA + +  +  + +HV T+ +NLR RM PP P+ C
Sbjct  234   EIGNGLSLYRPTRVEALSSLIWNAIIAGDTEEGE-IVPMHVATTAVNLRKRMNPPLPQLC  292

Query  935   LGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTALPIMSE  1114
             +GN ++      N       SR++LA K  ++I  ++D+  R+ +G G  L+    + +E
Sbjct  293   MGNISHVTMA--NLFMAKTKSRNSLAEKIHESILKIDDKFVRQFFGSGAHLNVMKNMAAE  350

Query  1115  IIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQVMKDSVVFMEGRFG-GVDL  1291
             + K   SK  ++    SS      Y  DFGWGKP W   A  +    +F++ R G G++ 
Sbjct  351   LGK--SSKARLFNF--SSWCRFPFYETDFGWGKPVWFATALRLNKLAIFLDTRDGKGIEA  406

Query  1292  WMGLPEELMNIVMKNPQFVEFVS  1360
             W+GL +E M  + ++P  + + S
Sbjct  407   WIGLTKEEMTKLERDPGILAYAS  429



>ref|XP_011008627.1| PREDICTED: vinorine synthase-like [Populus euphratica]
Length=432

 Score =   254 bits (650),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 153/451 (34%), Positives = 244/451 (54%), Gaps = 26/451 (6%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVDEL  223
             M++++  ++I+KPSS TPQ LRTY  S++DQL+  + IP + FY SP +S +     D L
Sbjct  1     MEVQIISKEILKPSSSTPQHLRTYKLSVLDQLAPPLYIPIILFY-SP-ASENLCKNSDHL  58

Query  224   KKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREMVP  403
             K+S SQTL+  YP AGRIK+D S ++CND G EFIE  VA  +S  LE  D    ++++P
Sbjct  59    KESFSQTLTHFYPFAGRIKDDFS-VDCNDYGAEFIEARVAGDISMVLEQADINQQQQLLP  117

Query  404   CNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRGCA  583
             C+P+  + + + D   L +QVN F+CGG+++ L + HA+ D ++++ F N WA I+R   
Sbjct  118   CSPYGKSSKLSTDQVTLAVQVNYFNCGGVAISLCIWHAVADASTLATFVNCWAAISRDPN  177

Query  584   VVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQLREQL  763
              V D   +FD + +FPP     DL  F+       +   + V++RF    S +  LR+++
Sbjct  178   NVID-EVVFDCTTLFPP----QDLSSFSLHNFVKEDVSSEIVMKRFLFEGSKVAALRDEV  232

Query  764   -RLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPFPENCLG  940
                 S  RPSR  A+  ++  A++   ++    +IN    T  ++LR R+EPP P+  +G
Sbjct  233   GNGPSLDRPSRFIAVSTLILTAMMTVTRENEAMQIN--AATIAVDLRRRLEPPMPKQSIG  290

Query  941   NNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTALPIMSEII  1120
             N        W +      + + LA K  ++IR +ND+  R+ +  GG+ +         +
Sbjct  291   NIFQVTIAKWPESESNELTYNGLAGKLHESIRMMNDDFIRKIHAGGGYFN--------FL  342

Query  1121  KHEGSKK----NMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQVMKDSVVFMEGRFG-GV  1285
             K  G +     N      SS      Y  DFGWGKP W   A  +K   +F++ + G G+
Sbjct  343   KRAGEEARKGLNFTVFGFSSWCNFPFYETDFGWGKPLWLSPALKLKRVAIFLDTKDGEGI  402

Query  1286  DLWMGLPEELMNIVMKNPQFVEFVSAGFSKS  1378
             + W+GL EE M    ++P  + +  A FS S
Sbjct  403   EAWIGLSEEDMVKFEQDPGILTY--ASFSPS  431



>ref|XP_006482086.1| PREDICTED: vinorine synthase-like [Citrus sinensis]
Length=426

 Score =   253 bits (646),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 154/442 (35%), Positives = 227/442 (51%), Gaps = 25/442 (6%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVDEL  223
             M +++   +IIKPSSPTPQ   TY  SI+DQL+ NV    +  Y + G S       D L
Sbjct  1     MDLQITCTEIIKPSSPTPQHQSTYKLSIIDQLTPNVYFSIILLYSNAGESTAKTS--DHL  58

Query  224   KKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREMVP  403
             KKSLS TL+  YPLAG++K D+  ++CNDQGV FIE  VA  +   L+ P+ +++ +++P
Sbjct  59    KKSLSNTLTHYYPLAGQLKYDQLIVDCNDQGVPFIEAHVANDMRQLLKIPNIDVLEQLLP  118

Query  404   CNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRGCA  583
               P  G    + D   L +QVN F CGG+++GL   H + D  + + F   W  I RG  
Sbjct  119   FKPHEGF---DSDRSNLTLQVNYFGCGGMAIGLCFRHKVIDATTAAFFVKNWGVIARGAG  175

Query  584   VVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQLREQL  763
              + D   I D + +FP      DL   A+         E    +RF      I   +E  
Sbjct  176   EIKD--LIIDHASLFP----ARDLSCLAKSVDEEFLKPESE-TKRFVFDGPTIASFQETF  228

Query  764   RLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSIL--NLRNRMEPPFPENCL  937
                   RP+R E + AV+  A+I A ++          L +I+  NLR RM PPFPE+C+
Sbjct  229   TSFER-RPTRFEVVSAVILGALITATRESDDESNVPERLDTIISVNLRQRMNPPFPEHCM  287

Query  938   GNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTALPIMSEI  1117
             GN   G  V+W  P E       LA +  ++I+ V+D+ AR+ YG   FL+     +  +
Sbjct  288   GNIISGGLVYW--PLEKKVDYGCLAKEIHESIKKVDDQFARKFYGDAEFLN-----LPRL  340

Query  1118  IKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQVMKDSVVFMEGRFG-GVDLW  1294
                E  KK  +  + +S     +Y ADFGWGKP+WA N+  +    VF +   G GV+ W
Sbjct  341   AGAEDVKKREF--WVTSWCKTPLYEADFGWGKPKWAGNSMRLNQITVFFDSSDGEGVEAW  398

Query  1295  MGLPEELMNIVMKNPQFVEFVS  1360
             +GLP++ M    K+   + + S
Sbjct  399   VGLPKKDMARFEKDSGILAYTS  420



>ref|XP_002308780.1| hypothetical protein POPTR_0006s01190g [Populus trichocarpa]
 gb|EEE92303.1| hypothetical protein POPTR_0006s01190g [Populus trichocarpa]
Length=432

 Score =   253 bits (645),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 151/451 (33%), Positives = 243/451 (54%), Gaps = 26/451 (6%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVDEL  223
             M++++  ++I+KPSS TPQ LRTY  S++DQL+  + IP + FY SP S        D L
Sbjct  1     MEVQIISKEILKPSSSTPQHLRTYKLSVLDQLAPPIYIPIILFY-SPASEHLCKNS-DHL  58

Query  224   KKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREMVP  403
             K+S SQTL+  YP AGRIK+D S ++CND G EFIE  VA  +S  LE  D    ++++P
Sbjct  59    KESFSQTLTHFYPFAGRIKDDFS-VDCNDDGAEFIEARVAGDISMVLEQADINQQQQLLP  117

Query  404   CNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRGCA  583
             C+P+  + + + D   L +QVN F+CGG+++ + + HA+ D ++++ F N WA I+R   
Sbjct  118   CSPYGKSSKLSTDQVTLAVQVNYFNCGGVAISICIWHAVADASTLATFVNCWAAISRDPN  177

Query  584   VVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQLREQL  763
              V D   +FD + +FPP     DL  F+  +    +   + V++RF    S +  LR+++
Sbjct  178   NVID-EVVFDCTTLFPP----QDLSSFSLHSFVKEDVSSEIVMKRFLFDGSKVAALRDEV  232

Query  764   -RLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPFPENCLG  940
                 S  RPSR  A+  ++  A++   ++    +IN    T  ++LR R++PP P+  +G
Sbjct  233   GNGPSLDRPSRFIAVSTLILTAMMTVTRENEAMQIN--AATIAVDLRRRLKPPVPKQSIG  290

Query  941   NNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTALPIMSEII  1120
             N        W +      S + LA K  ++IR +ND+  R+ +  GG+ +         +
Sbjct  291   NIFQVTIAKWPESESNELSYNGLAGKLHESIRMMNDDFIRKFHAGGGYFN--------FL  342

Query  1121  KHEGSK----KNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQVMKDSVVFMEGRFG-GV  1285
             K  G +     N+     SS      Y  DFGWGKP W   A  +    +F++ + G G+
Sbjct  343   KRSGEEARKGSNVTVFGFSSWCNFPFYETDFGWGKPLWLSPALKLNRVAIFLDTKDGEGI  402

Query  1286  DLWMGLPEELMNIVMKNPQFVEFVSAGFSKS  1378
             + W+GL EE M    ++P  + +  A FS S
Sbjct  403   EAWIGLSEEDMVKFEQDPGILTY--ASFSPS  431



>ref|XP_006430560.1| hypothetical protein CICLE_v10011796mg [Citrus clementina]
 gb|ESR43800.1| hypothetical protein CICLE_v10011796mg [Citrus clementina]
Length=426

 Score =   252 bits (643),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 155/442 (35%), Positives = 229/442 (52%), Gaps = 25/442 (6%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVDEL  223
             M +++   +IIKPSSPTPQ   TY  SI+DQL+ NV    +  Y   G S       D L
Sbjct  1     MDLQITCTEIIKPSSPTPQHQSTYKLSIIDQLTPNVYFSIILLYSKAGESTAKTS--DHL  58

Query  224   KKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREMVP  403
             KKSLS TL+  YPLAG++K D+  ++CNDQGV FIE  V       L+ P+ +++ +++P
Sbjct  59    KKSLSNTLTHYYPLAGQLKYDQLIVDCNDQGVPFIEAHVTNDRRQLLKIPNIDVLEQLLP  118

Query  404   CNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRGCA  583
               P  G    + D   L IQVN F CGG+++GL   H + D  + + F   W  I RG  
Sbjct  119   FKPHEGF---DSDRSNLTIQVNYFGCGGMAIGLCFRHKVIDATTAAFFVKNWGVIARGAG  175

Query  584   VVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQLREQL  763
              + D   I D + +F P ++ + L +         ES+ K    RF    + I  L+E  
Sbjct  176   EIKD--VIIDHASLF-PARDLSCLTKSVDEEFLKPESETK----RFVFDGATIASLQETF  228

Query  764   RLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSIL--NLRNRMEPPFPENCL  937
                   RP+R E + AV+  A+I A ++          L +I+  NLR RM PPFPE+C+
Sbjct  229   ASFER-RPTRFEVVSAVILGALITATRESDDESNVPERLDTIISVNLRQRMNPPFPEHCM  287

Query  938   GNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTALPIMSEI  1117
             GN   G  V+W  P E       LA +  ++I+ V+D+ AR+ YG   FL+     +  +
Sbjct  288   GNIISGGLVYW--PLEKKVDYGCLAKEIHESIKKVDDQFARKFYGDAEFLN-----LPRL  340

Query  1118  IKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQVMKDSVVFMEGRFG-GVDLW  1294
                E  KK  +  + +S     +Y ADFGWGKP+WA N+  +    VF +   G GV+ W
Sbjct  341   AGAEDVKKREF--WVTSWCKTPLYEADFGWGKPKWAGNSMRLNQITVFFDSSDGEGVEAW  398

Query  1295  MGLPEELMNIVMKNPQFVEFVS  1360
             +GLP++ M    K+   + + S
Sbjct  399   VGLPKKDMARFEKDSGILAYTS  420



>gb|KDO53588.1| hypothetical protein CISIN_1g048249mg [Citrus sinensis]
Length=426

 Score =   251 bits (640),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 153/442 (35%), Positives = 225/442 (51%), Gaps = 25/442 (6%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVDEL  223
             M +++   +IIKPSSPTPQ   TY  SI+DQL+ NV    +  Y + G S       D L
Sbjct  1     MDLQITCTEIIKPSSPTPQHQSTYKLSIIDQLTPNVYFSIILLYSNAGESTAKTS--DHL  58

Query  224   KKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREMVP  403
             KKSLS TL+  YPLAG++K D+  ++CNDQGV FIE  VA  +   L+ P+ +++ +++P
Sbjct  59    KKSLSNTLTHYYPLAGQLKYDQLIVDCNDQGVPFIEAHVANDMRQLLKIPNIDVLEQLLP  118

Query  404   CNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRGCA  583
               P  G    + D   L +QVN F CGG+++GL   H + D  + + F   W  I RG  
Sbjct  119   FKPHEGF---DSDRSNLTLQVNYFGCGGMAIGLCFRHKVIDATTAAFFVKNWGVIARGAG  175

Query  584   VVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQLREQL  763
              + D   I D + +FP      DL   A+         E    +RF      I   +E  
Sbjct  176   EIKD--LIIDHASLFP----ARDLSCLAKSVDEEFLKPESE-TKRFVFDGPTIASFQETF  228

Query  764   RLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSIL--NLRNRMEPPFPENCL  937
                   RP+R E + AV+  A+I A ++          L +I+  NLR RM PPFPE+C+
Sbjct  229   TSFER-RPTRFEVVSAVILGALITATRESDDESNVPERLDTIISVNLRQRMNPPFPEHCM  287

Query  938   GNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTALPIMSEI  1117
             GN   G  V+W  P E       LA +  ++I+ V+D+ AR+ YG   FL+     +  +
Sbjct  288   GNIISGGLVYW--PLEKKVDYGCLAKEIHESIKKVDDQFARKFYGDAEFLN-----LPRL  340

Query  1118  IKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQVMKDSVVFMEGRFG-GVDLW  1294
                E  KK  +  + +S     +Y ADFGWG P+WA N+  +    VF +   G GV+ W
Sbjct  341   AGAEDVKKREF--WVTSWCKTPLYEADFGWGNPKWAGNSMRLNQITVFFDSSDGEGVEAW  398

Query  1295  MGLPEELMNIVMKNPQFVEFVS  1360
             +GLP + M    K+   + + S
Sbjct  399   VGLPRKDMARFEKDSGILAYTS  420



>ref|XP_009359305.1| PREDICTED: vinorine synthase [Pyrus x bretschneideri]
Length=435

 Score =   248 bits (634),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 154/453 (34%), Positives = 248/453 (55%), Gaps = 27/453 (6%)
 Frame = +2

Query  38    ITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVD  217
             + MKIE+   D  KPSSPTP  L++Y  S++DQ++    +P V FY  P +  D   +VD
Sbjct  1     MQMKIEIVSEDQCKPSSPTPNHLKSYKLSLLDQIAPIFYVPVVLFYSDPENIDDTT-IVD  59

Query  218   ELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREM  397
              LKKSLS+TL+  YPLAGRI E  +S++C D GV F +      LS  L+ P+ ++++++
Sbjct  60    RLKKSLSETLTCFYPLAGRI-EGNASVDCEDGGVVFTKARAHIQLSEILKTPEMDLVQQL  118

Query  398   VPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRG  577
             +P +P+      +     + +Q+N F CGG+ +G+ +SH I DGA++S F + WA  +RG
Sbjct  119   LPLDPYN--IRTDKAVAAMAVQLNCFDCGGMGIGICLSHKIADGATLSSFLDAWATRSRG  176

Query  578   CAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQLRE  757
               + ++     +++ +FPP     D + F          +E  V +RF   AS++ +L+ 
Sbjct  177   --ISENITPSLNSATMFPP----RDKEIF---MPSNLIKRENIVTKRFVFDASSLAKLKV  227

Query  758   QLR--LISHYR-PSRAEALIAVVWDAVI-AANQKRHKGRINLHVLTSILNLRNRMEPPFP  925
             +    L +  R P+R EAL A++  + + A N    KGR ++  ++ ++NLR RM PP P
Sbjct  228   KASKGLCTDDRAPTRVEALTALICKSSMNAKNGTLGKGRPSM-AISHVVNLRERMAPPLP  286

Query  926   ENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTALPI  1105
             E+  G N +   V      E NP  H L ++ R  IR ++D+  R+  G+ GF H   P+
Sbjct  287   EHSFG-NIWRFAVASIMNDESNPELHDLVVRLRKVIRKIDDDYVRKLQGEDGFTHACEPL  345

Query  1106  --MSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQV-MKDSVVFMEGRF  1276
                SE++    S+  +     SS +   +Y  DFGWGKP WA    V +K+ V+ +    
Sbjct  346   KETSEMV----SEGEVEFFRVSSWIRFSLYNTDFGWGKPTWACIPSVPIKNVVILLSSSS  401

Query  1277  G-GVDLWMGLPEELMNIVMKNPQFVEFVSAGFS  1372
             G G++ W+ L EE M    ++ + +EFVS   S
Sbjct  402   GDGIEAWVTLDEEDMAKFERDHELLEFVSVAPS  434



>ref|XP_007030131.1| 3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase, putative [Theobroma 
cacao]
 gb|EOY10633.1| 3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase, putative [Theobroma 
cacao]
Length=444

 Score =   246 bits (629),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 157/454 (35%), Positives = 247/454 (54%), Gaps = 30/454 (7%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSS--RDYNGVVD  217
             M++++  R+ IKP SPTP  LRT+  S++DQL   + +P + FY +   +  R+YN + D
Sbjct  1     MEVQIISRETIKPFSPTPDHLRTHKLSLLDQLVPPIYLPMILFYSATDENDPRNYN-ISD  59

Query  218   ELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREM  397
              LKKSLS+ L+  YP AGRIK+D  +++CND GV F+E  VA  +S  LE P+ E +R++
Sbjct  60    YLKKSLSKALTHFYPFAGRIKDDL-TVDCNDGGVTFVEAQVACDMSFVLEEPEIE-VRQL  117

Query  398   VPCNPFTGA--FEPNPDGRV-LVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARI  568
             +PC PF  +   + + D  + L +QVN F+CGG+++ + +SH IGD ++ + F   WA +
Sbjct  118   LPCAPFEHSPQTQSSTDQVIPLAVQVNYFACGGMAISVCISHVIGDASAAAHFLKGWAAL  177

Query  569   NRGCAVVDDGGFIFDASKIFPPVKNTADLDQFARV------ARGAAESQE-KYVVRRFYI  727
              RG   ++  G I+D+S +FPP     DL  F +       A G  ES E K+V +R   
Sbjct  178   ARGADNIE--GVIYDSSSLFPP----RDLSIFRKYVGGLVDANGKVESPEDKFVTKRLMF  231

Query  728   PASAIDQLREQL-RLISHYRPSRAEALIAVVWDAVIAANQKRH-KGRINLHVLTSILNLR  901
               S I  LR ++   ++ YRP+R EA+ AVVW+A+I A  +    G   +  +++ +NLR
Sbjct  232   NGSKITALRNEIGDGLNLYRPTRVEAVTAVVWEALINATAENDGSGTSPILAVSNAMNLR  291

Query  902   NRMEPPFPENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGG  1081
              RM PP P+ C+GN ++   V        N  R  LA    ++I+  +DE  R+ +  G 
Sbjct  292   KRMNPPLPQQCIGNVSFSKMVSSLNVKIKN--RSNLAKIINESIKETDDEYIRKTFTSGE  349

Query  1082  FLHTALPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQVMKDSVVF  1261
              L+    +  +  K+  SK  M+    S       Y  DFGWGKP W            F
Sbjct  350   CLNLMEKLCEKFEKN--SKLGMFIF--SCWCRFPFYEVDFGWGKPVWFECPLRANRVGFF  405

Query  1262  MEGRFG-GVDLWMGLPEELMNIVMKNPQFVEFVS  1360
             ++   G G++ W+ L +E M  + K P  + + +
Sbjct  406   VDTSDGEGIEAWITLRKEEMAKLEKEPGILAYAT  439



>ref|XP_006345618.1| PREDICTED: vinorine synthase-like [Solanum tuberosum]
Length=425

 Score =   243 bits (619),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 156/446 (35%), Positives = 250/446 (56%), Gaps = 36/446 (8%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVDEL  223
             +K+E+  ++ IKP SP+ +S +++  S++DQ + N    +V FY+   SS D   V+D L
Sbjct  3     IKVEIISKETIKPFSPSSKSHKSHKLSLLDQKAPNCYTTFVLFYNK-NSSSDLENVIDSL  61

Query  224   KKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREMVP  403
             K SLS+TLS + PLAGR+K D  ++ECNDQGV+    +V E +S+ L N   +++R+++P
Sbjct  62    KVSLSKTLSYLNPLAGRVK-DGITVECNDQGVDLTRANVHEDMSNVLMNLKIQVLRKLLP  120

Query  404   CNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRGCA  583
              NP T +     D  +L +Q+N F+CGGI++G+ +SH I DG+SI+ F  TWA I++  A
Sbjct  121   MNPLTRS----DDNVLLALQINCFACGGIAIGVCISHLITDGSSIATFLKTWASISQSRA  176

Query  584   VVDD----GGFIFDASKIFPPVK-NTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQ  748
               D+         D + IFPP K ++  + QF     G  + Q K   RRF    S I  
Sbjct  177   ENDNITISDKLFMDCTSIFPPKKVHSFSVFQFG----GKDQLQPKMAARRFVFDESNILA  232

Query  749   LREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGR-INLHVLTSILNLRNRMEPPFP  925
             L  +    +    S+ EA++A VW++VIAA QKR     I  +V+   ++LR R++PP P
Sbjct  233   LNTK----AERSTSQVEAVLAFVWESVIAAMQKRSNNNGIKNYVIRIPIDLRRRIQPPLP  288

Query  926   ENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTALPI  1105
             +  +GN  +    +W + +EG      L  K +D+I+ V          K G+    +  
Sbjct  289   QQTMGNIIHMVEANW-EVSEGPLDYKLLVKKIQDSIKNVT---------KHGY---DVKN  335

Query  1106  MSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQVMKDSVVFMEGRFG-G  1282
             M + ++    ++ +  L ++S      Y  DFGWG+P+WA    +  + VV M+   G G
Sbjct  336   MDDRVRTLNKEERI--LGSTSFCKFPFYDIDFGWGRPKWASVGSIAPNLVVLMDTSDGKG  393

Query  1283  VDLWMGLPEELMNIVMKNPQFVEFVS  1360
             +++W+GL EE M I+ KN +F +FVS
Sbjct  394   IEVWLGLVEEDMAILEKNQEFFKFVS  419



>ref|XP_002511243.1| 3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase, putative [Ricinus 
communis]
 gb|EEF51845.1| 3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase, putative [Ricinus 
communis]
Length=429

 Score =   241 bits (615),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 144/443 (33%), Positives = 236/443 (53%), Gaps = 24/443 (5%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYN--GVVD  217
             M++E+  ++ I+PSS TP  LRTYN S++DQ++  V +P + FY SP ++ D N      
Sbjct  1     MEVEIISKETIRPSSSTPPHLRTYNLSLLDQIAPPVYVPVILFY-SPDAANDVNPSNKSH  59

Query  218   ELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREM  397
              LK++ S+TL+  YPLAGRI++D  +I+C+D G  + E +VA  +S  ++ P+   + ++
Sbjct  60    HLKQAFSKTLTHFYPLAGRIQDDIFNIDCSDNGASYTEVNVAGDMSMVIQEPNIHQLEKL  119

Query  398   VPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRG  577
             +PCNP+    E +    +L  QVN F CG I++ + + H IGD  + + F  +WA I  G
Sbjct  120   LPCNPYEMLPEISSQ-EILKAQVNYFECGEIAISICIWHVIGDATTAASFIKSWAAIASG  178

Query  578   CAVVDD-GGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQLR  754
                  D    +FD + IFPP K    +  F        E     +++RF    S +  LR
Sbjct  179   GGGYSDIDNVVFDCTSIFPPQK----IHSFLWRNFMTDEMLSDILMKRFVFDGSKVAALR  234

Query  755   EQL-RLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPFPEN  931
             E++ +  S   P+R EA+ A++W AV+AA  K        +V  ++++LR R+EPP P+N
Sbjct  235   EEVGKGPSLDHPTRVEAIGALIWKAVMAATGKD-------YVAATVIDLRKRVEPPLPKN  287

Query  932   CLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTALPIMS  1111
             C+GN    A        + N     LA K  ++I+ +N+E  R+ +  G +L     +  
Sbjct  288   CIGNINQMAFAADCSVMDYN----YLAGKIHESIKMINNEYVRKIHAGGEYLEHVRDLAD  343

Query  1112  EIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQVMKDSVVFMEGRFGGVDL  1291
             +  +  G   N + +  SS      Y ADFGWGKP W   A + + + +       G++ 
Sbjct  344   QNRESPG-WLNQFSI--SSWCRFPFYEADFGWGKPIWVTTALINRCAFLLDTKDGQGIEA  400

Query  1292  WMGLPEELMNIVMKNPQFVEFVS  1360
             W+GLP+E+M+   +NP    + S
Sbjct  401   WIGLPKEVMSKFEQNPDICTYAS  423



>ref|XP_007037899.1| 3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase, putative [Theobroma 
cacao]
 gb|EOY22400.1| 3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase, putative [Theobroma 
cacao]
Length=444

 Score =   240 bits (613),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 152/434 (35%), Positives = 233/434 (54%), Gaps = 25/434 (6%)
 Frame = +2

Query  29    LHQITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNG  208
             L ++ M+I++  R+ IKPSSPTP  LRT+  S++DQL   V IP + FY +   +     
Sbjct  13    LSKLEMEIQIISRETIKPSSPTPHHLRTHKLSLLDQLVPPVNIPVLLFYSATAENPRKRS  72

Query  209   VVDELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMI  388
             +  +LK+SLS+TL   Y  AGR+ E   SI+CND G  +IE  VA  +S  L+ P+ +++
Sbjct  73    L--QLKESLSKTLVHFYTFAGRLSESF-SIDCNDNGATYIEAQVAIDMSVVLKEPEIDLL  129

Query  389   REMVPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARI  568
              +++PC+P     EP+    VL IQVN F+CGG+++ + + HA+ D ++++ F  +WA +
Sbjct  130   LQLLPCDPHENLAEPSAQ-VVLSIQVNYFACGGMAICVCVHHAVADASAVATFLQSWAAV  188

Query  569   NRGCAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAES--QEKYVVRRFYIPASAI  742
               G  + D     FD + +FP      DL  F  V     +   +E  V  RF    S I
Sbjct  189   ACGANLTDTE--TFDCTSLFP----RQDLSGFWEVLEENKDLIIREDVVTTRFLFDRSKI  242

Query  743   DQLREQL-RLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPP  919
             D LR+++    S YRP+R EA+ A++W+A++A+  +  K  I ++V TS+ NLR RM  P
Sbjct  243   DVLRDEIGNGSSLYRPTRVEAVSALIWNAMVASIAEYDK-TIPIYVATSV-NLRKRMNFP  300

Query  920   FPENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTAL  1099
             FP+ C+ N      +    P E   +   LA    D+I  V+DE  R+ +  G +L+   
Sbjct  301   FPQKCVAN--VSQFIMTELPIEKTKNLSNLAGNLHDSITKVDDEYVRKLHAGGAYLN---  355

Query  1100  PIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQVMKDSVVFMEGR-F  1276
              IM   IK  G  KN +    SS      Y  DFGWGKP W      +     F++    
Sbjct  356   -IMKGAIK--GFGKN-WIFSFSSWCRFPFYETDFGWGKPIWFGTTLRLNRVAFFLDTNDG  411

Query  1277  GGVDLWMGLPEELM  1318
             GG++ W+ L +E M
Sbjct  412   GGIEAWITLTQEEM  425



>ref|XP_008340164.1| PREDICTED: vinorine synthase-like [Malus domestica]
Length=435

 Score =   236 bits (603),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 149/451 (33%), Positives = 242/451 (54%), Gaps = 27/451 (6%)
 Frame = +2

Query  38    ITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVD  217
             + MKIE+   D  KPSSPTP  L+ Y  S++DQ++    +P V FY S   + D   +VD
Sbjct  1     MQMKIEIVSEDQCKPSSPTPDHLKXYKLSLLDQIAPIFYVPVVLFY-SASVNIDDTTIVD  59

Query  218   ELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREM  397
              LKKSLS+TL+  YPLAGRI E  +S++C D  V F +      LS  L+ P+ ++++++
Sbjct  60    RLKKSLSETLTCFYPLAGRI-EGNASVDCEDGVVVFTKARAHIQLSEILKTPEMDLVQQL  118

Query  398   VPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRG  577
             +P +P+      +     + +Q+N F CGG+ +G+ +SH I DGA++S F + WA  +RG
Sbjct  119   LPLDPYN--IRTDKXVAAMAVQLNXFDCGGMGIGICLSHKIADGATLSSFLDAWATRSRG  176

Query  578   CAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQLRE  757
               + ++     +++ +FPP     D + F          +E  V +RF   AS++ +L+ 
Sbjct  177   --ISENITPSLNSATMFPP----RDKEIFMPT---NLIKRENIVTKRFVFDASSLAKLKV  227

Query  758   QLR--LISHYR-PSRAEALIAVVWDAVI-AANQKRHKGRINLHVLTSILNLRNRMEPPFP  925
             +    L +  R P+R EAL A++  + +   N    KGR ++  ++ ++NLR R  PP P
Sbjct  228   KASKGLCTDDRAPTRVEALTALICKSSMNTKNGTLGKGRPSM-AISHVVNLRERXAPPLP  286

Query  926   ENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTALPI  1105
             E+  G N +   V      E NP  H   ++ R  IR ++D+  R+  G+ GF H   P+
Sbjct  287   EHSFG-NIWRFAVASIMNDESNPELHDFXVRLRKVIRKIDDDYVRKLQGEDGFTHACEPL  345

Query  1106  --MSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQV-MKDSVVFMEGRF  1276
                SE++    S+  +     SS +   +Y  DFGWGKP WA    V +K+ V+ +    
Sbjct  346   KETSELV----SEGEVEFFRFSSWIRFSLYNTDFGWGKPTWACIPNVPIKNVVILLSSSS  401

Query  1277  G-GVDLWMGLPEELMNIVMKNPQFVEFVSAG  1366
             G G++ W+ L EE M    ++ + +EFVS  
Sbjct  402   GDGIEAWVTLDEEDMAKFERDHELLEFVSVA  432



>ref|XP_002323910.2| hypothetical protein POPTR_0017s04320g [Populus trichocarpa]
 gb|EEF04043.2| hypothetical protein POPTR_0017s04320g [Populus trichocarpa]
Length=430

 Score =   236 bits (602),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 150/446 (34%), Positives = 237/446 (53%), Gaps = 28/446 (6%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSV-NVKIPYVRFYDSPGSSRDYNGVVDE  220
             M+I++  ++IIKPS+PTP  L+TY  S VDQL+  +  +P + FY         N   D 
Sbjct  1     MEIQIISKEIIKPSAPTPHHLKTYKLSAVDQLAAFSADVPIILFYSPTDEISSKNS--DY  58

Query  221   LKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREMV  400
             LKKS ++TL+L YP AGRIK+D SSI+CND G  +IE  VA ++S  L+ PD + + ++ 
Sbjct  59    LKKSFAKTLTLFYPFAGRIKDD-SSIDCNDDGATYIEAHVAGNMSMILQQPDMDQLEQLQ  117

Query  401   PCNPFTGAFEPNPDGRV-LVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRG  577
              C P     EP+  G+V L  QVN F CGGI++ + + H IGD +S++ F   W  I+  
Sbjct  118   SCKPDENVDEPS--GKVMLAAQVNYFDCGGIAISVRIRHRIGDASSLASFVKCWGAIS--  173

Query  578   CAVVD-DGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQLR  754
             C + D + G + D S +FPP     DL   + +      S      +RF      +  LR
Sbjct  174   CGIYDNNAGTVVDCSSVFPP----QDLSGMSFLYNLIPRSSFNISTKRFVFEGPKLAALR  229

Query  755   EQLRLISHY-RPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPFPEN  931
              +L    +  RP+R EA+ A++W  V   ++ +   R      T  ++LR RM+PP P++
Sbjct  230   GKLCNGPYLNRPTRFEAVSALIWGVVGEDSESKKVNR----PATIAVDLRKRMDPPLPQH  285

Query  932   CLGNNTYGATVHW-NQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTALPIM  1108
             C+GN  + A  +W N+  + N     LA K  ++I  +N +  R+ Y  G F       M
Sbjct  286   CIGNIVHLAEANWENKAMDCN----GLAGKIHESISMINSDYVRQVYADGTFFSLMRQRM  341

Query  1109  SEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRW-AVNAQVMKDSVVFMEGRFG-G  1282
             +E+ +   S + +  +  SS    + Y  DFGWGKP W   + ++  + V+ ++ R G G
Sbjct  342   AEMAEDPNSFRGV--IGFSSWCKFRFYEVDFGWGKPIWVGTSLRLEPNWVMLLDTRDGEG  399

Query  1283  VDLWMGLPEELMNIVMKNPQFVEFVS  1360
             +++ + LP E M    +NP  + + S
Sbjct  400   MEVRIALPNEEMVKFEQNPDILAYAS  425



>ref|XP_004310025.1| PREDICTED: vinorine synthase-like [Fragaria vesca subsp. vesca]
Length=428

 Score =   234 bits (596),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 153/441 (35%), Positives = 226/441 (51%), Gaps = 32/441 (7%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGV-VDE  220
             MK+EV  RD IKPSSPTP  LR +  S +DQ++  + +P + FY +     D   +    
Sbjct  1     MKVEVIERDCIKPSSPTPNHLRKHELSFLDQVAPPIFMPMLLFYPATSYGNDETPLSASR  60

Query  221   LKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREMV  400
             +K+SLS+TL+  YPLAGRI  D + + CND+G  F+E  V   LS  +  PD   + +++
Sbjct  61    VKQSLSETLTQFYPLAGRII-DNAFVNCNDEGTPFVEARVKCLLSDVVSQPDPNQLNKLL  119

Query  401   PCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRGC  580
             PC+      E   D  VL +QVN F CGG+++G+ +SH + D  S+ +F N+WA I+RG 
Sbjct  120   PCD-----LECVVDF-VLAVQVNIFDCGGMAIGVCISHKVADALSLVMFLNSWASISRG-  172

Query  581   AVVDDGGF---IFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQL  751
                D+  +   IFD +  FPP          +    G   +++K V +RF   AS +  L
Sbjct  173   ---DNCNYRAPIFDLATFFPP-------RSISGFKPGVGIARDKIVTKRFVFSASNVASL  222

Query  752   REQLRLI-SHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPFPE  928
             R +     +  RP+R EAL A VW   +A+ Q +    I   VL ++ NLR RMEP  PE
Sbjct  223   RTKYTTSETERRPTRIEALSAFVWSRFLASTQGKPNSDIVYKVLHAV-NLRTRMEPALPE  281

Query  929   NCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTALPIM  1108
             +  GN +  AT       EG    +    + RDAI+ V+ E  R+       +       
Sbjct  282   HHFGNVSRFATAT-TSFEEGEEECYGFVGQMRDAIKSVDGEYMRKILEGTAHVDYLKQRA  340

Query  1109  SEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQV-MKDSVVFME-GRFGG  1282
              E +K E     +     +SL    +Y  DFGWGKP W  +A +  K+ V FM+ G  GG
Sbjct  341   EEFLKGE-----VVSFSFTSLCRFPLYETDFGWGKPIWVGSASLTFKNLVCFMDSGSSGG  395

Query  1283  VDLWMGLPEELMNIVMKNPQF  1345
             ++ W+ L EE M    ++ Q 
Sbjct  396   IEAWVNLKEEDMAKFQEDEQL  416



>ref|XP_006443122.1| hypothetical protein CICLE_v10020052mg [Citrus clementina]
 ref|XP_006478865.1| PREDICTED: vinorine synthase-like [Citrus sinensis]
 gb|ESR56362.1| hypothetical protein CICLE_v10020052mg [Citrus clementina]
Length=464

 Score =   234 bits (597),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 145/463 (31%), Positives = 246/463 (53%), Gaps = 32/463 (7%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPG------SSRDYN  205
             M++++  ++IIKPSSPTP  L+T+  S++DQL+ N     + FYD P       S+R  N
Sbjct  1     MQLDIISKNIIKPSSPTPLHLKTHKLSLLDQLAPNNYTSLLLFYDGPSRFDDKTSARTIN  60

Query  206   GVVDELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAE--SLSSFLENPDF  379
                  LK SLS+TL+L YP AG++ +D   ++C+D GV F+E  V    S+S  L+NP+ 
Sbjct  61    DY-HRLKSSLSKTLTLYYPFAGKVLKDNYVVDCDDSGVPFVETRVPSSISMSEVLKNPET  119

Query  380   EMIREMVPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTW  559
               +++++P NP    +  + D   + IQ+N F+CGG+++G    H + D  +   F   W
Sbjct  120   NTLQQLLPFNP-NKKYLSSTDDVNMAIQINHFACGGMAIGFNFRHIVADATASIGFIKNW  178

Query  560   ARINRG--CAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPA  733
             A++N     ++++    + D +  FP  K   ++  +AR       + E  V +RF    
Sbjct  179   AKLNSSDDNSIINYKHVVVDCTDTFPRNK---EIPSYARRINEWQRAPE-CVTKRFVFDG  234

Query  734   SAIDQLREQL------RLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSI-L  892
             S +  L+ ++       L   Y PSR EA+  ++W A+IA +  R K   +   + SI +
Sbjct  235   SKVAALKREMIVKNEASLNHQYSPSRFEAVCGLIWGALIAMD--REKNIDSTSTIVSIPV  292

Query  893   NLRNRMEPPFPENCLGNNTYGATVHW-NQPTEGNPSRHALALKFRDAIRGVNDEAARRRY  1069
             NLRNRM P  PE+C+GN  +  T    N+  +G+  +  LA    ++ + V D+  R+ Y
Sbjct  293   NLRNRMNPLLPEDCIGNLFHSVTCAANNEAGDGHRDKSTLARNVHESKKMVGDDFVRKVY  352

Query  1070  GKGG--FLHTALPIMSEIIK---HEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNA  1234
               GG  F++     + E++K   +  +  ++     S  +G+Q Y  DFGWGKP W  +A
Sbjct  353   QDGGVVFVNQYKEAVKELLKDGPNNDTTNSVRLFGFSGPIGLQYYEIDFGWGKPVWVTSA  412

Query  1235  QVMKDSVVFMEGRFG-GVDLWMGLPEELMNIVMKNPQFVEFVS  1360
               M ++ + ++ R G GV+ W+GLP   M  + ++P  + + S
Sbjct  413   MRMHNTAMLLDTRDGKGVEAWVGLPINDMPKLEQDPGILTYAS  455



>gb|KDP36802.1| hypothetical protein JCGZ_08093 [Jatropha curcas]
Length=450

 Score =   233 bits (594),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 153/453 (34%), Positives = 230/453 (51%), Gaps = 32/453 (7%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSR--DYNGVVD  217
             M++++  ++ +KPSSPTP  L+ +  S++DQ   +   P V FY    ++   D +  + 
Sbjct  1     MEVQIISKENVKPSSPTPPHLKIFKLSLLDQFMPSPYAPIVLFYPMIKNTNHLDVSSKLK  60

Query  218   ELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREM  397
              LK+SLSQTL+  YPLAG IK+D S IECND+G  F+E  V   L  FL  PD  +I + 
Sbjct  61    LLKESLSQTLTCFYPLAGIIKDDLS-IECNDKGANFVEARVTCRLHEFLAQPDLMLINKF  119

Query  398   VPCN-----PFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWA  562
             +PC         GAF  N       IQ N F C GI++G+ +SH I DG ++S F   W 
Sbjct  120   LPCQFVVNKSTVGAFVTN-------IQANIFDCDGIAIGICISHKILDGDALSTFLKGWT  172

Query  563   RINRGCAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAI  742
               +RGC       F+  AS +FP   N   L   + V   +   +   + RRF   +SAI
Sbjct  173   YASRGCNEAIYPKFV--ASFLFPA--NDLWLKNSSAVMWSSLLRKGNCITRRFVFDSSAI  228

Query  743   DQLREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPF  922
             ++L+ Q        P+R E + A +W ++++A+ K + G     +LT I+NLR RMEP  
Sbjct  229   EKLKAQANSSGLQCPTRVETVSAFLWKSIMSASAKVN-GFQKPSLLTHIVNLRRRMEPSL  287

Query  923   PENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYG--KGGFLHTA  1096
              EN LGN  + A   +    E  P    L  K ++AI  +++E  ++  G  +   L  +
Sbjct  288   SENSLGNFLWIAAAQYTD--EAKPKLSDLVSKVKEAISRIDEEFVKKIKGEEENSVLSES  345

Query  1097  LPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRW----AVNAQVMKDSVVFM  1264
             L    EI + +  K    C   SS      Y ADFGWGKP W     +   V  + ++ +
Sbjct  346   L---KEIGEMDSYKNGRDCFGFSSWCKFGYYDADFGWGKPVWISSMGLEGSVFMNLIILV  402

Query  1265  EGRFG-GVDLWMGLPEELMNIVMKNPQFVEFVS  1360
             E RFG G++ W+ L E+ M I+  N   ++  S
Sbjct  403   ETRFGDGIEAWLTLDEQEMAILEGNQDLLKLAS  435



>gb|KDO46443.1| hypothetical protein CISIN_1g043811mg [Citrus sinensis]
Length=448

 Score =   233 bits (593),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 137/457 (30%), Positives = 242/457 (53%), Gaps = 37/457 (8%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRD-----YNG  208
             M++ +  + IIKPSSPTP  L+T+  S++DQL+ ++    + FY+ P    D      N 
Sbjct  1     MQLRIISKKIIKPSSPTPLHLKTHKLSLLDQLAPDIYTSLLFFYNGPSRVYDETNTSTNN  60

Query  209   VVDELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIE--GDVAESLSSFLENPDFE  382
             V   L+ SLS+TL+L YP AG++ +D   ++C+D G+ F+E  G  + S+S  L+NP+  
Sbjct  61    VYHRLQSSLSKTLNLYYPFAGKLLQDNYVVDCDDSGIPFVETRGPSSISMSEVLKNPEMN  120

Query  383   MIREMVPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWA  562
              +++++P NP    +  + D     +Q+N F CGG+++GL   H + DGA+   F   WA
Sbjct  121   TLQQLLPFNP-NKKYLSSTDDVNAAVQINHFDCGGVAIGLNFRHIVADGAASVGFIQNWA  179

Query  563   RINRG--CAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPAS  736
             +++     ++++    + D +  FPP     ++  +AR       + E  V +RF     
Sbjct  180   KLHSSDDNSIINYKHTVVDCTDTFPP---NQEISSYARRINEWQRAPE-CVTKRFVFDGG  235

Query  737   AIDQLREQL------RLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNL  898
              +  LR ++        ++ YRP+R EA+  ++WDA+IA +++ + G  +  + +  +NL
Sbjct  236   KVAALRGEIIKKDASLSLNQYRPTRFEAVSGLIWDALIAMDREENVG--STCIASVPVNL  293

Query  899   RNRMEPPFPENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKG  1078
             RNRM PP PE+C+GN  +  T   N+ +  N ++           + V+D+  R+ Y  G
Sbjct  294   RNRMNPPLPEDCIGNLYHAVTCTANKTSARNINQFT---------KMVSDDFVRKVYQDG  344

Query  1079  G--FLHTALPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQVMKDS  1252
             G  F++     + EI+K +   +       + ++G+  Y  DFGWGKP W+  A  + + 
Sbjct  345   GIVFVNQYKEAVEEIMKGDNGVR---LFGFTGVIGLPFYEPDFGWGKPVWSTTAMSLNNI  401

Query  1253  VVFMEGRFG-GVDLWMGLPEELMNIVMKNPQFVEFVS  1360
              V +  R G GV+ W+GLP   M    ++P  + + S
Sbjct  402   AVLLGTRDGKGVEAWVGLPINDMPKFEQDPGILTYAS  438



>ref|XP_006443123.1| hypothetical protein CICLE_v10024067mg [Citrus clementina]
 ref|XP_006478989.1| PREDICTED: vinorine synthase-like [Citrus sinensis]
 gb|ESR56363.1| hypothetical protein CICLE_v10024067mg [Citrus clementina]
Length=447

 Score =   231 bits (590),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 138/457 (30%), Positives = 241/457 (53%), Gaps = 38/457 (8%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRD-----YNG  208
             M++ +  + IIKPSSPTP  L+T+  S++DQL+ ++    + FY+ P    D      N 
Sbjct  1     MQLRIISKKIIKPSSPTPLHLKTHKLSLLDQLAPDIYTSLLFFYNGPSRVYDETNTSTNN  60

Query  209   VVDELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIE--GDVAESLSSFLENPDFE  382
             V   LK SLS+TL+L YP AG++ +D   ++C+D G+ F+E  G  + S+S  L+NP+  
Sbjct  61    VYHRLKSSLSKTLTLYYPFAGKLLQDNYVVDCDDSGIPFVETRGPSSISMSEVLKNPEMN  120

Query  383   MIREMVPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWA  562
              +++++P NP       + D     +Q+N F CGG+++GL   H + DGA+   F   WA
Sbjct  121   TLQQLLPFNPNKKYL--STDDVNAAVQINHFDCGGVAIGLNFRHIVADGAASVGFIQNWA  178

Query  563   RINRG--CAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPAS  736
             +++     ++++    + D +  FP   +  ++  +AR       + E  V +RF     
Sbjct  179   KLHSSDDNSIINYKHAVVDCTDTFP---SNQEISSYARRIIEWHRAPE-CVTKRFVFDGG  234

Query  737   AIDQLREQL------RLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNL  898
              +  LR ++        ++ YRP+R EA+  ++WDA+IA +++ + G  +  + +  +NL
Sbjct  235   KVAALRGEIIKKDASLSLNQYRPTRFEAVSGLIWDALIAMDREENVG--STCIASVPVNL  292

Query  899   RNRMEPPFPENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKG  1078
             RNRM PP PE+C+GN  +  T   N+ +  N ++           + VND+  R+ Y  G
Sbjct  293   RNRMNPPLPEDCIGNLYHAVTCTTNKTSARNINQFT---------KMVNDDFVRKVYQDG  343

Query  1079  G--FLHTALPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQVMKDS  1252
             G  F++     + EI+K +   +       + ++G+  Y  DFGWGKP W+  A  + + 
Sbjct  344   GIVFVNQYKEAVEEILKGDNGVR---LFGFTGVIGLPFYEPDFGWGKPVWSTTAMSLNNI  400

Query  1253  VVFMEGRFG-GVDLWMGLPEELMNIVMKNPQFVEFVS  1360
              V +  R G GV+ W+GLP   M    ++P  + + S
Sbjct  401   AVLLGTRDGKGVEAWVGLPINDMPKFEQDPGILTYAS  437



>ref|XP_011001807.1| PREDICTED: vinorine synthase-like [Populus euphratica]
Length=430

 Score =   231 bits (588),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 149/445 (33%), Positives = 236/445 (53%), Gaps = 26/445 (6%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSV-NVKIPYVRFYDSPGSSRDYNGVVDE  220
             M+I++  ++IIKPS+PTP  L+TY  S VDQL+     IP + FY SP +    +   D 
Sbjct  1     MEIQIISKEIIKPSAPTPHHLKTYKLSAVDQLAAFAADIPIILFY-SP-TDEISSKTSDY  58

Query  221   LKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREMV  400
             LKKS ++TL+L YP AGRIK D SSI+CND G  +IE  VA ++S  L+ PD + + ++ 
Sbjct  59    LKKSFAKTLTLFYPFAGRIK-DASSIDCNDDGASYIEAHVAGNMSMILQQPDMDQLEQLQ  117

Query  401   PCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRGC  580
              C P     EP+  G +L  QVN F CGG+++ + + H IGD +S++ F   W+ I   C
Sbjct  118   SCKPDENVDEPSGKG-MLAAQVNYFDCGGMAISVRIRHRIGDASSVASFVKCWSAI--CC  174

Query  581   AVVDD-GGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQLRE  757
              + D+  G + D S +FPP     DL   + +      S      +RF      +  LR 
Sbjct  175   GIYDNSAGTVVDCSSLFPP----QDLSGISFLYNPIPRSSFNISTKRFVFEGPKLAALRG  230

Query  758   QLRLISHY-RPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPFPENC  934
             +L    +  RP+R EA+ A++W  V    +     ++N    T  ++LR RM+PP P++C
Sbjct  231   KLCNGPYLNRPTRFEAVSALIWGVV---GEDSESKKVN-KPATIAVDLRKRMDPPLPQHC  286

Query  935   LGNNTYGATVHW-NQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTALPIMS  1111
             +GN  + A  +W N+  + N     LA K  ++I  +N +  R+ Y  G F       M+
Sbjct  287   IGNIVHLAVANWENKVVDYN----GLAGKIHESISMINSDYVRQVYADGTFFSLMRQRMA  342

Query  1112  EIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRW-AVNAQVMKDSVVFMEGRFG-GV  1285
             E  +   + + +  +  SS    + Y  DFGWGKP W   + ++  + V+ ++ R G G+
Sbjct  343   EKAQDPDNFRGV--IGFSSWCKFRFYEVDFGWGKPIWVGTSLRLSPNWVMLLDTRDGEGM  400

Query  1286  DLWMGLPEELMNIVMKNPQFVEFVS  1360
             ++ + LP E M    +NP  + + S
Sbjct  401   EVRIALPNEEMVKFEQNPDILAYAS  425



>gb|KDO45520.1| hypothetical protein CISIN_1g039563mg [Citrus sinensis]
Length=472

 Score =   231 bits (589),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 144/455 (32%), Positives = 233/455 (51%), Gaps = 42/455 (9%)
 Frame = +2

Query  38    ITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRD------  199
             + M++ +  ++IIKPSSPTP  L+T+  S++DQL+ ++ +P V FYDS     D      
Sbjct  1     MNMQLRIISKEIIKPSSPTPHHLKTHKLSLLDQLAPDIYLPIVLFYDSSSRVDDKTSTAT  60

Query  200   ---YNGVVDELKKSLSQTLSLMYPLAGRI-KEDRSSIECNDQGVEFIEGDVAESLSSFLE  367
                 N +   LK SLS+TL+  YP AGR+  +D   I+C+D GV  +E  V  ++   L 
Sbjct  61    INSTNNISRRLKNSLSKTLTHYYPFAGRVLLKDNYVIDCDDSGVPVVETLVGSNMFDVLN  120

Query  368   NPDFEMIREMVPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVF  547
              P+ + + +++P NP       +     + +Q+N F CGG++VG    H + DGA+   F
Sbjct  121   FPEMDTLEQLLPFNPNKKHLSTH--DVTVAVQINYFHCGGVAVGFNFRHIVADGAAAIGF  178

Query  548   ANTWARINRGCAVVDDGGF---------IFDASKIFPPVKNTADLDQFARVARGAAESQE  700
                WA++N      DD            + D + IFPP K   ++  ++R       S E
Sbjct  179   IKNWAKLNYSN---DDHDINIDVSTKYAVVDCTNIFPPNK---EISGYSRSINEWQRSTE  232

Query  701   KYVVRRFYIPASAIDQLR-----EQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRI  865
               V +RF    S I  LR     E+  L   YRPSR EA+  ++W A++A ++++H    
Sbjct  233   -CVTKRFRFNGSKIAALRREMIMEKASLNLQYRPSRFEAVCGLIWGALLAMDREKHIDST  291

Query  866   NLHVLTSILNLRNRMEPPFPENCLGNNTYGAT-VHWNQPTEGNPSRHALALKFRDAIRGV  1042
             +  + T  +NLRNRM PP PE C+GN  +  T    N+  +G+ ++  LA   R+  + V
Sbjct  292   ST-IATIPVNLRNRMNPPLPEGCIGNLFHAVTCTENNEAGDGHYNKSTLARNVREFTKMV  350

Query  1043  NDEAARRRYGKGG--FLHTALPIMSEIIKH----EGSKKNMYCLYTSSLLGMQVYAADFG  1204
             +D+  R+ Y  GG  F++     + E++K       +  ++     S  +G+Q Y  DFG
Sbjct  351   SDDFVRKVYQDGGVVFVNQYKEAVEELLKDGTNNNNTTNSVRMFGFSGPIGLQYYGIDFG  410

Query  1205  WGKPRWAVNAQVMKDSVVFMEGRFG-GVDLWMGLP  1306
             WGKP W      + +  + ++   G GV+ W+GLP
Sbjct  411   WGKPLWVTTVMRLNNVAMLLDTCDGKGVEAWVGLP  445



>ref|XP_006372816.1| hypothetical protein POPTR_0017s05330g [Populus trichocarpa]
 gb|ERP50613.1| hypothetical protein POPTR_0017s05330g [Populus trichocarpa]
Length=426

 Score =   229 bits (585),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 146/431 (34%), Positives = 229/431 (53%), Gaps = 27/431 (6%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSV-NVKIPYVRFYDSPGSSRDYNGVVDE  220
             M+I++  ++IIKPS+PTP  L+TY  S VDQL+     IP V FY         N   D 
Sbjct  1     MEIQIISKEIIKPSAPTPHHLKTYKLSAVDQLAAFAADIPVVLFYSPTDEISSKNS--DY  58

Query  221   LKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREMV  400
             LKKS ++TL+L YP AGRIK+D SSI+CND G  +IE  VA ++S  L+  D + + ++ 
Sbjct  59    LKKSFAKTLTLFYPFAGRIKDD-SSIDCNDDGATYIEAHVAGNMSMILQQTDMDQLEQLQ  117

Query  401   PCNPFTGAFEPNPDGRV-LVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRG  577
              C P     EP+  G+V L  QVN F CGGI++ + + H IGD +S++ F   W  I+  
Sbjct  118   SCKPDENVDEPS--GKVMLAAQVNYFDCGGIAISVRIRHRIGDASSLASFVKCWGAIS--  173

Query  578   CAVVD-DGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQLR  754
             C + D + G + D S +FPP     DL   + +      S      +RF      +  LR
Sbjct  174   CGIYDNNAGTVVDCSSLFPP----QDLSGMSFLYNLIPRSSFNISTKRFVFEGPKLAALR  229

Query  755   EQLRLISHY-RPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPFPEN  931
              +L    +  RP+R EA+ A++W  V    +     ++N    T  ++LR RM+PP P++
Sbjct  230   GKLCNGPYLNRPTRFEAVSALIWGVV---GEDSESKKVN-KPATFAVDLRKRMDPPLPQH  285

Query  932   CLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTALPIMS  1111
             C+GN  + A  +W    + N     LA K  ++I  +N +  R+ Y  G F  +    M+
Sbjct  286   CIGNIVHLAVANWENKVDCN----GLAGKIHESISMINSDYVRQVYSDGTFFSSIRQRMA  341

Query  1112  EIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRW-AVNAQVMKDSVVFMEGRFG-GV  1285
             E+ +   + +++  +  SS    + Y  DFGWGKP W   + ++  + V+ ++ R G G+
Sbjct  342   EMAEDPNNFRSV--IGFSSWCKFRFYEVDFGWGKPVWVGTSLRLSPNWVMLLDTRDGEGM  399

Query  1286  DLWMGLPEELM  1318
             ++ + LP E M
Sbjct  400   EVRIALPNEEM  410



>ref|XP_011070326.1| PREDICTED: vinorine synthase-like [Sesamum indicum]
Length=437

 Score =   229 bits (583),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 161/453 (36%), Positives = 231/453 (51%), Gaps = 42/453 (9%)
 Frame = +2

Query  38    ITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYN-GVV  214
             + ++IEV  ++ IKPSSPTP+SL  Y  S +DQ++  + +P V FY +   +R  N G  
Sbjct  1     MEIEIEVVSKETIKPSSPTPESLGKYQLSFIDQIAPPIFMPLVYFYQA--DARFSNPGKS  58

Query  215   DELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIRE  394
             D LK+SLS+ LS  YPLAGR+ +D   I+CND+G  ++E     SLS  + NP       
Sbjct  59    DHLKQSLSKVLSRFYPLAGRVVDDLY-IDCNDKGAPYVEAVANCSLSQVITNP-------  110

Query  395   MVPCNPFTGAFEPNPDGRV----LVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWA  562
              VP N     F P     V    + +QV  F CGG +VGL++SH I D  S  + ANTWA
Sbjct  111   -VPMN--MNKFLPYKLDDVQNLGMAVQVTHFQCGGTAVGLVISHKIADALSFFLLANTWA  167

Query  563   RINRGCAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAI  742
              + R     D  G  F+ +KIFPP +N A       + +      E+ V + F  PAS I
Sbjct  168   AVARNGNYDDVPGPKFEGAKIFPP-RNAAGFKPSTGIVK------EQLVTKIFTFPASKI  220

Query  743   DQLREQLR----LISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRM  910
               LRE+         H RP+R EAL A +W   I+A   +      ++ +   +NLR R+
Sbjct  221   STLRERYSGGATEFLHRRPTRVEALSAFIWTRFISATGMKADPN-KIYTVLHAVNLRTRL  279

Query  911   EPPFPENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDE-AARRRYGKGGFL  1087
             +PP  E   GN +  A      P+ G     AL  K R+AIR VN E  A+ R G     
Sbjct  280   DPPLSEYHFGNISRLAIA---MPSVGADDGCALLQKVREAIRSVNGEYVAQLRQGD----  332

Query  1088  HTALPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQVM-KDSVVFM  1264
                L  + E +  + +K  ++    +SL    +Y ADFGWGKP W  +A +  K+ V FM
Sbjct  333   -KHLNFLKERMA-QANKSELHTFNFTSLCRFPLYGADFGWGKPVWVASAGLTYKNLVTFM  390

Query  1265  EGRFG-GVDLWMGLPEELMNIVMKNPQFVEFVS  1360
             +   G G++ W+ L +E M     + +  EF+S
Sbjct  391   DTATGEGIEAWINLTQEDMEKFEADLELQEFLS  423



>ref|XP_006435345.1| hypothetical protein CICLE_v10001106mg [Citrus clementina]
 ref|XP_006473775.1| PREDICTED: BAHD acyltransferase At5g47980-like [Citrus sinensis]
 gb|ESR48585.1| hypothetical protein CICLE_v10001106mg [Citrus clementina]
Length=455

 Score =   229 bits (583),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 155/456 (34%), Positives = 235/456 (52%), Gaps = 34/456 (7%)
 Frame = +2

Query  44    MKIEVR--RRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGV--  211
             MKIEV+   ++ IKPSSPTP  L+T+ FS++DQ   +   P + FY  P        +  
Sbjct  1     MKIEVQIISKEDIKPSSPTPPHLKTFKFSLLDQFIPSPYAPIILFY--PNDCMTLAEIPK  58

Query  212   -VDELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMI  388
              +  LK+SLS+TL+  YPLAG+IK+D S IECND G  F+E  V   L  FL  PD  ++
Sbjct  59    RLALLKRSLSETLTRFYPLAGKIKDDLS-IECNDDGAYFVEAQVNCRLDEFLTKPDLLLL  117

Query  389   REMVPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARI  568
                +PC       E      +  IQVN F CGGI++G+ +SH + DGA++S F   W+  
Sbjct  118   HRFLPCELMK---ELTAVTYLTNIQVNVFDCGGIAIGICISHKMLDGAALSTFLRAWSAT  174

Query  569   NRGCAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQ  748
              RGC  V    F   A  +FP   N   L   + V  G+   + K + +RF   ASAI  
Sbjct  175   ARGCEEVIYPNFA--APSLFP--ANDLWLRDTSMVMWGSLFKKGKCITKRFVFDASAIAA  230

Query  749   LR---EQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINL-HVLTSILNLRNRMEP  916
             L+      ++     P+R EA+ A +W  ++AA++++H  +     VLT ++NLR RM P
Sbjct  231   LKVVATSSKIKCPTPPTRVEAVSAFIWKCIMAASKEKHGYQTRRPCVLTHLVNLRRRMTP  290

Query  917   PFPENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTA  1096
             P  +NC GN  + A      P +  P  H L  + +DAI  ++ E  ++     G     
Sbjct  291   PLSDNCTGNLLWMAAAKCMTPDK--PELHDLVGELKDAISKLDGEFVKKLSSDEGN----  344

Query  1097  LPIMSEIIKHEG---SKKNMYCLYTSSLLGMQVYAADFGWGKPRW----AVNAQVMKDSV  1255
               +M E +K  G   SK  +  +  SS      Y  DFG GKP W     ++   + + V
Sbjct  345   -SLMCESLKQIGELCSKDEVDHVGFSSWCNFGFYEIDFGRGKPVWVSSYGLSGSPVMNLV  403

Query  1256  VFMEGRFG-GVDLWMGLPEELMNIVMKNPQFVEFVS  1360
             + +E R+G G++ WM L E+ M+ +  + ++++F S
Sbjct  404   ILVETRYGDGIEAWMTLDEQDMSNLECSSEYIKFAS  439



>ref|XP_006443121.1| hypothetical protein CICLE_v10023671mg [Citrus clementina]
 gb|ESR56361.1| hypothetical protein CICLE_v10023671mg [Citrus clementina]
Length=470

 Score =   228 bits (582),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 143/453 (32%), Positives = 231/453 (51%), Gaps = 42/453 (9%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRD--------  199
             M++ +  ++IIKPSSPTP  L+T+  S++DQL+ ++ +P V FYDS     D        
Sbjct  1     MQLRIISKEIIKPSSPTPHHLKTHKLSLLDQLAPDIYLPIVLFYDSSSRVDDKISTATIN  60

Query  200   -YNGVVDELKKSLSQTLSLMYPLAGRI-KEDRSSIECNDQGVEFIEGDVAESLSSFLENP  373
                 +   LKKSLS+TL+  YP AGR+  +D   I+C+D GV  +E  V  ++   L  P
Sbjct  61    STKNISRRLKKSLSKTLTHYYPFAGRVLLKDNYVIDCDDSGVPVVETLVGSNMFDVLSFP  120

Query  374   DFEMIREMVPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFAN  553
             + + + +++P NP       +     + +Q+N F CGG++VG    H + DGA+   F  
Sbjct  121   EMDTLEQLLPFNPNKKHLSTH--DVTVAVQINYFHCGGVAVGFNFRHIVADGAAAIGFIK  178

Query  554   TWARINRGCAVVDDGGF---------IFDASKIFPPVKNTADLDQFARVARGAAESQEKY  706
              W ++N      DD            + D + IFPP K   ++  ++R       S E  
Sbjct  179   NWGKLNYSN---DDHDINIDVSTKYAVVDCTNIFPPNK---EISGYSRSINEWQRSTE-C  231

Query  707   VVRRFYIPASAIDQLR-----EQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINL  871
             V +RF    S I  LR     E+  L   YRPSR EA+  ++W A++A ++++H    + 
Sbjct  232   VTKRFRFNGSKIAALRREMIMEKASLNLQYRPSRFEAVCGLIWGALLAMDREKHIDSTST  291

Query  872   HVLTSILNLRNRMEPPFPENCLGNNTYGAT-VHWNQPTEGNPSRHALALKFRDAIRGVND  1048
              + T  +NLRNRM PP PE C+GN  +  T    N+  +G+ ++  LA   R+  + V+D
Sbjct  292   -IATIPVNLRNRMNPPLPEGCIGNLFHAVTCTENNEAGDGHYNKSTLARNVREFTKMVSD  350

Query  1049  EAARRRYGKGG--FLHTALPIMSEIIKH----EGSKKNMYCLYTSSLLGMQVYAADFGWG  1210
             +  R+ Y  GG  F++     + E++K       +  ++     S  +G+Q Y  DFGWG
Sbjct  351   DFVRKVYQDGGVVFVNQYKEAVEELLKDGTNNNNTTNSVRMFGFSGPIGLQYYGIDFGWG  410

Query  1211  KPRWAVNAQVMKDSVVFMEGRFG-GVDLWMGLP  1306
             KP W      + +  + ++   G GV+ W+GLP
Sbjct  411   KPLWVTTVMRLNNVAMLLDTCDGKGVEAWVGLP  443



>gb|KDP40899.1| hypothetical protein JCGZ_24898 [Jatropha curcas]
Length=432

 Score =   227 bits (578),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 137/452 (30%), Positives = 238/452 (53%), Gaps = 22/452 (5%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVDEL  223
             M++++  ++ IKPS PTP  L+T+  SI+DQL++   +P + FY SP  ++D + +  +L
Sbjct  1     MEVQIISKEKIKPSCPTPDHLKTHKLSIIDQLAIQCYVPVIIFY-SPSHNQDSSQISTQL  59

Query  224   KKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREMVP  403
             KKSLS+TL+  YPLAG+   + S I+CND G  F+E ++   +S  L     E++R ++P
Sbjct  60    KKSLSETLTHFYPLAGK-AINGSFIDCNDDGASFVEANIVGDMSMVLNQSKIELLRLLLP  118

Query  404   CNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRGCA  583
                 +   E   +  ++ +QVN F+ GGI + + + H I D ++++ F   W  I R   
Sbjct  119   ----SKLNENFAEKEIVSVQVNYFTSGGIVISVCIKHLIADASTVASFVEVWGNIARCAT  174

Query  584   VVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQLREQL  763
                  G IFD + +FPPV N     +   ++        + V +RF      I  LRE +
Sbjct  175   NSVSNGIIFDRTGLFPPVNN-----KIEGLSWVEGSLLPETVTKRFLFDGLKIAALREMI  229

Query  764   -RLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPFPENCLG  940
                +S  +P+R EA+ A++W A I+A ++  +  ++ HV  +++NLR ++ P  P+ C+G
Sbjct  230   SNGVSVDQPTRFEAVSALIWGASISAARESEE-NVDSHVAVTVVNLRKKLNPNLPQQCIG  288

Query  941   NNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTALPIMSEII  1120
             N    A        E +     L  K R +I  ++D   R+ + +G +       + +++
Sbjct  289   NICQVAIAK--SAIEKSTDYRELVRKIRKSIGVLDDGYVRKFHAEGKWFD----FVKKLV  342

Query  1121  KHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQVMKDSVVFMEGRFG-GVDLWM  1297
             +  G+   +  L  SS      Y  DFGWGKP W       ++ V+F++   G G++ W+
Sbjct  343   EEPGNNYKVKQLNFSSWCRFPFYGVDFGWGKPIWVSTVMEQENGVIFLDTIDGQGIEAWI  402

Query  1298  GLPEELMNIVMKNPQFVEFVSAGFSKSKL*IE  1393
              L  E M+   KNP+ +EF  A F++S + I+
Sbjct  403   SLSRENMDKFEKNPEILEF--ATFNRSTVKID  432



>ref|XP_008389785.1| PREDICTED: vinorine synthase-like [Malus domestica]
Length=431

 Score =   226 bits (577),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 148/447 (33%), Positives = 232/447 (52%), Gaps = 39/447 (9%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVDEL  223
             MKIEV  +  IKPS PTP  LR + FS +DQ++  + +P + FY++     D     D++
Sbjct  1     MKIEVIEKACIKPSMPTPPHLRKHEFSFLDQIATPIFMPMILFYNN-DHGNDAITYSDKV  59

Query  224   KKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREMVP  403
             K+SLS+TL+  YPLAGR+ E+ + + CNDQG  +++  V   LS  +  PD   + +++P
Sbjct  60    KQSLSKTLTQYYPLAGRVIEN-AYVNCNDQGAPYVQARVRSPLSDVISQPDPNQLNQLLP  118

Query  404   CNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRGCA  583
             C         N    VL +QVN F CGG+++ + +SH + D  S+ +F N+WA I+RG  
Sbjct  119   CK------LDNVGDLVLAVQVNVFDCGGMAIXICISHKVADALSLIMFLNSWASISRGDC  172

Query  584   VVDDGGF---IFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQLR  754
              + +      IFD +  FPP ++ +       + R      EK V +RF   AS +  LR
Sbjct  173   NIKNSTVSPPIFDLATHFPP-RSISGFKPSTGITR------EKIVTKRFVFSASTVASLR  225

Query  755   EQL--RLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSIL---NLRNRMEPP  919
              +      +  +P+R EAL A +W  VIA+ Q    G+ N + L  +L   NLR RM+PP
Sbjct  226   SKYTDNKTNERKPTRIEALSAFIWARVIASTQ----GKPNPNTLYKVLHAVNLRTRMDPP  281

Query  920   FPENCLGNNTYGATVHWNQPT--EGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHT  1093
              PE   GN +  A    + P+  EG    + +  + R+AI+ ++ +   +       L  
Sbjct  282   LPEYHFGNVSRFAM---SSPSFDEGEDMCYGMVGQMREAIKTIDGDYMAKIKDGNAHLKF  338

Query  1094  ALPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQV-MKDSVVFME-  1267
                   E +K E +  +      +SL    +Y  DFGWGKP W  +A +  K+ VVFM+ 
Sbjct  339   LKQRAEEFMKGEVASFSF-----TSLCRFPLYETDFGWGKPVWVASASLTFKNLVVFMDA  393

Query  1268  GRFGGVDLWMGLPEELMNIVMKNPQFV  1348
             G  GG+++W+ L EE M     + Q +
Sbjct  394   GSSGGIEVWVNLKEEDMAKFQDDEQLL  420



>ref|XP_004294207.1| PREDICTED: vinorine synthase-like [Fragaria vesca subsp. vesca]
Length=440

 Score =   226 bits (576),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 143/446 (32%), Positives = 232/446 (52%), Gaps = 23/446 (5%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVDEL  223
             MKIE+  R IIKPSSPTP  LR +  S  DQ+++ +  P + F+ +  S+     + + L
Sbjct  5     MKIEIIERQIIKPSSPTPHHLRNFELSFFDQMAITIYTPLLLFFPNTESTSKLE-ICEHL  63

Query  224   KKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREMVP  403
              +SL++TL+  YPLAGRIK   + +ECND G EF++  V+ SLS FLENP  +++ + +P
Sbjct  64    TESLAKTLTHFYPLAGRIK-GSTVVECNDDGAEFVKAQVSCSLSDFLENPAVKILEQFLP  122

Query  404   CNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRGCA  583
                 +   +    G +L++QV+ F CGG+++G  +SH I D +++S F N WA+     +
Sbjct  123   AEILS---KEAGSGPLLLVQVSLFECGGMALGFSISHKIADASTLSTFINCWAQTT-NTS  178

Query  584   VVDDGGFI--FDASKIFPPVKNTADLDQ-FARVARGAAESQEKYVVRRFYIPASAIDQLR  754
             + D    +  F ++ +FPP++ ++D  Q  ARV           + RRF    + I  L+
Sbjct  179   ITDSEVTLPEFGSASLFPPLEKSSDSSQPPARV----YSKNHINITRRFVFDGANISALQ  234

Query  755   EQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPFPENC  934
              ++   S  +P+R EA+ A++W   I A+  +  G     V +  +NLR R+ PP PENC
Sbjct  235   SKVASPSVPKPTRVEAISALIWKCAIEASTSK-SGSQRPSVFSQDVNLRKRVVPPLPENC  293

Query  935   LGN--NTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTALPIM  1108
              GN    + + V     T        L  KFR+   G+ + AA      G     A   +
Sbjct  294   AGNVVGFFRSKVEVEDGTSVAIDLKDLVSKFRE---GIENYAAITETIFGS--DEAWQGI  348

Query  1109  SEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQV-MKDSVVFMEGRFG-G  1282
              +  K+      M     +S      Y ADFGWGKP W   A V +++ +V ++ R G G
Sbjct  349   KDKYKNLKKSDAMGFYSCTSWCRFPFYEADFGWGKPNWVSIASVSIENIIVMLDKRDGNG  408

Query  1283  VDLWMGLPEELMNIVMKNPQFVEFVS  1360
             +++W+ +  E M +   N + + + S
Sbjct  409   IEVWLTMNHETMALFESNAELLAYAS  434



>ref|XP_002271612.1| PREDICTED: vinorine synthase-like [Vitis vinifera]
Length=433

 Score =   226 bits (575),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 143/447 (32%), Positives = 235/447 (53%), Gaps = 27/447 (6%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFY---DSPGSSRDYNGVV  214
             MKI++     IKPSSPTP  LR++  S++DQL+    +P +  +   D    + D+  + 
Sbjct  3     MKIDILSTQPIKPSSPTPNHLRSFKISLLDQLAPPFYVPVILLFSADDFDCEAVDHVTIC  62

Query  215   DELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIRE  394
             D LK+SLSQTLS  YPLAG++K +  S++C+D G  F+E      LS  L +P+ +++++
Sbjct  63    DLLKRSLSQTLSRFYPLAGKLKGN-DSVDCSDDGAVFMEARANVELSEILRDPEIDLLQK  121

Query  395   MVPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINR  574
             ++PC P++   E + D  +  IQ   F CGGI +G+ MSH + DGA+++ F   W+    
Sbjct  122   LLPCEPYSVGSESS-DRAITAIQATIFECGGIGIGVCMSHKVADGATLATFLTAWSATAM  180

Query  575   GCAVVDDGGFIF-DASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQL  751
             G    DDG   F D++ +FPP     D++    V      S  K + RRF   A+++ +L
Sbjct  181   G---TDDGITPFLDSASLFPP----RDINT---VLSSGVISHGKTLTRRFLFDAASLARL  230

Query  752   REQLRLISHYRPSRAEALIAVVWDAVI-AANQKRHKGRINLHVLTSILNLRNRMEPPFPE  928
             + +         +R EA+ +++W + +  A +K  K  I+  ++T ++NLR + EPP  +
Sbjct  231   QSKAS-----NSTRVEAVTSLIWKSAMDVAREKSGKDTIS-SIVTHVVNLRGKTEPPLSD  284

Query  929   NCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTALPIM  1108
               LG N +   V      EG      L  + R AI+ V+ E  +   G+ G L  A   M
Sbjct  285   RSLG-NLWQQAVATVTEQEGKVELDDLVGRLRRAIKKVDKEYVKEIQGEEG-LSKACGAM  342

Query  1109  SEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQV-MKDSVVFMEGRF-GG  1282
              E+ K   SK  M     SS      Y  DFG+G+P W       +K+ ++ M+ +  GG
Sbjct  343   KEVQKMIMSKGEMELYRFSSWSRFPFYETDFGFGRPIWVCTITAPIKNVIILMDTKSGGG  402

Query  1283  VDLWMGLPEELMNIVMKNPQFVEFVSA  1363
             ++ W+ + EE M    ++ + +EFVS+
Sbjct  403   IEAWVTMVEEDMTKFQRHYELLEFVSS  429



>ref|XP_010046662.1| PREDICTED: vinorine synthase-like [Eucalyptus grandis]
 gb|KCW86861.1| hypothetical protein EUGRSUZ_B03452 [Eucalyptus grandis]
Length=436

 Score =   226 bits (575),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 147/453 (32%), Positives = 243/453 (54%), Gaps = 23/453 (5%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYN--GVVD  217
             MKI+V  ++ I PSS TP  ++TY FS++DQL+    +P V FY +P   +D++   + +
Sbjct  1     MKIQVISKETIMPSSATPSPVQTYRFSLLDQLAPPFFVPVVLFYSAPDPDQDFDHVNIYE  60

Query  218   ELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREM  397
             +LK SLS+ LS  YPLAGRIK D  +++   + V F+   V   L+  L NP+ ++++++
Sbjct  61    KLKTSLSECLSCFYPLAGRIKGDEHAVDLGQRAV-FVRTRVNARLAKLLANPELKLVQQL  119

Query  398   VPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRG  577
             +P +P+    +   +  V  IQ+N F+ GGI +G+ +SH I D A++S F ++W  I+RG
Sbjct  120   LPLDPYNIQCQ---NALVTAIQLNLFNRGGIGIGVCISHKIADRATLSTFLSSWGAISRG  176

Query  578   CAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQLRE  757
              + +       D + IFPP        +F          +EK V +RF   ++++  LR 
Sbjct  177   ASKL--VAPYQDTTTIFPP-------REFRVPLPNNLIKKEKIVTKRFEFDSASLAALRT  227

Query  758   QLRLISHYR-PSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPFPENC  934
             +    S  + P+  EA+ A++  A + A  +      +  V++ ++NLR RM PP P++ 
Sbjct  228   KAGDGSTSKSPTLIEAVTALICKAAMNARTEISGNGRSSTVISHVVNLRGRMNPPLPDHS  287

Query  935   LGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTALPIMSE  1114
              GN    AT    +  E +   H LA   R AIR ++++  R+  G+ GFL  A   M E
Sbjct  288   FGNIWRFATATIKE-EEDDAELHVLADHLRTAIRKIDNDYVRKLQGEDGFLW-ACESMRE  345

Query  1115  IIKHE-GSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQV-MKDSVVFMEGRFG-GV  1285
             +  HE   K ++     SS +    Y  DFGWGKP WA  + V +K++V+ M    G G+
Sbjct  346   V--HELMYKGDVESYRFSSWVRFPFYETDFGWGKPVWACISSVPIKNAVILMSSWSGNGL  403

Query  1286  DLWMGLPEELMNIVMKNPQFVEFVSAGFSKSKL  1384
             + W+ L E+ M     +P  ++FVS  +   K+
Sbjct  404   EAWVTLDEQEMAKFQSDPLLLQFVSLPYKSPKI  436



>ref|XP_006380880.1| hypothetical protein POPTR_0006s01180g [Populus trichocarpa]
 gb|ERP58677.1| hypothetical protein POPTR_0006s01180g [Populus trichocarpa]
Length=403

 Score =   224 bits (572),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 145/453 (32%), Positives = 240/453 (53%), Gaps = 59/453 (13%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVDEL  223
             MK+++  ++I+KPSS TPQ LRTY  S++DQL+  ++              D     D L
Sbjct  1     MKVQIISKEILKPSSSTPQHLRTYKLSVLDQLASPIE--------------DLCKNSDHL  46

Query  224   KKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREMVP  403
             K S S+TL+  YP AGRIK+D S ++CND G EFIE  VA  +S  LE  D    ++++P
Sbjct  47    KDSFSKTLTHFYPFAGRIKDDFS-VDCNDDGAEFIEARVAGDISMVLEQADINQQQQLLP  105

Query  404   CNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRG-C  580
             C+P+  + + + D   L +QVN F+CGG+++ + + HA+ D ++++ F N WA I+R   
Sbjct  106   CSPYVKSSKLSTDQVTLAVQVNYFNCGGVAISICIWHAVADASTLATFVNCWAAISRDPN  165

Query  581   AVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQLREQ  760
              V+D+   +FD + +FPP     DL  F+  +    +   + V++RF    S +  LR++
Sbjct  166   NVIDE--VVFDCTTLFPP----QDLSGFSLHSFVKEDVLSEIVMKRFLFDGSKVAALRDE  219

Query  761   L-RLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPFPENCL  937
             +    S  RP+R  A+ A++  A++A  ++ +  +IN   +  +++LR R++PP PE   
Sbjct  220   VGNGPSLDRPTRFIAVSALILGAMMAVTRENNAMQINAAFI--VVDLRRRLKPP-PE---  273

Query  938   GNNTYGATVHWNQPTEGNP-SRHALALKFRDAIRGVNDEAARRRYGKGGFLHTALPIMSE  1114
                           +E N  S + LA K  ++IR +ND+  R+ +  GG+ +        
Sbjct  274   --------------SESNVLSYNGLAGKLHESIRMMNDDYIRKFHAGGGYFN--------  311

Query  1115  IIKHEGSK----KNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQVMKDSVVFMEGRFG-  1279
             ++K  G +     N+     SS      Y  DFGWGKP W   A       VF++ + G 
Sbjct  312   LLKRAGEEARKGSNLTLFGFSSWCNFPFYETDFGWGKPLWVSPALKFNRVAVFLDTKDGE  371

Query  1280  GVDLWMGLPEELMNIVMKNPQFVEFVSAGFSKS  1378
             G++ W+GL +E M    ++P  + +  A FS S
Sbjct  372   GIEAWIGLSKEDMVKFEQDPGILTY--ASFSAS  402



>ref|XP_008390114.1| PREDICTED: vinorine synthase-like [Malus domestica]
Length=435

 Score =   225 bits (574),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 143/451 (32%), Positives = 238/451 (53%), Gaps = 27/451 (6%)
 Frame = +2

Query  38    ITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVD  217
             + MKIE+   D  KPSSP P  L++Y  S+++Q++    +P + FY +P +  D   +VD
Sbjct  1     MQMKIEIVSEDQCKPSSPIPDHLKSYKLSLLEQIAPMFYVPVILFYSAPENIDD-TTIVD  59

Query  218   ELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREM  397
             +L  SLS+TL+  YPLAGRI E  +S++C D  V F        LS  L+ P+ ++++++
Sbjct  60    KLNNSLSETLTGFYPLAGRI-EGNASVDCEDGAVXFARARANIQLSEILKIPEMDLVQQL  118

Query  398   VPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRG  577
             +P +P+      +     + IQ+N F CGG+ + + +SH I DGA++S F + WA  +RG
Sbjct  119   LPLDPYN--IRMDKAVAAMAIQLNFFDCGGMGIVICLSHKIADGATLSSFLDAWATRSRG  176

Query  578   CAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQLRE  757
               V ++     +++ IFPP      +             +EK+V +RF   AS++ +L+ 
Sbjct  177   --VFENITPSLNSANIFPPRDKQIFMP-------SNLIKREKFVTKRFVFDASSLAKLKV  227

Query  758   QLR--LISHYR-PSRAEALIAVVWDAVIAAN-QKRHKGRINLHVLTSILNLRNRMEPPFP  925
             +    L +  R P+R EAL A++  + + A      +GR ++ + + +  LR RM PP P
Sbjct  228   KASKGLCTDGRAPTRVEALTALICKSSMNAKIGTLGRGRPSMAI-SHVGYLRERMAPPLP  286

Query  926   ENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTALPI  1105
             E+  G N +   V      E  P  H   ++ R  IR ++D+  R+  G+ GF H   P+
Sbjct  287   EHSFG-NIWRVAVASIMKDESKPELHDFVVQLRKVIRKIDDDCVRKLQGEDGFSHACEPL  345

Query  1106  --MSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQV-MKDSVVFMEGRF  1276
                SE++    S+  +     SS +   +Y  DFGWGKP WA  + V +K+ V+ +    
Sbjct  346   KETSELV----SEGEVEFFRFSSWIRFSLYNTDFGWGKPTWACISNVPIKNVVILLSSSS  401

Query  1277  G-GVDLWMGLPEELMNIVMKNPQFVEFVSAG  1366
             G G++ W+ L EE M     + + +EFVS  
Sbjct  402   GDGIEAWVTLDEEDMAKFESDHELLEFVSVA  432



>gb|KDP26741.1| hypothetical protein JCGZ_17899 [Jatropha curcas]
Length=432

 Score =   224 bits (570),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 152/457 (33%), Positives = 239/457 (52%), Gaps = 40/457 (9%)
 Frame = +2

Query  38    ITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGV--  211
             + ++ E+  ++IIKPSSPTP  LR Y  S +DQ+S  V  P + FY++ G ++ +N V  
Sbjct  1     MKLECELISKEIIKPSSPTPDHLRHYKLSFLDQISPPVYNPLLLFYETDGETK-FNSVEK  59

Query  212   VDELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIR  391
              ++LK+SLSQ L   YPLAGRIK D   ++CND+G+  ++  V+  LS  +++P    I+
Sbjct  60    YNQLKQSLSQALIHFYPLAGRIK-DNHFVDCNDEGIPCLQAKVSGKLSDVVQSPVPTEIK  118

Query  392   EMVPCNPFTGAFEPNPDGRV-LVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARI  568
             +++P       FE + D  + L +Q N F CGGI +GL +SH IGD  SI +F   WA I
Sbjct  119   KLLP-------FELDQDQELPLGVQFNIFECGGICIGLCLSHNIGDALSIVLFVKIWAAI  171

Query  569   NRGCAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQ  748
              RG   +    F+  ++K+FPP         F+        ++E  +  RF   +S+I+ 
Sbjct  172   TRGEEEITRPEFV--SAKLFPP-------KDFSGFNPRIGFAKENVLTERFVFKSSSIES  222

Query  749   LREQL----RLISHYRPSRAEALIAVVWDAVIAA-NQKRHKGRINLHVLTSILNLRNRME  913
             LR +      L S   PSR EAL A +W   +AA  Q+  +    ++++   +NLR RM 
Sbjct  223   LRAKYAASTSLKSQRPPSRVEALSAFIWTRFMAAIKQQTEEPSEKIYMMLHAVNLRTRMN  282

Query  914   PPFPENCLGNNTYGATVHWNQPT-EGNPSRH-ALALKFRDAIRGVNDEAARRRYGKGGFL  1087
             PP PEN  G N Y   + +  PT  G  S +  + ++ RD+I  ++ E  ++    G   
Sbjct  283   PPLPENSFG-NFYRVAMTFPSPTNNGEESNYDDIVIQMRDSISKIDTEYVKKLQEAGNDE  341

Query  1088  HTALPIMSEIIKHEGS---KKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQV-MKDSV  1255
             H       + IK       +  M  L  +SL    +Y  DFGW KP W  +  +  K+ V
Sbjct  342   HM------DFIKQMAQFFMRGEMVSLNFTSLCRFPLYETDFGWRKPIWVGSPSLTFKNLV  395

Query  1256  VFMEGRFG-GVDLWMGLPEELMNIVMKNPQFVEFVSA  1363
             VFM+   G G++  + L +E M    ++ + ++FVS 
Sbjct  396   VFMDTPSGDGIEALIHLNQEDMQKFKEDQELLQFVSC  432



>gb|KDP38750.1| hypothetical protein JCGZ_04103 [Jatropha curcas]
Length=449

 Score =   224 bits (571),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 150/458 (33%), Positives = 231/458 (50%), Gaps = 47/458 (10%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVV---  214
             +K+E+  R+ IKPSSPTP++LR  N S++DQLS  +  P + FY  P      N +V   
Sbjct  5     VKVEIITRETIKPSSPTPRNLRYKNLSLLDQLSFAMSTPMLLFY--PFRCDKNNNIVHVI  62

Query  215   ----DELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFE  382
                   LK SLS+TL+L YPLAG +K + S IECND GVE+IE  V  S+    +NP+  
Sbjct  63    KEQSQNLKTSLSKTLTLFYPLAGELK-NNSFIECNDYGVEYIEAQVDCSMMELFQNPENY  121

Query  383   MIREMVP--CNP---FTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVF  547
             ++  + P   NP   FTGA          +I VN F+CGG+++G+ +SH I D AS+  F
Sbjct  122   LLENLFPIDLNPVDKFTGA----------IIHVNFFNCGGLAIGVSLSHKIADAASLGTF  171

Query  548   ANTWARINRGCAVV--DDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRF  721
                WA +      +  +     F ++ + P  +N+  L      +   + +Q K + +RF
Sbjct  172   LLAWASMASLSMEILPETKCPHFVSNTVIPSAENSLILP-----SPPPSLTQTKCITKRF  226

Query  722   YIPASAIDQLREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLR  901
              + +  ID L+ +    +   P+R E + A++W  +I+A+Q + KG+    VL   +NLR
Sbjct  227   TLSSCKIDMLKAKAATSTLQTPTRVEVVTALIWKCLISASQAKSKGKHKKSVLAQAVNLR  286

Query  902   NRMEPPFPENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGG  1081
              R+ P  P+N +GN +    V      +       L    R+ I  V+D   +R      
Sbjct  287   RRLVPHLPQNYIGNLSGKFLV---MAEKERAELKDLVAHLREGIEKVSDNVWKR------  337

Query  1082  FLHTALPIMSEIIK-HEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQ-VMKDSV  1255
              +   L    E  + H     ++Y    +SL G   Y  DFGWGKP W V    V+K+ V
Sbjct  338   -VDEILDFAKEFAELHSREDLDLYSF--TSLCGFPFYDVDFGWGKPIWTVVTNLVLKNYV  394

Query  1256  VFMEGR-FGGVDLWMGLPEELMNIVMKNPQFVEFVSAG  1366
             V ++ +   GV++WM L EE M +   N + +EF S  
Sbjct  395   VMLDMKDRKGVEVWMSLSEEDMPLFEANGELLEFASVN  432



>ref|XP_010051001.1| PREDICTED: vinorine synthase-like [Eucalyptus grandis]
 gb|KCW81034.1| hypothetical protein EUGRSUZ_C02410 [Eucalyptus grandis]
Length=440

 Score =   223 bits (569),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 150/453 (33%), Positives = 234/453 (52%), Gaps = 30/453 (7%)
 Frame = +2

Query  38    ITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPG--SSRDYNGV  211
             +  KIEV   + IKPSSPTP  LR +NF ++DQL+ +  +P V FY +P   ++ D   V
Sbjct  1     MATKIEVVSTETIKPSSPTPPHLRNFNFCLLDQLAPSFYVPVVLFYLAPDQKAAPDSALV  60

Query  212   VDELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIR  391
                LK SL+Q LSL YPL GR+K + + I+CND+G  ++E      LS  L NPD + ++
Sbjct  61    SGYLKTSLAQALSLFYPLGGRVKGN-AGIDCNDEGALYMEAKARFELSKVLSNPDIDQLQ  119

Query  392   EMVPCNPFTGAFEPNPDGRVLV-IQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARI  568
             + +P +P       N + +V+V +Q N F CGG+ +G+ +SH I DGAS+S F N W+ I
Sbjct  120   QFLPFSP--SRVSTNINEQVIVGVQANFFDCGGMGIGICISHKIADGASVSAFLNAWSEI  177

Query  569   -NRGCAVVDDGGFI---FDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPAS  736
              N G  V  +   I     AS++F P     D++   ++  G   S+EK   +RF     
Sbjct  178   ANNG--VDGEASLITPFLKASELFQP----KDINY--QIPSGVI-SREKLSTKRFCFNGE  228

Query  737   AIDQLREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSIL---NLRNR  907
             ++ +LR          P+R EA+ A++W + +AA +KR + +      ++++   N+R+R
Sbjct  229   SLARLRAGF---GGANPTRVEAVTALIWKSALAAARKRPEWKEKYPPSSAVIHAVNIRSR  285

Query  908   MEP-PFPENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGF  1084
             + P P PE  LGN          +P +G+      A   R++IR ++ E      G+ G 
Sbjct  286   IRPQPLPETTLGNLVQAVVAPLMEPNKGD-ELQDFAGTLRNSIRAIDSEYLSALQGENGL  344

Query  1085  LHTALPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQVMKDSVVFM  1264
                   +M+       S   +Y    SS      Y ADFGWG+P W      +K+ V+ M
Sbjct  345   AKACENLMATRKLAASSAIELYRF--SSWARFPFYEADFGWGRPAWVCTIAPIKNLVILM  402

Query  1265  EGRFG-GVDLWMGLPEELMNIVMKNPQFVEFVS  1360
               R G G++ W+ L E  M     N + ++FVS
Sbjct  403   GTRCGDGIEAWITLAEHDMIEFEHNDELLQFVS  435



>ref|XP_002284817.2| PREDICTED: vinorine synthase-like [Vitis vinifera]
Length=445

 Score =   223 bits (569),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 153/459 (33%), Positives = 227/459 (49%), Gaps = 32/459 (7%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFY---DSPGSSRDYNGVV  214
             M++ +  R+ IKPSSPTP  LR +  S++DQL        + FY      G S + + + 
Sbjct  1     MEVTIISRETIKPSSPTPHHLRAFKLSLLDQLVPCCYTQVLLFYLIDGFHGQSIETSHIS  60

Query  215   DELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIRE  394
               LK SLS+TL+  YPLAG I +D   I+CND+GV + E  V  +LS FL+ P+ E++ +
Sbjct  61    TRLKDSLSETLTHFYPLAGSIGDDELQIDCNDEGVPYFEARVDCNLSEFLQEPELELLNQ  120

Query  395   MVPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINR  574
               PC+P      P     + +IQVN F+ GGI++G+ +SH I DG SIS F   WA I R
Sbjct  121   FFPCDPLNTP--PMAKLHLAMIQVNIFNRGGIAIGVCLSHKIADGVSISAFLKAWAAIAR  178

Query  575   GCAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQLR  754
             GC         F+A  +FP  +N +    ++ V         K V +R    ASAI  L+
Sbjct  179   GCFEEYPS---FEAKSLFP--QNESLPQDYSMVLGKCLIRTGKCVTKRVVFDASAIAALK  233

Query  755   EQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPFPENC  934
              +    +    +R E + A +W   +AA  K+  G     +LT  +NLR +     PE+ 
Sbjct  234   AK----ASVDCTRVEVVSAFIWKRAMAA-AKQKLGFQRSSILTHAVNLRKKTILSLPESS  288

Query  935   LGNNTYGATVHWNQPTEGNPSRHA----LALKFRDAIRGVNDEAARRRYGKGGFLHTALP  1102
             +GN      + W   TEG     A    L  K R AI  ++ + A++  G+ GF      
Sbjct  289   MGN------LFWIAITEGRVDDEAELDLLVDKTRKAISKISCDFAKKLQGEEGFAVAFEH  342

Query  1103  IMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVN----AQVMKDSVVFMEG  1270
             +       E    + Y    SS    +VY  DFGWG+P W  +      V K+ + FM+ 
Sbjct  343   VKEVKAAFEEDGVDFYGF--SSWCKFEVYEGDFGWGRPIWVSSFSGKGSVYKNLIFFMDT  400

Query  1271  RFG-GVDLWMGLPEELMNIVMKNPQFVEFVSAGFSKSKL  1384
             R G G++ W+ L EE + I+  +P+F+ F S   S  KL
Sbjct  401   RCGNGIEEWVTLDEEELGILECDPEFLSFGSMDPSPLKL  439



>emb|CDP14000.1| unnamed protein product [Coffea canephora]
Length=447

 Score =   223 bits (569),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 141/454 (31%), Positives = 230/454 (51%), Gaps = 30/454 (7%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSL-RTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNG---V  211
             M +++   +IIKPSSPTP     TY  S++DQ S +  +P++ FY +  +S D+      
Sbjct  1     MNVKILSEEIIKPSSPTPHHHPNTYKVSLLDQFSPSSYMPFILFYKNKNNSLDHQDSAQT  60

Query  212   VDELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIR  391
             +  LK+S S+TL++ YPLAGR + D ++IECND+G  ++E  V  +L  FL+ PD + + 
Sbjct  61    LSHLKESFSKTLAIYYPLAGRFR-DAATIECNDEGGLYVEAQVNGTLPEFLKQPDVQFLN  119

Query  392   EMVPCNPFTGAFEPNPDGRV--LVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWAR  565
               +PC       E +   R+  + +++ +F CGG+ VG  + H + D A+ + F N+WAR
Sbjct  120   NFLPCK--ANGLEKD---RIPPVAVKITQFQCGGLVVGACLFHKVVDAAASAAFLNSWAR  174

Query  566   INRGCAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAID  745
             + RG  VV+       AS +FPP    +D   F R         +K  +RR+   A+A+ 
Sbjct  175   VARGEKVVEPD--FSSASALFPPKDPLSD--DFVRYFDNFFFQGKKSYMRRYVFDATALT  230

Query  746   QLREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPFP  925
              LR          PSR EAL A V + +  A+        +  ++T  +NLR R+EPP P
Sbjct  231   TLRANAASEKVPNPSRVEALSAFVAERLTWASTAAKSEIFSTLMITHPVNLRQRIEPPLP  290

Query  926   ENCLGNNTYGATVHWN---QPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTA  1096
             +N  GN  + A   +      TE       L    R+A  G+N ++         F    
Sbjct  291   DNTFGNIIWLAFAFYEIDPSNTEKKIDHADLVKILREAFAGLNKDSIAELDADEAF----  346

Query  1097  LPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQVM-----KDSVVF  1261
                ++E+++   + +N+     +S   M +Y  DFGWG P W  +   M     K   VF
Sbjct  347   -NALNEVLESVYTNENIKIFRFTSANNMGLYDVDFGWGTPSWVAHMGDMVGYRSKQQFVF  405

Query  1262  MEGRFG-GVDLWMGLPEELMNIVMKNPQFVEFVS  1360
             +E   G G++LW+   E  ++I+ K+P+F+E+ +
Sbjct  406   LEATTGKGLELWLASDEAELSILEKDPEFLEYAT  439



>ref|XP_008226170.1| PREDICTED: vinorine synthase-like [Prunus mume]
Length=454

 Score =   223 bits (568),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 138/454 (30%), Positives = 226/454 (50%), Gaps = 29/454 (6%)
 Frame = +2

Query  47    KIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSS-------RDYN  205
             K+++  R  IKPSS TP  LR++  S  DQ ++ + IP + +Y + GS+        D+ 
Sbjct  6     KVQIIERQTIKPSSATPPHLRSFKLSFFDQTAIVIYIPILLYYPNTGSTSKVRTGHHDHV  65

Query  206   GVVDE----LKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENP  373
               ++E    L +SLS+TL+  YPLAGRI E ++ +ECND G EF++  +  SLS  LE+P
Sbjct  66    VAINERCQHLIESLSKTLTHFYPLAGRIIEGKAMVECNDAGAEFVKARINCSLSEILEHP  125

Query  374   DFEMIREMVPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFAN  553
             D +M++E +   P     +    GR+L +Q+N F CGG+++GL +SH I D +++S F  
Sbjct  126   DAQMLKEFL---PIEYESKEASTGRLLRVQINCFECGGMAIGLSISHRIADASTLSTFIK  182

Query  554   TWARINRGCAVVDDGGFI---FDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFY  724
              WA I  G    D    +   F A+ +FPP+    D     +         E  + +RF 
Sbjct  183   CWATIAFGSRDSDQVLLVLPKFGAAPVFPPI----DFSNCTQPPAREVIKVENCITKRFV  238

Query  725   IPASAIDQLREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRN  904
               AS I  L+ +       +P+R EA+ A++W   + A+ +   G          +NLR 
Sbjct  239   FDASKIAALQSESTSSVVPKPTRVEAVSALIWKCAMEASSRSKLGTQRRSGFCQDVNLRK  298

Query  905   RMEPPFPENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGF  1084
             R+ PP PEN +GN     T   +   EG      L  K R+ I  + ++ A++       
Sbjct  299   RVVPPLPENLVGNVVGSFT---STAEEGTIDLKGLVAKLREGIEELKEKYAKKLVFDSNE  355

Query  1085  LHTALPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRW-AVNAQVMKDSVVF  1261
                 +      +K++   +   C   +S      Y ADFGWGKP W +V +  +K+ +V 
Sbjct  356   AWQGIKDKHSKLKNDDEMEIYSC---TSWCRFPFYEADFGWGKPSWVSVISIAIKNIIVL  412

Query  1262  ME-GRFGGVDLWMGLPEELMNIVMKNPQFVEFVS  1360
             M+ G   G++ W+ + +E M +   N + + + S
Sbjct  413   MDKGDCNGIEAWLTMSQESMALFESNVELLRYAS  446



>ref|XP_008353036.1| PREDICTED: vinorine synthase-like [Malus domestica]
Length=429

 Score =   221 bits (564),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 148/443 (33%), Positives = 228/443 (51%), Gaps = 33/443 (7%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVDEL  223
             MKIEV  R  IKPS PTP  L  + FS +DQ++ ++ +P + FY++     D     D++
Sbjct  1     MKIEVIERAYIKPSMPTPPHLCKHEFSFLDQIATHIFMPMIFFYNN-NHVNDARTYSDKV  59

Query  224   KKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREMVP  403
             K+SLS+ L+  YPLAGRI E+ + I+CNDQG  +++  V   LS  +   D   + +++P
Sbjct  60    KQSLSEILTQYYPLAGRIIEN-AFIDCNDQGAPYVQARVRSPLSDVISEADPNQLNKLLP  118

Query  404   CNPFTGAFEPNPDGR-VLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRG-  577
             C       E +  G  VL IQV+ F CGG+++G+ +SH + D  S   F N+WA I+RG 
Sbjct  119   C-------ELDKVGDLVLAIQVSMFDCGGMAIGICISHKVADALSFITFLNSWASISRGD  171

Query  578   CAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQLRE  757
             C + +    IFD + +FPP ++ +       +AR      EK V +RF   AS I  LR 
Sbjct  172   CNITNISPPIFDLATLFPP-RSISGFKPSTGIAR------EKIVTKRFVFSASTIASLRS  224

Query  758   QL--RLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPFPEN  931
             +      +  +PSR EAL A +W   IA+ Q +        VL ++ NLR RM+PP PE 
Sbjct  225   KYTDNKANEIKPSRIEALSAFIWARFIASTQGKPNPNTLYRVLHTV-NLRTRMDPPLPEY  283

Query  932   CLGNNTYGATVHWNQPT--EGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTALPI  1105
               GN +       + P+  EG  + + +  + R AI+ ++ +   +       L      
Sbjct  284   HFGNVSRFVM---SSPSFDEGEDTCYGIVSQMRQAIKTIDGDYIAKIKEGNELLEFLKQR  340

Query  1106  MSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQV-MKDSVVFME-GRFG  1279
             M E +K E +  +      +SL    +Y  DFGWGKP W  +     K+ V F++ G  G
Sbjct  341   MEEFMKGEVASFSF-----TSLCRFPLYETDFGWGKPVWVGSVSFPFKNLVSFIDAGSSG  395

Query  1280  GVDLWMGLPEELMNIVMKNPQFV  1348
             G++ W+ L EE M     + Q +
Sbjct  396   GIEAWVNLKEEDMAKFQHDEQLL  418



>gb|KDP30964.1| hypothetical protein JCGZ_11340 [Jatropha curcas]
Length=423

 Score =   221 bits (563),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 148/443 (33%), Positives = 234/443 (53%), Gaps = 29/443 (7%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVDEL  223
             M++++  ++IIKPSS  PQ+ +TYN S++DQL+  V IP + FY SP     Y  + D L
Sbjct  1     MEVQIISKEIIKPSSSAPQNRKTYNLSLLDQLAPPVYIPIILFY-SPAFENGYK-ISDHL  58

Query  224   KKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFL-ENPDFEMIREMV  400
             KKS S+TL+  YPLAGRI  D  SI+CND G  ++E  V   +S+ L + P+   + +++
Sbjct  59    KKSFSETLTHFYPLAGRIN-DEFSIDCNDDGAPYVEARVNGDMSTVLIQEPEIHKLEKLL  117

Query  401   PCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRGC  580
             PCNP   + +      +L  Q+N F CGGI++ + + HAI D ++++ F  +WA I  G 
Sbjct  118   PCNPHDLSSQ-----VILAAQINHFDCGGIAISVCIWHAIADASAMASFITSWATIASG-  171

Query  581   AVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQLREQ  760
             +  D  G IFD++ +FPP     D+  F+     + E   K VV+RF   +  I  LRE+
Sbjct  172   SNFDINGVIFDSTSLFPP----QDMRGFSLHKFLSKELLSKIVVKRFLFDSCNISALREE  227

Query  761   L-RLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPFPENCL  937
             +       RP+  EA+ A++W AV+A N++ H   I+       + LR R+ P  PE  +
Sbjct  228   VGNGPCLDRPTMVEAVAAIIWAAVMAGNEEEHVAAIS-------VGLRKRIIPLIPELSI  280

Query  938   GNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTALPIMSEI  1117
             G N +   +      E     + LA    ++I  +N+E  R+ +  G +       M + 
Sbjct  281   G-NIFQVAIANCSKNENVLDYNGLAGNLHESIERMNNEYVRKIHAGGRYFE----FMKKK  335

Query  1118  IKHEGSKKNMYCLYT-SSLLGMQVYAADFGWGKPRWAVNAQVMKDSVVFMEGRFG-GVDL  1291
              +  G   N+  ++  SS      Y ADFGWGKP W   A  +    +F++ + G G++ 
Sbjct  336   SEELGKNPNLMKVFGFSSWCRFPFYEADFGWGKPIWVGTALKLYKVAIFIDTKDGQGIEA  395

Query  1292  WMGLPEELMNIVMKNPQFVEFVS  1360
             W+ LP+E M    KNP    + S
Sbjct  396   WIALPKEEMLKFEKNPGICSYAS  418



>ref|XP_008368264.1| PREDICTED: vinorine synthase-like [Malus domestica]
Length=429

 Score =   221 bits (563),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 147/443 (33%), Positives = 228/443 (51%), Gaps = 33/443 (7%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVDEL  223
             MKIEV  R  IKPS PTP  L  + FS +DQ++ ++ +P + FY++     D     D++
Sbjct  1     MKIEVIERAYIKPSMPTPPHLCKHEFSFLDQIATHIFMPMIFFYNN-NHVNDARTYSDKV  59

Query  224   KKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREMVP  403
             K+SLS+ L+  YPLAGRI E+ + I+CNDQG  +++  V   LS  +   +   + +++P
Sbjct  60    KQSLSEILTQYYPLAGRIIEN-AFIDCNDQGAPYVQARVRSPLSDVISEABPNQLNKLLP  118

Query  404   CNPFTGAFEPNPDGR-VLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRG-  577
             C       E +  G  VL IQV+ F CGG+++G+ +SH + D  S   F N+WA I+RG 
Sbjct  119   C-------ELDKVGDLVLAIQVSMFDCGGMAIGICISHKVADALSFITFLNSWASISRGD  171

Query  578   CAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQLRE  757
             C + +    IFD + +FPP ++ +       +AR      EK V +RF   AS I  LR 
Sbjct  172   CNITNISPPIFDLATLFPP-RSISGFKPSTGIAR------EKIVTKRFVFSASTIASLRS  224

Query  758   QL--RLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPFPEN  931
             +      +  +PSR EAL A +W   IA+ Q +        VL ++ NLR RM+PP PE 
Sbjct  225   KYTDNKANEIKPSRIEALSAFIWARFIASTQGKPNPNTLYRVLHTV-NLRTRMDPPLPEY  283

Query  932   CLGNNTYGATVHWNQPT--EGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTALPI  1105
               GN +       + P+  EG  + + +  + R AI+ ++ +   +       L      
Sbjct  284   HFGNVSRFVM---SSPSFDEGEDTCYGIVSQMRQAIKTIDGDYIAKIKEGNELLEFLKQR  340

Query  1106  MSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQV-MKDSVVFME-GRFG  1279
             M E +K E +  +      +SL    +Y  DFGWGKP W  +     K+ V F++ G  G
Sbjct  341   MEEFMKGEVASFSF-----TSLCRFPLYETDFGWGKPVWVGSVSFPFKNLVSFIDAGSSG  395

Query  1280  GVDLWMGLPEELMNIVMKNPQFV  1348
             G++ W+ L EE M     + Q +
Sbjct  396   GIEAWVNLKEEDMAKFQHDEQLL  418



>ref|XP_010554168.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554169.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554170.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554172.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554173.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554174.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554175.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554176.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554177.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554178.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554179.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554180.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554181.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554182.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554183.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554184.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554185.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554186.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554187.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554188.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554189.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554190.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554191.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554192.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554193.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554194.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554195.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554196.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554198.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554199.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554200.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554201.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554202.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554203.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554204.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554205.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554206.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554207.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554208.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554209.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554210.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554211.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554212.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554213.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554214.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554215.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554216.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554217.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554218.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554219.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
Length=462

 Score =   221 bits (564),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 148/450 (33%), Positives = 228/450 (51%), Gaps = 35/450 (8%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVDEL  223
             M+++   RDII+PSSPTP  LR +  S+++QL   +  P V FY S  S       + +L
Sbjct  24    MRVDTVARDIIRPSSPTPDHLRHFKLSLLEQLGPTIFGPMVFFYSS--SRFRQAEQLQKL  81

Query  224   KKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREMVP  403
             KKSLS+TLS  YPLAGR+K +  SI+CND GV+F+E +   SLS FLE P  E +++++P
Sbjct  82    KKSLSETLSHFYPLAGRLKGN-VSIDCNDSGVDFLEAEADSSLSGFLEEPYLEGLQQLIP  140

Query  404   CNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRGCA  583
                 T    P    ++L+ Q + F CGGI++G+ +SH I D +SI +   +WA ++   +
Sbjct  141   ----TQVDSPEARTKLLLAQASFFRCGGIALGVCLSHKIADASSIGLIMKSWAAMSARGS  196

Query  584   VVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQLREQL  763
             +   G  +++ + +FPP  N +D D    V     E  +K V +RF   AS I  L+ + 
Sbjct  197   MKTVGFPVYNTANLFPP-GNFSDTDPAPVV---EPEIMKKTVSKRFVFGASDIQSLQAKS  252

Query  764   RLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPFPENCLGN  943
                   +P+R EA+ A++W   + A  +   G     V+    N+R  + PP PE  +GN
Sbjct  253   ASSEVSQPTRVEAVSALIWKCAMKAT-RTVSGTPKPSVIAHATNIRRLVSPPLPETSIGN  311

Query  944   --NTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTALPIMSEI  1117
               + + A        E       L  + R A +   D+   +  G         P   +I
Sbjct  312   LVSYFAARAE----EENQTKLQNLVFQIRKAKQNFRDKHVPKLIGN--------PEAPDI  359

Query  1118  I-KHEGSKKNM-----YCLYT-SSLLGMQVYAADFGWGKPRWAVNAQVMKDS--VVFMEG  1270
             I  H+    +M     Y  Y  SS     +Y  DFGWGKP W     V + +  V+F   
Sbjct  360   ICNHQKEAGDMIASGEYDFYIFSSACRFDLYETDFGWGKPTWVGVPSVQQKNMMVLFDTK  419

Query  1271  RFGGVDLWMGLPEELMNIVMKNPQFVEFVS  1360
               GG+++W+ L EE M +  K+ +F+EF S
Sbjct  420   EPGGIEVWVNLHEEEMELFEKDSEFIEFAS  449



>gb|KDP26742.1| hypothetical protein JCGZ_17900 [Jatropha curcas]
Length=438

 Score =   220 bits (561),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 150/447 (34%), Positives = 229/447 (51%), Gaps = 31/447 (7%)
 Frame = +2

Query  47    KIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVDELK  226
             KI V   + I+PSSPTP  L+T   S++DQ         V FY    ++     ++ +LK
Sbjct  6     KIRVINTETIRPSSPTPSDLKTLKLSLMDQFVPATYTSLVLFYSLNNNTHTNTEILQKLK  65

Query  227   KSLSQTLSL-MYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREMVP  403
              SLS+TL+   +PLAGRIK D SSIECND+G EFIE  +  SLS  LE PD E +++++P
Sbjct  66    TSLSETLTHHFFPLAGRIK-DNSSIECNDEGAEFIEARINCSLSDILEKPDTEFLKQLLP  124

Query  404   CNPFTGAFEPNPD---GRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINR  574
                   A E +P+   G +L++Q N F CGG+++G+ +SH I D A++++F N WA +  
Sbjct  125   -----AAIE-SPEAATGNLLLVQANFFDCGGLALGVCVSHKIADAATLTIFINCWAAMAS  178

Query  575   GCAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQLR  754
                 V D  F   AS +FPP+  +        VA      Q+  + +RF    S I  L+
Sbjct  179   RSNKVVDSPFFMGAS-LFPPIDISIPNASLELVA------QQNCITKRFVFTESKIAALK  231

Query  755   EQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPFPENC  934
              ++       P+R EA+  ++W AVI   + +  G     VL   +NLR+R  P  PEN 
Sbjct  232   AKVASTRVPEPTRVEAVSGLIWKAVITTVRSKL-GVSRKSVLCMAVNLRSRFVPKLPENY  290

Query  935   LGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAAR---RRYGKGGFLHTALPI  1105
              G N  G+ V    P     S    A++    IR   +E      +R  +GG L  A+  
Sbjct  291   AG-NCVGSIV----PRLDIASSVIDAVELVGKIRKEMEEFGENYVKRLQEGGSL--AICG  343

Query  1106  MSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNA-QVMKDSVVFMEGRFG-  1279
              ++        K++     SS     +Y ADFGWGKP W   A   +++  V ++ R G 
Sbjct  344   FTKQFGDMAMSKDIDFYVCSSWCKYDLYGADFGWGKPIWLCTAITTIRNVAVLVDTRDGL  403

Query  1280  GVDLWMGLPEELMNIVMKNPQFVEFVS  1360
             G+++W+ L EE M ++  N + ++F +
Sbjct  404   GIEVWLTLTEEEMALLESNQELLQFAA  430



>ref|XP_009342764.1| PREDICTED: vinorine synthase-like [Pyrus x bretschneideri]
Length=433

 Score =   220 bits (561),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 147/449 (33%), Positives = 230/449 (51%), Gaps = 41/449 (9%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVDEL  223
             MKIEV  +  IKPS PTP  LR + FS +DQ++  + +P + FY++     D     D +
Sbjct  1     MKIEVIEKACIKPSMPTPPHLRKHEFSFLDQIATPIFMPMIIFYNN-DHGNDAITYSDRV  59

Query  224   KKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREMVP  403
             K+SLS+TL+  YPLAGR+ E+ + ++CNDQG  +++  V   LS  +  P+   + +++P
Sbjct  60    KQSLSKTLTQYYPLAGRVIEN-AYVDCNDQGAPYVQARVRSPLSDVISQPEPNQLNQLLP  118

Query  404   CNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRGCA  583
             C         N    VL +QVN F CGG+++G+ +SH + D  S+ +F N+WA I+RG  
Sbjct  119   CE------LDNVGDLVLAVQVNVFDCGGMAIGVCISHKVADALSLIMFLNSWASISRGDC  172

Query  584   VVDDGGF---IFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQLR  754
              + +      IFD +  FPP ++ +       + R      EK V +RF   AS +  LR
Sbjct  173   NIKNSTVNPPIFDLATHFPP-RSISGFKPSTGITR------EKIVTKRFVFSASTVASLR  225

Query  755   EQL--RLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSIL---NLRNRMEPP  919
              +      +  +P+R EAL A +W  VIA+ Q    G+ N + L  +L   NLR RM PP
Sbjct  226   SKYTDNKNNERKPTRIEALSAFIWARVIASTQ----GKPNPNTLYKVLHAVNLRTRMHPP  281

Query  920   FPENCLGNNTYGATVHWNQPT--EGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHT  1093
              PE   GN +  A    + P+  EG      +  + R+AI+ ++ +   +       L  
Sbjct  282   LPEYHFGNVSRFAM---SSPSFDEGEDMCCGMVGQMREAIKTIDGDYIAKIKDGNAHLKF  338

Query  1094  ALPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQV-MKDSVVFME-  1267
                   E +K E +  +      +SL    +Y  DFGW KP W  +A +  K+ VVFM+ 
Sbjct  339   LKQRAEEFMKGEVASFSF-----TSLCRFPLYETDFGWSKPVWVASASLTFKNLVVFMDA  393

Query  1268  --GRFGGVDLWMGLPEELMNIVMKNPQFV  1348
               G  GG+++W+ L EE M     + Q +
Sbjct  394   GPGSSGGIEVWVNLKEEDMAKFQDDEQLL  422



>ref|XP_002267341.1| PREDICTED: vinorine synthase [Vitis vinifera]
 emb|CBI27536.3| unnamed protein product [Vitis vinifera]
Length=431

 Score =   220 bits (560),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 151/460 (33%), Positives = 224/460 (49%), Gaps = 55/460 (12%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSR-DYNGVVDE  220
             +++EV   D IKPSSPTP  LR +  S +DQ+   + IP + FY   G  + D       
Sbjct  4     IEVEVISTDTIKPSSPTPAHLRHFQLSFLDQVLSPIFIPIILFYPMDGDVKVDTIERSIW  63

Query  221   LKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREMV  400
             LKK+LS TL   YPLAGR+K D   I+C DQGV + E  V   LS F+ NPD   + + V
Sbjct  64    LKKTLSMTLVQFYPLAGRVK-DNLFIDCTDQGVPYFEAQVKCQLSEFICNPDPMQLSKFV  122

Query  401   PCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRGC  580
             P      A +   D  VL IQVN F CGGI++G+ +SH + D +S+  F N WA + R  
Sbjct  123   P-----HALDDIVD-IVLAIQVNIFKCGGIAIGVCISHKVADASSVVTFVNGWAAVAR--  174

Query  581   AVVDDGGFI---FDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQL  751
                 D   +   F  + +FPP+         +        ++EK + +RF   AS++  L
Sbjct  175   ---RDTHMVCPQFGLANLFPPI-------NLSGFNPSTGMTKEKILTKRFVFSASSVAAL  224

Query  752   REQLRLISHY-----RPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEP  916
             RE+    S       RP+R EAL A++W   +A        +  ++ +   +NLR RM+P
Sbjct  225   REKYADQSTTEDLPRRPTRIEALSALIWSRFVAVTHGMADPK-KIYTILHAVNLRTRMDP  283

Query  917   PFPENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTA  1096
             P PEN  GN  + A             RHAL  + R+AI  ++ +  ++           
Sbjct  284   PLPENSFGNIIWFAITRPCIDGMKEGKRHALVNQMREAIEKIDGDYIKK-----------  332

Query  1097  LPIMSEIIKHEG---------SKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQV-MK  1246
                + E IKH           +K  +     +S     VY ADFGWGKP+W  +  +  K
Sbjct  333   ---LPEGIKHLNFLKERAERVTKGEIESFRFTSFCRFPVYEADFGWGKPKWVGSGSLPFK  389

Query  1247  DSVVFME--GRFGGVDLWMGLPEELMNIVMKNPQFVEFVS  1360
             + V+F++  G  GG++ W+ L EE M+    + + + FVS
Sbjct  390   NLVIFIDSSGTNGGIEAWINLVEEDMDKFQGDEELLSFVS  429



>ref|XP_006427936.1| hypothetical protein CICLE_v10027290mg [Citrus clementina]
 gb|ESR41176.1| hypothetical protein CICLE_v10027290mg [Citrus clementina]
Length=439

 Score =   220 bits (560),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 141/450 (31%), Positives = 238/450 (53%), Gaps = 34/450 (8%)
 Frame = +2

Query  50    IEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVDELKK  229
             +++   + IKPSSPTP+ LRTY  S++DQ+  N+ +P+V FY S    +D+    D LK+
Sbjct  4     VQIISTEAIKPSSPTPKHLRTYELSMLDQMFSNLYMPFVFFY-SANKHQDFRKNSDFLKQ  62

Query  230   SLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREMVPCN  409
             SL++TL+  YPLAGR   D  S+ECND GV FIE  V   +S FL+ P+  ++++++P +
Sbjct  63    SLAKTLTHYYPLAGRFV-DSFSVECNDHGVTFIEAQVGCDMSKFLQPPNMGVMQQLIPPS  121

Query  410   PFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRGCAVV  589
             P +   E + +  +L +QVN FS G +++G+ + H + DG++IS F   WA INRG    
Sbjct  122   PQSLRLEAS-ERALLAVQVNYFSTGDVAIGICIWHGLADGSAISNFMKLWAEINRGVNEN  180

Query  590   DDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQLREQLR-  766
                  + D + +FPP  +++  DQ  +      +   K V +R +     I  L+E++  
Sbjct  181   ICNNVVLDCTSLFPP--HSSLKDQHIK-----PQLTSKVVFKRLFFDGKKIVALKEKVNK  233

Query  767   --LISHY----RPSRAEALIAVVWDAVIAANQKRHKG---RINLHVLTSILNLRNRMEPP  919
               ++  +    + SR   + +++W A IA  Q+R +    ++  H +   +NLR++M PP
Sbjct  234   EIMVGSFDHELQASRFMVVSSLIWGAFIAVAQERKRAINNKLYSHAMYYTMNLRSKMNPP  293

Query  920   FPENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTAL  1099
                 C+GN        W    + +    +L  K   A R V++      Y   GF+    
Sbjct  294   MIPQCMGNIFRFVRAEWPLVGDDDIEATSLVKKVIKAKRNVSNVMNNIEY--LGFMKD--  349

Query  1100  PIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRW-AVNAQVMKDSVVFMEGRF  1276
               M+E  +   S      L  +S++G++ Y ADFGWGKP W ++ +  + ++ +  +   
Sbjct  350   --MNEAWEDSRS------LTLTSVVGLRYYEADFGWGKPVWLSIGSVSLPNAALLSDTSD  401

Query  1277  G-GVDLWMGLPEELMNIVMKNPQFVEFVSA  1363
             G GV+ W+ L EE M+   KNP  +   S+
Sbjct  402   GKGVEAWVVLYEEDMDKFEKNPSIMAHASS  431



>ref|XP_010050993.1| PREDICTED: vinorine synthase-like [Eucalyptus grandis]
 gb|KCW81029.1| hypothetical protein EUGRSUZ_C02403 [Eucalyptus grandis]
Length=439

 Score =   219 bits (558),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 148/453 (33%), Positives = 229/453 (51%), Gaps = 29/453 (6%)
 Frame = +2

Query  38    ITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGS--SRDYNGV  211
             +  KIEV   + IKPSSPTP  LR +NF ++DQL+    +P V FY +P    + D   V
Sbjct  1     MATKIEVVSTETIKPSSPTPPYLRNFNFCLLDQLAPPFYVPVVLFYSAPDQKVAPDSALV  60

Query  212   VDELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIR  391
                LK SL+Q LSL YPL GR+K + +  +CND+G  ++E      LS  L NPD + ++
Sbjct  61    SGNLKTSLAQALSLFYPLGGRVKGN-AGFDCNDEGALYMEAKARFELSKVLPNPDMDQLQ  119

Query  392   EMVPCNPFTGAFEPNPDGRVLV-IQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARI  568
             + +P +P       N D +V+V +Q N F CGG+ +G+ +SH I DGAS+S F N W++I
Sbjct  120   QFLPFSPCR--VSTNIDEQVIVGVQANFFDCGGMGIGICISHKIADGASVSAFLNAWSKI  177

Query  569   NRGCAVVDDGGFIFDASKIFPPVKNTADLDQFARV---ARGAAESQEKYVVRRFYIPASA  739
                     + G   +AS I P +K  ++L Q   +         S+EK   +RF     +
Sbjct  178   A-------NSGVNGEASLITPFLK-ASELFQRKDINYQLPSGVISREKLSTKRFCFNGES  229

Query  740   IDQLREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSIL---NLRNRM  910
             + +LR          P+R EA+ A++W + +AA +KR + +      ++++   N+R+R+
Sbjct  230   LARLRAGF---GGANPTRVEAVTALIWKSAVAAARKRPEWKEKYPPSSAVMHAVNIRSRI  286

Query  911   EP-PFPENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFL  1087
              P P PE  LGN          +P +G+      A   R++IR ++ E      G+ G  
Sbjct  287   RPQPLPETTLGNLVQAVVAPLMEPNKGD-ELQDFAGILRNSIRAIDSEYLSALQGENGLA  345

Query  1088  HTALPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQV-MKDSVVFM  1264
                  +M+       S   +Y    SS      Y ADFGWG+P W     V +K+ V+ M
Sbjct  346   KACENLMATRKLAASSAIELYRF--SSWARFPFYDADFGWGRPAWVCTTSVPIKNLVILM  403

Query  1265  EGRFG-GVDLWMGLPEELMNIVMKNPQFVEFVS  1360
               R G G++ W+ L E  M     N + ++F S
Sbjct  404   GTRCGDGIEAWITLAEHDMIEFEHNDELLQFFS  436



>ref|XP_007018004.1| Anthranilate N-benzoyltransferase protein, putative [Theobroma 
cacao]
 gb|EOY15229.1| Anthranilate N-benzoyltransferase protein, putative [Theobroma 
cacao]
Length=439

 Score =   218 bits (555),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 148/444 (33%), Positives = 222/444 (50%), Gaps = 33/444 (7%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVDE-  220
             M++E+  ++ IKPS PTP  LRTY  S++DQL  +  +P + FY       +   VV E 
Sbjct  1     MEVEIMSKESIKPSCPTPHHLRTYKLSLLDQLMQSAHVPMILFYRPINCDSNNMSVVGER  60

Query  221   ---LKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIR  391
                LK+SLS+TL+  YP AGRIK D   I+CN+ GV++ E  ++ SLS  L  PD +MIR
Sbjct  61    LERLKQSLSETLTSFYPFAGRIK-DGLYIDCNNSGVQYFEAKISCSLSEILSKPDSQMIR  119

Query  392   EMVPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARIN  571
             +++P N  +    PN    V +IQVN   CGGI++G   SH I DG + + F   WA   
Sbjct  120   QLLPSN-LSRLETPNAGIPVAMIQVNILKCGGIAIGTQTSHKIIDGPTSTTFLKAWAASA  178

Query  572   RGCAVVDDGGFI----FDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASA  739
             RG        FI    F  + + P     A      +          K V RRF   AS 
Sbjct  179   RGSGEAPRPSFIAPLLFPQNSLLPSDTMLAIWPSLLKFG--------KCVTRRFVFDASG  230

Query  740   IDQLREQLRLISHYR-PSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEP  916
             I  L+ +    S  R P+  E++ A +W  V AA++ R+ G +   VL+ I+NLR +   
Sbjct  231   IATLKAKASSSSFVRNPTLVESVSAFIWICVTAASRIRY-GSLRPSVLSHIVNLRGKTAT  289

Query  917   PFPENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGF--LH  1090
               PE+ +GN  + AT   +     N    +L    R +I   + E   +  G+ GF  + 
Sbjct  290   SLPEHSIGNLLWMATAQCH--AVANLELQSLGALLRKSIMETSGEFVDQLQGEKGFQKVP  347

Query  1091  TALPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRW----AVNAQVMKDSVV  1258
               L  + E+  + G+    +    SS+  + +Y ADFGWGKP W     ++  V ++ V 
Sbjct  348   ECLTELGEVHSNGGADYFAF----SSMCKVGIYEADFGWGKPMWVSPGGIDGLVFQNLVF  403

Query  1259  FMEGRFG-GVDLWMGLPEELMNIV  1327
              +E R G G++ W+ L E+ M I+
Sbjct  404   LIETRNGDGIEAWVTLDEQDMAIL  427



>ref|XP_011037141.1| PREDICTED: vinorine synthase-like [Populus euphratica]
Length=430

 Score =   218 bits (554),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 144/435 (33%), Positives = 228/435 (52%), Gaps = 28/435 (6%)
 Frame = +2

Query  77    KPSSPTPQSLRTYNFSIVDQLSV-NVKIPYVRFYDSPGSSRDYNGVVDELKKSLSQTLSL  253
             KPS+PTP+ L+TY  S VDQL+     IP + FY         N   D LKKS ++TL+L
Sbjct  12    KPSAPTPRHLKTYKLSAVDQLAAFAADIPVILFYSPADEISSKNS--DYLKKSFAKTLTL  69

Query  254   MYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREMVPCNPFTGAFEP  433
              YP AGRIK D SSI+CND G  +IE  VA ++S  L+ PD + + ++  C P     E 
Sbjct  70    FYPFAGRIK-DASSIDCNDDGATYIEAHVAGNMSMILQQPDMDQLEQLQSCKPDENIDEL  128

Query  434   NPDGRV-LVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRGCAVVDDGG-FI  607
             +  G+V L  QVN F CGGI++ + + H IGD +S++ F   WA I+  C + D+    +
Sbjct  129   S--GKVMLAAQVNYFDCGGIAISVRIRHRIGDASSLASFVKCWAAIS--CGIYDNNAETV  184

Query  608   FDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQLREQLRLISHY-R  784
              D S +FPP     D    + +      S      +RF      +  LR +L    +  R
Sbjct  185   VDCSSLFPP----QDFLGMSFLYNLIPRSSLNISTKRFVFEGPKLAALRGKLCNGPYLNR  240

Query  785   PSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPFPENCLGNNTYGATV  964
             P+R EA+ A++W  V    +     ++N  + T  ++LR RM+PP P++C+GN  + A  
Sbjct  241   PTRFEAVSALIWGVV---GEDSESKKVN-KLATIAVDLRKRMDPPLPQHCIGNIVHLAEA  296

Query  965   HW-NQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTALPIMSEIIKHEGSKK  1141
             +W N+  + N     LA K  ++I  +N +  R+ Y  G F  +    M+E+ +   + +
Sbjct  297   NWENKVVDYN----GLAGKIHESISMINSDYVRQVYADGTFFSSMRQRMAEMAEDPNNFR  352

Query  1142  NMYCLYTSSLLGMQVYAADFGWGKPRW-AVNAQVMKDSVVFMEGRFG-GVDLWMGLPEEL  1315
             ++  +  SS    + Y  DFGWGKP W   + ++  + V+ ++ R G G+++ + LP E 
Sbjct  353   SV--IGFSSWCKFRFYEVDFGWGKPIWVGTSLRLSPNWVMLLDTRDGEGMEVRIALPNEE  410

Query  1316  MNIVMKNPQFVEFVS  1360
             M    +NP  + + S
Sbjct  411   MVKFEQNPDILAYAS  425



>ref|XP_002511241.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
 gb|EEF51843.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
Length=435

 Score =   218 bits (554),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 137/444 (31%), Positives = 233/444 (52%), Gaps = 19/444 (4%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVDEL  223
             M++E+  ++ +KP S TP+  RTY  S++DQL+  V IP V FY + G +     + D L
Sbjct  1     MEVEIISKETVKPCSSTPEHQRTYKLSLLDQLAPPVYIPIVLFYSTTGENSS-QKLSDHL  59

Query  224   KKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREMVP  403
             K S S  L+  YPLAGR+K D  SI+CND+G  ++E +VA  +S  L+ P+   +++++P
Sbjct  60    KTSFSGVLTHFYPLAGRMK-DGFSIDCNDEGAPYVEANVAGDMSIVLQEPEIHQLQKLLP  118

Query  404   CNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRGCA  583
             CNP+  + + +    +L  QVN F CGG+++ + + HAI D ++ + F  +WA +   C 
Sbjct  119   CNPYDISSDISSQ-VILAAQVNHFDCGGMAISICIWHAIADASAAASFITSWAAM--ACG  175

Query  584   VVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQLREQL  763
               D  G   D + +FPP     D+  F+       E     +V+RF   +  +  L+E++
Sbjct  176   ASDFQGVNVDCTSLFPP----QDMRSFSLRNFVKEELSSNILVKRFLFDSLKLAALKEKV  231

Query  764   RLISHYR-PSRAEALIAVVWDAVIAA--NQKRHKGRINLHVLTSILNLRNRMEPPFPENC  934
                     P+R EA+ A++W AV+AA   ++  +    ++V T  + LR R+ PP P+  
Sbjct  232   GSGPCLDCPTRVEAVAALIWGAVMAASTEEEEDESTREINVATISVGLRKRLIPPLPQLS  291

Query  935   LGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTALPIMSE  1114
             +G N Y   +      E     + LA K  ++I  +++   R+ +  GG+ H     + +
Sbjct  292   IG-NIYQVALANCSKNENMLDYNGLAGKLHESIGKMDNNFVRKIHAGGGYFH----FLKK  346

Query  1115  IIKHEGSKKNMYCLYT-SSLLGMQVYAADFGWGKPRWAVNAQVMKDSVVFMEGRFG-GVD  1288
               +  G + N+  ++  SS      Y ADFGWGKP W   A  +    +F++ + G G++
Sbjct  347   KAEELGRRPNLTRVFGFSSWCRFPFYEADFGWGKPTWVGTAMKLYKVAIFIDSKDGQGIE  406

Query  1289  LWMGLPEELMNIVMKNPQFVEFVS  1360
              W+ LP+E M    +NP    + S
Sbjct  407   AWVSLPKEDMAKFEQNPDICAYAS  430



>ref|XP_010048659.1| PREDICTED: vinorine synthase-like [Eucalyptus grandis]
Length=442

 Score =   218 bits (554),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 149/458 (33%), Positives = 227/458 (50%), Gaps = 38/458 (8%)
 Frame = +2

Query  38    ITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNG--V  211
             +TMK+EV   + +KPSSPTP  LR +   ++DQL+    +P + FY +  +    N   V
Sbjct  1     MTMKVEVVSTETVKPSSPTPSHLRDFKICLLDQLAPPFWVPVILFYSASNNEVAANSASV  60

Query  212   VDELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIR  391
                LK SLSQ LSL YPL GRIK + S+I+CNDQG  ++E      LS  L NPD   ++
Sbjct  61    TGNLKTSLSQALSLFYPLGGRIKGN-SAIDCNDQGALYLEAKARFELSEVLLNPDINQLQ  119

Query  392   EMVPCNPFTGAFEPNPDGRVLV-IQVNRFSCGGISVGLIMSHAIGDGASISVFANTWAR-  565
             + +P +  +    PN + +V+V +Q N F CGGI +G+ MSH I D AS+S F   W++ 
Sbjct  120   QFLPFS--SDKVVPNIEEQVIVGVQANFFDCGGIGIGICMSHKIADAASVSAFLTAWSKI  177

Query  566   ----INRGCAVVDDGGFIFDASKIFPPVKNTADLD-QFARVARGAAESQEKYVVRRFYIP  730
                 IN    V+        AS++FPP     D++ Q  R       S+EK   +RF   
Sbjct  178   ALNGINGKAKVITP---FLKASELFPP----KDVNFQMPR----RFTSREKLFTKRFRFD  226

Query  731   ASAIDQLREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHK--GRINLHVLTSILNLRN  904
               ++ +LR +        P+R EA+ A++W + + A +KR +   +    V T ++N+R+
Sbjct  227   GESLARLRARF---GSATPTRVEAVTALIWKSAVEAARKRPEWNEKYPSSVATHVVNIRS  283

Query  905   RMEP-PFPENCLGN---NTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYG  1072
             RM P P PE+ LGN    T    +  N+  E        A   R +IR ++DE      G
Sbjct  284   RMRPQPLPEHALGNLWQTTIAPLIDTNKGVE----LQDFAGSLRKSIRAIDDEYLSVLQG  339

Query  1073  KGGFLHTALPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQVMKDS  1252
             + G       + +     E S   M     SS +    Y  D G G+P W         +
Sbjct  340   ERGLTKAYESLTAARKLAESSAGKMESYGFSSWVKFPFYEVDLGLGRPTWVCTTGFPIGN  399

Query  1253  VVFMEGRF--GGVDLWMGLPEELMNIVMKNPQFVEFVS  1360
             +VF+ G     G++ W+ LPE  M    +N + ++F+S
Sbjct  400   MVFLMGTRCEDGIEAWITLPEHDMIEFERNDELLQFIS  437



>ref|XP_009780612.1| PREDICTED: vinorine synthase-like [Nicotiana sylvestris]
Length=418

 Score =   217 bits (552),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 143/427 (33%), Positives = 210/427 (49%), Gaps = 25/427 (6%)
 Frame = +2

Query  47    KIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVDELK  226
             K+E+  +++IKPSSPT  +L+T+  S++DQ+S  V IP + FY     + + +  +  LK
Sbjct  4     KVEIISKEMIKPSSPTTCTLKTHKLSLLDQISPPVFIPLIFFYQDELGNINRSRNIQILK  63

Query  227   KSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREMVPC  406
             KSLS  L+  YPLAGR   D + I+CND G EFIE  V   LS  +E P  E +RE +P 
Sbjct  64    KSLSDALTRFYPLAGRFN-DNNFIDCNDAGAEFIEAQVHGYLSQVIETPKTEEVREFLP-  121

Query  407   NPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRGCAV  586
                  A E   +  +L +QVN F+CGGI++G+ MSH +GDG+SI  F N WA I RG   
Sbjct  122   ---REASEVENNDVLLAVQVNIFNCGGIAIGVCMSHKVGDGSSIVTFINAWAAIARG---  175

Query  587   VDDGGFI---FDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQLRE  757
              +  G     F+ S IFPP+    DL + +          +K++ RRF      +D +++
Sbjct  176   -NHTGIAQPNFNMSSIFPPL----DLSK-SSFKPSIGIKNDKFLSRRFVFNKEKLDAIKK  229

Query  758   QLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPFPENCL  937
                      P+R EAL A +W  ++  + K +K    +     ++N+R+RM P   +N  
Sbjct  230   SASGSQVKDPTRVEALSAFLWKNLMKVS-KLNKDSTKMFAAVHVVNIRSRMNPTLSDNSF  288

Query  938   GNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTALPIMSEI  1117
             GN    A    +  +E       L    R AIR +N +          FL          
Sbjct  289   GNLWTTAPAFLSPKSEEIFGIDDLLYHLRSAIRKINSDYTEILQNGEEFLKHISKFAELF  348

Query  1118  IKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQV-MKDSVVFMEGRFG-GVDL  1291
              K E    N      SS     VY  DFGWGKP W        K+ V+FM  + G G++ 
Sbjct  349   SKEEVEFYNF-----SSWCRFPVYEVDFGWGKPVWVCTTTFPFKNVVIFMGTKCGEGIET  403

Query  1292  WMGLPEE  1312
             W+ + E+
Sbjct  404   WVNMLED  410



>ref|XP_010044504.1| PREDICTED: vinorine synthase-like [Eucalyptus grandis]
 gb|KCW86593.1| hypothetical protein EUGRSUZ_B03225 [Eucalyptus grandis]
Length=441

 Score =   217 bits (552),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 151/463 (33%), Positives = 232/463 (50%), Gaps = 52/463 (11%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVDE-  220
             +++EV  RD IKPSSPT   LR Y  S +DQ+ V V +P V F+      RD   ++DE 
Sbjct  6     VEVEVVSRDTIKPSSPTLDHLRHYKLSFLDQIQVPVFMPLVLFF-----PRDDGMLLDEK  60

Query  221   ---LKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIR  391
                +K+SL++ L+  YPLAGR++ D   ++CND+G  ++E  V   LS  LENP+  ++ 
Sbjct  61    LSRIKQSLAKALAKFYPLAGRVR-DNLYVDCNDEGALYVEARVRCKLSDILENPEPRVMN  119

Query  392   EMVPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARIN  571
               +PC         N     + +QVN F CGG+++ L++SH + D  S   F N WA   
Sbjct  120   RFLPCE------LDNVQDLPVAVQVNFFECGGLALSLLISHKVADALSFFTFLNAWASAA  173

Query  572   RGCAVVDDGGFI---FDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAI  742
             RG     D G I   F +S++FPP+    DL  F + + G    ++    RRF   A+ I
Sbjct  174   RG-----DPGIIDPCFSSSELFPPI----DLSGF-QTSTGIV--KDNISTRRFIFDAATI  221

Query  743   DQLREQLRLISHY---------RPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILN  895
               LRE+   +            RP+R EAL + +W   +A+ Q        ++ +   +N
Sbjct  222   ASLREKFTDLKKVADVADHPRRRPTRVEALSSFLWSRYMASTQPIEARGDKIYTVLHAVN  281

Query  896   LRNRMEPPFPENCLGNNTYGATV--HWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRY  1069
             LR R EPP  E   GN +  A      +  T+G    + +  + RDAI+ VN E  R+  
Sbjct  282   LRTRTEPPISERHFGNISRLAIAVPTVDASTDGG---YKIVDQVRDAIKQVNAEYVRKLQ  338

Query  1070  GKGGFLHTALPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQV-MK  1246
                G L++     S I     S+  +     +SL    +Y ADFGWGKP W  +A +  K
Sbjct  339   EGQGHLNSLKERSSRI-----SRGEVVSFSFTSLCRFPMYEADFGWGKPAWVGSASLTFK  393

Query  1247  DSVVFMEGRFG-GVDLWMGLPEELMNIVMKNPQFVEFVSAGFS  1372
             + +VFM+ + G G++ W+ L E+ M    ++ + +  VS   S
Sbjct  394   NLIVFMDTKSGDGIEAWVNLKEDDMAKFEQDKELLALVSPSVS  436



>ref|XP_009773462.1| PREDICTED: vinorine synthase-like [Nicotiana sylvestris]
Length=418

 Score =   216 bits (550),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 143/427 (33%), Positives = 209/427 (49%), Gaps = 25/427 (6%)
 Frame = +2

Query  47    KIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVDELK  226
             K+E+  +++IKPSSPT  +L+T+  S++DQ+S  V IP + FY     + + +  +  LK
Sbjct  4     KVEIISKEMIKPSSPTTCTLKTHKLSLLDQISPPVFIPLIFFYQDELGNINRSRNIQILK  63

Query  227   KSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREMVPC  406
             KSLS  L+  YPLAGR   D + I+CND G EFIE  V   LS  +E P  E +RE +P 
Sbjct  64    KSLSDALTRFYPLAGRFN-DNNFIDCNDAGAEFIEAQVHGYLSQVIETPKTEEVREFLP-  121

Query  407   NPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRGCAV  586
                  A E   +  +L +QVN F+CGGI++G+ MSH +GDG+SI  F N WA I RG   
Sbjct  122   ---REACEVENNDVLLAVQVNIFNCGGIAIGVCMSHKVGDGSSIVTFINAWAAIARG---  175

Query  587   VDDGGFI---FDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQLRE  757
              +  G     F  S IFPP+    DL + +          +K++ RRF      +D +++
Sbjct  176   -NHTGIAQPNFHLSSIFPPL----DLSK-SSFKPSIGIKNDKFLSRRFVFNKEKLDAIKK  229

Query  758   QLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPFPENCL  937
                      P+R EAL A +W  ++  + K +K    +     ++N+R+RM P   +N  
Sbjct  230   SASGSQVKDPTRVEALSAFLWKNLMKVS-KLNKDSTKMFAAVHVVNIRSRMNPTLSDNSF  288

Query  938   GNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTALPIMSEI  1117
             GN    A    +  +E       L    R AIR +N +          FL          
Sbjct  289   GNLWTTAPAFLSPKSEEIFGIDDLLYHLRSAIRKINSDYTEILQNGEEFLKHISKFAELF  348

Query  1118  IKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQV-MKDSVVFMEGRFG-GVDL  1291
              K E    N      SS     VY  DFGWGKP W        K+ V+FM  + G G++ 
Sbjct  349   SKEEVEFYNF-----SSWCRFPVYEVDFGWGKPVWVCTTTFPFKNVVIFMGTKCGEGIET  403

Query  1292  WMGLPEE  1312
             W+ + E+
Sbjct  404   WVNMLED  410



>ref|XP_011041297.1| PREDICTED: vinorine synthase-like [Populus euphratica]
Length=430

 Score =   216 bits (550),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 143/435 (33%), Positives = 228/435 (52%), Gaps = 28/435 (6%)
 Frame = +2

Query  77    KPSSPTPQSLRTYNFSIVDQLSV-NVKIPYVRFYDSPGSSRDYNGVVDELKKSLSQTLSL  253
             KPS+PTP+ L+TY  S VDQL+     IP + FY         N   D LKKS ++TL+L
Sbjct  12    KPSAPTPRHLKTYKLSAVDQLAAFAADIPVILFYSPADEISSKNS--DYLKKSFAKTLTL  69

Query  254   MYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREMVPCNPFTGAFEP  433
              YP AGRIK+D SSI+CND G  +IE  VA ++S  L+ PD + + ++  C P     E 
Sbjct  70    FYPFAGRIKDD-SSIDCNDDGASYIEAHVAGNMSMILQQPDMDKLEQLQSCKPDENIDEL  128

Query  434   NPDGRV-LVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRGCAVVDDGG-FI  607
             +  G+V L  QVN F CGGI++ + + H IGD +S++ F   WA I+  C + D+    +
Sbjct  129   S--GKVMLAAQVNYFDCGGIAISVRIRHRIGDASSLASFVKCWAAIS--CGIYDNNAETV  184

Query  608   FDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQLREQLRLISHY-R  784
              D S +FPP     D    + +      S      +RF      +  LR +L    +  R
Sbjct  185   VDCSSLFPP----QDFLGMSFLYNLIPRSSLNISTKRFVFEGPKLAALRGKLCNGPYLNR  240

Query  785   PSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPFPENCLGNNTYGATV  964
             P+R EA+ A++W  V    +     ++N  + T  ++LR  M+PP P++C+GN  + A  
Sbjct  241   PTRFEAVSALIWGVV---GEDSESKKVN-KLATIAVDLRKIMDPPLPQHCIGNIVHLAVA  296

Query  965   HW-NQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTALPIMSEIIKHEGSKK  1141
             +W N+  + N     LA K  ++I  +N +  R+ Y  G F  +    M+E+ +   + +
Sbjct  297   NWENKVVDCN----GLAGKIHESISMINSDYVRQVYADGTFFSSMRQRMAEMAEDPNNFR  352

Query  1142  NMYCLYTSSLLGMQVYAADFGWGKPRW-AVNAQVMKDSVVFMEGRFG-GVDLWMGLPEEL  1315
             ++  +  SS    + Y  DFGWGKP W   + ++  + V+ ++ R G G+++ + LP E 
Sbjct  353   SV--IGFSSWCKFRFYEVDFGWGKPIWVGTSLRLSPNWVMLLDTRDGEGMEVRIALPNEE  410

Query  1316  MNIVMKNPQFVEFVS  1360
             M    +NP  + + S
Sbjct  411   MVKFEQNPDILAYAS  425



>ref|XP_006429944.1| hypothetical protein CICLE_v10011699mg [Citrus clementina]
 gb|ESR43184.1| hypothetical protein CICLE_v10011699mg [Citrus clementina]
Length=453

 Score =   217 bits (552),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 147/454 (32%), Positives = 220/454 (48%), Gaps = 29/454 (6%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVDEL  223
             M+I +  R++++PSS     L+ +  S++DQL+     P V FY    +      +  +L
Sbjct  1     MEIGIVSREVVRPSSLNVHLLKPFRISLLDQLTPTTFAPLVLFYPMKSTHLKGTQISTQL  60

Query  224   KKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREMVP  403
             K+SLS+TL   YPLAGR++ D   I   D+GV +IE  V   L  FL+NP  E++ + +P
Sbjct  61    KESLSKTLEHFYPLAGRVR-DNLIINDYDEGVPYIETRVNTHLFEFLQNPPMELLNQCLP  119

Query  404   CNPFTGAFEPNPDGRV--LVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRG  577
               PF   ++PNPD RV  + +Q+N F CGGI++GL  SH I DGA+ S F  +WA  +RG
Sbjct  120   YPPFR--YQPNPD-RVPQVAVQLNTFDCGGIALGLSFSHKINDGATTSAFLRSWAANSRG  176

Query  578   -CAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQLR  754
              C        + +AS IFPP       +    V       + KY  RRF   A AI  LR
Sbjct  177   ACHKAVKYKNLSEASMIFPP--QNPSPNHHLSVMEKIWFREAKYKTRRFVFDAKAIATLR  234

Query  755   EQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPFPENC  934
              + +      P+R EAL A +  + + A++     R  LH     +NLR   EP      
Sbjct  235   SECKGERVPNPTRIEALSAFILKSAMLASRSTASSRFVLH---QAVNLRRLTEPRLSPCS  291

Query  935   LGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTALPIMSE  1114
             +GN    AT  +N         H L  + + A+  +N E  +  +G  GF     P + E
Sbjct  292   VGNLFLWATAAYNMEHAAEMELHGLVARMKQAVGKINSEYLKTLHGDEGF-----PKVCE  346

Query  1115  IIK---HEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWA-----VNAQVMKDSVVFMEG  1270
              IK      + KN+     SS +       DFGWG P W+     V +   ++   F E 
Sbjct  347   YIKRIEEVSAHKNLEAFTFSSWVKFGFNEVDFGWGNPIWSGIFGEVGSNSFRNLTFFKET  406

Query  1271  RFG----GVDLWMGLPEELMNIVMKNPQFVEFVS  1360
             R       V+ W+ L E++M+++  +PQF+ F S
Sbjct  407   RSANYDNAVEAWVTLDEKIMSLLEHDPQFLAFAS  440



>ref|XP_002511244.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
 gb|EEF51846.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
Length=445

 Score =   216 bits (549),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 150/455 (33%), Positives = 234/455 (51%), Gaps = 36/455 (8%)
 Frame = +2

Query  41    TMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGV--V  214
             ++ + V  R+ IKPSSPTPQ+L+ +  S++DQLS    +P + +Y S     +      +
Sbjct  3     SVNVLVTSRETIKPSSPTPQTLKCFKLSLLDQLSPAAYVPMIIYYASNSELDEVKNQERL  62

Query  215   DELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIRE  394
             D LKKSLS+TL+  YPLAGR+KE+   IECNDQGV+F E  V   LS  L  P+ +++ +
Sbjct  63    DLLKKSLSRTLTQFYPLAGRVKENLF-IECNDQGVDFFEARVNCPLSEILRRPEADVLNQ  121

Query  395   MVPCN---PFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWAR  565
              +P     P   + E       + IQVN F+CGGI++G  +SH + DG + + F N WA 
Sbjct  122   FLPHEYHVPAASSMEFQ-----VAIQVNTFTCGGIAIGTSISHKLVDGITFTCFMNNWAS  176

Query  566   INRGCAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAID  745
             I RG    +    +F     FPP K+ + L     +       Q K + +RF    S + 
Sbjct  177   IARGSD--EHSPPVFVGPHFFPP-KDLSGLFPVLDIP------QAKNITKRFLFDLSKVA  227

Query  746   QLREQLRLISHYR-PSRAEALIAVVWD-AVIAANQKRHKGRINL--HVLTSILNLRNRME  913
              LRE++   S    PSR E + A++W  A+ A+++ +     N     LT  +NLR RM 
Sbjct  228   SLRERVFGGSGSNAPSRVEIVSALIWKYAMDASSRAKPSSGCNKSPSFLTQTVNLRARMN  287

Query  914   PPFPENCLGNNTYGATVHWNQPTEGNP-SRHALALKFRDAIRGVNDEAARRRYGKGGFLH  1090
             PP P++  GN  +   +    P++      H L  + +++ +  N E  ++  G+ G L 
Sbjct  288   PPLPDSAAGNFIW--LIIAPAPSDFKKIELHELVYQVQNSFKNFNSEFVKKIQGEAGLL-  344

Query  1091  TALPIMSEIIKHEGS--KKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQV-MKDSVVF  1261
                 ++ E +   G    +N+     +SL   Q+Y ADFGWG P W  +A +  K+ VV 
Sbjct  345   ----VLGETLDQIGELVSRNVDIYRFTSLRKFQLYEADFGWGVPAWVSSAGLAFKNVVVL  400

Query  1262  MEGRFGG-VDLWMGLPEELMNIVMKNPQFVEFVSA  1363
             +E R    ++ W+ L EE+M I   N + + F S 
Sbjct  401   IETRDADRIEAWITLEEEVMAIFEHNQELLSFDST  435



>ref|XP_002300646.2| hypothetical protein POPTR_0002s01180g, partial [Populus trichocarpa]
 gb|EEE79919.2| hypothetical protein POPTR_0002s01180g, partial [Populus trichocarpa]
Length=451

 Score =   215 bits (547),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 150/452 (33%), Positives = 230/452 (51%), Gaps = 31/452 (7%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFY----DSPGSSRDYNGV  211
             M++++  +  ++PSSPTP  LR +  S++DQL      P + +Y    +S  S+ D    
Sbjct  1     MEVQIISKQNVRPSSPTPPHLRNFKLSLLDQLIPVPYAPLLLYYPMNDNSGASNLDVPKR  60

Query  212   VDELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIR  391
             +  LKKSLS+TL+  YPLAG+IK D  SI+CND+G  ++E  V   LS FL  PD  ++ 
Sbjct  61    LGVLKKSLSETLTHFYPLAGKIK-DELSIDCNDEGAYYVEAQVNCHLSEFLRQPDLLLVN  119

Query  392   EMVPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARIN  571
             +  PC        P     V   QVN F CGGI++G+ +SH I DGA++S F   W+   
Sbjct  120   QFFPCE-----LLPKAVTHVANFQVNVFECGGIAIGICISHLILDGAALSTFLKAWSATA  174

Query  572   RGC--AVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAID  745
             +G   A++      F  S +FP   N   L   A V  G+   +   V +RF   AS+I 
Sbjct  175   KGSREAIIYPE---FIPSSLFP--ANDLWLRDSAVVMFGSLFKKGNGVTKRFVFDASSIS  229

Query  746   QLREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPFP  925
              LR Q   +    P+R E + + +W  ++AA+++    +    +LT ++NLR +MEP   
Sbjct  230   ILRAQAASLGVKCPTRVEVVSSFLWKCIMAASEEWRGSQRRPSLLTHLVNLRRKMEPKLG  289

Query  926   ENCLGNNTYGATVHWNQPTEGNPSR---HALALKFRDAIRGVNDEAARRRYGKGGFLHTA  1096
             EN +GN  + A          N SR   + L  + R AI  ++ +   +  G  G    A
Sbjct  290   ENSMGNFLWLAAAKCM-----NKSRVELNDLVGEVRKAISKIDADFVEQIKGDKGN-SLA  343

Query  1097  LPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRW----AVNAQVMKDSVVFM  1264
                + EI +  GSK  +  L  SS      Y ADFGWGKP W    AV+  +  + V+  
Sbjct  344   EQTLKEIGEF-GSKDGVDYLGFSSWCRFGFYDADFGWGKPVWISSFAVSGSLTMNLVILA  402

Query  1265  EGRFGGVDLWMGLPEELMNIVMKNPQFVEFVS  1360
             + R  G++ ++ L E+ M I+  NP+ ++F S
Sbjct  403   DTRCDGIEAFVTLDEKDMTILEGNPELLKFAS  434



>gb|KDP30966.1| hypothetical protein JCGZ_11342 [Jatropha curcas]
Length=454

 Score =   215 bits (547),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 151/469 (32%), Positives = 238/469 (51%), Gaps = 44/469 (9%)
 Frame = +2

Query  41    TMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGV-VD  217
             ++ + +  R+ IKPSSPTPQ+L+ +  S++DQL+    +P + +Y     S   N   ++
Sbjct  3     SVNVLIVSRETIKPSSPTPQNLKCFKLSLLDQLAPAAYVPMILYYAPTADSIVKNQERIN  62

Query  218   ELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREM  397
              LKKSLSQTL+  YPLAGR+K++   IECNDQG++FIE  +  SLS  L  P+  ++   
Sbjct  63    LLKKSLSQTLTKFYPLAGRVKQNLF-IECNDQGIDFIEAKLNCSLSDILRRPEAHILDRF  121

Query  398   VPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRG  577
             +P          +     + IQVN FSCGG+++G  +SH + DG + + F NTWA + RG
Sbjct  122   LPQEYHFHVSSSSTKCSQMGIQVNSFSCGGMAIGTSISHKLVDGITFTSFINTWAAMARG  181

Query  578   CAVVDDGGF--IFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQL  751
                 +D     IF    IFPP K+   L     + +       K   +RF    S I  L
Sbjct  182   S---NDNLLSPIFVGPHIFPP-KDIYGLLPVLDIPKA------KNTTKRFVFDLSKIGLL  231

Query  752   REQL------------RLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILN  895
             RE+L               ++  PSR E + A++W   I A++ +          T  +N
Sbjct  232   RERLFGNGNSSVNNKNNNNNNNLPSRVEIVSALIWKCAIDASRTKKPS-----FSTQTVN  286

Query  896   LRNRMEPPFPENCLGNNTYGATVHWNQPTEGNP--SRHALALKFRDAIRGVNDEAARRRY  1069
             LR RM+PP PE+  GN  + A      P++G+       L  + R+A++  + +  ++  
Sbjct  287   LRARMDPPLPESAAGNLLWLAIAP--APSDGSSKIEIQDLVYQVRNALKKFDTDYVKKLQ  344

Query  1070  GKGGFLHTALPIMSEIIKH--EGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQV-  1240
             G+ G L     ++ E +K   E + K++     +SL   Q+Y  DFGWGKP W  +A + 
Sbjct  345   GENGSL-----VLEETLKQITELALKHVDIYRFTSLRKFQLYEGDFGWGKPVWISSAGLT  399

Query  1241  MKDSVVFMEGRFGG-VDLWMGLPEELMNIVMKNPQFVEFVSAGFSKSKL  1384
              K+ VV +E R G  V+ W+ L ++ M +   N + + F S   + S L
Sbjct  400   FKNVVVLIESRAGDRVEAWVTLDQQEMAVFECNQEILSFDSPTHNSSFL  448



>ref|XP_009602470.1| PREDICTED: vinorine synthase-like [Nicotiana tomentosiformis]
Length=412

 Score =   214 bits (544),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 142/430 (33%), Positives = 210/430 (49%), Gaps = 27/430 (6%)
 Frame = +2

Query  38    ITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVD  217
             +  K+E+  +++IKPSSPT  +LRT+  S+VDQ+S  V IP + FY     + + +  + 
Sbjct  1     MVAKVEIISKEMIKPSSPTTSTLRTHKLSLVDQISPPVFIPLIFFYQDELGNINRSRKLQ  60

Query  218   ELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREM  397
              LKKSLS  L   YPLAGR   D + I+CND G EFIE  V   LS  +E P  E +RE 
Sbjct  61    LLKKSLSDALMRFYPLAGRFN-DNNFIDCNDAGAEFIEAQVHGYLSQVIETPKMEDLREF  119

Query  398   VPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRG  577
             +P      A     +  +L +QVN F CGGI++G+ MSH +GDG+SI  F N W+ I RG
Sbjct  120   LP----REACVVENNDVLLAVQVNLFDCGGIAIGICMSHKVGDGSSIVTFINAWSAIARG  175

Query  578   CAVVDDGGFI---FDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQ  748
                  D G +   F+ S IFPP+    DL   +          +K + RRF      +D 
Sbjct  176   -----DTGIVQPNFNLSSIFPPL----DLSN-SSFKPSIGIKNDKLMTRRFVFDKEKLDA  225

Query  749   LREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPFPE  928
             +++         P+R EAL A VW  ++  + K ++    +      +N+R+RM P  P+
Sbjct  226   IKKSASGSQVKDPTRVEALSAFVWKHLMEVS-KLNRDSTKMFAAVHAVNIRSRMNPTLPD  284

Query  929   NCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTALPIM  1108
             +  G N +   + +  P         L    R AIR +N +          FL     + 
Sbjct  285   HSFG-NLWTTALAFLSPESEEIEIGDLLHHLRCAIRNINSDYIEILQNGQEFLKHMSKLA  343

Query  1109  SEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQV-MKDSVVFMEGRFG-G  1282
                 K E    N      SS     VY  DFGWGKP W   A    +++V+F+  + G G
Sbjct  344   ELFSKEEVEFYNF-----SSWCRFPVYEVDFGWGKPVWVCTATFPYENTVIFVGTKCGEG  398

Query  1283  VDLWMGLPEE  1312
             ++ W+ + E+
Sbjct  399   IEAWVNMLED  408



>emb|CDP07885.1| unnamed protein product [Coffea canephora]
Length=453

 Score =   214 bits (545),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 149/453 (33%), Positives = 229/453 (51%), Gaps = 29/453 (6%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVK-IPYVRFYDSPGSSRDYNGVVDE  220
             ++IE+  R+ IKP SPTP   +T+  S++DQL  ++  +P V F+ + G S D +   + 
Sbjct  4     LEIEIISREYIKPESPTPNDFKTFKISLLDQLLPHLYVVPLVYFFKNDGKS-DISKRREL  62

Query  221   LKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREMV  400
             LK+SLS+TL   YPLAG++K D   ++CND G+ ++E  V   LS FL +P  E+I  ++
Sbjct  63    LKQSLSKTLVHFYPLAGKVK-DNLHVDCNDDGMYYVEARVNAQLSDFLGHPQQELIHGLL  121

Query  401   PCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRGC  580
             P +P   + E      V ++QVN F CGGI++G+  SH + DG S   F N WA    G 
Sbjct  122   PFHP--SSTELFTKTYVAMVQVNIFECGGIAIGIYSSHKVMDGQSTVTFMNAWAATASGS  179

Query  581   AVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQLREQ  760
             +      FI  +S IF P  N    +  + +       Q K   RRF   ASA++ L+  
Sbjct  180   SEEIHPSFI--SSSIFHP--NPKLPNATSILIPPPQSEQSKSATRRFVFDASALNVLKNN  235

Query  761   LRLISH--YRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPFPENC  934
                       PSR  A + ++W   IA +Q R   R    +LT ++NLR+R  PP P   
Sbjct  236   ANCAESNVTNPSRVTAAMGLIWQCAIATSQARFGFR-KPSILTFVVNLRSRNSPPLPPYS  294

Query  935   LGN---NTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTALPI  1105
             +GN    TY   +        +    ++  + R+ I  +++       GK G L   +  
Sbjct  295   MGNIFWVTYAKCL-----VNSDLKLPSMVRRVRNGIDKLDNSFLEDIKGKDGSLVNVMKH  349

Query  1106  MSEIIK-HEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWA------VNAQVMKDSVVFM  1264
             + E+ + H G+    Y L  SS+    +Y ADFGWGKP W       ++A  + + VVFM
Sbjct  350   LKELEEVHTGNLDTEY-LSLSSICNGGIYNADFGWGKPIWTCIGSAGIDALGLPNLVVFM  408

Query  1265  EGRFG-GVDLWMGLPEELMNIVMKNPQFVEFVS  1360
             + R G G++ W+ L E  M I  K P+ + F +
Sbjct  409   DTRSGDGIEAWVTLKENDMAIFEKIPELLNFAT  441



>ref|XP_011071304.1| PREDICTED: vinorine synthase-like [Sesamum indicum]
Length=433

 Score =   213 bits (543),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 158/453 (35%), Positives = 229/453 (51%), Gaps = 42/453 (9%)
 Frame = +2

Query  38    ITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYN-GVV  214
             + ++IEV   + IKPSSPTP+SLR Y  S +DQ++    +P V FY  P  ++  N    
Sbjct  1     MEIEIEVISNETIKPSSPTPESLRKYQLSFLDQIAPPTFMPLVYFY--PADAKFSNPEKS  58

Query  215   DELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIRE  394
             + LKKSLSQ LS  YPLAGR+ +D   ++CN++G  ++E     SLS  + NP       
Sbjct  59    NHLKKSLSQVLSRFYPLAGRLIDDLY-VDCNNEGAPYVEAVANCSLSQVVTNP-------  110

Query  395   MVPCNPFTGAFEPNPDGRV----LVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWA  562
              +P N     F P     V    + +QV  F CGG +VGL++SH I D  S  + ANTWA
Sbjct  111   -IPKN--MNKFLPYKVDEVQNLGMAVQVTYFQCGGTAVGLLISHKIADALSFFLVANTWA  167

Query  563   RINRGCAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAI  742
              I R     D  G  F+ +KIFPP ++ A       + +      E+ V + F  PAS I
Sbjct  168   AIARNGNYDDVPGPKFEGAKIFPP-RDAAGFKPSTGIVK------EELVTKIFTFPASRI  220

Query  743   DQLREQLR----LISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRM  910
               L+E+       +   RPSR EAL A +W   I+A Q +      ++ +   +NLR R+
Sbjct  221   SALQERYSGGAAELPQRRPSRVEALSAFLWTRFISATQMKADPN-KIYTVLHAVNLRTRL  279

Query  911   EPPFPENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDE-AARRRYGKGGFL  1087
             +PP  E   GN +  A      P+ G      L  K R+AIR V+ E  A+ R G     
Sbjct  280   DPPLSEYHFGNISRLAIA---MPSVGVDGGSELLQKVREAIRAVDGEYVAQLRQG-----  331

Query  1088  HTALPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQ-VMKDSVVFM  1264
                L  + E +  + +K  +     +SL    +Y ADFGWGKP WA +A  V K+ V F+
Sbjct  332   DKHLNFLKERMA-QANKGELVTFNFTSLCRFPLYEADFGWGKPVWAGSAGLVYKNLVTFI  390

Query  1265  EGRFG-GVDLWMGLPEELMNIVMKNPQFVEFVS  1360
             +   G G++ W+ L +E M     + +  EF+S
Sbjct  391   DTATGNGIEAWINLRKEDMEKFEADLELQEFLS  423



>ref|XP_006379530.1| hypothetical protein POPTR_0008s03350g, partial [Populus trichocarpa]
 gb|ERP57327.1| hypothetical protein POPTR_0008s03350g, partial [Populus trichocarpa]
Length=442

 Score =   213 bits (543),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 147/461 (32%), Positives = 228/461 (49%), Gaps = 43/461 (9%)
 Frame = +2

Query  38    ITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGV--  211
             + +++ +  +++IKPSSPT Q  + Y  S++DQL+     P + FY  P +   +N +  
Sbjct  2     VKIEVHIISKELIKPSSPTIQQKKPYKLSLIDQLNPTTYTPAIFFY--PMNDASFNNITA  59

Query  212   ---VDELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFE  382
                +D LKKSLS+TL+L YP +GR+K D   I+C  +GV F+E  V   LS +L++ + E
Sbjct  60    KTRIDSLKKSLSETLNLYYPFSGRVK-DNLFIDCFSEGVPFLEAQVNCRLSDYLKHHEVE  118

Query  383   MIREMVPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWA  562
              +   +PC PFT   + N +  +   QV+ F+CGGIS+G   SH + DG +   F + WA
Sbjct  119   SLNHFLPCQPFT---KENMNAPISAFQVSIFACGGISLGWSASHKLVDGGTAKAFLSAWA  175

Query  563   RINRGCAVVDDGGFIFDASKIFPP----VKNTADLDQFARVARGAAESQEKYVVRRFYIP  730
               +RG     +      AS  FPP     +N   L +      G       Y+ RRF   
Sbjct  176   SKSRGEHT--EAPDFSKASLFFPPRNPLPQNHISLTETLWFTEG------NYITRRFVFD  227

Query  731   ASAIDQLREQLRL-ISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNR  907
               AI  LR + +      +PSRAE L   +W   +AA+ K         +L   +NLR+R
Sbjct  228   PKAIAMLRAKAKAGKPDTKPSRAETLSCFIWKCCMAAS-KAISDSPKPSILVEAVNLRSR  286

Query  908   MEPPFPENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFL  1087
              +PP  E  +GN  + AT   N PT+ N   H L  +  +AI   + +  R   G+ GF 
Sbjct  287   TKPPMSEASIGNIFWWATAVAN-PTDTNTELHELVNQLNEAIALYDSDYTRTMQGEEGF-  344

Query  1088  HTALPIMSEIIKH-EG----SKKNMYCLYTSSLLGMQVYAADFGWGKPRW----AVNAQV  1240
                   MS+     EG     K +++       LG+    A+FGWG+P W          
Sbjct  345   ----ETMSDYCSQLEGLFSLEKPDIFAFTCWCYLGLT--KANFGWGEPIWVGLMGKVGPA  398

Query  1241  MKDSVVFMEGRFG-GVDLWMGLPEELMNIVMKNPQFVEFVS  1360
              ++  V +E + G G++ W+ L EE M I+ ++P+F+ F S
Sbjct  399   FRNLTVLIETKDGNGIEAWVTLDEERMAILERDPEFLAFAS  439



>ref|XP_008240680.1| PREDICTED: vinorine synthase-like [Prunus mume]
Length=463

 Score =   214 bits (544),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 139/446 (31%), Positives = 225/446 (50%), Gaps = 23/446 (5%)
 Frame = +2

Query  50    IEVRRRDIIKPSSPTPQSLRTYNFSIVDQL-SVNVKIPYVRFYDSPGSSRDYNGVVDE-L  223
             +E+  R IIKPSSPTP  L+    S++DQ+    +    + FY +     D+     + L
Sbjct  9     VEITSRKIIKPSSPTPYHLKNLKLSLLDQMFPPTLYGTLLFFYTNHWHCADFASKASKRL  68

Query  224   KKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREMVP  403
             ++SLS+TL L YPLAGR+K   + IECND+G  F+E  V   L+ FL+ P+ +++  ++P
Sbjct  69    QESLSKTLVLFYPLAGRLK-GPAFIECNDEGAHFLEARVNCQLADFLQQPEPKLLNHLIP  127

Query  404   CNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRGCA  583
                   A +      +L++Q+N F+CGGI++ +  SH I D  S+  FA TWA INR   
Sbjct  128   ETDSKTA-QVAMGSVILLVQINVFNCGGIAIAVSPSHKIADVKSLYTFAQTWAAINRDED  186

Query  584   VVDD--GGFI----FDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAID  745
               DD  GG +    F+   + P    + DL  F       +E+      RRF    S + 
Sbjct  187   QYDDGVGGRLVLPEFNGGNLLP----SRDLPAFPNTLETPSEN---LTARRFVFDVSKMA  239

Query  746   QLREQLR-LISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPF  922
              L+ ++  ++ ++ P+  + ++A++    IAA+     GRI   VL  ++NLR RM P  
Sbjct  240   SLKAKIEGIVQNFIPTNVQLVLAIILKCAIAASHNSKPGRITPTVLFQMVNLRRRMLPEL  299

Query  923   PENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTALP  1102
              +N +GN  +   V +N   E     H L    R  +    +E A R  G  GFL     
Sbjct  300   TQNAMGNWFWPLPVLFN---EDETQLHELVSTMRKGLTDFVNEKANRFKGVEGFL-AVFE  355

Query  1103  IMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQVMKDSVVFMEGRFG-  1279
              + E  +   SKK +     +SL  + +Y  DFGWGKP W  +    K+ +  ++ +FG 
Sbjct  356   CIRERDRLLKSKKGINLYRATSLCKLPLYEMDFGWGKPTWVTSKGGYKNVIALLDTKFGD  415

Query  1280  GVDLWMGLPEELMNIVMKNPQFVEFV  1357
             G++ W+ L E+ M I   + + + ++
Sbjct  416   GIEAWVTLDEQEMAIFESDEELLAYL  441



>ref|XP_008222013.1| PREDICTED: vinorine synthase-like [Prunus mume]
Length=435

 Score =   212 bits (540),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 142/445 (32%), Positives = 229/445 (51%), Gaps = 32/445 (7%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVV--D  217
             M+I+V  RD IKPSSPTP  LR +  S +DQ++  + +P + FY +    R  +  +  D
Sbjct  2     MRIQVIERDCIKPSSPTPPHLRKHELSFLDQIATPIFMPMILFYTNNNGRRGNHVKIYSD  61

Query  218   ELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREM  397
              +K+SLS+ L+  YPLAGR+ +D + ++CNDQG  +++  V  +LS  +  PD     ++
Sbjct  62    RVKQSLSEILTQYYPLAGRVIDD-AYVDCNDQGAHYVQAQVNCTLSDVISQPDPNQHNKL  120

Query  398   VPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRG  577
             +P +        N    VL +QVN F CGG+++G+ +SH I D  S+  F N+WA ++RG
Sbjct  121   LPYD------LDNVGDLVLAVQVNIFDCGGMAIGICISHKIVDAFSVITFLNSWASVSRG  174

Query  578   CAVVDDGGF---IFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQ  748
                + +      +FD + +FPP          +        ++E  V +RF   AS +  
Sbjct  175   DYDIKNNTISPPLFDVATLFPP-------RSISGYKPSTGITRENIVTKRFVFSASMVAS  227

Query  749   LREQLRL--ISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPF  922
             LR +      +   P+R EAL   +W   IA+ Q     +    VL ++ NLR RM+PP 
Sbjct  228   LRSKYTENNSNEIYPTRIEALSCFIWARFIASTQGEPNPKKIYKVLHAV-NLRTRMDPPL  286

Query  923   PENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVN-DEAARRRYGKGGFLHTAL  1099
             PE  +GN +  A    +     + + + L  + RDA++ ++ D  ++ R G      T L
Sbjct  287   PEYHIGNVSRFAIAKLSFDGSKD-TCYRLVGQMRDALKTIDSDYLSKMRDGD-----THL  340

Query  1100  PIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQV-MKDSVVFMEGRF  1276
               + E +  E  K  +  L  +SL    +Y  DFGWGKP W  +A +  K+ VVFM+   
Sbjct  341   NFLKERVA-EFMKGEVVSLNFTSLCRFPLYGTDFGWGKPVWVGSASLPFKNLVVFMDTES  399

Query  1277  -GGVDLWMGLPEELMNIVMKNPQFV  1348
              GG++ W+ L EE M    ++ Q +
Sbjct  400   GGGIEAWVNLKEEDMAKFQEDEQLL  424



>gb|KCW81000.1| hypothetical protein EUGRSUZ_C02376, partial [Eucalyptus grandis]
Length=433

 Score =   212 bits (540),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 147/454 (32%), Positives = 223/454 (49%), Gaps = 38/454 (8%)
 Frame = +2

Query  38    ITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNG--V  211
             +TMK+EV   + +KPSSPTP  LR +   ++DQL+    +P + FY +  +    N   V
Sbjct  1     MTMKVEVVSTETVKPSSPTPSHLRDFKICLLDQLAPPFWVPVILFYSASNNEVAANSASV  60

Query  212   VDELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIR  391
                LK SLSQ LSL YPL GRIK + S+I+CNDQG  ++E      LS  L NPD   ++
Sbjct  61    TGNLKTSLSQALSLFYPLGGRIKGN-SAIDCNDQGALYLEAKARFELSEVLLNPDINQLQ  119

Query  392   EMVPCNPFTGAFEPNPDGRVLV-IQVNRFSCGGISVGLIMSHAIGDGASISVFANTWAR-  565
             + +P +  +    PN + +V+V +Q N F CGGI +G+ MSH I D AS+S F   W++ 
Sbjct  120   QFLPFS--SDKVVPNIEEQVIVGVQANFFDCGGIGIGICMSHKIADAASVSAFLTAWSKI  177

Query  566   ----INRGCAVVDDGGFIFDASKIFPPVKNTADLD-QFARVARGAAESQEKYVVRRFYIP  730
                 IN    V+        AS++FPP     D++ Q  R       S+EK   +RF   
Sbjct  178   ALNGINGKAKVITP---FLKASELFPP----KDVNFQMPR----RFTSREKLFTKRFRFD  226

Query  731   ASAIDQLREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHK--GRINLHVLTSILNLRN  904
               ++ +LR +        P+R EA+ A++W + + A +KR +   +    V T ++N+R+
Sbjct  227   GESLARLRARF---GSATPTRVEAVTALIWKSAVEAARKRPEWNEKYPSSVATHVVNIRS  283

Query  905   RMEP-PFPENCLGN---NTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYG  1072
             RM P P PE+ LGN    T    +  N+  E        A   R +IR ++DE      G
Sbjct  284   RMRPQPLPEHALGNLWQTTIAPLIDTNKGVE----LQDFAGSLRKSIRAIDDEYLSVLQG  339

Query  1073  KGGFLHTALPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQVMKDS  1252
             + G       + +     E S   M     SS +    Y  D G G+P W         +
Sbjct  340   ERGLTKAYESLTAARKLAESSAGKMESYGFSSWVKFPFYEVDLGLGRPTWVCTTGFPIGN  399

Query  1253  VVFMEGRF--GGVDLWMGLPEELMNIVMKNPQFV  1348
             +VF+ G     G++ W+ LPE  M    +N + +
Sbjct  400   MVFLMGTRCEDGIEAWITLPEHDMIEFERNDELL  433



>gb|KDO85081.1| hypothetical protein CISIN_1g015400mg [Citrus sinensis]
Length=407

 Score =   211 bits (538),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 143/405 (35%), Positives = 206/405 (51%), Gaps = 29/405 (7%)
 Frame = +2

Query  44    MKIEVR--RRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGV--  211
             MKIEV+   ++ IKPSSPTP  L+T+ FS++DQ   +   P + FY  P        +  
Sbjct  1     MKIEVQIISKEDIKPSSPTPPHLKTFKFSLLDQFIPSPYAPIILFY--PNDCMTLAEIPK  58

Query  212   -VDELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMI  388
              +  LK+SLS+TL+  YPLAG+IK+D S IECND G  F+E  V   L  FL  PD  ++
Sbjct  59    RLALLKRSLSETLTRFYPLAGKIKDDLS-IECNDDGAYFVEAQVNCRLDEFLTKPDLLLL  117

Query  389   REMVPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARI  568
                +PC       E      +  IQVN F CGGI++G+ +SH + DGA++S F   W+  
Sbjct  118   HRFLPCELMK---ELTAVTYLTNIQVNVFDCGGIAIGICISHKMLDGAALSTFLRAWSAT  174

Query  569   NRGCAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQ  748
              RGC  V    F   A  +FP   N   L   + V  G+   + K + +RF   ASAI  
Sbjct  175   ARGCEEVIYPNFA--APSLFP--ANDLWLRDTSMVMWGSLFKKGKCITKRFVFDASAIAA  230

Query  749   LR---EQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINL-HVLTSILNLRNRMEP  916
             L+      ++     P+R EA+ A +W  ++AA++++H  +     VLT ++NLR RM P
Sbjct  231   LKVVATSSKIKCPTPPTRVEAVSAFIWKCIMAASKEKHGYQTRRPCVLTHLVNLRRRMTP  290

Query  917   PFPENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTA  1096
             P  +NC GN  + A      P +  P  H L  + +DAI  ++ E  ++     G     
Sbjct  291   PLSDNCTGNLLWMAAAKCMTPDK--PELHDLVGELKDAISKLDGEFVKKLSSDEGN----  344

Query  1097  LPIMSEIIKHEG---SKKNMYCLYTSSLLGMQVYAADFGWGKPRW  1222
               +M E +K  G   SK  +  +  SS      Y  DFG GKP W
Sbjct  345   -SLMCESLKQIGELCSKDEVDHVGFSSWCNFGFYEIDFGRGKPVW  388



>ref|XP_002514976.1| 3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase, putative [Ricinus 
communis]
 gb|EEF47530.1| 3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase, putative [Ricinus 
communis]
Length=435

 Score =   212 bits (539),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 143/429 (33%), Positives = 216/429 (50%), Gaps = 27/429 (6%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVDEL  223
             +++E   +++IKPSSPTP  LR +  S +DQ+ V V +P+V FY    ++ +     ++L
Sbjct  3     VEVEFISQELIKPSSPTPDHLRHFQLSFLDQIQVPVWMPFVLFYSKEPNTSNL-ARCNQL  61

Query  224   KKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREMVP  403
             KKSLS+TL++ YPLAGR+  + +SI CND+GV F+E      LS  L N +     +++P
Sbjct  62    KKSLSKTLTIFYPLAGRV-NNNTSIHCNDEGVLFVEAQANCQLSDILRNANPSDNNKLIP  120

Query  404   CNPFTGAFEPNPDGRVLV--IQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRG  577
                      P  DG+ L   +QV  F+CGG+++ L MSH +GD  S  +F N WA I RG
Sbjct  121   L--------PLDDGKGLAAFLQVTFFTCGGLAISLAMSHKLGDALSKLIFLNCWAAITRG  172

Query  578   CAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQLRE  757
                 +  G     S    P K  +  D       GAA  ++  V +RF   +S +  LR 
Sbjct  173   DTDPNIIGVSPSGSATLFPPKILSGFDA------GAAIVKDNIVTKRFVFDSSTVSGLRA  226

Query  758   QLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPFPENCL  937
             + +  +    SR EAL A +W   +AA Q        L+++   +NLR RMEPP      
Sbjct  227   KYKHKNGCSVSRVEALAAFIWSRFMAATQADRTDN-KLYMVLHAVNLRPRMEPPLSNLYF  285

Query  938   GNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTALPIMSEI  1117
             GN T  AT   +   + +   + +  +  +AIR VN +  +      G L+       +I
Sbjct  286   GNITRIATTMADMNAKDDEC-YGIVSRMNNAIRSVNADFVKSLQKSDGHLNFLKEEAGKI  344

Query  1118  IKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNA-QVMKDSVVFMEGRFG-GVDL  1291
              K E     +     +SL    VY  DFGWGKP W  +A  V K+  +F + + G G++ 
Sbjct  345   TKGE-----LIHFAFTSLCKFPVYEIDFGWGKPVWVGSACLVFKNLALFFDTKEGNGIEA  399

Query  1292  WMGLPEELM  1318
             W+ L EE M
Sbjct  400   WINLKEEDM  408



>ref|XP_010094574.1| Salutaridinol 7-O-acetyltransferase [Morus notabilis]
 gb|EXB56328.1| Salutaridinol 7-O-acetyltransferase [Morus notabilis]
Length=456

 Score =   212 bits (540),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 152/459 (33%), Positives = 234/459 (51%), Gaps = 31/459 (7%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVDEL  223
             M++++   D IKPSSPTP  LRT+  S++DQL  +   P + FY  P      +  ++ L
Sbjct  1     MEVKIVSIDHIKPSSPTPSHLRTFKLSLLDQLIPSPYAPIILFY-PPNDDVSNSNKLESL  59

Query  224   KKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREMV-  400
             KKSLS+TL+ +YPLAG+IK+D S I+C+D G  F E  V  SL  FL  PD+ ++ + + 
Sbjct  60    KKSLSETLTDLYPLAGKIKDDLS-IDCDDGGAYFAEAKVDSSLRDFLNQPDYLLLLQKLL  118

Query  401   PCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRG-  577
             PC+    A   N +  V  IQ+N F CGG++VGL +SH I DGA++S F  +WA   RG 
Sbjct  119   PCDLNFAASNRNDNNHVANIQINVFGCGGLAVGLCISHKILDGAALSSFLRSWATTARGD  178

Query  578   --CAVVDDGGFIFDASKIFPPVKNTAD--LDQFARVARGAAESQEKYVVRRFYIPASAI-  742
               C         F+A+    P  +  D  L   + V  G+  ++ K V +RF   ASAI 
Sbjct  179   RTCKAARPPS--FEAANSLFPANDAGDLWLRDTSMVMFGSFFTKGKCVTKRFVFDASAIL  236

Query  743   ---DQLREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRME  913
                 +        +   P+R EA+ A +W  VI+A + R+ G     + T ++NLR R  
Sbjct  237   SLRSEASRSSSSAAVQNPTRVEAVSAFIWRCVISAAKDRNGGVSRPSLSTHLVNLRRRTT  296

Query  914   PPFPENCLGNNTYGATVHWNQPTEGNPSRHALA------LKFRDAIRGVNDEAARRRYGK  1075
             P   E+CLGN  + A+   ++P  G+   HA+A         R++    + +  +R  G+
Sbjct  297   PFLSEHCLGNLLWIASAQ-SRPARGD---HAVAGVSELVGLLRESFSKTDGDFVKRLRGE  352

Query  1076  GGFLHTALPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRW----AVNAQVM  1243
                    L  ++ II+  G  + M  +  SS      Y ADFGWG+P W     ++  V 
Sbjct  353   KRRFRM-LESLNRIIQVMGDGE-MDQIGFSSWCKFGFYEADFGWGRPAWVSSFGLSGSVF  410

Query  1244  KDSVVFMEGRFG-GVDLWMGLPEELMNIVMKNPQFVEFV  1357
                V+  + R G G++ W+ L E  M I+  N + ++  
Sbjct  411   MKLVILADTRLGDGIEAWVTLDERDMAIMESNTELLQLA  449



>ref|XP_006292162.1| hypothetical protein CARUB_v10018368mg [Capsella rubella]
 gb|EOA25060.1| hypothetical protein CARUB_v10018368mg [Capsella rubella]
Length=431

 Score =   211 bits (538),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 142/450 (32%), Positives = 233/450 (52%), Gaps = 32/450 (7%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNG-VVDE  220
             M ++V  RDIIKPSSPTP  L+T+  S+++QL   +  P V FY   G++R      + +
Sbjct  1     MIVDVTSRDIIKPSSPTPNHLKTFKLSLLEQLGPTIFGPMVFFYS--GNNRIKPAEQIQK  58

Query  221   LKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREMV  400
             LK+SLS+TL+  +PLAGR+K +  SI+CND GV+FIE  V   LSS L+ P  + +++++
Sbjct  59    LKQSLSETLTHFHPLAGRLKGN-VSIDCNDSGVDFIEAQVDSPLSSLLQEPSSDSLQQLI  117

Query  401   PCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRGC  580
             P    T A       ++L+ Q + F CG ++VG+ +SH   D  SI +F  TWA I+   
Sbjct  118   P----TSADSIETRTKLLLAQASFFECGSMAVGVCISHKFADATSIGLFMKTWAAISSRG  173

Query  581   AVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQE----KYVVRRFYIPASAIDQ  748
             ++   G  +FD +KIFPP         F+  +       E    + V +RF   +S+I  
Sbjct  174   SIETVGSPVFDTAKIFPP-------GNFSETSPAPVIEPEIKMNQTVSKRFIFDSSSIQS  226

Query  749   LREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPFPE  928
             L+ +       +P+R EA+ A++W   + A  +   G     +L +  +LR+R+ PPF E
Sbjct  227   LQAKASSFEVNQPTRVEAVSALIWKTAVKAT-RTVSGTSKPSILANSASLRSRLSPPFTE  285

Query  929   NCLGN-NTYGATVHWNQPTEG-NPSR-HALALKFRDAIRGVNDEAARRRYGKGGFLHTAL  1099
             N +GN  +Y A     +  EG N ++   L  + R A +   +    +  G         
Sbjct  286   NTIGNLVSYFAA----KAEEGINQTKLQTLVSEIRKAKQRFQENHVPKLVGNPNATEVIC  341

Query  1100  PIMSEIIKHEGSKK-NMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQVMKDSVV-FMEGR  1273
                 E      S + + Y + ++   G+  Y  DFGWGKP W     + + S+V  ++ R
Sbjct  342   SYQKEAGDMIASGEFDFYIISSACRFGL--YEIDFGWGKPVWVGIPSIRQKSIVTLLDTR  399

Query  1274  -FGGVDLWMGLPEELMNIVMKNPQFVEFVS  1360
               GG++ W+ L E+ M +  ++ + ++FVS
Sbjct  400   EAGGIEAWVNLNEQEMKLFEQDRELLQFVS  429



>ref|XP_002517535.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
 gb|EEF44699.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
Length=446

 Score =   211 bits (537),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 139/458 (30%), Positives = 233/458 (51%), Gaps = 30/458 (7%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRD--YNGVVD  217
             MK+E+  R++IKPSSPTP  L+ +   ++D+L+     P +  Y S     +  ++ V D
Sbjct  1     MKVEIISREMIKPSSPTPIHLKDFKICLLDELAPPSYAPILLLYSSTDFVNENCFSAVAD  60

Query  218   ELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREM  397
             +LKKSLSQTL   YP +G++KE+ +SI+CND+G  F+E  V  +LS  ++NP+  M+ ++
Sbjct  61    KLKKSLSQTLVHFYPFSGKLKENLNSIDCNDEGALFLEAKVNVALSKIVKNPETNMLCQL  120

Query  398   VPCNPFTGAFEPNPDGRVLV---IQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARI  568
              P +P+  A     DG + V   +QVN F CGG+ +G+ +SH I DGA+++ F ++WA  
Sbjct  121   FPFDPYDAAV----DGEIRVTTGVQVNVFECGGVGIGVCVSHKIADGATMASFISSWASS  176

Query  569   NRGCAVVDDGGFI----FDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPAS  736
                    DD         D++ IFPP K    +     V R      EK V +RF     
Sbjct  177   ATATGSDDDHQAFSSPRLDSAMIFPP-KGMDMMKHCNMVIR-----NEKIVTKRFEFDWK  230

Query  737   AIDQLREQLR---LISHYRPSRAEALIAVVWDAVIAANQK-RHKGRINLHVLTSILNLRN  904
              +  L+  +    +     P+R EA+ A++W + +   +    +  I   + T ++N+R 
Sbjct  231   KLANLKANIDANGVSEKINPTRVEAVTALIWRSAMEVKRSMSEQDTIPCSIATHLVNIRE  290

Query  905   RMEPPFPENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGF  1084
             RM PP P + +GN    A   + +  +    +  + L  R++IR ++++      G+ GF
Sbjct  291   RMRPPLPGHSIGNLWRLAVAPYLEFKKDVKLQELVDL-IRESIRRIDNDYVTELQGEDGF  349

Query  1085  LHTALPI--MSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKP-RWAVNAQVMKDSV  1255
                  P+  + E+    G    +Y    SSL     Y  DFG GKP +       +++ V
Sbjct  350   EKGIEPLKELRELALLGGEGVEVYTF--SSLARFPFYEIDFGLGKPVKVCTITMPIRNCV  407

Query  1256  VFMEGRFG-GVDLWMGLPEELMNIVMKNPQFVEFVSAG  1366
               ++ RFG G++ W+ L E  M     + + ++FVSA 
Sbjct  408   TLIDTRFGDGIEAWVTLTENDMAKFECSQELLQFVSAA  445



>ref|XP_007044963.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
 gb|EOY00795.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
Length=429

 Score =   211 bits (536),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 152/454 (33%), Positives = 224/454 (49%), Gaps = 41/454 (9%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYN-GVVDE  220
             MK+EV  R IIKPSSPTP  LR  +FS +DQ++  V +P V FY   G     N    + 
Sbjct  1     MKVEVVARGIIKPSSPTPGHLRNLHFSFLDQIATPVFMPMVFFYPIDGDVNVGNFNRTEW  60

Query  221   LKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREMV  400
             LKKSLS+TL+  YPLAGR+K D + I+CND+GV F++  V   LS  +  P+   + +++
Sbjct  61    LKKSLSETLTRFYPLAGRVK-DNAFIDCNDEGVPFVQSRVKCQLSDVVRQPEPAQLNKLL  119

Query  401   PCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRGC  580
             P          N    +L IQ N F CGG+++G+ +SH I D  S+ +F N WA   RG 
Sbjct  120   PYE------LDNVGDLILAIQANIFDCGGMAIGVCISHKIADALSLIMFLNNWAATARGD  173

Query  581   AVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAES----QEKYVVRRFYIPASAIDQ  748
             +        FD + +FP           AR   G   S    ++K V RRF   AS I  
Sbjct  174   SYTVPPR--FDLATLFP-----------ARSISGFKPSTGIFKDKIVTRRFVFSASMIAA  220

Query  749   LREQLRLIS------HYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRM  910
             LR +             RP+R EAL   +W   +A    +      L+ +   +NLR RM
Sbjct  221   LRAKYADDGASNGEFQRRPTRIEALSTFIWSRFMATTHGKPDPE-KLYTVLHAVNLRTRM  279

Query  911   EPPFPENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLH  1090
             +PP PE   GN +  A    +  +E       +  + RDAIR ++ +  R+     G L+
Sbjct  280   DPPLPEYYFGNISRFAIAIPSINSE--EECFGIVSEVRDAIRKIDGDYVRKLQEGSGHLN  337

Query  1091  TALPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQV-MKDSVVFME  1267
                  M E  +   +K ++     +SL    +Y  DFGWG+P W  +A +  K+ VVFM+
Sbjct  338   ----FMKERAERI-TKGDVVSFSFTSLCRFPLYETDFGWGRPIWVGSASLTFKNLVVFMD  392

Query  1268  -GRFGGVDLWMGLPEELMNIVMKNPQFVEFVSAG  1366
              G  GG++ W+ + EE M     + + + FV + 
Sbjct  393   TGSSGGIEAWINMKEEDMARFEGDEELLAFVCSA  426



>ref|XP_011034885.1| PREDICTED: vinorine synthase-like [Populus euphratica]
Length=448

 Score =   211 bits (537),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 152/453 (34%), Positives = 231/453 (51%), Gaps = 34/453 (8%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFY----DSPGSSRDYNGV  211
             M++++     ++PSSPTP  LR +  S++DQL      P + +Y    +S  S+ D +  
Sbjct  1     MEVQIISEQNVRPSSPTPPHLRNFKLSLLDQLIPVPYAPLLLYYPMNDNSGASNLDVHRR  60

Query  212   VDELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIR  391
             +  LKKSLS+TL+  YPLAG+IK D  SI+CND+G  ++E  V   LS FL  PD  +  
Sbjct  61    LGVLKKSLSETLTHFYPLAGKIK-DELSIDCNDEGAYYVEAQVNCHLSEFLRQPDLLLAH  119

Query  392   EMVPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARIN  571
             +  PC        P     V   QVN F CGGI++G+ +SH I DGA++S F   W+   
Sbjct  120   QFFPCE-----LLPKAVTHVANFQVNVFECGGIAIGICISHLILDGAALSTFLKAWSATA  174

Query  572   RGC--AVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAID  745
             +G   A++      F  S +FP   N   L   A V  G+   + K V +RF   AS+I 
Sbjct  175   KGSKEAIIYPE---FIPSSLFP--ANDLWLRDSAVVMFGSLFKKGKGVTKRFVFDASSIS  229

Query  746   QLREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPFP  925
              LR Q   +    P+R E + + +W  ++AA+++  +G     +LT ++NLR +MEP   
Sbjct  230   SLRAQAASLGVKCPTRVEVVSSFLWKCIMAASEE-WRGSQRPSLLTHLVNLRRKMEPNLG  288

Query  926   ENCLGNNTYGATVHWNQPTEGNPSR---HALALKFRDAIRGVN-DEAARRRYGKGGFLHT  1093
             EN +GN  + A          N SR     L  + R AI  ++ D   + +  K   L  
Sbjct  289   ENSIGNFLWLAAAKCM-----NKSRVELDDLVGEVRKAISKIDADFVGQIKGDKSNSL--  341

Query  1094  ALPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRW----AVNAQVMKDSVVF  1261
             A   + EI +  GSK  +  L  SS      Y ADFGWGKP W    AV+  +  + ++ 
Sbjct  342   AEQTLKEIGEF-GSKDGVDYLGFSSWCRFGFYDADFGWGKPVWISSFAVSGSLTMNLIIL  400

Query  1262  MEGRFGGVDLWMGLPEELMNIVMKNPQFVEFVS  1360
              + R  G++ ++ L E+ M I+  NP+ ++F S
Sbjct  401   ADTRCDGIEAFVTLDEKDMTILEDNPELLKFAS  433



>ref|XP_009359286.1| PREDICTED: vinorine synthase-like [Pyrus x bretschneideri]
Length=432

 Score =   211 bits (536),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 145/448 (32%), Positives = 220/448 (49%), Gaps = 40/448 (9%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVDEL  223
             MKIEV  R  IKPS PTP  L  + FS +DQ++  + +P + FY++     D     D +
Sbjct  1     MKIEVIERAYIKPSMPTPPHLCKHEFSFLDQIATQIFMPMIFFYNN-HHVNDARTYSDRV  59

Query  224   KKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDV-AESLSSFLENPDFEMIREMV  400
             K+SLS+ L+  YP AGRI E+ + I+CNDQG  +++  V +  LS  +  PD   + +++
Sbjct  60    KQSLSEALTQYYPFAGRIVEN-AFIDCNDQGAPYVQARVRSPPLSDVISEPDPNQLNKLL  118

Query  401   PCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRGC  580
             PC         N    V  IQVN F CGG+++G+  SH + D  S   F N+WA I+RG 
Sbjct  119   PCE------LDNVGDLVFAIQVNMFDCGGMAIGICFSHKVADALSFITFLNSWASISRGD  172

Query  581   AVVDDGGF---IFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQL  751
               + +      IFD + +FPP          +       +++EK V +RF   AS I  L
Sbjct  173   CNIKNSTVSRPIFDLATLFPP-------RSISGFKPSVEKAREKIVTKRFVFSASTIASL  225

Query  752   REQL--RLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPFP  925
             R +      +  +PSR EAL A +W   IA+ Q +      L+ +   +NLR RM+PP P
Sbjct  226   RSRYTDNKANEIKPSRIEALSAFIWARFIASTQGKPNPN-TLYRVAHAVNLRTRMDPPLP  284

Query  926   ENCLGNNTYGATVHWNQPT--EGNPSRHALALKFRDAIRGVN-DEAARRRYGKGG--FLH  1090
             E   GN +       + P+  E   + + +  + R AI+ ++ D  A+ + G     FL 
Sbjct  285   EYHFGNVSRFVM---SSPSFDEREDTCYGMVRQMRQAIKTIDGDYVAKIKEGNEHVEFLK  341

Query  1091  TALPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQV-MKDSVVFME  1267
                      +  E  K+ +     SSL     Y  D GWGKP W  +A    K+ V F++
Sbjct  342   Q--------LAEESMKREVASFSFSSLCRFPYYETDLGWGKPVWVGSASFPFKNLVCFID  393

Query  1268  -GRFGGVDLWMGLPEELMNIVMKNPQFV  1348
              G  GG++ W+ L EE M     + Q +
Sbjct  394   AGSSGGIEAWVNLKEEDMAKFQHDEQLL  421



>ref|XP_008437382.1| PREDICTED: BAHD acyltransferase At5g47980-like [Cucumis melo]
Length=437

 Score =   211 bits (536),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 139/455 (31%), Positives = 223/455 (49%), Gaps = 41/455 (9%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVDEL  223
             M++++  ++IIKPSSPTP  L  +N S++DQLS    +P + F+ +   +  +N   D L
Sbjct  1     MEVQILTKEIIKPSSPTPSHLHRFNISLLDQLSTAGYVPVILFFPNSNGATPFNERSDRL  60

Query  224   KKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREMVP  403
             KKSL++ L+  YPLAGR +E+ S I+CND G E++E      LS FL+ P  E++ + +P
Sbjct  61    KKSLAEILTRFYPLAGRPREN-SYIDCNDDGAEYVEARTNCVLSDFLKEPTPELLAQFLP  119

Query  404   CNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRGCA  583
                 T A E    GR+L++QV  F CGG+++G+  SH + D +SISV   +W+    G  
Sbjct  120   IK--TEAPEAADGGRMLLVQVTLFECGGMAMGISFSHKLVDASSISVILKSWSAAALGSD  177

Query  584   VVDDGGF---IFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQLR  754
             +V+       +  + +  P      DL             + K   RR    A +I  L+
Sbjct  178   MVEPEFLQTSLVPSPEGIPIAAPPTDLG-----------GKVKCSSRRLVFNAQSIADLK  226

Query  755   EQLRLISHYRPSRAEALIAVVWDAVIAA----NQKRHKGRINLHVLTSILNLRNRMEPPF  922
              +        P+R E + A++W   + A     +K      NL V++  +NLR R+ PP 
Sbjct  227   SKAASDIAPNPTRVEVVTALIWKCAMKAQASTTRKTTSPSPNLSVMSQTVNLRKRLTPPS  286

Query  923   PE----NCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLH  1090
             PE    N +GN    A   W +  +G      L    RD +R  N    +R  GK  F+ 
Sbjct  287   PEYSIGNLVGNFVTDAIPAWEKDLKG------LVELLRDGVREFNKNGIKRYEGKDCFMK  340

Query  1091  TALPIMSEIIKHEGS---KKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQVM-KDSVV  1258
                  + E ++  G    ++++    +SS     +Y  DFGWGKP W     +M  + VV
Sbjct  341   -----IFEWLQQSGGLFMREDVAFYISSSWTRFGLYEMDFGWGKPGWVSIGSIMFLNFVV  395

Query  1259  FMEGRFG-GVDLWMGLPEELMNIVMKNPQFVEFVS  1360
              M+ + G G++ W+ L E+ M     + + + F S
Sbjct  396   LMDTKDGEGIEAWVTLKEDEMTFFQSDDELLSFAS  430



>ref|XP_008222012.1| PREDICTED: vinorine synthase-like [Prunus mume]
Length=434

 Score =   211 bits (536),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 140/446 (31%), Positives = 226/446 (51%), Gaps = 34/446 (8%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSR--DYNGVVD  217
             M+I+V  RD IKPSSPTP  LR +  S +DQ++  + +P + FY +    R  D     D
Sbjct  1     MRIQVIERDCIKPSSPTPSHLRKHELSFLDQIATPIFMPMILFYTNNNGRRGNDVKIYSD  60

Query  218   ELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREM  397
              +K+SLS+ L+  YPLAGR+ +D + ++C DQG  +++  V  +LS  +  PD     ++
Sbjct  61    RVKQSLSEILTQYYPLAGRVIDD-AYVDCIDQGAHYVQAQVNCTLSDVISQPDPNQHNKL  119

Query  398   VPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRG  577
             +P +        N    VL +QVN F CGG+++G+ +SH I D  S+  F N+WA I+RG
Sbjct  120   LPYD------LDNVGDLVLAVQVNIFDCGGMAIGICISHKIVDAFSVITFLNSWASISRG  173

Query  578   CAVVDDGGF---IFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQ  748
                + +      +FD + +FPP          +        ++E  V +RF   AS +  
Sbjct  174   DCDIKNNTISPPLFDVATLFPP-------RSISGYKPSTGITRENIVTKRFVFSASMVAS  226

Query  749   LREQLRL--ISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPF  922
             LR +      +   P+R EAL   +W   IA+ Q     +    VL ++ NLR RM+PP 
Sbjct  227   LRSKYTENNSNERYPTRIEALSCFIWARFIASTQGEPNPKKIYKVLHAV-NLRTRMDPPL  285

Query  923   PENCLGNNTYG--ATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTA  1096
             PE  +GN +    AT+ ++   +   + + L  + RDA++ ++ +   +       L+  
Sbjct  286   PEYHIGNVSRFAIATLSFDGSKD---TCYGLVGQMRDALKTIDSDYLSKMRDGDTHLNFL  342

Query  1097  LPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQV-MKDSVVFMEGR  1273
                 +E +K E    N      +SL    +Y  DFGWGKP W  +A +  K+ VVFM+  
Sbjct  343   KQGAAEFMKGEVVSLNF-----TSLCRFPLYETDFGWGKPVWVGSASLPFKNLVVFMDTE  397

Query  1274  F-GGVDLWMGLPEELMNIVMKNPQFV  1348
               GG++ W+ L EE M    ++ Q +
Sbjct  398   SGGGIEAWVNLKEEDMAKFQEDEQLL  423



>ref|XP_010050981.1| PREDICTED: vinorine synthase-like [Eucalyptus grandis]
 gb|KCW81005.1| hypothetical protein EUGRSUZ_C02383 [Eucalyptus grandis]
Length=440

 Score =   211 bits (536),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 146/456 (32%), Positives = 230/456 (50%), Gaps = 34/456 (7%)
 Frame = +2

Query  38    ITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNG--V  211
             + MK+EV   + IKPSSPTP  LR +   ++DQL+    +P + FY +  +    N   V
Sbjct  1     MAMKVEVVSTETIKPSSPTPSHLRDFKLCLLDQLAPPFWVPVILFYSASNNEVAANSASV  60

Query  212   VDELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIR  391
                LK SLSQ LSL YPL GR+K + ++I+CND+G  ++E      LS  L NPD   ++
Sbjct  61    TGNLKTSLSQALSLFYPLGGRMKGN-TAIDCNDEGALYLEAKARFELSEVLSNPDMNQLQ  119

Query  392   EMVPCNPFTGAFEPNPDGRVLV-IQVNRFSCGGISVGLIMSHAIGDGASISVFANTWAR-  565
             + +P +  +    PN + +V+V +Q N F CGGI +G+ MSH I D AS+S F   W+  
Sbjct  120   QFLPFS--SDKVVPNIEEQVIVGVQANFFDCGGIGIGICMSHKIADAASVSAFLTAWSEI  177

Query  566   ----INRGCAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPA  733
                 IN   +++        AS++FPP       D   ++  G   S+EK + +RF    
Sbjct  178   ALNGINGKASLITP---FLKASELFPPK------DVNFQMPYGFT-SREKLLTKRFRFDG  227

Query  734   SAIDQLREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKG--RINLHVLTSILNLRNR  907
              ++ +LR +        P+R EA+ A++W + + A +KR +   +    V   ++N+R+R
Sbjct  228   ESLARLRARF---GSATPTRVEAVTALIWKSAVEAARKRPEWNEKYPSSVAAHVVNIRSR  284

Query  908   MEP-PFPENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGF  1084
             M P P PE+ LG N + ATV     T         A   R +IR ++ E      G+ G 
Sbjct  285   MRPQPLPEHALG-NLWRATVAPLIDTNKGVELQDFAGSLRKSIRAIDGEYLSVLQGERGL  343

Query  1085  --LHTALPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQVMKDSVV  1258
                + +L    ++ +  G K   Y    SS +    Y  DFG G+P W         ++V
Sbjct  344   EKAYESLKAARKLAESSGGKMEFYGF--SSWVNFPFYEVDFGLGRPTWLCTTGFPIGNMV  401

Query  1259  FMEG-RFG-GVDLWMGLPEELMNIVMKNPQFVEFVS  1360
             F+ G R G G++ W+ L E  M    +N + ++F+S
Sbjct  402   FLMGTRCGNGIEAWITLHEHDMIEFDRNDELLQFIS  437



>ref|XP_011071181.1| PREDICTED: vinorine synthase-like isoform X1 [Sesamum indicum]
 ref|XP_011071182.1| PREDICTED: vinorine synthase-like isoform X2 [Sesamum indicum]
Length=422

 Score =   210 bits (534),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 154/453 (34%), Positives = 230/453 (51%), Gaps = 44/453 (10%)
 Frame = +2

Query  38    ITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFY--DSPGSSRDYNGV  211
             + ++IEV   + IKPSSPTP+SLR Y  S +DQ++  + +P V FY  D+  SS + +  
Sbjct  1     MEIEIEVVSNETIKPSSPTPESLRKYQLSFLDQIAPPIFMPLVYFYPADAKFSSPEKS--  58

Query  212   VDELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIR  391
              + LKKSLSQ LS  YPLAG++ +D   ++CND+G  ++E     SLS  + NP      
Sbjct  59    -NHLKKSLSQVLSRFYPLAGQLIDDLY-VDCNDEGAPYVEAVANCSLSQVVTNP------  110

Query  392   EMVPCNPFTGAFEPNPDGRV----LVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTW  559
               +P N     F P     V    + +QV  F CGG +VG+++SH I D  S+ + ANTW
Sbjct  111   --IPKN--MDKFLPYKVDEVQNLGMAVQVTYFQCGGTAVGVLISHKIADALSLFLVANTW  166

Query  560   ARINRGCAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASA  739
             A + R     D     F+ +KIFPP ++ A       + +      E+ V + F  PAS 
Sbjct  167   AAVARNGNYDDVPSPKFEGAKIFPP-RDAAGFKPSTGIVK------EQLVTKIFTFPASK  219

Query  740   IDQLREQLR----LISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNR  907
             I  L+E+       +   RPSR EAL A +W   I+A Q +      ++ +   +NLR R
Sbjct  220   ISALQERYSGGTAELPQRRPSRVEALSAFIWTRFISATQMKADPN-KIYTVHHAVNLRTR  278

Query  908   MEPPFPENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDE-AARRRYGKGGF  1084
             ++PP  E   GN +  A      P+ G      L  K R+AIR V+ E  A+ R G    
Sbjct  279   LDPPLSEYHFGNISRLAIA---MPSVGVDGGSELLQKVREAIRAVDGEYVAQLRQG----  331

Query  1085  LHTALPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQ-VMKDSVVF  1261
                 L  + E +  + +K  +     +SL    +Y ADFGWGKP W  +A  V K+ V F
Sbjct  332   -DKHLNFLKERMA-QANKGELVTFNFTSLCRFPLYEADFGWGKPVWVGSAGLVYKNLVTF  389

Query  1262  MEGRFG-GVDLWMGLPEELMNIVMKNPQFVEFV  1357
             ++   G G++ W+ L +E M     + +  EF+
Sbjct  390   IDTAAGNGIEAWINLKKEDMEKFEADLELQEFL  422



>ref|XP_008222021.1| PREDICTED: BAHD acyltransferase At5g47980-like [Prunus mume]
Length=446

 Score =   211 bits (536),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 142/451 (31%), Positives = 231/451 (51%), Gaps = 36/451 (8%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVD--  217
             MKIE+ +++ IKPSSPTP +L+++  S++DQLS     P V FY  P +  +     +  
Sbjct  5     MKIEIVKKETIKPSSPTPHNLKSFKLSLLDQLSPVAYGPLVLFY--PNNVSEVTLTEERS  62

Query  218   -ELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIRE  394
              +LKKSLS+ L+  YPLAGRIK D   IECND+G  ++E  V   LS+FL+ P  E+++ 
Sbjct  63    HQLKKSLSEALTRFYPLAGRIK-DNLFIECNDEGAVYVEARVNALLSNFLDQPSLEILKL  121

Query  395   MVPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWA--RI  568
             ++P    +        G +L++Q + F CGG+++G+ MSH + D +++S F   WA   +
Sbjct  122   LLPIKVDS---PEAATGCLLLVQASFFKCGGLAIGVCMSHKLADASTLSTFIKVWAATAL  178

Query  569   NRGCAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQ-EKYVVRRFYIPASAID  745
               G  VV D    F A+  +PP       D  A+    A E +  K V +RF      + 
Sbjct  179   GLGHTVVPD----FSAATRYPP------RDFSAQSPAAAVEMKIVKCVTKRFVFDGPKMR  228

Query  746   QLREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPFP  925
              L+ ++   S  RP+R EA+  ++W     A+ K   G   L +++  +N+R R+ P  P
Sbjct  229   ALKAKVTSGSVQRPTRVEAVTGLIWKCATKAS-KLSSGISKLSMVSQSVNIRKRVVPQLP  287

Query  926   ENCLGNNT-YGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTALP  1102
             +  +GN   Y   +      E N     L  + R  +   N+  ++R  G   F      
Sbjct  288   QTSIGNLAGYYTAMAEESGIELN--SMELVSRLRKGMVEFNENHSKRLQGDNVF-----E  340

Query  1103  IMSEIIKHEGS---KKNMYCLYTSSLLGMQVYAADFGWGKPRW-AVNAQVMKDSVVFMEG  1270
              + E  K  G+   + ++     +SL    +Y  DFGWGKP W ++   V+K+  + ++ 
Sbjct  341   AICEYFKEIGNIMRRDDINLFICTSLCNFGIYEIDFGWGKPIWVSIPGGVVKNVAILIDT  400

Query  1271  RFG-GVDLWMGLPEELMNIVMKNPQFVEFVS  1360
             + G GVD W+ L EE M +  ++P+ + F S
Sbjct  401   KEGDGVDAWISLSEEDMALFERDPELLAFAS  431



>ref|XP_010044502.1| PREDICTED: vinorine synthase-like [Eucalyptus grandis]
Length=436

 Score =   210 bits (535),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 146/445 (33%), Positives = 240/445 (54%), Gaps = 23/445 (5%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGV--VD  217
             MKI V  ++ IKPS  TP   +TY FS++DQL+    +P V FY +P   +D++ V   +
Sbjct  1     MKIRVISKETIKPSLVTPSQDQTYRFSLLDQLAPPFYVPVVLFYSAPEPDQDFDHVNIYE  60

Query  218   ELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREM  397
             +LK SLS+ L+  YPLAG+IK D  +++   QG  F++  V   L+  L NP+ ++++++
Sbjct  61    KLKTSLSECLTCFYPLAGQIKGDEHAVDLG-QGAVFVKARVNARLAKLLANPELKLVQQL  119

Query  398   VPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRG  577
             +P +P+    +   +  V  IQ+N F CGGI +G+ +SH I DGA++S F ++WA I+RG
Sbjct  120   LPLDPYNIKCQ---NALVTAIQLNLFDCGGIGIGICISHKIADGATLSTFLSSWAAISRG  176

Query  578   CAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQLRE  757
                +       D + +FPP        +F          +EK V +RF    +++  LR 
Sbjct  177   ANKL--VAPYLDTTTLFPP-------REFQVPLPNNLIKKEKIVTKRFEFDTASLAALRT  227

Query  758   QLRLISHYR-PSRAEALIAVVWDAVIAANQK-RHKGRINLHVLTSILNLRNRMEPPFPEN  931
             +    S  + P+  EA+ A++  + + A  +   KGR +  V++  +NLR RM PP P++
Sbjct  228   KAGNGSTSKSPTLVEAVTALICKSAMNARTEISGKGRSST-VISHAVNLRGRMNPPLPDH  286

Query  932   CLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTALPIMS  1111
               GN    A     +  + +   H LA   R AIR ++ +  R+  G+ GF H A   + 
Sbjct  287   SFGNIWRFAIATIKEDVD-DAELHVLADHLRTAIRKIDSDYMRKLQGEDGF-HWACESIR  344

Query  1112  EIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQV-MKDSVVFMEGRFG-GV  1285
             E ++    K ++     SS + +  Y  DFGWGKP WA  + V +K++V+ M  R G G+
Sbjct  345   E-VRELMYKGDVESYRFSSWVRLPFYETDFGWGKPVWACISSVPIKNAVILMSSRSGNGI  403

Query  1286  DLWMGLPEELMNIVMKNPQFVEFVS  1360
             + W+ L E+ M     +P  ++FVS
Sbjct  404   EAWVTLDEQEMAKFQSDPLLLQFVS  428



>ref|XP_004239499.1| PREDICTED: vinorine synthase [Solanum lycopersicum]
Length=431

 Score =   210 bits (534),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 141/452 (31%), Positives = 233/452 (52%), Gaps = 33/452 (7%)
 Frame = +2

Query  38    ITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVD  217
             + ++IE+  + +IKPS+PTP  L  Y  S +DQ++ N+ +P V FY +  ++     + +
Sbjct  1     MKIEIEIISKLVIKPSTPTPHELHNYKLSYLDQITPNILMPLVFFYQA-NNNFTKTHISN  59

Query  218   ELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREM  397
             +LK SLS TL+  YPL GR+    + + CND+GV ++E     +LS FL +P    + ++
Sbjct  60    QLKTSLSHTLTKFYPLCGRLDVANTHVNCNDEGVPYVEAIAKCNLSDFLLDPLPNELNKL  119

Query  398   VPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRG  577
             +PC+        +     L++Q N F CGG+++G+ +SH I D  S  +  NTW  I RG
Sbjct  120   IPCDLH------DVKEFCLLVQANFFQCGGMAIGIAISHKIADALSTFMIINTWGAIARG  173

Query  578   CAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQLRE  757
                +D     FD+S +FPP     D+ +F          ++  V +RF   AS +  LR+
Sbjct  174   S--IDIPCPRFDSSILFPP----RDVTKF---KSSVMIEKDNIVTKRFVFSASKVSALRD  224

Query  758   QL--RLISHYR-PSRAEALIAVVWDAVIAA-NQKRHKGRINLHVLTSILNLRNRMEPPFP  925
             +   +   + R PSR EAL A +W  ++A+ + +R + +I  + +   +NLR R +PP P
Sbjct  225   KYTEKGTENTRPPSRIEALSAFIWTRLMASIHAERDETKI--YGMVHTVNLRTRSDPPLP  282

Query  926   ENCLGN-----NTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLH  1090
             ++  GN      T  AT   +  +        L  K R++I  VN E       K     
Sbjct  283   DSLFGNVMQVVVTVPATDSNDNNSTNKEQDFELVKKVRESINNVNSEFVSGLRKKD---Q  339

Query  1091  TALPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQ-VMKDSVVFME  1267
               L  + E   +E  K  +     +SL  + +Y ADFGWGKP W  +A+ V+KD + F++
Sbjct  340   KHLSFIKE-KANEQRKGELVVFNFTSLCRLPLYKADFGWGKPIWVGSARLVLKDVIGFLD  398

Query  1268  GRFG-GVDLWMGLPEELMNIVMKNPQFVEFVS  1360
              + G G++ W+ L EE M I   + + + + S
Sbjct  399   TKSGNGIEAWVNLREEDMAIFEADKELLSWCS  430



>ref|XP_010090836.1| Vinorine synthase [Morus notabilis]
 gb|EXB40961.1| Vinorine synthase [Morus notabilis]
Length=462

 Score =   211 bits (536),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 147/474 (31%), Positives = 241/474 (51%), Gaps = 57/474 (12%)
 Frame = +2

Query  41    TMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYD-----------SPG  187
             T  +E+ +R+ IKPSSPTPQ LR +  SI+DQL++ + IP + FY            S  
Sbjct  5     TFNVEIVQRERIKPSSPTPQDLRIHELSILDQLALVIYIPIILFYPRRTIDDKRHHYSNC  64

Query  188   SSRDYNGVVDELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLE  367
              + + + ++  LK SLS+TL+L YPLAGRIK+D + +ECND+G E  E  V   +S  LE
Sbjct  65    VNNNIDMIIYSLKSSLSKTLTLFYPLAGRIKQDYTVVECNDEGAELTEARVDHPMSEILE  124

Query  368   NP--DFEMIREMVPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASIS  541
              P  D E +R+++  +  +   +   DG +L +Q+N F+CGG ++G+ +SH + D +++S
Sbjct  125   RPAPDPEALRKLLAVDVES---KEASDGALLHVQINVFACGGTAIGVSLSHKVADASTLS  181

Query  542   VFANTWA---RINRGCAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVV  712
             +F +TWA   ++N   A+ +     F ++ +FP       L     +AR      EK ++
Sbjct  182   MFISTWAATAKLNHIEALPE-----FSSASLFPARHGHHQLGLNKELAR------EKCLM  230

Query  713   RRFYIPASAIDQLREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSI-  889
             RR+   AS I  L+ +    S   P+R E + AV+W   +  ++ + +G+ +     SI 
Sbjct  231   RRYVFDASNIAILKAKSASSSVESPTRVEVVSAVIWKCALGVSRAKFRGKYSSSSTNSIY  290

Query  890   ------LNLRNRMEPPFPENCLGN--NTYGA-------TVHWNQPTEGNPSRHALALKFR  1024
                   +N+R R  PP PE   GN   ++ A        +  +   + +     L  + R
Sbjct  291   VQFRQDVNIRRRTSPPLPEILAGNLVGSFSAKHDLLRDHIADDDHDDPDDGVQVLVSELR  350

Query  1025  DAIRGVNDEAARRRYGKGGFLHTALPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFG  1204
               I     E  +  Y KG    +    M + +K   S+K  + +  SS  G + Y ADFG
Sbjct  351   KGI-----EEMKEDYSKGIIFGSEK--MLKALKE--SRKYDHVVNCSSWCGFKFYEADFG  401

Query  1205  WGKPRWAVNAQV-MKDSVVFMEGRFG-GVDLWMGLPEELMNIVMKNPQFVEFVS  1360
             WG P W   A V MK+ VV ++ R G G++ W+ L E+ + ++  N     F +
Sbjct  402   WGLPFWVSLASVAMKNIVVLLDARDGKGIEAWLTLGEDDVALLESNEVLRAFAT  455



>ref|XP_004295709.1| PREDICTED: BAHD acyltransferase At5g47980-like [Fragaria vesca 
subsp. vesca]
Length=423

 Score =   210 bits (534),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 140/446 (31%), Positives = 221/446 (50%), Gaps = 37/446 (8%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVDEL  223
             MK+++  ++ I PSSPTP  L+T + S +DQL   V +P + FY +P ++ + + +   L
Sbjct  1     MKVKIIHKETITPSSPTPSHLKTLHLSFMDQLVPEVYVPLLLFYPNP-TTHEKSSI---L  56

Query  224   KKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREMVP  403
             K SLS+TL+  YPLAG+ + +  SI C+D G  F+E  V   +S  LENPD EM++ + P
Sbjct  57    KTSLSETLTHFYPLAGKFQYN-DSICCDDHGAAFVEARVNCRVSKILENPDAEMLKHLFP  115

Query  404   CNPFTGAFEPNP--DGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRG  577
                   AFE      G +L++QVN F CGG+++ + +SH + D  ++S F   WAR+ +G
Sbjct  116   -----AAFESTQALTGHLLLVQVNFFECGGMAIAINISHKVADAFTLSTFTKIWARVAQG  170

Query  578   CAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAE-SQEKYVVRRFYIPASAIDQLR  754
               V+         + ++PP         F   ++  AE +QE+ ++RRF   AS I  L+
Sbjct  171   HPVLLPADSFGALTYLYPP-------QDFLNASKPLAEYTQEQCMIRRFVFDASRIAALQ  223

Query  755   EQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPFPENC  934
              +    S   P+R E + A++W   + A+ + + G I   V +  +N+R R   PF EN 
Sbjct  224   FKAASASVTNPTRIEVVSALIWKCAMEAS-RSNSGSIRPSVCSQPVNMRKRSGKPFVENV  282

Query  935   LGNNTY---GATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTALPI  1105
             LGN  +     TV      EG     +L   FR  +     E  +  Y  G     A   
Sbjct  283   LGNFVWFFKAITV------EGEVDLQSLVATFRKCM-----EDFKVNYRNGVSAEQAYQT  331

Query  1106  MSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQVMKDSVVFMEGRFG-G  1282
             + E  K    K+ M     +S      Y  +FGWGKP W      +K+    M+   G G
Sbjct  332   IKESAKLL-EKEGMDSYTCTSWCRFPFYETNFGWGKPSWVSTPYALKNKFYLMDANDGNG  390

Query  1283  VDLWMGLPEELMNIVMKNPQFVEFVS  1360
             ++ ++ L EE M I   N + + + S
Sbjct  391   IEAYVTLLEEDMAIFGSNQELLAYAS  416



>ref|XP_006484023.1| PREDICTED: vinorine synthase-like [Citrus sinensis]
Length=480

 Score =   211 bits (537),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 143/450 (32%), Positives = 225/450 (50%), Gaps = 28/450 (6%)
 Frame = +2

Query  35    QITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFY---DSPGSSRDYN  205
             ++ +++EV   + IKPSSPTPQ L  Y  S +DQ+S  V  P V FY   D   ++ +  
Sbjct  51    KLQLEVEVISTETIKPSSPTPQHLGHYQLSFLDQISPPVYNPLVLFYTADDEINNNNNTE  110

Query  206   GVVDELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEM  385
              + + +K+SLS+  +  YPLAGRI +D + IECND+G+ F +  V   L   L+NP+   
Sbjct  111   TLGNFIKQSLSEVFTCFYPLAGRIHKDNNFIECNDEGIPFKKARVKCQLLHLLQNPNPNE  170

Query  386   IREMVPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWAR  565
             + +++P +       P      + IQ N F CGGI +G+ +SH +GD  S   F  +WA 
Sbjct  171   LNKLLPFDLAEAKELP------IGIQFNIFDCGGIGLGICISHKVGDAQSFFTFVKSWAA  224

Query  566   INRGCAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAID  745
               RG        F+  ++ +FPP KN    +    +      ++E  V +RF   A  I+
Sbjct  225   TARGEKHTVRVEFV--SATLFPP-KNILGFEPSTGI------TKENVVTKRFVFAAPKIE  275

Query  746   QLREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRIN-LHVLTSILNLRNRMEPPF  922
             ++R          PSR EAL A +W   +AA +  HK   +  + +T  +NLR +MEPP 
Sbjct  276   EIRSNYTHSESCTPSRVEALSAFIWSRFVAATKPSHKTSDHRFYTITHAVNLRTKMEPPL  335

Query  923   PENCLGNNTYGA-TVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTAL  1099
             P+   GN    A T+      +     H +  + RD++R V+ +  ++   + G  H   
Sbjct  336   PDYSFGNLYRTAVTIPCLDNEDEERYNHIIISQMRDSLRKVDKDYVKKL--QQGDEHLGF  393

Query  1100  PIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQV-MKDSVVFMEGRF  1276
              I     K   ++  +     +SL    +Y ADFGWGKP WA +A +  K+ V FM+   
Sbjct  394   -IRDRAEKF--ARGEIVSFSFTSLCRFPLYEADFGWGKPVWAASASLSFKNLVTFMDTVS  450

Query  1277  G--GVDLWMGLPEELMNIVMKNPQFVEFVS  1360
             G  GV+ W+ L EE M  +  + + + F S
Sbjct  451   GDHGVEAWINLKEEDMAKLEADEKLLSFAS  480



>emb|CDY04190.1| BnaA09g19680D [Brassica napus]
Length=459

 Score =   211 bits (536),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 141/466 (30%), Positives = 234/466 (50%), Gaps = 42/466 (9%)
 Frame = +2

Query  14    SLINLLHQ--ITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPG  187
             S I   HQ  +T ++EV  RDIIKPSSPTP  L+ +  S+++QL   +  P + FY +  
Sbjct  6     SFIRSFHQKSLTTRVEVISRDIIKPSSPTPNHLKNFKLSLLEQLGPTIFGPMLFFYSANY  65

Query  188   SSRDYNGVVDELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLE  367
               +    +++ LKKSLS+TL+  YPL+GR+  + +SI CND G +F+E  V   LS+ L+
Sbjct  66    RIKQTEQLLN-LKKSLSETLTHFYPLSGRLNGN-TSINCNDSGADFLEAQVNSPLSNLLQ  123

Query  368   NPDFEMIREMVPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVF  547
              P  EM+ +++P    T         ++L+ Q   F CGG+++G+ +SH + D  S+ +F
Sbjct  124   EPSSEMLEQLIP----TSVDSIEARTKLLLAQATFFKCGGMAIGVCVSHKLADATSVGLF  179

Query  548   ANTWARINRGCAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYI  727
               +W+ I    ++   G  +FD  KIFPP  N ++      V      +Q   + +RF  
Sbjct  180   MKSWSAITSQGSIKTVGSPVFDTLKIFPP-GNFSETSPAPVVEPDIKMNQT--LSKRFVF  236

Query  728   PASAIDQLREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNR  907
              +S+I+ L+ +       +P+R EA+ A +W   + A +   +      +L +  +LR+R
Sbjct  237   DSSSIEALQAKASSFEVTQPTRVEAVSAFIWKLAMKATRTVSRTS-KPSILANSASLRSR  295

Query  908   MEPPFPENCLGN-NTYGATVHWNQPTEGNPSR--HALALKFRDAIRGVNDEAARRRYGKG  1078
             + PPF +N +GN  +Y A     +  EG   R    L  + R A +   DE   +  G G
Sbjct  296   VSPPFTKNSIGNLVSYFAA----KAEEGEKQRKLQTLVAEIRRAKQRFRDEHIPKLVGNG  351

Query  1079  GFLHTALPIMSEIIKHEGSKKNM--------YCLYTSSLLGMQVYAADFGWGKPRWAVNA  1234
                         I  H+    +M        Y L ++   G+  Y  DFGWGKP W    
Sbjct  352   DATEV-------ICNHQKEAGDMIASGGFDFYILTSACRFGL--YEIDFGWGKPVWFAFP  402

Query  1235  QVMKDSVVFM----EGRFGGVDLWMGLPEELMNIVMKNPQFVEFVS  1360
              V + ++V +    EG  GG++ W+ L E+ M +  ++ + ++F S
Sbjct  403   SVRQKNIVALVDTKEG--GGIEAWVNLNEQEMKLFEEDRELLDFAS  446



>ref|XP_006438136.1| hypothetical protein CICLE_v10033777mg [Citrus clementina]
 gb|ESR51376.1| hypothetical protein CICLE_v10033777mg [Citrus clementina]
Length=430

 Score =   210 bits (534),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 142/449 (32%), Positives = 223/449 (50%), Gaps = 28/449 (6%)
 Frame = +2

Query  38    ITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFY---DSPGSSRDYNG  208
             + +++EV   + IKPSSPTPQ L  Y  S +DQ+S  V  P V FY   D   ++ +   
Sbjct  2     MKLEVEVISTETIKPSSPTPQHLGHYQLSFLDQISPPVYNPLVLFYTADDEINNNNNTET  61

Query  209   VVDELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMI  388
             + + +K+SLS+  +  YPLAGRI +D + IECND+G+ F +  V   L   L+NP+   +
Sbjct  62    LGNFIKQSLSEVFTCFYPLAGRIHKDNNFIECNDEGIPFKKARVKCQLLHLLQNPNPNEL  121

Query  389   REMVPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARI  568
              +++P +       P      + IQ N F CGGI +G+ +SH +GD  S   F  +WA  
Sbjct  122   NKLLPFDLAEAKELP------IGIQFNIFDCGGIGLGICISHKVGDAQSFFTFVKSWAAT  175

Query  569   NRGCAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQ  748
              RG        F+  ++ +FPP KN    +    +      ++E  V +RF   A  I++
Sbjct  176   ARGEKHTVRVEFV--SATLFPP-KNILGFEPSTGI------TKENVVTKRFVFAAPKIEE  226

Query  749   LREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRIN-LHVLTSILNLRNRMEPPFP  925
             +R          PSR EAL A +W   +AA +  HK   +  + +T  +NLR +MEPP P
Sbjct  227   IRSNYTHSESCTPSRVEALSAFIWSRFVAATKPSHKTSDHRFYTITHAVNLRTKMEPPLP  286

Query  926   ENCLGNNTYGA-TVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTALP  1102
             +   GN    A T+      +     H +  + RD++R V+ +  ++   + G  H    
Sbjct  287   DYSFGNLYRTAVTIPCLDNEDEERYNHIIISQMRDSLRKVDKDYVKKL--QQGDEHLGF-  343

Query  1103  IMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQV-MKDSVVFMEGRFG  1279
             I     K   ++  +     +SL    +Y ADFGWGKP W  +A +  K+ V FM+   G
Sbjct  344   IRDRAEKF--ARGEIVSFSFTSLCRFPLYEADFGWGKPVWTASASLSFKNLVTFMDTVSG  401

Query  1280  --GVDLWMGLPEELMNIVMKNPQFVEFVS  1360
               GV+ W+ L EE M  +  + + + F S
Sbjct  402   DHGVEAWINLKEEDMAKLEADEKLLSFAS  430



>ref|XP_006430562.1| hypothetical protein CICLE_v10013397mg [Citrus clementina]
 gb|ESR43802.1| hypothetical protein CICLE_v10013397mg [Citrus clementina]
Length=431

 Score =   209 bits (533),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 143/440 (33%), Positives = 223/440 (51%), Gaps = 38/440 (9%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVDEL  223
             M++ +   + IKPSSPTP  LRT+  S +DQLS    +  + FY S G+S  +      L
Sbjct  1     MELRISSTENIKPSSPTPDHLRTHRLSFIDQLSPRAYLSMILFY-SAGASPVH------L  53

Query  224   KKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAES-LSSFLENPDFEMIREMV  400
             KKSLS+TL+  YP AG+ K D   ++C+D GV FIE  +AE  +S  ++     ++ +++
Sbjct  54    KKSLSETLTHFYPFAGQFK-DSPVVDCDDHGVTFIEAYLAEEDVSEVIQQAKANILEQLM  112

Query  401   PCNPFTGA-FEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRG  577
             PC P      E N     L++QVN F CGG+++G+   H I D A+ + F  TW    RG
Sbjct  113   PCKPHESTRVEHN-----LIVQVNYFGCGGMAIGICFHHKIADAATAANFLKTWGLHARG  167

Query  578   CAVVDDGGF---IFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQ  748
                 D   F   ++D++ IF P ++  D+     V  G        VV+RF I    I  
Sbjct  168   AGAGDTNDFKHVVYDSNSIF-PAQDLPDMS----VNLGLGLFSLDSVVKRFTIEGEKIAS  222

Query  749   LREQLRLISHY--RPSRAEALIAVVWDAVIAA-----NQKRHKGRINLHVLTSI--LNLR  901
             LRE++     Y  RPSR E + +V+  A++AA     +            +T+I  +NLR
Sbjct  223   LREKVVKAEPYLDRPSRVEVVSSVILGALLAAYGGLRDDDEEFTTTPPKNVTAIFAVNLR  282

Query  902   NRMEPPFPENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGG  1081
              RM PP PE   GN +  A ++     E   +  +LA + R +IR V+D+  R+ Y +G 
Sbjct  283   KRMNPPLPEQSFGNISSAAFLNLPIDREKKINHSSLAGQLRQSIRMVDDQFVRKLYAEGE  342

Query  1082  FLHTALPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKP-RWAVNAQVMKDSVV  1258
              L+     + + ++ +GS K+      SS   M  Y ADFGWGKP    V  +    +++
Sbjct  343   ILN-----ILKAVEAQGSPKSNKVFVISSWCKMPFYEADFGWGKPVSIGVGTRFTDAAIL  397

Query  1259  FMEGRFGGVDLWMGLPEELM  1318
                 +   ++ W+GL ++ M
Sbjct  398   VDSCQTDAIEAWVGLSKQDM  417



>ref|XP_008340165.1| PREDICTED: deacetylvindoline O-acetyltransferase-like [Malus 
domestica]
Length=437

 Score =   209 bits (533),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 151/454 (33%), Positives = 230/454 (51%), Gaps = 44/454 (10%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVD--  217
             M+++   R++IKPS+PTP  LRT+  SI+DQ++    +P V FY  P  + DY  V D  
Sbjct  4     MEVQNISREVIKPSTPTPPHLRTHKLSILDQINPRSYVPVVYFY--PKEASDYWSVADKS  61

Query  218   -ELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAE-SLSSFLENPDFE---  382
              +LKKSLS+TLS  YP AGRI+ DR SI+CND+GV F+E  +    LS  LENP  E   
Sbjct  62    NQLKKSLSETLSKYYPFAGRIR-DRFSIDCNDEGVAFVETQIRNFKLSDILENPKDEDLA  120

Query  383   -MIREMVPCNPFTGAFEPNPDGRVLV-IQVNRFSCGGISVGLIMSHAIGDGASISVFANT  556
              +I E V       A+  +PD  V+V +QV+ F CGG+++G+ MSH I D ++I  F N 
Sbjct  121   LLISEDV-------AWNEDPDVSVIVDVQVSFFECGGMALGIGMSHKIADASTIINFVND  173

Query  557   WARINRGCAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPAS  736
             WA + R   V       F A  IFP      DL  F      A   +   V +RF   A+
Sbjct  174   WAAVARDQYVPSPE---FVAENIFP----QGDLPLFPE----AVPEKSDCVAKRFVFDAT  222

Query  737   AIDQLREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEP  916
              I  L+  L       P+R E + A ++   I+A +       N  VLT  +NLR RM P
Sbjct  223   KIAALK-ALVADKVQNPTRVEVVAAFIYSCTISALRLTSGSSSNPTVLTQSVNLRTRMVP  281

Query  917   PFPENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTA  1096
             P P+N +G   +  TV  +   +     H L  + +  +    D  A++  GK  +    
Sbjct  282   PVPQNSVGCMVWIYTV--STAEDSVIELHDLVAQLKQNMTRFCDSYAQKFRGKDQW----  335

Query  1097  LPIMSEIIKHEG----SKKNMYCLYTSSLLGMQVYAADFGWGKPRW-AVNAQVMKDSVVF  1261
              P++ +    E     S+ N+     +S     +Y  DFGWGKP W  V +   KD  + 
Sbjct  336   -PVIFQXCLQESMVEFSRPNLVMYKCTSWCRFPMYEVDFGWGKPIWITVPSCTTKDCFIL  394

Query  1262  MEGRFG-GVDLWMGLPEELMNIVMKNPQFVEFVS  1360
             ++ + G G++ ++ L ++ +++  ++ + + F S
Sbjct  395   IDTKNGEGIEAYVNLEKQQLDVFERDEELLAFAS  428



>ref|XP_006464646.1| PREDICTED: salutaridinol 7-O-acetyltransferase-like [Citrus sinensis]
Length=476

 Score =   211 bits (536),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 146/471 (31%), Positives = 230/471 (49%), Gaps = 37/471 (8%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFY----DSPGSSRDYNGV  211
             M++E+  R+ IKPSSPTP  L+++   ++DQ   N+ +P V +Y    D   S+ D + +
Sbjct  17    MEVEIISRESIKPSSPTPHDLKSHKLCLLDQFRSNIYVPRVLYYPLNQDDLSSTIDIDHI  76

Query  212   V----DELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDF  379
             V     +LK+SLS+ L   YPLAG++  +  S++CND+GV F+E      L+ FL  PD 
Sbjct  77    VSKRLQQLKQSLSEALVRFYPLAGKLT-NNFSVDCNDEGVYFVEAAAKIHLNEFLIQPDH  135

Query  380   EMIREMVPC--NPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFAN  553
              +I +  P   N   G         V  +QV  F+CGG+ +   +SHA GDG S S F  
Sbjct  136   NLIYKFFPVDGNEQRGQI---AGAHVAKVQVTSFACGGLVICACISHAFGDGTSFSSFMK  192

Query  554   TWARINRGCAVVDDGGFI---FDASKIFPPVKNTAD----LDQFARVARGAAESQEKYVV  712
              WA   R     ++  +I   +DAS +FPP  N  D    L   +R + G      K+VV
Sbjct  193   AWAATARNKTSEEEAIYICPNYDASSLFPP--NDGDLFHQLKATSRASFGRFFETGKFVV  250

Query  713   RRFYIPASAIDQLREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSIL  892
             RRF   A A  +L+ + +      P+R E + A +  +V+ A + R  G +   +L+  +
Sbjct  251   RRFVFDAKATAELKAKAKSSRVQNPTRVEVVSATLSKSVMTAFKTR-SGSLKPTLLSHAV  309

Query  893   NLRNRMEPPFPENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYG  1072
             NLR++  PP  EN +GN  +         TE       L  + R+A+   + +  +   G
Sbjct  310   NLRSKARPPLSENLIGNIVWKTNA---LCTEEEVDLDVLVWQLREALSKFDGDFVKSLQG  366

Query  1073  KGGFLHTALPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNA----QV  1240
              GG L  +  I  E   +  +K     +  SS      Y  DFGWGKP W   A     +
Sbjct  367   VGGLLKLSEDIKCEAEAYSDAKNK---IMFSSWCTFGFYGIDFGWGKPIWVSGACLGGSI  423

Query  1241  MKDS--VVFMEGRFG-GVDLWMGLPEELMNIVMKNPQFVEFVSAGFSKSKL  1384
             ++ S  ++ M+ R G G++ W+ L EE M ++  + + +E  +   S  KL
Sbjct  424   VQSSPTIILMDSRSGNGIEAWVLLLEEDMALLEVDEKLLEVATIDPSPLKL  474



>ref|XP_011031655.1| PREDICTED: vinorine synthase-like [Populus euphratica]
Length=447

 Score =   210 bits (534),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 150/460 (33%), Positives = 225/460 (49%), Gaps = 45/460 (10%)
 Frame = +2

Query  47    KIEVR--RRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGV---  211
             KIEV    +++IKPSSPT Q  + Y  S+ DQL+     P + FY  P +   +N +   
Sbjct  3     KIEVHIISKELIKPSSPTIQQKKPYKLSLFDQLTPTTYSPAIFFY--PMNDAGFNNITAK  60

Query  212   --VDELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEM  385
               +D LKKSLS+TL+L YPL+GR+K D   I+C  +GV F+E  V   LS +L++ + E 
Sbjct  61    TRIDSLKKSLSETLNLYYPLSGRVK-DNLFIDCFSEGVPFLEAQVNCRLSDYLKHHEVES  119

Query  386   IREMVPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWAR  565
             +   +PC PFT   + N    +   QV+ F+CGGIS+G   SH + DG +   F + WA 
Sbjct  120   LNHFLPCQPFT---KENMSAPISAFQVSIFACGGISLGWTASHKLVDGGTAKTFLSAWAS  176

Query  566   INRGCAVVDDGGFIFDASKIFPP----VKNTADLDQFARVARGAAESQEKYVVRRFYIPA  733
              +RG     +      AS  FPP     +N   L +      G       Y+ RRF    
Sbjct  177   KSRGEHT--EAPDFSKASLFFPPRNPLPQNHISLTETLWFREG------NYITRRFVFDP  228

Query  734   SAIDQLREQLRL-ISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRM  910
              AI  LR + +      +PSR E L   +W   +AA+ K         +L   +NLR+R 
Sbjct  229   KAIAMLRAKAKAGKPDNKPSRTETLSCFIWKCCMAAS-KAISDSPKPSILVEAVNLRSRT  287

Query  911   EPPFPENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLH  1090
             +PP  E  +GN  + AT   N PT+ N   H L  +  +AI   + +  +   G+ GF  
Sbjct  288   KPPLSEASIGNIFWWATAVAN-PTDTNTELHELVNQLNEAIALYDSDYTQTMQGEEGF--  344

Query  1091  TALPIMSEIIKH-EG----SKKNMYCLYTSSLLGMQVYAADFGWGKPRW----AVNAQVM  1243
                  MS+     EG     K +++       LG+    A+FGWG+P W           
Sbjct  345   ---ETMSDYCSQLEGLFSLEKPDIFAFTCWCYLGLT--KANFGWGEPFWVGLMGKAGPAF  399

Query  1244  KDSVVFMEGRFG-GVDLWMGLPEELMNIVMKNPQFVEFVS  1360
             ++  V ME + G G++ W+ L +E M I+ ++P+F+ F S
Sbjct  400   RNLTVLMETKDGNGIEAWVTLDQERMAILERDPEFLAFAS  439



>ref|XP_009361768.1| PREDICTED: BAHD acyltransferase At5g47980-like [Pyrus x bretschneideri]
Length=451

 Score =   210 bits (534),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 141/457 (31%), Positives = 229/457 (50%), Gaps = 36/457 (8%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFY-----DSPGSSRDYNG  208
             +K+E+  R  IKPS+ TP  LR+Y  S +DQ++  +  P + FY      S  S+R +  
Sbjct  5     IKVEIIERQTIKPSTSTPHHLRSYKLSFLDQMAFVIYTPLLLFYPIASTTSNVSTRHHAM  64

Query  209   VVDE----LKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPD  376
              +DE    L +SL++TL+  YPLAGRI +  S +ECND G  FI+  ++  LS  LENPD
Sbjct  65    SIDERCRHLIESLAKTLTHFYPLAGRIVKGNSIVECNDGGAAFIKARISCCLSDILENPD  124

Query  377   FEMIREMVPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANT  556
              ++++  +P    +   +    G +L++QVN F CGG+++GL +SH I D +++  F N 
Sbjct  125   GQILKRFLPIEIES---KEAGTGWLLLVQVNLFECGGMAIGLSISHRIADASTLCTFINC  181

Query  557   WARINRGCAVVDDGGFI--FDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIP  730
             WA I  G +  D    +  F A+ +F P++ ++     AR        +EK V +R+   
Sbjct  182   WATIALGSSDSDQVLNLPEFGAASVFKPIEFSSSSQPPAREV-----VKEKCVTQRYVFD  236

Query  731   ASAIDQLREQLRLISHYRPSRAEALIAVVWDAVIAANQK--RHKGRINLHVLTSILNLRN  904
             AS I  L+ ++      +P+R EA+ A++W     A++   R +G          +NLR 
Sbjct  237   ASKISTLQSEVASSFVAKPTRVEAVSALIWKCATEASRSNLRKQGP---SFFRQDVNLRK  293

Query  905   RMEPPFPENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGF  1084
             R+ PP PEN L  N  G+            +   L  K R+ I G+ ++ A +       
Sbjct  294   RVVPPLPEN-LAGNVVGSFTSKADEESSVINLKDLVAKLREGIEGLKEKYAAK------L  346

Query  1085  LHTALPIMSEIIKHEGSKK---NMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQV-MKDS  1252
             +  +     EI   +   K   NM     +S      Y ADFGWG+P WA  A + +K+ 
Sbjct  347   VFDSDEAWQEIKDEQNKPKTHDNMEIYSCTSWCRFPFYEADFGWGRPSWASVASIAIKNI  406

Query  1253  VVFMEGR-FGGVDLWMGLPEELMNIVMKNPQFVEFVS  1360
             +V M+ R   G++ W+ + EE   +   N + + + S
Sbjct  407   IVLMDKRDCSGIEAWVTMSEEGKALFESNVELLGYAS  443



>ref|XP_006432232.1| hypothetical protein CICLE_v10001086mg [Citrus clementina]
 gb|ESR45472.1| hypothetical protein CICLE_v10001086mg [Citrus clementina]
Length=460

 Score =   210 bits (534),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 146/471 (31%), Positives = 230/471 (49%), Gaps = 37/471 (8%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFY----DSPGSSRDYNGV  211
             M++E+  R+ IKPSSPTP  L+++   ++DQ   N+ +P V +Y    D   S+ D + +
Sbjct  1     MEVEIISRESIKPSSPTPHDLKSHKLCLLDQFRSNIYVPRVLYYPLNQDDLSSTIDIDHI  60

Query  212   V----DELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDF  379
             V     +LK+SLS+ L   YPLAG++  +  S++CND+GV F+E      L+ FL  PD 
Sbjct  61    VSKRLQQLKQSLSEALVRFYPLAGKLT-NNFSVDCNDEGVYFVEAAAKIHLNEFLIQPDH  119

Query  380   EMIREMVPC--NPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFAN  553
              +I +  P   N   G         V  +QV  F+CGG+ +   +SHA GDG S S F  
Sbjct  120   NLIYKFFPVDGNEQRGQI---AGAHVAKVQVTSFACGGLVICACISHAFGDGTSFSSFMK  176

Query  554   TWARINRGCAVVDDGGFI---FDASKIFPPVKNTAD----LDQFARVARGAAESQEKYVV  712
              WA   R     ++  +I   +DAS +FPP  N  D    L   +R + G      K+VV
Sbjct  177   AWAATARNKTSEEEAIYICPNYDASSLFPP--NDGDLFHQLKATSRASFGRFFETGKFVV  234

Query  713   RRFYIPASAIDQLREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSIL  892
             RRF   A A  +L+ + +      P+R E + A +  +V+ A + R  G +   +L+  +
Sbjct  235   RRFVFDAKATAELKAKAKSSRVQNPTRVEVVSATLSKSVMTAFKTR-SGSLKPTLLSHAV  293

Query  893   NLRNRMEPPFPENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYG  1072
             NLR++  PP  EN +GN  +         TE       L  + R+A+   + +  +   G
Sbjct  294   NLRSKARPPLSENLIGNIVWKTNA---LCTEEEVDLDVLVWQLREALSKFDGDFVKSLQG  350

Query  1073  KGGFLHTALPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNA----QV  1240
              GG L  +  I  E   +  +K     +  SS      Y  DFGWGKP W   A     +
Sbjct  351   VGGLLKLSEDIKCEAEAYSDAKNK---IMFSSWCTFGFYGIDFGWGKPIWVSGACLGGSI  407

Query  1241  MKDS--VVFMEGRFG-GVDLWMGLPEELMNIVMKNPQFVEFVSAGFSKSKL  1384
             ++ S  ++ M+ R G G++ W+ L EE M ++  + + +E  +   S  KL
Sbjct  408   VQSSPTIILMDSRSGNGIEAWVLLLEEDMALLEVDEKLLEVATIDPSPLKL  458



>ref|XP_009114100.1| PREDICTED: vinorine synthase [Brassica rapa]
Length=459

 Score =   210 bits (534),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 139/467 (30%), Positives = 235/467 (50%), Gaps = 44/467 (9%)
 Frame = +2

Query  14    SLINLLHQ--ITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPG  187
             S I   HQ  +T ++EV  RDIIKPSSPTP  L+ +  S+++QL   +  P + FY +  
Sbjct  6     SFIRSFHQKSLTTRVEVISRDIIKPSSPTPNHLKNFKLSLLEQLGPTIFGPMLFFYSANY  65

Query  188   SSRDYNGVVDELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLE  367
               +    +++ LKKSLS+TL+  YPL+GR+  + +SI CND G +F+E  V   LS+ L+
Sbjct  66    RIKQTEQLLN-LKKSLSETLTHFYPLSGRLNGN-TSINCNDSGADFLEAQVNSPLSNLLQ  123

Query  368   NPDFEMIREMVPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVF  547
              P  EM+ +++P    T         ++L+ Q   F CGG+++G+ +SH + D  S+ +F
Sbjct  124   EPSSEMLEQLIP----TSVDSIEARTKLLLAQATFFKCGGMAIGVCVSHKLADATSVGLF  179

Query  548   ANTWARINRGCAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQE----KYVVR  715
               +W+ I    ++   G  +FD  KIFPP         F+  +       E    + + +
Sbjct  180   MKSWSAITSQGSIKTVGSPVFDTLKIFPP-------GNFSETSPAPVVEPEIKMNQTLSK  232

Query  716   RFYIPASAIDQLREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILN  895
             RF   +S+I+ L+ +       +P+R EA+ A +W   + A +   +      +L +  +
Sbjct  233   RFVFDSSSIEALQAKASSFEVTQPTRVEAVSAFIWKLAMKATRTVSRTS-KPSILANSAS  291

Query  896   LRNRMEPPFPENCLGN-NTYGATVHWNQPTEGNPSR--HALALKFRDAIRGVNDEAARRR  1066
             LR+R+ PPF +N +GN  +Y A     +  EG   R    L  + R A +   D+   + 
Sbjct  292   LRSRVSPPFTKNSIGNLVSYFAA----KAEEGEKQRKLQTLVAEIRRAKQRFRDDHIPKL  347

Query  1067  YGKGGFLHTALPIMSEIIKHEGSKK-----NMYCLYTSSLLGMQVYAADFGWGKPRWAVN  1231
              G G     A  ++    K  G+       + Y L ++   G+  Y  DFGWGKP W   
Sbjct  348   VGNGD----ATEVICNYQKEAGNMIASGGFDFYILTSACRFGL--YEIDFGWGKPVWFAF  401

Query  1232  AQVMKDSVVFM----EGRFGGVDLWMGLPEELMNIVMKNPQFVEFVS  1360
               V + ++V +    EG  GG++ W+ L E+ M +  ++ + ++F S
Sbjct  402   PSVRQKNIVALVDTKEG--GGIEAWVNLNEQEMKLFEEDRELLDFAS  446



>ref|XP_002510627.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
 gb|EEF52814.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
Length=440

 Score =   209 bits (532),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 143/451 (32%), Positives = 229/451 (51%), Gaps = 34/451 (8%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVDEL  223
             M+IE+  R+ IKPSSPTP  L+TY  S++DQL  +  +P + FY  P +  D +  + +L
Sbjct  1     MEIEIMSRENIKPSSPTPSHLKTYKLSLLDQLMPSAHVPIIFFY-GPINQTDMSIRLPKL  59

Query  224   KKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREMVP  403
             K+SLS+ L+  YP AG++K+D   I+CND+GV + +  V+  LS  L  PD E I +++P
Sbjct  60    KQSLSEALTSFYPFAGKVKDDL-YIDCNDEGVSYTQAKVSCCLSDILGKPDSETIFKLLP  118

Query  404   CNPFTGAFEPNPDG-RVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRGC  580
              + +    E + +G  V +IQVN F CGG+++G   SH I DG + + F   WA I RG 
Sbjct  119   GDSY--FMESSGNGIPVAMIQVNVFKCGGVAIGTKTSHKIIDGPTSTAFLKAWAAIARGS  176

Query  581   AVVDDGGFI----FDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPAS--AI  742
                 +  FI    F  +   P     A      +  +G        + +RF   AS  AI
Sbjct  177   GETVEPCFIAPSLFPQNDCLPKDTMLAIWPSLIKFGKG--------ITKRFVFDASSVAI  228

Query  743   DQLREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPF  922
              + R    L+ H RP+R EA+ A +W   + A++ +H G      L+ I+NLR +     
Sbjct  229   LKARAASSLLVH-RPTRVEAVSAFIWQCNMLASKAKH-GCQRPSFLSLIVNLRGKKGTQL  286

Query  923   PENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGF--LHTA  1096
             P N +GN  +      +  TE     H L    R++I  ++ +  ++  G+ GF  +   
Sbjct  287   PSNSVGNLLWMTIAQCSAETERE--LHPLVGLLRESISKIDGDFVQKLSGEEGFSKVCEC  344

Query  1097  LPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRW----AVNAQVMKDSVVFM  1264
             L    E+  + G+    Y  +T SL  + +Y  DFGWG+P W     +   V ++ V   
Sbjct  345   LQEFGEVYSNAGAD---YLTFT-SLCNVGIYETDFGWGRPIWVTPGGITGPVFQNLVFLN  400

Query  1265  EGRFG-GVDLWMGLPEELMNIVMKNPQFVEF  1354
             E   G G++ W+ L E+ M I+ ++ + + F
Sbjct  401   ETSVGDGIEAWLTLDEQDMIILERDTEILSF  431



>ref|XP_011101100.1| PREDICTED: vinorine synthase-like [Sesamum indicum]
Length=462

 Score =   209 bits (533),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 146/437 (33%), Positives = 212/437 (49%), Gaps = 26/437 (6%)
 Frame = +2

Query  53    EVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFY----DSPGSSRDYNGVVDE  220
             E+  R+ IKPSSPTP   RTY  S++DQ+   + +P V +Y    ++P      +     
Sbjct  6     EIISREHIKPSSPTPLEQRTYKLSLLDQIVPPIYVPLVLYYPNLENTPKDPDFISQTTQI  65

Query  221   LKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREMV  400
             L++SLS TL+  YPLAGRIK D+ SI+CND+GV F+       LS FL+NPD ++ R  +
Sbjct  66    LRQSLSATLTRFYPLAGRIK-DKLSIDCNDEGVPFVVTKFNTRLSDFLKNPDSQVCRGHI  124

Query  401   PCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRGC  580
             P +P T A EP P   V +IQVN F CGGI+VG +  H + DG +I  F   WA   RG 
Sbjct  125   P-SPLTWA-EPGPGSNVALIQVNFFDCGGIAVGSLFLHKVADGVTIGTFMKAWAAAARGS  182

Query  581   AVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQLREQ  760
                    +   A++ F P   T   +     A        K V+RR+   A AI  LR +
Sbjct  183   VETVSPDY---AAQSFFPQNETMKRESHLFSAMRQYFKFGKTVMRRYVFDALAISALRAK  239

Query  761   LRLIS--HYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPFPENC  934
             L        RPS+ E + A++W   I A+ K         ++T  +N+R + EPPFPE+ 
Sbjct  240   LSSTEGLKQRPSKVEVVSALLWKCFIIASNKSSNNHPTTSLVTHGVNMRRKAEPPFPEHS  299

Query  935   LGNNTYGATV-HWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTALPIMS  1111
              GN  +       N  T+ +     L  K R+ I  V+ E  +R  G+ GFL     +  
Sbjct  300   FGNFVWLVPASSTNDHTDAD--LENLFSKVRNTISTVDVEFVKRMQGESGFLGYCKNLEE  357

Query  1112  EIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQV-------MKDSVVFMEG  1270
                  +G  +N   L  SS     +Y+ DFG G+P W               + +  M+ 
Sbjct  358   ---SWKGFPENADYLAISSWCNFGLYSIDFGLGRPIWISKCDAGSEVDWPFINVLWLMDT  414

Query  1271  R-FGGVDLWMGLPEELM  1318
             R  GG++ W+ L E  +
Sbjct  415   RQGGGIEAWLTLDEHYI  431



>ref|XP_008222084.1| PREDICTED: BAHD acyltransferase At5g47980-like [Prunus mume]
Length=446

 Score =   209 bits (531),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 138/447 (31%), Positives = 231/447 (52%), Gaps = 28/447 (6%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVD--  217
             MKIE+ +++ IKPSSPTP +L+++  S++DQLS+    P V FY  P +  +     +  
Sbjct  5     MKIEIVKKETIKPSSPTPHNLKSFKLSLLDQLSLVAYGPLVLFY--PNNVSEVTLTEERS  62

Query  218   -ELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIRE  394
              +LKKSLS+ L+  YPLAGRIK D   IECND+G  ++E  V   LS+FL+ P  E+++ 
Sbjct  63    HQLKKSLSEALTRFYPLAGRIK-DNLFIECNDEGAVYVEARVNALLSNFLDQPSLEILKL  121

Query  395   MVPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWA--RI  568
             ++P    +        G +L++Q + F CGG+++G+ MSH + D +++S F   WA   +
Sbjct  122   LLPIKVDS---PEAATGCLLLVQASFFECGGLAIGVCMSHKLADASTLSTFIKVWAATAL  178

Query  569   NRGCAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQ-EKYVVRRFYIPASAID  745
               G  VV D    F A+  +PP       D  A+    A E +  K V +RF      + 
Sbjct  179   GLGHTVVPD----FSAATRYPP------RDFSAQSPAAAVEMKIVKCVAKRFVFDGPKMR  228

Query  746   QLREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPFP  925
              L+ ++   S  RP+R EA+  ++W+  + A+ K   G   L +++  +N+R R+ P  P
Sbjct  229   ALKAKVTSGSVQRPTRVEAVTGLIWNCAMKAS-KLSSGISKLSMVSQSVNIRKRVVPRLP  287

Query  926   ENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTALPI  1105
             +  +G N  G      + +    +   L  + R  +   N+  ++R  G   F       
Sbjct  288   QTSIG-NLVGYYTAMAEESGIELNSMELVSRLRKGMVEFNEIHSKRLQGDIVFEAICEYF  346

Query  1106  MSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRW-AVNAQVMKDSVVFMEGRFG-  1279
             M   I +   + ++     +SL    +Y  DFGWGKP W ++   ++K+    ++ + G 
Sbjct  347   ME--IGNIMRRDDINLFICTSLCNFGIYEIDFGWGKPIWVSIPFDIIKNVACLIDTKEGD  404

Query  1280  GVDLWMGLPEELMNIVMKNPQFVEFVS  1360
             GVD W+ L EE M +  ++P+ + F S
Sbjct  405   GVDAWISLSEEDMALFERDPELLAFAS  431



>ref|XP_007044964.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
 gb|EOY00796.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
Length=430

 Score =   208 bits (529),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 147/449 (33%), Positives = 222/449 (49%), Gaps = 34/449 (8%)
 Frame = +2

Query  38    ITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYN--GV  211
             + +++EV  ++IIKPSSPTP  LR Y  S +DQ+S  V  P V FY     +   N   +
Sbjct  1     MKLEVEVMSKEIIKPSSPTPDQLRHYQLSFLDQISPPVYNPLVLFYPMTECNILVNKTKI  60

Query  212   VDELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIR  391
              D LK+S+S  LS  YPLAGRIK++R  ++CND+G+ F+E  V   LS  LENP    + 
Sbjct  61    TDHLKQSMSNALSYFYPLAGRIKDNR-LVDCNDEGIPFLEAQVKCKLSDILENPAPSELN  119

Query  392   EMVPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARIN  571
             +++P        E  P G    IQ N F  GGI +G+ +SH + D  S   F NTWA I 
Sbjct  120   KLLPF--VLDDAEELPLG----IQFNIFDSGGICIGVCISHKLADALSFFTFVNTWAAIA  173

Query  572   RGCAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQL  751
             RG + +    F   ++K+FPP K+T   +    +      S E+ V +RF   AS I ++
Sbjct  174   RGESYIVSPEFA--SAKLFPP-KSTLGFEPRTGI------STERIVTKRFVFTASKIQEI  224

Query  752   REQLRLIS-----HYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEP  916
             + +    +        PSR EAL   +W   +AA + +       + +   +NLR R++P
Sbjct  225   KAKYTKSTASAENQKGPSRIEALSTFIWSRFVAATKAKPIPDNCFYTIIHAVNLRPRLDP  284

Query  917   PFPENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTA  1096
             P  E+  G N Y   +      E   S   L  + RD+IR ++ +  R+      +    
Sbjct  285   PLAEHSFG-NFYRIAMTVPSSEEDCCS---LVYQIRDSIRKLDMKYVRQLQDGQSYFDFM  340

Query  1097  LPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQV-MKDSVVFMEGR  1273
                    I+ E     +     +SL    +Y ADFGWGKP W  +A +  K+ VVFM+  
Sbjct  341   KERAESFIRGE-----IVSFSFTSLCRFPIYKADFGWGKPIWVGSANLTFKNLVVFMDTV  395

Query  1274  FG-GVDLWMGLPEELMNIVMKNPQFVEFV  1357
              G G++ W+ L EE M +   +   + +V
Sbjct  396   SGDGIEAWVSLKEEDMAMFGSDEVLLAYV  424



>ref|XP_010040717.1| PREDICTED: vinorine synthase-like [Eucalyptus grandis]
Length=441

 Score =   208 bits (529),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 142/452 (31%), Positives = 223/452 (49%), Gaps = 25/452 (6%)
 Frame = +2

Query  38    ITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPG--SSRDYNGV  211
             + MK+E    + IKPSSPTP   R + F ++DQL+    +P + FY +P   ++ D   V
Sbjct  1     MAMKVEAVSAESIKPSSPTPSHHREFKFCLLDQLAPPFYVPAILFYSAPDDKAALDSASV  60

Query  212   VDELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIR  391
                LK SLSQ LSL YPL GR+K + ++I+C+D G  ++E      LS  L NPD   ++
Sbjct  61    TGNLKTSLSQALSLFYPLGGRVKGN-AAIDCSDDGALYLEAKAHFELSEVLSNPDINQLQ  119

Query  392   EMVPCNPFTGAFEPNPDGRVLV-IQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARI  568
             + +P +P+     PN + +V+V +Q   F+CGGI++G+ +SH I DGAS+S F   W+ I
Sbjct  120   KFLPFSPYR--VIPNIEEQVIVGVQFTFFNCGGIAIGICISHKIADGASVSAFLAAWSEI  177

Query  569   --NRGCAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAI  742
               N      +       AS+IFPP       D   ++  G   S+EK + + F     ++
Sbjct  178   AVNGVDGEANLKTPFLKASEIFPPK------DIKFQMPSGVI-SREKLLTKMFRFDGESL  230

Query  743   DQLREQLRLISHYRPSRAEALIAVVWDAVIAANQKR---HKGRINLHVLTSILNLRNRME  913
               LR +        P+R EA+ A++W + + A +KR    K       +T ++N+R+R+ 
Sbjct  231   GHLRARF---GSTAPTRVEAVTALIWKSAVEAARKRPDWTKKYPPSSAVTHVVNIRSRIR  287

Query  914   P-PFPENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLH  1090
               P PEN LGN          +P +        A   R +IR ++ E      G+ G   
Sbjct  288   SQPLPENALGNLWQSIVAPLMEPNK-EAELQDFAGIVRKSIREIDSEYLSALRGENGLAK  346

Query  1091  TALPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQV-MKDSVVFME  1267
                 + +       S   +     SS      Y ADFGWG+P W     V MK+ V+ M 
Sbjct  347   ACENLTAARRLAAASAGEIELYRFSSWARFPFYEADFGWGRPAWVCTTSVPMKNVVILMG  406

Query  1268  GRFG-GVDLWMGLPEELMNIVMKNPQFVEFVS  1360
              + G G++ W+ L E  M    +N + ++FV+
Sbjct  407   TKCGDGIEAWITLAEHDMIEFERNDELLQFVA  438



>gb|KCW86595.1| hypothetical protein EUGRSUZ_B03227 [Eucalyptus grandis]
Length=443

 Score =   208 bits (529),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 147/463 (32%), Positives = 233/463 (50%), Gaps = 49/463 (11%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVDE-  220
             +++EV   D IKPSSPTP  LR Y  S +DQ+ V V +P V F+      RD +  +DE 
Sbjct  4     VEVEVVSSDTIKPSSPTPDHLRHYKLSFLDQIQVPVFMPLVLFF-----PRDDDVSLDEK  58

Query  221   ---LKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIR  391
                ++++L++ L+  YPLAGR++ D   ++CND+G  ++E  V   LS  LENP   ++ 
Sbjct  59    RGRIRQALAKALTQFYPLAGRVR-DNLYVDCNDEGALYVEARVRCELSDILENPVPRVLN  117

Query  392   EMVPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARIN  571
               +P          +     + +QVN F CGG+++ L++SH + D  S   F N+WA   
Sbjct  118   RFLPRQI------DDVQDLAVAVQVNFFECGGLALSLLISHKVADALSYFTFLNSWAATA  171

Query  572   RGCAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQL  751
             RG   + D    F +S++FPP+    +L  F + + G    ++    RRF   A+ I  L
Sbjct  172   RGDTDIIDP--CFSSSELFPPI----NLSGF-QTSTGIV--KDNISTRRFVFDAATIASL  222

Query  752   REQLR----------LISHY--RPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILN  895
             REQL            + H   RP+R EAL + +W   +A+ Q        L+ +   +N
Sbjct  223   REQLTDLNNAAAAATTVDHQRSRPTRVEALSSFLWSRYMASTQPIDTRGDKLYTVLHAVN  282

Query  896   LRNRMEPPFPENCLGNNTYGATVHWNQPTEGN--PSRHALALKFRDAIRGVNDEAARRRY  1069
             LR RMEPP   +  GN +  A      PT+       H +  + R+AI+ V+ E  ++  
Sbjct  283   LRTRMEPPMSGHHFGNISRLAI---TVPTKDAVVDGGHKIVHQVREAIKQVDGEHIKKLR  339

Query  1070  GKGGFLHTALPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQV-MK  1246
                G+L+      + I     S+  +     +SL    +Y ADFGWGKP WA +A +  K
Sbjct  340   DGEGYLNWLKERSARI-----SQGEVVSFSFTSLCRFPIYEADFGWGKPTWAGSASLTFK  394

Query  1247  DSVVFMEGRFG-GVDLWMGLPEELMNIVMKNPQFVEFVSAGFS  1372
             + VVFM+ + G G++ W+ L E+ M    ++ + +  VS   S
Sbjct  395   NLVVFMDTKSGDGIEAWVHLKEDDMAKFEQDKELLALVSPSVS  437



>ref|XP_008226167.1| PREDICTED: vinorine synthase-like [Prunus mume]
Length=450

 Score =   208 bits (529),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 145/455 (32%), Positives = 219/455 (48%), Gaps = 32/455 (7%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFY--DSPGSSRDY---NG  208
             +K+E+ +R  +KPSSPTP  LR Y  SI+DQ++    IP + FY   +  +S D    N 
Sbjct  5     IKVEIIQRQTVKPSSPTPHHLRNYKLSILDQIAPQTYIPILLFYPNAADATSNDVMATNE  64

Query  209   VVDELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMI  388
                 L +SL++TL+  YP AGRIK D + IECND G EF+E  V  SLS   E+PD  M+
Sbjct  65    RCQHLMQSLAKTLTHFYPSAGRIKGD-AVIECNDDGAEFVEARVKCSLSEIFEHPDAVML  123

Query  389   REMVPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARI  568
             R  +P  P +        G +L++QVN F CGG+++G  +SH  GD A++S F N W   
Sbjct  124   RRFLPVEPES---REAGTGTLLLVQVNLFECGGMAIGFSISHKFGDAATLSTFINCWTAA  180

Query  569   NRGCAVVDDGGFI----FDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPAS  736
              R     D    +    F A+ +F P+ N ++ +    V        EK++ RRF   AS
Sbjct  181   AR-----DQSNMLMLPKFGAASLFSPL-NFSNSEPLPSVEV----DNEKFITRRFVFDAS  230

Query  737   AIDQLREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGR-----INLHVLTSILNLR  901
              I  L+ ++      +P+R EA  A++W   I A+ +          I   V +  +N+R
Sbjct  231   KIAALQSKVTSSVVPKPTRVEAASALIWKCKIEASSRSSSNTLGTSLIRPSVFSLSVNMR  290

Query  902   NRMEPPFPENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGG  1081
                 P  PEN +GN    +T +++   E +       L  +  IRG  +E   R      
Sbjct  291   KMAVPLLPENLVGNILEFSTTNYSHSEENSTVIDLKGLVAK--IRGGLEETKERCAAVVV  348

Query  1082  FLHTALPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQVMKDSV-V  1258
             F        ++   +     +M     SS      Y ADFGWGKP W     V  +++ V
Sbjct  349   FDSNEAWQRTKWYMNLMKNDDMDKFICSSWCRFPFYEADFGWGKPSWVSYVAVAINNITV  408

Query  1259  FMEGR-FGGVDLWMGLPEELMNIVMKNPQFVEFVS  1360
              M  R   G++ W+ L +E M +   N + +E+ S
Sbjct  409   LMNKRDDNGIEAWVTLSQENMALFESNKELLEYAS  443



>ref|XP_008222018.1| PREDICTED: vinorine synthase-like [Prunus mume]
Length=436

 Score =   207 bits (528),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 147/460 (32%), Positives = 232/460 (50%), Gaps = 48/460 (10%)
 Frame = +2

Query  38    ITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDS-PGSSRDYNGVV  214
             + +++EV  ++IIKPSSPTP  LRTY+ S +DQ+S  V  P V FY S P +  +   + 
Sbjct  1     MKVEVEVISKEIIKPSSPTPDHLRTYHLSFLDQISPPVHNPLVIFYSSEPDTKFNIVDIS  60

Query  215   DELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIRE  394
             ++LKKSLS  L+L YPLAGR     S I+CND+G+ ++E  V   LS  ++NP    + +
Sbjct  61    NQLKKSLSDVLTLFYPLAGR-AHGNSFIDCNDEGIPYLETRVNCQLSHVIQNPIPSELNK  119

Query  395   MVPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINR  574
              +P      A         L +Q+N F CGGI++G  +SH I D  S+ +F  +WA I R
Sbjct  120   FIPFQVHEVA------DLSLGVQLNIFDCGGIALGACVSHKIADALSLFMFIKSWAAIAR  173

Query  575   GCAVVDDGGFI---FDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAID  745
                   D   +   F ++ +FPP +N + L+    + +      +  V +RF   AS I+
Sbjct  174   Q----QDEHIVCPQFVSATLFPP-RNISGLNPRTGITK------QNVVTKRFIFDASKIE  222

Query  746   QLREQLRLISHYR--------PSRAEALIAVVWDAVIAANQ-KRHKGRINLHVLTSILNL  898
              L+ +  + ++ +        PSR EAL A++W  V+A+ Q K       L+ +   +NL
Sbjct  223   ALKAKYSIDNYSQSLESYQKPPSRVEALSALIWSRVVASTQVKSEPAPERLYAIVHAVNL  282

Query  899   RNRMEPPFPENCLGN-NTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGK  1075
             R R +PP PE+  GN      T+   Q  E     + L  + RD +R ++     +    
Sbjct  283   RTRTDPPLPEHSFGNLYRIAMTIPSLQTGE---ECYGLVRQVRDQVRQIDKHFVSKLQQG  339

Query  1076  GGFLHTALPIMSEIIKHEGS---KKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQV-M  1243
                L        + IK       K  M  L  +SL    +Y ADFGWGKP W  +  +  
Sbjct  340   SEHL--------DFIKQSSENFFKGEMVTLSFTSLCRFPLYEADFGWGKPTWVGSPPLTF  391

Query  1244  KDSVVFMEGRF-GGVDLWMGLPEELMNIVMKNPQFVEFVS  1360
              + VVFM+ +  GG++ ++ + EE +  +  + +F+ FVS
Sbjct  392   NNLVVFMDAKSGGGIEAYINMKEEDLAKLEGDNEFLAFVS  431



>ref|XP_010044505.1| PREDICTED: vinorine synthase-like [Eucalyptus grandis]
Length=445

 Score =   207 bits (528),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 147/463 (32%), Positives = 233/463 (50%), Gaps = 49/463 (11%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVDE-  220
             +++EV   D IKPSSPTP  LR Y  S +DQ+ V V +P V F+      RD +  +DE 
Sbjct  6     VEVEVVSSDTIKPSSPTPDHLRHYKLSFLDQIQVPVFMPLVLFF-----PRDDDVSLDEK  60

Query  221   ---LKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIR  391
                ++++L++ L+  YPLAGR++ D   ++CND+G  ++E  V   LS  LENP   ++ 
Sbjct  61    RGRIRQALAKALTQFYPLAGRVR-DNLYVDCNDEGALYVEARVRCELSDILENPVPRVLN  119

Query  392   EMVPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARIN  571
               +P          +     + +QVN F CGG+++ L++SH + D  S   F N+WA   
Sbjct  120   RFLPRQI------DDVQDLAVAVQVNFFECGGLALSLLISHKVADALSYFTFLNSWAATA  173

Query  572   RGCAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQL  751
             RG   + D    F +S++FPP+    +L  F + + G    ++    RRF   A+ I  L
Sbjct  174   RGDTDIIDP--CFSSSELFPPI----NLSGF-QTSTGIV--KDNISTRRFVFDAATIASL  224

Query  752   REQLR----------LISHY--RPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILN  895
             REQL            + H   RP+R EAL + +W   +A+ Q        L+ +   +N
Sbjct  225   REQLTDLNNAAAAATTVDHQRSRPTRVEALSSFLWSRYMASTQPIDTRGDKLYTVLHAVN  284

Query  896   LRNRMEPPFPENCLGNNTYGATVHWNQPTEGN--PSRHALALKFRDAIRGVNDEAARRRY  1069
             LR RMEPP   +  GN +  A      PT+       H +  + R+AI+ V+ E  ++  
Sbjct  285   LRTRMEPPMSGHHFGNISRLAI---TVPTKDAVVDGGHKIVHQVREAIKQVDGEHIKKLR  341

Query  1070  GKGGFLHTALPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQV-MK  1246
                G+L+      + I     S+  +     +SL    +Y ADFGWGKP WA +A +  K
Sbjct  342   DGEGYLNWLKERSARI-----SQGEVVSFSFTSLCRFPIYEADFGWGKPTWAGSASLTFK  396

Query  1247  DSVVFMEGRFG-GVDLWMGLPEELMNIVMKNPQFVEFVSAGFS  1372
             + VVFM+ + G G++ W+ L E+ M    ++ + +  VS   S
Sbjct  397   NLVVFMDTKSGDGIEAWVHLKEDDMAKFEQDKELLALVSPSVS  439



>ref|XP_006473916.1| PREDICTED: vinorine synthase-like [Citrus sinensis]
Length=472

 Score =   208 bits (529),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 147/477 (31%), Positives = 228/477 (48%), Gaps = 53/477 (11%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVDE-  220
             M++E+  ++ IKPSSPT   L T+  S++D       IP V +Y         N + D  
Sbjct  1     MEVEILSKECIKPSSPTAHHLETHKLSLLDLYLPPAYIPLVLYYPMNQQHSSANIIDDHI  60

Query  221   -------LKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDF  379
                    LK++LS+TLSL YPLAG+IK D  SI+CND+G+ FIE      L  FL  P  
Sbjct  61    ISTRLQLLKQALSETLSLFYPLAGKIK-DLHSIDCNDEGIYFIEARAKSPLDEFLNLPSI  119

Query  380   EMIREMVPCNPFTGAFE--PNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFAN  553
              +I+E +P +P    +   P P   V  +QV  FSCGG+++G  +SH IGDG + S+F  
Sbjct  120   SLIKEFLP-DPDDAKWRSIPTPGDYVASVQVTTFSCGGMTIGAYVSHMIGDGTAFSLFLK  178

Query  554   TWARINRGCAVVDDGGFI------FDASKIFPPVKNTADLDQFARVARGAAESQE-----  700
             +WA      +  ++          FDAS  FP  +N    D + R A   +         
Sbjct  179   SWAAATARKSYNEESEAALLLSPKFDASLSFP--QN----DAYPRQACSTSIRSNLPIKF  232

Query  701   -KYVVRRFYIPASAIDQLREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINL--  871
              + V RRF   ASAI  L+ + +  +   P+R EA+  ++   ++AA++ + +   +   
Sbjct  233   GRCVCRRFLFDASAIANLKAKAKGSTVQNPTRVEAVTTLLGKCIMAASKTQARSSSSDRD  292

Query  872   ----HVLTSILNLRNRMEPPFPENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRG  1039
                   L   +NLR R  PPF EN +GN  + A+      TE  P    L  + R+AI  
Sbjct  293   SDKPFALIHAVNLRRRATPPFSENYMGNFIWMASALCK--TEEEPELQGLVCQLREAIAK  350

Query  1040  VNDEAARRRYGKGGFLHTALPIMSEIIKHEGSKKNMYC--LYTSSLLGMQVYAADFGWGK  1213
             +N +      G  G L+       E +K+E     +    +  SS      Y  DFGWGK
Sbjct  351   LNGDFVNSLQGDEGLLN-----FLEALKYERETYTLAADRIAYSSWCNFGFYEIDFGWGK  405

Query  1214  PRWA-------VNAQVMKDSVVFMEGRFG-GVDLWMGLPEELMNIVMKNPQFVEFVS  1360
             P WA         A  + ++++ M+   G G++ W+ L E+ M I+  + Q +++ +
Sbjct  406   PIWASVTGPPESPATAILNAILLMDTNMGNGIEAWVYLHEDTMAILQVDQQLLQYAT  462



>ref|XP_002514980.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
 gb|EEF47534.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
Length=450

 Score =   207 bits (527),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 151/470 (32%), Positives = 227/470 (48%), Gaps = 46/470 (10%)
 Frame = +2

Query  47    KIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVDELK  226
             +++V  +++IKPSSPTP  LR Y  S +DQ++V V +P V FY    ++       +  K
Sbjct  3     EVKVISKELIKPSSPTPHLLRHYQLSFLDQIAVPVFMPLVLFYPKETNNITNQERCNHAK  62

Query  227   KSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREMVPC  406
             KSLS+ L+  YPLAGR+K +   I+CND+G  F+E +   +LS  L++PD   + + +P 
Sbjct  63    KSLSKALTQFYPLAGRVKHNM-YIDCNDEGAYFVEAEAKCTLSHILQHPDPNDLNKFLPL  121

Query  407   NPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRGCAV  586
                      + +    V QV  F CGG+++   MSH +GD  S  +F N+WA I RG + 
Sbjct  122   E------LDDVNDLASVFQVTLFQCGGLAISFGMSHKVGDALSFFMFLNSWAAIARGDST  175

Query  587   VDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQLREQLR  766
               +    F +S +FPP     DL  F          ++  V +RF   AS I  LR    
Sbjct  176   TINTVPCFQSSLLFPP----KDLSGF---QPRTGIVKDTIVAKRFVFDASTISALRAMYT  228

Query  767   LISH-----YRPSRAEALIAVVWD---AVIAANQKRHKGRINLHVLTSILNLRNRMEPPF  922
                       RP+R EAL A +W    A + AN+     +I  + L   +NLR RM+PP 
Sbjct  229   DDGDNNKYPRRPTRVEALSAFIWSRFMASVEANKVHDCDKI--YTLLHAINLRPRMDPPL  286

Query  923   PENCLGNNTYGATVHWNQP--------------TEGNPSRHALALKFRDAIRGVNDEAAR  1060
              E   GN +  A    +                T+ +   H    K RDAIR VN E  +
Sbjct  287   QELYFGNISRIAVAIASMEDIDNICGPKDICGGTKEDFKNHGTVKKMRDAIRNVNVEYVK  346

Query  1061  RRYGKGGFLHTALPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQV  1240
             +     G L        +++K E     +     +SL    +Y ADFGWGKP W  +A++
Sbjct  347   KLQESDGHLSFMKGRAEQVMKGE-----VVSFSFTSLCRFPIYEADFGWGKPVWVGSARL  401

Query  1241  -MKDSVVFMEGRFG-GVDLWMGLPEELMNIVMKNPQFVEFVSAGFSKSKL  1384
               K+ VVF++ + G G++ W+ L  E M     + +F+  VS  FS  K+
Sbjct  402   TFKNLVVFLDTKEGDGIEAWINLKVEDMVKFEADKEFLAHVSP-FSNVKI  450



>ref|XP_006432229.1| hypothetical protein CICLE_v10001082mg [Citrus clementina]
 ref|XP_006464647.1| PREDICTED: vinorine synthase-like [Citrus sinensis]
 gb|ESR45469.1| hypothetical protein CICLE_v10001082mg [Citrus clementina]
Length=462

 Score =   207 bits (527),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 149/473 (32%), Positives = 230/473 (49%), Gaps = 41/473 (9%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFY----DSPGSSRDYNGV  211
             M++E+  R+ IKPSSPTP  L+T+   ++DQ   N   P V +Y    D   S+ D + +
Sbjct  1     MEVEIISRESIKPSSPTPLDLKTHKLCLMDQFLSNAYAPRVLYYPLNQDDLSSAIDIDHI  60

Query  212   VDE----LKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDF  379
             V E    LK+SLS+TL   YPLAG++  +  S++CND+GV F+E      L+  L  PD 
Sbjct  61    VSERLQLLKQSLSETLVHFYPLAGKLT-NNFSVDCNDEGVYFVEAAAKSPLNELLIQPDL  119

Query  380   EMIREMVPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTW  559
              +I ++ P +    + +      V ++QV  F+CGG+ +   +SH  GDG S S F   W
Sbjct  120   NLINKLCPVDGSQQSGQV-AGAHVAMVQVTSFACGGLVICACISHTFGDGTSFSSFTKAW  178

Query  560   ARINRGCAVVDDGGFI---FDASKIFPPVKNTADLDQFARVARGAAESQ----EKYVVRR  718
             A   R     ++  FI   +DAS +F P  N  DL    R    A+ ++      +V RR
Sbjct  179   AATARKKTSEEETIFICPNYDASSLFLP--NEDDLFHQLRAVSNASYTRLLETGTFVKRR  236

Query  719   FYIPASAIDQLREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNL  898
             F   A AI +L+ + +      P+R EAL A++  +++A   K+  G     +L+  +NL
Sbjct  237   FVFDAKAIAELKAKAKSSRVQNPTRIEALSAILSKSIMAVVNKK-SGSHKPMLLSHAVNL  295

Query  899   RNRMEPPFPENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKG  1078
             R R  PP  E  +GN  +     +   TE       L  + R+AI   + E  +   G G
Sbjct  296   RPRARPPLSEYLIGNIVWYTNALF---TEEGVDLDGLVWQLREAISKFDGEFVKSLQGVG  352

Query  1079  GFLHTALPIMSEIIKHEGS----KKNMYCLYTSSLLGMQVYAADFGWGKPRW----AVNA  1234
             G L      +SE IK+E       KN     +    G   Y  DFGWG+P W        
Sbjct  353   GLLK-----LSEAIKYEAEACSDAKNRVIFSSWCTFGF--YGIDFGWGQPIWVSCVGFGG  405

Query  1235  QVMKDSVV--FMEGRFG-GVDLWMGLPEELMNIVMKNPQFVEFVSAGFSKSKL  1384
              +++ S +   ++ RFG G++ W+ L EE M ++  +   +EF +   S  KL
Sbjct  406   SILQFSPIINLVDTRFGDGIEAWVSLLEEDMALLEVDKNLLEFATIDPSPLKL  458



>gb|KDP35375.1| hypothetical protein JCGZ_10359 [Jatropha curcas]
Length=440

 Score =   206 bits (525),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 139/455 (31%), Positives = 237/455 (52%), Gaps = 30/455 (7%)
 Frame = +2

Query  38    ITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSP------GSSRD  199
             + M +E    + IKPSSPTP  LR +   ++D+L+    +P +  Y SP      G +  
Sbjct  1     MAMMVEKISSETIKPSSPTPNDLRNFKICLLDELAPPSYVPILLLY-SPSADFNNGVADY  59

Query  200   YNGVVDELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDF  379
             ++ + ++LKKSLS+TL+  YPL G++ E   S+ECND G  F++  V  ++S  ++N + 
Sbjct  60    FDAISEKLKKSLSETLTRFYPLCGKL-EGNLSVECNDDGALFVKAKVNIAVSEIVKNLET  118

Query  380   EMIREMVPCNPFT----GAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVF  547
             +++ ++ P NP+     GA E N +  +  +QVN F CGG+ +G+ +SH I DGA+++ F
Sbjct  119   DLLYQLFPFNPYKVRPDGARE-NGEAMITGVQVNLFECGGVGIGVCVSHKIVDGAAMAAF  177

Query  548   ANTWARINRGCAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYI  727
              N WA    G  + +      DA K+FPP     D+ + + + R      EK + +RF  
Sbjct  178   LNAWAATATG--IDNTISPRLDAHKLFPP--KGIDIIKQSDMIR-----NEKVITKRFEF  228

Query  728   PASAIDQLREQLRLISHYRPSRAEALIAVVW-DAVIAANQKRHKGRINLHVLTSILNLRN  904
              A ++  L+E+   I +   +R EA+ A++W  A+ A      K ++   + T ++N+R+
Sbjct  229   DAKSLANLKEK---IKNGNSTRVEAVTALIWKSAMKAVRLNSGKDKLPSSIATHLINIRD  285

Query  905   RMEPPFPENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGF  1084
             RM+PP P   LG N +  ++      + +     L    R +IR V+++      G GG 
Sbjct  286   RMDPPLPGYSLG-NLWRLSLAPCVDEKKDVELQELVSLLRKSIRRVDNDYVNELQGDGGL  344

Query  1085  LHTALPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQV-MKDSVVF  1261
             L  AL  + E+ +     + +     SS     +Y  DFGWGKPR      V +++ V+ 
Sbjct  345   LK-ALEPLKELRQLALGGEGVEVYTFSSWARFPLYEIDFGWGKPRRVCTITVPVRNCVIL  403

Query  1262  MEGRFG-GVDLWMGLPEELMNIVMKNPQFVEFVSA  1363
             M  R G G++ W+ L E+ M     + + ++FVS 
Sbjct  404   MGTRSGDGIEAWVTLTEKDMAKFESSEELLQFVSG  438



>gb|KDO58317.1| hypothetical protein CISIN_1g037128mg [Citrus sinensis]
Length=460

 Score =   207 bits (527),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 149/475 (31%), Positives = 232/475 (49%), Gaps = 45/475 (9%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFY----DSPGSSRDYNGV  211
             M++E+  R+ IKPSSPTP  L+++   ++DQ   N+ +P V +Y    D   S+ D + +
Sbjct  1     MEVEIISRESIKPSSPTPHDLKSHKLCLLDQFRSNIYVPRVLYYPLNQDDLSSTIDIDHI  60

Query  212   V----DELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDF  379
             V     +LK+SLS+ L   YPLAG++  +  S++CND+GV F+E      L+ FL  PD 
Sbjct  61    VSKRLQQLKQSLSEALVRFYPLAGKLT-NNFSVDCNDEGVYFVEAAAKIHLNEFLIQPDH  119

Query  380   EMIREMVPC--NPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFAN  553
              +I +  P   N   G         V  +QV  F+CGG+ +   +SHA GDG S S F  
Sbjct  120   NLIYKFFPVDGNEQRGQI---AGAHVAKVQVTSFACGGLVICACISHAFGDGTSFSSFMK  176

Query  554   TWARINRGCAVVDDGGFI---FDASKIFPPVKNTAD----LDQFARVARGAAESQEKYVV  712
              WA   R     ++  +I   +DAS +FPP  N  D    L   +R + G      K+VV
Sbjct  177   AWAATARNKTSEEEAIYICPNYDASSLFPP--NDGDLFHQLKATSRASFGRFFETGKFVV  234

Query  713   RRFYIPASAIDQLREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSIL  892
             RRF   A A  +L+ + +      P+R E + A +  +V+ A + R  G +   +L+  +
Sbjct  235   RRFVFDAKATAELKAKAKSSRVQNPTRVEVVSATLSKSVMTAFKTR-SGSLKPTLLSHAV  293

Query  893   NLRNRMEPPFPENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYG  1072
             NLR++  PP  EN +GN  +         TE       L  + R+A+   + +  +   G
Sbjct  294   NLRSKARPPLSENLIGNIVWKTNA---LCTEEEVDLDVLVWQLREALSKFDGDFVKSLQG  350

Query  1073  KGGFLHTALPIMSEIIKHEGS----KKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNA--  1234
              GG L      +SE IK E       KN     + S  G   Y  +FGWGKP W   A  
Sbjct  351   VGGLLK-----LSEDIKCEAEAYSDAKNKIMFSSWSTFGF--YGINFGWGKPIWVSGACL  403

Query  1235  --QVMKDS--VVFMEGRFG-GVDLWMGLPEELMNIVMKNPQFVEFVSAGFSKSKL  1384
                +++ S  ++ M+ R G G++ W+ L EE M ++  + + +E  +   S  KL
Sbjct  404   GGSIVESSPTIILMDTRSGNGIEAWVLLIEEDMALLEVDEKLLEVATIDPSPLKL  458



>ref|XP_009359304.1| PREDICTED: deacetylvindoline O-acetyltransferase-like [Pyrus 
x bretschneideri]
Length=437

 Score =   206 bits (524),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 137/448 (31%), Positives = 231/448 (52%), Gaps = 27/448 (6%)
 Frame = +2

Query  38    ITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGS-SRDYNGVV  214
             +TM++E+  R+IIKPS+PTP  LRT+N S ++Q +    +P V FY    S S + +   
Sbjct  1     MTMEVELISREIIKPSTPTPPHLRTHNLSFIEQNTPRTYLPVVYFYHKESSASPNGDHES  60

Query  215   DELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAE-SLSSFLENPDFEMIR  391
             ++LKKSLS+ LS  YP AGRI+ DR+S++CND+GV F+E  V    LS  LE+P+   + 
Sbjct  61    NQLKKSLSEILSKYYPFAGRIR-DRASVDCNDEGVAFVEARVRNVKLSEILEHPEDTWLA  119

Query  392   EMVPCNPFTGAFEPNPDGRVLVI---QVNRFSCGGISVGLIMSHAIGDGASISVFANTWA  562
              +     FT   + N D  + VI   QV+ F CGG+++G+ MSH + D ++++ F N WA
Sbjct  120   LL-----FTDNLQWNDDSSLSVIFAVQVSFFDCGGMAIGICMSHKVADTSTVANFINDWA  174

Query  563   RINRGCAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAI  742
               N+    V    FI   +  FP      D+  F        +     V +RF   A  I
Sbjct  175   ARNKCDQYVPSPLFI--GADTFP----QGDMPLFPETVLEKGDC----VTKRFVFDALKI  224

Query  743   DQLREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPF  922
               L+  +       P+R E + A+++   I+A +   +  +N  V    +NLR R+ PP 
Sbjct  225   ASLK-AIVADKVQNPTRVEVVTALIYSCAISALRSTSQSSLNPTVFIHTVNLRTRVVPPL  283

Query  923   PENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTALP  1102
             P+N +G+  +  T+  +   +     H L  + + ++    D  A++  G+  +      
Sbjct  284   PKNSVGSMIWAFTL--STAEDSVMELHDLVTQMKQSMTRFCDSYAQKFRGEDQW-PAIFK  340

Query  1103  IMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQV-MKDSVVFMEGRFG  1279
               ++ ++ E S  N+     SS     VY ADFGWGKP W   A   +K+++  ++ R G
Sbjct  341   ECTQALRKEFSIANLVTYRCSSWCRFPVYEADFGWGKPIWVTIASCPLKNAIFLIDTRNG  400

Query  1280  -GVDLWMGLPEELMNIVMKNPQFVEFVS  1360
              G++ ++ L ++ +++  ++ Q + F S
Sbjct  401   EGIEAYVNLEKQQLDVFERDAQLLAFAS  428



>ref|XP_007135112.1| hypothetical protein PHAVU_010G102000g [Phaseolus vulgaris]
 gb|ESW07106.1| hypothetical protein PHAVU_010G102000g [Phaseolus vulgaris]
Length=454

 Score =   207 bits (526),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 147/455 (32%), Positives = 225/455 (49%), Gaps = 35/455 (8%)
 Frame = +2

Query  38    ITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVD  217
             + +++E+  R+ I+PSSPTP  LR +  S++D+L      P + FY SP S+ +Y   V 
Sbjct  1     MKVEVEIISREDIRPSSPTPSHLRVFRLSLLDRLIPFPYAPIILFYTSPKSNTNYLSEVP  60

Query  218   E----LKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEM  385
             +    LKKSLS+TL+  YPL G+IKED  SIECND+G  F+   V   L  FL  P+  +
Sbjct  61    KRLELLKKSLSETLTKFYPLGGKIKEDL-SIECNDEGANFVLARVKCPLDEFLVQPEVTV  119

Query  386   IREMVPCNPFTGAFEPNPDG-RVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWA  562
             + + +P +    A E +  G  V  IQVN F CGGI++G+ +SH I DGA +S F   W 
Sbjct  120   LHKFIPVDLVDLASEGSNSGTHVTNIQVNIFECGGIAIGMCISHKILDGAGLSTFIKGWT  179

Query  563   RINRGCAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAI  742
                + C  +    F      +FP   N++ L   +    G+   Q K+V RRF    SAI
Sbjct  180   ERAKDCNQLTQPNFT--GPSLFP--INSSWLKDLSMWMWGSLFKQGKWVTRRFLFRNSAI  235

Query  743   DQLREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPF  922
               L+ Q         +R E + +++W +++  ++ R  G      ++ ++NLR +M+   
Sbjct  236   ATLKAQTP--GTENSTRVEMVSSMLWKSLMGVSKARF-GTQRPSFISHLVNLRRKMDEAL  292

Query  923   -PENCLGN---NTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGG--F  1084
              PE+ LGN    T   TV  N+          L  K R AI  V+ E      G  G   
Sbjct  293   CPEHALGNLLWLTAAETVDDNE-----MGLEELVGKLRTAISRVDKEFVEELKGDKGRSI  347

Query  1085  LHTALPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAV------NAQVMK  1246
             +  +L  + E+    GSK  +     SS      Y ADFGWGKP W        +  +  
Sbjct  348   MQESLGAICEM----GSKSEVDYFGFSSWCNFGFYEADFGWGKPTWVSCVGSIGSVSMFM  403

Query  1247  DSVVFMEGRFG-GVDLWMGLPEELMNIVMKNPQFV  1348
             + ++ ++ R G G++ W+ L EE M  +  NP+ +
Sbjct  404   NLIILVDTRLGDGIEAWVTLKEEDMTYLKANPELL  438



>ref|XP_011029622.1| PREDICTED: BAHD acyltransferase At5g47980 [Populus euphratica]
Length=439

 Score =   206 bits (524),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 135/431 (31%), Positives = 211/431 (49%), Gaps = 27/431 (6%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVDEL  223
             M +E+  R+ +KPSSPTP  LR +N   +DQL      P +  Y S           + L
Sbjct  1     MAVEIITREAVKPSSPTPDHLREFNLCFLDQLPPVANEPLLLVYSSFQQKFTVAHKSERL  60

Query  224   KKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREMVP  403
             K+SLS+TLS  YPLAGRIK+D +SIECND G  F+E  V   LS FLE PD E+IR+ +P
Sbjct  61    KRSLSETLSRFYPLAGRIKDD-ASIECNDFGAVFVEARVNCLLSKFLEKPDAEVIRKFIP  119

Query  404   CNPFTGAFEPNP-DGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTW--ARINR  574
                 TG   P    G ++++Q N F+CGG+++G+ +SH + D  + S F   W  A  + 
Sbjct  120   ----TGIESPEELTGSLVLVQANFFACGGLAIGVCISHMVADPVTFSTFVKAWAAAAFHS  175

Query  575   GCAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQLR  754
             G + +     +F+A  +FPP   +        V R      ++ V +R    AS +  L+
Sbjct  176   GDSTILP---LFNAPSVFPPQNISLSKPAALEVMR------DRCVTKRVVFDASKVAALQ  226

Query  755   EQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPFPENC  934
              +    S   P+R EA+ A++W   + A  + +   +   +L+  +NLRN+M PP PE+ 
Sbjct  227   VKAVCESVTCPTRVEAVTALIWKCAMNA-ARSNSEHLRYSILSQSVNLRNKMVPPLPEHT  285

Query  935   LGNNT-YGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTALPIMS  1111
             +GN   Y A+      TE      +LA + R  ++   +   ++       +    P   
Sbjct  286   IGNLAGYFASCA----TECEVELQSLARQLRKGLQDFGENYLKKLGKDKASMAICEPFQE  341

Query  1112  EIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRW-AVNAQVMKDSVVFMEGRFG-GV  1285
                       + Y   ++S   +  Y  DFGWGKP W  +     K+    M+ + G G+
Sbjct  342   AASMLPEGNVDFY--VSTSFCRLPFYGIDFGWGKPTWVTIPTGAYKNVASIMDAKDGKGI  399

Query  1286  DLWMGLPEELM  1318
             + W+ L E+ M
Sbjct  400   EAWVTLTEDDM  410



>ref|XP_008383113.1| PREDICTED: vinorine synthase-like [Malus domestica]
Length=506

 Score =   207 bits (528),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 143/448 (32%), Positives = 225/448 (50%), Gaps = 44/448 (10%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSR-DYNGVVDE  220
             +K+EV  ++IIKPSSPTP  L  Y FS +DQ++  V    V F++  G  +   N +   
Sbjct  4     IKVEVISKEIIKPSSPTPNHLSHYQFSFLDQINPPVYTSLVLFFEFNGERQPTINEISQH  63

Query  221   LKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAE-SLSSFLENPDFEMIREM  397
             LKKSL+  L+L YPLAGR + +   + CND+GV ++E  V    LS  L NP  E + ++
Sbjct  64    LKKSLAYVLTLYYPLAGRARLENHFVNCNDEGVPYLEAQVKNCQLSEVLNNPIPEELNKL  123

Query  398   VP--CNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARIN  571
             VP   +   G F       +L +Q+N F CGG ++GL  SH I DG S+ +F  TWA I 
Sbjct  124   VPFELDDVAGEF-------ILGVQLNMFECGGFAIGLCTSHKIADGLSMLMFTKTWAAIA  176

Query  572   RGCAVVDDGGFI-----FDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPAS  736
             RG    DD         F ++ +FPP K     D    + R       K V +RF   AS
Sbjct  177   RGGHDHDDNQAKIERPEFVSASLFPP-KEITGYDAHVGITR-------KKVTKRFVFDAS  228

Query  737   AIDQLREQLRLI--SHYRPSRAEALIAVVWDAVI-AANQKRHKGRIN-LHVLTSILNLRN  904
              I++LR++   +  +  RPSR E L A +W  ++ AA    H    N LH+L   +NLR 
Sbjct  229   TIEELRKKYTGLESNKIRPSRIEILSAFIWRRIVEAAKGGDHIDVENKLHMLIHAVNLRP  288

Query  905   RMEPPFPENCLGN----NTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYG  1072
             RM+PP P +  GN    +  G     N   + +P  + +    R+A+  +++E  +R   
Sbjct  289   RMDPPLPRSSFGNICLISMTGPFTSSNTSLDNDPC-YGMVRHIREAMSKIDNEYVKRLQE  347

Query  1073  KGGFLHTALPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRW-AVNAQVMKD  1249
                 L +   +         +++++     +SL    +Y  DFGWG+P W  + A   K+
Sbjct  348   GDEHLSSVKKLADSF-----TREHLVTYNFTSLCRYPLYDNDFGWGRPTWVGLPALTFKN  402

Query  1250  SVVFMEGRFG-----GVDLWMGLPEELM  1318
              +VF++ +       G++ ++ L +++M
Sbjct  403   LIVFLDTKEAGGGGRGIEAYVSLEKQVM  430



>ref|XP_010100293.1| Vinorine synthase [Morus notabilis]
 gb|EXB82427.1| Vinorine synthase [Morus notabilis]
Length=438

 Score =   206 bits (523),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 149/457 (33%), Positives = 225/457 (49%), Gaps = 38/457 (8%)
 Frame = +2

Query  38    ITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFY----DSPGSSRDYN  205
             + ++IE+  ++ IKPSSPTP  LR Y  S +DQLS  V  P++ FY    D      ++N
Sbjct  1     MEVEIELISKEFIKPSSPTPDHLRHYQLSFLDQLSPKVYNPWLLFYLLNNDDHVHHSEFN  60

Query  206   GVVD---ELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPD  376
              + +    LKKSLSQ LSL YPLAGR+K+  + I+CND+GV F E  V   LS  ++NP+
Sbjct  61    NITNISYHLKKSLSQVLSLYYPLAGRVKDGLNIIDCNDEGVPFFEARVKGKLSDVIDNPN  120

Query  377   FEMIREMVPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANT  556
                +   +P          +     L +Q+N F CGGI++G+  SH + D  S   F  T
Sbjct  121   INELDRFLPFKL------DDVTELALGLQINVFECGGIAIGVCNSHQLSDALSNITFIKT  174

Query  557   WARINRGCAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPAS  736
             W    R    +    FI  + K+FPP KN   L+    + R      +  + +RF   A+
Sbjct  175   WVATARREPDIVRPEFI--SGKLFPP-KNLVGLNPSIGITR------KNIMTKRFVFKAA  225

Query  737   AIDQLREQLRLIS----HYRPSRAEALIAVVWDAVIAANQKRHKGRIN--LHVLTSILNL  898
              I+ LR +    S      RPSR EAL A +W   +AA      G  +   +++   +NL
Sbjct  226   TIEALRAKYDENSLGEDRRRPSRVEALSAFIWSRFVAATNGDQSGHDDQKTYIVLHAVNL  285

Query  899   RNRMEPPFPENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKG  1078
             R R EPP  EN  G N +   +       G    H    + R+ IR ++ E  R+   + 
Sbjct  286   RPRFEPPLGENHFG-NYFRVAITVPSLKTGEDLCHGFVRQVREEIRKIDKEFVRKL--QE  342

Query  1079  GFLHTALPIMSEIIKHEGSKKNMYCLYT-SSLLGMQVYAADFGWGKPRWAVNAQV-MKDS  1252
             G  H  L ++ +  + EG  K     +  +SL    VY ADFGWGKP W  +A +   + 
Sbjct  343   GNEH--LELLKD--RSEGFVKGEVITFAFTSLCRFPVYEADFGWGKPTWVGSAALNFHNV  398

Query  1253  VVFMEGRFG-GVDLWMGLPEELMNIVMKNPQFVEFVS  1360
              VFM+ + G G++ ++ L +E +  +  + +F   VS
Sbjct  399   TVFMDAKNGDGIEAYLSLKDEDLAKLEVDKEFQACVS  435



>ref|XP_010040066.1| PREDICTED: vinorine synthase-like [Eucalyptus grandis]
Length=440

 Score =   206 bits (523),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 145/455 (32%), Positives = 226/455 (50%), Gaps = 32/455 (7%)
 Frame = +2

Query  38    ITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNG--V  211
             + MK+EV   + +KPSSPTP  LR +   ++DQL+    IP + FY +  +    N   V
Sbjct  1     MAMKVEVVSTETVKPSSPTPSHLRNFKLCLLDQLAPPFWIPVILFYSASNNEVAANSASV  60

Query  212   VDELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIR  391
                LK SLSQ LSL YPL GR+K + ++I+CND+G  ++E      LS  L NPD   ++
Sbjct  61    TGNLKTSLSQALSLFYPLGGRMKGN-TAIDCNDEGALYLEAKARFELSEVLSNPDINQLQ  119

Query  392   EMVPCNPFTGAFEPNPDGRVLV-IQVNRFSCGGISVGLIMSHAIGDGASISVFANTWAR-  565
             + +P +  +    PN + +V+V +Q N F CGGI +G+ MSH I D AS+S F   W+  
Sbjct  120   QFLPFS--SDKVVPNIEEQVIVGVQANFFDCGGIGIGICMSHKIVDAASVSGFLTAWSEI  177

Query  566   ----INRGCAVVDDGGFIFDASKIFPPVKNTADLD-QFARVARGAAESQEKYVVRRFYIP  730
                 IN   +++        AS++FPP     D++ Q  R       S+EK + +RF   
Sbjct  178   ALNGINGKASLITP---FLKASELFPP----KDVNFQMPR----RFSSREKLLTKRFRFD  226

Query  731   ASAIDQLREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHK--GRINLHVLTSILNLRN  904
             + ++ +LR +        P+R EA+ A++W + + A +KR +   +      T  +N+R+
Sbjct  227   SESLARLRARF---GSATPTRVEAVTALIWKSAVEAARKRPEWNEKYPSSAATHTVNIRS  283

Query  905   RMEP-PFPENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGG  1081
             RM P P PE+ LG N +  TV     T         A   R +IR ++ E      G+ G
Sbjct  284   RMRPQPLPEHALG-NLWQITVAPLIDTNKGVELQDFAGSLRKSIRAIDGEYLSVLQGERG  342

Query  1082  FLHTALPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQVMKDSVVF  1261
                    + +     E S   M     SS +    Y  DFG G+P W         ++VF
Sbjct  343   LAKAYESLTAARKLGESSAGKMELYGFSSWVKFPFYKVDFGLGRPTWVCTTGFPIGNMVF  402

Query  1262  MEG-RFG-GVDLWMGLPEELMNIVMKNPQFVEFVS  1360
             + G R G G++ W+ L E  M    +N + ++F+S
Sbjct  403   LMGTRCGDGIEAWITLHEHDMIEFERNDELLQFIS  437



>gb|KDO46444.1| hypothetical protein CISIN_1g037811mg [Citrus sinensis]
Length=435

 Score =   205 bits (522),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 127/455 (28%), Positives = 224/455 (49%), Gaps = 45/455 (10%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGV----  211
             M++++  ++IIKPSSPTP  L+T+  S++DQL+ N     + FYD P    D        
Sbjct  1     MQLDIISKNIIKPSSPTPLHLKTHKLSLLDQLAPNNYTSLLLFYDGPSRFDDKTSASTIN  60

Query  212   -VDELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAE--SLSSFLENPDFE  382
                 LK SLS+TL+L YP AG++ +D   ++C+D GV F+E  V    S+S  L+NP+  
Sbjct  61    DYHHLKSSLSKTLTLYYPFAGKVLKDNYVVDCDDSGVPFVEARVPSSISMSEVLKNPEMN  120

Query  383   MIREMVPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWA  562
              +++++P NP    +  + D   + IQ+N F+CGG+++G    H + D  +   F   WA
Sbjct  121   TLQQLLPFNP-NKKYLSSTDDVNMAIQINHFACGGVAIGFNFRHIVADATASIGFIKNWA  179

Query  563   RINRG--CAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPAS  736
             ++N     ++++    + D +  FP  K   ++  +AR       + E  V +RF     
Sbjct  180   KLNSSDDNSIINYKHVVVDCTDTFPRNK---EIPSYARRINEWQRAPE-CVTKRFVFDGC  235

Query  737   AIDQLREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEP  916
              +  L+ ++ L+          + ++                         +NLRNRM  
Sbjct  236   KVAALKREMILLIERNIDSTSTIESIP------------------------VNLRNRMNQ  271

Query  917   PFPENCLGNNTYGATVHW-NQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGG--FL  1087
             P PE+C+GN  +  T    N+  +G+  +  LA    ++ + V  +  R+ Y  GG  F+
Sbjct  272   PLPEDCIGNLFHSVTCAANNEAGDGHCDKSTLARNVHESKKMVGGDFVRKVYQDGGVVFV  331

Query  1088  HTALPIMSEIIK---HEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQVMKDSVV  1258
             +     + E++K   +  +  ++     S  +G+Q Y  DFGWGKP W  +A  M ++ +
Sbjct  332   NQYKEAVEELLKDGTNNDTTNSVRLFGFSGPMGLQFYEIDFGWGKPVWVTSAMRMHNTAM  391

Query  1259  FMEGRFG-GVDLWMGLPEELMNIVMKNPQFVEFVS  1360
              ++ R G GV+ W+GLP   M  + ++P  + + S
Sbjct  392   LLDTRDGKGVEAWVGLPINDMPKLEQDPGILTYAS  426



>ref|XP_006482379.1| PREDICTED: salutaridinol 7-O-acetyltransferase-like [Citrus sinensis]
Length=441

 Score =   205 bits (522),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 142/464 (31%), Positives = 225/464 (48%), Gaps = 42/464 (9%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVDEL  223
             M++ +   + IKPSSPTP   RT+  S +DQL+       + FY +  SS       + L
Sbjct  1     MELRISSTENIKPSSPTPDHQRTHKLSFIDQLNPGAYFSIILFYSAGASS-------ERL  53

Query  224   KKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAE-SLSSFLENPDFEMIREMV  400
             KKSLS+TL+  YP AG+ K D   ++C+D GV FIE       +S  ++     ++ +++
Sbjct  54    KKSLSETLTHFYPFAGQFK-DNHFVDCDDHGVTFIEAHFHRGDMSEVIQQAKTNILEQLI  112

Query  401   PCNPFTGA-FEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRG  577
             PC P      E N     L++QVN F CGG+++G+   H + D A+ + F  TW    RG
Sbjct  113   PCKPHESTRVEHN-----LIVQVNYFGCGGMAIGVCFHHKVADAATAANFLKTWGLHARG  167

Query  578   CAVVDDGGF---IFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQ  748
                 D   F   I+D++ IF P ++  D+     V  G        VV+RF      I  
Sbjct  168   AGAGDTNDFKHAIYDSNSIF-PAQDLPDMS----VNLGLVLFSLDSVVKRFTFEGEKIAS  222

Query  749   LREQLRLISH--YRPSRAEALIAVVWDAVIAANQKRHKGRINL------HVLTSI-LNLR  901
             LRE++        RPSR E + +V+  A++AA +    G          HV   I +NLR
Sbjct  223   LREKIVQAEPGLGRPSRVEVVSSVILGALLAAYRGSRDGDEEFTTAPLTHVTAIIAVNLR  282

Query  902   NRMEPPFPENCLGNNTYGATVHW----NQPTEGNPSRHALALKFRDAIRGVNDEAARRRY  1069
              RM PP PE   GN    A ++     +   E   +  +LA +   +IR V+D+  R+ Y
Sbjct  283   KRMNPPLPEESFGNICSAAFLNLPIDRDHDHEKKINHGSLAGQLHQSIRMVDDQFVRKLY  342

Query  1070  GKGGFLHTALPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQVMKD  1249
              +G  L+     + + ++ +GS K+      SS   M  Y ADFGWGKP          +
Sbjct  343   VEGEILN-----IRKAVEAQGSPKSNKVFVISSWCKMPFYEADFGWGKPVSIGVGTRFTE  397

Query  1250  SVVFMEG-RFGGVDLWMGLPEELMNIVMKNPQFVEFVSAGFSKS  1378
             + V ++G +  G++ W+GL ++ M    ++P  + + S+   K+
Sbjct  398   AAVLVDGCQTDGIEAWVGLSKQDMARFEQHPGILAYTSSSTDKA  441



>gb|KDO85073.1| hypothetical protein CISIN_1g044625mg [Citrus sinensis]
Length=472

 Score =   206 bits (524),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 147/477 (31%), Positives = 227/477 (48%), Gaps = 53/477 (11%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVDE-  220
             M++E+  ++ IKPSSPT   L T+  S++D       IP V +Y         N + D  
Sbjct  1     MEVEILSKECIKPSSPTAHHLETHKLSLLDLYLPPAYIPLVLYYPMNQQHSSANIIDDHI  60

Query  221   -------LKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDF  379
                    LK++LS+TLSL YPLAG+IK D  SI+CND+G+ FIE      L  FL  P  
Sbjct  61    ISTRLQLLKQALSETLSLFYPLAGKIK-DLHSIDCNDEGIYFIEARAKSPLDEFLNLPSI  119

Query  380   EMIREMVPCNPFTGAFE--PNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFAN  553
              +I+E +P +P    +   P P   V  +QV  FSCGG+++G  +SH IGDG + S+F  
Sbjct  120   SLIKEFLP-DPDDAKWRSIPTPGDYVASVQVTTFSCGGMTIGAYVSHMIGDGTAFSLFLK  178

Query  554   TWARINRGCAVVDDGGFI------FDASKIFPPVKNTADLDQFARVARGAAESQE-----  700
             +WA      +  ++          FDAS  FP  +N    D + R A   +         
Sbjct  179   SWAAATARKSYNEESEAALLLSPKFDASLSFP--QN----DAYPRQACSTSIRSNLPIKF  232

Query  701   -KYVVRRFYIPASAIDQLREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINL--  871
              + V RRF   ASAI  L+ + +  +   P+R EA+  ++   ++AA++ + +   +   
Sbjct  233   GRCVCRRFLFDASAIANLKAKAKGSTVQNPTRVEAVTTLLGKCIMAASKTQARSSSSDRD  292

Query  872   ----HVLTSILNLRNRMEPPFPENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRG  1039
                   L   +NLR R  PPF EN +GN  + A+      TE  P    L  + R+AI  
Sbjct  293   SDKPFALIHAVNLRGRATPPFSENYMGNFIWMASALCK--TEEEPELQGLVCQLREAIAK  350

Query  1040  VNDEAARRRYGKGGFLHTALPIMSEIIKHEGSKKNMYC--LYTSSLLGMQVYAADFGWGK  1213
             +N +      G  G L+       E +K+E          +  SS      Y  DFGWGK
Sbjct  351   LNGDFVNSLQGDEGLLN-----FLEALKYERETYTRAADRIAYSSWCNFGFYEIDFGWGK  405

Query  1214  PRWA-------VNAQVMKDSVVFMEGRFG-GVDLWMGLPEELMNIVMKNPQFVEFVS  1360
             P WA         A  + ++++ M+   G G++ W+ L E+ M I+  + Q +++ +
Sbjct  406   PIWASVTGPPESPATAILNAILLMDTNMGNGIEAWVYLHEDTMAILQVDQQLLQYAT  462



>ref|XP_006853006.1| hypothetical protein AMTR_s00174p00025490 [Amborella trichopoda]
 gb|ERN14473.1| hypothetical protein AMTR_s00174p00025490 [Amborella trichopoda]
Length=431

 Score =   205 bits (521),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 140/459 (31%), Positives = 221/459 (48%), Gaps = 49/459 (11%)
 Frame = +2

Query  38    ITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFY----DSPGSSRDYN  205
             + + + +   + IKPSSPTP+  RT     +DQ+     IP + FY    + P S R   
Sbjct  1     MMLNLRIISTESIKPSSPTPERQRTMKLCFMDQMVSTTYIPLIFFYTMKEEEPHSQR---  57

Query  206   GVVDELKKSLSQTLSLMYPLAGRIKEDRSS----IECNDQGVEFIEGDVAESLSSFLENP  373
                  LK+SL+  L+  YPLAGRI+  + +    +ECND+GVEF E  V   LS FLE P
Sbjct  58    -----LKQSLAHILTSFYPLAGRIQYAQETGEIWVECNDEGVEFKEAQVEGDLSLFLERP  112

Query  374   DFEMIREMVPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFAN  553
                 I++++PC P +G          L++Q N F CGG+++G+ MSH +GD AS++   N
Sbjct  113   PINEIKKLLPCEPLSGG------ATTLLVQANWFKCGGLALGICMSHMVGDMASLADLMN  166

Query  554   TWARINRGCAVVDDGGFI-----FDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRR  718
              WAR++R     D+         FD   +F P  N  +L         +   Q   + + 
Sbjct  167   CWARVSRS---SDNKKLSILAPRFDWRSLFSP--NPLNLS----FEPPSLAIQAPPLTKV  217

Query  719   FYIPASAIDQLREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNL  898
             F      ++ LR+  R  S+ RP+   A+ A++W  +I A  ++       H + ++ N+
Sbjct  218   FIFQREQVEALRDNGRETSNPRPTSVGAVSALLWRCLIKARYRKTGKDGTWHAVYAV-NI  276

Query  899   RNRMEPPFPENCLGNNTYGATVHWNQPTEGN--PSRHALALKFRDAIRGVNDEAARRRYG  1072
             R RMEP  P+   GN + GA    + P E    PSR  L    R  I+ ++ E  ++   
Sbjct  277   RTRMEPQAPDGSFGNLSMGAHCLIHDPIESATPPSRRQLESCLRMGIQELSCEFLKK---  333

Query  1073  KGGFLHTALPIMSEIIKHEGSKKNM-YCLYTSSLLGMQVYAADFGWGKPRW--AVNAQVM  1243
                 +  +  I+ E+I     + +  Y    SS     +Y +DFGWGKP W  +V   + 
Sbjct  334   ----VQESPHILEEMIGSITDRASKGYAFGISSYCKFPLYESDFGWGKPDWVSSVGGFIT  389

Query  1244  KDSVVFMEGRFGGVDLWMGLPEELMNIVMKNPQFVEFVS  1360
               + +F +    G+  W+ L EE M     +P+ + FVS
Sbjct  390   GVAFLFDDPSENGIQAWVNLGEEEMAHFECDPELLAFVS  428



>ref|XP_009361769.1| PREDICTED: BAHD acyltransferase At5g47980-like [Pyrus x bretschneideri]
Length=446

 Score =   205 bits (521),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 143/448 (32%), Positives = 232/448 (52%), Gaps = 33/448 (7%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYN-GVVDE  220
             M+ E+ +R+ +KPSSPTPQ LR +  S+++QLS       V FY  PG+    N   +  
Sbjct  1     MEFEMIKRETLKPSSPTPQYLRNFKLSLLNQLSPAAYESLVLFY--PGNDSTTNQSSLRI  58

Query  221   LKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREMV  400
             LKKSLS+TL   YPLAGR+K D  S++CND GV+++E  V   LS+FL  PD   +R+++
Sbjct  59    LKKSLSETLVRFYPLAGRMK-DNISVDCNDYGVDYVEAKVNGLLSTFLSQPDAGTLRQLL  117

Query  401   PCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRGC  580
             P    T + E +  G +L++Q N F C G+++G+ MSH + D AS+S F  +W+    G 
Sbjct  118   PVA--TESPEAS-KGALLLVQANVFGCSGLAIGMCMSHKLADAASLSTFIMSWSATALGF  174

Query  581   --AVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQLR  754
               A++ D    F AS  FPP+  ++   Q ++V  GA   +E  V +RF   AS I  LR
Sbjct  175   SQALLPD----FTASFRFPPIDYSSSFHQSSQV--GA--KRENCVTKRFVFNASKISALR  226

Query  755   EQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGR--INLHVLTSILNLRNRMEPPFPE  928
              +       +P++AEA+ A++W   +AA++  +  +    L VL+  +++R  + PP  +
Sbjct  227   TKAASTIVDQPTQAEAVTALIWRCAVAASRSSNSLQPPPKLSVLSQSVDIRKSVVPPLSD  286

Query  929   NCLGN-NTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTALPI  1105
             + +GN   Y A     Q  E       L  + R  I  +++  A+R         +   +
Sbjct  287   DSIGNLMGYFAA----QTDENELELQGLVAQLRRGIEELSNNYAKRPGKDQAIRESVTEV  342

Query  1106  MSEIIKHEGSKKNMYCLYTSSLLG--MQVYAADFGWGKPRWAVNAQVMKDS-VVFMEG--  1270
              +  +K + +       Y  + LG    +Y  +FGWGKP W  N      + V ++    
Sbjct  343   HNNFVKRDDTIN----FYVGTDLGNYKLLYEVNFGWGKPIWLSNVPAASSTNVAYLVSTR  398

Query  1271  RFGGVDLWMGLPEELMNIVMKNPQFVEF  1354
             +  G++ W+ L EE M    +N + + F
Sbjct  399   KDDGIEAWVTLSEEDMAAFERNQELLAF  426



>dbj|BAB01067.1| acetyltranferase-like protein [Arabidopsis thaliana]
Length=455

 Score =   205 bits (521),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 141/458 (31%), Positives = 231/458 (50%), Gaps = 40/458 (9%)
 Frame = +2

Query  29    LHQITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNG  208
              HQ  M+++V  RDIIKPSSPTP  L+ +  S+++QL   +  P V FY +  S +    
Sbjct  11    FHQ--MRVDVVSRDIIKPSSPTPNHLKKFKLSLLEQLGPTIFGPMVFFYSANNSIKPTEQ  68

Query  209   VVDELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMI  388
             +   LKKSLS+TL+  YPLAGR+K +  SI+CND G +F+E  V   LS+ L  P  + +
Sbjct  69    L-QMLKKSLSETLTHFYPLAGRLKGN-ISIDCNDSGADFLEARVNSPLSNLLLEPSSDSL  126

Query  389   REMVPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARI  568
             ++++P    T         R+L+ Q + F CG +S+G+ +SH + D  SI +F  +WA I
Sbjct  127   QQLIP----TSVDSIETRTRLLLAQASFFECGSMSIGVCISHKLADATSIGLFMKSWAAI  182

Query  569   NRGCAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQE----KYVVRRFYIPAS  736
             +   ++   G  +FD  KIFPP         F+  +       E    + + +RF   +S
Sbjct  183   SSRGSIKTIGAPVFDTVKIFPP-------GNFSETSPAPVVEPEIMMNQTLSKRFIFDSS  235

Query  737   AIDQLREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEP  916
             +I  L+ +       +P+R EA+ A++W + + A  +   G     +L + ++LR+R+ P
Sbjct  236   SIQALQAKASSFEVNQPTRVEAVSALIWKSAMKAT-RTVSGTSKPSILANSVSLRSRVSP  294

Query  917   PFPENCLGN-NTYGATVHWNQPTEG-NPSR-HALALKFRDAIRGVNDEAARRRYGKGGFL  1087
             PF +N +GN  +Y A     +  EG N ++   L  K R A +   D    +  G     
Sbjct  295   PFTKNSIGNLVSYFAA----KAEEGINQTKLQTLVSKIRKAKQRFRDIHIPKLVGNPN--  348

Query  1088  HTALPIMSEIIKHEGS-----KKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQVMKDS  1252
               A  I+    K  G        + Y   ++   G+  Y  DFGWGKP W     V + +
Sbjct  349   --ATEIICSYQKEAGDMIASGDFDFYIFSSACRFGL--YETDFGWGKPVWVGFPSVRQKN  404

Query  1253  VVFM--EGRFGGVDLWMGLPEELMNIVMKNPQFVEFVS  1360
             +V +      GG++ W+ L E+ MN+  ++ + ++F S
Sbjct  405   IVTLLDTKEAGGIEAWVNLNEQEMNLFEQDRELLQFAS  442



>ref|XP_006341810.1| PREDICTED: vinorine synthase-like [Solanum tuberosum]
Length=430

 Score =   204 bits (519),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 147/454 (32%), Positives = 229/454 (50%), Gaps = 38/454 (8%)
 Frame = +2

Query  38    ITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNG-VV  214
             + ++IE+  + IIKPSS TP  L  Y  S +DQ++ N+ +P V FY  P ++   N    
Sbjct  1     MKIEIEIISKLIIKPSSSTPHELHNYKLSYLDQITPNILMPLVFFY--PVNNNFTNTHTS  58

Query  215   DELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIRE  394
             ++LK SLS TL+  YPL GR+    S + CND+GV ++E     SLS FL +P    + +
Sbjct  59    NQLKTSLSHTLTKFYPLGGRLDVANSHVNCNDEGVPYVEAIAKCSLSEFLLDPLPNELNK  118

Query  395   MVPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINR  574
              +PC+        +     L++Q N F CGG+++G+ +SH I D  S  +F NTW  I R
Sbjct  119   FIPCDLH------DVKDFCLLVQANFFQCGGMAIGIAISHKITDALSTFMFINTWGAIAR  172

Query  575   GCAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQLR  754
             G   +D     FD+S +FPP     D+ +F          ++  V +RF   AS +  LR
Sbjct  173   GS--IDVPCPRFDSSILFPP----RDITKF---KSSVMIEKDNIVTKRFVFSASKVSALR  223

Query  755   EQLRLI---SHYRPSRAEALIAVVWDAVIAA-NQKRHKGRINLHVLTSILNLRNRMEPPF  922
             ++       S   PSR EAL A +W  ++A+ + +R + +I  + +   +NLR R  PP 
Sbjct  224   DKYTEKGSESTKPPSRIEALSAFLWTRLMASVHAERDETKI--YGMVHTVNLRTRSNPPL  281

Query  923   PENCLGNNTYGATV----HWNQPTEGNPSRHALALKFRDAIRGVNDE--AARRRYGKGGF  1084
             PE+  GN           + N           L  K R++I  VN E  +  R+  K   
Sbjct  282   PESLFGNVMQVVITVPATNNNNNRTNEEQDFELVKKVRESINNVNSEFVSGLRKNDK---  338

Query  1085  LHTALPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQ-VMKDSVVF  1261
                 L  + E   +E  K  +     +SL  + +Y ADFGWGKP W  +A+ V+KD + F
Sbjct  339   --KHLSFIKE-KANEQRKGELVVFNFTSLCRLPLYKADFGWGKPIWVGSARLVLKDVIGF  395

Query  1262  MEGRFG-GVDLWMGLPEELMNIVMKNPQFVEFVS  1360
             ++ + G G++ W+ L EE M I   + + + + S
Sbjct  396   LDTKSGNGIEAWVNLKEEDMAIFEVDKELLSWCS  429



>ref|XP_011101142.1| PREDICTED: vinorine synthase-like [Sesamum indicum]
Length=447

 Score =   204 bits (520),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 147/454 (32%), Positives = 227/454 (50%), Gaps = 33/454 (7%)
 Frame = +2

Query  38    ITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVD  217
             + M +E+   + IKPS PTP  LR +   ++DQL      P V +Y + G++  +  V++
Sbjct  1     MIMDVEIISVERIKPSFPTPNHLRNFKLCVLDQLIPAAYGPVVVYYPNEGAASHFE-VLE  59

Query  218   E---LKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMI  388
                 LKKSLS+TL+  +PLAG I++D  SI+C+D G  F    V  +L+ FLE+PD +MI
Sbjct  60    RFAVLKKSLSETLTGFFPLAGTIRDD-VSIDCDDHGACFTTAKVKCTLTEFLESPDLKMI  118

Query  389   REMVPCN-PFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWAR  565
              +++PC     GA   N       +Q + F+CGGI+VGL +SH I DG ++S F  +W  
Sbjct  119   AQLLPCGLKSAGACVTN-------VQASEFACGGIAVGLCISHRILDGTALSTFLKSWGT  171

Query  566   INRGCA---VVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPAS  736
                      V  D    F AS +FP       L   +    G+   + ++V RRF    S
Sbjct  172   AASSSVEKLVSPD----FSASALFPAAG--VWLKDASMAMWGSLFKKGQFVTRRFMFDGS  225

Query  737   AIDQLREQLRLISHY-RPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRME  913
             AI  L++     S   +P+R EA+   +W   +AA+++R  G     +LT I+NLR R  
Sbjct  226   AIASLKDMATGTSRTGKPTRVEAVSGFIWKCAMAASEERF-GCKRPSLLTHIVNLRKRAA  284

Query  914   PPFPENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHT  1093
             P F E  LGN  +  +  +   TE N     L  + R +I  ++ +  ++  G  G  + 
Sbjct  285   PNFSEQSLGNLIWMTSAKFTGGTE-NLEFPELVDEIRRSISKIDADYVKKLQGDEG-SNM  342

Query  1094  ALPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWA----VNAQVMKDSVVF  1261
                 + EI+  E S K++     +S   +  Y  DFGWGKP W      +     +  V 
Sbjct  343   MQKYLKEIV--EFSSKDVDYFGFTSWCKLGFYDVDFGWGKPVWVSSIDSSGPFFMNLSVL  400

Query  1262  MEGRFG-GVDLWMGLPEELMNIVMKNPQFVEFVS  1360
             M+ R G G++ W+ L E+ M I+  N +F  F S
Sbjct  401   MDSRCGDGIEAWVTLDEQEMVILEGNQEFKIFAS  434



>ref|XP_002875299.1| transferase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51558.1| transferase family protein [Arabidopsis lyrata subsp. lyrata]
Length=442

 Score =   204 bits (519),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 135/451 (30%), Positives = 224/451 (50%), Gaps = 34/451 (8%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNG-VVDE  220
             M+++V  RDIIKPSSPTP  L+ +  S+++QL   +  P V FY   G++R      + +
Sbjct  1     MRVDVISRDIIKPSSPTPNHLKKFQLSLLEQLGPTIFGPMVFFYS--GNNRIKPAEQLQK  58

Query  221   LKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREMV  400
             LKKSLS+TL+  YPLAGR+K + S I+CND G +F+E +V   LSS L+ P  + +++++
Sbjct  59    LKKSLSETLTHFYPLAGRLKGNIS-IDCNDSGADFLEAEVNSPLSSLLQEPSSDSLQQLI  117

Query  401   PCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRGC  580
             P    T         R+ + Q + F CG +++G+ +SH + D  SI +F  +WA I+   
Sbjct  118   P----TSVDSIETRTRLFLAQASFFECGSMAIGVCISHKLADATSIGLFMKSWAAISSQG  173

Query  581   AVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQE----KYVVRRFYIPASAIDQ  748
             ++   G  +FD +KIFPP         F+  +       E    + + +RF   +S+I  
Sbjct  174   SIKTVGFPVFDTAKIFPP-------GNFSETSPAPVVEPEIMMNQTLSKRFVFDSSSIQA  226

Query  749   LREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPFPE  928
             L+ +       +P+R EA+ A++W   + A  +   G     +L +  +LR+R+ PPF +
Sbjct  227   LQAKASSFEVNQPTRVEAVSALIWKTAMKAT-RTVSGTSKPSILANSASLRSRVSPPFTK  285

Query  929   NCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTALPIM  1108
             N +GN          + T        L  K R A +   D    +  G       A  I+
Sbjct  286   NSIGNLVSYFAAKAEEGT-NQTKLQTLVSKIRKAKQWFRDNHIPKLVGN----PNATEII  340

Query  1109  SEIIKHEGS-----KKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQVMKDSVVFM--E  1267
                 K  G        + Y   ++   G+  Y  DFGWGKP W     V + ++V +   
Sbjct  341   CSYQKEAGDMIASGDFDFYIFSSACRFGL--YDTDFGWGKPVWVGIPTVRQKNIVTLLDT  398

Query  1268  GRFGGVDLWMGLPEELMNIVMKNPQFVEFVS  1360
                GG++ W+ L E+ MN+  ++ + ++F S
Sbjct  399   KEAGGIEAWVNLYEQEMNLFEQDRELLQFAS  429



>ref|XP_010044501.1| PREDICTED: vinorine synthase-like [Eucalyptus grandis]
 gb|KCW86587.1| hypothetical protein EUGRSUZ_B03219 [Eucalyptus grandis]
Length=434

 Score =   204 bits (518),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 148/452 (33%), Positives = 221/452 (49%), Gaps = 40/452 (9%)
 Frame = +2

Query  38    ITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFY--DSPGSSRDYNGV  211
             + + +E+  R+ IKPSS TP  LR Y  S +DQ+S  V  P+V FY     G   + + +
Sbjct  1     MEIAVEITSRETIKPSSLTPDHLRHYRLSFLDQISPPVYNPFVLFYTPKKEGGQSNIDDI  60

Query  212   VDELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIR  391
               +LK SLS  L+  YPLAGR+K +  SIEC+D GV + E  V   +S F ENPD   +R
Sbjct  61    SSKLKASLSCILTHFYPLAGRLKGN-VSIECDDAGVPYSEAIVKCQVSEFTENPDPRELR  119

Query  392   EMVPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARIN  571
              +VP            D     +Q NRF CGGI++G+ MSH I D  S+  F N WA + 
Sbjct  120   NLVP------FVLDASDETTFGVQFNRFDCGGIAIGICMSHKIADALSLLTFINMWAAVC  173

Query  572   RGCAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQL  751
             RG  +V      F ++++FPP KN    +    + R      +  V +RF      I+ L
Sbjct  174   RGEEIVAPPQ--FPSAELFPP-KNILGFEPSTGIIR------DNIVSKRFIFKTDKIENL  224

Query  752   R----EQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPP  919
             +    +++ L  +  PSR EAL   +W     + +   +      VL ++ NLR + +PP
Sbjct  225   KARYSKEMDLDRNRPPSRIEALSTFIWSRFAWSTRVYSEPSKKCIVLHAV-NLRTKFDPP  283

Query  920   FPENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARR-RYGKGGFLHTA  1096
              P+   G N Y   V   Q   G    + L  K R+ +RG++     + R GK       
Sbjct  284   LPQYSFG-NFYRVAVTSLQLDSGKEC-YGLVAKMRETLRGIDKGYVEKLRDGKEHL----  337

Query  1097  LPIMSEIIKHEGS---KKNMYCLYTSSLLGMQVYAADFGWGKPRWAVN-AQVMKDSVVFM  1264
                  + IK       K  +  +  +SL    VY +DFGWG P WA + A   ++ VVFM
Sbjct  338   -----DFIKRSAEVYLKGQLLAMNFTSLCRFPVYESDFGWGNPTWAGSPALTFQNLVVFM  392

Query  1265  EGRFG-GVDLWMGLPEELMNIVMKNPQFVEFV  1357
             + + G GV+ ++ L  E M  +  + +F+EFV
Sbjct  393   DTKSGDGVETYISLRVEDMAALESDEEFMEFV  424



>ref|NP_189233.1| HXXXD-type acyl-transferase-like protein [Arabidopsis thaliana]
 gb|AEE77107.1| HXXXD-type acyl-transferase-like protein [Arabidopsis thaliana]
Length=442

 Score =   204 bits (519),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 139/453 (31%), Positives = 229/453 (51%), Gaps = 38/453 (8%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVDEL  223
             M+++V  RDIIKPSSPTP  L+ +  S+++QL   +  P V FY +  S +    +   L
Sbjct  1     MRVDVVSRDIIKPSSPTPNHLKKFKLSLLEQLGPTIFGPMVFFYSANNSIKPTEQL-QML  59

Query  224   KKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREMVP  403
             KKSLS+TL+  YPLAGR+K + S I+CND G +F+E  V   LS+ L  P  + +++++P
Sbjct  60    KKSLSETLTHFYPLAGRLKGNIS-IDCNDSGADFLEARVNSPLSNLLLEPSSDSLQQLIP  118

Query  404   CNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRGCA  583
                 T         R+L+ Q + F CG +S+G+ +SH + D  SI +F  +WA I+   +
Sbjct  119   ----TSVDSIETRTRLLLAQASFFECGSMSIGVCISHKLADATSIGLFMKSWAAISSRGS  174

Query  584   VVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQE----KYVVRRFYIPASAIDQL  751
             +   G  +FD  KIFPP         F+  +       E    + + +RF   +S+I  L
Sbjct  175   IKTIGAPVFDTVKIFPP-------GNFSETSPAPVVEPEIMMNQTLSKRFIFDSSSIQAL  227

Query  752   REQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPFPEN  931
             + +       +P+R EA+ A++W + + A  +   G     +L + ++LR+R+ PPF +N
Sbjct  228   QAKASSFEVNQPTRVEAVSALIWKSAMKAT-RTVSGTSKPSILANSVSLRSRVSPPFTKN  286

Query  932   CLGN-NTYGATVHWNQPTEG-NPSR-HALALKFRDAIRGVNDEAARRRYGKGGFLHTALP  1102
              +GN  +Y A     +  EG N ++   L  K R A +   D    +  G       A  
Sbjct  287   SIGNLVSYFAA----KAEEGINQTKLQTLVSKIRKAKQRFRDIHIPKLVGNPN----ATE  338

Query  1103  IMSEIIKHEGS-----KKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQVMKDSVVFM-  1264
             I+    K  G        + Y   ++   G+  Y  DFGWGKP W     V + ++V + 
Sbjct  339   IICSYQKEAGDMIASGDFDFYIFSSACRFGL--YETDFGWGKPVWVGFPSVRQKNIVTLL  396

Query  1265  -EGRFGGVDLWMGLPEELMNIVMKNPQFVEFVS  1360
                  GG++ W+ L E+ MN+  ++ + ++F S
Sbjct  397   DTKEAGGIEAWVNLNEQEMNLFEQDRELLQFAS  429



>ref|XP_004485524.1| PREDICTED: vinorine synthase-like [Cicer arietinum]
Length=444

 Score =   204 bits (518),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 133/456 (29%), Positives = 227/456 (50%), Gaps = 48/456 (11%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVDE-  220
             +K+E   R +IKPS PTP +L+T+  S++DQLS N       FY +  +    +  +++ 
Sbjct  15    VKLETLNRVLIKPSKPTPPNLQTFKLSLLDQLSPNFHGNTTFFYPNYNNINHSSHFLEKS  74

Query  221   --LKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIRE  394
               L+ SLSQTL+L YPLAG + +D ++I CND GV FIE     +LS  L NPDF+    
Sbjct  75    KLLQNSLSQTLTLFYPLAGNL-QDAATINCNDGGVFFIESQTNTTLSEILTNPDFDTFE-  132

Query  395   MVPCNPFTGAFEPNPDGR----VLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWA  562
                       F P+ D +    +L+I+   F CG  ++ + ++H I D  ++  F  TW 
Sbjct  133   ---------CFLPSTDEKQILNLLLIRFTLFDCGSTAITVSLTHKIADFNTLITFLKTWT  183

Query  563   RINRG-CAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASA  739
              +  G   ++ D   +  A  +FPP        +F  ++     S +K   RRF   AS 
Sbjct  184   AVCGGDTKILPD---LTTAVNLFPP-------REFPAISASVKTSNKKITSRRFIFEASK  233

Query  740   IDQLREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPP  919
             I++L+ +++    + P+R E ++A++W   ++    +        +L   +NLR RMEP 
Sbjct  234   IEELKTRVKRTVEFNPTRVEVVLALIWKCALSTTATKTTSFFKHSILLQAVNLRTRMEPT  293

Query  920   FPENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTAL  1099
              PEN +GN  +  +V      E + +   +  + R  +R    E+   R+ + G+    +
Sbjct  294   IPENAVGNLIWPFSV--TVEDECHVAIDEMVKRMRKGMREF-IESKVERFKEEGWFEFVM  350

Query  1100  PIMSEIIK-HEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNA-QVMKDSVVFMEGR  1273
               + E +K +EGS   +    +SS     +   DFGWGKP W+ +  +V+ +++  M+ +
Sbjct  351   ESLKERVKINEGS---LVIYRSSSWCNFPLLENDFGWGKPVWSCSVNKVVSNTIALMDTK  407

Query  1274  FG-GVDLWMGLPE----------ELMNIVMKNPQFV  1348
              G GV+ ++ L E          EL+N  M NP+ +
Sbjct  408   DGCGVEAFVTLDEDHMEFFQQDQELLNYAMLNPRII  443



>ref|XP_009588476.1| PREDICTED: vinorine synthase-like [Nicotiana tomentosiformis]
Length=443

 Score =   204 bits (518),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 142/453 (31%), Positives = 228/453 (50%), Gaps = 34/453 (8%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVDEL  223
             M++++   ++I+PSSPTP  L+ ++  ++DQL      P + FY + G  + +      L
Sbjct  1     MEVKLISTEMIQPSSPTPNHLKNFSLCLLDQLIPASYAPIILFYTNLGDIKVHEKSA-LL  59

Query  224   KKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREMVP  403
             KKSL+ TLS  YPLAGR K D  SI+CNDQGV ++  +V   L  FL  P+ E I + +P
Sbjct  60    KKSLADTLSRFYPLAGRFK-DELSIDCNDQGVNYVTTNVNCLLIEFLNEPNLESIGQFLP  118

Query  404   CNPFTGAFEPNPDGRVLV-IQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRGC  580
             C P    F+    G  +  IQ+N F CGGI++GL ++H I DG  +S F   WA +   C
Sbjct  119   CQP---PFKELVGGDCVTNIQINVFECGGIAIGLCIAHKILDGVGLSTFLKYWAGL--AC  173

Query  581   AVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQLREQ  760
             +  +       A+  FP   +   L   +     +   +  ++ RRF   ASAID L+  
Sbjct  174   SSNEVQCPNLMANYFFP--ADDLWLRDTSMTMWSSLFKKGNFITRRFVFNASAIDNLK-T  230

Query  761   LRLISHYR-PSRAEALIAVVWDAVIAANQKR--HKGRINLHVLTSILNLRNRMEPPFPEN  931
             +   SH + P++ E + + +W   IAA++++     R +  +LT I+NLR R  P  PEN
Sbjct  231   MSTSSHIKHPTKVEVVSSFIWKCSIAASKEKSCSNKRPSNSLLTHIVNLRKRAAPALPEN  290

Query  932   CLGNNTYGATVHWNQPTEGNPSRHALAL-----KFRDAIRGVNDEAARRRYGKGGFLHTA  1096
              LGN  + ++         N ++H + L     + R +IR ++D   +R     GF +  
Sbjct  291   ILGNLLWLSSAK-------NTAKHEMGLPDLVNQVRKSIRRIDDHYVKRLRSDEGF-NLM  342

Query  1097  LPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRW----AVNAQVMKDSVVFM  1264
                ++EI        + Y   +    G   Y  DFG+GKP W    +       + ++ M
Sbjct  343   RKSLNEIGDFCTKGADHYGFTSWCKFGF--YDIDFGFGKPIWISSISSRCSFFMNLIILM  400

Query  1265  EGR-FGGVDLWMGLPEELMNIVMKNPQFVEFVS  1360
             E +   G++ W+ L EE MN+++ N + V F S
Sbjct  401   ETKCVDGIEAWVTLDEEEMNMLVGNQELVVFAS  433



>ref|XP_010050974.1| PREDICTED: vinorine synthase-like [Eucalyptus grandis]
 gb|KCW80997.1| hypothetical protein EUGRSUZ_C02371 [Eucalyptus grandis]
Length=441

 Score =   204 bits (518),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 142/452 (31%), Positives = 225/452 (50%), Gaps = 25/452 (6%)
 Frame = +2

Query  38    ITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPG--SSRDYNGV  211
             + MK+E    + IKPSSPTP   R + F ++DQL+    +P + FY +P   ++ D   V
Sbjct  1     MAMKVEAVSAESIKPSSPTPSHHREFKFCLLDQLAPPFYVPAILFYSAPDDKAALDSASV  60

Query  212   VDELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIR  391
                LK SLSQ LSL YPL GR+K + ++I+C+D G  ++E      LS  L NPD   ++
Sbjct  61    SGNLKTSLSQALSLFYPLGGRVKGN-AAIDCSDDGALYLEAKAHFELSEVLSNPDINQLQ  119

Query  392   EMVPCNPFTGAFEPNPDGRVLV-IQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARI  568
             + +P +P+     PN + +V++ +Q   F+CGGI++G+ +SH I DGAS+S F   W+ I
Sbjct  120   KFLPFSPYR--VIPNIEEQVILGVQFTFFNCGGIAIGICISHKIADGASVSAFLAAWSEI  177

Query  569   --NRGCAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAI  742
               N      +       AS+IFPP       D   ++  G   S+EK + + F     ++
Sbjct  178   AVNGVDGEANLKTPFLKASEIFPPK------DINFQMPSGVI-SREKLLTKMFRFDGESL  230

Query  743   DQLREQLRLISHYRPSRAEALIAVVWDAVIAANQKR---HKGRINLHVLTSILNLRNRME  913
              +LR +        P+R EA+ A++W + + A  KR    K       +T ++N+R+R+ 
Sbjct  231   GRLRARF---GSTAPTRVEAVTALIWKSAVEAAGKRPDWTKKYPPSSAVTHVVNIRSRIR  287

Query  914   P-PFPENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLH  1090
             P P PEN LG N + + V     T         A   R +IR ++ E      G+ G   
Sbjct  288   PQPLPENALG-NLWQSVVAPLIDTNKGVELQDFAGSLRKSIRAIDGEYLSVLQGERGLAK  346

Query  1091  TALPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQVMKDSVVFMEG  1270
                 + +     E S   M     SS +    Y  DFG G+P W     +   ++VF+ G
Sbjct  347   AYESLTAARKLAESSAGKMELYGFSSWVKFPFYEVDFGLGRPTWVCTTGLPIGNMVFLMG  406

Query  1271  -RFG-GVDLWMGLPEELMNIVMKNPQFVEFVS  1360
              R G G++ W+ L E  M    +N + ++F+S
Sbjct  407   TRCGDGIEAWITLHENDMIEFERNDELLQFIS  438



>ref|XP_002314561.1| transferase family protein [Populus trichocarpa]
 gb|EEF00732.1| transferase family protein [Populus trichocarpa]
Length=445

 Score =   204 bits (518),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 146/438 (33%), Positives = 217/438 (50%), Gaps = 40/438 (9%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVDEL  223
             + +E+  R++I PSSPT   LR +N S++DQL+     P V  Y +       N     L
Sbjct  6     VNVEIVAREVIGPSSPTLNHLRKFNLSLLDQLAPVSYEPLVLLYSNFQQRLTGNHQSLRL  65

Query  224   KKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREMVP  403
             K+SLS+TL+  YPLAGRIK D +SIECND G  F+E  V+  LS FLE PD E IR+ +P
Sbjct  66    KRSLSETLTRFYPLAGRIK-DGASIECNDLGAVFVESRVSCLLSKFLEKPDAEAIRKFIP  124

Query  404   CNPFTGAFEPNPD---GRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINR  574
                       +P+   G ++++Q N F+CGG+++G+ +SH   D  + S F   WA    
Sbjct  125   VE------TESPEALTGSLVLVQANFFACGGLAIGVCISHKAADPVTFSTFIKAWAA--A  176

Query  575   GCAVVDDGGF--IFDASKIFPPVKNTADLDQFARVARGAAES--QEKYVVRRFYIPASAI  742
                 V+D     +F+AS +FPP        Q   + R AA     +K V +R    AS I
Sbjct  177   AFRSVNDSTVLPLFNASSLFPP--------QNLPLTRPAAVELMNDKCVTKRLVFDASKI  228

Query  743   DQLREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPF  922
               L+ +    S   P+R EA+ A++W   + A++   +  +   +L+  +NLR RM PP 
Sbjct  229   AALQAKAVSESVTCPTRVEAVTALIWKCAMNASRSNSE-HLRYSILSQSVNLRKRMVPPL  287

Query  923   PENCLGNNT-YGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTAL  1099
             PEN +GN   Y A+      TE      +L  + R  +R   +     + G+G     A 
Sbjct  288   PENTIGNLVGYFASCA----TECEIELQSLVGQLRKGLRDFGENYV-EKLGEG----KAF  338

Query  1100  PIMSEIIKHEGS---KKNMYCLYTSSLLGMQVYAADFGWGKPRW-AVNAQVMKDSVVFME  1267
               + E  +  GS   + N+    ++       Y  DFGWGKP W  +     K+    M+
Sbjct  339   MAVCESFQEAGSMLQEGNVDFYASTDFCRFPFYGIDFGWGKPTWVTIPTGANKNVTTIMD  398

Query  1268  GRFG-GVDLWMGLPEELM  1318
              R G GV+ W+ L EE M
Sbjct  399   TRDGEGVEAWVTLTEEDM  416



>gb|KDO50293.1| hypothetical protein CISIN_1g012496mg [Citrus sinensis]
Length=462

 Score =   204 bits (519),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 147/473 (31%), Positives = 229/473 (48%), Gaps = 41/473 (9%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFY----DSPGSSRDYNGV  211
             M++E+  R+ IKPSSPTP  L+T+   ++DQ   N   P V +Y    D   S+ D + +
Sbjct  1     MEVEIISRESIKPSSPTPLDLKTHKLCLMDQFLSNAYAPRVLYYPLNQDDLSSAIDIDHI  60

Query  212   VDE----LKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDF  379
             V +    LK+SLS+TL   YPLAG++  +  S++CND+GV F+E      L+  L  PD 
Sbjct  61    VSKRLQLLKQSLSETLVHFYPLAGKLT-NNFSVDCNDEGVYFVEAAAKSPLNELLIQPDL  119

Query  380   EMIREMVPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTW  559
              +I ++ P +    + +      V ++QV  F+CGG+ +   +SH  GDG S S F   W
Sbjct  120   NLINKLCPVDGSQQSGQV-AGAHVAMVQVTSFACGGLVICACISHTFGDGTSFSSFTKAW  178

Query  560   ARINRGCAVVDDGGFI---FDASKIFPPVKNTADLDQFARVARGAAESQ----EKYVVRR  718
             A   R     ++  FI   +DAS +F P  N  DL    R    A+ ++      +V RR
Sbjct  179   AATARKKTSEEETIFICPNYDASSLFLP--NEDDLFHQLRAVSNASYTRLLETGTFVKRR  236

Query  719   FYIPASAIDQLREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNL  898
             F   A AI +L+ + +      P+R E L A++  +++A   K+  G     +L+  +NL
Sbjct  237   FVFDAKAIAELKAKAKSSRVQNPTRIEVLSAILSKSIMAVVNKK-SGSHKPMLLSHAVNL  295

Query  899   RNRMEPPFPENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKG  1078
             R R  PP  E  +GN  +     +   TE       L  + R+AI   + E  +   G G
Sbjct  296   RPRARPPLSEYLIGNIVWYTNALF---TEEGVDLDGLVWQLREAISKFDGEFVKSLQGVG  352

Query  1079  GFLHTALPIMSEIIKHEGS----KKNMYCLYTSSLLGMQVYAADFGWGKPRW----AVNA  1234
             G L      +SE IK+E       KN     +    G   Y  DFGWG+P W        
Sbjct  353   GLLK-----LSEAIKYEAEACSDAKNRVIFSSWCTFGF--YGIDFGWGQPIWVSCVGFGG  405

Query  1235  QVMKDSVV--FMEGRFG-GVDLWMGLPEELMNIVMKNPQFVEFVSAGFSKSKL  1384
              +++ S +   ++ RFG G++ W+ L EE M ++  +   +EF +   S  KL
Sbjct  406   SILQFSPIINLVDTRFGDGIEAWVSLLEEDMALLEVDKNLLEFATIDPSPLKL  458



>ref|XP_006387729.1| hypothetical protein POPTR_0640s00200g [Populus trichocarpa]
 gb|ERP46643.1| hypothetical protein POPTR_0640s00200g [Populus trichocarpa]
Length=464

 Score =   204 bits (519),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 142/454 (31%), Positives = 226/454 (50%), Gaps = 34/454 (7%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNG--VVD  217
             M + +  R++IKPSSP+   L  +  S++DQL     +P V FY    +++D+ G  +  
Sbjct  1     MDVSIISRELIKPSSPSIHHLLPFKLSLLDQLLPTTYVPMVFFYPR-NNNQDFKGLQISI  59

Query  218   ELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREM  397
             +LK+SLSQTLS  YP +GR++ + S I+  ++G  F+E  V  SL  FL  P   ++ + 
Sbjct  60    QLKRSLSQTLSTFYPFSGRVRNN-SIIDNYEKGAPFVETRVKGSLFDFLIQPQLNLLNKF  118

Query  398   VPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRG  577
             +PC PF    +P    +V  IQVN F CGG ++GL  SH I D A+   F ++WA   RG
Sbjct  119   LPCQPFGYQSDPEATPQV-AIQVNTFDCGGTALGLCFSHKIIDVATAIAFLDSWAANTRG  177

Query  578   CAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQLRE  757
               +      +F+AS  FPP      L QF          +E  V +RF   A AI  LR 
Sbjct  178   HYLEQINPALFEASSRFPP--QNKFLVQFPLWVAENYLFKEGNVTKRFVFDADAIATLRA  235

Query  758   QLRLISHYRPSRAEALIAVVWDAVIAANQK---RHKGRINLHVLTSILNLRNRMEPPFPE  928
             + +      PSR E L A +W +   A +      +  ++LH     +N+R R +P F  
Sbjct  236   KAKSKRVPNPSRTETLTAFIWKSCTEACRSLCALPRPSVSLHA----VNIRQRTKPSFSR  291

Query  929   NCLGNNTYGATVHWNQPTEGNPSRHALALK-----FRDAIRGVNDEAARRRYGKGGFLHT  1093
               +GN      + W   T    +   + L       R++   +ND+  +   G+ G    
Sbjct  292   YSIGN------LWWRSLTACELADTKIELNDLVSLTRESFTNINDDLLKDFQGENGLQGI  345

Query  1094  ALPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRW-AVNAQVMKDS----VV  1258
             +  ++ +++   GS+     L+ SS L   +   DFGWGKP W  +  +V + S      
Sbjct  346   SESLLKQLVGI-GSRNPEIFLF-SSWLNFDLNDVDFGWGKPIWVGLTGEVGRPSGWANAT  403

Query  1259  FME--GRFGGVDLWMGLPEELMNIVMKNPQFVEF  1354
             F +  GR   +++WM L E++M++V +NP+F+EF
Sbjct  404   FFKQTGRNNEIEVWMTLNEKIMSVVERNPEFLEF  437



>ref|XP_010050979.1| PREDICTED: vinorine synthase-like [Eucalyptus grandis]
 gb|KCW81002.1| hypothetical protein EUGRSUZ_C02380 [Eucalyptus grandis]
Length=439

 Score =   203 bits (517),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 139/450 (31%), Positives = 221/450 (49%), Gaps = 25/450 (6%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPG--SSRDYNGVVD  217
             MK+E    + IKP SPTP   R + F ++DQL+    +P + FY +P   ++ D   V  
Sbjct  1     MKVEAVSAESIKPFSPTPSHHREFKFCLLDQLAPPFYVPAILFYSAPDDKAALDSASVTG  60

Query  218   ELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREM  397
              LK SLSQ LSL YPL GR+K + ++I+C+D G  ++E      LS  L NPD   +++ 
Sbjct  61    NLKTSLSQALSLFYPLGGRVKGN-AAIDCSDDGALYLEAKAHFELSEVLSNPDINQLQKF  119

Query  398   VPCNPFTGAFEPNPDGRVLV-IQVNRFSCGGISVGLIMSHAIGDGASISVFANTWAR--I  568
             +P +P+     PN + +V+V +Q   F+CGGI++G+ +SH I DGAS+S F   W+   I
Sbjct  120   LPFSPYR--VIPNIEEQVIVGVQFTFFNCGGIAIGICISHKIADGASVSAFLAAWSEIAI  177

Query  569   NRGCAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQ  748
             N      +       AS+IFPP       D   ++  G   S+EK + + F     ++ +
Sbjct  178   NGVDGKANLKTPFLKASEIFPPK------DINFQMPSGVI-SREKILTKMFRFDGESLGR  230

Query  749   LREQLRLISHYRPSRAEALIAVVWDAVIAANQKRH---KGRINLHVLTSILNLRNRMEP-  916
             LR +        P+R EA+ A++W + + A +KR    K       +T ++N+R+R+   
Sbjct  231   LRARF---GSTAPTRVEAVTALIWKSAVEAARKRSDWTKKYPPSSAVTHVVNIRSRIRSQ  287

Query  917   PFPENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTA  1096
             P PEN LGN          +P +        A   R +I  ++ E      G+ G     
Sbjct  288   PLPENALGNLWQSIVAPLMEPNK-EAELQDFAGIIRKSISSIDSEYLSALRGENGLAKAC  346

Query  1097  LPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQV-MKDSVVFMEGR  1273
               + +       S   +     SS      Y ADFGWG+P W     V MK+ V+ M  +
Sbjct  347   ENLTAARRLAAASAGEIELYRFSSWARFPFYEADFGWGRPAWVCTTSVPMKNVVILMGTK  406

Query  1274  FG-GVDLWMGLPEELMNIVMKNPQFVEFVS  1360
              G G++ W+ L E  M    +N + ++F++
Sbjct  407   CGDGIEAWITLAEHDMIEFERNDELLQFIA  436



>ref|XP_008446186.1| PREDICTED: vinorine synthase-like [Cucumis melo]
 gb|ADN33961.1| anthranilate N-benzoyltransferase [Cucumis melo subsp. melo]
Length=430

 Score =   203 bits (516),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 142/455 (31%), Positives = 221/455 (49%), Gaps = 43/455 (9%)
 Frame = +2

Query  41    TMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVDE  220
             ++KIE+   +IIKPSSPTP + + +  S +DQ +     P + FY  PG + D+     +
Sbjct  6     SLKIEITSTEIIKPSSPTPSTHQHHKLSFLDQFAPGSYTPLLFFY--PGHA-DHRDRCRK  62

Query  221   LKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENP-DFEMIREM  397
             LK+SL++TLS  Y LAG + E    +ECND+GV F E  V+  LS  +ENP D   +  +
Sbjct  63    LKESLAETLSRFYLLAGTLVEAYL-VECNDEGVAFSEVRVSGRLSEVMENPNDLVSLHRL  121

Query  398   VPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRG  577
             +P +P     E      +L +Q N F CGG  +GL ++H I DG S ++F   WA   RG
Sbjct  122   LPFHP-DAVLEREC---ILGVQYNVFECGGAVIGLCVTHKIVDGTSATMFTKAWASTCRG  177

Query  578   ---CAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQ---EKYVVRRFYIPASA  739
                C++V      FDA+++FP ++            RG    Q   +K V RRF    S 
Sbjct  178   DSQCSIVP----TFDATELFPAME-----------IRGGNRRQSRMQKVVTRRFIFNKSN  222

Query  740   IDQLREQLR----LISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNR  907
             I  L++Q       ++   PSR E++   +W+  IA + ++   +    V    +NLR+R
Sbjct  223   IAALKKQANSAALFLNQRPPSRVESVSGFLWNRFIALSHQKPPTKAKRFVAIQTVNLRSR  282

Query  908   MEPPFPENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFL  1087
             M PP P +  GN  + AT     P +       L  K R+AI+ ++DE  +        +
Sbjct  283   MNPPLPPHSFGNICWSATAE--VPIDEKQHFPFLVGKIREAIKEIDDEYTKTLQDTEKSM  340

Query  1088  HTALPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVN-AQVMKDSVVFM  1264
                + +   +   E     M C   +S     VY  DFGWGKP W     +  K+ V+F+
Sbjct  341   RAKMKMGERVYSGE---VEMVCF--TSWCNFPVYETDFGWGKPTWVCTPGRPYKNVVLFV  395

Query  1265  EGRFG-GVDLWMGLPEELMNIVMKNPQFVEFVSAG  1366
                 G G++ W+ L E  M +   + + + F S+ 
Sbjct  396   NTSDGEGIEAWVNLEENDMALFENDSELLSFTSSS  430



>gb|KCW44979.1| hypothetical protein EUGRSUZ_L01434, partial [Eucalyptus grandis]
Length=434

 Score =   203 bits (516),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 140/448 (31%), Positives = 219/448 (49%), Gaps = 25/448 (6%)
 Frame = +2

Query  38    ITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPG--SSRDYNGV  211
             + MK+E    + IKPSSPTP   R + F ++DQL+    +P + FY +P   ++ D   V
Sbjct  1     MAMKVEAVSAESIKPSSPTPSHHREFKFCLLDQLAPPFYVPAILFYSAPDDKAALDSASV  60

Query  212   VDELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIR  391
                LK SLSQ LSL YPL GR+K + ++I+C+D G  ++E      LS  L NPD   ++
Sbjct  61    TGNLKTSLSQALSLFYPLGGRVKGN-AAIDCSDDGALYLEAKAHFELSEVLSNPDINQLQ  119

Query  392   EMVPCNPFTGAFEPNPDGRVLV-IQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARI  568
             + +P +P+     PN + +V+V +Q   F+CGGI++G+ +SH I DGAS+S F   W+ I
Sbjct  120   KFLPFSPYR--VIPNIEEQVIVGVQFTFFNCGGIAIGICISHKIADGASVSAFLAAWSEI  177

Query  569   --NRGCAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAI  742
               N      +       AS+IFPP       D   ++  G   S+EK + + F     ++
Sbjct  178   AVNGVDGEANLKTPFLKASEIFPPK------DIKFQMPSGVI-SREKLLTKMFRFDGESL  230

Query  743   DQLREQLRLISHYRPSRAEALIAVVWDAVIAANQKR---HKGRINLHVLTSILNLRNRME  913
               LR +        P+R EA+ A++W + + A +KR    K       +T ++N+R+R+ 
Sbjct  231   GHLRARF---GSTAPTRVEAVTALIWKSAVEAARKRPDWTKKYPPSSAVTHVVNIRSRIR  287

Query  914   P-PFPENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLH  1090
               P PEN LGN          +P +        A   R +IR ++ E      G+ G   
Sbjct  288   SQPLPENALGNLWQSIVAPLMEPNK-EAELQDFAGIVRKSIREIDSEYLSALRGENGLAK  346

Query  1091  TALPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQV-MKDSVVFME  1267
                 + +       S   +     SS      Y ADFGWG+P W     V MK+ V+ M 
Sbjct  347   ACENLTAARRLAAASAGEIELYRFSSWARFPFYEADFGWGRPAWVCTTSVPMKNVVILMG  406

Query  1268  GRFG-GVDLWMGLPEELMNIVMKNPQFV  1348
              + G G++ W+ L E  M    +N + +
Sbjct  407   TKCGDGIEAWITLAEHDMIEFERNDELL  434



>ref|XP_002317521.2| hypothetical protein POPTR_0011s12510g [Populus trichocarpa]
 gb|EEE98133.2| hypothetical protein POPTR_0011s12510g [Populus trichocarpa]
Length=451

 Score =   203 bits (517),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 141/458 (31%), Positives = 227/458 (50%), Gaps = 42/458 (9%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNG--VVD  217
             M + +  R++IKPSSP+   L  +  S++DQL     +P V FY +  +++D+ G  +  
Sbjct  1     MDVSIISRELIKPSSPSIHHLSPFKLSLLDQLFPTTYVPMVFFYPT-KNNQDFKGLQISI  59

Query  218   ELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREM  397
             +LK+SLSQTLS  YPL+GR++ + S I+  ++G  F+E  V  SL  FL  P    + + 
Sbjct  60    QLKRSLSQTLSTFYPLSGRVRNN-SLIDNYEKGAPFVETRVKGSLFDFLIQPQLNSLNKF  118

Query  398   VPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRG  577
             +PC P     +P    +V  IQVN F CGG ++GL  SH I D A+   F ++WA   RG
Sbjct  119   LPCQPLGYQSDPEATPQV-AIQVNTFDCGGTALGLCFSHKIIDVATAIAFLDSWAANTRG  177

Query  578   CAVVDDGGFIFDASKIFPPVKNTADLDQF-ARVARGAAES---QEKYVVRRFYIPASAID  745
                      +F+AS  FPP      L++F  +V     E+   +E  V +RF   A A+ 
Sbjct  178   HYHEQKNPGLFEASSRFPP------LNKFLVQVPLWVTENCLFKEGNVTKRFVFDADAVA  231

Query  746   QLREQLRLISHYRPSRAEALIAVVWDAVIAANQKRH---KGRINLHVLTSILNLRNRMEP  916
              LR + +      PSR E L A +W +   A +      +  ++LH     +N+R R EP
Sbjct  232   TLRARAKSKRVPNPSRTETLTAFIWKSCTEACRSLRDLPRPSVSLHA----VNIRQRTEP  287

Query  917   PFPENCLGNNTYGATVHWNQPTEGNPSRHALALK-----FRDAIRGVNDEAARRRYGKGG  1081
              F    +GN      + W   T    +   + L       R++   +ND+  +   G+ G
Sbjct  288   SFSRYSIGN------LWWRSMTACELADTKIELNDLVSLTRESFANINDDRLKDFQGENG  341

Query  1082  FLHTALPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRW-AVNAQVMKDS--  1252
             F    + ++ +++        ++    SS L   +   DFGWGKP W  +  +V + S  
Sbjct  342   FQGITVSLLKQLVGIVSRNPEIFMF--SSWLNFDLNDVDFGWGKPIWVGLTGEVGRPSGF  399

Query  1253  --VVFME--GRFGGVDLWMGLPEELMNIVMKNPQFVEF  1354
               + F +  GR   ++ WM L E++M+ V +NP+F+EF
Sbjct  400   ANITFFKQTGRNNEIEAWMTLNEKIMSAVERNPEFLEF  437



>ref|XP_008222017.1| PREDICTED: vinorine synthase-like [Prunus mume]
Length=444

 Score =   203 bits (516),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 144/463 (31%), Positives = 229/463 (49%), Gaps = 45/463 (10%)
 Frame = +2

Query  38    ITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSR-DYNGVV  214
             + +++EV  ++IIKPSSPTP  LR    S +DQL+  V  P+V FY+  G ++     + 
Sbjct  1     MKVEVEVISKEIIKPSSPTPDHLRYLQLSFLDQLAPPVYNPFVLFYEFNGQTQPKITEIS  60

Query  215   DELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIRE  394
               LKKSL+  L+L YPLAGR+ +    ++CND+GV ++E  V  SLS FL NP  + +++
Sbjct  61    GHLKKSLADVLTLFYPLAGRVFKQNHFVDCNDEGVPYVEAQVKCSLSDFLNNPIPDELKK  120

Query  395   MVPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINR  574
              +P      A E       L +Q+N F CGG ++G  +SH I DG S  +F+ TWA    
Sbjct  121   FIPLELDNIANE-----LALGVQLNIFECGGFAIGQCISHKIADGLSHFMFSKTWAATAL  175

Query  575   GCAV-VDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQL  751
             G    ++   F+  ++ +FPP +     D    + R         V +RF    S I+ L
Sbjct  176   GDQPRIERPEFV--SAALFPPKEFNIGYDAGIGITRNR-------VTKRFVFDTSKIESL  226

Query  752   REQ-------------LRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSIL  892
             + +             L L +   PSR EAL A +W   +A  +         +++   +
Sbjct  227   KTKYKGEDSSGFNSRALSLENEKGPSRVEALSAFIWSRFVATTKDDAGHDEKHYIVLHSV  286

Query  893   NLRNRMEPPFPENCLGNNTYGATVHWNQPTEGNPSRH-ALALKFRDAIRGVNDEAARRRY  1069
             NLR R +PP P++C GN   GA       + G    + A+  K R+ I  +N++  +R  
Sbjct  287   NLRPRFDPPLPQHCFGNLYRGAMTAPFLLSSGEECNYGAVITKVREEINKINNDYIKRL-  345

Query  1070  GKGGFLHTALPIMSE----IIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQ  1237
              + G  H  L ++ E    +I+ E    +      SS     VY  DFGWG+P W  +  
Sbjct  346   -QQGIEH--LSVLQESSDNVIRGEVDTFSF-----SSFCRFPVYDNDFGWGRPVWVSSPP  397

Query  1238  V-MKDSVVFMEGRFG-GVDLWMGLPEELMNIVMKNPQFVEFVS  1360
             +  K+ VVFM+ +   G++ ++ L EE+M     + +F+  VS
Sbjct  398   LTFKNLVVFMDTKEADGIEAYISLEEEVMAKFECDTEFLACVS  440



>ref|XP_010506970.1| PREDICTED: vinorine synthase-like [Camelina sativa]
Length=459

 Score =   203 bits (517),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 140/463 (30%), Positives = 232/463 (50%), Gaps = 46/463 (10%)
 Frame = +2

Query  29    LHQ-ITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYN  205
              HQ  +M ++V  RDIIKPSSPTP  L+ +  S+++QL   +  P V FY    +     
Sbjct  11    FHQNSSMIVDVVSRDIIKPSSPTPNHLKKFKLSLLEQLGPTIFGPMVFFYSGNNNRIKPT  70

Query  206   GVVDELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEM  385
               + +LKKSLS+TL+  YPLAGR+K +  SI+CN+ G +F+E +V   LSS L+ P  + 
Sbjct  71    EQLQKLKKSLSETLTHFYPLAGRLKGN-VSIDCNNSGADFLEAEVNSPLSSLLQEPSSDN  129

Query  386   IREMVPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWAR  565
             +++++P    T         ++L+ Q + F CG +++G+ +SH   D  SI +F  TWA 
Sbjct  130   LQQLIP----TSVDSIETRTKLLLAQASFFECGSMAIGVCISHKFADATSIGLFMKTWAA  185

Query  566   INRGCAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQE----KYVVRRFYIPA  733
             I+   ++   G  +FD  KIFPP         F+  +       E    + + +RF   +
Sbjct  186   ISSRGSIKTVGSPVFDTVKIFPP-------GNFSETSPAPVIEPEIMMNQTLSKRFVFDS  238

Query  734   SAIDQLREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRME  913
             S+I  L+ +       +P+R EA+ A++W   + A  +   G     +L +  +LR+R+ 
Sbjct  239   SSIQSLQAKASSFEVKQPTRVEAVSALIWKTAMKAT-RTVSGTSKPSILANSASLRSRVS  297

Query  914   PPFPENCLGN-NTYGATVHWNQPTEG-NPSR-HALALKFRDAIRGVNDEAARRRYGKGGF  1084
             PPF EN +GN  +Y A     +  EG N ++   L  K R+A +   +    +  G    
Sbjct  298   PPFTENSVGNLVSYFAA----KAEEGVNQTKLQTLVSKLRNAKQRFRENHVPKLVGN---  350

Query  1085  LHTALPIMSEII-KHEGSKKNM--------YCLYTSSLLGMQVYAADFGWGKPRWAVNAQ  1237
                  P  +EII  ++    +M        Y   ++   G+  Y  DFGWGKP W     
Sbjct  351   -----PNATEIICSYQREAGDMIASGDFDFYIFSSACRFGL--YETDFGWGKPVWVGIPS  403

Query  1238  VMKDSVVFM--EGRFGGVDLWMGLPEELMNIVMKNPQFVEFVS  1360
             V + ++V +      GG++ W+ L E+ M +  ++ + + FVS
Sbjct  404   VRQKNIVTLLDTKEAGGIEAWVNLNEQEMKLFEQDRELLHFVS  446



>ref|XP_006479029.1| PREDICTED: vinorine synthase-like [Citrus sinensis]
Length=442

 Score =   203 bits (516),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 143/441 (32%), Positives = 218/441 (49%), Gaps = 35/441 (8%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSR-DYNGVVDE  220
             M+I     +IIKPSSPTPQ L+T+  S++DQ++ +   P + FY    S+    N   D 
Sbjct  1     MEINNVSSEIIKPSSPTPQHLKTHKLSVLDQVAGDSLFPIILFYPQTCSNNTSLNKTTDL  60

Query  221   LKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAES-LSSFLENPDFEMIREM  397
             LK+SLS+TL+L +P AGR+K D  SI+C+D G  FIE   A S +S  ++ P  +M+ ++
Sbjct  61    LKRSLSRTLTLYHPFAGRLK-DEFSIDCDDTGATFIEARAAASDMSEIVKQPTVDMLEQL  119

Query  398   VPCNPFTGAFEPNPDGRV-LVIQVNRFS-CGGISVGLIMSHAIGDGASISVFANTWARIN  571
             +P           P   V L  +V  F  CGG+++ +  SH I D  + + F  TW    
Sbjct  120   MPYK-----LNEKPSVAVNLAAKVTYFEHCGGMALCVCFSHVIADITTAANFIKTWVTFA  174

Query  572   RG--CAVVDDGGF---IFDASKIFPPVKNTADLDQFAR--VARGAAESQEKYVVRRFYIP  730
              G   +  DD      +F  S IFPP K       F+R  +A   ++S E  + +RF   
Sbjct  175   SGSDTSSEDDDVIKHAVFGCSSIFPPQK----FSSFSRNVIAENLSKSAE-ILTKRFIFE  229

Query  731   ASAIDQLREQL--RLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSI-LNLR  901
                I  L+E++     S Y P+R EA+ A++   +++  +K      + H++ SI +NLR
Sbjct  230   GDKIAALKEKMGSESSSGYHPTRVEAVSAIILGGIMSV-EKEADDFNHSHLVASIAVNLR  288

Query  902   NRMEPPFPENCLGNNTYGATVHWNQPTEGNPSRH-ALALKFRDAIRGVNDEAARRRYGKG  1078
             NR+ PP PE  +GN           P E     +  LA     +I  +NDE  R+ +  G
Sbjct  289   NRVNPPIPEQSIGNIVQAGIA--KLPIEKKTIDYRNLAETLHKSIEKINDEYLRKFHADG  346

Query  1079  GFLHTALPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQVMKDSVV  1258
             GFL     ++  +       KN      S+     +Y ADFGWGKP W       KD  V
Sbjct  347   GFLSNMNDVLEGLF-----DKNCRWFTISAWCRRPLYEADFGWGKPVWVSTVMKHKDVAV  401

Query  1259  FMEGRFG-GVDLWMGLPEELM  1318
              ++   G G++ W+ LP++ M
Sbjct  402   LLDSSDGKGIEAWVALPKKDM  422



>ref|XP_010046626.1| PREDICTED: vinorine synthase-like [Eucalyptus grandis]
 gb|KCW86590.1| hypothetical protein EUGRSUZ_B03222 [Eucalyptus grandis]
Length=434

 Score =   202 bits (515),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 148/453 (33%), Positives = 224/453 (49%), Gaps = 42/453 (9%)
 Frame = +2

Query  38    ITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVD  217
             + + +E+  R+ IKPSSPTP  LR Y  S +DQ+S  V  P+V FY +P +  D + + D
Sbjct  1     MEIAVEITSRETIKPSSPTPDHLRHYRLSFLDQISPPVYNPFVLFY-TPQNEGDQSNIDD  59

Query  218   ---ELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMI  388
                +LK SLS  L+  YPLAGR++ +  SIEC+D GV + E  V   +S F ENPD   +
Sbjct  60    LSSKLKASLSIILTHFYPLAGRLRGN-VSIECDDAGVPYSEAIVKCQVSEFTENPDPREL  118

Query  389   REMVPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARI  568
             R +VP            D   L +Q NRF CGGI++G+ MSH I D  S+  F N WA +
Sbjct  119   RNLVP------FVLDASDETTLGVQFNRFDCGGIAIGICMSHKISDALSLLTFINMWAAV  172

Query  569   NRGCAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQ  748
              RG  ++      F ++++FPP KN    +    + R      +  V +RF      I+ 
Sbjct  173   CRGEEILAPPQ--FPSAELFPP-KNILGFEPSTGIIR------DNIVSKRFVFKTDKIEN  223

Query  749   LR----EQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEP  916
             L+    +++ L  +  PSR EAL   +W     + +   +      VL ++ NLR + +P
Sbjct  224   LKARYSKEMDLDRNRPPSRIEALSTFIWSRFAWSTRVYSEPSKKCIVLHAV-NLRTKFDP  282

Query  917   PFPENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARR-RYGKGGFLHT  1093
             P P+   G N Y   V   Q   G    + L  K R+ +RG++     + R GK      
Sbjct  283   PLPQYSFG-NFYRVAVTSLQLDSGKEC-YGLVAKMRETLRGIDKGYVEKLRDGKEHL---  337

Query  1094  ALPIMSEIIKHEGS---KKNMYCLYTSSLLGMQVYAADFGWGKPRWAVN-AQVMKDSVVF  1261
                   + IK       K  +  +  +SL    VY + FGWG P W  + A   ++ VVF
Sbjct  338   ------DFIKRSAEVYLKGQLLAMNFTSLCRFPVYESSFGWGNPTWVGSPALTFQNLVVF  391

Query  1262  MEGRFG-GVDLWMGLPEELMNIVMKNPQFVEFV  1357
             M+ + G GV+ ++ L  E M  +  + +F+EFV
Sbjct  392   MDTKSGDGVETYISLRVEDMAALESDEEFMEFV  424



>ref|XP_008383117.1| PREDICTED: vinorine synthase-like [Malus domestica]
Length=451

 Score =   203 bits (516),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 138/457 (30%), Positives = 213/457 (47%), Gaps = 34/457 (7%)
 Frame = +2

Query  41    TMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYD----------SPGS  190
             ++++E   +  +KPSS TP  LR +  S++DQ S    IP++ FY           S  S
Sbjct  5     SVEVETVEKQTVKPSSQTPHVLRNFKLSLLDQFSPVAYIPFLLFYPNVVSTTTSNVSTHS  64

Query  191   SRDYNGVVDELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLEN  370
              +  N     L KSLS+ L+  YPLAGRIK +   I CND G EF++  V  SLS  LE+
Sbjct  65    VKAINERYQHLIKSLSEILTHYYPLAGRIKGN-VVIVCNDDGAEFVKAHVKCSLSEILEH  123

Query  371   PDFEMIREMVPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFA  550
             PD EM+R ++P  P +        G++L +QVN F CGG+++GL +SH I D +++  F 
Sbjct  124   PDAEMLRRLLPIEPESTE---AVTGKLLAVQVNLFECGGMAIGLTISHKIADASTVCTFI  180

Query  551   NTWARINRGCAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIP  730
             N+WA        V      F  + +FPP      LD            +EK   RR+   
Sbjct  181   NSWAATAHKSNKVMLPQ--FGVASLFPP------LDFSDSEPPSMIYVKEKCTTRRYVFD  232

Query  731   ASAIDQLREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGR-----INLHVLTSILN  895
              S I  L+ ++      +P+R EA+ A++W   I A+ K          +   +    +N
Sbjct  233   DSKISVLQSKVSSSLVPKPTRVEAISALIWKCAIEASPKSSSNTLGSSPVRPSIFHQAVN  292

Query  896   LRNRMEPPFPENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGK  1075
             LR R+ PP P+N  GN    +T    + T        L  K R  I  + + A +     
Sbjct  293   LRKRVTPPLPDNLAGNLLVLSTSKAEESTTSVFDLKDLVAKIRAGIEEMKECATKLVDP-  351

Query  1076  GGFLHTALPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQV-MKDS  1252
                 + A+ +++E   +    + +     +S      Y ADFGWG P W   A   +K+ 
Sbjct  352   ----NEAMQVLTEYRTNLMKDQEIETYSCTSWCRFPFYGADFGWGMPSWVSFAGCSVKNL  407

Query  1253  VVFMEGR-FGGVDLWMGLPEELMNIVMKNPQFVEFVS  1360
               FM+ R   G++ W+ L EE M +    P+ + + S
Sbjct  408   FGFMDKRDCNGIETWLTLSEESMALFESKPKLLAYAS  444



>ref|XP_010100286.1| Deacetylvindoline O-acetyltransferase [Morus notabilis]
 gb|EXB82420.1| Deacetylvindoline O-acetyltransferase [Morus notabilis]
Length=439

 Score =   203 bits (516),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 148/452 (33%), Positives = 225/452 (50%), Gaps = 36/452 (8%)
 Frame = +2

Query  50    IEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVDE---  220
             IE+ +R+ IKPSSPTPQ  R +N    DQ+S    IP + FY     +   N V +    
Sbjct  4     IEIIKRETIKPSSPTPQHNRIHNLCWFDQISTPFFIPILLFYRHGLFNTSINAVSETSSL  63

Query  221   LKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREMV  400
             L  SLS+TLS  YP AGRI+ DR SI CND+GV+F+   V + LSS L NP  E++  + 
Sbjct  64    LINSLSKTLSKYYPFAGRIR-DRESILCNDEGVDFLVAKVKQDLSSLLHNPKAEILHLLF  122

Query  401   PCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRGC  580
             P N     +       +L +QVN F CGG+++G+ MSH + D A++  F N WA   R  
Sbjct  123   PDNL---QWRNTDVSFLLAVQVNYFDCGGLAIGVCMSHKLSDAATLVSFINCWASTARNA  179

Query  581   AVVDDGGF-IFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQLRE  757
                 D  F + + + +FP      DL  F      A   +  Y  RRF   A  I+ L+ 
Sbjct  180   G--RDVSFPVLNVASLFP----RGDLPLFPE----AVHWKGNYASRRFVFEAEKINSLKA  229

Query  758   QLRLISHY--RPSRAEALIAVVWDAVIAANQK-RHKGRINLHVLTSILNLRNRMEPPFPE  928
                +IS     P+R EA+ A+++ + I A++      + + H+L   +N+R RM P  PE
Sbjct  230   ---VISEKVENPTRVEAVTALLYKSAIKASRAVVSNAKTSSHLLVQQVNMRTRMVPELPE  286

Query  929   NCLGNNTYGATVHWNQPTEGNPSRH-ALALKFRDAIRGVNDEAARRRYGKGGFLHTALPI  1105
               +G+ ++   V W      + S    L  + R+A   +    A +  G+  FL      
Sbjct  287   TSVGSLSWFFPVLWGSIEMDDQSFFVGLVSRMREAFTKLCSSFADKFGGEDWFLE-----  341

Query  1106  MSEIIK-HEG--SKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVN-AQVMKDSVVFME--  1267
             M EI+K ++G  S+ +      SS     VY ADFGWGKP W  +   V K+ ++ M+  
Sbjct  342   MLEILKEYKGLLSRSDQVVYRFSSWCRFPVYEADFGWGKPVWVTSVGTVDKNVIILMDHG  401

Query  1268  GRFGGVDLWMGLPEELMNIVMKNPQFVEFVSA  1363
                GG++ ++ L E+ M +   + + + F S 
Sbjct  402   KNGGGIEAFVTLEEDEMFVFECDQELLAFASC  433



>ref|XP_004240930.1| PREDICTED: vinorine synthase-like [Solanum lycopersicum]
Length=439

 Score =   202 bits (515),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 135/453 (30%), Positives = 224/453 (49%), Gaps = 36/453 (8%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVDEL  223
             M ++V   +IIKP  PTP+ LR Y  S +DQ +    IP + FY++   + D +  +  +
Sbjct  1     MDVKVISEEIIKPCIPTPRHLRNYKISFIDQFTPCSYIPVILFYNA---NDDVDHELKPM  57

Query  224   KKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREMVP  403
             + +L++TLS  YPLAGR K D  SIECND+GV ++E     +LS FL+NPD   + + +P
Sbjct  58    QVALAETLSYYYPLAGRFK-DVYSIECNDEGVVYVEAQANFNLSKFLQNPDIPFLNKFLP  116

Query  404   CNPFTG-AFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRGC  580
                F G   EP+ +  ++ +Q   F CGG+++G+ M H + D +++SVF  TWA+I+RG 
Sbjct  117   ---FKGNCLEPSYNQPLVALQTTAFECGGMAIGVCMLHKVVDASTMSVFLKTWAKISRGE  173

Query  581   AVVDDGGFIFDASKIFPPV-----KNTADLDQFARVARGAAESQEKYVVRRFYIPASAID  745
                        A  +FPP+     K   D D F    +G+     K  +RRF   + +I 
Sbjct  174   GDKTLHPDFTSAISLFPPIDSLPTKFITDFDNF--YFQGS-----KSPMRRFLFDSKSIK  226

Query  746   QLREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPFP  925
              L+      S   PS+ EAL A +   + AA    +  +    ++T   NLR R++PP P
Sbjct  227   ALKANTSSESVPFPSKIEALTAFICKRIGAALMANNVPKT--LMITHAANLRPRVDPPLP  284

Query  926   ENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTALPI  1105
             +   GN  + A   ++ P + N     L +  R+    +  E  +    +  F       
Sbjct  285   QKTFGNLLWLAFAFYD-PLDTNNELPDLGIMLREVFAQLTAENIKDIDSECVFES-----  338

Query  1106  MSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRW--------AVNAQVMKDSVVF  1261
             +SE+++   + +N+     +S   M +Y  +FGWGKP W        A N +  +  V  
Sbjct  339   LSEVLESLSTNENIKTYRFTSWCNMGLYDVNFGWGKPVWVAHMGDLPAANVRSKQQFVFI  398

Query  1262  MEGRFGGVDLWMGLPEELMNIVMKNPQFVEFVS  1360
                   G++LW+   EE +  + K+ +F+ + +
Sbjct  399   ESASRQGIELWVASDEEEIRFLEKDAEFLAYAN  431



>gb|KCW80998.1| hypothetical protein EUGRSUZ_C02374 [Eucalyptus grandis]
Length=427

 Score =   202 bits (514),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 138/449 (31%), Positives = 218/449 (49%), Gaps = 33/449 (7%)
 Frame = +2

Query  38    ITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPG--SSRDYNGV  211
             + MK+E    + IKPSSPTP   R + F ++DQL+    +P + FY +P   ++ D   V
Sbjct  1     MAMKVEAVSAESIKPSSPTPSHHREFKFCLLDQLAPPFYVPAILFYSAPDDKAALDSASV  60

Query  212   VDELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIR  391
                LK SLSQ LSL YPL GR+K + ++I+C+D G  ++E      LS  L NPD   ++
Sbjct  61    TGNLKTSLSQALSLFYPLGGRVKGN-AAIDCSDDGALYLEAKAHFELSEVLSNPDINQLQ  119

Query  392   EMVPCNPFTGAFEPNPDGRVLV-IQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARI  568
             + +P +P+     PN + +V+V +Q   F+CGGI++G+ +SH I DGAS+S F   W+ I
Sbjct  120   KFLPFSPYR--VIPNIEEQVIVGVQFTFFNCGGIAIGICISHKIADGASVSAFLAAWSEI  177

Query  569   --NRGCAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAI  742
               N      +       AS+IFPP       D   ++  G   S+EK + + F     ++
Sbjct  178   AVNGIDGEANLKTPFLKASEIFPPK------DINFQMPSGVI-SREKLLTKMFRFDGESL  230

Query  743   DQLREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEP-P  919
              +LR +        P+R EA+ A++W + + A +KR                ++R+ P P
Sbjct  231   GRLRARF---GSTAPTRVEAVTALIWKSAVEAARKRPD-----------WTKKSRIRPQP  276

Query  920   FPENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTAL  1099
              PEN LGN          +P +        A   R +IR ++ E      G+ G      
Sbjct  277   LPENALGNLWQSVVAPLMEPNK-EAELQDFAGIVRKSIRAIDSEYLSALRGENGLAKACE  335

Query  1100  PIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQV-MKDSVVFMEGRF  1276
              + +       S   +     SS      Y ADFGWG+P W     V MK+ V+ M  + 
Sbjct  336   NLTAARRLAAASAGEIELYRFSSWARFPFYEADFGWGRPAWVCTTSVPMKNVVILMGTKC  395

Query  1277  G-GVDLWMGLPEELMNIVMKNPQFVEFVS  1360
             G G++ W+ L E  M    +N + ++F++
Sbjct  396   GDGIEAWITLAEHDMIEFERNDELLQFIA  424



>ref|XP_006377777.1| hypothetical protein POPTR_0011s12490g [Populus trichocarpa]
 gb|ERP55574.1| hypothetical protein POPTR_0011s12490g [Populus trichocarpa]
Length=451

 Score =   202 bits (515),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 141/454 (31%), Positives = 226/454 (50%), Gaps = 34/454 (7%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNG--VVD  217
             M + +  R++IKPSSP+   L  +  S++DQL     +P V FY    +++D+ G  +  
Sbjct  1     MDVSIISRELIKPSSPSIHHLLPFKLSLLDQLLPTTYVPMVFFYPR-NNNQDFKGLQISI  59

Query  218   ELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREM  397
             +LK+SLSQTLS  YP +GR++ + S I+  ++G  F+E  V  SL  FL  P   ++ + 
Sbjct  60    QLKRSLSQTLSTFYPFSGRVRNN-SIIDNYEKGAPFVETRVKGSLFDFLIQPQLNLLNKF  118

Query  398   VPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRG  577
             +PC PF    +P    +V  IQVN F CGG ++GL  SH I D A+   F ++WA   RG
Sbjct  119   LPCQPFGYQSDPEATPQV-AIQVNTFDCGGTALGLCFSHKIIDVATAIAFLDSWAANTRG  177

Query  578   CAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQLRE  757
               +      +F+AS  FPP      L QF          +E  V +RF   A AI  LR 
Sbjct  178   HYLEQINPALFEASSRFPP--QNKFLVQFPLWVAENYLFKEGNVTKRFVFDADAIATLRA  235

Query  758   QLRLISHYRPSRAEALIAVVWDAVIAANQK---RHKGRINLHVLTSILNLRNRMEPPFPE  928
             + +      PSR E L A +W +   A +      +  ++LH     +N+R R +P F  
Sbjct  236   KAKSKRVPNPSRTETLTAFIWKSCTEACRSLCALPRPSVSLHA----VNIRQRTKPSFSR  291

Query  929   NCLGNNTYGATVHWNQPTEGNPSRHALALK-----FRDAIRGVNDEAARRRYGKGGFLHT  1093
               +GN      + W   T    +   + L       R++   +ND+  +   G+ G    
Sbjct  292   YSIGN------LWWRSLTACELADTKIELNDLVSLTRESFTNINDDLLKDFQGENGLQGI  345

Query  1094  ALPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRW-AVNAQVMKDS----VV  1258
             +  ++ +++   GS+     L+ SS L   +   DFGWGKP W  +  +V + S      
Sbjct  346   SESLLKQLVGI-GSRNPEIFLF-SSWLNFDLNDVDFGWGKPIWVGLTGEVGRPSGWANAT  403

Query  1259  FME--GRFGGVDLWMGLPEELMNIVMKNPQFVEF  1354
             F +  GR   +++WM L E++M++V +NP+F++F
Sbjct  404   FFKQTGRNNEIEVWMTLNEKIMSVVERNPEFLQF  437



>emb|CDP13291.1| unnamed protein product [Coffea canephora]
Length=443

 Score =   202 bits (515),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 146/463 (32%), Positives = 236/463 (51%), Gaps = 49/463 (11%)
 Frame = +2

Query  44    MKIEVR--RRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDS---------PGS  190
             MK++V+   R  IKPSSPTP  L+ Y  S +DQ++  V +P V FY S         PG 
Sbjct  1     MKVDVQVISRYTIKPSSPTPDHLQHYPLSFLDQINPPVFMPLVLFYPSEQNHLITSTPGP  60

Query  191   SRDYNGVVDELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLEN  370
              +     +++LKKSLS+ L+  YPLAGR+  + + ++CND+G+ ++E   +  LS FL+N
Sbjct  61    DK-----LNQLKKSLSEALTRFYPLAGRLIGN-TYVDCNDEGIPYVEARASCGLSDFLDN  114

Query  371   PDFEMIREMVPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFA  550
             P    + + +PC+        +     +VIQV  F CGG++VG+ +SH I D  S+ +F 
Sbjct  115   PIPGELNKFLPCD------LDDVKDIGMVIQVTLFECGGVAVGVAISHKIADATSLFLFV  168

Query  551   NTWARINRGCAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIP  730
              +WA I+R  +  D    I++++ IFPP ++ A  +     A G  +  E  V +R    
Sbjct  169   TSWATISRRDS-HDTRSPIYESAAIFPP-RDVAGYNH----ALGMVKKDE-IVTKRLVFT  221

Query  731   ASAIDQLREQLRLIS---------HYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLT  883
             A+ I  LRE+    S           RP+R EAL A +W   + A       R  +++L 
Sbjct  222   ATKIASLREKYTTNSNTATGDEYHQIRPTRIEALSAFIWTRFLTATTGHKVNRDKMYMLN  281

Query  884   SILNLRNRMEPPFPENCLGNNTYGATVHWNQPTEGNPSR-HALALKFRDAIRGVNDEAAR  1060
               +NLR RM PP  E   GN +  A      P+  N  + + +  + RDAIR V  +   
Sbjct  282   HAVNLRPRMHPPLSECYFGNLSRPAIT---IPSFDNDEQGYGIVNQVRDAIRNVGGDQYV  338

Query  1061  RRYGKGGFLHTALPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQV  1240
              +  +G      +   ++++    +K  +     +SL     Y ADFGWGKP W  +A +
Sbjct  339   TKLREGDKHLNFIRERAKLV----NKGEVVSFSFTSLCRFPSYEADFGWGKPVWIGSASL  394

Query  1241  -MKDSVVFMEGRFG-GVDLWMGLPEELMNIVMKNPQFVEFVSA  1363
               K+ VVF++ R G G++ W+ +  E M  +  + + +++VS 
Sbjct  395   TFKNLVVFLDTRSGDGIEAWINMKLEDMAKLEADKELLKYVST  437



>ref|XP_007039558.1| Anthranilate N-benzoyltransferase protein, putative [Theobroma 
cacao]
 gb|EOY24059.1| Anthranilate N-benzoyltransferase protein, putative [Theobroma 
cacao]
Length=444

 Score =   202 bits (514),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 134/457 (29%), Positives = 230/457 (50%), Gaps = 37/457 (8%)
 Frame = +2

Query  38    ITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGS----SRDYN  205
             I +K E+  R  IKPS+PTP  L+T+  S++DQLS  V      FY S  +      D++
Sbjct  2     IEIKSEIVSRQTIKPSTPTPSDLKTFKLSLLDQLSPAVHGNMTFFYPSSNTMDSIGDDFS  61

Query  206   GVVDELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEM  385
                  L++S+S+TLSL YPL GR+ +D ++I+CND+G  F E  V   LS FL  P+F +
Sbjct  62    EKSQLLQESISKTLSLFYPLGGRL-QDAATIDCNDEGAFFAEAKVNIQLSEFLNQPEFNL  120

Query  386   IREMVPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWAR  565
             +   +P    T   E + +G + ++Q+  F+CGG+++ L ++H + D +++     +W  
Sbjct  121   MDHFLPTTD-TKTMELS-NGAMFIVQLTSFTCGGVAISLSLTHKLADVSALLTLLQSWTA  178

Query  566   INRGCAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAID  745
             + RG +       I +        K  A  D+ + ++     + EK+V+RRF   AS I 
Sbjct  179   VCRGLSDPVTPDLIGE--------KFLAPRDELSAMSASLNIAAEKFVLRRFVFSASKIA  230

Query  746   QLREQL------RLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNR  907
             +L+ ++       + SH  PSR E ++A++W   +A  +K+  G      L   +NLR R
Sbjct  231   ELKAKVDQEFQNEMQSH--PSRVEVVLALLWKCAVAC-KKQKTGSFGPTALFQAVNLRKR  287

Query  908   MEPPFPENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFL  1087
             M PP PE  +GN  +   V  ++  E +     L ++ R +    N+  A    G+    
Sbjct  288   MSPPLPETAIGNFIWPFMVLAHE--EKDLKLPELVIQMRKSFIEFNNTKANMFRGEAA--  343

Query  1088  HTALPIMSEIIKHEG----SKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNA-QVMKDS  1252
                L IM   +K  G    + + M     SS     +Y  DFGWGKP W V+  +++ ++
Sbjct  344   --PLAIMGA-LKERGEFFRNNREMTVYKCSSWCKFPLYDTDFGWGKPLWHVSINKLVSNT  400

Query  1253  VVFMEGRF-GGVDLWMGLPEELMNIVMKNPQFVEFVS  1360
             +   + R   G++  + L EE M +  +N + +++ +
Sbjct  401   IALADTRSRDGIEALLTLDEEEMALFEQNEELLKYAT  437



>ref|XP_011013913.1| PREDICTED: salutaridinol 7-O-acetyltransferase-like, partial 
[Populus euphratica]
Length=449

 Score =   202 bits (515),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 145/463 (31%), Positives = 228/463 (49%), Gaps = 31/463 (7%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFY----DSPGSSRDYNGV  211
             M++++  +  +KPSSPTP  LR +  S++DQL      P + FY     +  S  D    
Sbjct  1     MEVQIISKQNVKPSSPTPSPLRNFKLSLLDQLVTVPYAPILLFYPMNKKASTSYLDVPKR  60

Query  212   VDELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIR  391
             ++ LKKSLS+TL+  YPLAG+IK D  SI+CND+G  ++E  V   L  FL  PD  +  
Sbjct  61    LELLKKSLSETLTQFYPLAGKIK-DELSIDCNDEGAYYVETQVNCHLCEFLRQPDLLLAN  119

Query  392   EMVPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARIN  571
             +  PC       E      V   QVN F C GI +G+ +SH + DGA++S F   W+   
Sbjct  120   QFFPCELLPT--ESTAVTYVANFQVNVFECCGIVIGMCISHRVVDGAALSTFLKAWSATA  177

Query  572   RGC--AVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAID  745
             +G   A++      F AS +FP   N   L   A V  G+   + + + +RF   ASAI 
Sbjct  178   KGSKEAIIYPE---FIASSLFP--ANDLWLRDSAIVMFGSLLKKGQCMTKRFVFDASAIS  232

Query  746   QLREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPFP  925
              L+ Q  ++    P+R E + + +W  ++AA+++  +G     +LT  +NLR +MEP   
Sbjct  233   NLKAQAAILGLKCPTRVEVVSSFLWKCLMAASEE-WRGSQRPSLLTHYVNLRRKMEPKLS  291

Query  926   ENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTALPI  1105
              N +GN  + A   +   ++  P    L  + R AI  ++ +      G  G       +
Sbjct  292   GNSMGNFLWLAAEKYTNKSK--PGLKDLVGEVRKAISKIDSDFVEHIKGDKGN-----AL  344

Query  1106  MSEIIK---HEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRW----AVNAQVMKDSVVFM  1264
             M E +K     GS   +  L  SS      Y  DFGWGKP W     ++  +  + V  +
Sbjct  345   MDESLKGIGAFGSGDGVDYLGFSSWCKFGFYDTDFGWGKPVWVSSFGLSCSLTMNLVFLV  404

Query  1265  EGRFGGVDLWMGLPEELMNIVMKNPQFVEFVSAGFSKSKL*IE  1393
             + R  G++ ++ L E+ M I+  NP+ ++  SA  + S L I+
Sbjct  405   DTRCDGIEAFVTLDEKDMTILEGNPELLK--SASLNPSPLDID  445



>emb|CDY39174.1| BnaC09g21700D [Brassica napus]
Length=459

 Score =   202 bits (515),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 137/470 (29%), Positives = 229/470 (49%), Gaps = 50/470 (11%)
 Frame = +2

Query  14    SLINLLHQ--ITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPG  187
             + I   HQ  +T ++EV  RDIIKPSSPTP  L+ +  S+++QL   +  P + FY +  
Sbjct  6     TFIRRFHQKSLTRRVEVISRDIIKPSSPTPNHLKNFKLSLLEQLGPTIFGPMLFFYSANN  65

Query  188   SSRDYNGVVDELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLE  367
               +    +   LKKSLS+TL+  YPLAGR+  +  SI CND G +F+E  V   LS+ L+
Sbjct  66    RIKQTEQL-QNLKKSLSETLTHFYPLAGRLNGN-ISINCNDSGADFLEAQVNSPLSNLLQ  123

Query  368   NPDFEMIREMVPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVF  547
              P  E++ +++P    T         ++L+ Q   F CGG+++G+ +SH + D  S+ +F
Sbjct  124   EPSSEVLEQLIP----TSVDSTEARTKLLLAQATFFKCGGMAIGVCVSHKLADATSVGLF  179

Query  548   ANTWARINRGCAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQE----KYVVR  715
               +W+ I+    +   G  +FD  KIFPP         F+  +       E    + + +
Sbjct  180   MKSWSAISSRGTIKTVGSPVFDTLKIFPP-------GNFSETSPAPVVEPEIKMNQTLSK  232

Query  716   RFYIPASAIDQLREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILN  895
             RF   + +I+ L+ +       +P+R EA+ A +W   + A +   +      +L +  +
Sbjct  233   RFVFDSWSIEALQAKASSFEVSQPTRVEAVSAFIWKLAMKATRTVSRTS-KPSILANSAS  291

Query  896   LRNRMEPPFPENCLGN-NTYGATVHWNQPTEGNPSR--HALALKFRDAIRGVNDEAARRR  1066
             LR+R+ PPF +N +GN  +Y A     +  EG   R    L  + R A +   D+   + 
Sbjct  292   LRSRVSPPFTKNSIGNLVSYFAA----KAEEGEKQRKLQTLVAEIRRAKQRFRDDHIPKL  347

Query  1067  YGKGGFLHTALPIMSEIIKHEGSKKNM--------YCLYTSSLLGMQVYAADFGWGKPRW  1222
              G G            I  H+    +M        Y L ++   G+  Y  DFGWGKP W
Sbjct  348   VGNGDATEV-------ICNHQKEAGDMIASGGFDFYILTSACRFGL--YEIDFGWGKPVW  398

Query  1223  AVNAQVMKDSVVFM----EGRFGGVDLWMGLPEELMNIVMKNPQFVEFVS  1360
                  V + ++V +    EG  GG++ W+ L E+ M +  ++ + ++F S
Sbjct  399   FAFPSVRQKNIVALLDTKEG--GGIEAWVNLNEQEMKLFEEDRELLDFAS  446



>ref|XP_007037901.1| Anthranilate N-benzoyltransferase protein, putative [Theobroma 
cacao]
 gb|EOY22402.1| Anthranilate N-benzoyltransferase protein, putative [Theobroma 
cacao]
Length=432

 Score =   202 bits (513),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 150/457 (33%), Positives = 228/457 (50%), Gaps = 41/457 (9%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVDEL  223
             + I++  ++ IKP+ PTP  LR    S +DQL+  + IP V FY +  +       VD L
Sbjct  4     IDIQIVSKETIKPAIPTPHHLRNLKLSFLDQLAPPIYIPIVLFYPAKQN-------VDLL  56

Query  224   KKSLSQTLSL------MYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEM  385
             ++SL    SL       YPLAG ++ED  + ECND+GVE+ E  V   L    ENPD  +
Sbjct  57    ERSLLLKKSLSKTLTQFYPLAGTMRED-FTFECNDEGVEYFETKVPCKLVDVTENPDVNV  115

Query  386   IREMVPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWAR  565
             +   +P  P     E +     L IQ N F CGG+++G+ +SH I DG S+  F N WA 
Sbjct  116   LNLFLPFEPQQNCIE-SKKQVPLAIQYNIFKCGGVAIGIRLSHLIADGTSVITFVNAWAA  174

Query  566   INR--GCAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASA  739
             ++R  G  ++     IF+A+  FPP     D+  F R + G   ++EK V +RF     +
Sbjct  175   MSREPGEVIIP----IFEAATHFPP----RDISMF-RPSIGI--TKEKIVTKRFVFDKPS  223

Query  740   IDQLREQL--RLISHYR-PSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRM  910
             I  LRE+   R  S  + P+R EA+ + +W   +A  + + + R  L+     +NLR RM
Sbjct  224   ITVLREKASSRDGSQVKTPTRVEAISSFIWSRQMAIAKTKPE-RAKLYAAVHAVNLRERM  282

Query  911   EPPFPENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLH  1090
              P  P++  GN    A   +  P E     H L    R+AI  +++   +       +L 
Sbjct  283   VPSLPKHSFGNFWRMAIATF--PAEMEQDYHVLVSHMRNAISKIDNNYVKMLQDGDRYLK  340

Query  1091  TALPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVN-AQVMKDSVVFME  1267
             T   +  +  K E      +C +T S     VY  DFGWGKP WA + ++  K+ V+ M 
Sbjct  341   TMKMVSEQFSKSEVE----FCNFT-SWCRFPVYEVDFGWGKPAWACSPSRPYKNLVILMS  395

Query  1268  GRFG-GVDLWMGLPEELMNIVMKNPQFVEFVSAGFSK  1375
              + G GV+ W+ L EE M I  ++P+ + F S+   K
Sbjct  396   DKGGEGVEAWVNLLEEDMAIFERDPELLSFASSKTGK  432



>ref|XP_010064604.1| PREDICTED: vinorine synthase-like [Eucalyptus grandis]
 gb|KCW68077.1| hypothetical protein EUGRSUZ_F01762 [Eucalyptus grandis]
Length=449

 Score =   202 bits (514),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 138/452 (31%), Positives = 219/452 (48%), Gaps = 26/452 (6%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNG---VV  214
             M++ V  R+ +KP SPTP  L+ +  S++DQ    + +P V FY    + R       ++
Sbjct  1     MEVVVVSREFVKPYSPTPNHLKIHKLSLLDQFVPTLYVPLVLFYTIEEADRAATTPSRMI  60

Query  215   DELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIRE  394
               LK+SLS+TL L YPLAG+I  D  SIEC+D+GV  +E     +LS  L  PDFE +R+
Sbjct  61    QLLKQSLSETLPLFYPLAGKINGDGLSIECDDEGVLLVEARAEFALSRLLHRPDFETVRK  120

Query  395   MVPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINR  574
              +PC       E     RV +IQ   F CGG+ VG+++SHA  DGAS + F   WA   R
Sbjct  121   FLPCAAAWRRVEVG--DRVAMIQATAFPCGGVVVGVLISHAAADGASFATFLKGWAAAAR  178

Query  575   GCAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQLR  754
                        FDAS +F   K  ++ D F  V      ++ +Y  RR    AS + +L+
Sbjct  179   KTGEAPRPS--FDASTLFIQNKAFSEEDTFFGV---CPVNRGRYGTRRLVFDASTMARLK  233

Query  755   EQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPFPENC  934
              +   +    P+RAE + A++  + + A   +  G     V T+ +NLR R  P F ++ 
Sbjct  234   AEAANVGVQNPTRAEVVTALICKS-LTATMTKVSGLDKPVVFTNAVNLRRRAVPNFHDDS  292

Query  935   LGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGF--LHTALPIM  1108
             +GN  +  T       +      +L    R+A   ++ E  R   G GGF  L  AL  M
Sbjct  293   MGNYVWLPTFLCPLEEKDYDGLPSLIGWLREAKSKIDGEFVRGLEGDGGFNALQDALGEM  352

Query  1109  SEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAV-------NAQVMKDSVVFME  1267
              E +      +    +  SS      Y  DFGWG+P W         +  ++ ++V+ ++
Sbjct  353   REFL-----ARTDRLVTFSSWCNFGHYEIDFGWGRPAWVSPVGFPEESGNLIVNTVLLLD  407

Query  1268  GRF-GGVDLWMGLPEELMNIVMKNPQFVEFVS  1360
              R   G++ W+ + E+ + ++ +N +  E+ S
Sbjct  408   TRCRKGIEAWVFIDEQELEVLEQNEELTEYAS  439



>ref|XP_006464983.1| PREDICTED: salutaridinol 7-O-acetyltransferase-like [Citrus sinensis]
Length=462

 Score =   202 bits (515),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 150/476 (32%), Positives = 234/476 (49%), Gaps = 47/476 (10%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFY----DSPGSSRDYNGV  211
             M++++  R+ IKPSSPTP  L+T+   ++DQ   NV  P V +Y    D   S+ D + +
Sbjct  1     MEVQIISRESIKPSSPTPLDLKTHKLCLLDQFRNNVYAPRVLYYPLNQDDLSSAIDIDHI  60

Query  212   VDE----LKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDF  379
             V +    LK+SLS+TL   YPLAG++ ++  S++CND+GV F+E      L+  L  PD 
Sbjct  61    VSKRLQLLKQSLSETLVRFYPLAGKLTKN-FSVDCNDEGVYFVEAVAKSLLNELLIQPDP  119

Query  380   EMIREMVPCNPFTGAFEPN--PDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFAN  553
              +  ++ P +   G+ +        V  +QV  F+CGG+ +   +SH  GDG S S F  
Sbjct  120   SLRNKLFPVD---GSQQRGQVAGAHVAKVQVTSFACGGLVICACISHTFGDGTSFSSFMK  176

Query  554   TWARINRGCAVVDDGGFI---FDASKIFPPVKNTADLDQFARVARGAAESQ----EKYVV  712
              WA   R     ++  +    +DAS +F P  N  DL    R    A+ ++     ++V 
Sbjct  177   AWAATARNKTSEEEAIYTCPNYDASSLFLP--NKDDLFHQLRAISNASYTRFFETGRFVT  234

Query  713   RRFYIPASAIDQLREQLRLISHYRPSRAEALIAVVWDAVIAA-NQKRHKGRINLHVLTSI  889
             RRF     AI +L+++ +      P+R EAL A++  +++A  N+K    R  L  L+  
Sbjct  235   RRFVFDTEAIAELKDKAKSSRVQNPTRIEALSAILSRSIMAVLNKKSSSHRPTL--LSHA  292

Query  890   LNLRNRMEPPFPENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRY  1069
             +NLR +  PP  E  +GN  +         TE       L    R+AI   + +  +   
Sbjct  293   VNLRTKARPPLSEYLIGNIVWQTNA---LCTEEEVDLDGLVWLLREAISKFDGDFVKNLQ  349

Query  1070  GKGGFLHTALPIMSEIIKHEGS----KKNMYCLYTSSLLGMQVYAADFGWGKPRW----A  1225
             G GG L      +SE IKHE       KN   +  SS      Y  DFGWGKP W     
Sbjct  350   GVGGLLE-----LSEAIKHEAEAYSDAKNR--IMFSSWCTFGSYGIDFGWGKPIWVSCVG  402

Query  1226  VNAQVMKDS--VVFMEGRFG-GVDLWMGLPEELMNIVMKNPQFVEFVSAGFSKSKL  1384
             ++  +++ S  V+ M+ RFG G++ W+ L EE M ++  +   +EF +   S  KL
Sbjct  403   LDGSILEFSPVVILMDTRFGDGIEAWVSLLEEDMALLEVDKNLLEFATIDPSPLKL  458



>ref|XP_010514234.1| PREDICTED: vinorine synthase-like [Camelina sativa]
Length=459

 Score =   202 bits (514),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 140/461 (30%), Positives = 225/461 (49%), Gaps = 42/461 (9%)
 Frame = +2

Query  29    LHQ-ITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYN  205
              HQ  +M ++V  RDIIKPSSPTP  L+ +  S+++QL   +  P V FY    +     
Sbjct  11    FHQNSSMIVDVVSRDIIKPSSPTPNHLKKFKLSLLEQLGPTIFGPMVYFYSGNNNRIKPT  70

Query  206   GVVDELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEM  385
               + +LKKSLS+TL+  YPLAGR+K +  SI+CND G +F+E +V   LSS L+ P  + 
Sbjct  71    EQLQKLKKSLSETLTHFYPLAGRLKGN-VSIDCNDSGADFLEAEVNSPLSSLLQEPSSDN  129

Query  386   IREMVPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWAR  565
             ++ ++P    T         ++L+ Q + F CG +++G+ +SH   D  SI +F  TWA 
Sbjct  130   LQRLIP----TSVDSIETRTKLLLAQASFFECGSMAIGVCISHKFADATSIGLFMKTWAA  185

Query  566   INRGCAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQE----KYVVRRFYIPA  733
             I+   ++   G  +FD  KIFPP         F+  +       E    + +  RF   +
Sbjct  186   ISSRGSIKTVGSPVFDTVKIFPP-------GNFSETSPAPVIEPEIMMNQTLSNRFVFDS  238

Query  734   SAIDQLREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRME  913
             S+I  L+         +P+R EA+ A++W   + A  +   G     +L +  +LR+R+ 
Sbjct  239   SSIQSLQANASSFEVKQPTRVEAVSALIWKTAMKAT-RTVSGTSKPSILANSASLRSRVS  297

Query  914   PPFPENCLGN-NTYGATVHWNQPTEG-NPSR-HALALKFRDAIRGVNDEAARRRYGKGGF  1084
             PPF EN +GN  +Y A     +  EG N ++   L  + R   +   D    +  G    
Sbjct  298   PPFTENSVGNLVSYFAA----KAEEGVNQTKLQTLVSELRKEKQRFRDNHVPKLVGN---  350

Query  1085  LHTALPIMSEII-------KHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQVM  1243
                  P  +EII        H  +  +      SS     +Y  DFGWGKP W     V 
Sbjct  351   -----PSATEIICSYQREAGHMIASGDFDFYIFSSACRFGLYETDFGWGKPAWVGIPCVR  405

Query  1244  KDSVVFM--EGRFGGVDLWMGLPEELMNIVMKNPQFVEFVS  1360
             + ++V +      GG++ W+ L E+ M ++ ++ + + FVS
Sbjct  406   QKNIVTLLDTKEAGGIEAWVNLNEQEMKLLEQDSELLHFVS  446



>ref|XP_011021361.1| PREDICTED: BAHD acyltransferase At5g47980-like [Populus euphratica]
Length=445

 Score =   202 bits (513),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 144/452 (32%), Positives = 219/452 (48%), Gaps = 40/452 (9%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVDEL  223
             + +E+  R++I+PSSPT   LR +N S++DQL+     P V  Y +             L
Sbjct  6     VNVEIVAREVIRPSSPTLNHLRKFNLSLLDQLAPVSYEPLVLLYSNFQQQLAGTHESQRL  65

Query  224   KKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREMVP  403
             K+SLS+TL+  YPLAGRIK D +SIECND G  F+E  V+  LS FLE PD E IR+ +P
Sbjct  66    KRSLSETLTRFYPLAGRIK-DGASIECNDLGAVFVESRVSCLLSKFLEKPDAEAIRKFIP  124

Query  404   CNPFTGAFEPNPD---GRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINR  574
                       +P+   G ++++Q N F+CGG+++G+ +SH   D  + S F   WA    
Sbjct  125   VE------TESPEALTGSLVLVQANFFACGGLAIGVCISHKAADPVTFSTFIKAWAAA--  176

Query  575   GCAVVDDGGFI--FDASKIFPPVKNTADLDQFARVARGAAES--QEKYVVRRFYIPASAI  742
                 VDD   +  F+AS +FPP        Q   + R AA     +K V +R    AS I
Sbjct  177   AFRSVDDSTVLPLFNASSLFPP--------QNLPLTRPAAVELMNDKCVTKRLVFDASKI  228

Query  743   DQLREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPF  922
               L+ +    S   P+R EA+ A++W   + A++   +  +   +L+  +NLR RM PP 
Sbjct  229   AALQAKAVSESVTCPTRVEAVTALIWKCAMNASRSNSE-HLRYSILSQSVNLRERMVPPL  287

Query  923   PENCLGNNT-YGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTAL  1099
             PEN +GN   Y A+      TE      +L  + R  +    +    +      F+    
Sbjct  288   PENTIGNLVGYFASCA----TECEIELQSLVGQLRKGLLDFGENYVEKLGEDKAFMA---  340

Query  1100  PIMSEIIKHEGS---KKNMYCLYTSSLLGMQVYAADFGWGKPRW-AVNAQVMKDSVVFME  1267
               + E  +  GS   + N+    ++       Y  DFGWGKP W  +     K+    M+
Sbjct  341   --VRESFQEAGSMLQEGNVDFYASTDFCRFPFYGIDFGWGKPTWVTIPTGANKNVTTIMD  398

Query  1268  GRFG-GVDLWMGLPEELMNIVMKNPQFVEFVS  1360
              R G GV+ W+ L EE M    ++ + +   S
Sbjct  399   TRDGEGVEAWVTLTEEDMAFFERDRELLAAAS  430



>ref|XP_008446094.1| PREDICTED: vinorine synthase-like [Cucumis melo]
Length=440

 Score =   201 bits (512),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 145/460 (32%), Positives = 235/460 (51%), Gaps = 47/460 (10%)
 Frame = +2

Query  38    ITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVD  217
             + ++IE+  + IIKPSSPTP+ LR Y+ S +DQ++V+V  P V FY + GS+     + D
Sbjct  1     MAVQIEIVSKAIIKPSSPTPEHLRRYSLSFLDQVTVDVYNPMVYFYPAGGSATPAE-ISD  59

Query  218   ELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREM  397
              LKKSLS  L+  YPLAG++  D   ++CND GV FIE  +   +S  +  P    + + 
Sbjct  60    HLKKSLSHVLTHYYPLAGKVNYDEFFVDCNDDGVPFIETKINCRMSGVMNTPFPSELNKF  119

Query  398   VPCNPFTGAFEPNP-DGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINR  574
             +P       FE +  D   + +Q+N F CGG++VG+ +SH I D  S+ +  N WA   R
Sbjct  120   LP-------FELDQLDEVSMGVQLNVFECGGVAVGICVSHKISDALSLFIVVNEWAAYCR  172

Query  575   GCAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQLR  754
             G   V        ++++FPP K T   +    + R       + V RR+ I    ++ +R
Sbjct  173   GEKEVVRAH--LSSAELFPPTK-TGLYNTRTSIFR-------QRVARRYEIDGGNVESIR  222

Query  755   ----EQLRLISHYRPSRAEALIAVVWDAVIAA-----------NQKRHKGRINLHVLTSI  889
                 E   + S  RP+R EAL A ++   IAA           N +  +   N+ ++   
Sbjct  223   AKYAECSAMESQRRPTRVEALSAFIYGRFIAAIKAVVSSSELENGRSTELEKNIFLVCHS  282

Query  890   LNLRNRMEPPFPENCLGNNTYGATVHWNQPTE---GNPSRHALALKFRDAIRGVNDEAAR  1060
             +N+R+R++PP  +   G N Y  T  +  P E    +   + L  + RD I  ++ E  +
Sbjct  283   VNIRSRLDPPVVDYAFG-NYYRTT--FAVPAENILNDTYCYDLVKQARDEIGKIDKEYLK  339

Query  1061  RRYGKGGFLHTALPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQV  1240
             R      FL +    M +      + + + C +T SL  M +Y ADFGWGKP W  +  +
Sbjct  340   RLQQGSKFLDS----MKKTAAQFSTGELISCSFT-SLCRMPIYDADFGWGKPAWIGSPAL  394

Query  1241  M-KDSVVFMEGRFG-GVDLWMGLPEELMNIVMKNPQFVEF  1354
             M K+  VF++ + G GVD+++ L +E MN    + +F+++
Sbjct  395   MFKNLFVFIDKKDGDGVDIYVHLKQEHMNKFEMDEEFLKY  434



>ref|XP_002515007.1| 3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase, putative [Ricinus 
communis]
 gb|EEF47561.1| 3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase, putative [Ricinus 
communis]
Length=441

 Score =   201 bits (512),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 134/448 (30%), Positives = 223/448 (50%), Gaps = 32/448 (7%)
 Frame = +2

Query  47    KIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDS-PGSSRDYNGVVDE-  220
             K+++ +R+ IKPSSPTP  L+ +  S++DQL     IP V FY +  G + D++    E 
Sbjct  6     KVKIIQRETIKPSSPTPPELKIHKLSLLDQLIPTNYIPVVLFYPANDGDNLDHHANSTER  65

Query  221   ---LKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIR  391
                LK SLS+TL+  YP AGRIK D +S+EC+DQG +FI+  +   LS  L++PD  ++R
Sbjct  66    SLKLKTSLSETLTHYYPFAGRIK-DSTSVECDDQGADFIQARINCLLSDVLKSPDAVVLR  124

Query  392   EMVPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARIN  571
             + +P    +        G +L++Q   F CGG++VG+ +SH I D  ++  F   W    
Sbjct  125   QFLPAAITSTE---AATGNLLLVQATFFHCGGLAVGVCISHKISDATTLKAFIKCWVATA  181

Query  572   RGCAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQL  751
                +  +    +F  + IFPPV    D+     V       +++ + +RF    S I  L
Sbjct  182   TSSS-TESATPLFMGASIFPPV----DISIPTSVVELM---KKQCITKRFVFTGSKIAAL  233

Query  752   REQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPFPEN  931
             + ++   +   P+R E +  ++W   +AA + +  G     V +  +N+R R  PP PE+
Sbjct  234   KAKVASTTMRNPTRVETVSGLLWKTAMAATRSKL-GYSRPSVWSMPVNMRTRFLPPLPES  292

Query  932   CLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTALPIMS  1111
               GN      +H N           L  + R  I G  +   ++  G+   L T      
Sbjct  293   YAGN----CLLHINPKIADESELKELVGRIRKEIEGFRENYVKKLRGERAVLATF-----  343

Query  1112  EIIKHEG--SKKNMYCLYT-SSLLGMQVYAADFGWGKPRW-AVNAQVMKDSVVFMEGRFG  1279
                +  G  +  N   LYT +S   +++Y ADFGWG+P W  +++  + + V  M+ R G
Sbjct  344   GFFQEYGNLAMNNDIDLYTCTSWCKLELYDADFGWGRPLWVGIDSIPLSNVVCLMDTRDG  403

Query  1280  -GVDLWMGLPEELMNIVMKNPQFVEFVS  1360
              G++ W+ L EE M +   N + ++F +
Sbjct  404   DGIEAWLTLGEENMALFESNQELLQFAA  431



>gb|KCW86588.1| hypothetical protein EUGRSUZ_B03220 [Eucalyptus grandis]
Length=409

 Score =   201 bits (510),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 141/449 (31%), Positives = 225/449 (50%), Gaps = 58/449 (13%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGV--VD  217
             MKI+V  ++ I PSS TP  ++TY FS++DQL+    +P V FY +P   +D++ V   +
Sbjct  1     MKIQVISKETIMPSSATPSPVQTYRFSLLDQLAPPFYVPVVLFYSAPDPEQDFDHVNIYE  60

Query  218   ELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREM  397
             +LK SLS+ LS  YPLAGR K D  +++   QG  F+   V   L+  L NP+ ++++++
Sbjct  61    KLKTSLSECLSCFYPLAGRSKGDEHAVDLG-QGAVFVRTRVNARLAKLLANPELKLVQQL  119

Query  398   VPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRG  577
             +P +P+    +   +  V  IQ+N F CGGI +G+ +SH I DGA++S F ++W  I+RG
Sbjct  120   LPLDPYNIQCQ---NALVTAIQLNLFDCGGIGIGVCISHKIADGATLSTFLSSWGAISRG  176

Query  578   CAVVDDGGFIFDASKIFPPVKNTADL---DQFARVARGAAESQEKYVVRRFYIPASAIDQ  748
                         ASK+  P ++T  +    +F          +EK V +RF   ++++  
Sbjct  177   ------------ASKLVAPYQDTTTIFPPREFRVPLPNNLIKKEKIVTKRFEFDSASLAA  224

Query  749   LREQLRLISHYR-PSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPFP  925
             LR +    S  + P   EA+ A++  A + A  +      +  V++ ++NLR RM PP P
Sbjct  225   LRTKAGDGSTSKSPILVEAVTALICKAAMNARTEISGNGRSSTVISHVVNLRGRMNPPLP  284

Query  926   ENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHT-ALP  1102
             ++  GN    AT                       I+   D+A          LH  A  
Sbjct  285   DHSFGNIWRFATA---------------------TIKEEEDDAE---------LHVRACE  314

Query  1103  IMSEIIKHE-GSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQV-MKDSVVFMEGRF  1276
              M E+  HE   K ++     SS +    Y  DFGWGKP WA  + V +K+ V+ M    
Sbjct  315   SMREV--HELMYKGDVESYRFSSWVRFPFYETDFGWGKPVWACISSVPIKNVVILMSSWS  372

Query  1277  G-GVDLWMGLPEELMNIVMKNPQFVEFVS  1360
             G G++ W+ L E+ M     +P  ++FVS
Sbjct  373   GNGLEAWVTLDEQEMAKFQSDPLLLQFVS  401



>ref|XP_008372831.1| PREDICTED: BAHD acyltransferase At5g47980-like [Malus domestica]
 ref|XP_008346322.1| PREDICTED: BAHD acyltransferase At5g47980-like [Malus domestica]
Length=446

 Score =   201 bits (511),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 140/451 (31%), Positives = 229/451 (51%), Gaps = 39/451 (9%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGV-VDE  220
             M+ E+ +R+ +KPSSPTPQ LR +  S+++QLS       V FY  P +      + +  
Sbjct  1     MEFEMIKRETLKPSSPTPQYLRNFKLSLLNQLSPAAYESLVLFY--PRNDXTTPQISLRI  58

Query  221   LKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREMV  400
             LKKSLS+TL   YPLAGR+K D  S++CND GV+++E  V   LS+FL  PD   +R+++
Sbjct  59    LKKSLSETLVRFYPLAGRMK-DNISVDCNDYGVDYVEAKVNGLLSTFLSQPDAGTLRQLL  117

Query  401   PC---NPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARIN  571
             P    +P  G       G +L++Q N F CGG+++G+ MSH + D AS+S F  +W+   
Sbjct  118   PVXTESPEAG------KGALLLVQANVFGCGGLAIGICMSHKLADAASLSTFIMSWSATA  171

Query  572   RGC--AVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAID  745
              G   A++ D    F AS  FPP+  ++   Q + V       +E  V +RF   AS I 
Sbjct  172   LGFSQALLPD----FTASFRFPPIDYSSSFHQSSPV----DAKRENCVTKRFVFNASKIS  223

Query  746   QLREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGR--INLHVLTSILNLRNRMEPP  919
              LR +       +P++AEA+ A++W   +AA++  +  +    L VL+  +++R  + PP
Sbjct  224   ALRTKAASTIVDQPTQAEAVTALIWRCAVAASRSSNSLQPPPKLSVLSQSVDIRKSVVPP  283

Query  920   FPENCLGN-NTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTA  1096
               ++ +GN   Y A     Q  E       L  + R  I+ +++  A+R         + 
Sbjct  284   LSDDSIGNLMGYFAA----QTDENELELQGLVAQLRRGIKELSNNYAKRPGKDQAIRESV  339

Query  1097  LPIMSEIIKHEGSKKNMYCLYTSSLLG--MQVYAADFGWGKPRWAVNAQVMKDS-VVFME  1267
               + +  +K + +       Y  + LG    +Y  +FGWGKP W  N      + V ++ 
Sbjct  340   KEVHNNFVKRDDTTS----FYVGTDLGNYKLLYEVNFGWGKPIWLSNVPAASSTNVAYLV  395

Query  1268  G--RFGGVDLWMGLPEELMNIVMKNPQFVEF  1354
                +  G++ W+ L EE M    +N + + F
Sbjct  396   STRKDDGIEAWVTLSEEDMAAFERNQELLAF  426



>ref|XP_004310028.1| PREDICTED: vinorine synthase-like [Fragaria vesca subsp. vesca]
Length=442

 Score =   201 bits (511),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 144/451 (32%), Positives = 224/451 (50%), Gaps = 36/451 (8%)
 Frame = +2

Query  38    ITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVD  217
             + + +EV  ++ + PSSPTP  LR +  S +DQL+ +  +P++ FY  P ++  +  +  
Sbjct  1     MKIDVEVISQETVTPSSPTPHHLRHHQLSFLDQLAPHAYVPFLYFYSLP-NTHSHTQIST  59

Query  218   ELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAE-SLSSFLENPDFEMIRE  394
              LKKSLS+ L+  YPLAGR+K +   +ECND GV F E  V   SLS  + NP    +  
Sbjct  60    HLKKSLSKALTQYYPLAGRVKLNL-FVECNDFGVPFYEARVKSLSLSDVITNPSLPELNN  118

Query  395   MVPCNPFTGAFEPNPDGRV-LVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARIN  571
             ++P       F+ +    + L +Q+N F CGG+++GL  SH + DG S   F   WA   
Sbjct  119   LLP-------FKLDELKDIALGVQLNLFRCGGVAIGLCASHRVADGLSYFTFVKNWASAA  171

Query  572   RGCAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQL  751
              G   V      F A+ IFPP     ++D +  V       + + V + F      I+ L
Sbjct  172   CGNESVSPD---FSAASIFPP----KNMDGYNGV---LIPKRNEIVTKGFVFDGLKIEAL  221

Query  752   R----EQLRLISHYRPSRAEALIAVVWDAVIAANQKRH-KGRINLHVLTSILNLRNRMEP  916
             R    E +RL +   PSR EAL A +W+  +AA  K        L+ +  I++LR+R +P
Sbjct  222   RSKYAEGIRLKTKKIPSRVEALSAFLWNKFMAAAAKEEGSSSRKLYAVVYIMDLRSRFDP  281

Query  917   PFPENCLGNNTYGATVHWNQPTEGN-PSRHALALKFRDAIRGVNDEAARRRYGKGGFLHT  1093
             P P++  GN    AT     PT  N   R  L  +  + I  + D    R++  G   H 
Sbjct  282   PLPQHSFGNYYRAATA---TPTLVNGEERGGLVRQVIEEIEKI-DNKYMRKFQDGYKEH-  336

Query  1094  ALPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQV-MKDSVVFMEG  1270
              L  M   ++   +K  +  L  SSL    +Y ADFGWGKP W   A + + + +VFM+ 
Sbjct  337   -LDFMRRRME-RAAKGELVTLTFSSLCRFPLYEADFGWGKPEWVSMASMKINNQIVFMDT  394

Query  1271  RFG-GVDLWMGLPEELMNIVMKNPQFVEFVS  1360
             + G G++ +    EE M     + +F++ +S
Sbjct  395   KLGDGIESYFSFKEEDMAKFELDSEFLQLIS  425



>ref|XP_006387730.1| hypothetical protein POPTR_0640s00210g [Populus trichocarpa]
 gb|ERP46644.1| hypothetical protein POPTR_0640s00210g [Populus trichocarpa]
Length=451

 Score =   201 bits (511),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 142/454 (31%), Positives = 224/454 (49%), Gaps = 34/454 (7%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNG--VVD  217
             M + +  R++IKPSSP+   L  +  S++DQL     +P V FY    +++D+ G  +  
Sbjct  1     MDVSIISRELIKPSSPSIHHLLPFKLSLLDQLLPTTYVPMVFFYPR-NNNQDFKGLQISI  59

Query  218   ELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREM  397
             +LK+SLSQTLS  YPL+GR++ + S I+  ++G  F+E  V  SL  FL  P    + + 
Sbjct  60    QLKRSLSQTLSTFYPLSGRVRNN-SIIDNYEKGAPFVETRVKGSLFDFLIQPQLNSLNKF  118

Query  398   VPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRG  577
             +PC PF    +P    +V  IQVN F CGG ++GL  SH I D A+   F ++WA   RG
Sbjct  119   LPCQPFGYQSDPEATPQV-AIQVNTFDCGGTALGLCFSHKIIDVATAIAFLDSWAANTRG  177

Query  578   CAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQLRE  757
               +      +F+AS  FPP      L QF          +E  V +RF   A AI  LR 
Sbjct  178   HYLEQINPALFEASSRFPP--QNKFLVQFPLWVAENYLFKEGNVTKRFVFDADAIATLRA  235

Query  758   QLRLISHYRPSRAEALIAVVWDAVIAANQK---RHKGRINLHVLTSILNLRNRMEPPFPE  928
             + +      PSR E L A +W +   A +      +  ++LH     +N+R R +P F  
Sbjct  236   KAKSKRVPNPSRTETLTAFIWKSCTEACRSLCALPRPSVSLHA----VNIRQRTKPSFSR  291

Query  929   NCLGNNTYGATVHWNQPTEGNPSRHALALK-----FRDAIRGVNDEAARRRYGKGGFLHT  1093
               +GN      + W   T    +   + L       R++   +ND+      G+ G    
Sbjct  292   YSIGN------LWWRSLTACELADTKIELNDLVSLTRESFTNINDDLLNDFQGENGLQGI  345

Query  1094  ALPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRW-AVNAQVMKDS----VV  1258
                ++ +++   GS+     L+ SS L   +   DFGWGKP W  +  +V + S      
Sbjct  346   TESLLKQLVGI-GSRNPEIFLF-SSWLNFDLNDVDFGWGKPIWVGLTGEVGRPSGWANAT  403

Query  1259  FME--GRFGGVDLWMGLPEELMNIVMKNPQFVEF  1354
             F +  GR   +++WM L E++M++V +NP+F++F
Sbjct  404   FFKQTGRNNEIEVWMTLNEKIMSVVERNPEFLQF  437



>gb|KGN64382.1| hypothetical protein Csa_1G050210 [Cucumis sativus]
Length=431

 Score =   201 bits (510),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 143/450 (32%), Positives = 214/450 (48%), Gaps = 37/450 (8%)
 Frame = +2

Query  41    TMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVDE  220
             + KI++   +IIKPSSPTP + + +  S +DQ +     P + FY   G+ RD       
Sbjct  7     SFKIDIISTEIIKPSSPTPSTHQHHKLSFLDQFAPGSYTPLLFFYPGGGNHRDR---CRR  63

Query  221   LKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENP-DFEMIREM  397
             LK+SL++TLS  YPLAG + E    +ECND+GV F E  V+  LS  +ENP D      +
Sbjct  64    LKESLAETLSRFYPLAGTLVE-AYLVECNDEGVAFSEARVSGRLSEVMENPNDVVTYHRL  122

Query  398   VPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRG  577
             +P +P     E      +L +Q N F CGG  + L ++H I DG S ++F   WA   RG
Sbjct  123   LPFHP-DAVLEREC---ILGVQYNVFECGGAVIALCITHKIVDGTSTTMFTKAWASTCRG  178

Query  578   CAVVDDGGFI---FDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQ  748
                 D+   I   FDA+ +FP ++      +  R+        +K V RRF    S I  
Sbjct  179   ----DNEYPIVPNFDATDLFPAMEIRGGNKRHPRM--------QKIVTRRFVFNKSNIAA  226

Query  749   LREQLR----LISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEP  916
             L++Q       ++   PSR E++   +W   IA   K+   +     +   +NLRNRM P
Sbjct  227   LKKQASSAALFLNQRPPSRVESVSGFLWKRFIALYHKKTPTKAKRFAVIQAVNLRNRMNP  286

Query  917   PFPENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTA  1096
             P P N  GN  + AT   + P +      +L  K R+AIR ++DE  +        L   
Sbjct  287   PLPPNSFGNIWWFATA--DVPIDEEQDFPSLVGKVREAIREIDDEYTKTLQDTEKSLRAK  344

Query  1097  LPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVN-AQVMKDSVVFMEGR  1273
             + +   +   E     M C   +S     VY  DFGWGKP W     +  K+ V+F+   
Sbjct  345   MKMGERVYSGE---VEMACF--TSWCNFPVYETDFGWGKPTWVCTPGRPYKNVVLFVNTS  399

Query  1274  FG-GVDLWMGLPEELMNIVMKNPQFVEFVS  1360
              G G++ W+ L E  M +   + + + F S
Sbjct  400   DGEGIEAWVNLEESDMALFENDCELLSFTS  429



>ref|XP_006429945.1| hypothetical protein CICLE_v10011714mg [Citrus clementina]
 gb|ESR43185.1| hypothetical protein CICLE_v10011714mg [Citrus clementina]
Length=448

 Score =   201 bits (511),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 145/456 (32%), Positives = 217/456 (48%), Gaps = 32/456 (7%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVDEL  223
             M+I +  R++++PSS     L+ +  S++DQL+     P V FY    +      +  +L
Sbjct  1     MEIGIVSREVVRPSSLHVHLLKPFKISLLDQLTPTTFAPLVLFYPMKSTHLKGTQISTQL  60

Query  224   KKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREMVP  403
             K+SLS+TL   YPLAGR++ D   I   D+GV +IE  V   L  FL+N   E++ + +P
Sbjct  61    KESLSKTLEHFYPLAGRVR-DNLIINDYDEGVPYIETRVNTHLFEFLQNRPMELLNQCLP  119

Query  404   CNPFTGAFEPNPDGRVLV-IQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRGC  580
               PF+   +PNP     V +Q+N F CGG+++GL  SH I DG + S F  +WA   RG 
Sbjct  120   YPPFS--HQPNPHQVPQVAVQLNTFDCGGVALGLCFSHKIIDGGTASAFLRSWAANTRGG  177

Query  581   ---AVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQL  751
                AV  +   +  AS IFPP +N +   Q+  V       + KY  RRF   A AI  L
Sbjct  178   YHKAVKYEN--LSQASMIFPP-QNPSPNHQYLSVMEKIWFREAKYKTRRFVFDAKAIATL  234

Query  752   REQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPFPEN  931
             R + +      P+R EAL A +  + + A +     R  LH     +NLR   EP     
Sbjct  235   RSECKGERVPNPTRTEALSAFILKSTMLALRSTASSRFVLH---QAVNLRRLTEPRLSTC  291

Query  932   CLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTALPI--  1105
              +GN    AT  ++         H L  + R  +  +N E  +  +G  GF      I  
Sbjct  292   SVGNLFLWATAAYDMEHAAEMGLHGLVARMRQGVGKINSEYLKTLHGDEGFPKVCEYIKR  351

Query  1106  MSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWA-----VNAQVMKDSVVFMEG  1270
             M E+  HE    N+  L  SS +       DFGWG P W+     V +   ++   F E 
Sbjct  352   MEEVSAHE----NLEALKFSSWVKFGFNEVDFGWGNPIWSSIFGEVGSNSFQNVTFFKET  407

Query  1271  RFGG------VDLWMGLPEELMNIVMKNPQFVEFVS  1360
               GG      V+ W+ L E++M+++  +PQF+   S
Sbjct  408   --GGAIYDTAVEAWVTLDEKIMSVLEHDPQFLALAS  441



>ref|XP_002315639.2| transferase family protein [Populus trichocarpa]
 gb|EEF01810.2| transferase family protein [Populus trichocarpa]
Length=430

 Score =   201 bits (510),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 144/449 (32%), Positives = 228/449 (51%), Gaps = 33/449 (7%)
 Frame = +2

Query  38    ITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYN-GVV  214
             + ++IEV   +IIKPSSPTP  L  Y  S +DQ+S     P + FY + G  +  N    
Sbjct  1     MKIEIEVISNEIIKPSSPTPDHLCHYQLSFLDQISPPTYNPLLLFYPADGDVKINNIEKP  60

Query  215   DELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIRE  394
             ++LK+SLS+ L+L YPLAGRIK D   +ECND+G+ F + +V   L   +ENP+   + +
Sbjct  61    NQLKQSLSEVLNLYYPLAGRIK-DNLFVECNDEGIPFFQAEVKCRLPQVVENPEPSELNK  119

Query  395   MVPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINR  574
             ++P      A + + +   L IQ N F CGGI +GL +SH +GD +S+  F   WA   R
Sbjct  120   LIPF-----ALD-DAEELPLGIQYNIFECGGIVIGLCISHKVGDASSLFTFIKYWAATAR  173

Query  575   GCA-VVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQL  751
             G A  +    FI  ++ +FPP+  +       + A G   ++E  V +RF   +S+I+ L
Sbjct  174   GEADHISRPDFI--SATLFPPINISG-----FKPATGI--TKEDVVTKRFVFRSSSIELL  224

Query  752   REQL-----RLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEP  916
             +E+       L +   PSR EAL   +W    AA++   +    ++ +   +NLR+RMEP
Sbjct  225   KEKCSPASGSLENQRPPSRVEALSVFIWQRFTAASKVESRPE-RIYSMVHAVNLRSRMEP  283

Query  917   PFPENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTA  1096
             P PE   GN  Y          +     + LA + RD+I  V+ E  ++       L   
Sbjct  284   PLPEYSFGN--YCRIAFTIPSIDTGEENYNLASQIRDSIGKVDKEYVKKLQKGNEHLGFM  341

Query  1097  LPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQV-MKDSVVFMEGR  1273
                 +  ++ E    N      +SL    +Y ADFGW KP W  +  +  K+ VVFM+  
Sbjct  342   KEQAARFLRGEVVPLNF-----TSLCRFPLYEADFGWAKPIWVGSPSLTFKNLVVFMDTA  396

Query  1274  FG-GVDLWMGLPEELMNIVMKNPQFVEFV  1357
              G G++  + L EE M    ++ + ++++
Sbjct  397   SGDGIEALVHLKEEDMAKFQEDEELLQYI  425



>ref|XP_004292913.1| PREDICTED: vinorine synthase-like [Fragaria vesca subsp. vesca]
Length=480

 Score =   202 bits (513),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 153/488 (31%), Positives = 229/488 (47%), Gaps = 65/488 (13%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYD--SPGSSRDYNGVVD  217
             M++++  ++ IKPSSPTP  L TY FS++D L   V +P + FY   SP  S   +    
Sbjct  1     MEVQIISQEYIKPSSPTPPHLNTYKFSLLDHLMPPVYVPMILFYPPVSPPISTS-SERSQ  59

Query  218   ELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDV-AESLSSFLENPDFEMIRE  394
              LK+SLS+TL+  YPLAGRI+ +   I+CND+G  +IE  V +  LS FL++PD  +  +
Sbjct  60    ALKQSLSETLTRFYPLAGRIRSNL-CIDCNDEGAYYIEAKVESHDLSEFLQHPDLSLFPK  118

Query  395   MVPCNPFTGAFE-----------PNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASIS  541
             +VP  PF    +           P     V+++QV  F+CGG  +G+ +SH I DG +IS
Sbjct  119   LVP--PFNSLLDYTDQLTNPTTTPGGGPDVVMVQVTNFACGGFVIGVYVSHMIVDGVAIS  176

Query  542   VFANTWARINRGCAVVDDGGFI---FDASKIFPPVKNTADLDQFARVARGAAE-------  691
              F   WA         D    +   FD + +FPP+ +  +  +FA               
Sbjct  177   TFLQAWAAATAQNQSGDQCIHVLPSFDGATLFPPIHD--EQGKFAHPTEATMRGLYRRFA  234

Query  692   SQEKYVVRRFYIPASAIDQLREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINL  871
              + + V +RF   ASA+ +L+E     S   PSR EA+ A +W    AA  K   GR   
Sbjct  235   KKGRCVNKRFVFEASAVAKLKELAATSSLQNPSRVEAVSAFIWKCARAA-WKAKSGRSAP  293

Query  872   HVLTSILNLRNRMEPPFPENCLGN-----NTYGATVHWNQPTEGNPSRHALALKFRDAIR  1036
              ++T  +NLR R +P  P+N +GN            H  +  E      +L  K R+A  
Sbjct  294   SLITHAVNLRRRADPNLPQNSMGNFVCLTGAIANECHGEEELE----LSSLVSKMREATS  349

Query  1037  GVNDEAARRRYGKGGF--LHTALPIMSEIIKHEGS----KKNMYCLYTSSLLGMQVYAAD  1198
              VN +   +   +G    L      M++ I    +    K  M  +  +S+    VY AD
Sbjct  350   KVNGDLVAKLQDQGRLETLSKVFQDMADAIALSTTNGDDKVEMNFIGYTSIAYSGVYDAD  409

Query  1199  FGWGKPRW------------AVNAQVMKDSVVFMEGRFG--GVDLWMGLPEELMNIVMKN  1336
             FGWGKP W            +VN   + D+     G +G  G + W+ L EE M ++  N
Sbjct  410   FGWGKPLWVAPVHEPCHEAFSVNVVRLMDT-----GEWGNNGFEAWISLAEEEMILLQSN  464

Query  1337  PQFVEFVS  1360
                + F S
Sbjct  465   QDLLAFAS  472



>ref|XP_007134122.1| hypothetical protein PHAVU_010G020900g [Phaseolus vulgaris]
 gb|ESW06116.1| hypothetical protein PHAVU_010G020900g [Phaseolus vulgaris]
Length=441

 Score =   201 bits (510),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 136/450 (30%), Positives = 229/450 (51%), Gaps = 27/450 (6%)
 Frame = +2

Query  47    KIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFY---DSPGSSRDYNGVVD  217
             K E+   + IKPSSPTP  L  +  S +DQL+ +  +P + FY   D    + D   + +
Sbjct  4     KNEIISNERIKPSSPTPNHLHNFKLSFLDQLAPSFYVPILLFYSASDVRTFATDLTALSE  63

Query  218   ELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREM  397
             +LK SLS+ L+L YP  GR++ + S+I+CNDQGV FI   +   LS+ L+NP    + ++
Sbjct  64    KLKTSLSKLLTLYYPFCGRLRGN-STIDCNDQGVIFIHSKLPIPLSNILKNPKPHNLHQL  122

Query  398   VPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRG  577
             +PC P+    +      ++ +Q+++F CGGI++G+  SH I D ++ + F + WA  +RG
Sbjct  123   LPCAPYNLQPQQRDTLGIMAVQLSQFKCGGIALGVCFSHKIIDASTAASFLSAWAATSRG  182

Query  578   CAVVDDGGFIFDASKIFPPVKNTADL----DQFARVARGAAESQEKYVVRRFYIPASAID  745
                        ++S   PP++ T+ L    + F  +  G        V +RF    S I 
Sbjct  183   HG---------NSSFAPPPMEETSLLFPPRNVFVDMTSGMF-GHANTVTKRFIFSGSNIS  232

Query  746   QLREQLRLISHYRPSRAEALIAVVWDAVI-AANQKRHKGRINLHV--LTSILNLRNRMEP  916
             +LR+ +   S + PSR EA+ A++W + + AA +    G  N+    +  I+N+R+RM P
Sbjct  233   RLRQNIGCPS-FNPSRVEAVTALLWKSSLEAAKEGSDSGEENVAASSVCHIVNIRSRMVP  291

Query  917   PFPENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTA  1096
                ++ +G N +   V      EG      LA + R+ IR V+ +  R+      F+   
Sbjct  292   ALSKDSIG-NIWQYAVSSLVEVEGGVGLRDLAERVRETIRKVDGDYIRKLQSDVEFVEV-  349

Query  1097  LPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQV-MKDSVVFMEGR  1273
             +  + E       K + +C +T S +G   Y  DFGWGKP +A    + +K+  V +  +
Sbjct  350   VKGLEEARTMAAEKGHRFCAFT-SWVGFGFYEVDFGWGKPTYATTIGMPIKNLGVLISTK  408

Query  1274  FG-GVDLWMGLPEELMNIVMKNPQFVEFVS  1360
              G G++ W+ L    M  +  N Q ++F S
Sbjct  409   DGEGIEAWLTLTTREMAQLEHNAQLLDFAS  438



>ref|XP_008377211.1| PREDICTED: vinorine synthase-like [Malus domestica]
Length=501

 Score =   202 bits (513),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 149/492 (30%), Positives = 230/492 (47%), Gaps = 62/492 (13%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVDE-  220
             M++++   + IKPSSPTPQ LRT+  S++DQ   ++ +P + F++   S    N  +   
Sbjct  6     MQVKIISDECIKPSSPTPQHLRTHKLSLLDQFIPSIYVPMILFFNPSSSIHPININITTP  65

Query  221   -----LKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEM  385
                  LK+SLS+TL+  +PLAGRI+ D  SI+CND+   +IE +V  +LS FL +PD   
Sbjct  66    MRSQLLKQSLSETLTHFHPLAGRIR-DSLSIDCNDERARYIEAEVDSNLSQFLNHPDLSF  124

Query  386   IREMVPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWAR  565
             I + +P        E  P   V ++Q+  F+CGG  +G  +SH + DG ++S F   WA 
Sbjct  125   ISQFLPGE--ASWHEAAPGAHVAMMQITNFACGGFVLGAFVSHMVVDGTALSAFFKAWAA  182

Query  566   IN-RGCAVVDDGGFI-----FDASKIFPPVKNTADLDQFARVARGAAESQE-----KYVV  712
                R  A  +   +I     FDA  +FP  +N    D + R A   A           V 
Sbjct  183   ATFRYIATPNTPHYIYTKGKFDAPSLFP--QN----DAYPREATMMALYYRFLKVGNCVT  236

Query  713   RRFYIPASAIDQLREQLRLISHYRPSRAEALIAVVWDAVIAA-NQKRHKGRI---NLHVL  880
             RR    A A+  L+ +    +   P+R E + A++W  ++AA N K  +  +   +  ++
Sbjct  237   RRIVFDAPALATLKRKAASSTVPNPTRVEVVTALIWKHIMAAFNLKTERNIVQNRSTTLI  296

Query  881   TSILNLRNRMEPPFPENCLGNNTYGATVHWNQPTEGNPSRHA---------------LAL  1015
             T  +NLR R  PPF E  +GN    A       TE N  +                 LA 
Sbjct  297   THAVNLRRRAVPPFSEYTMGNFLSMAAALSQCSTEDNYQKEDNLAHVDDDRDHELGRLAK  356

Query  1016  KFRDAIRGVNDEAARRRYGKG--GFLHTALPI------MSEIIKHEGSKKNMYCLYTSSL  1171
               R+AI  ++ +  +   G G  G      P       +S         +++ C+  SS 
Sbjct  357   HVREAISKLDGDFVQSLQGDGTRGLTKFCEPFKEIRETLSRTSADAADGQSLDCIGFSSW  416

Query  1172  LGMQVYAADFGWGKPRW--------AVNAQVMKDSVVFMEGRFG-GVDLWMGLPEELMNI  1324
                 +Y  DFGWGKP W          +  V  + VV M+ R G GV+ W+ L E+ + I
Sbjct  417   CNFGLYEVDFGWGKPSWVSCVGGKRGADEPVYMNMVVLMDTRSGDGVEAWIYLDEQDIAI  476

Query  1325  VMKNPQFVEFVS  1360
             +  +P F+ FVS
Sbjct  477   LEHDPHFLAFVS  488



>gb|KCW45515.1| hypothetical protein EUGRSUZ_L00759, partial [Eucalyptus grandis]
Length=433

 Score =   200 bits (509),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 143/451 (32%), Positives = 222/451 (49%), Gaps = 32/451 (7%)
 Frame = +2

Query  38    ITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNG--V  211
             + MK+EV   + +KPSSPTP  LR +   ++DQL+    IP + FY +  +    N   V
Sbjct  1     MAMKVEVVSTETVKPSSPTPSHLRNFKLCLLDQLAPPFWIPVILFYSASNNEVAANSASV  60

Query  212   VDELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIR  391
                LK SLSQ LSL YPL GR+K + ++I+CND+G  ++E      LS  L NPD   ++
Sbjct  61    TGNLKTSLSQALSLFYPLGGRMKGN-TAIDCNDEGALYLEAKARFELSEVLSNPDINQLQ  119

Query  392   EMVPCNPFTGAFEPNPDGRVLV-IQVNRFSCGGISVGLIMSHAIGDGASISVFANTWAR-  565
             + +P +  +    PN + +V+V +Q N F CGGI +G+ MSH I D AS+S F   W+  
Sbjct  120   QFLPFS--SDKVVPNIEEQVIVGVQANFFDCGGIGIGICMSHKIVDAASVSGFLTAWSEI  177

Query  566   ----INRGCAVVDDGGFIFDASKIFPPVKNTADLD-QFARVARGAAESQEKYVVRRFYIP  730
                 IN   +++        AS++FPP     D++ Q  R       S+EK + +RF   
Sbjct  178   ALNGINGKASLITP---FLKASELFPP----KDVNFQMPR----RFSSREKLLTKRFRFD  226

Query  731   ASAIDQLREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHK--GRINLHVLTSILNLRN  904
             + ++ +LR +        P+R EA+ A++W + + A +KR +   +      T  +N+R+
Sbjct  227   SESLARLRARF---GSATPTRVEAVTALIWKSAVEAARKRPEWNEKYPSSAATHTVNIRS  283

Query  905   RMEP-PFPENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGG  1081
             RM P P PE+ LG N +  TV     T         A   R +IR ++ E      G+ G
Sbjct  284   RMRPQPLPEHALG-NLWQITVAPLIDTNKGVELQDFAGSLRKSIRAIDGEYLSVLQGERG  342

Query  1082  FLHTALPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQVMKDSVVF  1261
                    + +     E S   M     SS +    Y  DFG G+P W         ++VF
Sbjct  343   LAKAYESLTAARKLGESSAGKMELYGFSSWVKFPFYKVDFGLGRPTWVCTTGFPIGNMVF  402

Query  1262  MEG-RFG-GVDLWMGLPEELMNIVMKNPQFV  1348
             + G R G G++ W+ L E  M    +N + +
Sbjct  403   LMGTRCGDGIEAWITLHEHDMIEFERNDELL  433



>ref|XP_002533732.1| 3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase, putative [Ricinus 
communis]
 gb|EEF28651.1| 3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase, putative [Ricinus 
communis]
Length=433

 Score =   200 bits (509),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 134/449 (30%), Positives = 229/449 (51%), Gaps = 25/449 (6%)
 Frame = +2

Query  38    ITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDY-NGVV  214
             + MK+E+  R++IKPSSPTP  L+ +   ++D+L+    +P    Y    SS ++ N   
Sbjct  1     MAMKVEIISREMIKPSSPTPAHLKHFKICLLDELAPPSYVPIFLLY----SSAEFGNCFA  56

Query  215   DELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIRE  394
             D+LKKSLS TL+  YP +G++K + S ++CND G  F+E  V  + S  + +P+  M+ +
Sbjct  57    DKLKKSLSDTLARYYPFSGKLKGNLS-VDCNDDGALFLEAKVNIAASEIVRDPETSMLYK  115

Query  395   MVPCNPFTGAFE-PNPDGRVLV--IQVNRFSCGGISVGLIMSHAIGDGASISVFANTWAR  565
             + P +P+ G  +    DG  L+  +QVN F CGG+ +G+ +SH I DGA+++ F N WA 
Sbjct  116   LFPFDPYRGTADGATVDGETLITGVQVNVFECGGVGIGVCVSHKIADGATMASFLNAWAA  175

Query  566   INRGCAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAID  745
                G  +        D++ +FPP     D+ +   + R      EK V RRF      + 
Sbjct  176   TATG--IDQTAAPSLDSALLFPP--KGVDIIKQRDMIR-----DEKIVTRRFEFEGKNLA  226

Query  746   QLREQLRLISHYRPSRAEALIAVVWDAVIAANQ-KRHKGRINLHVLTSILNLRNRMEPPF  922
              L+  +   +   P+R EA+  ++W A +   +    K  I   ++T ++N+R+RM PP 
Sbjct  227   NLKANIA--NDISPTRVEAVTTLIWKAAMEVTRLNTGKDLIPPSIVTHLVNIRDRMNPPL  284

Query  923   PENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTALP  1102
             P + +G N +  ++      +       L    R +IRG++ E   +  G  G L  AL 
Sbjct  285   PRHSVG-NLWRLSLAPYVDVKKELELQELVRILRKSIRGIDSEYLTKLQGDDG-LAKALE  342

Query  1103  IMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQV-MKDSVVFMEGRFG  1279
              + E+ +     + +     SS     +Y  +FGWG P       V +++SV+ M  + G
Sbjct  343   PLKELRQLALRGEGVEVYTFSSWARFPLYEINFGWGMPIKVCTITVPVRNSVILMGTKSG  402

Query  1280  -GVDLWMGLPEELMNIVMKNPQFVEFVSA  1363
              G++ W+ L E+ M     + + ++FVSA
Sbjct  403   DGIEAWVTLTEKDMAKFECSQELLQFVSA  431



>gb|KDP36822.1| hypothetical protein JCGZ_08113 [Jatropha curcas]
Length=696

 Score =   205 bits (522),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 161/494 (33%), Positives = 242/494 (49%), Gaps = 32/494 (6%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVDEL  223
             M+IEV  R+ IKP S TP  LRTY  S++DQL  +  +P + FY  P         +  L
Sbjct  1     MEIEVFSRESIKPPSLTPSHLRTYKLSLLDQLMPSAHVPIIFFY-RPIDQPVIPARLQRL  59

Query  224   KKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREMVP  403
             K SLSQ L+  YP AG+IK+D   I+CND GV + E  V+  LS  L +PD + I +++P
Sbjct  60    KHSLSQALTSFYPFAGKIKDDL-YIDCNDDGVSYTEAKVSSFLSDILGHPDTKTIFKLLP  118

Query  404   CNPFTGAFEPNPDGR---VLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINR  574
              + +    E   +G    V +IQVN F CGGI++G   SH I DG + + F   WA I R
Sbjct  119   DDSYL--LETYNEGNGIPVAMIQVNVFKCGGIAIGTKTSHKIIDGPTSTSFLKAWAAIAR  176

Query  575   GCA--VVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQ  748
             G    VV      F A  +FP   ++   D    V     +   K V++RF   +SAI  
Sbjct  177   GSGELVVQPS---FTAPSLFPQ-NHSLPKDTLLAVWPSLVKFG-KGVMKRFVFDSSAIAT  231

Query  749   LREQLRLISHY-RPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPFP  925
             L+ +    S   RP+R EA+ A +W   + A++KR+ G     VL+  +NLR +     P
Sbjct  232   LKARASSSSFVQRPTRVEAVSAFIWQCTMVASEKRN-GSYKPSVLSHTVNLRGKKTVHLP  290

Query  926   ENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHT--AL  1099
             E+ +GN  + +       TE     H L    R++I  ++    ++  G+ GF      L
Sbjct  291   ESSVGNLLWMSIAKCC--TEAERELHVLVGLLRESILKIDSNFVQKLSGEEGFYKVCECL  348

Query  1100  PIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQVMK---DSVVFMEG  1270
                SE+  + G+      L  SSL  + +Y  DFGWGKP W     V+     ++VF+  
Sbjct  349   QEFSEVYSNAGADY----LTFSSLCKVGIYETDFGWGKPIWVSPGGVIGPVFQNLVFLNE  404

Query  1271  RFG--GVDLWMGLPEELMNIVMKNPQFVEFVSAGFSKSKL*IEWLKKTMTIEPN---PKM  1435
               G  G+++W+ L E+ M I+      + F S   S  +L   +++ T  I  +    K 
Sbjct  405   TSGGDGIEVWLTLDEQDMAILELETHILSFSSLDPSPLQLCACYIEATSNITLSQYLAKP  464

Query  1436  TIVLLCMVLRHILC  1477
              + LL  +L  I+C
Sbjct  465   DLALLRKLLPDIIC  478


 Score = 89.0 bits (219),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 65/254 (26%), Positives = 115/254 (45%), Gaps = 12/254 (5%)
 Frame = +2

Query  323   FIEGDVAESLSSFLENPDFEMIREMVPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGL  502
             +IE     +LS +L  PD  ++R+++P       +E      + +IQ   F+CGG ++G+
Sbjct  448   YIEATSNITLSQYLAKPDLALLRKLLP--DIICEYELPSGSHIALIQETTFACGGFTIGI  505

Query  503   IMSHAIGDGASISVFANTWARINRGCAVVDDGGFIFDASKIFPPVKNTADLDQFARVARG  682
               SH   DGAS+ +F   WA     C       ++  A  IFPP         F      
Sbjct  506   YASHMFCDGASLFLFLKDWAATT--CKSPTKHPYL-AAEGIFPPYTAFPSGVSFFTTMYA  562

Query  683   AAESQEKYVVRRFYIPASAIDQLREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGR  862
                 + KY + R     SAI  L+ +  L ++  P+R E + A +   +IA+ + +    
Sbjct  563   PFVKKGKYTLNRIVFNESAITNLKAKASL-NNINPTRVEVVTAFLSKCLIASFKNKTGID  621

Query  863   INLHVLTSILNLRNRMEPPFPENCLGN-NTYGATVHWNQPTEGNPSRHALALKFRDAIRG  1039
               L +  ++ NLR + +PP PE+ LGN  ++   V   +  E       L  + R+ ++ 
Sbjct  622   KPLAICHAV-NLRRKADPPLPESLLGNIISFAGAVFTTKEKE----LIELVSELREEMKK  676

Query  1040  VNDEAARRRYGKGG  1081
             V+++  ++    GG
Sbjct  677   VDNDFLKKIKSGGG  690



>ref|XP_010682887.1| PREDICTED: vinorine synthase-like [Beta vulgaris subsp. vulgaris]
Length=426

 Score =   200 bits (508),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 137/448 (31%), Positives = 232/448 (52%), Gaps = 36/448 (8%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVDEL  223
             M++E+  ++ IKPS PTP   + Y  S +DQLS ++ +P + FY++P + +    +  +L
Sbjct  1     MEVEIISKEAIKPSKPTPSHCKLYRLSSLDQLSPSIYVPILLFYEAPTTPQKRADLSSQL  60

Query  224   KKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREMVP  403
             K SLS+TL+  YP AGRIK D S I+C+D+G  FIE     +L   L  P  E +  + P
Sbjct  61    KSSLSETLTYYYPFAGRIK-DGSYIDCDDEGSLFIEAQAKNNLVDILTFPKLEALDVLFP  119

Query  404   CNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRGCA  583
                    ++ + +  VL +Q++ F CGG+S+G+ +SH I D  +I  F N WA   R   
Sbjct  120   DE---KQWKSSRNSSVLAVQLSYFDCGGLSIGICISHKIADACTIFTFLNDWASQARKSG  176

Query  584   VVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQLREQL  763
               +    +F+ + IFPP       D+F        +S    V RR+    + I +L+  +
Sbjct  177   --ESICPLFNTTSIFPPN------DEFVIPELEFVKSN--VVTRRYVFHPTKISELKATI  226

Query  764   RLISH--YRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPFPENCL  937
                S+  + P+R E + +++++++I A + R  G +  +VL   +N+R+RM PP   N +
Sbjct  227   VSNSNSLHNPTRVEVVTSLIFNSIIQATKIRSFGLVKSYVLAQTVNMRSRMVPPLVRNSM  286

Query  938   GNNTYGATVHWNQPT----EGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTALPI  1105
             GN      + W  P       + S   LA + R+ +  + D  A+   GK   L      
Sbjct  287   GN------IVWYFPVMIKDNEDISLERLATQMREGLVKLCD-FAKNVEGKDWLL------  333

Query  1106  MSEIIKHEGSKKNMYCLY-TSSLLGMQVYAADFGWGKPRWAVNAQV-MKDSVVFMEGRFG  1279
             M+   ++ GS+ +M   Y  SS     VY  DFGWG P W   A+   K+++  ++ + G
Sbjct  334   MAAASENNGSEHSMNDAYKISSWCKYPVYQVDFGWGNPMWVSTAEYPYKNNIFLIDCKDG  393

Query  1280  -GVDLWMGLPEELMNIVMKNPQFVEFVS  1360
              G++ W+ L E++M I+  + +F++F S
Sbjct  394   EGIEAWVTLDEDVMFILQGDEEFLKFAS  421



>ref|XP_009359355.1| PREDICTED: vinorine synthase-like [Pyrus x bretschneideri]
Length=455

 Score =   200 bits (509),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 147/461 (32%), Positives = 233/461 (51%), Gaps = 46/461 (10%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFY-DSPGSSRDYNGVVDE  220
             +++EV     IKPSSPTP  LR +N S +DQL   + +P V F+   P ++ D      +
Sbjct  4     LEVEVVSSKTIKPSSPTPDHLRRHNLSFLDQLQPPIFMPMVLFFPKDPHTTDDPTERCTK  63

Query  221   LKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENP---DFEMIR  391
             +K +LS+TL+  YPLAGRI+  +  ++CND+G  ++E     +++  ++NP   DF M  
Sbjct  64    IKTALSKTLTKFYPLAGRIRGIQY-VDCNDEGAYYVEAKANSNITDIIQNPCPSDFNM--  120

Query  392   EMVPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARIN  571
               +PC     +  P      + +QV  F+CGG+S+G+ MSH +GD  SI +F N+ A   
Sbjct  121   -FIPCALDAASELP------ICLQVTFFACGGMSIGMGMSHKVGDALSIFIFLNSLAATT  173

Query  572   RGCAVVDDGGFI--FDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAID  745
             RG     D G    F + K FP      DL    + + G    +     +RF   ASA+ 
Sbjct  174   RG---EPDYGHAPEFISDKYFP----QQDLSGSYQHSSGMI--KHNISTKRFVFDASAVS  224

Query  746   QLREQLRLISHY---RPSRAEALIAVVWDAVIAA----NQKRHKGRI-NLHVLTSILNLR  901
              LR +   + +    RP+R EAL A VW   IAA     Q  H   +  ++ ++  +NLR
Sbjct  225   ALRARSTDVENEHARRPTRVEALSAFVWRRYIAACTSQQQNDHADDVPAMYTVSHAVNLR  284

Query  902   NRMEPPFPENCLGNNTYGATVH---WNQPTEG---NPSRHALALKFRDAIRGVNDEAARR  1063
              RM+PP PE   GN T  A        +P +G   +PS +++    R A++ V+ E  ++
Sbjct  285   TRMDPPLPEYTFGNVTRTAISVPPILMEPKDGSLSDPSLYSVVGHVRQALKQVDREYVKK  344

Query  1064  RYGKGGFLHTALPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQ-V  1240
                  G++       S++ + E     +     +SL    +Y ADFGWGKP +A +A+  
Sbjct  345   LQEGEGYVSFLKERSSQVKRGE-----VVSFSFTSLCRFPIYDADFGWGKPAYAGSARFT  399

Query  1241  MKDSVVFMEGRFG-GVDLWMGLPEELMNIVMKNPQFVEFVS  1360
              K+ V F +   G GV+ W+ L EE M     + + +++VS
Sbjct  400   FKNLVSFFDTTSGDGVEAWINLKEEDMEKFEADEEVLKYVS  440



>gb|AES72092.2| anthranilate N-benzoyltransferase [Medicago truncatula]
Length=416

 Score =   199 bits (507),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 142/436 (33%), Positives = 225/436 (52%), Gaps = 44/436 (10%)
 Frame = +2

Query  38    ITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVD  217
             + +++E+  ++IIKPSSPTP  LR Y  S +DQ++  V  P V FY S   + +   + +
Sbjct  1     MKLEVEIISKEIIKPSSPTPSHLRHYQLSFLDQIAPMVYNPIVLFY-SHNDALNTATISN  59

Query  218   ELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAE-SLSSFLENPDFEMIRE  394
              LKKSLS+ L+  YPLAGR+  +++ I+CND+G+ +IE  +   +L   ++NP    +  
Sbjct  60    TLKKSLSKILTHFYPLAGRMN-NKNFIDCNDEGIPYIETKITNYNLKDIIQNPIPNELNR  118

Query  395   MVPCNPFTGAFEPNPDGRVLV-IQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARIN  571
             ++P       F+ +    +   IQ+N FSCGGI++G  +SH I DG S   F N+WA I 
Sbjct  119   LIP-------FQLDDITNIAFGIQLNFFSCGGIAIGACLSHQIADGLSFFNFLNSWANIT  171

Query  572   RGCAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQL  751
             R          IFD+SK+FPP KN +  D  + +A+      E  V + F   A  ++ L
Sbjct  172   RKLIFPKP---IFDSSKLFPP-KNISGFDPRSGIAK------ENIVCKIFVFNADVVENL  221

Query  752   REQLRLISHYRPSRAEALIAVVW----DAVIAANQKRHKGRINLHVLTSILNLRNRMEPP  919
             R +     ++ P+R EAL A +W    D +     +R+ G ++       +NLR +MEPP
Sbjct  222   RAKY---INFNPTRVEALSAFIWSRYVDVIYNDGVQRNYGVVHA------VNLRQKMEPP  272

Query  920   FPENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARR-RYGKGGFLHTA  1096
              P    G N    T+   +   G    + LA + RD I+ ++ E  ++ + GK       
Sbjct  273   LPLESFG-NYLRFTITIPKMNSGEEC-YGLAKQVRDEIKKIDKEYVKKVQEGK-----EH  325

Query  1097  LPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWA-VNAQVMKDSVVFMEGR  1273
             L  + E       K+ +     +SL    +Y ADFGWGKP W    A   K+ VVF++ +
Sbjct  326   LEFLKESFDRVIVKEELVVFNFTSLCRFPLYDADFGWGKPIWVGSTALNFKNLVVFVDCK  385

Query  1274  -FGGVDLWMGLPEELM  1318
               GG++ ++ L  E M
Sbjct  386   DGGGIEAYVSLKVEDM  401



>ref|XP_006395599.1| hypothetical protein EUTSA_v10005565mg [Eutrema salsugineum]
 gb|ESQ32885.1| hypothetical protein EUTSA_v10005565mg [Eutrema salsugineum]
Length=458

 Score =   200 bits (509),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 132/462 (29%), Positives = 227/462 (49%), Gaps = 45/462 (10%)
 Frame = +2

Query  29    LHQIT-MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYN  205
              HQ + M++++  RD+IKPSSPTP  L+ +  S+++QL   +  P V FY      +   
Sbjct  11    FHQKSLMRVDLISRDMIKPSSPTPNHLKNFKLSLLEQLGPTIFGPMVFFYSGNKGIKPTE  70

Query  206   GVVDELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEM  385
              +  +LKKS S+TL+  YPLAGR+K +  SI+CND G +F+E +V   LS+ L+ P  ++
Sbjct  71    QL-QKLKKSFSETLTHFYPLAGRLKGN-ISIDCNDSGADFLEAEVNTPLSNLLQEPSSDI  128

Query  386   IREMVPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWAR  565
             +++++P    T         ++L+ Q + F CGG+++G+ +SH + D  SIS+F  +WA 
Sbjct  129   LQQLIP----TSVDSIETRTKLLLAQASFFECGGMAIGVCISHKLADATSISLFMKSWAA  184

Query  566   INRGCAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQE----KYVVRRFYIPA  733
             I+   ++   G  +FD  KIFPP         F+  +       E    + + +RF   +
Sbjct  185   ISSRGSIKTVGFPVFDTVKIFPP-------GNFSETSPAPVVEPEIMMNQTLSKRFVFDS  237

Query  734   SAIDQLREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRME  913
             S+I  L+ +       +P+R EA+ A++W A + A +   +      +L +   LR+R+ 
Sbjct  238   SSIQALQAKASSFEVNQPTRVEAVSALIWKAAMKATRTVSRTS-KPSILANSACLRSRVS  296

Query  914   PPFPENCLGN--NTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFL  1087
             PPF EN +GN  + + A     +  E       L  + R A +   D    +  G     
Sbjct  297   PPFTENSIGNLVSYFAAKA---EEGENQTKLRTLVFEIRKAKQRFRDNHVSKLVGN----  349

Query  1088  HTALPIMSEIIKH---------EGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQV  1240
                 P  +EII +              + Y   ++   G+  Y  DFGWG P W     V
Sbjct  350   ----PDATEIICNYQIEAGDMIASGDFDFYIFSSACRFGL--YETDFGWGNPVWVGFPSV  403

Query  1241  MKDSVVFM--EGRFGGVDLWMGLPEELMNIVMKNPQFVEFVS  1360
              + ++V +      GG++ W+ L E+ M +  ++ + + F S
Sbjct  404   RQKNIVALLDTKEAGGIEAWVNLNEQEMKLFEQDRELLSFAS  445



>ref|XP_007029093.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
 gb|EOY09595.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
Length=546

 Score =   202 bits (514),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 139/450 (31%), Positives = 223/450 (50%), Gaps = 23/450 (5%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFY-DSPGSSRDYNGVVDE  220
             M + +  R+ ++PSS     L+ +  S +DQL     +P + FY  S  S  D   ++  
Sbjct  1     MDVRITSRETVQPSSQEVHLLKPFKLSFLDQLIPAFYVPLIFFYTQSSNSHFDSAQILAR  60

Query  221   LKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREMV  400
             LK+SLS+TL+  YPL+GR   D   I+   +GV +IE  V   LS +L++ + E +  ++
Sbjct  61    LKESLSKTLNQFYPLSGRTI-DNFCIDYYREGVPYIEARVNGCLSDYLQSTELEKLNHLI  119

Query  401   PCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRGC  580
             PC PF    +P    + L +QVN F CGGI++ +  SH I D ++IS F  +WA  +RG 
Sbjct  120   PCEPFCYFSDPAVIPQ-LAVQVNIFDCGGIALAMCCSHKIIDASTISAFLRSWAAFSRGS  178

Query  581   -AVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQLRE  757
                +     +  +S++FPP+ +      F    R     +E+Y  RRF   A+AI  L  
Sbjct  179   NGEIPHPDLLEASSRLFPPMDSIP--PNFLSSTRTLWFKEERYKTRRFVFDANAIATLMF  236

Query  758   QLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPFPENCL  937
             + +  S   PSR EAL A +W   + A      G +   VL   +NLR++M+P  P+  +
Sbjct  237   KAKSKSLEHPSRVEALTAFIWKYAMLACASA-SGILKPSVLCQAVNLRHKMKPRLPDYSV  295

Query  938   GNNT-YGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTALPIMSE  1114
             GN   + A+ +  +P + +   H LA   R+A+   N +  +   G  GF      ++SE
Sbjct  296   GNLIRFAASAY--KPADKDIELHHLAYLLREAMENYNTDYLQSLQGDEGF-----KVISE  348

Query  1115  I---IKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQVMK---DSVVFME--G  1270
                 +    +K N      SS L   ++  DFGWGKP W     V+     S+ F++  G
Sbjct  349   KANQVAEFAAKGNAQVYGFSSWLNSGMHQVDFGWGKPSWIGIPGVVSPAFTSLTFLKEIG  408

Query  1271  RFGGVDLWMGLPEELMNIVMKNPQFVEFVS  1360
             +   V+ W+ L E+ M I   + +F+ F S
Sbjct  409   QEKAVEAWVTLDEKKMTIFEHDHEFLAFAS  438



>gb|AFK43775.1| unknown [Medicago truncatula]
Length=416

 Score =   199 bits (506),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 138/423 (33%), Positives = 218/423 (52%), Gaps = 43/423 (10%)
 Frame = +2

Query  38    ITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVD  217
             + +++E+  ++IIKPSSPTP  LR Y  S +DQ++  V  P V FY S   + +   + +
Sbjct  1     MKLEVEIISKEIIKPSSPTPSHLRHYQLSFLDQIAPMVYNPIVLFY-SHNDALNTATISN  59

Query  218   ELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAE-SLSSFLENPDFEMIRE  394
              LKKSLS+ L+  YPLAGR+  +++ I+CND+G+ +IE  +   +L   ++NP    +  
Sbjct  60    TLKKSLSKILTHFYPLAGRM-NNKNFIDCNDEGIPYIETKITNYNLKDIIQNPIPNELNR  118

Query  395   MVPCNPFTGAFEPNPDGRVLV-IQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARIN  571
             ++P       F+ +    +   IQ+N FSCGGI++G  +SH I DG S   F N+WA I 
Sbjct  119   LIP-------FQLDDITNIAFGIQLNFFSCGGIAIGACLSHQIADGLSFFNFLNSWANIT  171

Query  572   RGCAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQL  751
             R          IFD+SK+FPP KN +  D  + +A+      E  V + F   A  ++ L
Sbjct  172   RKLIFSKP---IFDSSKLFPP-KNISGFDPRSGIAK------ENIVCKIFVFNADVVENL  221

Query  752   REQLRLISHYRPSRAEALIAVVW----DAVIAANQKRHKGRINLHVLTSILNLRNRMEPP  919
             R +     ++ P+R EAL A +W    D +     +R+ G ++       +NLR +MEPP
Sbjct  222   RAKY---INFNPTRVEALSAFIWSRYVDVIYNDGVQRNYGVVHA------VNLRQKMEPP  272

Query  920   FPENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARR-RYGKGGFLHTA  1096
              P    G N    T+   +   G    + LA + RD I+ ++ E  ++ + GK       
Sbjct  273   LPLESFG-NYLRFTITIPKMNSGEEC-YGLAKQVRDEIKKIDKEYVKKVQEGK-----EH  325

Query  1097  LPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQV-MKDSVVFMEGR  1273
             L  + E       K+ +     +SL    +Y ADFGWGKP W  +  +  K+ VVF + +
Sbjct  326   LEFLKESFDRVIVKEELVVFNFTSLCRFPLYDADFGWGKPIWVGSTALNFKNLVVFFDCK  385

Query  1274  FGG  1282
              GG
Sbjct  386   DGG  388



>ref|XP_006420178.1| hypothetical protein CICLE_v10006986mg [Citrus clementina]
 gb|ESR33418.1| hypothetical protein CICLE_v10006986mg [Citrus clementina]
Length=428

 Score =   199 bits (505),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 143/446 (32%), Positives = 222/446 (50%), Gaps = 34/446 (8%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVDEL  223
             M +EV  ++ IKPS+PTP+ L+ Y FS  DQ+S +  IP + FY+        N +  +L
Sbjct  1     MDVEVISKETIKPSTPTPKHLQIYKFSFTDQISPSFYIPLIYFYNLNDHKLGNNIISGDL  60

Query  224   KKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREMVP  403
             KKSLS+ L+  YPLAG + +D   ++CND+GV F+E  V  +LS  +  P+   + + +P
Sbjct  61    KKSLSKVLTHYYPLAGCLNDDY--VDCNDKGVLFLEAKVKCNLSQIIGEPNPRKLNKFLP  118

Query  404   CNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRGCA  583
                       +    +L IQVN F CG I++G  +SH I D ++   F   WA       
Sbjct  119   ---------DHVKNFILAIQVNFFDCGNIAIGACVSHKIADASTFITFIKNWAAAASFGG  169

Query  584   VVDDGGFIFDASKIFPPVKNTA-----DLDQFARVARGAAESQEKYVVRRFYIPASAIDQ  748
                D     D+ KI P + +       D+ +  RV+  A   ++  V + F    S I  
Sbjct  170   GGGD-----DSVKICPELLSATLFPPRDVGESCRVSLPA---EKNIVCKSFVFRGSRIAA  221

Query  749   LREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPFPE  928
             L+E+     H  P+R EAL A +W +  AA+ +   G   + +L   +NLR RM+PP P+
Sbjct  222   LKEKYAGGIH--PTRVEALSAFIW-SRFAASTEIKIGPERVSMLVHAVNLRKRMDPPQPD  278

Query  929   NCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTALPIM  1108
             +  GN + G T        G    + L   FRDAI  +N + A ++  +G F H  L  +
Sbjct  279   DSFGNIS-GPTATIISEDIGEEC-YGLVKMFRDAIGRINKDYA-KKLQEGVFEHFGL--L  333

Query  1109  SEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRW-AVNAQVMKDSVVFMEGRFG-G  1282
               I      ++ +   Y +SL    +Y ADFGWGKP W A      ++  V M+ + G G
Sbjct  334   GSINDDGFDRREVVNFYYTSLCRFPLYEADFGWGKPIWVAWGGWPYRNIAVLMDTKCGNG  393

Query  1283  VDLWMGLPEELMNIVMKNPQFVEFVS  1360
             ++ W+ L EE M     + +F+ +VS
Sbjct  394   IEAWIHLKEEDMVKFEADKEFLSYVS  419



>ref|XP_008222020.1| PREDICTED: BAHD acyltransferase At5g47980-like [Prunus mume]
Length=437

 Score =   199 bits (506),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 146/466 (31%), Positives = 230/466 (49%), Gaps = 61/466 (13%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVDEL  223
             M+I +  R  IKPSSPTP  L+T+  S++DQ+     IP + FY +    R       +L
Sbjct  5     MEIGIIARQNIKPSSPTPTHLKTFKLSLLDQMVPPTYIPLLLFYPTSDHHR-----ARQL  59

Query  224   KKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREMVP  403
             KKSLS+TL+  YP AG IK D + IECND G  FIE  V+  LS  L  PD E++++++P
Sbjct  60    KKSLSETLTRFYPFAGTIK-DNAFIECNDNGACFIEAQVSCLLSHILNEPDHEVLKQLLP  118

Query  404   CNPFTGAFEPNPDGR--VLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRG  577
              N     FE   +GR  VL +Q N F CG +++G+ +SH I D A+++ F  TWA    G
Sbjct  119   IN-----FESPEEGRGCVLHVQANYFKCGAMAIGICLSHKIADAATLTTFIKTWAATASG  173

Query  578   CAVVDDGGFI--FDASKIFPPVKNTADLDQFARVARGAAE-SQEKYVVRRFYIPASAIDQ  748
               + D+   +  F+A  +  P+K+ +       +A  A E  Q K V +RF   +S I  
Sbjct  174   --IGDESVVVPLFNAVSMM-PLKDIS-------IAPPAVEIKQHKSVTKRFVFHSSKIAA  223

Query  749   LREQLR------LISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRM  910
             L+ ++        + H  P++ E L A++W   + A++           L   +N+R+R+
Sbjct  224   LKAKVTNNSVSAEVEH--PTKVETLAALIWKCAMKASRANLGISTRPSALYQNVNIRSRV  281

Query  911   EPPFPENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLH  1090
              PP P   +G N  G+ +   + +E     H L  + R  I      A R          
Sbjct  282   LPPVPNESIG-NFVGSFI--ARTSEAETELHGLVAELRKGILQFCKNAKR----------  328

Query  1091  TALPI---MSEIIKHEGSKKNMYC------LYTSSLLGMQVY-AADFGWGKPRWAVNAQ-  1237
               +P+   +S I+K +     + C         +S    QVY AADFGWGKP W  +A  
Sbjct  329   --VPLIEDISVILKPQIEAIGLLCRDDVDFYACTSWCRFQVYEAADFGWGKPMWVTSANP  386

Query  1238  VMKDSVVFMEGRFG-GVDLWMGLPEELMNIVMKNPQFVEFVSAGFS  1372
               K+ V+ ++ + G G++  + L EE M + + + + + + S   S
Sbjct  387   TCKNMVILLDTKDGDGIECLVRLTEEDMKVFVCDQELLAYASLNTS  432



>ref|XP_010044503.1| PREDICTED: vinorine synthase-like [Eucalyptus grandis]
Length=434

 Score =   199 bits (505),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 143/452 (32%), Positives = 225/452 (50%), Gaps = 40/452 (9%)
 Frame = +2

Query  38    ITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYN--GV  211
             + + +E+  R+ +KPSSPTP  LR Y  S +DQ+S  V  P+V FY        +N   +
Sbjct  1     MEIAVEITSRETVKPSSPTPDHLRHYRLSFLDQISPPVYNPFVLFYTPQNEDDQFNIDDI  60

Query  212   VDELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIR  391
               +LK SLS  L+  YPLAGR+K +  SIEC+D GV + E  V   +S   ENPD + + 
Sbjct  61    SSKLKASLSCILTHFYPLAGRLKGN-VSIECDDVGVPYSEAIVKCQVSDVTENPDPQELG  119

Query  392   EMVPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARIN  571
             +++P   F        D   L +Q N+F CGGI+VG+ MSH I D  S+  F   WA + 
Sbjct  120   KLLP---FVLDVS---DETTLGVQFNKFDCGGIAVGICMSHKISDALSLLTFIKMWAAVC  173

Query  572   RGCAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQL  751
             RG  +V    F   ++++FPP KN +  +    + R      +  V +RF    + I+ L
Sbjct  174   RGEEIVTPPQFA--SAELFPP-KNISGFEPRTGITR------DNIVSKRFIFKTNKIETL  224

Query  752   R----EQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPP  919
             +    +++ L  +  PSR EAL   +W +  A + + +       ++   +NLR + +PP
Sbjct  225   KARYSKEMDLGQNRPPSRVEALSTFIW-SRFAWSTRVYSEPSKKCIILHAVNLRTKFDPP  283

Query  920   FPENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARR-RYGKGGFLHTA  1096
              P++  G N Y   V   Q   G    + LA K R+ +RG++     + R GK       
Sbjct  284   LPQHSFG-NFYRVAVTSLQLDSGKEC-YGLAAKMRETVRGIDKGYVEKLRDGKEHL----  337

Query  1097  LPIMSEIIKHEGS---KKNMYCLYTSSLLGMQVYAADFGWGKPRWAVN-AQVMKDSVVFM  1264
                  + IK       K  +  +  +SL    +Y +DFGW  P W  + A   ++ VVFM
Sbjct  338   -----DFIKRSAEVYLKGELLAMNFTSLCRFPMYESDFGWDNPTWVGSPALTFQNLVVFM  392

Query  1265  EGRFG-GVDLWMGLPEELMNIVMKNPQFVEFV  1357
             + + G GV+ ++ L  E M  +  + +F+EFV
Sbjct  393   DTKSGDGVEAYISLRVEDMAALESDEEFMEFV  424



>emb|CDP08574.1| unnamed protein product [Coffea canephora]
Length=437

 Score =   199 bits (505),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 136/437 (31%), Positives = 210/437 (48%), Gaps = 33/437 (8%)
 Frame = +2

Query  50    IEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPG--SSRDYNGVVDEL  223
             +E+  +++IKPSSPTP  LR +  S +DQL+  + IP + FY      + +D+  +   L
Sbjct  5     LEILSKEMIKPSSPTPYHLRNFTLSFLDQLAPPIYIPLIFFYQPSQLQTYKDHAQISQLL  64

Query  224   KKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREMVP  403
             K+SLS  L+  YPL GRI  D  +I+ ND G  F+E  V  +L   +E P  + +++ +P
Sbjct  65    KQSLSNALTKFYPLGGRICSDDFAIDANDAGALFVEAQVHSNLLQVIEKPSMDEMKQYLP  124

Query  404   CNPF-TGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRGC  580
               P  +G      +  +L +Q+N F CGG+++G+ MSH I DG S+  F N WA   RG 
Sbjct  125   LQPNGSGHGITEANTILLAVQINIFDCGGLAIGVQMSHKIADGTSLVAFMNAWAANCRGD  184

Query  581   AVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQLREQ  760
             A +       D + +FPP K+   L+   +   G   ++EK   +RF      + +L++ 
Sbjct  185   AEIHQSS--LDLASLFPP-KDV--LNSGFKPTVGI--TKEKITTKRFVFDREKLAKLKQA  237

Query  761   LRLISHYR---PSRAEALIAVVWDAVIAANQKRHKGRINLHV-LTSILNLRNRMEPPFPE  928
             L      +   P+R EA+ A  W   I A + +   +    V     +NLR RM P  P+
Sbjct  238   LASSPGSQVKDPTRVEAVSAFFWRHFIEATKAKMDSKSKKMVAAVHAVNLRPRMNPALPD  297

Query  929   NCLGNNTYGATVHWNQP-----TEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHT  1093
             +  GN        W         EG      LA   R+AIR +N    +       +LH 
Sbjct  298   HAFGN-------LWRHALAIPVAEGEKGYQNLAGDLRNAIRNINSNYVKTLQIGDEYLH-  349

Query  1094  ALPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQV-MKDSVVFMEG  1270
             AL    E++    SK ++     SS     VY  D+GWGKP W     +  K+ V+ M  
Sbjct  350   ALKKTMELV----SKGDIEFCNFSSWCRFPVYEVDYGWGKPTWVCTTTLPFKNVVILMST  405

Query  1271  RFG-GVDLWMGLPEELM  1318
               G G++ W+ + EE M
Sbjct  406   SCGEGIEAWVNMLEEDM  422



>ref|XP_009780317.1| PREDICTED: vinorine synthase-like [Nicotiana sylvestris]
Length=445

 Score =   199 bits (506),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 139/457 (30%), Positives = 229/457 (50%), Gaps = 38/457 (8%)
 Frame = +2

Query  38    ITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVD  217
             + +K+++   ++I+PSSPTP  L+ +N  ++DQL      P + FY + G  + +     
Sbjct  1     MNIKVKLISTEMIQPSSPTPNHLKNFNLCLLDQLIPAPYAPILLFYPNLGDIKVHEKSA-  59

Query  218   ELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREM  397
              LKKSL  TL   YPLAGR K D  SI+CNDQGV ++  +V   L  FL  P+ E I + 
Sbjct  60    LLKKSLVDTLYRFYPLAGRFK-DELSIDCNDQGVNYVTTNVNCHLIEFLNEPNLESISQF  118

Query  398   VPCNPFTGAFEPNPDGRVLV-IQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINR  574
             +PC P    F+    G  +  IQ+N F CGGI++GL ++H I DG  +S F   WA +  
Sbjct  119   LPCQP---PFKVLAAGDYVTNIQINVFKCGGIAIGLCIAHKILDGVGLSTFLKYWAGLAC  175

Query  575   GCAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQLR  754
                 V     +  A+  FP       L   +     +   +  +V RRF   ASAI+ L+
Sbjct  176   SSNEVQYPNLM--ANYFFP--AEDLWLRDTSMTMWSSMFKKGNFVTRRFVFNASAINNLK  231

Query  755   EQLRLISHYR-PSRAEALIAVVWDAVIAANQKRH--KGRINLHVLTSILNLRNRMEPPFP  925
               +   SH + P++ E + + +W   IAA+++++    R +  +LT I+NLR R  P  P
Sbjct  232   -TMSTSSHIKHPTKVEVVSSFIWKCSIAASKQKNCSNKRHSNSILTHIVNLRKRAAPSLP  290

Query  926   ENCLGNNTYGATVHWNQPTEGNPSRHALAL-----KFRDAIRGVNDEAARRRYGKGGF--  1084
             EN LGN  + ++         N ++H + L     + R +I  ++D   +R     GF  
Sbjct  291   ENILGNLLWLSSAK-------NTAKHEMELPDLVNQVRKSISTIDDRYIKRLRSDEGFNL  343

Query  1085  LHTALPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRW--AVNAQVM--KDS  1252
             +  +L  + E+               +S      Y  DFG+GKP W  +++++ +   + 
Sbjct  344   MRKSLKEIGEVCSKGADHYGF-----TSWCKFGFYDIDFGFGKPIWISSISSRCLFFMNL  398

Query  1253  VVFMEGR-FGGVDLWMGLPEELMNIVMKNPQFVEFVS  1360
             ++ ME +   G++ W+ L EE MN+++ N + + F S
Sbjct  399   IILMETKCVDGIEAWVTLDEEEMNMIVGNQELLVFAS  435



>ref|XP_006430561.1| hypothetical protein CICLE_v10011733mg [Citrus clementina]
 gb|ESR43801.1| hypothetical protein CICLE_v10011733mg [Citrus clementina]
Length=441

 Score =   199 bits (506),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 141/464 (30%), Positives = 224/464 (48%), Gaps = 42/464 (9%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVDEL  223
             M++     + IKPSSPTP   RT+  S +DQL+       + FY +  SS       + L
Sbjct  1     MELRFSSIENIKPSSPTPDHQRTHKLSFIDQLNPGAYFSIILFYSAGASS-------ERL  53

Query  224   KKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAE-SLSSFLENPDFEMIREMV  400
             KKSLS+TL+  YP AG+ K D   ++C+D GV FIE       +S  ++     ++ +++
Sbjct  54    KKSLSETLTHFYPFAGQFK-DNHFVDCDDHGVTFIEAHFDRGDMSEVIQQAKTNILEQLI  112

Query  401   PCNPFTGA-FEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRG  577
             PC P      E N     L++QVN F CGG+++G+   H + D A+ + F  TW    RG
Sbjct  113   PCKPHESTRVEHN-----LIVQVNYFGCGGMAIGVCFHHKVADAATAANFLKTWGLHARG  167

Query  578   CAVVDDGGF---IFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQ  748
                 D   F   I+D++ IF P ++  D+     V  G        VV+RF      I  
Sbjct  168   AGAGDTNDFKHAIYDSNSIF-PAQDLPDMS----VNLGLGLFSLDSVVKRFTFEGEKIAS  222

Query  749   LREQLRLISH--YRPSRAEALIAVVWDAVIAA-----NQKRHKGRINLHVLTSIL--NLR  901
             LRE++        RPSR E + +V+  A++AA     +         L  +T+I+  NLR
Sbjct  223   LREKIVQAEPGLGRPSRVEVVSSVILGALLAAYGGSRDDDEEFTTAPLTHVTAIIAVNLR  282

Query  902   NRMEPPFPENCLGNNTYGATVHW----NQPTEGNPSRHALALKFRDAIRGVNDEAARRRY  1069
              RM PP PE   GN    A ++     +   E   +  +LA +   +IR V+D+  R+ Y
Sbjct  283   KRMNPPLPEESFGNICSAAFLNLPIDRDHDHEKKINHGSLAGQLHQSIRMVDDQFVRKLY  342

Query  1070  GKGGFLHTALPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKP-RWAVNAQVMK  1246
              +G  L+     + + ++ +GS K+      SS   M  Y ADFGWGKP    V  +  +
Sbjct  343   VEGEILN-----IRKAVEAQGSPKSNKVFVISSWCKMPFYEADFGWGKPVSIGVGTRFTE  397

Query  1247  DSVVFMEGRFGGVDLWMGLPEELMNIVMKNPQFVEFVSAGFSKS  1378
              +V+    +  G++ W+GL ++ M    ++P  +   S+   K+
Sbjct  398   AAVLVDSCQTDGIEAWVGLSKQDMARFEQHPGILAHTSSSTDKA  441



>ref|XP_008392421.1| PREDICTED: salutaridinol 7-O-acetyltransferase-like [Malus domestica]
Length=455

 Score =   199 bits (506),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 138/468 (29%), Positives = 217/468 (46%), Gaps = 58/468 (12%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQ-LSVNVKIPYVRFYDSPG----SSRDYN-  205
             MK+E+  R  I+PSSPTP   + +  S++DQ  S N+    + FY S      +  D+N 
Sbjct  5     MKVEIISRKTIRPSSPTPHHHKNFKLSLLDQRHSPNLYGNMIFFYSSTSNYDHTYGDFNP  64

Query  206   ---GVVDELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPD  376
                 +   L+KSLS+TL   YPLAGR+K D ++IECNDQGV F+E  +   L +FL  PD
Sbjct  65    HALKMSSHLQKSLSKTLVHFYPLAGRLK-DAATIECNDQGVYFVEARMDCHLLNFLSQPD  123

Query  377   FEMIREMVPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANT  556
               + +  +P    T + E   D  VL++Q+  F+CGGI++ + + H I D +S+  F  +
Sbjct  124   STLFQHFIP----TSSAE-KEDVIVLLVQLTVFNCGGIAIAVSLLHKIADASSLCTFVQS  178

Query  557   WARINRGCAVVDDGGFI------------FDASKIFPP----VKNTADLDQFARVARGAA  688
             W         +D   FI            F  S + PP    +  T D+           
Sbjct  179   W---TAASTALDQSEFIGHDQRLGQVLPLFIGSSLLPPSEMLITRTLDI----------P  225

Query  689   ESQEKYVVRRFYIPASAIDQLREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRIN  868
             +  + +  RRF    S +  L+ +  + ++  P+  E + AVV    IAA Q        
Sbjct  226   DPHQNFTTRRFVFSTSKMASLKAKAAITTN-NPTNVELVSAVVVKCAIAAAQSISTSSSR  284

Query  869   LHVLTSILNLRNRMEPPFPENCLGNNTYGATVHWNQPT---EGNPSRHALALKFRDAIRG  1039
               VL   +NLR RM  P P N +GN      + W  P    E +   H + +K R  +  
Sbjct  285   PSVLFHAMNLRKRMVSPLPXNTVGN------LVWAFPVLIEESDIKLHEVVVKLRKGLTD  338

Query  1040  VNDEAARRRYGKGGFLHTALPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPR  1219
               ++ A R  G+ GF   +     E+   E   + +     +SL    +Y  DFGWGKP 
Sbjct  339   FCNDKANRFKGEDGFAVVSEYHTKEV---EFISRGVNIFRCTSLCKFPIYDMDFGWGKPT  395

Query  1220  WAVNAQVMKDSVVFMEGRFG-GVDLWMGLPEELMNIVMKNPQFVEFVS  1360
             W   +   K+ +V ++ + G  ++ W+ L E+ M I  ++   + F S
Sbjct  396   WVATSMGFKNFIVLIDSKLGENIEAWVTLAEQEMAIFQRDEMLLSFAS  443



>ref|XP_011042323.1| PREDICTED: vinorine synthase-like [Populus euphratica]
Length=430

 Score =   198 bits (504),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 141/452 (31%), Positives = 227/452 (50%), Gaps = 39/452 (9%)
 Frame = +2

Query  38    ITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYN-GVV  214
             + ++IEV   +IIKPSSPTP  LR Y  S +DQ+S     P + FY + G  +  N   +
Sbjct  1     MKIEIEVISNEIIKPSSPTPDHLRHYQLSFLDQISPPTYNPMLLFYPADGDVKINNIEKL  60

Query  215   DELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIRE  394
             +++K+SLS+ L+L +PLAGRIK D   +ECND+G+ F + +V   L   +E+P+   + +
Sbjct  61    NQIKQSLSEVLNLYHPLAGRIK-DNLFVECNDEGIPFFQAEVKCRLPQVVEDPEPSELNK  119

Query  395   MVPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINR  574
             ++P      A + + +   L IQ N F CGGI +GL +SH +GD +S+  F   WA   R
Sbjct  120   LIPF-----ALD-DAEELPLGIQYNIFECGGIVIGLCISHKVGDASSLFTFIKYWAATAR  173

Query  575   GCA-VVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQL  751
             G A  +    FI  ++ +FPP+         +        ++E  V +RF   +S+I+ L
Sbjct  174   GEADHISRPEFI--SATLFPPI-------NISGFKPSTGITKEDVVTKRFVFRSSSIELL  224

Query  752   REQLRLIS-----HYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEP  916
             +E+    S        PSR EAL   +W    AA +   +    ++ +   +NLR RMEP
Sbjct  225   KEKCSTASGSLENQRPPSRVEALSVFIWQRFTAATKVESRPE-RIYSMVHAVNLRPRMEP  283

Query  917   PFPENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTA  1096
             P PE   GN  Y          +     + L  + RD+I  ++ E  ++   + G  H  
Sbjct  284   PLPEYSFGN--YYRIAFTIPSIDTGEENYNLVSQIRDSIGKIDKEYVKKL--QKGSQHLG  339

Query  1097  LPIMSEIIKHEGS---KKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQV-MKDSVVFM  1264
                    IK + +   K  +  L  +SL    +Y ADFGW KP W  +  +  K+ VVFM
Sbjct  340   F------IKEQAARFLKGEVVSLNFTSLCRFPLYEADFGWAKPIWVGSPSLTFKNLVVFM  393

Query  1265  EGRFG-GVDLWMGLPEELMNIVMKNPQFVEFV  1357
             +   G G++  + L EE M    ++ + ++++
Sbjct  394   DTASGDGIEALVHLKEEDMAKFQEDEELLQYI  425



>ref|XP_007018005.1| 3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase, putative [Theobroma 
cacao]
 gb|EOY15230.1| 3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase, putative [Theobroma 
cacao]
Length=459

 Score =   199 bits (506),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 149/460 (32%), Positives = 221/460 (48%), Gaps = 38/460 (8%)
 Frame = +2

Query  71    IIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVV-------DELKK  229
              IKP+SPTP  LRT+  S +DQ    + +P V FY +  +S     ++         LK+
Sbjct  12    FIKPASPTPHHLRTHRISFLDQFIPLIYVPMVFFYMNQETSIPLTDIIAFNSKRSQLLKQ  71

Query  230   SLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREMVPCN  409
             SLS+TL+L YP AGRIK D  SI+CND+G  ++E  V  SL+ FL +PD   I E++P  
Sbjct  72    SLSETLTLFYPFAGRIK-DCLSIDCNDEGAYYVEARVDWSLNEFLRHPDSSFIPELLPAE  130

Query  410   PFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRGCAVV  589
                 A   +  G V +IQV  F+CGGI +G  +SH I DG + + F   WA + R     
Sbjct  131   ASWTA--TSAGGYVAMIQVTNFACGGIVIGTFLSHMIADGPAATTFLRCWAAVTRKSGEE  188

Query  590   D-----DGGFIFDASKIFPPVKNTADLDQFARVAR-GAAESQEKYVVRRFYIPASAIDQL  751
                   D  F+F  S+ +P  K    L  F    + G   S      RR    ASAI  L
Sbjct  189   AAYPNFDASFVFPQSEAYP--KEATILALFTPFLKTGICWS------RRIVFDASAIASL  240

Query  752   REQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPFPEN  931
             + +    S   P+R EA+ A++   ++A  + +   +    V+   +NLR R  PP P+N
Sbjct  241   KAKTASSSVPDPTRVEAVSALLCKCLMATFKAKSDFQ-KPTVINHAVNLRRRAVPPVPKN  299

Query  932   CLGNNTYGAT-VHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTALPIM  1108
              +GN    AT +   + TE +     L    R  IR  + +  +   G+GG L     I 
Sbjct  300   SMGNFLCMATALVMGEETELDD----LVCHLRKEIRKADGDFVKSLQGEGGLLKFCEHIE  355

Query  1109  SEIIKHE-GSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAV------NAQVMKDSVVFME  1267
               + K   G+      +  +S     +Y  DFGWGKP W        +  V  ++VVFM+
Sbjct  356   EMMGKASYGAAGETDFIGFTSWCNFGLYEIDFGWGKPAWVTCTASNKSETVFSNTVVFMD  415

Query  1268  GRFG-GVDLWMGLPEELMNIVMKNPQFVEFVSAGFSKSKL  1384
              R G G++ W+ L E+ M  + +N + + F S   S S +
Sbjct  416   TRLGDGIEAWVFLDEQDMAKLEQNEELLAFGSLEASPSDV  455



>ref|XP_004135298.1| PREDICTED: vinorine synthase-like [Cucumis sativus]
 ref|XP_004164195.1| PREDICTED: vinorine synthase-like [Cucumis sativus]
 gb|KGN51706.1| hypothetical protein Csa_5G590720 [Cucumis sativus]
Length=438

 Score =   198 bits (504),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 135/455 (30%), Positives = 228/455 (50%), Gaps = 39/455 (9%)
 Frame = +2

Query  38    ITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVD  217
             + ++I++  ++IIKPSSPTP  LR Y  S +DQ++V+V  P V FY + GS+     + D
Sbjct  1     MAVQIDIVSKEIIKPSSPTPDHLRRYCLSFLDQVTVDVYNPMVYFYVA-GSATTPVEIAD  59

Query  218   ELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREM  397
              LKKSLS  L+  YPLAGR+  D   I+CND GV FIE  V   LS  +       + ++
Sbjct  60    RLKKSLSDFLTYYYPLAGRLNSDELFIDCNDDGVPFIETSVNCPLSDVMNTSFPSELNKL  119

Query  398   VPCNPFTGAFEPNP-DGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINR  574
             +P       FE +  D   + +Q+N F CGG++VG+ +SH I D  S  +  N WA   R
Sbjct  120   LP-------FELDKLDDVSMGVQLNVFECGGVAVGICVSHKISDALSFFIVVNEWAAYCR  172

Query  575   GCAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQLR  754
             G    +       ++++FPP K         +V         + V RR++I A+ ++ +R
Sbjct  173   GEK--EAVRVHLSSAEVFPPTK--------TKVHNTRTSIFRQRVGRRYHIDAANVETIR  222

Query  755   EQL----RLISHYRPSRAEALIAVVWDAVIAANQKRHKGRI---------NLHVLTSILN  895
              +      + +  RPSR EAL   ++   IAA +     R+          + ++   +N
Sbjct  223   AKYADCPAMENQRRPSRVEALSTFIYSRFIAAIKAVSNDRMENGSSDSEKKIFLVCHSVN  282

Query  896   LRNRMEPPFPENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGK  1075
             +R+R++PP P+   GN         ++    +   + L  + R+ I  +N +  +R    
Sbjct  283   IRSRLDPPVPDYAFGNYYRTTFAVPSEEVLNDEYCYDLVKQVREEIGKINKDYLKRLQDS  342

Query  1076  GGFLHTALPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVN-AQVMKDS  1252
               F+ +    M +      + + + C +T SL  M +Y  DFGWG+P W  + A + K+ 
Sbjct  343   SKFIES----MKKTASQFATGELISCSFT-SLCRMPIYDIDFGWGQPDWISSPALIFKNL  397

Query  1253  VVFMEGRFG-GVDLWMGLPEELMNIVMKNPQFVEF  1354
              VF++ + G GV++++ L EE M     + +F+++
Sbjct  398   FVFIDKKDGDGVEIYVHLTEEHMKKFEADEEFLKY  432



>ref|XP_009371390.1| PREDICTED: vinorine synthase-like [Pyrus x bretschneideri]
Length=450

 Score =   199 bits (505),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 141/458 (31%), Positives = 218/458 (48%), Gaps = 42/458 (9%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVDE-  220
             MK+EV  ++ I+PSSPTP  L+T N S+ DQL  ++ +P++ FY  P ++ D+  +  E 
Sbjct  5     MKVEVIHKEAIRPSSPTPHYLKTTNLSVFDQLIPDIYVPFLLFY--PNNNTDHRSLAAER  62

Query  221   ---LKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIR  391
                LK SLS+ L+  YP AG+   +  SI CND GV F+E  V   +S  L+  D  M++
Sbjct  63    SKILKTSLSEILTHFYPFAGKFHYN-DSICCNDHGVAFLEAQVNCPISKILDKADIGMVK  121

Query  392   EMVPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARI-  568
             +++P +    A      G +L++Q N F CGG+++G+ ++H + D ++IS F   WA I 
Sbjct  122   QLLPAD---MASRQAVTGYLLLVQANFFECGGMAIGVSIAHKVADASTISTFIKRWAEIA  178

Query  569   -------NRGCAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAE-SQEKYVVRRFY  724
                    N  C  V    F   AS +FPP              +   E  +EKY+ R + 
Sbjct  179   LDSTSRPNTDCEAVLPAEFGVAAS-LFPP-------QDILNAPQPTLEFPKEKYITRTYL  230

Query  725   IPASAIDQLREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRN  904
               AS I  L+ +    +  +P+R E + A++W   + A++ +  G I        +N+RN
Sbjct  231   FDASKIAALKSKSASATVPKPTRIEVVSALIWKCAMEASKSKF-GSIRPSAWCHAVNMRN  289

Query  905   RMEPPFPENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGF  1084
              +  P  EN LGN          +    +    +L  K R  I     + A    G    
Sbjct  290   VLVRPSAENLLGNLVGKFIARAGESEVVDLDLQSLVGKLRKGIEEFKVKYANNVTGDA--  347

Query  1085  LHTALPIMSEIIKHEGSKKNM--YCLYT-SSLLGMQVYAADFGWGKPRWAVNAQVMKDSV  1255
                      E +K  G    M    +YT SS      YAADFGWGKP W   +   K+ +
Sbjct  348   --------CESLKEYGDLLQMDDIEIYTCSSWCRFPFYAADFGWGKPSWVNQSLEGKNLI  399

Query  1256  VFMEGRFG-GVDLWMGLPEELMNIVMKNPQFVEFVSAG  1366
             V M+ R G GV++ +   EE M I+  N + + + S G
Sbjct  400   VLMDVRDGDGVEVSLTFNEEDMAIIESNKKLLAYASLG  437



>ref|XP_006342247.1| PREDICTED: salutaridinol 7-O-acetyltransferase-like [Solanum 
tuberosum]
Length=435

 Score =   198 bits (504),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 140/449 (31%), Positives = 225/449 (50%), Gaps = 37/449 (8%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSS--RDYNGVVD  217
             MK++V  R+ I+PSSPTP  L+ +N  ++DQL      P V FY +      R+ + +  
Sbjct  2     MKVQVISRENIQPSSPTPNHLKKFNLCLLDQLIPAPYAPIVLFYPNLNDVKLREKSSL--  59

Query  218   ELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREM  397
              LKKSL+QTLS  YPLAGR K D  SI+CNDQGV ++  +V   L  +L  P+ E I + 
Sbjct  60    -LKKSLAQTLSSFYPLAGRFK-DELSIDCNDQGVNYVTTNVNCHLIDYLNEPNLESIGQF  117

Query  398   VPCNPFTGAFEPNPDGRVLV-IQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINR  574
             +PC P    F+    G  +  IQ+N F CGGI++GL ++H + DGA +S F   W+ +  
Sbjct  118   LPCQP---PFKVLGVGDYVTNIQINVFECGGIAIGLCIAHKVLDGAGLSTFLKNWSGLVT  174

Query  575   GCAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQLR  754
                ++    + F    ++  +++T+     +   +G       +V +RF    S ID L+
Sbjct  175   CPNLM--ANYFFPCDDLW--LRDTSMTMWSSMFKKG------NFVTKRFVFNDSVIDNLK  224

Query  755   EQLRLISHYR-PSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPFPEN  931
              ++   +H + P++ E + + +W  +IA+N+K +       +LT I+NLR R  P  PEN
Sbjct  225   -RMSTSAHIKYPTKVEVVSSFIWKCLIASNKKSNS------LLTHIVNLRKRAAPALPEN  277

Query  932   CLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTALPIMS  1111
              LGN  + ++   N   + +     L  + R +I  ++D   +R  G  G        + 
Sbjct  278   ILGNLIWLSSAKNNNTAKSDVVLSDLVNQVRRSILRIDDCFVKRLRGDEG-CSLMRKSLK  336

Query  1112  EIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRW----AVNAQVMKDSVVFMEGRF-  1276
             EI        N Y    SS      Y  DFG+GKP W    +       + ++ ME    
Sbjct  337   EIGDFCSKGANHYGF--SSWCKFGFYDIDFGFGKPIWVSSISSKCSFFMNLIILMESSRC  394

Query  1277  -GGVDLWMGLPEELMNIVMKNPQFVEFVS  1360
               G++ W+ L EE MN+++ N + + F S
Sbjct  395   DNGIEAWVTLDEEEMNMLVSNQELLVFAS  423



>ref|XP_011041291.1| PREDICTED: vinorine synthase-like [Populus euphratica]
Length=463

 Score =   199 bits (505),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 140/449 (31%), Positives = 219/449 (49%), Gaps = 29/449 (6%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFY----DSPGSSRDYNGV  211
             M++++  +  +KPSSPTP  LR +  S++DQL      P + FY     +  S  D    
Sbjct  1     MEVQIISKQNVKPSSPTPSPLRNFKLSLLDQLVTVPYAPILLFYPMNKKASTSYLDVPKR  60

Query  212   VDELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIR  391
             ++ LKKSLS+TL+  YPLAG+IK D  SI+CND+G   +E  V   L  FL  PD  +  
Sbjct  61    LELLKKSLSETLTQFYPLAGKIK-DELSIDCNDEGAYDVETQVNCHLCEFLRQPDLLLAN  119

Query  392   EMVPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARIN  571
             +  PC       E      V   QVN F CGGI +G+ +SH + DGA++S F   W+   
Sbjct  120   QFFPCELLPT--ESTAVTYVANFQVNVFECGGIVIGMCISHRVVDGAALSTFLKAWSATA  177

Query  572   RGC--AVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAID  745
             +G   A++      F AS +FP   N   L   A V  G+   + + + +RF   ASAI 
Sbjct  178   KGSKEAIIYPE---FIASSLFP--ANDLWLRDSAIVMFGSLLKKGQCMTKRFVFDASAIS  232

Query  746   QLREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPFP  925
              L+ Q  ++    P+R E + + +W  ++AA+++  +G     +LT  +NLR +MEP   
Sbjct  233   NLKAQAAILGLKCPTRVEVVSSFLWKCLMAASEE-WRGSQRPSLLTHYVNLRRKMEPKLS  291

Query  926   ENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTALPI  1105
              N +GN  + A   +   ++  P    L  + R AI  ++ +      G  G       +
Sbjct  292   GNSMGNFLWLAAAKYTNKSK--PGLKDLVGEMRKAISKIDSDFVEHIKGDKGN-----AL  344

Query  1106  MSEIIK---HEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRW----AVNAQVMKDSVVFM  1264
             M E +K     GS   +  L  SS      Y  DFGWGKP W     ++  +  + V  +
Sbjct  345   MDESLKGIGAFGSGDGVDYLGFSSWCKFGFYDTDFGWGKPVWVSSFGLSCSLTMNLVFLV  404

Query  1265  EGRFGGVDLWMGLPEELMNIVMKNPQFVE  1351
             + R  G++ ++ L E+ M I+  N +  +
Sbjct  405   DTRCDGIEAFVTLNEKDMTILEGNLELFD  433



>ref|XP_002514981.1| Salutaridinol 7-O-acetyltransferase, putative [Ricinus communis]
 gb|EEF47535.1| Salutaridinol 7-O-acetyltransferase, putative [Ricinus communis]
Length=430

 Score =   198 bits (503),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 147/444 (33%), Positives = 218/444 (49%), Gaps = 44/444 (10%)
 Frame = +2

Query  77    KPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGV-VDELKKSLSQTLSL  253
             KPSSPTP  LR Y  S +DQ+S  V  P + FY + G  +  N    D+LK+SLSQ L+ 
Sbjct  14    KPSSPTPDHLRHYKLSFLDQISPPVYNPLLLFYPTDGRVKSNNAQKYDQLKQSLSQVLTY  73

Query  254   MYPLAGRIKEDRSSIECNDQGVEFIEGD-VAESLSSFLENPDFEMIREMVPCNPFTGAFE  430
              YPLAGRIK D + ++CND+GV F++   +A  LS  + NP     R+++P       FE
Sbjct  74    YYPLAGRIK-DNNLVDCNDEGVPFLQAQAIACRLSDAVNNPMPTEFRKLLP-------FE  125

Query  431   PN-PDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRGCAVVDDGGFI  607
              + P      IQ+N F CGGI +   +SH I D  S  VF  TWA I RG    D     
Sbjct  126   LDEPQEFAFGIQLNIFDCGGICIAFCLSHKIADALSTLVFLKTWAAITRG-ETDDIVCPE  184

Query  608   FDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQLREQLRLIS----  775
             F ++ +FPP KN +  +    +      ++E  V +RF    S+I+ L E+    +    
Sbjct  185   FISATLFPP-KNLSGFNPAIGI------TKENVVTKRFVFRLSSIESLIEKYSTSTTSIE  237

Query  776   ---HYRPSRAEALIAVVWDAVIAANQ-KRHKGRINLHVLTSILNLRNRMEPPFPENCLGN  943
                   PSR EAL   +W   +AA + +   GR+  +++   +NLR RM P  PE+  GN
Sbjct  238   NQQQKSPSRIEALSVFIWSRFMAATKVESEPGRV--YLMLHAVNLRTRMNPQLPEHSFGN  295

Query  944   NTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTALPIMSEIIK  1123
                 A    +  TE     + L  + RD+I  ++ +  ++       LH         IK
Sbjct  296   YYRVAITIPSSDTEEE--SYNLVRRMRDSISKIDKDYVKKLQDGNEHLH--------FIK  345

Query  1124  HEG---SKKNMYCLYTSSLLGMQVYAADFGWGKPRWA-VNAQVMKDSVVFMEGRFG-GVD  1288
                   ++  M  L  +SL    +Y ADFGW KP WA   +   K+ VVFM+   G G++
Sbjct  346   ERAESFTRGEMATLNFTSLCRFPLYEADFGWSKPIWAGAPSLTFKNLVVFMDTVSGDGIE  405

Query  1289  LWMGLPEELMNIVMKNPQFVEFVS  1360
               + L EE M    ++ + ++F +
Sbjct  406   ALIHLKEEDMAKFQEDQELLQFAT  429



>ref|XP_011071305.1| PREDICTED: vinorine synthase-like [Sesamum indicum]
Length=412

 Score =   197 bits (502),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 140/391 (36%), Positives = 202/391 (52%), Gaps = 26/391 (7%)
 Frame = +2

Query  38    ITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVD  217
             + ++IE+  ++IIKPSSPTP+SLR Y  S +DQ++  + +P V FY +     ++ G  +
Sbjct  1     MEIEIEMISQEIIKPSSPTPESLRKYQLSFLDQIAPPIFMPVVYFYQADAKFSNH-GKSN  59

Query  218   ELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREM  397
              LKKSLSQ LS  YPLAGR+  D   ++CND+G  ++E     SLS  L NP  + + + 
Sbjct  60    NLKKSLSQVLSRFYPLAGRLV-DNLYVDCNDEGSPYVEAVANCSLSQVLTNPVVKNMDKF  118

Query  398   VPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRG  577
             +P        + +     + +QV  F CGG +VGL++SH I D  S  + ANTWA + R 
Sbjct  119   LPYK-----VDDDVQNLCVAVQVTFFQCGGTAVGLVISHKIADALSSFLVANTWAAVARH  173

Query  578   CAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQLRE  757
                 D  G  F+  KIFPP ++TA       + +      E+ V + F  P S I  L+E
Sbjct  174   GNYDDVPGPKFEGDKIFPP-RDTAGFKPSTGILK------EELVTKIFTFPNSKISALQE  226

Query  758   QLR-LISHYRPSRAEALIAVVWDAVIAANQ-KRHKGRINLHVLTSILNLRNRMEPPFPEN  931
             +     +  RPSR EAL A +W   I+A + K H  +I  + +   +NLR R++PP  E 
Sbjct  227   RYYGGAAQRRPSRVEALSAFIWTRFISAMEMKAHPNKI--YTVLHAVNLRPRLDPPLSEY  284

Query  932   CLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTALPIMS  1111
               GN    A     +PT G  S   L  K R+AIR VN E   +       L+     M+
Sbjct  285   HFGNIFRLAIA---RPTVGADSGSELLQKVREAIRAVNREYVAQLQQGDKHLNFLKERMA  341

Query  1112  EIIKHEGSKKNMYCLYTSSLLGMQVYAADFG  1204
             + IK E    N      +SL G  +Y ADFG
Sbjct  342   QAIKGELVTFNF-----TSLCGYPLYKADFG  367



>ref|XP_004301957.1| PREDICTED: BAHD acyltransferase At5g47980-like [Fragaria vesca 
subsp. vesca]
Length=452

 Score =   198 bits (504),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 144/459 (31%), Positives = 216/459 (47%), Gaps = 33/459 (7%)
 Frame = +2

Query  38    ITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFY-------DSPGSSR  196
             + +K+EV  ++ I PSSPTP  LR ++ S+ DQL+  V  P + FY       D   +S 
Sbjct  3     LEVKVEVLHKENISPSSPTPHPLRFFSLSVFDQLTPTVYFPLLLFYPNTVQPRDRELNSI  62

Query  197   DYNGVVDE----LKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFL  364
             D   +V E    LK SLS+TL+  YP AGRI  D +SI CNDQG  F+E  V  S+S  L
Sbjct  63    DPQSLVVERTKLLKTSLSETLTRFYPFAGRI-HDHASICCNDQGAVFVEAKVKCSISRVL  121

Query  365   ENPDFEMIREMVPCNPFTGAFEPNPDGRVLV-IQVNRFSCGGISVGLIMSHAIGDGASIS  541
             E PD E + E++P    T   E    G VL+ +QVN F CGGI++G  +SH + D  ++S
Sbjct  122   EEPDLEFLTELIPKLESTDEGE---TGYVLLNVQVNFFECGGIAIGFNVSHKMIDAFTLS  178

Query  542   VFANTWARINRGCAVVDDGGF----IFDASKIFPPVKNTADLDQFARVARGAAESQEKYV  709
              F N+WA  + G    D   F       A+  FPP+       QF ++A+      EK +
Sbjct  179   TFVNSWAATSLGFGTSDHTVFPSHQYVGAASRFPPLDLFKSPPQFGKLAK------EKCI  232

Query  710   VRRFYIPASAIDQLREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSI  889
              +RF   +S I  L+ +    +   P+R E + A++W   + A+               I
Sbjct  233   TKRFVFESSKIAYLKSEAASDAVPNPTRVEVVSALIWKTAMKASSANSDSVRPSSTWLQI  292

Query  890   LNLRNRMEPPFPENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRY  1069
             +N+RN +  P  +N +GN             E       L    R        E  + +Y
Sbjct  293   VNMRNILAQPSGKNLMGNLLGFFAARSTGGGESKDDLQGLVAAMRKGF-----EEFKVKY  347

Query  1070  GKGGFLHTALPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQV-MK  1246
             G        +  +    + +  K ++ C  ++S        ADFGWGKP  +V A V +K
Sbjct  348   GTKFVSGEDVSKLMNEYREQMQKDDIECYCSTSWCRFPFCEADFGWGKPLMSVPATVELK  407

Query  1247  DSVVFME-GRFGGVDLWMGLPEELMNIVMKNPQFVEFVS  1360
             + ++ M+    GGV+  + L EE M    KN + + F S
Sbjct  408   NLIMLMDTSDGGGVEARLTLKEEDMAKFEKNEELLAFAS  446



>ref|XP_003538872.1| PREDICTED: vinorine synthase-like [Glycine max]
 gb|KHN41919.1| Vinorine synthase [Glycine soja]
Length=433

 Score =   197 bits (502),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 137/436 (31%), Positives = 216/436 (50%), Gaps = 31/436 (7%)
 Frame = +2

Query  38    ITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVD  217
             + +++EV  ++++KPSSPTP  LR YN S++D L+  +    V F+ +   S  +     
Sbjct  1     MKVEVEVISKELVKPSSPTPNHLRHYNLSLLDHLTPQLNNSMVYFFAANNVSNQFLNTCT  60

Query  218   E-----LKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFE  382
             E     LKKSLS+ L+  YPLAGR+  D++ IECND+G  ++E  V   L+  +E+P   
Sbjct  61    ENASNHLKKSLSEALTHYYPLAGRLV-DKAFIECNDEGALYLEAKVRCKLNDVVESPIPN  119

Query  383   MIREMVPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWA  562
              +  ++P         P      L +Q+N F CGGI++G  MSH I D  S  VF  TWA
Sbjct  120   EVTNLLPFGMDDIVDTP------LGVQLNVFECGGIAIGACMSHKIADAMSFFVFIQTWA  173

Query  563   RINRGCAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAI  742
              I R    +      F ++ +FPP ++    D    +      ++   V R F   AS I
Sbjct  174   AIARDYNEIKTH---FVSASLFPP-RDIPWYDPNKTI------TKPNTVSRIFVFDASVI  223

Query  743   DQLREQL--RLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEP  916
             D L+ +   ++     PSR EAL   +W   +A+ Q         +V+   +NLR+RM+P
Sbjct  224   DGLKAKYAEKMALQKPPSRVEALSTFIWTRFMASTQVAASESSKFYVVAHTVNLRSRMDP  283

Query  917   PFPENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTA  1096
             P P +  GN  Y   V      +     + L  K R+ IR +++E   +      +L + 
Sbjct  284   PLPAHAFGN--YYRAVKAFPSLDDKGECYELVEKLREEIRKIDNEYILKLQEGSEYLSS-  340

Query  1097  LPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAV-NAQVMKDSVVFMEGR  1273
               +  ++ + E  K  +     ++L    VY ADFGWGKP WA   A  +K+ VVF + +
Sbjct  341   --LREDLRRFENIKGEIVPFTFTALCRFPVYDADFGWGKPIWACPPAWKVKNVVVFTDTK  398

Query  1274  F-GGVDLWMGLPEELM  1318
             F GG++  + + EE M
Sbjct  399   FGGGIEAHISMMEEDM  414



>ref|XP_007018014.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
 gb|EOY15239.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
Length=648

 Score =   202 bits (514),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 147/446 (33%), Positives = 224/446 (50%), Gaps = 28/446 (6%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFY--DSPGSSRDYNGVVD  217
             M++E+     IKPSS TPQ L+ +  S++DQ   +   P + FY  D   S  +    ++
Sbjct  202   MEVEIISTQHIKPSSLTPQHLKIFKLSLLDQFIPSPYAPIILFYPTDESTSHLEIPRRLE  261

Query  218   ELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREM  397
              LKKSLS TL+  YPLAG+I+ D S IEC+DQG  ++E  V   L+ FL  PD   +   
Sbjct  262   LLKKSLSNTLTSFYPLAGKIRNDLS-IECSDQGAYYVEAGVNCRLNEFLNQPDLLFLPRF  320

Query  398   VPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRG  577
             +P        EP     V  IQVN F CGGI++G+ +SH I DGA++S F   W    RG
Sbjct  321   LPREFILD--EPTAGTYVTNIQVNMFECGGIAIGICISHKILDGAALSTFLKAWTATARG  378

Query  578   CAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQLRE  757
             C       FI  A+ +FP   +   L   + V  G+   + K + RR     S+I  L+ 
Sbjct  379   CKEAIYPNFI--ATSLFP--TDDLWLRDSSLVMWGSLFRKGKSITRRMIFGTSSIAALKA  434

Query  758   QLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPFPENCL  937
             Q  +     P+R EA+ A +W   + A++ ++ G     +LT ++NLR RM  P  EN  
Sbjct  435   QATIPGRQCPTRVEAVSAFLWKCTMDASKGKN-GFQRPSLLTHLVNLRRRMVQP-TENST  492

Query  938   GNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTALPIMSEI  1117
             GN  + A+       E       L  + R+AI  V+ +  ++     G       +M E 
Sbjct  493   GNLLWIASA--KSKVENKSDLPDLVGRVREAISRVDGDFLKKLGDDKG-----KSLMCET  545

Query  1118  IKHEG---SKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQVMKDSV-----VFMEGR  1273
             ++  G   SK+ +     SS      Y ADFGWGKP W V++  M++SV     + ++ R
Sbjct  546   LREIGDLVSKEGLDHFGFSSWCKFGFYEADFGWGKPAW-VSSFGMENSVYMNLIILVDTR  604

Query  1274  FG-GVDLWMGLPEELMNIVMKNPQFV  1348
             FG G++ W+ L E+ M I+ ++ + +
Sbjct  605   FGDGIEAWVTLDEQDMAILERDEELL  630



>gb|KCW86592.1| hypothetical protein EUGRSUZ_B03224, partial [Eucalyptus grandis]
Length=423

 Score =   197 bits (501),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 142/451 (31%), Positives = 224/451 (50%), Gaps = 40/451 (9%)
 Frame = +2

Query  38    ITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYN--GV  211
             + + +E+  R+ +KPSSPTP  LR Y  S +DQ+S  V  P+V FY        +N   +
Sbjct  1     MEIAVEITSRETVKPSSPTPDHLRHYRLSFLDQISPPVYNPFVLFYTPQNEDDQFNIDDI  60

Query  212   VDELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIR  391
               +LK SLS  L+  YPLAGR+K +  SIEC+D GV + E  V   +S   ENPD + + 
Sbjct  61    SSKLKASLSCILTHFYPLAGRLKGN-VSIECDDVGVPYSEAIVKCQVSDVTENPDPQELG  119

Query  392   EMVPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARIN  571
             +++P   F        D   L +Q N+F CGGI+VG+ MSH I D  S+  F   WA + 
Sbjct  120   KLLP---FVLDVS---DETTLGVQFNKFDCGGIAVGICMSHKISDALSLLTFIKMWAAVC  173

Query  572   RGCAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQL  751
             RG  +V    F   ++++FPP KN +  +    + R      +  V +RF    + I+ L
Sbjct  174   RGEEIVTPPQFA--SAELFPP-KNISGFEPRTGITR------DNIVSKRFIFKTNKIETL  224

Query  752   R----EQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPP  919
             +    +++ L  +  PSR EAL   +W +  A + + +       ++   +NLR + +PP
Sbjct  225   KARYSKEMDLGQNRPPSRVEALSTFIW-SRFAWSTRVYSEPSKKCIILHAVNLRTKFDPP  283

Query  920   FPENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARR-RYGKGGFLHTA  1096
              P++  G N Y   V   Q   G    + LA K R+ +RG++     + R GK       
Sbjct  284   LPQHSFG-NFYRVAVTSLQLDSGKEC-YGLAAKMRETVRGIDKGYVEKLRDGKEHL----  337

Query  1097  LPIMSEIIKHEGS---KKNMYCLYTSSLLGMQVYAADFGWGKPRWAVN-AQVMKDSVVFM  1264
                  + IK       K  +  +  +SL    +Y +DFGW  P W  + A   ++ VVFM
Sbjct  338   -----DFIKRSAEVYLKGELLAMNFTSLCRFPMYESDFGWDNPTWVGSPALTFQNLVVFM  392

Query  1265  EGRFG-GVDLWMGLPEELMNIVMKNPQFVEF  1354
             + + G GV+ ++ L  E M  +  + +F+EF
Sbjct  393   DTKSGDGVEAYISLRVEDMAALESDEEFMEF  423



>ref|XP_008372859.1| PREDICTED: BAHD acyltransferase At5g47980-like [Malus domestica]
Length=450

 Score =   198 bits (503),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 135/457 (30%), Positives = 226/457 (49%), Gaps = 37/457 (8%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFY-----DSPGSSRDYNG  208
             +K+E+  R  IKPS+ TP  LR+Y  S +DQ+++ +  P + FY      S  S+R +  
Sbjct  5     IKVEIIERQTIKPSTSTPHHLRSYELSFLDQMAIVIYTPLLLFYPITSTTSKVSTRHHAM  64

Query  209   VVDE----LKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPD  376
              +DE    L +SL++TL+  YPLAGRI +  + +EC D G  FI   ++  LS  LENPD
Sbjct  65    SIDEKCRHLIESLAKTLTHFYPLAGRIVKG-NIVECTDDGAAFITARISCCLSDILENPD  123

Query  377   FEMIREMVPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANT  556
              ++++  +P    +   +    G +L++QVN F CGG+++GL +SH I D +++  F N 
Sbjct  124   GQILKRFLPIEIES---KEAGTGWLLLVQVNLFECGGMAIGLSISHRIADASTLCTFINC  180

Query  557   WARINRGCAVVDDGGFI--FDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIP  730
             WA I  G +  D    +  F A+ +F P++ ++     AR        +EK + +R+   
Sbjct  181   WATIALGSSDSDQVLNLPEFGAASVFKPIEFSSSSQPPAREV-----VKEKCITQRYVFD  235

Query  731   ASAIDQLREQLRLISHYRPSRAEALIAVVWDAVIAANQK--RHKGRINLHVLTSILNLRN  904
             A  I  L+ ++      +P+R EA+ A++W     A++   R +G          +NLR 
Sbjct  236   APKISTLQSEVASSVVAKPTRVEAVSALIWKCATEASRSNLRKQGP---SFFRQDVNLRK  292

Query  905   RMEPPFPENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGF  1084
             R+  P PEN L  N  G+            +   L  K R+ I G+ ++ A +       
Sbjct  293   RVVXPLPEN-LAGNVVGSFTSRADEESSVINLKDLVAKLREGIEGLKEKYAAK------L  345

Query  1085  LHTALPIMSEIIKHEGSKK---NMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQV-MKDS  1252
             +  +     EI   +   K   NM     +S     +Y ADFGWG+P W   A + +K+ 
Sbjct  346   VFDSDEAWQEIKDKQNKPKTHDNMEIYSCTSWCRFPLYEADFGWGRPSWVSVASIAIKNI  405

Query  1253  VVFMEGR-FGGVDLWMGLPEELMNIVMKNPQFVEFVS  1360
             +V M+ R   G++ W+ + EE   +   N + + + S
Sbjct  406   IVLMDKRDCSGIEAWVTMSEESKALFESNVELLGYAS  442



>ref|XP_006598680.1| PREDICTED: uncharacterized protein LOC100305374 isoform X1 [Glycine 
max]
Length=455

 Score =   198 bits (503),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 140/455 (31%), Positives = 225/455 (49%), Gaps = 31/455 (7%)
 Frame = +2

Query  38    ITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVV-  214
             + +++E+  R+ I+PSSPTP  LR +N S++D L  +   P + +Y SP S +     V 
Sbjct  1     MKVEVEIISREDIRPSSPTPSHLRVFNLSLLDHLIPSPYAPIILYYTSPNSDKTCFSEVP  60

Query  215   ---DELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEM  385
                + LKKSLS+TL+  YPL G+IKE   SIECND+G  F++  V   L  FL  P   +
Sbjct  61    KRLELLKKSLSETLTQFYPLGGKIKELDFSIECNDEGANFVQAKVKCPLDKFLVQPQLTL  120

Query  386   IREMVPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWAR  565
             + + +P +  +     N    V  IQVN F CGGI++GL +SH I DGA++S F   W+ 
Sbjct  121   LHKFLPTDLVSEG--SNSGTYVTNIQVNIFECGGIAIGLCISHRILDGAALSTFIKGWSE  178

Query  566   INRG--CAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASA  739
               +G  C  +    FI   S +F P  N   L   +    G+   Q K+V +RF    S 
Sbjct  179   RAKGFNCDQLTKPNFI--GSALF-PTNNNPWLRDLSMRMWGSFFKQGKWVTKRFLFRNSD  235

Query  740   IDQLREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPP  919
             I +L+ Q   +     +R E + +++W +++  ++ R  G     ++T ++NLR RM+  
Sbjct  236   IAKLKAQ--TLGTATSTRLEIVSSMLWKSLMGVSKVRF-GTQRPSLVTHLVNLRRRMDEA  292

Query  920   F-PENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGG--FLH  1090
               P++ +GN  +                  L  K R +I  V+++      G  G   + 
Sbjct  293   LCPQHAMGNLLWLVAAEKMCDDHDEMGLEDLVGKLRKSISQVDEKFVEELRGDKGRSIMK  352

Query  1091  TALPIMSEIIKHEGSKKNM--YCLYTSSLLGMQVYAADFGWGKPRWAV------NAQVMK  1246
              +L  +SE    +GSK  +  Y  + SS      Y ADFGWGKP W        +  +  
Sbjct  353   ESLGAISE----KGSKGEVVDYVGF-SSWCNFGYYEADFGWGKPTWVSGVGSIGSVSMFM  407

Query  1247  DSVVFMEGRFG-GVDLWMGLPEELMNIVMKNPQFV  1348
             + ++ ++ R G G++ W+ L EE M  +  N + +
Sbjct  408   NLIILVDTRLGDGIEAWVTLDEEDMTHLEANTELL  442



>gb|KDO36951.1| hypothetical protein CISIN_1g045540mg [Citrus sinensis]
Length=428

 Score =   197 bits (501),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 142/446 (32%), Positives = 222/446 (50%), Gaps = 34/446 (8%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVDEL  223
             M +EV  ++ IKPS+PTP+  + Y FS  DQ+S +  IP + FY+        N +  +L
Sbjct  1     MDVEVISKETIKPSTPTPKHRQIYKFSFTDQISPSFYIPLIYFYNLNDHKLGNNIISGDL  60

Query  224   KKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREMVP  403
             KKSLS+ L+  YPLAG + +D   ++CND+GV F+E  V  +LS  +  P+   + + +P
Sbjct  61    KKSLSKVLTHYYPLAGCLNDDY--VDCNDKGVLFLEAKVKCNLSQIIGEPNPRKLNKFLP  118

Query  404   CNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRGCA  583
                       +    +L IQVN F+CG I++G  +SH I D ++   F   WA       
Sbjct  119   ---------DHVKNFILAIQVNFFNCGNIAIGACVSHKIADASTFITFIKNWAAAASFGG  169

Query  584   VVDDGGFIFDASKIFPPVKNTA-----DLDQFARVARGAAESQEKYVVRRFYIPASAIDQ  748
                D     D+ KI P + +       D+ +  RV+  A   ++  V + F    S I  
Sbjct  170   GGGD-----DSVKICPELLSATLFPPRDVGESCRVSLPA---EKNIVCKSFVFRGSRIAA  221

Query  749   LREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPFPE  928
             L+E+     H  P+R EAL A +W +  AA+ +   G   + +L   +NLR RM+PP P+
Sbjct  222   LKEKYAGGIH--PTRVEALSAFIW-SRFAASTEIKIGPERVSMLVHAVNLRKRMDPPQPD  278

Query  929   NCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTALPIM  1108
             +  GN + G T        G    + L   FRDAI  +N + A ++  +G F H  L  +
Sbjct  279   DSFGNIS-GPTATIISEDIGEEC-YGLVKMFRDAIGKINKDYA-KKLQEGVFEHFGL--L  333

Query  1109  SEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRW-AVNAQVMKDSVVFMEGRFG-G  1282
               I      ++ +   Y +SL    +Y ADFGWGKP W A      ++  V M+ + G G
Sbjct  334   GSINDDGFDRREVVNFYYTSLCRFPLYEADFGWGKPIWVAWGGWPYRNIAVLMDTKCGNG  393

Query  1283  VDLWMGLPEELMNIVMKNPQFVEFVS  1360
             ++ W+ L EE M     + +F+ +VS
Sbjct  394   IEAWIHLKEEDMVKFEADKEFLSYVS  419



>ref|XP_011071306.1| PREDICTED: vinorine synthase-like [Sesamum indicum]
Length=439

 Score =   197 bits (501),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 139/448 (31%), Positives = 219/448 (49%), Gaps = 28/448 (6%)
 Frame = +2

Query  38    ITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVD  217
             + ++IEV  ++IIKPSSPTP+SLR +  S +DQ++    +P + FY +     +     +
Sbjct  1     MEIEIEVISKEIIKPSSPTPESLRKHQLSFLDQIAPPAFMPVLYFYQADAKFSNLKKS-N  59

Query  218   ELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREM  397
              LKKSLSQ LS  YPLAGR+ +D   ++CND+G  ++E     +LS  + NP  + + + 
Sbjct  60    NLKKSLSQVLSRFYPLAGRLVDDLY-VDCNDEGAPYVEAVANCTLSQIITNPVMKNMDKF  118

Query  398   VPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRG  577
             +P        +       + +QV  F CGG +VGL++SH I DG+S    ANTWA + R 
Sbjct  119   LPYK-----VDEYVQNLCMAVQVTYFQCGGTAVGLVISHKIADGSSFVPVANTWAAVARN  173

Query  578   CAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQLRE  757
                 D     F+ +KIFPP   T       +        +E  + + F  PAS I  L+E
Sbjct  174   GNYDDVPAPKFEGAKIFPPQDATG-----FKPPSSTGIVKEAVITKIFTFPASKISALQE  228

Query  758   QLRL----ISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPFP  925
             +            PSR EAL A +W   ++A + +      ++ +   +NLR R+ PP  
Sbjct  229   RYSSGAAEFLQRPPSRVEALSAFIWTRFVSATEMKANPN-KIYTVRHTVNLRPRLNPPLS  287

Query  926   ENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTALPI  1105
             +   GN  + A      P+ G      +  K ++AIR VN E   +    G  L+     
Sbjct  288   DYHFGNIFWVAVA---MPSVGANCGVEVMQKVKEAIRAVNGENVAQLLQGGETLN----F  340

Query  1106  MSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQVM--KDSVVFMEGRFG  1279
             + E + +    + +   +T SL    +Y ADFGWGKP W V    +  K+ VV ++   G
Sbjct  341   LKEKMAYANRGELVRFTFT-SLHKFPLYKADFGWGKPVWVVTLAGLLDKNLVVLVDTATG  399

Query  1280  -GVDLWMGLPEELMNIVMKNPQFVEFVS  1360
              G++  + L +E M     + +  EF+S
Sbjct  400   DGIEARINLSKEDMEKFEADLELQEFLS  427



>ref|XP_003521961.1| PREDICTED: vinorine synthase-like [Glycine max]
 gb|KHN35623.1| Vinorine synthase [Glycine soja]
Length=433

 Score =   197 bits (501),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 129/449 (29%), Positives = 231/449 (51%), Gaps = 27/449 (6%)
 Frame = +2

Query  38    ITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVD  217
             + +K+E+  +D IKPSSPTP  L+ +  S++DQL+    +P + FY    S  D+  +  
Sbjct  1     MAVKVEIVSKDTIKPSSPTPNHLQHFKLSLLDQLAPPFYVPILLFYSF--SDDDFKTISH  58

Query  218   ELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREM  397
             +LK SLSQ L+L +P  G ++ + S++ECND+G+ + E  V+  LS+ ++NP    I E+
Sbjct  59    KLKASLSQVLTLYHPFCGTLRGN-SAVECNDEGILYTESRVSVELSNVVKNPHLHEINEL  117

Query  398   VPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRG  577
              P +P+  A E      ++ +Q+N+F CGG+++G+  SH I D ++ + F + WA  +R 
Sbjct  118   FPFDPYNPARETLEGRNMMAVQLNQFKCGGVALGVCFSHKIADASTAASFLSAWAATSRK  177

Query  578   CAVVDDGGFIF-----DASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAI  742
                 +D   +      + + +FPP     D+       RG    ++  V +RF    S I
Sbjct  178   ----EDNNKVVPPQMEEGALLFPPRNIEMDM------TRGMVGDKD-IVTKRFVFNDSNI  226

Query  743   DQLREQLRLISHYRPSRAEALIAVVWDAVI-AANQKRHKGRINLHVLTSILNLRNRMEPP  919
              +LR+++    ++ P+R EA+ A++W + + AA ++  +GR    +++  +N+R+R+   
Sbjct  227   SKLRQKMGCF-NFNPTRVEAVTALIWKSSLEAAKERSAEGRFPASMISHAVNIRHRIMAS  285

Query  920   FPENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTAL  1099
                + +G N +   V      E       LA + R   R V+     +   +G   +  +
Sbjct  286   SKHHSIG-NLWQQAVSQLVEVEEEMGLCDLAERVRKTTREVDGNYVAKL--QGLEFYKVI  342

Query  1100  PIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQV-MKDSVVFMEGRF  1276
               + E  +   S+K + C   SS +    Y  DFGWGKP +     V +K+ V+ M  + 
Sbjct  343   ESLKE-ARIMASEKGVPCYSFSSWVRFGFYEVDFGWGKPTYVRTIGVPIKNVVILMGTKD  401

Query  1277  G-GVDLWMGLPEELMNIVMKNPQFVEFVS  1360
             G G++ W+ L    M    +NP+ +EF S
Sbjct  402   GDGLEAWVTLTTSNMVQFEQNPELLEFAS  430



>ref|XP_003601841.1| Vinorine synthase [Medicago truncatula]
Length=496

 Score =   199 bits (505),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 141/436 (32%), Positives = 226/436 (52%), Gaps = 44/436 (10%)
 Frame = +2

Query  38    ITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVD  217
             + +++E+  ++IIKPSSPTP  LR Y  S +DQ++  V  P V FY S   + +   + +
Sbjct  1     MKLEVEIISKEIIKPSSPTPSHLRHYQLSFLDQIAPMVYNPIVLFY-SHNDALNTATISN  59

Query  218   ELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAE-SLSSFLENPDFEMIRE  394
              LKKSLS+ L+  YPLAGR+  +++ I+CND+G+ +IE  +   +L   ++NP    +  
Sbjct  60    TLKKSLSKILTHFYPLAGRM-NNKNFIDCNDEGIPYIETKITNYNLKDIIQNPIPNELNR  118

Query  395   MVPCNPFTGAFEPNPDGRVLV-IQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARIN  571
             ++P       F+ +    +   IQ+N FSCGGI++G  +SH I DG S   F N+WA I 
Sbjct  119   LIP-------FQLDDITNIAFGIQLNFFSCGGIAIGACLSHQIADGLSFFNFLNSWANIT  171

Query  572   RGCAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQL  751
             R          IFD+SK+FPP KN +  D  + +A+      E  V + F   A  ++ L
Sbjct  172   RKLIFPKP---IFDSSKLFPP-KNISGFDPRSGIAK------ENIVCKIFVFNADVVENL  221

Query  752   REQLRLISHYRPSRAEALIAVVW----DAVIAANQKRHKGRINLHVLTSILNLRNRMEPP  919
             R +     ++ P+R EAL A +W    D +     +R+ G ++       +NLR +MEPP
Sbjct  222   RAKY---INFNPTRVEALSAFIWSRYVDVIYNDGVQRNYGVVH------AVNLRQKMEPP  272

Query  920   FPENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARR-RYGKGGFLHTA  1096
              P    G N    T+   +   G    + LA + RD I+ ++ E  ++ + GK       
Sbjct  273   LPLESFG-NYLRFTITIPKMNSGEEC-YGLAKQVRDEIKKIDKEYVKKVQEGK-----EH  325

Query  1097  LPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQV-MKDSVVFMEGR  1273
             L  + E       K+ +     +SL    +Y ADFGWGKP W  +  +  K+ VVF++ +
Sbjct  326   LEFLKESFDRVIVKEELVVFNFTSLCRFPLYDADFGWGKPIWVGSTALNFKNLVVFVDCK  385

Query  1274  -FGGVDLWMGLPEELM  1318
               GG++ ++ L  E M
Sbjct  386   DGGGIEAYVSLKVEDM  401



>ref|XP_008240535.1| PREDICTED: vinorine synthase-like [Prunus mume]
Length=444

 Score =   197 bits (501),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 140/456 (31%), Positives = 235/456 (52%), Gaps = 37/456 (8%)
 Frame = +2

Query  38    ITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSR-DYNGVV  214
             + +++EV  ++IIKPSSPTP  LR Y FS +DQ++     P + FY+    ++ +   + 
Sbjct  3     MKVEVEVISKEIIKPSSPTPDHLRHYQFSFLDQIAPQGYNPLLLFYEHNAKTQPNITEIS  62

Query  215   DELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAE-SLSSFLENPDFEMIR  391
             + LK SL + L+L YPLAGRIK ++  I CND+G+ F+E  V + +LS  L NP    + 
Sbjct  63    NHLKNSLCEVLNLFYPLAGRIKNNQ-FIHCNDEGIPFVEARVLDCTLSDVLSNPIPGELN  121

Query  392   EMVPCNPFTGAFEPN--PDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWAR  565
             + +P       FE +   +   L +Q+N F CGG ++G  +SH I DG S  +F+  WA 
Sbjct  122   KFMP-------FELDDITNSLPLGVQLNIFQCGGFAIGQCISHKIADGLSYFMFSKIWAA  174

Query  566   INRG-CAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAI  742
             I RG  A ++   F+  +S +FPP +     D       G+    +  + +RF   AS I
Sbjct  175   IARGDQANINPPEFV--SSTLFPPKEFNIGFD-------GSVGITKDRITKRFVFDASQI  225

Query  743   DQLREQLRLISH---YRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRME  913
             + LRE+     H    RP+R E L   +W   +AA +     +  L+ +   +NLR R++
Sbjct  226   ENLRERYEQSMHNMKKRPTRVETLSTFLWSRFVAATKDSTLNK--LYRVIHAVNLRPRID  283

Query  914   PPFPENCLGNNTYGA-TVHWNQPTEGNPSR---HALALK-FRDAIRGVNDEAARRRYGKG  1078
             PP P++  GN  + A T     P+ G       H + +   R+AI  +++E  ++   +G
Sbjct  284   PPLPQSSFGNLFHVAITAPLQIPSSGGGDEECGHGVVIPVIREAIDNIDNEYVKKLQKEG  343

Query  1079  GFLHTALPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVN-AQVMKDSV  1255
                   L +M ++       +    L  SS     +Y  DFGWG+P W  + ++  K+ V
Sbjct  344   ---DEYLGVMKKLAYSCKRGEMGTLLSFSSYCRFPLYDNDFGWGRPTWVGSPSRTYKNLV  400

Query  1256  VFMEGR-FGGVDLWMGLPEELMNIVMKNPQFVEFVS  1360
             +FM+ +  GG++ ++ L EE+M     + + + +V+
Sbjct  401   LFMDTKEGGGIEAYVSLEEEVMAKFECDSELLSYVA  436



>ref|XP_008222015.1| PREDICTED: vinorine synthase-like [Prunus mume]
Length=442

 Score =   197 bits (501),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 141/456 (31%), Positives = 230/456 (50%), Gaps = 37/456 (8%)
 Frame = +2

Query  38    ITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSR-DYNGVV  214
             + +++EV  ++IIKPSSPTP  LR Y FS +DQ++  V  P + FY+    ++ +   + 
Sbjct  1     MKVEVEVISKEIIKPSSPTPDHLRHYQFSFLDQIAPQVYNPLLLFYEHNAKTQPNSTEIS  60

Query  215   DELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAE-SLSSFLENPDFEMIR  391
             + LK SL + L+L YPLAGRIK ++  I CND+G+ F+E  V + +LS  L NP    + 
Sbjct  61    NHLKNSLCEVLNLFYPLAGRIKNNQ-FIHCNDEGIPFVEARVLDCTLSDVLSNPIPGELN  119

Query  392   EMVPCNPFTGAFEPN--PDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWAR  565
             + +P       FE +   +   L +Q+N F CGG ++G  +SH I DG S  +F+  WA 
Sbjct  120   KFMP-------FELDDITNSLPLGVQLNIFQCGGFAIGQCISHKIADGLSYFMFSKIWAA  172

Query  566   INRG-CAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAI  742
             I RG  A ++   F+  +S +FPP +     D       G+    +  V +RF   AS I
Sbjct  173   IARGDQANINPPKFV--SSTLFPPKEFNIGFD-------GSVGITKDRVTKRFVFAASQI  223

Query  743   DQLREQLRLISH---YRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRME  913
             + LRE+     H    RP+R E L   +W   +A  +     +  L+ +   +NLR R +
Sbjct  224   ENLRERYEQSMHNMKKRPTRVETLSTFLWSRFVAVTKDSTLNK--LYRVIHAVNLRPRFD  281

Query  914   PPFPENCLGN-NTYGATVHWNQPTEGNPSR---HALALK-FRDAIRGVNDEAARRRYGKG  1078
             PP P++  GN      T     P+ G       H + +   R+AI  +++E  ++   +G
Sbjct  282   PPLPQSFFGNLFRLAITAPLQIPSSGGSDEECGHGMVIPVVREAIDNIDNEYVKKLQKQG  341

Query  1079  GFLHTALPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVN-AQVMKDSV  1255
                   L +M +        +    L  SS     +Y  DFGWG+P W  + A   K+ V
Sbjct  342   D---EHLGVMKKQADSFKRGEMAKLLSFSSYCRFPLYDNDFGWGRPTWVGSPALTYKNIV  398

Query  1256  VFMEGRF-GGVDLWMGLPEELMNIVMKNPQFVEFVS  1360
             +FM+ +  GG++ ++ L EE+M     + + + +V+
Sbjct  399   LFMDTKEGGGIEAYVSLEEEVMAKFECDSELLSYVA  434



>ref|XP_004152528.1| PREDICTED: BAHD acyltransferase At5g47980-like [Cucumis sativus]
 gb|KGN64241.1| hypothetical protein Csa_1G044900 [Cucumis sativus]
Length=434

 Score =   197 bits (500),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 136/445 (31%), Positives = 218/445 (49%), Gaps = 24/445 (5%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVDEL  223
             M++++  ++IIKPSSPTP  L  +N S++DQLS    +P + F+ +   +  ++     L
Sbjct  1     MELQILTKEIIKPSSPTPSHLHRFNISLLDQLSTAGYVPVILFFPNSNGAPSFHERSHRL  60

Query  224   KKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREMVP  403
             KKSL++TL+  YPLAGR +++ S I+CND G E++E      LS FL+ P  +++ + +P
Sbjct  61    KKSLAETLTRFYPLAGRPRQN-SYIDCNDDGAEYVEARANCVLSDFLKEPTPDLLAQFLP  119

Query  404   CNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRGCA  583
                 T A E    GR+L++QV  F CGG+++G+  SH + D +SISV    W+    G  
Sbjct  120   IK--TEAPEAADGGRMLLVQVTLFECGGMAMGISFSHKLVDASSISVILKCWSAAALGSD  177

Query  584   VVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQLREQL  763
              V+     F  + + PP +          V       + K   RR       I  L+ + 
Sbjct  178   PVEPE---FLQASLVPPPEGIP-----IAVPPTDLGGKVKCSSRRLVFNGQEITVLKSKA  229

Query  764   RLISHYRPSRAEALIAVVWD-AVIAANQKRHKGRINLHVLTSILNLRNRMEPPFPENCLG  940
                    P+R E + A++W  A+ AA Q+      NL V++  +NLR R+ PP P+  +G
Sbjct  230   ATDITPNPTRVEVVTALIWKCAMKAATQETKPFSPNLSVMSQTVNLRKRLTPPSPDYSIG  289

Query  941   NNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTALPIMSEII  1120
              N  G  V    P      +  + L  RD ++  N    RR  GK  F       + E +
Sbjct  290   -NLVGNFVTDPIPASEKDLKGLVEL-LRDGVKEFNKNGIRRYEGKDCFAK-----ILEGL  342

Query  1121  KHEGS---KKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQVM-KDSVVFMEGRFG-GV  1285
             +  G    + ++     SS     +Y  DFGWGKP W     +M  + VV M+ + G G+
Sbjct  343   QQGGGLFMRDDVAFYICSSWTRFGLYEMDFGWGKPGWVSIGSIMFLNFVVLMDTKDGEGI  402

Query  1286  DLWMGLPEELMNIVMKNPQFVEFVS  1360
             + W+ L E+ M     + + + F S
Sbjct  403   EAWVTLKEDEMASFQNDDELLSFAS  427



>ref|XP_006427943.1| hypothetical protein CICLE_v10027036mg [Citrus clementina]
 ref|XP_006464852.1| PREDICTED: salutaridinol 7-O-acetyltransferase-like [Citrus sinensis]
 gb|ESR41183.1| hypothetical protein CICLE_v10027036mg [Citrus clementina]
Length=475

 Score =   198 bits (503),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 127/454 (28%), Positives = 227/454 (50%), Gaps = 32/454 (7%)
 Frame = +2

Query  41    TMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVDE  220
             T  +++   ++IKPSSPTP+ LRTY  S++DQL   + +P V FY +    + ++   D 
Sbjct  33    TSDVQIISTEVIKPSSPTPKHLRTYKLSLLDQLFSKIYVPLVFFYSANCKHQYFSKKSDL  92

Query  221   LKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREMV  400
             LK+SL++TL+  YP AGR+  D  S++C+D G  FIE +V   +S FL+ PD E++++++
Sbjct  93    LKQSLAKTLTHYYPFAGRLI-DSFSVDCSDHGAAFIEANVGCDISKFLQPPDMELLQQLI  151

Query  401   PCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRGC  580
             P +P     + + +  +L +QVN FS G +++G+  SH + DG++I  F  TW  I RG 
Sbjct  152   PPSPQLSNLDVS-ERELLAVQVNLFSGGEMAIGVCFSHGVADGSAIFNFMKTWGEITRGV  210

Query  581   ----AVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQ  748
                   + +   + D + +FPPV N     Q       + +S    V +R    +  I  
Sbjct  211   INGNDNICNNNVVLDCTSLFPPV-NFPKPYQIVT----SPQSSGNIVFKRLLFDSKKIAA  265

Query  749   LREQLR----LISHYRPSRAEALIAVVWDAVIAANQKRHKG---RINLHVLTSILNLRNR  907
             L+E++       +  + +R   + A++W A IA  ++R +    ++  H +   +NLRN+
Sbjct  266   LKEKVNKEIGKFNELQATRFGVVSALIWGAFIAIARERKRAIDNKLYSHAIYYTMNLRNK  325

Query  908   MEPPFPENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFL  1087
             + PP    C+GN        W+   +      +L    R+ I+        +R G+    
Sbjct  326   LNPPMIPQCMGNIYRLVRAEWSLAKDDAIEETSL---LREVIKA-------KRMGREVMH  375

Query  1088  HTALPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRW-AVNAQVMKDSVVFM  1264
             +       + +K        + L  +S++G+  Y  DFGWGKP W +V   ++ D  +  
Sbjct  376   NNEYLGFIKDMKETWEDSRSFGL--TSVVGLPCYEVDFGWGKPVWFSVGPLLLIDLAILT  433

Query  1265  EGRFG-GVDLWMGLPEELMNIVMKNPQFVEFVSA  1363
                 G G++  M + +E M+   + P  + + S+
Sbjct  434   STSDGEGIEALMVMFKEDMDKFEQEPSIMAYASS  467



>gb|KDO40774.1| hypothetical protein CISIN_1g037323mg [Citrus sinensis]
Length=475

 Score =   197 bits (502),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 127/454 (28%), Positives = 227/454 (50%), Gaps = 32/454 (7%)
 Frame = +2

Query  41    TMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVDE  220
             T  +++   ++IKPSSPTP+ LRTY  S++DQL   + +P V FY +    + ++   D 
Sbjct  33    TSDVQIISTEVIKPSSPTPKHLRTYKLSLLDQLFSKIYVPLVFFYSANCKHQYFSKKSDL  92

Query  221   LKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREMV  400
             LK+SL++TL+  YP AGR+  D  S++C+D G  FIE +V   +S FL+ PD E++++++
Sbjct  93    LKQSLAKTLTHYYPFAGRLI-DSFSVDCSDHGAAFIEANVGCDISKFLQPPDMELLQQLI  151

Query  401   PCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRGC  580
             P +P     + + +  +L +QVN FS G +++G+  SH + DG++I  F  TW  I RG 
Sbjct  152   PPSPQLSNLDVS-ERELLAVQVNLFSGGEMAIGVCFSHGVADGSAIFNFMKTWGEITRGV  210

Query  581   ----AVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQ  748
                   + +   + D + +FPPV N     Q       + +S    V +R    +  I  
Sbjct  211   INDNDNICNNNVVLDCTSLFPPV-NFPKPYQIVT----SPQSSGNIVFKRLLFDSKKIAA  265

Query  749   LREQLR----LISHYRPSRAEALIAVVWDAVIAANQKRHKG---RINLHVLTSILNLRNR  907
             L+E++       +  + +R   + A++W A IA  ++R +    ++  H +   +NLRN+
Sbjct  266   LKEKVNKEIGKFNELQATRFGVVSALIWGAFIAIARERKRAIDNKLYSHAIYYTMNLRNK  325

Query  908   MEPPFPENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFL  1087
             + PP    C+GN        W+   +      +L    R+ I+        +R G+    
Sbjct  326   LNPPMIPQCMGNIYRLVRAEWSLAKDDAIEETSL---LREVIKA-------KRMGREVMH  375

Query  1088  HTALPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRW-AVNAQVMKDSVVFM  1264
             +       + +K        + L  +S++G+  Y  DFGWGKP W +V   ++ D  +  
Sbjct  376   NNEYLGFIKDMKETWEDSRSFGL--TSVVGLPCYEVDFGWGKPVWFSVGPLLLIDLAILT  433

Query  1265  EGRFG-GVDLWMGLPEELMNIVMKNPQFVEFVSA  1363
                 G G++  M + +E M+   + P  + + S+
Sbjct  434   STSDGEGIEALMVMFKEDMDKFEQEPSIMAYASS  467



>gb|KCW86594.1| hypothetical protein EUGRSUZ_B03226 [Eucalyptus grandis]
Length=412

 Score =   196 bits (498),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 139/455 (31%), Positives = 225/455 (49%), Gaps = 63/455 (14%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVDE-  220
             +++EV   DI+KPSSPTP  LR Y  S +DQ+ V V +P++ F+      RD +  +DE 
Sbjct  6     VEVEVISSDIVKPSSPTPDHLRHYKLSFLDQIQVPVFMPWILFF-----PRDDHLSLDEK  60

Query  221   ---LKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIR  391
                +++SL++ L+  YPLAGR++ D   I+CND+G  ++E  V   LS  LENP   ++ 
Sbjct  61    CSNIRRSLAEALTRFYPLAGRVR-DNLYIDCNDEGALYVEARVRCKLSDILENPVPRVLN  119

Query  392   EMVPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARIN  571
               +P          +     + +QVN F CGG+++ L++SH + D  SI  F N WA   
Sbjct  120   RFLPRE------LDDVQDLAVAVQVNFFECGGLALALLISHKVADALSIFTFLNAWAATA  173

Query  572   RGCA-VVD---DGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASA  739
             RG A ++D   D  F+FDA+ IF   +  A+L+  A     AA+ Q              
Sbjct  174   RGDADIIDPCFDSRFVFDATAIFSLREQFANLNSAA-----AADPQ--------------  214

Query  740   IDQLREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPP  919
                           RP+R EAL + +W   +A+ Q        L+ +   +NLR RMEPP
Sbjct  215   ------------CCRPTRVEALSSFLWSRYMASTQPVDARGDKLYTVLHAVNLRTRMEPP  262

Query  920   FPENCLGNNTYGATVHWNQPTE--GNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHT  1093
                +  GN +  A      PT+  G    + +  + R+AI+ V+ +   +     G+L+ 
Sbjct  263   ISGHHFGNISRVAVA---VPTKDAGTDGGYEIVHQVREAIKQVDRQYIEKLQDGEGYLNW  319

Query  1094  ALPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQV-MKDSVVFMEG  1270
                  + I     S+  +     +S+    +Y ADFGWGKP W  +A +  K+ +VF++ 
Sbjct  320   LKERSARI-----SQGEVVSFSFTSMCRFPIYEADFGWGKPAWVGSASLTFKNLIVFVDT  374

Query  1271  RFG-GVDLWMGLPEELMNIVMKNPQFVEFVSAGFS  1372
             + G G++ W+ L E+ M    ++ + +  VS   S
Sbjct  375   KSGDGIEAWVHLKEDDMAKFEQDKELLALVSPSVS  409



>emb|CBI18889.3| unnamed protein product [Vitis vinifera]
Length=631

 Score =   201 bits (510),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 135/401 (34%), Positives = 197/401 (49%), Gaps = 27/401 (7%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFY---DSPGSSRDYNGVV  214
             M++ +  R+ IKPSSPTP  LR +  S++DQL        + FY      G S + + + 
Sbjct  1     MEVTIISRETIKPSSPTPHHLRAFKLSLLDQLVPCCYTQVLLFYLIDGFHGQSIETSHIS  60

Query  215   DELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIRE  394
               LK SLS+TL+  YPLAG I +D   I+CND+GV + E  V  +LS FL+ P+ E++ +
Sbjct  61    TRLKDSLSETLTHFYPLAGSIGDDELQIDCNDEGVPYFEARVDCNLSEFLQEPELELLNQ  120

Query  395   MVPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINR  574
               PC+P      P     + +IQVN F+ GGI++G+ +SH I DG SIS F   WA I R
Sbjct  121   FFPCDPLNTP--PMAKLHLAMIQVNIFNRGGIAIGVCLSHKIADGVSISAFLKAWAAIAR  178

Query  575   GCAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQLR  754
             GC         F+A  +FP  +N +    ++ V         K V +R    ASAI  L+
Sbjct  179   GCFEEYPS---FEAKSLFP--QNESLPQDYSMVLGKCLIRTGKCVTKRVVFDASAIAALK  233

Query  755   EQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPFPENC  934
              +    +    +R E + A +W   +AA  K+  G     +LT  +NLR +     PE+ 
Sbjct  234   AK----ASVDCTRVEVVSAFIWKRAMAA-AKQKLGFQRSSILTHAVNLRKKTILSLPESS  288

Query  935   LGNNTYGATVHWNQPTEGNPSRHA----LALKFRDAIRGVNDEAARRRYGKGGFLHTALP  1102
             +GN      + W   TEG     A    L  K R AI  ++ + A++  G+ GF      
Sbjct  289   MGN------LFWIAITEGRVDDEAELDLLVDKTRKAISKISCDFAKKLQGEEGFAVAFEH  342

Query  1103  IMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWA  1225
             +       E    + Y    SS    +VY  DFGWG+P WA
Sbjct  343   VKEVKAAFEEDGVDFYGF--SSWCKFEVYEGDFGWGRPIWA  381



>ref|XP_008389788.1| PREDICTED: vinorine synthase-like [Malus domestica]
Length=454

 Score =   197 bits (501),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 146/464 (31%), Positives = 234/464 (50%), Gaps = 47/464 (10%)
 Frame = +2

Query  44    MKIEV----RRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGV  211
             MKIEV    +  ++IKP SPTP  L  +  S +DQL+ +  IP++ FY+S G+ +    +
Sbjct  1     MKIEVEVISKSIEMIKPFSPTPNHLHXHQLSFLDQLAPHAYIPFLFFYESTGT-KTITQI  59

Query  212   VDELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDV-AESLSSFLENPDFEMI  388
              + LK SLS+ LS  YP AGR+K +   + C+DQGV F E  V ++ LS  + +P    +
Sbjct  60    SNILKTSLSKILSQYYPFAGRVKHNLF-VHCSDQGVPFFESKVKSQPLSDMIASPFVSEL  118

Query  389   REMVPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARI  568
              +++P     G     P G    +Q+N F CGG ++GL +SH I DG +   F N WA  
Sbjct  119   NKLLPYR--LGEVTEVPLG----VQLNVFDCGGFAIGLCVSHRIADGLTSFTFVNRWA-A  171

Query  569   NRGCAVVDDGGFI----FDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPAS  736
                C        I    F A+ IFPP     ++D +  V   +  +++  V +RF    S
Sbjct  172   QANCDAQGKSNIIVGPDFSAASIFPP----KNMDGYLGV---SIVNKKAIVTKRFVFDGS  224

Query  737   AIDQLREQLRLISHY-----RPSRAEALIAVVWDAVIAANQKRHKGRIN-------LHVL  880
              +  LR +     ++     RPS+ EAL A +W+  +A+ ++R    I+       L+ +
Sbjct  225   KVQALRSRYEESMNFSKTQKRPSKVEALSAXLWNIFLASRRERDCVAISNQSRTQTLYTV  284

Query  881   TSILNLRNRMEPPFPENCLGNNTYGATVHWNQPTEGN-PSRHALALKFRDAIRGVNDEAA  1057
               I+NLR+R +PP P++  GN    AT     PT  N    H L  +  + I  + D   
Sbjct  285   VYIMNLRSRFDPPLPQHAFGNYYRAATA---TPTLVNGEESHRLVRQVIEEIENI-DNNY  340

Query  1058  RRRYGKGGFLHTALPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRW-AVNA  1234
              RR+ +G   H  L  M + ++   +K  +  L  SS+    +Y ADFGWGKP W ++ A
Sbjct  341   MRRFQEGYREH--LDFMRKRME-RFAKGELVTLTFSSVCRFPIYDADFGWGKPAWVSMAA  397

Query  1235  QVMKDSVVFMEGRFG-GVDLWMGLPEELMNIVMKNPQFVEFVSA  1363
               + + +VFM+ + G G++ +  L EE M     + +F+  + +
Sbjct  398   MDINNQIVFMDTKNGDGIESYFSLTEEDMAKFELHKEFIALLKS  441



>ref|XP_008222087.1| PREDICTED: vinorine synthase-like [Prunus mume]
Length=442

 Score =   196 bits (499),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 140/442 (32%), Positives = 224/442 (51%), Gaps = 37/442 (8%)
 Frame = +2

Query  38    ITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSR-DYNGVV  214
             + +++EV  ++IIKPSSPTP  LR Y FS +DQ++  V  P + FY+    ++ +   + 
Sbjct  1     MKVEVEVISKEIIKPSSPTPDHLRHYQFSFLDQIAPQVYNPLLLFYEHNAKTQPNSTEIS  60

Query  215   DELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAE-SLSSFLENPDFEMIR  391
             + LK SL + L+L YPLAGRIK ++  I CND+G+ F+E  V + +LS  L NP    + 
Sbjct  61    NHLKNSLCEVLNLFYPLAGRIKNNQ-FIHCNDEGIPFVEARVLDCTLSDVLSNPIPGELN  119

Query  392   EMVPCNPFTGAFEPN--PDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWAR  565
             + +P       FE +   +   L +Q+N F CGG ++G  +SH I DG S  +F+  WA 
Sbjct  120   KFMP-------FELDDITNSLPLGVQLNIFQCGGFAIGQCISHKIADGLSYFMFSKIWAA  172

Query  566   INRG-CAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAI  742
             I RG  A ++   F+  +S +FPP +     D       G+    +  V +RF   AS I
Sbjct  173   IARGDQANINPPKFV--SSTLFPPKEFNIGFD-------GSVGITKDRVTKRFVFAASQI  223

Query  743   DQLREQLRLISH---YRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRME  913
             + LRE+     H    RP+R E L   +W   +A  +     +  L+ +   +NLR R +
Sbjct  224   ENLRERYEQSMHNMKKRPTRVETLSTFLWSRFVAVTKDSTLNK--LYRVIHAVNLRPRFD  281

Query  914   PPFPENCLGN-NTYGATVHWNQPTEGNPSR---HALALK-FRDAIRGVNDEAARRRYGKG  1078
             PP P++  GN      T     P+ G       H + +   R+AI  +++E  ++   +G
Sbjct  282   PPLPQSFFGNLFRLAITAPLQIPSSGGSDEECGHGVVIPVVREAIDNIDNEYVKKLQKQG  341

Query  1079  GFLHTALPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVN-AQVMKDSV  1255
                   L +M +        +    L  SS     +Y  DFGWG+P W  + A   K+ V
Sbjct  342   ---DEHLGVMKKQADSFKRGEMATLLSFSSYCRFPLYDNDFGWGRPTWVGSPALTYKNLV  398

Query  1256  VFMEGR-FGGVDLWMGLPEELM  1318
             +FM+ +  GG++ ++ L EE+M
Sbjct  399   LFMDTKEGGGIEAYVSLEEEVM  420



>ref|XP_008240679.1| PREDICTED: vinorine synthase-like [Prunus mume]
Length=464

 Score =   197 bits (500),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 136/456 (30%), Positives = 216/456 (47%), Gaps = 42/456 (9%)
 Frame = +2

Query  50    IEVRRRDIIKPSSPTPQSLRTYNFSIVDQ-LSVNVKIPYVRFYDSPGSSRDY-NGVVDEL  223
             +E+  R IIKP SPTP  L+    S++DQ L   +    V  Y +     D+ +     L
Sbjct  9     VEITSRKIIKPLSPTPYHLKALKLSLLDQILPPTLYGTLVFLYTNHWHGADFVSNASKRL  68

Query  224   KKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREMVP  403
             ++SLS+TL L YPLAGR+K   + IECND+G  F+E  V   L+ FL+ P+ ++I  ++P
Sbjct  69    QESLSKTLVLFYPLAGRLK-GAAFIECNDEGAHFLEARVNCLLADFLQQPEPKLIGHLIP  127

Query  404   CNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRGCA  583
                   A +      +L++Q+N F CGGI++ +  SH I D  S+  FA TWA INR   
Sbjct  128   ETDSQTA-QVALGSVLLLVQINVFKCGGIAIAVSPSHKIADLTSLYTFARTWAAINRDED  186

Query  584   VVDDG-----------GFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIP  730
               DDG           G     S+  P   NT +               E    R+F   
Sbjct  187   QYDDGVGGQLALPEFNGGNLLPSRDLPATPNTLE------------TQSENLTTRQFVFD  234

Query  731   ASAIDQLREQLR-LISHYRPSRAEALIAVVWDAVIAANQKRHKGR-INLHVLTSILNLRN  904
              S +  L+ ++  ++ ++ P+  + ++A++    IAA+     G  I   VL  ++NLR 
Sbjct  235   VSKMASLKAKIEGVVQNFIPTNVQLVLAIILKCAIAASHNSKPGTPIRPTVLFQMVNLRR  294

Query  905   RMEPPFPENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGF  1084
             RM P  P+N +GN  +   + +    E     H L    R  +    +E A R  G  GF
Sbjct  295   RMLPELPQNAMGNWFWPLLILFK---EDETQLHELVSTMRKGLTDFINEKANRFKGVEGF  351

Query  1085  LHTALPIMSEIIKHEG----SKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQVMKDS  1252
             L      + E I+  G    S K +   + +SL  + +Y  DFGWGKP W       K+ 
Sbjct  352   LA-----VFECIRERGQLLKSTKGINLYWATSLCKLPLYEMDFGWGKPTWVTGKGGYKNV  406

Query  1253  VVFMEGRF-GGVDLWMGLPEELMNIVMKNPQFVEFV  1357
             +  ++ +F  G++ W+ L E+ M I   + + + ++
Sbjct  407   IALLDTKFCDGIEAWVTLDEQEMAIFESDEELLAYL  442



>ref|XP_008459937.1| PREDICTED: BAHD acyltransferase At5g47980-like [Cucumis melo]
 gb|ADN33685.1| 3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase [Cucumis melo 
subsp. melo]
Length=435

 Score =   196 bits (498),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 137/446 (31%), Positives = 213/446 (48%), Gaps = 32/446 (7%)
 Frame = +2

Query  47    KIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVDELK  226
             K+++   +IIKPS PTP++L   NFS +DQL++ V +P + FY SP +++  +  +  LK
Sbjct  4     KVDIINEEIIKPSIPTPKTLNHLNFSFLDQLALPVYVPLLLFY-SPKNNQIPS--ISHLK  60

Query  227   KSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREMVPC  406
              SLS+TL+  YP AGR+ +D  SI C D+G  F+E +   SL+  L   + + + + +P 
Sbjct  61    SSLSKTLTQFYPFAGRVNDDNLSISCTDEGAIFVEAETNYSLNDILTQLNVDSLNQFLP-  119

Query  407   NPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARI----NR  574
                   F     G +++IQ   F CGGI+VGL+MSH I D +SIS F  TW  +    N 
Sbjct  120   ------FHLANKGCIVLIQTTTFQCGGITVGLLMSHKISDASSISSFVKTWTSVHVSGND  173

Query  575   GCAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAES--QEKYVVRRFYIPASAIDQ  748
                 V    FI D+  + PP KN      F        +S    K + +R     S I  
Sbjct  174   NPLSVSKPEFISDS--VLPPPKN------FPVTTPTTPDSGIHAKGITKRIVFSHSKITS  225

Query  749   LREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPFPE  928
             L+ +    +   P+R EA+  ++W + I+A+ +   G     VL   +NLR R+EP  P+
Sbjct  226   LKAKAASSTVKNPTRVEAVAGLLWKSAISAS-RSTSGLSKASVLGQAVNLRKRLEPNLPD  284

Query  929   NCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTALPIM  1108
             N +GN     T       E      ++    R+AI        ++      +L     +M
Sbjct  285   NSVGNAIGFVTPETAVGAELE--LQSMVGLMREAIEEFKKNGYKKYQDTEAYLSYFKALM  342

Query  1109  SEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQVM-KDSVVFMEGRFG-G  1282
                  + G K    C   SS    + Y ADFGWG P W +    M  +  + ++ R G G
Sbjct  343   DPDGPYNGEKNFYLC---SSWSRFEFYEADFGWGCPVWFIGGISMFSNFFLLLDTRDGKG  399

Query  1283  VDLWMGLPEELMNIVMKNPQFVEFVS  1360
             ++  + L EE M +   +   +EF S
Sbjct  400   IEALVSLSEEDMRLFECDEDLLEFGS  425



>ref|XP_002305585.1| hypothetical protein POPTR_0004s01720g [Populus trichocarpa]
 gb|EEE86096.1| hypothetical protein POPTR_0004s01720g [Populus trichocarpa]
Length=433

 Score =   196 bits (498),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 137/460 (30%), Positives = 223/460 (48%), Gaps = 49/460 (11%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVDEL  223
             M++++  R +IKPS  TP  L+  N S +DQL+ ++ +P + +Y    ++  +   +++L
Sbjct  1     MEVQLISRKLIKPSVQTPPHLQNLNISFLDQLAPSLNVPNIFYY----TNNHHVNNIEDL  56

Query  224   KKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDV-AESLSSFLE---NPDFEMIR  391
             +KSLS+ L+L YPLAGR  ED  S++CND+GVEF+E  V    L+  ++   N + +++ 
Sbjct  57    EKSLSEILTLFYPLAGRYIEDNLSVDCNDEGVEFLEAKVDGVDLTQIIQQDPNSNLDLLD  116

Query  392   EMVPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARIN  571
               VPC         +   R+L IQ+N+F CGG+++GL+ SH I D  +IS F N WA   
Sbjct  117   HFVPC------VTESDTSRLLAIQINKFKCGGLAIGLLTSHRIADIPTISTFINAWATTF  170

Query  572   RGCAVVD-------DGGFIF---DASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRF  721
             R   + D       D  F+F   D    FPP                A + Q K V + F
Sbjct  171   RERGISDQVRRPRFDCPFLFPQRDLRLNFPP----------------APKVQPKIVTKVF  214

Query  722   YIPASAIDQLREQLRLIS----HYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSI  889
                  AID+L+ ++   +     Y  SR E + A++W A+I + + +H G++    +  I
Sbjct  215   VFNKEAIDKLKSKIGGGTDSGVKYHHSRLEVVTALIWKALIGSVKAQH-GQLRASSVRQI  273

Query  890   LNLRNRMEPPFPENCLGNNTYGATVHWNQPTEGNPSRHA-LALKFRDAIRGVNDEAARRR  1066
             + LR ++  P PEN  GN        +N   E N    + +A   RDA R    + A   
Sbjct  274   MTLRGKVSMPLPENACGNMYMPFISRFNANGESNRLELSDIASLLRDAKRKAISDCANAV  333

Query  1067  YGKGGFLHTALPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQVMK  1246
                  F  + +    + +  E +K  +     SS   + +  A+FGWGKP W        
Sbjct  334   NSDDVF--SMVTKYHKELFEELNKGEVDSFKFSSWCRLGMEEANFGWGKPAWMSAMNFPI  391

Query  1247  DSVVFMEGRFG-GVDLWMGLPEELMNIVMKNPQFVEFVSA  1363
             D  +  + +FG G++ WM L E  M    ++P  +   S+
Sbjct  392   DVSILKDDKFGDGIEAWMTLKEIDMLHFQQDPDILALPSS  431



>ref|NP_001238226.1| uncharacterized protein LOC100305374 [Glycine max]
 gb|ACS94570.1| unknown [Glycine max]
Length=456

 Score =   196 bits (498),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 140/456 (31%), Positives = 226/456 (50%), Gaps = 32/456 (7%)
 Frame = +2

Query  38    ITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRD-YNGVV  214
             + +++E+  R+ I+PSSPTP  LR +N S++D L  +   P + +Y SP S +  ++ V 
Sbjct  1     MKVEVEIISREDIRPSSPTPSHLRVFNLSLLDHLIPSPYAPIILYYTSPNSDKTCFSEVP  60

Query  215   DEL----KKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFE  382
               L    KKSLS+TL+  YPL G+IKE   SIECND+G  F++  V   L  FL  P   
Sbjct  61    KRLELLKKKSLSETLTQFYPLGGKIKELDFSIECNDEGANFVQAKVKCPLDKFLVQPQLT  120

Query  383   MIREMVPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWA  562
             ++ + +P +  +     N    V  IQVN F CGGI++GL +SH I DGA++S F   W+
Sbjct  121   LLHKFLPTDLVSEG--SNSGTYVTNIQVNIFECGGIAIGLCISHRILDGAALSTFIKGWS  178

Query  563   RINRG--CAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPAS  736
                +G  C  +    FI   S +F P  N   L   +    G+   Q K+V +RF    S
Sbjct  179   ERAKGFNCDQLTKPNFI--GSALF-PTNNNPWLRDLSMRMWGSFFKQGKWVTKRFLFRNS  235

Query  737   AIDQLREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEP  916
              I +L+ Q   +     +R E + +++W +++  ++ R  G     ++T ++NLR RM+ 
Sbjct  236   DIAKLKAQ--TLGTATSTRLEIVSSMLWKSLMGVSKVRF-GTQRPSLVTHLVNLRRRMDE  292

Query  917   PF-PENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGG--FL  1087
                P++ +GN  +                  L  K R +I  V+++      G  G   +
Sbjct  293   ALCPQHAMGNLLWLVAAEKMCDDHDEMGLEDLVGKLRKSISQVDEKFVEELRGDKGRSIM  352

Query  1088  HTALPIMSEIIKHEGSKKNM--YCLYTSSLLGMQVYAADFGWGKPRWAV------NAQVM  1243
               +L  +SE    +GSK  +  Y  + SS      Y ADFGWGKP W        +  + 
Sbjct  353   KESLGAISE----KGSKGEVVDYVGF-SSWCNFGYYEADFGWGKPTWVSGVGSIGSVSMF  407

Query  1244  KDSVVFMEGRFG-GVDLWMGLPEELMNIVMKNPQFV  1348
              + ++ ++ R G G++ W+ L EE M  +  N + +
Sbjct  408   MNLIILVDTRLGDGIEAWVTLDEEDMTHLEANTELL  443



>ref|XP_008446095.1| PREDICTED: vinorine synthase-like [Cucumis melo]
Length=438

 Score =   195 bits (496),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 135/455 (30%), Positives = 225/455 (49%), Gaps = 39/455 (9%)
 Frame = +2

Query  38    ITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVD  217
             +  +I++  ++ IKPSSPTP  LR Y+ S +DQ++V+V  P V F+ + GS+     + D
Sbjct  1     MAFQIQIVSKETIKPSSPTPDHLRRYSLSFLDQVTVDVYNPMVYFFVA-GSTTTPAEIAD  59

Query  218   ELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREM  397
              LK SLS  L+  YPLAGR+  D   I+CND GV FIE  V   LS  +  P    +  +
Sbjct  60    RLKTSLSDVLTHYYPLAGRLNYDEFFIDCNDDGVPFIETRVNCPLSDVMNTPFPSELNRL  119

Query  398   VPCNPFTGAFEPNP-DGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINR  574
             +P       FE +  D   + +Q+N F CGG++VG+ +SH I D  S  +  N WA   R
Sbjct  120   LP-------FELDKLDDVSMGVQLNVFECGGVAVGICVSHKISDALSFFIVVNGWAAYCR  172

Query  575   GCAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQLR  754
             G            ++++FPP K         +V         + V RR++I A+ ++ +R
Sbjct  173   GEKEALRAH--LSSAEVFPPTK--------TKVHNTRTSIFRQRVGRRYHIDAANVETIR  222

Query  755   ----EQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRI---------NLHVLTSILN  895
                 E   + +  RPSR EAL   ++   IAA +   K R+          + ++   +N
Sbjct  223   AKYAECPAMENQRRPSRVEALSTFIYSRFIAAIKAVSKERLENGSSETEKKIFLVCHSVN  282

Query  896   LRNRMEPPFPENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGK  1075
             +R+R++PP P+   GN         ++    +   + L  + R+ I  +N +  +R    
Sbjct  283   IRSRLDPPVPDYAFGNYYRTTFAPPSEEILNDEYCYDLVKQVREEIGKINKDYLKRLQES  342

Query  1076  GGFLHTALPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVN-AQVMKDS  1252
               F+ +     S+    E     + C +T SL  M +Y  DFGWG+P W  + A + K+ 
Sbjct  343   SKFIESMKKTASQFFTGEL----VSCSFT-SLCRMPIYDIDFGWGQPDWISSPALLFKNL  397

Query  1253  VVFMEGRFG-GVDLWMGLPEELMNIVMKNPQFVEF  1354
              VF++ + G G+++++ L EE M     + +F+++
Sbjct  398   FVFIDKKDGDGIEIYVHLTEEHMKKFEIDEEFLKY  432



>ref|XP_011037677.1| PREDICTED: acetyl-CoA-benzylalcohol acetyltransferase-like [Populus 
euphratica]
Length=456

 Score =   196 bits (497),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 138/455 (30%), Positives = 222/455 (49%), Gaps = 49/455 (11%)
 Frame = +2

Query  35    QITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVV  214
             ++ MK+ +  R +IKPS  TP  L+  N S +DQL+ ++ +P + +Y  P +    N  +
Sbjct  8     KLAMKVHLISRKLIKPSVQTPPHLQNLNISFLDQLAPSLNVPNIFYY--PDNHHVNN--I  63

Query  215   DELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDV-AESLSSFLE---NPDFE  382
             ++L+KSLS+ L+L YPLAGR  +D  S++CND+GVEF+E  V    L+  ++   N + +
Sbjct  64    EDLEKSLSEILTLFYPLAGRYIQDNLSVDCNDEGVEFLEAKVDGVDLTQIIQQGPNSNRD  123

Query  383   MIREMVPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWA  562
             ++   VPC         +   R+L IQ+N+F CGG+++GL+ SH I D  +IS F N WA
Sbjct  124   LLDHFVPC------VTESDTSRLLAIQINKFKCGGLAIGLLTSHRIADMPTISTFINAWA  177

Query  563   RINRGCAVVD-------DGGFIF---DASKIFPPVKNTADLDQFARVARGAAESQEKYVV  712
                R   + D       D  F+F   D    FPP                A + Q K V 
Sbjct  178   TTFRERGISDQVRRPRFDCPFLFPQRDLRLNFPP----------------APKVQPKIVT  221

Query  713   RRFYIPASAIDQLREQLRLIS----HYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVL  880
             + F     AID+L+ ++   +     Y  SR E + A++W A+I + + +H G +    +
Sbjct  222   KVFVFNKEAIDKLKSKIGGGTDSGVKYHHSRLEVVTALIWKALIGSVKAQH-GHLRASSV  280

Query  881   TSILNLRNRMEPPFPENCLGNNTYGATVHWNQPTEGNPSRHA-LALKFRDAIRGVNDEAA  1057
               I+ LR ++  P PEN  GN        +N   E N    + +A   RDA R    + A
Sbjct  281   RQIMTLRRKVSMPLPENACGNMYMPFISRFNANGESNRLELSDIASLLRDAKRKAISDCA  340

Query  1058  RRRYGKGGFLHTALPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQ  1237
                     F  + +    + +  E +K+ +     SS   + +  A+FGWGKP W  +  
Sbjct  341   NAVNSDDVF--SMVTRYHKELFEELNKEEVDTFKFSSWCRLGLEEANFGWGKPAWTSSKN  398

Query  1238  VMKDSVVFMEGRFG-GVDLWMGLPEELMNIVMKNP  1339
                D  +  + +FG G++ WM L E  M    ++P
Sbjct  399   FPIDVSILKDDKFGDGIEAWMTLKEIDMLHFQQDP  433



>ref|XP_004135508.1| PREDICTED: vinorine synthase-like [Cucumis sativus]
 gb|KGN51705.1| hypothetical protein Csa_5G590220 [Cucumis sativus]
Length=438

 Score =   195 bits (496),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 141/458 (31%), Positives = 231/458 (50%), Gaps = 45/458 (10%)
 Frame = +2

Query  38    ITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVD  217
             + ++IE+  ++ IKPSSPTP+ LR Y+ S +DQ++V+V  P V FY + GS+     + D
Sbjct  1     MAVEIEIVSKETIKPSSPTPEHLRRYSLSFLDQVTVDVYNPMVYFYPAGGSATPAE-ISD  59

Query  218   ELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREM  397
              LK SLS  L+  YPLAG++  D   I+CND GV FIE  +   LS  +  P    + + 
Sbjct  60    HLKTSLSHVLTHYYPLAGKVNYDEFFIDCNDNGVPFIETKINCRLSDVMNTPFPSEVNKF  119

Query  398   VPCNPFTGAFEPNP-DGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINR  574
             +P       FE +  D   + +Q+N F CGG+ +G+ +SH I D  S+ +  N WA   R
Sbjct  120   LP-------FELDQLDEVSMGVQLNVFECGGVVIGICVSHKISDALSLFIVVNEWAAYCR  172

Query  575   GCAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQLR  754
             G   V        ++++FPP K T   +    + R       + V RR+ I    ++ +R
Sbjct  173   GEKEVVRAH--LSSAELFPPTK-TGLYNTRTSIFR-------QRVARRYEIDGENVESIR  222

Query  755   EQLRLIS----HYRPSRAEALIAVVWDAVIAANQKRHKGRI---------NLHVLTSILN  895
              +    S      RPSR EAL A ++   IAA +      +          + ++   +N
Sbjct  223   AKYAECSAMENQRRPSRVEALSAFIYSRFIAAIKAVSSSELENGKSGSEKKIFLVCHSVN  282

Query  896   LRNRMEPPFPENCLGNNTYGATVHWNQPTE---GNPSRHALALKFRDAIRGVNDEAARRR  1066
             +R+R++PP  +   G N Y  T  +  P+E    +   + L  + R+ I  ++ +  +R 
Sbjct  283   IRSRLDPPVVDYAFG-NYYRTT--FAVPSENILNDNYCYDLVKQARNEIGKIDKDYLKRL  339

Query  1067  YGKGGFLHTALPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQVM-  1243
                  FL +    M +      + + + C +T SL  M +Y ADFGWGKP W  +  +M 
Sbjct  340   QEGSKFLDS----MKKTATQFSTGELVSCSFT-SLCRMPIYDADFGWGKPAWISSPALMF  394

Query  1244  KDSVVFMEGRFG-GVDLWMGLPEELMNIVMKNPQFVEF  1354
             K+  VF++ + G GVD+++ L EE MN    + +F+++
Sbjct  395   KNLFVFIDKKDGDGVDIYVHLKEEHMNKFEVDEEFLKY  432



>ref|XP_004165031.1| PREDICTED: BAHD acyltransferase At5g47980-like [Cucumis sativus]
Length=434

 Score =   195 bits (495),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 135/445 (30%), Positives = 218/445 (49%), Gaps = 24/445 (5%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVDEL  223
             M++++  ++IIKPSSPTP  L  +N S++DQLS    +P + F+ +   +  ++     L
Sbjct  1     MELQILTKEIIKPSSPTPSHLHRFNISLLDQLSTAGYVPVILFFPNSNGAPSFHERSHRL  60

Query  224   KKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREMVP  403
             KKSL++TL+  YPLAGR +++ S I+CND G E++E      LS FL+ P  +++ + +P
Sbjct  61    KKSLAETLTRFYPLAGRPRQN-SYIDCNDDGAEYVEARANCVLSDFLKEPTPDLLAQFLP  119

Query  404   CNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRGCA  583
                 T A E    GR+L++QV  F CGG+++G+  SH + D +SISV    W+    G  
Sbjct  120   IK--TEAPEAADGGRMLLVQVTLFECGGMAMGISFSHKLVDASSISVILKCWSAAALGSD  177

Query  584   VVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQLREQL  763
              V+     F  + + PP +          V       + K   RR       I  L+ + 
Sbjct  178   PVEPE---FLQASLVPPPEGIP-----IAVPPTDLGGKVKCSSRRLVFNGQEITVLKSKA  229

Query  764   RLISHYRPSRAEALIAVVWD-AVIAANQKRHKGRINLHVLTSILNLRNRMEPPFPENCLG  940
                    P+R E + A++W  A+ AA Q+      +L V++  +NLR R+ PP P+  +G
Sbjct  230   ATDITPNPTRVEVVTALIWKCAMKAATQETKPFSPHLSVMSQTVNLRKRLTPPSPDYSIG  289

Query  941   NNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTALPIMSEII  1120
              N  G  V    P      +  + L  RD ++  N    RR  GK  F       + E +
Sbjct  290   -NLVGNFVTDPIPASEKDLKGLVEL-LRDGVKEFNKNGIRRYEGKDCFAK-----ILEGL  342

Query  1121  KHEGS---KKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQVM-KDSVVFMEGRFG-GV  1285
             +  G    + ++     SS     +Y  DFGWGKP W     +M  + VV M+ + G G+
Sbjct  343   QQGGGLFMRDDVAFYICSSWTRFGLYEMDFGWGKPGWVSIGSIMFLNFVVLMDTKDGEGI  402

Query  1286  DLWMGLPEELMNIVMKNPQFVEFVS  1360
             + W+ L E+ M     + + + F S
Sbjct  403   EAWVTLKEDEMASFQNDDELLSFAS  427



>ref|XP_002311734.1| hypothetical protein POPTR_0008s18070g [Populus trichocarpa]
 gb|EEE89101.1| hypothetical protein POPTR_0008s18070g [Populus trichocarpa]
Length=439

 Score =   195 bits (496),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 140/450 (31%), Positives = 227/450 (50%), Gaps = 45/450 (10%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVDEL  223
             M +E+  R+ +KPSSPTP  LR +N  ++DQL+     P V FY +           + L
Sbjct  1     MAVEIITREAVKPSSPTPDHLREFNLRLLDQLAPVAYEPLVLFYSNFQQKFTVAHKSERL  60

Query  224   KKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREMVP  403
             K+SLS+TLS  YPLAGRIK+D +SIECND G  F++  V+  LS  LE PD E+IR+ +P
Sbjct  61    KRSLSETLSRFYPLAGRIKDD-ASIECNDFGAVFVQARVSCLLSKLLEKPDAEVIRKFIP  119

Query  404   CNPFTGAFEPNPD---GRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTW--ARI  568
                       +P+   G ++++Q N F+CGG+++G+ +SH + D  + S F   W  A  
Sbjct  120   IEI------ESPEELTGSLVLVQANFFACGGLAIGVCISHKVADPVTFSTFIKAWAAAAF  173

Query  569   NRGCAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAES--QEKYVVRRFYIPASAI  742
               G + V     +F+AS +FPP        Q   +AR AA    +++ V +R  + AS +
Sbjct  174   RSGDSTVLP---LFNASSVFPP--------QNIPLARPAALEFIRDRCVTKRVVLDASKV  222

Query  743   DQLREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPF  922
               L+ +    S   P+R EA+ A++W   + A  + +   +   +L+  +NLR +M  P 
Sbjct  223   AALQVKAVSESVTCPTRVEAVTALIWKCAMNA-ARSNSEHLRYSILSQSVNLRKKMVRPL  281

Query  923   PENCLGNNT-YGATVHWNQPTEGNPSRHALALKFRDAIRGVND--EAARRRYGKGGFLHT  1093
             PE+ +GN   Y A+      TE      +L  + R   +G+ D  E   ++ GK      
Sbjct  282   PEHTIGNLAGYFASCA----TECEVELQSLVRQLR---KGLQDFGENYLKKLGK----DK  330

Query  1094  ALPIMSEIIKHEGS---KKNMYCLYTSSLLGMQVYAADFGWGKPRW-AVNAQVMKDSVVF  1261
             A   + E  +   S   +  +    ++S   +  Y  DFGWGKP W  +     K+    
Sbjct  331   ASMAICESFQEAASMLPEGTVDFYVSTSFCRLPFYGIDFGWGKPTWVTIPTGAYKNVASI  390

Query  1262  MEGRFG-GVDLWMGLPEELMNIVMKNPQFV  1348
             M+ + G G++ W+ L E+ M    ++ + +
Sbjct  391   MDAKDGKGIEAWVTLTEDDMAFFERDRELL  420



>ref|XP_010100292.1| Vinorine synthase [Morus notabilis]
 gb|EXB82426.1| Vinorine synthase [Morus notabilis]
Length=438

 Score =   195 bits (496),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 141/456 (31%), Positives = 219/456 (48%), Gaps = 46/456 (10%)
 Frame = +2

Query  47    KIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVDELK  226
             K+++  R+ IKPSSPTP  LR +  S++DQ+   +    V FY +  +  +++     L+
Sbjct  6     KVDIIARNTIKPSSPTPDHLRIFKLSLLDQIIPPMYGLIVFFYPAE-TGTNFSEQSSRLR  64

Query  227   KSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREMVP-  403
             +SLS+TL+  YP+AGR      SI+C+D G  F+E  +   LS FL  PD E++   +P 
Sbjct  65    ESLSRTLTTFYPMAGRTNAIEPSIDCSDDGAFFVEAKMDCELSDFLRKPDGELLNNFLPT  124

Query  404   CNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRGCA  583
              +P T       +G V +IQ+  F CGG +V + +SH IGD +S+  F + W        
Sbjct  125   TDPLTAQLS---EGYVTLIQITGFRCGGTAVSVCISHKIGDISSLVTFLHGWTSSGEA--  179

Query  584   VVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQLREQL  763
                 G  +F    + PP        Q   +  G        + +RF   AS I  L++++
Sbjct  180   ----GSPVFVGDSLLPP--RDLSFAQRTDIKSG------NLITKRFVFEASKISHLKDKV  227

Query  764   RLISH------YRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPFP  925
               I H        PSR E ++A ++   IAA+ +   G     VL   +NLR R +PP P
Sbjct  228   GAIDHNIQMINKYPSRVEVVMAQIFKCAIAAS-RSVTGSFKTSVLFHSVNLRPRTDPPLP  286

Query  926   ENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVND---EAARRRYGKGGFLHTA  1096
             EN +GN      + W  P     S   L        R VN+   E A++      F   +
Sbjct  287   ENSVGN------LIWFVPVVIEESEMDLRTMVHKMKRLVNEFCNEKAKK------FKDHS  334

Query  1097  LPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQV-MKDSVVFMEGR  1273
             L ++ E  K     K M     SS     +Y  DFGWGKP W  +A +  K+S++ ++ R
Sbjct  335   LSVLGEFGKW-AEFKEMEFYSCSSWCKFPLYETDFGWGKPIWVSSANLTFKNSIILVDTR  393

Query  1274  FG-GVDLWMGLPEELMNIVMKNPQFVEFVSAGFSKS  1378
              G G++ W+ L EE M I  ++ + ++  SA F+ S
Sbjct  394   EGDGIEAWVTLEEEKMAIFERDNELLD--SATFNPS  427



>gb|KDP45585.1| hypothetical protein JCGZ_17192 [Jatropha curcas]
Length=447

 Score =   195 bits (496),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 138/455 (30%), Positives = 218/455 (48%), Gaps = 25/455 (5%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVDEL  223
             M++E+  ++ IKPSS   Q  + Y  +  DQL   V  P + F+    S    N  +  L
Sbjct  1     MEVEIISKEFIKPSSSATQHQKPYKLTFFDQLQPAVYFPVIFFFPMNDSKSHINQTLTHL  60

Query  224   KKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREMVP  403
             KKSLS+TL+L YPL+GR  +D   I    +G+ FIE   + S+S FL+  + E +   +P
Sbjct  61    KKSLSETLNLYYPLSGRPNDDNIFISRFQEGLPFIEAKASCSMSDFLKLHETESLNSFLP  120

Query  404   CNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRGCA  583
             C+P+    E   +  +L +QV++F+CGGI++G   SH + D A+ S F  +W+ ++RG  
Sbjct  121   CSPYHK--ELAVEIPLLAVQVSKFTCGGIALGCCFSHKLLDAATASNFIASWSSLHRG--  176

Query  584   VVDDGGFI---FDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQLR  754
               D  G I   F+   +F P K      Q + +      ++  Y+ RRF   A AID L+
Sbjct  177   --DPNGVIMPDFEEPSLFFPPKIPIPRTQIS-LMDTLCFAKGDYITRRFVFNAEAIDTLK  233

Query  755   EQLR--LISHYRPSRAEALIAVVWDAVIAAN----QKRHKGRINLHVLTSILNLRNRMEP  916
              + +   +    P+R + L   +W   + A     Q       N  VL   +NLR R  P
Sbjct  234   AKAKGNEVDQTEPTRIQTLSCFIWKHCMEATRMLAQSSSSSASNTSVLIESVNLRKRTTP  293

Query  917   PFPENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTA  1096
                +   GN  +GA V    P + N   H L     +AI     +      G  GF    
Sbjct  294   EMKDGSSGNLIWGA-VAIADPNDTNQELHELVKMLSEAIALFKPDYTESFQGDNGF--ET  350

Query  1097  LPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRW-AVNAQV---MKDSVVFM  1264
             L    E I+   S +N      +S   M +   DFGWG+P W  V  +V    ++  +F+
Sbjct  351   LSQYFETIEL-LSMENPEVFVFTSWSRMSLTRPDFGWGEPYWVGVMGKVGDLSRNMTIFV  409

Query  1265  EGRFG-GVDLWMGLPEELMNIVMKNPQFVEFVSAG  1366
             + + G G++ W+ L ++ M I+ +NP+F+EF S  
Sbjct  410   DAKDGKGIEAWITLDDKRMEILQQNPEFLEFASVS  444



>ref|XP_004310187.1| PREDICTED: salutaridinol 7-O-acetyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=437

 Score =   195 bits (495),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 137/449 (31%), Positives = 223/449 (50%), Gaps = 29/449 (6%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRD----YNGV  211
             M++E+  R+ IKPS+PT    RTYN S ++QL+     P V FY    S+ D    +   
Sbjct  1     MEVEIVSRETIKPSTPTLPHYRTYNLSFLEQLNPRTYTPIVYFYPKEASASDHYPNFCDK  60

Query  212   VDELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIR  391
              D+LKKSLS+TL++ YP +GRIK DR SI+CND+GV FIE  +   LS  LE P  E + 
Sbjct  61    SDQLKKSLSETLAIYYPFSGRIK-DRVSIDCNDEGVIFIEARIKVQLSQILEQPKDEELD  119

Query  392   EMVPCNPFTGAFEPNPDGR---VLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWA  562
              +     FT   + N D     +L +QV+ F CGG+++G+ MSH + D +++  F N WA
Sbjct  120   LL-----FTDKLQWNDDSNLTVILAVQVSFFDCGGMAIGICMSHKVADTSTMINFINDWA  174

Query  563   RINRGCAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAI  742
              + R           F A  +FP  +    L   + + +G        + +R+   AS I
Sbjct  175   AMTRDHKADQYVSPKFIAETVFP--RGEIPLPPESVIEKGDC------ISKRYVFDASKI  226

Query  743   DQLREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLH-VLTSILNLRNRMEPP  919
               L+  L       P+R E + A +    I+A +       N + +L   +N+R RM PP
Sbjct  227   AALK-ALVCDKVQNPTRVEVVTAFIHRCAISALKSNSGSLSNPNTLLIQTVNMRARMVPP  285

Query  920   FPENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTAL  1099
              P++ +G+  +   V      E     H L  + ++ +          ++GK  +    L
Sbjct  286   LPKSSVGSMVWYYAVS-TAEEESVIELHELVTQMKERMAQFCG-TYLEKFGK-EWPSIFL  342

Query  1100  PIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQ-VMKDSVVFMEGRF  1276
               M E  +     +N+     SS     +Y ADFGWGKP W   A  V+K+++  ++ R 
Sbjct  343   ECMEE-SRKSFHIQNLVVYRCSSWCRFPIYEADFGWGKPIWVTIASCVLKNTIFLIDARN  401

Query  1277  G-GVDLWMGLPEELMNIVMKNPQFVEFVS  1360
             G G+++++ L ++ M++  ++P+ + F S
Sbjct  402   GEGIEVYVNLEKQHMDMFERDPELLAFAS  430



>ref|XP_008226064.1| PREDICTED: BAHD acyltransferase At5g47980-like [Prunus mume]
Length=446

 Score =   195 bits (495),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 141/450 (31%), Positives = 224/450 (50%), Gaps = 36/450 (8%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVDEL  223
             M+ E+ +R+ IKPSSPTP  LR +  S++DQL      P V FY   G +     +   +
Sbjct  1     MEFEIIKRETIKPSSPTPHYLRNFKLSLLDQLGPVAYEPLVLFYPKNGIATPQKSIWI-I  59

Query  224   KKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREMVP  403
             KKSLS+TL+  YPLAGRIK +  SI+CND GV+++E  V   LS+FL  PD + +R+++P
Sbjct  60    KKSLSETLTRFYPLAGRIKGN-ISIDCNDHGVDYVEARVNGLLSTFLSKPDAQTLRKLLP  118

Query  404   CNPFTGAFEPNPD-GRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRGC  580
              +    A  P    G +L++Q N F CGG+++G+ MSH + D AS+S F   W+    G 
Sbjct  119   VD----AESPEAGRGPLLLVQANVFDCGGLAIGVCMSHKLADAASLSTFILAWSATALGF  174

Query  581   --AVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQLR  754
               A++ D    F AS  FPP  + +   Q +   +     +   V +RF   AS I  LR
Sbjct  175   SQALLPD----FSASFRFPPTDHASSFQQSSVDVK-----RVNCVTKRFVFYASKIAGLR  225

Query  755   EQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKG--RINLHVLTSILNLRNRMEPPFPE  928
              +       +P+RAEA+ A++W  V+AA  +         L VL+  +++R R+ PP  +
Sbjct  226   TKAASAIVDQPTRAEAVTALIWRCVVAAASRSSSSLQSPKLSVLSQSVDIRKRVVPPLSD  285

Query  929   NCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTALPIM  1108
             + +GN       H +   E       L +K R  I+ +++   +R          AL ++
Sbjct  286   DSIGNLVGYFAAHTD---ETKLELQGLVVKLRKGIKELSNSYTKRLQK-----DQALQVV  337

Query  1109  SEIIKHEG---SKKNMYCLYTSSLLG--MQVYAADFGWGKPRWAVNAQVMKDSVV--FME  1267
              +  K       + ++   Y  + L     +Y   FGWG P W  N     ++ V   + 
Sbjct  338   CKSFKEADEFIKRDDIINFYVGTDLCNYKLLYGVSFGWGNPIWLSNVPAASNNNVASLVS  397

Query  1268  GRF-GGVDLWMGLPEELMNIVMKNPQFVEF  1354
              R  GG++ W+ L EE M    ++ + + F
Sbjct  398   TREDGGIEAWVTLSEEDMAAFEQDQELLAF  427



>ref|XP_004298111.1| PREDICTED: salutaridinol 7-O-acetyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=436

 Score =   195 bits (495),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 138/448 (31%), Positives = 223/448 (50%), Gaps = 29/448 (6%)
 Frame = +2

Query  41    TMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVDE  220
             T++I +   D I+PSS TP  L+T+N S++DQL+    IP + FY +   +    G   +
Sbjct  3     TLEICIIGIDSIRPSSSTPIQLKTFNLSLLDQLAPATYIPVLLFYTTSDLTA-AAGRTLQ  61

Query  221   LKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREMV  400
             LKKSLS+TL+  YP AGRIK D  SI+CND G  F E  V+  LS  L+ PD E++++++
Sbjct  62    LKKSLSETLTRFYPFAGRIK-DNFSIDCNDDGAGFTEAQVSCFLSDILKAPDHEVLKQLL  120

Query  401   PCNPFTGAFEPNPDGR--VLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINR  574
             P N      E   +GR  VL +Q N F CGGI +G+ +SH I D A++S F  +WA  N 
Sbjct  121   PIN-----CESFIEGRGCVLHVQANYFKCGGIGLGICLSHKIADAATLSTFLRSWA--NT  173

Query  575   GCAVVDDGGFIFDASKIFPP---VKNTADLDQFARVARGAAESQEKYVVRRFYIPASAID  745
                + +    IF+A+ + PP         L+   ++        +K V +R+    S + 
Sbjct  174   ASGISEKVCPIFNAASMTPPRDISMTPPTLENLNKI------RDDKSVTKRYVFNGSKMT  227

Query  746   QLREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPFP  925
              L+ +   +S  + ++ E + A++W   + A++        L  L   +N+RNR  PP P
Sbjct  228   ALKAKAPSLSVKQATKVEIVAALIWKCAMKASRTNFGSSSRLSALYQNVNIRNRTVPPLP  287

Query  926   ENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTALPI  1105
              + +GN   G+ +   + TE     H L  + R  I     +A R    +   +      
Sbjct  288   NDSVGNFV-GSFIATAEDTEAE--LHGLVSELRKGIEEFCKKANRLPLSED--ISVICEP  342

Query  1106  MSEIIKHEGSKKNMYCLYTSSLLGMQVY-AADFGWGKPRWAVNA-QVMKDSVVFMEGRFG  1279
               E ++   S  +M     +S     +Y AADFGWGKP W  +     K+ V  M+ + G
Sbjct  343   QMEAMRMLTS-DDMALYACTSWCRFPLYEAADFGWGKPVWMSSCIPPAKNMVFLMDTKGG  401

Query  1280  -GVDLWMGLPEELMNIVMKNPQFVEFVS  1360
              G++ W+ L +E M +   + + + + S
Sbjct  402   DGIESWVRLSQEDMKLFECDQELLAYAS  429



>ref|XP_002514983.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
 gb|EEF47537.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
Length=442

 Score =   195 bits (495),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 140/451 (31%), Positives = 225/451 (50%), Gaps = 33/451 (7%)
 Frame = +2

Query  38    ITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFY------DSPGSSRD  199
             +  K+E+ ++D IKPSSPTP  L+    S++DQ         + FY      D+      
Sbjct  3     MATKVEIIQKDTIKPSSPTPHDLKILKLSLLDQFIPITYTSLLLFYPINYGDDNLDHHAS  62

Query  200   YNGVVDELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDF  379
              +    +LKKSLS+TL+  +PLAGR++ D +S+ C+DQG EFIE  V   LS  L+NPD 
Sbjct  63    TSEKSLKLKKSLSETLTHFHPLAGRLR-DNTSVACDDQGAEFIEARVNCLLSELLKNPDA  121

Query  380   EMIREMVPCNPFTGAFEPNPD---GRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFA  550
             +++ + +P      A   +P+   G +L++Q   F CGG++VG+ +SH + D A+++ F 
Sbjct  122   QVLSQFLP------APIESPEAATGNLLLVQATFFDCGGLAVGICISHKMADAATLTTFI  175

Query  551   NTWARINRGCAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAE-SQEKYVVRRFYI  727
               W+      + + +   +F  + IFPP+  +        + R   E  Q+K V RRF  
Sbjct  176   RCWSATATDRSKILNP--VFMGASIFPPIDIS--------IPRTPVELMQQKCVTRRFVF  225

Query  728   PASAIDQLREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNR  907
              A  I  LR ++   +   P+R EA+  ++W + + A++ R  G     + +  +N+R R
Sbjct  226   AAPKIAALRAKVASTTVPDPTRVEAVSGILWKSAVTASRIRF-GYSRPSIWSISVNMRTR  284

Query  908   MEPPFPENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFL  1087
               PPFPEN  G N  G         E       L  + R  I+G  +   ++  G+G  L
Sbjct  285   FVPPFPENYAG-NCLGHIAPILMDGECEFELKELVGRVRKEIKGFGENYVKKLQGEGALL  343

Query  1088  HTALPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNA-QVMKDSVVFM  1264
                     E      S  N + + T S    ++Y ADFGWGKP W  NA   +++  + M
Sbjct  344   -AVCGFAKEFGNLAMSNDNDFYICT-SWCKYELYDADFGWGKPVWVGNASHKVRNVAILM  401

Query  1265  EGRFG-GVDLWMGLPEELMNIVMKNPQFVEF  1354
             + R G G+++W+ L EE M     N + +EF
Sbjct  402   DTRDGDGIEVWLTLGEEDMAFFESNEELLEF  432



>ref|XP_008226093.1| PREDICTED: BAHD acyltransferase At5g47980-like [Prunus mume]
Length=449

 Score =   195 bits (495),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 140/457 (31%), Positives = 221/457 (48%), Gaps = 37/457 (8%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFY-----DSPGSSRDYNG  208
             MK+EV  ++ IKPSSPTP  L+T N S+ DQLS +V IP + FY     D   ++ D++ 
Sbjct  5     MKVEVTHKETIKPSSPTPSHLQTTNLSVFDQLSPDVYIPLLLFYPKNSRDDEANNIDHHS  64

Query  209   VVDE----LKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPD  376
              + E    LK SLS+TL+  YP AG   E   SI CND G  F E  V   +S+ L+ PD
Sbjct  65    SIAERSKILKTSLSETLTHFYPFAGEF-EYNVSISCNDHGAAFFEARVNCPISTILDEPD  123

Query  377   FEMIREMVPCNPFTGAFEPNPD-GRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFAN  553
             F ++R+++P    TG      D G +L++Q N F CGG+++G+  SH I D  ++S F  
Sbjct  124   FGILRKLLP----TGIGSTQADTGFLLLVQANFFECGGLAIGVSSSHIITDAYTLSRFIK  179

Query  554   TWARIN-RGCAVVDDGGFIFD----ASKIFPPVKNTADLDQFARVARGAAE-SQEKYVVR  715
             +WA I   G    D    +      A+ +FP       LD F    + A E ++EK + +
Sbjct  180   SWADIALMGSTTTDHHALLPKKFGAAATLFP------QLD-FLNSPQPALEFAEEKCITK  232

Query  716   RFYIPASAIDQLREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILN  895
             RF   AS I  L+ +    +   P+R EA+ A++W   +  ++  + G +     +S++N
Sbjct  233   RFVFHASKIAALKSRAASATAPNPTRVEAVSALIWKCAMETSRLSNSGVVRASEWSSVVN  292

Query  896   LRNRM-EPPFPENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYG  1072
             +R  + + P   + +GN     +V        +    +L  K R  +     E  + +YG
Sbjct  293   IRKILVQQPLAYDLMGNLVGLFSVRTVASEVVDIDVQSLVAKLRKGV-----EEFKIKYG  347

Query  1073  KGGFLHTALPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQVMKDS  1252
              G     A     E         + Y    SS      Y  +FGWGKP W   +  +K+ 
Sbjct  348   NGVSGEKACQFFREFGNLMTRDVDNY--KCSSWGRFPFYETNFGWGKPLWVCQSTGLKNL  405

Query  1253  VVFMEGRFG-GVDLWMGLPEELMNIVMKNPQFVEFVS  1360
             +V M+ R G G+++ +   EE M +   N + + + S
Sbjct  406   IVLMDTRDGVGIEVSLTFKEETMAVFETNKELLAYAS  442



>ref|XP_010061156.1| PREDICTED: vinorine synthase-like [Eucalyptus grandis]
 gb|KCW68074.1| hypothetical protein EUGRSUZ_F01758 [Eucalyptus grandis]
Length=449

 Score =   195 bits (495),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 137/456 (30%), Positives = 218/456 (48%), Gaps = 34/456 (7%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNG---VV  214
             M++ V  ++ +KP SPTP  L+ +  S++DQ      +P V FY    + R       +V
Sbjct  1     MEVVVVSKEFVKPYSPTPNHLKIHKLSLLDQFMPTAYVPLVLFYTIEEADRAATTPLRMV  60

Query  215   DELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIRE  394
               LK+SLS+TL L YPLAG+I  D  SIEC+D+GV F+E     +LS  L  PDF+ +R+
Sbjct  61    QLLKQSLSETLPLFYPLAGKINGDGLSIECDDEGVLFVEARAEFALSRLLHQPDFKTVRK  120

Query  395   MVPCNPFTGAFEPNPDG-RVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARIN  571
              +PC     A+     G RV ++QV  F CGG+ VG+++SH   DGAS + F   WA   
Sbjct  121   FLPC---AAAWRRTEVGDRVAMVQVTAFPCGGVVVGVLISHTAADGASFATFLKGWAAAA  177

Query  572   RGCAVVDDGGFIFDASKIFPPVKNTADLDQF---ARVARGAAESQEKYVVRRFYIPASAI  742
             R           FDA  +F   K  ++ D F     V RG      +Y  RR    ASA+
Sbjct  178   RKTGEAPHPS--FDAPTLFIQNKAFSEEDTFFGMCPVNRG------RYGTRRLVFDASAM  229

Query  743   DQLREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPF  922
              +L+ +   +    P+R E + A++  + + A   +  G     V  + +NLR R  P F
Sbjct  230   ARLKAKTANVGVQNPTRTEVVTALMCKS-LTATMTKVSGLDKPVVFPNAVNLRRRAVPNF  288

Query  923   PENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGF--LHTA  1096
              ++ +GN  +  T+      +      +L    R+A   ++ E  +   G GGF  L  A
Sbjct  289   HDDSMGNYVWLPTILCQLEEKDYDGLPSLIGWLREAKSKIDGEFVKSLEGDGGFNALQDA  348

Query  1097  LPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAV-------NAQVMKDSV  1255
             L    E +      +    +  SS      Y  DFGWG+P W         +  ++ ++V
Sbjct  349   LRETRESL-----ARTDRLVSFSSWCNFGHYEIDFGWGRPAWVSPVGFPEESENLIGNTV  403

Query  1256  VFMEGRF-GGVDLWMGLPEELMNIVMKNPQFVEFVS  1360
             + M+ R   GV+ W+ + E  + ++ ++ +  E+ S
Sbjct  404   LLMDTRCRKGVEAWVFMDERELEVLEQDEELTEYAS  439



>emb|CDP15027.1| unnamed protein product [Coffea canephora]
Length=432

 Score =   194 bits (493),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 139/436 (32%), Positives = 215/436 (49%), Gaps = 27/436 (6%)
 Frame = +2

Query  47    KIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVDELK  226
             ++E+  ++ IKPSSPTP  L+  N S +D+L   + +P++ FY +  SS D + +  +LK
Sbjct  3     QVEIILKEYIKPSSPTPLHLKHQNLSFIDRLPTPIYLPFILFYQNHASS-DRSQISQQLK  61

Query  227   KSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREMVPC  406
              S+SQ L+  YPLAGRI++D   ++CND G  FIE  V  SLS   +N   E     +P 
Sbjct  62    LSISQALTKFYPLAGRIQDD-VFVDCNDSGALFIEAQVHSSLSEATQNFVIEEFNHYLPI  120

Query  407   NPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRGCAV  586
              P+        +   L +Q++ F CGG+SVG+ +SH I D  S+ +F N+WA I RG   
Sbjct  121   KPYEIIENSLRNDVPLAVQISFFECGGMSVGVCISHRIADALSVVMFLNSWAAICRGS--  178

Query  587   VDDGGFI---FDASKI-FPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQLR  754
              DD   +   FD   + FPP ++        R    +   ++K V +RF      +++++
Sbjct  179   -DDREILTPNFDVGCLHFPPPEDV------PRAPLISVADKQKIVAKRFVFSKEKLERIK  231

Query  755   EQLRLISHYR---PSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPFP  925
             E     S      P+R EAL A +    I  N+ +      + V    +NLR +M+ P  
Sbjct  232   ELASSDSTSTIRDPTRVEALSAFICKNFIEVNRSKLDSE-TMFVAIHNVNLRPKMKLPHD  290

Query  926   ENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTALPI  1105
             E   GN +   +       E     H LA   R AIR VND+  +    +       L I
Sbjct  291   EFAFGNVSLPISAVLMPEMEK--ECHNLAGHLRYAIRNVNDDFVKNVVQQR---EPYLRI  345

Query  1106  MSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQV-MKDSVVFMEGRFG-  1279
             +SE  K     +  YC +T S     VY  DFGWGKP     A V  K++++ M  + G 
Sbjct  346   LSETRKLLSKTEMCYCNFT-SWCRFPVYEVDFGWGKPFAIGTAAVPRKNTIILMSTKCGD  404

Query  1280  GVDLWMGLPEELMNIV  1327
             G++ W+ + E+ M ++
Sbjct  405   GIEAWINMAEDHMELL  420



>ref|XP_002514982.1| 3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase, putative [Ricinus 
communis]
 gb|EEF47536.1| 3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase, putative [Ricinus 
communis]
Length=441

 Score =   194 bits (494),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 136/437 (31%), Positives = 219/437 (50%), Gaps = 35/437 (8%)
 Frame = +2

Query  80    PSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFY--DSPGSSRDYNGVVDELKKSLSQTLSL  253
             PSSPTP  LR +  S++DQLS       +  Y  + P ++ D + +   LK+SLS+TL+ 
Sbjct  15    PSSPTPNHLRIFKLSLLDQLSPAAYGSMLLVYSINKPSTAIDKSQL---LKRSLSETLTR  71

Query  254   MYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENP-DFEMIREMVPCNPFTGAFE  430
              YPLAG+IK D S++ECND G  ++E  V   LS  LE P D ++IR ++P        E
Sbjct  72    FYPLAGKIK-DNSAVECNDDGAVYLEAQVDCLLSKLLEKPDDHQVIRNLIPAEHIQSLSE  130

Query  431   PNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRGCAVVDDGGFI-  607
                 G +L++Q   F+CGG+++G+ +SH + D  ++  F   WA      A+  D   + 
Sbjct  131   TQA-GCLLLVQATFFACGGLAIGVCISHKLADARTVCTFIQGWA----AAALGTDHEAVR  185

Query  608   --FDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQLREQLRLISHY  781
               F+ S IFPP    ++L            ++EK V +R+   AS I  L+++    S  
Sbjct  186   PKFNVSSIFPPQNLPSEL--------AVKLNEEKCVTKRYVFHASGIATLKDKAASESVR  237

Query  782   RPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPFPENCLGNNTYGAT  961
              P+R EA+ A++W   + A++   K +  + VL   +N+R ++ PP  E  +GN      
Sbjct  238   HPTRVEAVTALIWKCAMKASRSNSK-QPKMSVLAQSVNIRKKLVPPLSEYSIGNLMGHFA  296

Query  962   VHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTALPIMSEI--IKHEGS  1135
             +   + TE       L  K R  I+   +    ++  +G  L      + E+  + H GS
Sbjct  297   L---RATENEVELGTLVTKMRKGIQEFGENYV-KKLQEGNALKAVFEALKEMGSLLHGGS  352

Query  1136  KKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQ-VMKDSVVFMEGRFG-GVDLWMGLPE  1309
              +  Y   TSSL     Y  DFGWGKP W V  +  +K+ +  ++ R G G++ W+ L E
Sbjct  353   TE-FY--ITSSLCRFPFYGIDFGWGKPAWVVPPRDPIKNIISLIDARDGNGIEAWVTLKE  409

Query  1310  ELMNIVMKNPQFVEFVS  1360
             E M I  ++ + +   S
Sbjct  410   EDMAIFERDQELLAVAS  426



>ref|XP_009371382.1| PREDICTED: BAHD acyltransferase At5g47980-like isoform X2 [Pyrus 
x bretschneideri]
Length=474

 Score =   195 bits (496),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 138/462 (30%), Positives = 222/462 (48%), Gaps = 52/462 (11%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFY----DSPGSSRDYNGV  211
             +K+E+  ++ IKPSSPTP+ L + + S+ DQ +  + +P + FY    D   ++ D++ +
Sbjct  36    IKVEITHKETIKPSSPTPRHLSSTDLSVFDQFTPEIYVPLLLFYPRSSDEEVNNIDHHSL  95

Query  212   VDE----LKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDF  379
               E    LK SLS+ L+  YP AG    +  SI CND G  F E  V  SLS  LENPD 
Sbjct  96    FAERSNLLKTSLSEALTRFYPFAGEFVYN-VSIRCNDHGAGFHEAQVNCSLSKILENPDL  154

Query  380   EMIREMVPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTW  559
              +++  VP    +   E    G +L++QVN F CGG+++G+ +SH + D +++S F  +W
Sbjct  155   GILKLFVPTAVESKQAEA---GHLLLVQVNLFKCGGMAIGVSISHKVADASTLSTFIKSW  211

Query  560   ARINRGCAVVDDGGFIFD----ASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYI  727
               I  G  +      +      A+ +FPP       D F+        ++ K V +RF  
Sbjct  212   TEIALGSGITTVPAVLPAEFRVAATLFPPQ------DFFSSSKPIVEFAENKCVTKRFVF  265

Query  728   PASAIDQLREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNR  907
              A+ I  L+ +   I+   P+R E + A++W     A+ + + G +   VL  +LN+R R
Sbjct  266   DAAKIAALKSKAASITLPNPTRVEVVSALIWKCATEAS-RSNLGFVKPSVLLQVLNMRKR  324

Query  908   MEPPFPENCLGNNTYGATVHWNQPT---EGNPSRHALALKFRDAIRGVNDEAARRRYGKG  1078
                   EN LGN        W  PT   E      +L  K R  I     E  + +Y  G
Sbjct  325   SGQAMTENILGN------FLWYFPTTTMESELDLESLVGKLRKGI-----EEYKEKYSNG  373

Query  1079  GFLHTALPIMSEIIKHEG------SKKNMYCLYTSSLLGMQVYAADFGWGKPRW-AVNAQ  1237
                  +  ++ + +K  G      S +N  C   +S      Y A+FGWGKP W + +  
Sbjct  374   ----LSSEVIFQSLKESGNLLLKDSTENYTC---TSWCRFPFYEANFGWGKPSWVSTHGS  426

Query  1238  VMKDSVVFMEGRFG-GVDLWMGLPEELMNIVMKNPQFVEFVS  1360
              +K+ ++ M+   G G++  + L EE M IV  N + + + S
Sbjct  427   ELKNKILLMDMSDGVGIEASLTLKEEDMAIVESNKELLAYAS  468



>ref|XP_004152282.1| PREDICTED: salutaridinol 7-O-acetyltransferase-like [Cucumis 
sativus]
 gb|KGN53109.1| hypothetical protein Csa_4G016480 [Cucumis sativus]
Length=477

 Score =   195 bits (496),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 141/482 (29%), Positives = 226/482 (47%), Gaps = 59/482 (12%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFY-----DSPGSSRDYNG  208
             M+++V  ++ I PSSPTP  L+T+  S++DQ S  +  P + FY     D P   + +  
Sbjct  1     MEVKVLSKENIMPSSPTPPHLKTFQLSLLDQFSPVLYAPLIIFYTMDNKDDPRHHQSHEK  60

Query  209   VVDELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMI  388
             ++  LK SLS+TLS  Y LAGRI +   SI C+D+G  FIE  V+ S+S  L+ P+ E +
Sbjct  61    LMATLKSSLSKTLSHFYLLAGRIVD--KSICCSDEGAVFIEATVSCSMSEILKQPNNEFL  118

Query  389   REMVPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARI  568
              ++VPC+      +P  +   +++QVN F CGGI++ L + H + D  +I  F   WA I
Sbjct  119   MKLVPCS--ERCTKPIEEYAHVIVQVNVFDCGGIAISLCLLHKLMDATTIGCFLKCWATI  176

Query  569   NRGCAVVDDGGFIFDASKIFPP---VKNTADLDQFARVA---------------------  676
             N+      +      AS++F P   + N  + D F+++                      
Sbjct  177   NKRSFATTNLTIDNGASELFTPPSSMTNDDNSDPFSKMVCYDYKELSSLFPQTNFLPFHP  236

Query  677   ----RGAAESQEKYVVRRFYIPASAIDQLREQLRLISHYRPSRAEALIAVVWDAVI-AAN  841
                   ++  +EK   +RF     AI  L+ + +      P+  E L   +W   + AA+
Sbjct  237   RLHEALSSNCEEKSSFQRFVFKEKAILDLKAKAKSNDVPNPTSVEVLSGFIWKCALEAAS  296

Query  842   QKRHKGRINLHVLTSILNLRNRMEPPFPENCLGNNTYGATVHWNQPTEGNPSRHALALKF  1021
              K    +I   +LT  +NLR RMEPP PE  +GN  +    H+    +       L    
Sbjct  297   TKLGLSQIP-SILTHAVNLRKRMEPPLPEFSVGNIFWNVVAHYLADKKTQVELSELVSLI  355

Query  1022  RDAIRGVNDEAARRRYGKGGFLHTALPIMSEIIKHEGSKKNMYC-----LY-TSSLLGMQ  1183
             R +   +N    +R  G  G         SE +     ++NM       LY  +S   M 
Sbjct  356   RQSFVDINGNYIKRIVGNEG---------SEALVKLVWERNMKLFQIPKLYICTSWRNMD  406

Query  1184  VYAADFGWGKPRWAVNA----QVMKDSVVFMEG-RFGGVDLWMGLPEELMNIVMKNPQFV  1348
             +   +FGWGKP W  +A      +K+ +V ++     GV+ W+ L EE M I+++N +F 
Sbjct  407   LSEVNFGWGKPVWIGSAGNSNTTIKNMIVLLDAISNDGVEAWVILEEEEMQILLQNQEFF  466

Query  1349  EF  1354
              F
Sbjct  467   NF  468



>ref|XP_004310183.1| PREDICTED: vinorine synthase-like [Fragaria vesca subsp. vesca]
Length=435

 Score =   194 bits (493),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 143/470 (30%), Positives = 234/470 (50%), Gaps = 68/470 (14%)
 Frame = +2

Query  38    ITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSS-RDYNGVV  214
             + + +EV  ++II PSSPTP  LR Y  S +DQL+  V  P V FY+S   +  +   + 
Sbjct  1     MKVDVEVTSKEIITPSSPTPAHLRHYQLSSLDQLAPLVYNPLVLFYESNDKTVPNITEIS  60

Query  215   DELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIRE  394
               LKKSL++ L+L YPLAGRIK D   ++CND+G+ ++E  V   LS FL+NP  + + +
Sbjct  61    SHLKKSLAEVLTLFYPLAGRIKHDW-CVDCNDEGIPYLEAQVNCKLSDFLKNPIPDQLTK  119

Query  395   MVPCNPFTGAFE--PNPDGRV-LVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWAR  565
              VP       FE   + D  + L +Q++ F CGG ++G  +SH + D +S  +F+ TWA 
Sbjct  120   FVP-------FELGDHIDKELALGVQLSVFDCGGFAIGQCVSHRLADASSYFMFSKTWAA  172

Query  566   INRGCAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAID  745
               RG A ++    +F  ++ FPP K+    D    +++         V +RF   A+ ++
Sbjct  173   TARGEANIEHPD-LFSGTR-FPP-KDVLAYDPSFNISKNK-------VTKRFLFNATMLE  222

Query  746   QLREQL------RLISHYRPSRAEALIAVVWDAVIAANQKRHKGRIN--LHVLTSILNLR  901
              LRE+          +  RPSR +AL + VW   + AN  +  G  +  L+++   +NLR
Sbjct  223   ALREKYVEGAFGSKENQKRPSRVDALTSFVWSRYL-ANSIKITGADDEKLYIMIHAVNLR  281

Query  902   NRMEPPFPENCLGN---------------NTYGATVHWNQPTEGNPSRHALALKFRDAIR  1036
              R  PP P+N  GN               NTYG  +                 + R  I+
Sbjct  282   PRFVPPLPQNSFGNIYRVAMTGPLLRDACNTYGRAME----------------EVRAEIK  325

Query  1037  GVNDEAARRRYGKGGFLHTALPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKP  1216
              ++DE  +    + G   + +P+     +   ++  +  L  +S      Y  DFGWG+P
Sbjct  326   KIDDECVKGL--QQGAEQSWIPVNENTGRL--TELELVSLGFTSYCRFPAYDNDFGWGRP  381

Query  1217  RWAVNAQV-MKDSVVFMEGRFG-GVDLWMGLPEELMNIVMKNPQFVEFVS  1360
              W  +A +  K+   FM+ + G G++ ++GL E+LM     + +F+ +VS
Sbjct  382   AWVFSAPLTFKNLTAFMDTKEGDGIEAYIGLEEQLMAEFETDAEFLAYVS  431



>ref|XP_008360182.1| PREDICTED: vinorine synthase-like [Malus domestica]
Length=443

 Score =   194 bits (493),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 140/452 (31%), Positives = 224/452 (50%), Gaps = 31/452 (7%)
 Frame = +2

Query  38    ITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSR-DYNGVV  214
             + +++ V  ++II+PSSPTP  LR Y FS +DQ++  V  P + FY+       +   + 
Sbjct  1     MKVQVVVISKEIIRPSSPTPGHLRHYQFSFLDQMAPQVYNPLLLFYEYNAKMHPNITEIS  60

Query  215   DELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAE-SLSSFLENPDFEMIR  391
             + LK SLS+ LSL YPLAGRIK D   I CND+G+ +IE  V   +LS  L NP+ + + 
Sbjct  61    NHLKNSLSEALSLFYPLAGRIK-DNCFIHCNDEGIPYIEARVLNCTLSDVLSNPNPDELN  119

Query  392   EMVPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARIN  571
             + +P         P P G    +Q+N F CGG ++G  +SH I DG S   F+  WA I 
Sbjct  120   KFMPFE-LDDITNPLPFG----VQLNIFQCGGFAIGQCVSHKIADGLSYFTFSKIWAAIA  174

Query  572   RG-CAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQ  748
             RG  A +D   F+  ++ +FPP +     D       G     +  V +RF   AS I  
Sbjct  175   RGEQANIDPPQFV--SATLFPPKEFNTGFD-------GGVGITKDRVTKRFVFNASKIKT  225

Query  749   LR----EQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEP  916
             L+    + ++ +    P+R E L A +W   +AA +     +  L+++   +NLR R  P
Sbjct  226   LQAKYEKDMKSLQLKHPTRVETLSAFIWSRYVAATKDCTVNK--LYMVIHAVNLRPRFSP  283

Query  917   PFPENCLGNNTYGATVHWNQPTEGNPSR--HALALKFRDAIRGVNDEAARRRYGKGGFLH  1090
             P P++  GN    A     + + G        +  + R+AI  +++E  ++  G+G    
Sbjct  284   PLPQHSFGNLFRVAMTSPLRISNGGEEECDGVVIGEVREAISKIDNEYVKQLQGQG---D  340

Query  1091  TALPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVN-AQVMKDSVVFME  1267
               L +M +          +  L  SS     +Y  DFGWGKP W  + A   K+ V+FM+
Sbjct  341   EHLGLMKKAADSFKRGDMVAVLSFSSYCRFPLYENDFGWGKPAWVGSPALTYKNLVLFMD  400

Query  1268  GRFG-GVDLWMGLPEELMNIVMKNPQFVEFVS  1360
              + G G++ ++ L E +M     + + + +VS
Sbjct  401   TKEGDGIEAYVSLEERVMVKFECDSELLSYVS  432



>gb|ADD71922.1| BAHD-type acyltransferase [Actaea racemosa]
Length=424

 Score =   194 bits (492),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 143/453 (32%), Positives = 220/453 (49%), Gaps = 54/453 (12%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDY--NGVVD  217
             M++ V  R+IIKPSSPTP  L+  NFS+ DQ S +  +  + FY + G    +      D
Sbjct  1     MEVVVSSREIIKPSSPTPNHLKKLNFSLNDQYSTHY-VSVLLFYSAQGDVDRFKQTNTSD  59

Query  218   ELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREM  397
              LKKSLS+ L+  YPLAGRI  +   I+CND G+E++E  V   LS  L  P  + + ++
Sbjct  60    RLKKSLSEILTQFYPLAGRIINNEC-IDCNDDGLEYLEARVPCPLSQLLGCPKADELNQL  118

Query  398   VPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRG  577
             +P +            ++  +QV+ F CGGI++G+ +SH  GD +S++ F N+WA   +G
Sbjct  119   IPFS-----------QKLSAVQVSLFDCGGIAIGVTISHTAGDASSLTAFINSWAATAKG  167

Query  578   CAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQE--KYVVRRFYIPASAIDQL  751
                +    F FD   +FPP     D+   +    GA +  +  ++V +RF   +S +  L
Sbjct  168   ANEIVPPKFGFDY--LFPP----RDVPTVS-FGGGAVDYTQLPRFVGKRFIFDSSKLAAL  220

Query  752   REQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPFPEN  931
             +     +   RP+R E + A ++   +   + R        VL+  +NLR RM PP P +
Sbjct  221   KSACADVE--RPTRVEVVTAFIYKCFLNTIRSRSS---KPSVLSMPINLRGRMNPPLPPH  275

Query  932   CLGNNTYGATVH-WNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTALPIM  1108
               GN     T   W  P E  P  + L  + R+ IR VN          GGF+       
Sbjct  276   SFGNLAIRLTSQPW--PAEKEPELNCLVKQLRETIRKVN----------GGFVEKLQADN  323

Query  1109  SEII-KH-EGSKKNMYCLYTSSLLGMQV--------YAADFGWGKPRWAVNAQVMKDSVV  1258
             +E++ +H +  KK +    T  L  + V        Y ADFGWGKP WA    +   SV 
Sbjct  324   AELLFEHWKDWKKGIELSLTGDLNVLMVLICCRFPFYEADFGWGKPAWATRVNLYP-SVS  382

Query  1259  FMEGRFG-GVDLWMGLPEELMNIVMKNPQFVEF  1354
              ++ + G GV+ W+ L E  M      P  ++F
Sbjct  383   LVDTKDGEGVEAWVTLAEGDMTRFCSEPDLLDF  415



>ref|XP_007134037.1| hypothetical protein PHAVU_010G014100g [Phaseolus vulgaris]
 gb|ESW06031.1| hypothetical protein PHAVU_010G014100g [Phaseolus vulgaris]
Length=432

 Score =   194 bits (492),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 124/444 (28%), Positives = 225/444 (51%), Gaps = 19/444 (4%)
 Frame = +2

Query  38    ITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVD  217
             + +K+E+  ++ +K SSP P  L+ +  S++DQL+    +P + FY S   + D   +  
Sbjct  1     MEVKVEIVSKERVKASSPPPNKLKHFKLSLLDQLAPPFYVPVLLFY-SASDATDITTISH  59

Query  218   ELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREM  397
              LK SLSQ L+L YP  G ++ D S++ECN +GV F    +   LS+ L+NP    I ++
Sbjct  60    NLKASLSQLLTLYYPFCGTLR-DNSTVECNHEGVLFTHSTLPIHLSTILKNPHLHRINQL  118

Query  398   VPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRG  577
              P +P+  A +   +   +V+Q+N+FSCGG+++ +  SH I D +S + F   WA  +R 
Sbjct  119   FPLDPYNPARDTLLE--TMVVQLNQFSCGGVALAVCFSHKIADASSAASFLTAWAATSRK  176

Query  578   CAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQLRE  757
                +     + + + +FPP K   D      + RG     +  V +RF    + I +L++
Sbjct  177   EENILIAPQMEEGALVFPPRKIEMD------ITRGMV-GHKDIVTKRFMFNRTNISRLKQ  229

Query  758   QLRLISHYRPSRAEALIAVVWDAVI-AANQKRHKGRINLHVLTSILNLRNRMEPPFPENC  934
             ++  +  + P+  EA+ A++W + + AA     +G+    +++  +N+R+RM     ++ 
Sbjct  230   KVGSLEFF-PTSVEAVTALIWKSSLEAAKASSEEGKFPASMVSHAVNIRSRMASTLGKHS  288

Query  935   LGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTALPIMSE  1114
             +G N +   V      EG      L  + R+ IR V+     +   +G   +  +  + E
Sbjct  289   MG-NLWQQAVSPLVEVEGEVGLRDLGERVRETIRKVDGNYVSKL--QGDEFYEVIEGLKE  345

Query  1115  IIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQV-MKDSVVFMEGRFG-GVD  1288
               +   S+K + C   SS +   +Y  DFGWGKP +     V +K+ V+ M  + G G++
Sbjct  346   -ARRMASEKGVPCYSFSSWVRFGLYETDFGWGKPSYVRTIGVPIKNVVILMPTKVGDGIE  404

Query  1289  LWMGLPEELMNIVMKNPQFVEFVS  1360
              W+ L    M    +NP+ + F+S
Sbjct  405   AWITLTTNDMLHFQQNPELLHFLS  428



>ref|XP_010061158.1| PREDICTED: vinorine synthase-like [Eucalyptus grandis]
Length=470

 Score =   195 bits (495),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 142/464 (31%), Positives = 232/464 (50%), Gaps = 36/464 (8%)
 Frame = +2

Query  29    LHQITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNG  208
             LH   M+IEV   + IKPS+PTP +L+ +  S++DQL  +     V FY    ++   + 
Sbjct  5     LHHNVMEIEVISTEFIKPSNPTPDNLKIHKLSLLDQLMHSRYSALVFFYQGHDTTLSTSQ  64

Query  209   VVDELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMI  388
             +   LK SLSQ+L+  YP AG+IK DR SIEC+D G+ F       SLS FL+ PD   I
Sbjct  65    ISRTLKSSLSQSLTRFYPFAGKIK-DRLSIECDDGGIPFSVARAQSSLSRFLDRPDPRAI  123

Query  389   REMVPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARI  568
             ++ +P   F      +   RV ++Q+  F+CGGI+VG++++H + DG  +S F   WA  
Sbjct  124   QDFLPGATFKLV---DTGSRVAMVQMTTFACGGIAVGMLVAHVVADGVGMSTFLKAWA--  178

Query  569   NRGCAVVDDGGFIFDAS-KIFPPVKNTADLDQFARVARGAAESQEKYV-VRRFYIPASAI  742
              R    +DD    FD +  +FP  +   +   FA V   A   Q  +   RR    ASAI
Sbjct  179   ARAHESMDDVWPDFDTTLSLFPQYEAFPEKLSFASVY--APCYQRGWCGARRLVFDASAI  236

Query  743   DQLREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPF  922
              +++++       +PSR EA+ A++  +++AA   + K  +  H     ++LR R  P  
Sbjct  237   ARMKDKATSSRLQKPSRVEAVSALICKSMMAAVNPKPKAMLMAHY----VDLRRRATPTI  292

Query  923   PENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGF--LHTA  1096
             P   +GN+ + A   +  PTE N     +A + R+A   V+ +  +   G+GGF  L  A
Sbjct  293   PNYAVGNHLFLAVARFC-PTESN-DLAIIAGRLREATARVDGDLVKGLQGEGGFLKLREA  350

Query  1097  LPIMSEIIK--------HEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVN-------  1231
             +  + E+I            +   +  L  +S+    +Y  +FGWG P W  +       
Sbjct  351   VGEIKEVISGGMNGGGGGNINNNKLDYLGFTSMCNFGLYEINFGWGNPAWVTSIGLPGKK  410

Query  1232  -AQVMKDSVVFM-EGRFG-GVDLWMGLPEELMNIVMKNPQFVEF  1354
               ++   + VF+ + R G G++ W+   E  +  + K+P+ +EF
Sbjct  411   PIEIPNINYVFLSDTRCGNGIEAWILSDENRLLALEKDPEILEF  454



>gb|KCW81026.1| hypothetical protein EUGRSUZ_C02399, partial [Eucalyptus grandis]
Length=383

 Score =   192 bits (489),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 133/404 (33%), Positives = 201/404 (50%), Gaps = 33/404 (8%)
 Frame = +2

Query  38    ITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPG--SSRDYNGV  211
             +  KIEV   + IKPSSPTP  LR +NF ++DQL+    +P V FY +P   ++ D   V
Sbjct  1     MATKIEVVSTETIKPSSPTPPHLRNFNFCLLDQLAPTFYVPVVLFYLAPDQKAAPDSALV  60

Query  212   VDELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIR  391
                LK SL+Q LSL YPL GR+K + + I+CND+G           LS  L NPD + ++
Sbjct  61    SGNLKTSLAQALSLFYPLGGRVKGN-AGIDCNDEGA----AKARFELSKVLSNPDIDQLQ  115

Query  392   EMVPCNPFTGAFEPNPDGRVLV-IQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARI  568
             + +P +P       N D +V+V +Q N F CGG+ +G+ +SH I DGAS+S F N W+ I
Sbjct  116   QFLPFSP--SRVSTNIDEQVIVGVQANFFDCGGMGIGICISHKIADGASVSAFLNAWSEI  173

Query  569   -NRGCAVVDDGGFI---FDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPAS  736
              N G  V  +   I     AS++F P     ++            S EK   +RF     
Sbjct  174   ANNG--VDGEASLITPFLKASELFQPKDINYEMPS-------GVISSEKLSTKRFCFNGE  224

Query  737   AIDQLREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSIL---NLRNR  907
             ++ +LR          P+R EA+ A++W + +AA +KR + +      ++++   N+R+R
Sbjct  225   SLARLRAGF---GGANPTRVEAVTALIWKSALAAARKRPEWKEKYPPSSAVIHAVNIRSR  281

Query  908   MEP-PFPENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGF  1084
             + P P PE  LGN          +P +G+      A   R++IR ++ E      G+ G 
Sbjct  282   IRPQPLPETTLGNLVQAVVAPLMEPNKGD-ELQDFAGILRNSIRAIDSEYLSALQGENGL  340

Query  1085  LHTALPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKP  1216
                   +M+       S   +Y    SS      Y ADFGWG+P
Sbjct  341   AKACENLMTTRKLAASSAIELYRF--SSWARFPFYDADFGWGRP  382



>gb|KHN36442.1| Vinorine synthase [Glycine soja]
Length=466

 Score =   194 bits (494),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 136/464 (29%), Positives = 223/464 (48%), Gaps = 37/464 (8%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSR-DYNGVV--  214
             M++E+     IKPS  TP    TYN SI+DQ   ++ IP V FY    SS+ + +  +  
Sbjct  1     MEVEIISTQCIKPSCTTPNHPNTYNLSILDQFMPSIYIPMVLFYSFAQSSQANIDSTITQ  60

Query  215   ---DELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFE-  382
                 +LK+SLSQ L+  YP AGR+K D+ +I+CND+GV + E  V+ +L+ F   P+F  
Sbjct  61    QRLKQLKESLSQVLTHFYPFAGRVK-DKFTIDCNDEGVHYTEAKVSCTLAEFFNQPNFSS  119

Query  383   MIREMVPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWA  562
             +I ++VP  P     E   +G   ++QVN F+CGG+ +G ++SH I DGA  S F N+W 
Sbjct  120   LIHKLVPNQPI---MELATEGYTAMVQVNCFACGGMVIGTLISHMIADGAGASFFLNSWG  176

Query  563   RINRGCAVVDDGGFIFDASKIFPPVKNTADLDQFARVAR--GAAESQEKYVVRRFYIPAS  736
               N   +  D      +    FP   N         V    G   ++ +  +RRF   A 
Sbjct  177   S-NSNFSHQDAFDQFPNFDTPFPQNNNNYACPHDTNVMNLCGQFLNEGRVAMRRFLFDAE  235

Query  737   AIDQLREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLH---VLTSILNLRNR  907
             AI +LR Q   ++   P+R E    VV   +     K       L    ++T  +N+R R
Sbjct  236   AISRLRAQGSSLTVQNPTRVE----VVTSLLCKCTAKVFNANFGLERPTLITHAVNMRRR  291

Query  908   MEPPFPENCLGNNTYGATVHWNQPTEGNPSRHA---LALKFRDAIRGVNDEAARRRYGKG  1078
               P FP++C+GN  + A        +          L +K R+A+  +N +  +   G  
Sbjct  292   ASPMFPKSCMGNFAWLALALIMSSKDNKVIMELLPDLVVKLREAVSSINSDFVKGFEGDE  351

Query  1079  GFLHTALPIMSEIIKHEGS-----KKNMYCLYTSSLLGMQVYAADFGWGKPRW------A  1225
             G+      +  E+I+   S        +  ++ +S     +Y  D+GWGKP W      +
Sbjct  352   GYAKYC-EVSKELIEKASSFAATTTSGVNYVHFTSWCNFGLYDVDYGWGKPIWVSCVADS  410

Query  1226  VNAQVMKDSVVFMEGRFG-GVDLWMGLPEELMNIVMKNPQFVEF  1354
             V+  +  ++V+ M+   G G++ W+ L E+ M I+ ++ + + F
Sbjct  411   VDDSMFFNAVILMDTPSGNGIECWVYLNEDEMAILQQDKELLAF  454



>ref|XP_004140566.1| PREDICTED: BAHD acyltransferase At5g47980-like [Cucumis sativus]
 ref|XP_004157592.1| PREDICTED: BAHD acyltransferase At5g47980-like [Cucumis sativus]
 gb|AIT72029.1| acetyltransferase [Cucumis sativus]
 gb|KGN46392.1| hypothetical protein Csa_6G088700 [Cucumis sativus]
Length=433

 Score =   193 bits (491),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 134/448 (30%), Positives = 217/448 (48%), Gaps = 32/448 (7%)
 Frame = +2

Query  38    ITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVD  217
             + +K+++   +IIKPS  TP++    NFS +DQL++ V +P + FY SP  ++  +  + 
Sbjct  1     MALKVDIINEEIIKPSISTPKTHNHLNFSFLDQLALPVYVPLLLFY-SPKPNQIPS--IS  57

Query  218   ELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREM  397
              LK SLSQTL+  YP AGR+ +D  SI CND+G  F+E +   SL+  L + + + + + 
Sbjct  58    HLKSSLSQTLTQFYPFAGRVNDDNLSISCNDEGAIFVEAEANYSLNDILTHLNVDSLNQF  117

Query  398   VPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRG  577
             +P       F     G +++IQ   F CGGI+VGL+MSH I D +SIS F  TW  IN  
Sbjct  118   LP-------FHLANKGCIVLIQTTTFQCGGITVGLLMSHKISDASSISSFVKTWTSINVS  170

Query  578   CAVVDDGGFI---FDASKIFPPVKNTADLDQFARVARGAAES--QEKYVVRRFYIPASAI  742
              +  D+  F    F +  + PP         F   +    +S    K + +R   P S I
Sbjct  171   GS--DNPLFSKPEFVSDSVLPP-------PNFPVASPTTPDSGIHAKGITKRIVFPHSKI  221

Query  743   DQLREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPF  922
               L+ +    +   P+R EA+ A++W + ++A+ +   G     VL   +NLR  ++P  
Sbjct  222   ASLKAKAASSTVKNPTRVEAIAALLWKSAVSAS-RSTSGVSRASVLGQAVNLRKILKPNL  280

Query  923   PENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTALP  1102
             PEN +GN     T       E      ++    R+AI        ++      +L     
Sbjct  281   PENSVGNAIGFVTPETAVGAELE--LQSMVGLMREAIEEFKKNGYKKYQDTDAYLSYFKT  338

Query  1103  IMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQVM-KDSVVFMEGRFG  1279
             +M     + G K    C   SS    + Y ADFGWG P W +    M  +  + ++ + G
Sbjct  339   LMDPDGPYNGEKNFYLC---SSWSRFEFYEADFGWGCPVWFIGGISMFSNFFLLLDTKDG  395

Query  1280  -GVDLWMGLPEELMNIVMKNPQFVEFVS  1360
              G++  + L EE M++  ++   +EF S
Sbjct  396   KGIETLVSLSEEDMSVFERDEDLLEFGS  423



>ref|XP_004301806.1| PREDICTED: vinorine synthase-like [Fragaria vesca subsp. vesca]
Length=423

 Score =   193 bits (490),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 140/446 (31%), Positives = 219/446 (49%), Gaps = 30/446 (7%)
 Frame = +2

Query  38    ITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSR-DYNGVV  214
             +  + EV  + IIKP+SPTP  LR Y FS +DQ+S  V  P + FY+     + +   + 
Sbjct  1     MKFEAEVISKHIIKPASPTPDHLRHYQFSFLDQISPPVYSPLLLFYEFNAKIQPNITEIS  60

Query  215   DELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIRE  394
             + LK SL++ LSL YPLAGR K D   ++CND GV ++E  V   LS  L NP    + +
Sbjct  61    NHLKTSLAKVLSLYYPLAGRFK-DNQYVDCNDNGVPYLEVQVNCKLSDVLNNPIPGELNK  119

Query  395   MVPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINR  574
             ++P        +   +   L +Q+N F CGG ++   ++H + DG S   F+ TWA   R
Sbjct  120   LMPFE-----LDDVANKYPLGVQLNIFQCGGFAIAQCLTHKLADGLSYFTFSKTWAATAR  174

Query  575   GCAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQLR  754
             G   ++   FI  ++ +FPP +N +  D    + R         V +RF   AS I++LR
Sbjct  175   GEPKIEHPQFI--SATLFPP-RNLSGFDARTGITRNK-------VSKRFVFSASDIEELR  224

Query  755   EQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPFPENC  934
             E     +  RPSR EAL + +    + A  K        + +   +NLR+R EPP P + 
Sbjct  225   EVQANKASARPSRVEALSSFILSRFVEAT-KDIGSPDKFYRVVHAVNLRSRFEPPLPHHS  283

Query  935   LGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTALPIMSE  1114
              GN    A     + + G P  H +    R+ I  + D A  R+  KG    +++    +
Sbjct  284   FGNLYRVAMTAPLRISSGEPF-HGI----REEISKI-DNAYVRKLQKGDEHLSSI----K  333

Query  1115  IIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVN-AQVMKDSVVFMEGRF-GGVD  1288
              I    +K     +  SS     +Y  DFGWG+P W  + A   K+ V FM+ R  GG++
Sbjct  334   TIAKSFAKGEQVTISFSSYCRFPLYDNDFGWGRPTWVGSPALTFKNLVNFMDTREGGGIE  393

Query  1289  LWMGLPEELMNIVMKNPQFVEFVSAG  1366
              ++ L EE+M     + + + +VS+ 
Sbjct  394   AYISLEEEVMTKFESDVELLAYVSSS  419



>emb|CDP10330.1| unnamed protein product [Coffea canephora]
Length=445

 Score =   193 bits (491),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 139/453 (31%), Positives = 222/453 (49%), Gaps = 30/453 (7%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVDEL  223
             M++E+  ++IIKPS PTP  L+ +  S +DQ+S    + ++ FY    ++   N V  +L
Sbjct  1     MEVEIISQEIIKPSIPTPDHLKIFKRSFLDQISGRFLVRFISFYPRKETNLKINQVTHQL  60

Query  224   KKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREMVP  403
             K SLSQTL+L YPLAG  K+D SSIECND+G  F+   V  +++  L  P F+   ++  
Sbjct  61    KISLSQTLTLYYPLAGVYKDD-SSIECNDKGALFVTAHVRCNINELLNLPKFQQFHKLGT  119

Query  404   CNPFT--GAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRG  577
              + F   G F+       + +Q N FSCGG+++    SH + D  +ISVF   WA I+RG
Sbjct  120   SSKFLEDGPFQ-------VFVQFNTFSCGGVAIFTCFSHMVIDMPTISVFLKCWAAISRG  172

Query  578   CAVVDDGGFI---FDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQ  748
                    G     +++  +FPP K++  L  F+ V +G+     + + +RF   A AI  
Sbjct  173   SQDDQSPGHPYPRYESQVLFPP-KDSVPLG-FSVVVKGSLLKDGRSIRKRFVFSAPAISD  230

Query  749   LREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPFPE  928
             L+ +        P+  E + + +W   +AA  K  KG     V+    +LR RM PP PE
Sbjct  231   LKVKGTSKRVPDPTSVEVVSSFIWKHAMAA-AKVVKGFQQPSVIFHAADLRRRMVPPLPE  289

Query  929   NCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTALPIM  1108
                GN        +++  +       L    R A     DE   +    GGF      +M
Sbjct  290   YFAGNIGCPIVAEYDKIDDLEVKFGRLVKILRLAKEKNKDEFVPKLLSSGGF-----DMM  344

Query  1109  SEIIKHEGSK---KNMYCLYTSSLLGMQVYAADFGWGKPRW-----AVNAQVM-KDSVVF  1261
              + ++  G K   K++     SS   + +   DFGWGKP W         + M K+ VV 
Sbjct  345   IKFLEDWGEKCSNKDLNTYQFSSWCKIGLNEVDFGWGKPIWTSLVGGTEVESMYKNFVVL  404

Query  1262  MEGRFGGVDLWMGLPEELMNIVMKNPQFVEFVS  1360
             ++G  GG++ W+ L ++ M I+  + +F+ + S
Sbjct  405   VDGSDGGIEAWLILEQKEMAILENDREFLAYAS  437



>ref|XP_008383035.1| PREDICTED: vinorine synthase-like [Malus domestica]
Length=461

 Score =   194 bits (492),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 135/460 (29%), Positives = 220/460 (48%), Gaps = 46/460 (10%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYD-------SPGSSRDY  202
             + +EV  ++I+KPSSPTP  L  Y FS +DQ++  +    V FY+        P ++   
Sbjct  2     VNVEVISKEIVKPSSPTPNHLYHYQFSFLDQITPPIYTSLVLFYEFNDEIQPEPAAAV--  59

Query  203   NGVVDELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAES-LSSFLENPDF  379
               +   LKKSLS+ L+L YPLAGR+K D   ++CND+G+ ++E  V    L  F +NP  
Sbjct  60    --ISKRLKKSLSEVLTLFYPLAGRVKIDNHLVQCNDEGIPYLEAQVTNCRLCDFQQNP--  115

Query  380   EMIREMVPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTW  559
              M  E+    PF      N +   L +Q+N F CGG ++GL +SH + DG S+ +F NTW
Sbjct  116   -MPGELFKLIPFELRDHDNSE-FALGVQLNIFECGGYAIGLCISHKLADGLSMIMFTNTW  173

Query  560   ARINRGCAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASA  739
             A I RG          F ++ +FPP  + +    F  + +         V +RF   A  
Sbjct  174   AAITRGENETKIERPEFVSAAVFPPADDVSGYRTFGVIPKNK-------VTKRFVFNAPT  226

Query  740   IDQLREQLRLIS----HYRPSRAEALIAVVWDAVIAANQKRHKGRIN-LHVLTSILNLRN  904
             I+ LRE+   ++       PSR +AL A +W  +  A++  H    N LH     +NLR 
Sbjct  227   IEHLREKYTGLAGDDREKLPSRVQALSAFLWRRLAEASKDDHSIDENILHAAVHTVNLRP  286

Query  905   RMEPPFPENCLGN-------NTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARR  1063
             R +PP P    GN           ++   +   +   S H +  + R+ +  ++ +  +R
Sbjct  287   RTDPPIPRCSFGNFYQIFLTTPLVSSSSSSSGIDDQESCHDMVKQVREELSKIDKDHVKR  346

Query  1064  --RYGKGGFLHTALPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRW-AVNA  1234
               + G G +L       +  I+       +  L  SSL    +Y  DFGWG+P W AV  
Sbjct  347   LQKGGHGSYL-------NRFIQRLAKPGKVVTLSYSSLCSFPLYDIDFGWGRPTWVAVPP  399

Query  1235  QVMKDSVVFMEGR-FGGVDLWMGLPEELMNIVMKNPQFVE  1351
                K+ +V  + +  GG++ ++ L ++      ++  F++
Sbjct  400   PPYKNLIVLADTKEAGGIEAYVSLADDDAMTKFESDAFIQ  439



>gb|KDP36817.1| hypothetical protein JCGZ_08108 [Jatropha curcas]
Length=446

 Score =   193 bits (491),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 142/457 (31%), Positives = 231/457 (51%), Gaps = 36/457 (8%)
 Frame = +2

Query  38    ITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVD  217
             + M++E+  +  I PSSPTP  L+TY  S++DQ   +     + FY +   +     +  
Sbjct  2     MNMEVEIFSKRSISPSSPTPTHLKTYKISLLDQFEPSGYFSTILFYLNSQET----SISV  57

Query  218   ELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREM  397
              LK+SLS+TLS  YPLAG++K DR SI+CND+GV +IE      LS +L  PD E + ++
Sbjct  58    LLKQSLSETLSRFYPLAGKVK-DRLSIDCNDEGVCYIEATSNIPLSQYLAQPDLESLEKL  116

Query  398   VPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRG  577
             +P    T   E      V +IQ   F+CGG ++G+ +SH + DGAS+ +F   WA     
Sbjct  117   IPNA--TRKSELPSGSHVALIQETTFACGGFTIGVSVSHMVCDGASLFLFLKDWAAAACK  174

Query  578   CAVVD---DGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQ  748
               V     DG  IF     FP     + L+ +A  A+     + K++ +R     SAI  
Sbjct  175   STVKHPYLDGESIFPQYAPFP--AEASILNIYASFAK-----EGKHITKRIVFKESAIAN  227

Query  749   LREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHV-LTSILNLRNRMEPPFP  925
             L+ + RL +   P+R E + A++   ++A    ++K  IN  + +T  +NLR + EPP P
Sbjct  228   LKAKARLNNINNPTRVEVVTAILSKRLMACF--KNKTGINKPLGITHAVNLRRKGEPPLP  285

Query  926   ENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGV-NDEAARRRYGKGGFL--HTA  1096
             E  +GN    A   +    E N     L    R+AIR V ND   + +  + GF   + A
Sbjct  286   ECLVGNCVSIAGAVFTAEEELN----ELVTGLREAIRKVGNDFLKKIKSKEDGFCEYYDA  341

Query  1097  LPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNA-QVMKDS-------  1252
             +  + ++     S   +     SS      Y  +FGWGKP WA  A   ++DS       
Sbjct  342   MKEIGDLFTTPESDSEVELAGFSSWCNFGAYDIEFGWGKPIWAGCAVPYVEDSDNPHFSV  401

Query  1253  VVFMEGR-FGGVDLWMGLPEELMNIVMKNPQFVEFVS  1360
             ++ M+ R + GV+ W+ + E+ ++ + K+ + +++V+
Sbjct  402   IILMDTRTYKGVEAWVSMNEDDLDFLEKDEELLQYVT  438



>ref|XP_010046625.1| PREDICTED: vinorine synthase-like [Eucalyptus grandis]
Length=346

 Score =   191 bits (484),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 115/348 (33%), Positives = 189/348 (54%), Gaps = 17/348 (5%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYN--GVVD  217
             MKI+V  ++ I PSS TP  ++TY FS++DQL+    +P V FY +P   +D++   + +
Sbjct  1     MKIQVISKETIMPSSATPSPVQTYRFSLLDQLAPPFYVPVVLFYSAPDPEQDFDHVNIYE  60

Query  218   ELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREM  397
             +LK SLS+ LS  YPLAGR K D  +++   QG  F+   V   L+  L NP+ ++++++
Sbjct  61    KLKTSLSECLSCFYPLAGRSKGDEHAVDLG-QGAVFVRTRVNARLAKLLANPELKLVQQL  119

Query  398   VPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRG  577
             +P +P+    +   +  V  IQ+N F CGGI +G+ +SH I DGA++S F ++W  I+RG
Sbjct  120   LPLDPYNIQCQ---NALVTAIQLNLFDCGGIGIGVCISHKIADGATLSTFLSSWGAISRG  176

Query  578   CAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQLRE  757
              + +       D + IFPP        +F          +EK V +RF   ++++  LR 
Sbjct  177   ASKL--VAPYQDTTTIFPP-------REFRVPLPNNLIKKEKIVTKRFEFDSASLAALRT  227

Query  758   QLRLISHYR-PSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPFPENC  934
             +    S  + P   EA+ A++  A + A  +      +  V++ ++NLR RM PP P++ 
Sbjct  228   KAGDGSTSKSPILVEAVTALICKAAMNARTEISGNGRSSTVISHVVNLRGRMNPPLPDHS  287

Query  935   LGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKG  1078
              GN    AT    +  E +   H LA   R AIR ++D+  R+  G+G
Sbjct  288   FGNIWRFATATIKE-EEDDAELHVLADHLRTAIRKIDDDYVRKLQGEG  334



>ref|XP_009783396.1| PREDICTED: acetyl-CoA-benzylalcohol acetyltransferase-like [Nicotiana 
sylvestris]
Length=431

 Score =   193 bits (490),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 133/448 (30%), Positives = 223/448 (50%), Gaps = 37/448 (8%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVDEL  223
             ++I+++ R ++KPS+PTP  LR++N S+ DQ++  V +  +  Y  P S  +   + D+L
Sbjct  4     LEIQIQIRKMLKPSTPTPNHLRSHNISLFDQVAPPVYVTILLHY-LPCSEWNSEEITDKL  62

Query  224   KKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFL-ENPDFEMIREMV  400
             +KSL++TL+  YPLAGR ++D  SI CND+GV+++E  V  +L+ FL E P  E++ +++
Sbjct  63    QKSLAETLTKFYPLAGRFRKDDLSIHCNDEGVDYVETKVNTNLAEFLHEGPKIELLDDLL  122

Query  401   PCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARIN---  571
             P               +L +QVN F+CGG+ +G+ + H + D  +++ F   WA+I+   
Sbjct  123   PKTDMLSV-------PLLGVQVNIFNCGGLVMGVQILHILADAFTLATFVKEWAQISQTG  175

Query  572   --RGCAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAID  745
               +GC       F F  S +FP         Q++  + G  E     V RRF   A AI 
Sbjct  176   TTKGCL----SSFDFLPS-LFP--TKVLSGHQYSLPSSGDPE----IVTRRFVFDALAIA  224

Query  746   QLREQLRLISH--YRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPP  919
             +L++++    H   RP+R   +++++W  ++  +  +H    +  +L  I NLR ++  P
Sbjct  225   KLKDRIGSSDHTFTRPTRVAVVMSLIWKVLVGISSAKHGHPRDSSLLFPI-NLRGKLNLP  283

Query  920   FPENCLGNNT--YGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHT  1093
               E  LGN      AT+  NQ  E N   + +    RD    +       +    G    
Sbjct  284   SLEYALGNFIVLVHATLKANQSKELNDFVNMIGNTSRDISVDIG------KASINGIAPM  337

Query  1094  ALPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQVMKDSVVFMEGR  1273
              +   +E +   G K  M    +SS   +  Y ADFGWGKP W  N     +    M+ +
Sbjct  338   FVNCDAEFVNKLGQKDEMDIYLSSSWCRLPWYEADFGWGKPFWVSNVSKTFEIFCLMDTK  397

Query  1274  FG-GVDLWMGLPEELMNIVMKNPQFVEF  1354
              G G++ W+ L E  M    K+P  + F
Sbjct  398   NGDGIEAWVSLKENDMAEFEKDPDILTF  425



>ref|XP_010528792.1| PREDICTED: BAHD acyltransferase At5g47980-like [Tarenaya hassleriana]
Length=447

 Score =   193 bits (490),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 132/457 (29%), Positives = 222/457 (49%), Gaps = 39/457 (9%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSP---------GSSR  196
             MK+E   ++ IKPSSPTP  LRT   S+ DQ    V    V F+ +          G   
Sbjct  1     MKVEAIGKETIKPSSPTPNDLRTVKLSVYDQFLPPVYTVSVLFFSNSCRHDQTQREGPMF  60

Query  197   DYNGVVDELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPD  376
               +    +LK SLS+TL+  YPL+GRI +   +I+CND+G  F++     +L  FL++PD
Sbjct  61    SEHDTSLKLKSSLSETLTRFYPLSGRINDGGDAIDCNDEGAVFVDARSDSTLLDFLKSPD  120

Query  377   FEMIREMVPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANT  556
             F  ++  +P +     +E      +L+++   F CGG+++G+ +SH I D ASIS+F   
Sbjct  121   FAALQRFLPLDTVENPYESAATWPLLLVKATYFKCGGLAIGICISHKIADAASISMFVRG  180

Query  557   WARINRGCAVVDDGGFI-FDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPA  733
             WA   RG +  D   +  F A+K FPP   +       R +      ++    +RF    
Sbjct  181   WAATARGDS--DSATYPEFTAAKFFPPASES------TRFSGKITLDRKICATKRFVFDG  232

Query  734   SAIDQLREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRME  913
             S I +LR ++       P+R E++  ++W  V+ A+    +  ++  VL   +NLR ++ 
Sbjct  233   SKIAELRRKVASGDVAEPTRVESITGLLWKCVVTASNSVSEKLLS-KVLNQPVNLRGKVP  291

Query  914   PPFPENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVN---DEAAR--RRYGKG  1078
                 EN +GN  Y +++      +G        ++ +DA++ +    DE  R  R  G  
Sbjct  292   SLLSENVMGNVMY-SSMPLMIDGQGE-------VEIQDAVKDLRRKADELKRFIRDDGGS  343

Query  1079  GFLHTALP--IMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVN--AQVMK  1246
               + T +   I+S I          Y +  SS   + +Y ADFGWG P W     A  + 
Sbjct  344   SLIGTKMVDLILSNISGLSYETHEPYSV--SSWCKLPLYEADFGWGSPAWVTGNVAPALD  401

Query  1247  DSVVFMEGRFG-GVDLWMGLPEELMNIVMKNPQFVEF  1354
             + ++ ++ + G GV+ W+ LPE++M    +N + + F
Sbjct  402   NLMILIDSKDGAGVEAWVTLPEQVMLSFEQNAELLAF  438



>ref|XP_006423966.1| hypothetical protein CICLE_v10028504mg [Citrus clementina]
 gb|ESR37206.1| hypothetical protein CICLE_v10028504mg [Citrus clementina]
Length=425

 Score =   192 bits (489),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 143/447 (32%), Positives = 227/447 (51%), Gaps = 29/447 (6%)
 Frame = +2

Query  38    ITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFY---DSPGSSRDYNG  208
             + + +E   R++IKPS+PTP  LR Y+FS +DQ +  + +  + FY   D    S + + 
Sbjct  1     MKITVETISREMIKPSTPTPNHLRHYHFSYLDQTAPPLYMSLLYFYHLDDHKLVSNNNHL  60

Query  209   VVDELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMI  388
              ++ LK SLS  L+  YPLAGR+K   S ++CND+GV F E  V+  LS  +     E+ 
Sbjct  61    FINSLKSSLSNVLTKYYPLAGRVK--NSYVDCNDEGVVFSEAKVSCLLSEIIN----ELP  114

Query  389   REMVPCNPFTGAFEP-NPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWAR  565
              E     PF    +  + +G  + IQVN F+CG +++ +++SH I D +S+  F   WA 
Sbjct  115   SEFNKLRPFDQEKDVVSINGLPIAIQVNMFNCGSVAIAVMISHKIADASSLITFTKNWAA  174

Query  566   INRGCAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAID  745
               RG +  ++    F A+++FPP       D             +K V+++F      I 
Sbjct  175   AARGGS--ENVFPEFAAARLFPPK------DAGGSSGVSVDPRPKKIVLKKFLFEGPKIT  226

Query  746   QLREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPFP  925
              LR++  L +   P+R EAL A +W + +AA+ +        ++L  ++NLR RMEPP P
Sbjct  227   ALRDKYGLDNGIYPTRVEALSAFIW-SRLAASTRIKISPERPYMLVHLVNLRKRMEPPLP  285

Query  926   ENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTALPI  1105
             ++  G N  GA V      E N     +  KFRDAI  V+ +  +    +   L T L I
Sbjct  286   DDSFG-NIIGAAV---TVLEENDDDDRMVNKFRDAICKVDKDYLKVMKLEHSEL-TDLVI  340

Query  1106  MSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQV-MKDSVVFMEGRFG-  1279
              +  I   G     YC + SSL    VY ADFG GKP W    ++  K+ +  ++ + G 
Sbjct  341   TNGEIVDRGELG--YCFF-SSLCKFPVYEADFGLGKPMWVAWGRLPYKNIIHLIDTKSGD  397

Query  1280  GVDLWMGLPEELMNIVMKNPQFVEFVS  1360
             G++ W+ L EE+M     + + + +VS
Sbjct  398   GIEAWVHLEEEVMAKFGNDQELLAYVS  424



>ref|XP_008383040.1| PREDICTED: BAHD acyltransferase At5g47980-like [Malus domestica]
Length=474

 Score =   194 bits (492),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 139/461 (30%), Positives = 223/461 (48%), Gaps = 50/461 (11%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFY----DSPGSSRDYNGV  211
             +K+E+  ++IIKPSSPTP+ L + + S+ DQ +  + +P + FY    D   +S D++ +
Sbjct  36    IKVEITHKEIIKPSSPTPRHLSSTDLSVFDQFTPEIYVPLLLFYPSSSDEEVNSIDHHSL  95

Query  212   VDE----LKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDF  379
               E    LK SLS+ L+  YP AG    +  SI CND G  F E  V  SLS  LE PD 
Sbjct  96    FAERSNLLKTSLSEALTRFYPFAGEFVYN-VSIRCNDHGAGFHEAQVNCSLSKILEKPDL  154

Query  380   EMIREMVPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTW  559
              +++  VP    +   E    G +L++QVN F CGG+++G+ +SH + D A++S F  +W
Sbjct  155   GILKLFVPTAVESKQAEA---GHLLLVQVNLFKCGGMAIGVSISHKVADAATLSTFIKSW  211

Query  560   ARINRGC------AVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRF  721
               I  G       AV+     +  A+ +FPP       D F+        ++ K V +RF
Sbjct  212   TEIALGSDSTIVPAVLPAEFRV--AATLFPPQ------DFFSSSKPIVEFAENKCVTKRF  263

Query  722   YIPASAIDQLREQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLR  901
                A+ I  L+ +    +   P+R E L A++W     A+ + + G +   VL  +LN+R
Sbjct  264   VFDAANIAALKSKAASTTLPNPTRVEVLSALIWKCATEAS-RSNLGFVKPSVLLQVLNMR  322

Query  902   NRMEPPFPENCLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGG  1081
              R      EN LGN  +  T   +   E      +L  K R  I     E  + +Y  G 
Sbjct  323   KRSGQALTENILGNFLWYFT---STTMESELDLESLVEKLRKGI-----EEYKEKYPSG-  373

Query  1082  FLHTALPIMSEIIKHEG------SKKNMYCLYTSSLLGMQVYAADFGWGKPRW-AVNAQV  1240
                 +  ++ + +K  G      S +N  C   +S      Y A+FGWGKP W + +   
Sbjct  374   ---LSSEVIFQSLKESGNLLLKDSTENYTC---TSWCRFPFYEANFGWGKPSWVSTHGSE  427

Query  1241  MKDSVVFMEGRFG-GVDLWMGLPEELMNIVMKNPQFVEFVS  1360
             +K+ ++ M+   G G++  + L EE M I+  N + + + S
Sbjct  428   LKNKILLMDMSDGVGIEALLTLKEEDMAIIESNEELLAYAS  468



>ref|XP_004238629.1| PREDICTED: vinorine synthase-like [Solanum lycopersicum]
Length=435

 Score =   192 bits (489),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 140/456 (31%), Positives = 229/456 (50%), Gaps = 49/456 (11%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSS--RDYNGVVD  217
             MK++V  R+ I+PSSPTP+ L+ +N  ++DQL      P V FY +      R+ + +  
Sbjct  2     MKVQVISRENIQPSSPTPKHLKKFNLCLLDQLIPAPYAPIVLFYPNLNDVKLREKSSL--  59

Query  218   ELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREM  397
              LKKSL+QTLS  YPLAGR + D  SI+CNDQGV ++  +V   L  +L  P+ E I + 
Sbjct  60    -LKKSLAQTLSSFYPLAGRFR-DELSIDCNDQGVNYVTTNVNCHLIDYLNKPNLESISQF  117

Query  398   VPCNPFTGAFEPNPDGRVLV-IQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINR  574
             +PC P    F+    G  +  IQ+N F CGGI++GL ++H + DGA +S F   W+ +  
Sbjct  118   LPCQP---PFKVLGVGDYVTNIQINVFECGGIAIGLCIAHKVLDGAGLSTFLKNWSGLVT  174

Query  575   GCAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQLR  754
                ++    + F +  ++  +++T+ +   +   +G       +V +R     SAID L+
Sbjct  175   CPNLM--ANYFFPSDDLW--LRDTSMIMWSSMFKKG------NFVTKRLVFNDSAIDNLK  224

Query  755   EQLRLISHYR-PSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPFPEN  931
              ++   +H + P++ E + + +W  +IA+N+K +       +LT I+NLR R  P  PEN
Sbjct  225   -RMSTSAHIKYPTKVEVVSSFIWKCLIASNKKSNS------LLTHIVNLRKRATPALPEN  277

Query  932   CLGNNTYGATVHWNQPTEGNPSRHALAL-----KFRDAIRGVNDEAARRRYGKGGFLHTA  1096
              LGN      + W    + N ++  + L     + R +I  ++D   +R  G  G     
Sbjct  278   ILGN------LIWLSSAKNNNAKRYVELADLVNQVRKSILKIDDGYVKRLRGDEG-CSLM  330

Query  1097  LPIMSEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRW----AVNAQVMKDSVVFM  1264
                + EI        N Y    SS      Y  DFG+GKP W    +       + ++ M
Sbjct  331   RKSLKEIEDFCSKGANHYGF--SSWCKFGFYDIDFGFGKPIWVSSISSKCSFFMNLIILM  388

Query  1265  EGRF--GGVDLWMGL-PEELMNIVMKNPQFVEFVSA  1363
             E      G++ W+ L  EE MN+++ N + + F S 
Sbjct  389   ESNRCDNGIEAWVTLDEEEEMNMLVDNQELLVFASV  424



>gb|KCW86591.1| hypothetical protein EUGRSUZ_B03223, partial [Eucalyptus grandis]
Length=396

 Score =   191 bits (486),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 135/412 (33%), Positives = 222/412 (54%), Gaps = 22/412 (5%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGV--VD  217
             MKI V  ++ IKPS  TP   +TY FS++DQL+    +P V FY +P   +D++ V   +
Sbjct  1     MKIRVISKETIKPSLVTPSQDQTYRFSLLDQLAPPFYVPVVLFYSAPEPDQDFDHVNIYE  60

Query  218   ELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREM  397
             +LK SLS+ L+  YPLAG+IK D  +++   QG  F++  V   L+  L NP+ ++++++
Sbjct  61    KLKTSLSECLTCFYPLAGQIKGDEHAVDLG-QGAVFVKARVNARLAKLLANPELKLVQQL  119

Query  398   VPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRG  577
             +P +P+    +   +  V  IQ+N F CGGI +G+ +SH I DGA++S F ++WA I+RG
Sbjct  120   LPLDPYNIKCQ---NALVTAIQLNLFDCGGIGIGICISHKIADGATLSTFLSSWAAISRG  176

Query  578   CAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQLRE  757
                +       D + +FPP        +F          +EK V +RF    +++  LR 
Sbjct  177   ANKL--VAPYLDTTTLFPP-------REFQVPLPNNLIKKEKIVTKRFEFDTASLAALRT  227

Query  758   QLRLISHYR-PSRAEALIAVVWDAVIAANQK-RHKGRINLHVLTSILNLRNRMEPPFPEN  931
             +    S  + P+  EA+ A++  + + A  +   KGR +  V++  +NLR RM PP P++
Sbjct  228   KAGNGSTSKSPTLVEAVTALICKSAMNARTEISGKGRSST-VISHAVNLRGRMNPPLPDH  286

Query  932   CLGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTALPIMS  1111
               GN    A     +  + +   H LA   R AIR ++ +  R+  G+ GF H A   + 
Sbjct  287   SFGNIWRFAIATIKEDVD-DAELHVLADHLRTAIRKIDSDYMRKLQGEDGF-HWACESIR  344

Query  1112  EIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQV-MKDSVVFM  1264
             E ++    K ++     SS + +  Y  DFGWGKP WA  + V +K++V+ M
Sbjct  345   E-VRELMYKGDVESYRFSSWVRLPFYETDFGWGKPVWACISSVPIKNAVILM  395



>gb|KCW68080.1| hypothetical protein EUGRSUZ_F01765 [Eucalyptus grandis]
Length=448

 Score =   193 bits (490),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 135/452 (30%), Positives = 217/452 (48%), Gaps = 27/452 (6%)
 Frame = +2

Query  44    MKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNG---VV  214
             M++ V  R+ +KP SPTP  L+ +  S++DQ    + +P V FY    + R       ++
Sbjct  1     MEVVVVSREFVKPYSPTPNHLKIHKLSLLDQFVPTLYVPLVLFYTIEEADRAATTPSRMI  60

Query  215   DELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIRE  394
               LK+SLS+TL L YPLAG+I  D  SIEC+D+GV  +E     +LS  L  PDFE IR+
Sbjct  61    QLLKQSLSETLPLFYPLAGKINGDGLSIECDDEGVLLVEARAEFALSRLLHRPDFETIRK  120

Query  395   MVPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINR  574
              +PC       E     RV ++QV  F CGG+ VG+++SHA  DGAS + F   WA   R
Sbjct  121   FLPCAAPWRRVEVG--DRVAMVQVTAFPCGGVVVGVLISHAAADGASFATFLKGWAATAR  178

Query  575   GCAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQLR  754
                        FDA  +F   K  ++ D +  V      ++ +Y  RR    AS + +L+
Sbjct  179   KTGEAPRPS--FDAPTLFIQNKAFSEEDTYFGV---CPVNRGRYGTRRLVFDASTMARLK  233

Query  755   EQLRLISHYRPSRAEALIAVVWDAVIAANQKRHKGRINLHVLTSILNLRNRMEPPFPENC  934
              +   +    P+RAE + A++  ++ A   K     ++  V T+ +NLR R  P F ++ 
Sbjct  234   AETANVGVQNPTRAEVVTALICKSLTATMTKVSG--LDKVVFTNAVNLRRRAVPNFHDDS  291

Query  935   LGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGF--LHTALPIM  1108
             +GN  +  T+      +      +L    R A   ++    R   G GG   L  AL  M
Sbjct  292   MGNYVWLPTILCPLEEKDYDGLPSLIGWLRQAKSKIDGGFVRGLEGDGGLNALQDALGEM  351

Query  1109  SEIIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAV-------NAQVMKDSVVFME  1267
              E +      +    +  SS      Y  DFGWG+P W         +  ++ + V+ ++
Sbjct  352   RESL-----ARTDRLVTFSSWCNFGHYEIDFGWGRPAWVSPVGFPEESGNLIMNVVLLLD  406

Query  1268  GRF-GGVDLWMGLPEELMNIVMKNPQFVEFVS  1360
              R   GV+ W+ + E+ + ++ ++ +  E+ S
Sbjct  407   TRCRKGVEAWVFMDEQELEVLEQDEELTEYAS  438



>ref|XP_007134039.1| hypothetical protein PHAVU_010G014300g [Phaseolus vulgaris]
 gb|ESW06033.1| hypothetical protein PHAVU_010G014300g [Phaseolus vulgaris]
Length=432

 Score =   192 bits (489),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 125/444 (28%), Positives = 226/444 (51%), Gaps = 19/444 (4%)
 Frame = +2

Query  38    ITMKIEVRRRDIIKPSSPTPQSLRTYNFSIVDQLSVNVKIPYVRFYDSPGSSRDYNGVVD  217
             + +K+E+  ++ +K SSP P  L+ +  S++DQL+    +P + FY S   + D   +  
Sbjct  1     MEVKVEIVSKERVKASSPPPNKLKHFKLSLLDQLAPPFYVPVLLFY-SASDATDITTISH  59

Query  218   ELKKSLSQTLSLMYPLAGRIKEDRSSIECNDQGVEFIEGDVAESLSSFLENPDFEMIREM  397
              LK SLSQ L+L YP  G ++ D S++ECN +GV F    +   LS+ L+NP    I ++
Sbjct  60    NLKASLSQLLTLYYPFCGTLR-DNSTVECNHEGVLFTHSTLPIHLSTILKNPHLHRINQL  118

Query  398   VPCNPFTGAFEPNPDGRVLVIQVNRFSCGGISVGLIMSHAIGDGASISVFANTWARINRG  577
              P +P+  A +   +   +V+Q+N+FSCGG+++ +  SH I D +S + F   WA  +R 
Sbjct  119   FPLDPYNPARDTLLE--TMVVQLNQFSCGGVALAVCFSHKIADASSAASFLTAWAATSRK  176

Query  578   CAVVDDGGFIFDASKIFPPVKNTADLDQFARVARGAAESQEKYVVRRFYIPASAIDQLRE  757
                +     + + + +FPP K   D      + RG     +  V +RF    + I +L++
Sbjct  177   EENILIAPQMEEGALVFPPRKIEMD------ITRGMV-GHKDIVTKRFMFNRTNISRLKQ  229

Query  758   QLRLISHYRPSRAEALIAVVWDAVI-AANQKRHKGRINLHVLTSILNLRNRMEPPFPENC  934
             ++  +  + P+  EA+ A++W + + AA     +G+    +++  +N+R+RM     ++ 
Sbjct  230   KVGSLEFF-PTSVEAVTALIWKSSLEAAKASSEEGKFPASMVSHAVNIRSRMASTLGKHS  288

Query  935   LGNNTYGATVHWNQPTEGNPSRHALALKFRDAIRGVNDEAARRRYGKGGFLHTALPIMSE  1114
             +G N +   V      EG      L  + R+ IR V+     +   +G   +  +  + E
Sbjct  289   MG-NLWQQAVSPLVEVEGEVGLRDLGERVRETIRKVDGNYVSKL--QGDEFYEVIEGLKE  345

Query  1115  IIKHEGSKKNMYCLYTSSLLGMQVYAADFGWGKPRWAVNAQV-MKDSVVFMEGRFG-GVD  1288
               +   S+K + C   SS +   +Y  DFGWGKP +     V +K+ V FM  + G G++
Sbjct  346   -ARRMASEKGVPCYSFSSWVRFGLYETDFGWGKPSYVSRIGVPIKNVVSFMPTKGGDGIE  404

Query  1289  LWMGLPEELMNIVMKNPQFVEFVS  1360
              W+ L +  M    +N + ++FVS
Sbjct  405   AWISLTKPHMLHFEQNQELLQFVS  428



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4149190095066