BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c103486_g1_i1 len=149 path=[127:0-148]

Length=149
                                                                      Score     E

ref|XP_006590118.1|  PREDICTED: uncharacterized protein LOC100778260  74.7    5e-14   
ref|XP_003605924.1|  TdcA1-ORF2 protein                               75.1    5e-14   
ref|XP_004514600.1|  PREDICTED: uncharacterized protein LOC101488279  74.3    8e-14   
ref|XP_004515092.1|  PREDICTED: uncharacterized protein LOC101501585  73.6    2e-13   
ref|XP_004513979.1|  PREDICTED: uncharacterized protein LOC101510347  72.0    4e-13   
ref|XP_009627683.1|  PREDICTED: uncharacterized protein LOC104118192  68.6    5e-13   
ref|XP_004514178.1|  PREDICTED: uncharacterized protein LOC101496841  69.7    3e-12   
ref|XP_004514785.1|  PREDICTED: uncharacterized protein LOC101499773  69.7    3e-12   
ref|XP_004505399.1|  PREDICTED: uncharacterized protein LOC101503093  70.1    3e-12   
ref|XP_004494054.1|  PREDICTED: uncharacterized protein LOC101497833  69.3    6e-12   
ref|XP_009631062.1|  PREDICTED: uncharacterized protein LOC104120898  65.9    6e-12   
ref|XP_009776422.1|  PREDICTED: uncharacterized protein LOC104226...  67.4    7e-12   
ref|XP_004497958.1|  PREDICTED: uncharacterized protein LOC101514137  68.6    7e-12   
ref|XP_004516322.1|  PREDICTED: uncharacterized protein LOC101490274  68.6    7e-12   
ref|XP_009776421.1|  PREDICTED: uncharacterized protein LOC104226...  67.8    9e-12   
ref|XP_011039084.1|  PREDICTED: uncharacterized protein LOC105135756  68.6    1e-11   
ref|XP_004488300.1|  PREDICTED: uncharacterized protein LOC101515602  68.2    1e-11   
ref|XP_011007650.1|  PREDICTED: uncharacterized protein LOC105113251  68.2    2e-11   
ref|XP_004514879.1|  PREDICTED: uncharacterized protein LOC101496630  67.8    2e-11   
ref|XP_004499474.1|  PREDICTED: uncharacterized protein LOC101514915  67.8    2e-11   
ref|XP_006590084.1|  PREDICTED: uncharacterized protein LOC102666495  67.4    2e-11   
ref|XP_004488346.1|  PREDICTED: uncharacterized protein LOC101505488  67.4    3e-11   
ref|XP_006590077.1|  PREDICTED: uncharacterized protein LOC102665163  67.0    3e-11   
ref|XP_009773819.1|  PREDICTED: uncharacterized protein LOC104223971  66.2    3e-11   
dbj|BAB64937.1|  TdcA1-ORF1-ORF2                                      67.0    4e-11   Daucus carota [carrots]
ref|XP_004488260.1|  PREDICTED: uncharacterized protein LOC101500695  67.0    4e-11   
ref|XP_009769640.1|  PREDICTED: uncharacterized protein LOC104220460  66.2    6e-11   
ref|XP_004516027.1|  PREDICTED: uncharacterized protein LOC101488515  66.2    7e-11   
ref|XP_004516953.1|  PREDICTED: uncharacterized protein LOC101493202  65.9    8e-11   
ref|XP_010690165.1|  PREDICTED: uncharacterized protein LOC104903750  65.9    9e-11   
ref|XP_004515006.1|  PREDICTED: uncharacterized protein LOC101494987  65.9    9e-11   
ref|XP_011011885.1|  PREDICTED: uncharacterized protein LOC105116299  65.9    9e-11   
emb|CAM59133.1|  putative transposase                                 65.9    9e-11   Antirrhinum majus [garden snapdragon]
ref|XP_004515596.1|  PREDICTED: uncharacterized protein LOC101488619  65.5    1e-10   
dbj|BAB64529.1|  TdcA1-ORF2                                           65.5    1e-10   Daucus carota [carrots]
ref|XP_004513821.1|  PREDICTED: uncharacterized protein LOC101493812  64.7    1e-10   
ref|XP_004488505.1|  PREDICTED: uncharacterized protein LOC101488681  65.5    1e-10   
ref|XP_004514735.1|  PREDICTED: uncharacterized protein LOC101504463  65.1    2e-10   
ref|XP_004513822.1|  PREDICTED: uncharacterized protein LOC101495419  64.7    2e-10   
ref|XP_006362685.1|  PREDICTED: uncharacterized protein LOC102582826  64.7    2e-10   
ref|XP_004514610.1|  PREDICTED: uncharacterized protein LOC101494042  65.1    2e-10   
ref|XP_004488345.1|  PREDICTED: uncharacterized protein LOC101505173  64.7    2e-10   
ref|XP_011016039.1|  PREDICTED: uncharacterized protein LOC105119585  64.3    3e-10   
ref|XP_009784050.1|  PREDICTED: uncharacterized protein LOC104232...  63.5    4e-10   
ref|XP_009770563.1|  PREDICTED: uncharacterized protein LOC104221243  63.2    4e-10   
ref|XP_006355770.1|  PREDICTED: uncharacterized protein LOC102599843  61.6    5e-10   
ref|XP_004506447.1|  PREDICTED: uncharacterized protein LOC101512105  62.0    1e-09   
ref|XP_010693266.1|  PREDICTED: uncharacterized protein LOC104906231  62.8    1e-09   
ref|XP_009621288.1|  PREDICTED: uncharacterized protein LOC104112945  62.4    1e-09   
ref|XP_004488903.1|  PREDICTED: uncharacterized protein LOC101501429  62.4    1e-09   
ref|XP_009605089.1|  PREDICTED: uncharacterized protein LOC104099716  61.6    2e-09   
ref|XP_010555874.1|  PREDICTED: uncharacterized protein LOC104825271  60.8    4e-09   
ref|XP_010532388.1|  PREDICTED: uncharacterized protein LOC104808409  61.2    4e-09   
ref|XP_011004861.1|  PREDICTED: uncharacterized protein LOC105111246  60.8    5e-09   
ref|XP_010686699.1|  PREDICTED: uncharacterized protein LOC104900868  60.5    6e-09   
ref|XP_004506268.1|  PREDICTED: uncharacterized protein LOC101494613  60.1    7e-09   
gb|ABG37655.1|  integrase                                             60.5    8e-09   Populus trichocarpa [western balsam poplar]
ref|XP_003597012.1|  TdcA1-ORF2 protein                               60.1    8e-09   
ref|XP_010545155.1|  PREDICTED: uncharacterized protein LOC104817604  60.1    9e-09   
ref|XP_010694139.1|  PREDICTED: uncharacterized protein LOC104906988  60.1    1e-08   
gb|ABM55245.1|  transposon-like protein                               60.1    1e-08   Beta vulgaris [beet]
ref|XP_010680482.1|  PREDICTED: uncharacterized protein LOC104895620  60.1    1e-08   
gb|ABB46852.1|  transposon protein, putative, CACTA, En/Spm sub-c...  59.7    1e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009783976.1|  PREDICTED: uncharacterized protein LOC104232461  59.3    1e-08   
ref|XP_010695922.1|  PREDICTED: uncharacterized protein LOC104908504  59.7    1e-08   
ref|XP_010535289.1|  PREDICTED: uncharacterized protein LOC104810640  59.3    1e-08   
ref|XP_009591501.1|  PREDICTED: uncharacterized protein LOC104088517  58.5    1e-08   
gb|ABG37667.2|  transposase tnp2                                      59.3    1e-08   Populus trichocarpa [western balsam poplar]
ref|XP_010682650.1|  PREDICTED: uncharacterized protein LOC104897464  59.7    1e-08   
ref|XP_010684137.1|  PREDICTED: uncharacterized protein LOC104898733  59.7    1e-08   
gb|AAM74372.1|AC116603_8  Putative transposable element               59.7    2e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004517042.1|  PREDICTED: uncharacterized protein LOC101505019  59.3    2e-08   
ref|XP_010684970.1|  PREDICTED: uncharacterized protein LOC104899469  58.5    3e-08   
ref|XP_004492138.1|  PREDICTED: uncharacterized protein LOC101505635  58.5    3e-08   
ref|XP_010530536.1|  PREDICTED: uncharacterized protein LOC104807121  57.8    4e-08   
ref|XP_010669259.1|  PREDICTED: uncharacterized protein LOC104886511  57.4    5e-08   
ref|XP_006601486.1|  PREDICTED: uncharacterized protein LOC102668025  56.2    8e-08   
ref|XP_010672801.1|  PREDICTED: uncharacterized protein LOC104889304  57.4    1e-07   
ref|XP_010555676.1|  PREDICTED: uncharacterized protein LOC104825104  56.6    1e-07   
ref|XP_010428128.1|  PREDICTED: uncharacterized protein LOC104712847  56.2    1e-07   
ref|XP_010558998.1|  PREDICTED: uncharacterized protein LOC104827517  56.6    1e-07   
ref|XP_010693338.1|  PREDICTED: uncharacterized protein LOC104906299  56.2    2e-07   
gb|ABA94910.1|  transposon protein, putative, CACTA, En/Spm sub-c...  56.2    2e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010682939.1|  PREDICTED: uncharacterized protein LOC104897700  56.2    2e-07   
ref|XP_010667521.1|  PREDICTED: uncharacterized protein LOC104884542  55.5    2e-07   
ref|XP_010541809.1|  PREDICTED: uncharacterized protein LOC104815191  55.8    2e-07   
ref|XP_010690173.1|  PREDICTED: uncharacterized protein LOC104903759  55.8    2e-07   
ref|XP_009107714.1|  PREDICTED: uncharacterized protein LOC103833381  55.5    3e-07   
ref|XP_009128623.1|  PREDICTED: uncharacterized protein LOC103853474  55.5    3e-07   
ref|XP_010681184.1|  PREDICTED: uncharacterized protein LOC104896163  55.5    3e-07   
ref|XP_009123108.1|  PREDICTED: uncharacterized protein LOC103847790  55.5    3e-07   
ref|XP_006664968.1|  PREDICTED: uncharacterized protein LOC102717...  55.8    3e-07   
ref|XP_009140279.1|  PREDICTED: uncharacterized protein LOC103864271  55.5    3e-07   
gb|ABD96944.1|  hypothetical protein                                  55.5    4e-07   Tarenaya spinosa
ref|XP_010689504.1|  PREDICTED: uncharacterized protein LOC104903203  55.5    4e-07   
ref|XP_010518611.1|  PREDICTED: uncharacterized protein LOC104793884  55.1    5e-07   
gb|ABA94136.1|  transposon protein, putative, CACTA, En/Spm sub-c...  55.5    5e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010495881.1|  PREDICTED: uncharacterized protein LOC104773034  55.1    5e-07   
ref|XP_010544444.1|  PREDICTED: uncharacterized protein LOC104817064  55.1    5e-07   
ref|XP_010670313.1|  PREDICTED: uncharacterized protein LOC104887394  55.1    5e-07   
ref|XP_010668099.1|  PREDICTED: uncharacterized protein LOC104885093  54.7    6e-07   
ref|XP_008389002.1|  PREDICTED: uncharacterized protein LOC103451366  54.3    7e-07   
ref|XP_010536309.1|  PREDICTED: uncharacterized protein LOC104811343  54.3    7e-07   
ref|XP_010519132.1|  PREDICTED: uncharacterized protein LOC104798660  51.6    8e-07   
ref|XP_010541813.1|  PREDICTED: uncharacterized protein LOC104815196  53.1    9e-07   
dbj|BAB09502.1|  transposon protein-like                              54.3    9e-07   Arabidopsis thaliana [mouse-ear cress]
gb|ABF67953.1|  CACTA TnpD transposase                                54.3    9e-07   Zea mays [maize]
ref|XP_010675427.1|  PREDICTED: uncharacterized protein LOC104891429  53.5    1e-06   
ref|XP_008657644.1|  PREDICTED: uncharacterized protein LOC103637172  53.5    1e-06   
ref|XP_008646835.1|  PREDICTED: uncharacterized protein LOC103628405  53.5    1e-06   
ref|XP_009128586.1|  PREDICTED: uncharacterized protein LOC103853426  53.1    2e-06   
ref|XP_008392411.1|  PREDICTED: uncharacterized protein LOC103454586  53.1    2e-06   
ref|XP_009135019.1|  PREDICTED: uncharacterized protein LOC103859258  53.1    2e-06   
ref|XP_009102785.1|  PREDICTED: uncharacterized protein LOC103828898  53.1    2e-06   
ref|XP_004488629.1|  PREDICTED: uncharacterized protein LOC101512250  52.8    2e-06   
ref|XP_010666521.1|  PREDICTED: uncharacterized protein LOC104883671  52.8    2e-06   
ref|XP_009141157.1|  PREDICTED: uncharacterized protein LOC103865128  53.1    3e-06   
ref|XP_009113453.1|  PREDICTED: uncharacterized protein LOC103838751  52.8    4e-06   
ref|XP_006653255.1|  PREDICTED: uncharacterized protein LOC102712905  52.4    4e-06   
ref|XP_009623896.1|  PREDICTED: uncharacterized protein LOC104115034  52.4    4e-06   
ref|XP_009102149.1|  PREDICTED: uncharacterized protein LOC103828288  52.4    5e-06   
ref|XP_010668296.1|  PREDICTED: uncharacterized protein LOC104885300  52.4    5e-06   
ref|XP_008235411.1|  PREDICTED: uncharacterized protein LOC103334243  51.6    6e-06   
ref|XP_009775626.1|  PREDICTED: uncharacterized protein LOC104225...  51.6    6e-06   
ref|XP_009775625.1|  PREDICTED: uncharacterized protein LOC104225...  51.6    6e-06   
ref|XP_008662989.1|  PREDICTED: uncharacterized protein LOC103641416  51.6    6e-06   
ref|XP_010468397.1|  PREDICTED: uncharacterized protein LOC104748456  51.6    7e-06   
ref|XP_010687513.1|  PREDICTED: uncharacterized protein LOC104901621  51.6    8e-06   
gb|AAK13155.1|AC078829_7  putative transposase                        51.6    9e-06   Oryza sativa Japonica Group [Japonica rice]
gb|AAD20646.1|  putative TNP2-like transposon protein                 51.6    9e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006663384.1|  PREDICTED: uncharacterized protein LOC102706425  51.2    9e-06   
ref|XP_008663863.1|  PREDICTED: uncharacterized protein LOC103642341  51.2    1e-05   
emb|CAH67329.1|  OSIGBa0102I15.9                                      51.2    1e-05   Oryza sativa [red rice]
emb|CAH66101.1|  OSIGBa0132O24.3                                      51.2    1e-05   Oryza sativa [red rice]
ref|XP_010695661.1|  PREDICTED: uncharacterized protein LOC104908266  51.2    1e-05   
ref|XP_004512662.1|  PREDICTED: uncharacterized protein LOC101489810  50.8    1e-05   
ref|XP_010683839.1|  PREDICTED: uncharacterized protein LOC104898452  51.2    1e-05   
ref|XP_010495146.1|  PREDICTED: uncharacterized protein LOC104772206  50.8    1e-05   
ref|XP_009124479.1|  PREDICTED: uncharacterized protein LOC103849479  50.8    1e-05   
ref|XP_010694719.1|  PREDICTED: uncharacterized protein LOC104907482  50.4    1e-05   
ref|XP_004498129.1|  PREDICTED: uncharacterized protein LOC101501909  50.8    1e-05   
gb|AAR01649.1|  transposon protein, putative, CACTA, En/Spm sub-c...  50.8    1e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008657774.1|  PREDICTED: uncharacterized protein LOC103637333  50.8    1e-05   
ref|XP_010695418.1|  PREDICTED: uncharacterized protein LOC104908060  50.4    2e-05   
ref|XP_008373084.1|  PREDICTED: uncharacterized protein LOC103436432  50.4    2e-05   
gb|ABA98141.1|  transposon protein, putative, CACTA, En/Spm sub-c...  50.4    2e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010663960.1|  PREDICTED: uncharacterized protein LOC104882445  50.4    2e-05   
ref|XP_010436384.1|  PREDICTED: uncharacterized protein LOC104720121  50.1    2e-05   
ref|XP_009123180.1|  PREDICTED: uncharacterized protein LOC103847918  50.4    2e-05   
ref|XP_008338260.1|  PREDICTED: uncharacterized protein LOC103401325  50.1    2e-05   
ref|XP_004492006.1|  PREDICTED: uncharacterized protein LOC101504571  50.4    2e-05   
ref|XP_009608267.1|  PREDICTED: uncharacterized protein LOC104102290  49.7    2e-05   
ref|XP_008363626.1|  PREDICTED: uncharacterized protein LOC103427344  49.7    2e-05   
ref|XP_006346671.1|  PREDICTED: uncharacterized protein LOC102584385  49.7    2e-05   
emb|CAN78763.1|  hypothetical protein VITISV_003315                   50.1    2e-05   Vitis vinifera
ref|XP_006658479.1|  PREDICTED: uncharacterized protein LOC102709387  50.1    3e-05   
gb|AAM18727.1|AC092548_5  putative TNP2-like transposon protein       50.1    3e-05   Oryza sativa Japonica Group [Japonica rice]
gb|AAP53328.2|  transposon protein, putative, CACTA, En/Spm sub-c...  50.1    3e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006588206.1|  PREDICTED: uncharacterized protein LOC100803554  50.1    3e-05   
ref|XP_010445608.1|  PREDICTED: uncharacterized protein LOC104728307  49.7    3e-05   
ref|XP_009348845.1|  PREDICTED: uncharacterized protein LOC103940453  50.1    3e-05   
ref|XP_010481106.1|  PREDICTED: uncharacterized protein LOC104759941  49.7    3e-05   
ref|XP_009367775.1|  PREDICTED: uncharacterized protein LOC103957344  49.7    3e-05   
ref|XP_009351448.1|  PREDICTED: uncharacterized protein LOC103942981  49.7    3e-05   
ref|XP_006590121.1|  PREDICTED: uncharacterized protein LOC102664072  49.3    3e-05   
ref|XP_009365384.1|  PREDICTED: uncharacterized protein LOC103955232  49.7    3e-05   
ref|XP_010667637.1|  PREDICTED: uncharacterized protein LOC104884650  49.7    4e-05   
ref|XP_006475270.1|  PREDICTED: uncharacterized protein LOC102625722  49.7    4e-05   
ref|XP_006360475.1|  PREDICTED: uncharacterized protein LOC102601884  49.7    4e-05   
ref|XP_008359349.1|  PREDICTED: uncharacterized protein LOC103423058  49.7    4e-05   
ref|XP_004513297.1|  PREDICTED: uncharacterized protein LOC101504995  49.7    4e-05   
ref|XP_010665733.1|  PREDICTED: uncharacterized protein LOC104882993  49.3    4e-05   
ref|XP_010468685.1|  PREDICTED: uncharacterized protein LOC104748789  49.3    4e-05   
ref|XP_009343565.1|  PREDICTED: uncharacterized protein LOC103935520  49.7    4e-05   
ref|XP_008671526.1|  PREDICTED: uncharacterized protein LOC103648928  49.3    4e-05   
gb|ABA93762.1|  transposon protein, putative, CACTA, En/Spm sub-c...  49.3    4e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008229480.1|  PREDICTED: uncharacterized protein LOC103328856  49.3    5e-05   
ref|XP_008341191.1|  PREDICTED: uncharacterized protein LOC103404112  49.3    5e-05   
ref|XP_008371756.1|  PREDICTED: uncharacterized protein LOC103435145  49.3    5e-05   
ref|XP_006596863.1|  PREDICTED: uncharacterized protein LOC100817210  49.3    6e-05   
ref|XP_008363631.1|  PREDICTED: uncharacterized protein LOC103427350  48.9    6e-05   
ref|XP_008361424.1|  PREDICTED: uncharacterized protein LOC103425132  48.9    6e-05   
ref|XP_010665698.1|  PREDICTED: uncharacterized protein LOC104882960  48.9    7e-05   
ref|XP_010510109.1|  PREDICTED: uncharacterized protein LOC104786397  48.5    7e-05   
ref|XP_006338206.1|  PREDICTED: uncharacterized protein LOC102584000  48.5    7e-05   
ref|XP_010243168.1|  PREDICTED: uncharacterized protein LOC104587313  48.5    7e-05   
ref|XP_010694601.1|  PREDICTED: uncharacterized protein LOC104907371  48.5    7e-05   
ref|XP_010445388.1|  PREDICTED: uncharacterized protein LOC104728042  48.9    7e-05   
ref|XP_008338384.1|  PREDICTED: uncharacterized protein LOC103401455  48.5    8e-05   
ref|XP_010438349.1|  PREDICTED: uncharacterized protein LOC104721...  48.5    8e-05   
ref|XP_008649875.1|  PREDICTED: uncharacterized protein LOC103630603  48.5    8e-05   
ref|XP_008372814.1|  PREDICTED: uncharacterized protein LOC103436169  48.9    8e-05   
ref|XP_010438346.1|  PREDICTED: uncharacterized protein LOC104721...  48.5    8e-05   
ref|XP_006598374.1|  PREDICTED: uncharacterized protein LOC100809757  48.5    8e-05   
ref|XP_010424835.1|  PREDICTED: uncharacterized protein LOC104710007  48.5    8e-05   
gb|ABA91272.1|  transposon protein, putative, CACTA, En/Spm sub-c...  48.5    8e-05   Oryza sativa Japonica Group [Japonica rice]
emb|CAE05629.1|  OSJNBb0061C13.11                                     48.5    8e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008678805.1|  PREDICTED: uncharacterized protein LOC103653780  48.5    8e-05   
ref|XP_008659783.1|  PREDICTED: uncharacterized protein LOC103638724  48.5    8e-05   
ref|XP_010693301.1|  PREDICTED: uncharacterized protein LOC104906262  48.5    9e-05   
ref|XP_010548757.1|  PREDICTED: uncharacterized protein LOC104820082  46.6    9e-05   
ref|XP_010677867.1|  PREDICTED: uncharacterized protein LOC104893460  48.1    1e-04   
ref|XP_008660801.1|  PREDICTED: uncharacterized protein LOC103639897  48.1    1e-04   
ref|XP_010690984.1|  PREDICTED: uncharacterized protein LOC104904438  48.5    1e-04   
ref|XP_008666337.1|  PREDICTED: uncharacterized protein LOC103644976  48.1    1e-04   
gb|AAX95821.1|  transposon protein, putative, CACTA, En/Spm sub-c...  48.5    1e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006590024.1|  PREDICTED: uncharacterized protein LOC100780571  48.1    1e-04   
ref|XP_009776780.1|  PREDICTED: uncharacterized protein LOC104226462  48.1    1e-04   
ref|XP_010681526.1|  PREDICTED: uncharacterized protein LOC104896473  48.1    1e-04   
ref|XP_008646998.1|  PREDICTED: uncharacterized protein LOC103628606  48.1    1e-04   
ref|XP_008671492.1|  PREDICTED: uncharacterized protein LOC103648889  48.1    1e-04   
ref|XP_006465241.1|  PREDICTED: uncharacterized protein LOC102617...  48.1    1e-04   
ref|XP_009768699.1|  PREDICTED: uncharacterized protein LOC104219689  47.8    1e-04   
ref|XP_003553111.2|  PREDICTED: uncharacterized protein LOC100782578  48.1    1e-04   
ref|XP_006480458.1|  PREDICTED: uncharacterized protein LOC102608...  48.1    1e-04   
ref|XP_008338261.1|  PREDICTED: uncharacterized protein LOC103401326  48.1    1e-04   
ref|XP_004148721.1|  PREDICTED: anaphase-promoting complex subuni...  48.1    1e-04   
ref|XP_010513142.1|  PREDICTED: uncharacterized protein LOC104789093  47.8    1e-04   
ref|XP_008359569.1|  PREDICTED: uncharacterized protein LOC103423276  47.4    1e-04   
emb|CAE04318.3|  OSJNBb0016D16.9                                      48.1    1e-04   Oryza sativa [red rice]
ref|XP_008343034.1|  PREDICTED: uncharacterized protein LOC103405801  47.8    1e-04   
ref|XP_010684021.1|  PREDICTED: uncharacterized protein LOC104898624  47.8    1e-04   
ref|XP_010667535.1|  PREDICTED: uncharacterized protein LOC104884557  47.4    1e-04   
ref|XP_008661260.1|  PREDICTED: uncharacterized protein LOC103640464  47.8    1e-04   
ref|XP_008655512.1|  PREDICTED: uncharacterized protein LOC103634696  47.8    2e-04   
gb|ABA98912.1|  transposon protein, putative, CACTA, En/Spm sub-c...  47.8    2e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008646978.1|  PREDICTED: uncharacterized protein LOC103628584  47.8    2e-04   
ref|XP_010678035.1|  PREDICTED: uncharacterized protein LOC104893606  47.4    2e-04   
ref|XP_009103337.1|  PREDICTED: uncharacterized protein LOC103829419  47.8    2e-04   
gb|ACT98135.1|  TNP2                                                  47.8    2e-04   Glycine max [soybeans]
ref|XP_010665585.1|  PREDICTED: uncharacterized protein LOC104882866  47.8    2e-04   
gb|AAA66266.1|  unknown protein                                       47.8    2e-04   Zea mays [maize]
ref|XP_008675660.1|  PREDICTED: uncharacterized protein LOC103651739  47.8    2e-04   
ref|XP_006590031.1|  PREDICTED: uncharacterized protein LOC100786982  47.8    2e-04   
ref|XP_010696424.1|  PREDICTED: uncharacterized protein LOC104908951  47.4    2e-04   
prf||1206239A  ORF 1                                                  47.4    2e-04
ref|XP_006598551.1|  PREDICTED: uncharacterized protein LOC100806722  47.4    2e-04   
ref|XP_010229766.1|  PREDICTED: uncharacterized protein LOC100824246  47.4    2e-04   
ref|XP_003554943.1|  PREDICTED: uncharacterized protein LOC100787031  47.4    2e-04   
ref|XP_010668257.1|  PREDICTED: uncharacterized protein LOC104885256  47.0    2e-04   
ref|XP_006588102.1|  PREDICTED: uncharacterized protein LOC100812852  47.4    2e-04   
ref|XP_007044255.1|  Transposase tnp2                                 47.0    2e-04   
emb|CAM57450.2|  putative transposase                                 47.4    2e-04   Antirrhinum majus [garden snapdragon]
emb|CAD40757.2|  OSJNBa0081G05.10                                     47.4    2e-04   Oryza sativa Japonica Group [Japonica rice]
emb|CAH66664.1|  OSIGBa0110B10.1                                      47.4    2e-04   Oryza sativa [red rice]
gb|AAK91322.1|AC090441_4  Putative transposase protein                47.4    2e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003551521.1|  PREDICTED: uncharacterized protein LOC100800209  47.4    2e-04   
gb|AAF06087.1|AC007918_11  Similar to gi|4325351 T25H8.2 TNP2 pro...  47.4    3e-04   Arabidopsis thaliana [mouse-ear cress]
gb|AAG17043.1|AF187822_1  transposase                                 47.0    3e-04   Zea mays [maize]
ref|XP_010667222.1|  PREDICTED: uncharacterized protein LOC104884295  47.0    3e-04   
ref|XP_006601519.1|  PREDICTED: uncharacterized protein LOC100806434  47.0    3e-04   
ref|XP_006479017.1|  PREDICTED: uncharacterized protein LOC102618...  47.0    3e-04   
ref|XP_010684858.1|  PREDICTED: uncharacterized protein LOC104899379  47.0    3e-04   
ref|XP_010495705.1|  PREDICTED: uncharacterized protein LOC104772841  47.0    3e-04   
ref|XP_006589964.1|  PREDICTED: uncharacterized protein LOC102666749  47.0    3e-04   
gb|AAD22705.1|  putative TNP2-like transposon protein                 47.0    3e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006479014.1|  PREDICTED: uncharacterized protein LOC102618...  47.0    3e-04   
ref|XP_010508146.1|  PREDICTED: uncharacterized protein LOC104784...  47.0    3e-04   
ref|XP_006574186.1|  PREDICTED: uncharacterized protein LOC100812270  47.0    3e-04   
ref|XP_006606994.1|  PREDICTED: uncharacterized protein LOC100813458  47.0    3e-04   
ref|XP_006589962.1|  PREDICTED: uncharacterized protein LOC100777745  46.6    3e-04   
ref|XP_010682842.1|  PREDICTED: uncharacterized protein LOC104897613  47.0    3e-04   
ref|XP_010508147.1|  PREDICTED: uncharacterized protein LOC104784...  47.0    3e-04   
ref|XP_004971863.1|  PREDICTED: uncharacterized protein LOC101786371  46.6    3e-04   
ref|XP_008680460.1|  PREDICTED: uncharacterized protein LOC103655489  46.6    3e-04   
ref|XP_009607817.1|  PREDICTED: uncharacterized protein LOC104101952  44.7    3e-04   
ref|XP_010451681.1|  PREDICTED: uncharacterized protein LOC104733837  46.6    4e-04   
ref|XP_009370727.1|  PREDICTED: uncharacterized protein LOC103960063  46.6    4e-04   
ref|XP_008346828.1|  PREDICTED: uncharacterized protein LOC103409816  46.6    4e-04   
ref|XP_010430954.1|  PREDICTED: uncharacterized protein LOC104715225  46.6    4e-04   
ref|XP_008675989.1|  PREDICTED: uncharacterized protein LOC103652118  46.2    4e-04   
emb|CAE05813.1|  OSJNBa0028M15.5                                      46.6    4e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011004418.1|  PREDICTED: uncharacterized protein LOC105110911  46.6    4e-04   
ref|XP_006598452.1|  PREDICTED: uncharacterized protein LOC100778749  46.6    4e-04   
ref|XP_010689452.1|  PREDICTED: uncharacterized protein LOC104903150  46.2    5e-04   
gb|ACT32426.1|  putative transposase                                  44.7    5e-04   Vigna unguiculata
ref|XP_010476476.1|  PREDICTED: uncharacterized protein LOC104755719  46.2    5e-04   
emb|CAN64494.1|  hypothetical protein VITISV_018031                   46.6    5e-04   Vitis vinifera
ref|XP_006659827.1|  PREDICTED: uncharacterized protein LOC102715326  46.2    5e-04   
ref|XP_004295900.1|  PREDICTED: uncharacterized protein LOC101307772  46.2    5e-04   
ref|XP_010481112.1|  PREDICTED: uncharacterized protein LOC104759948  46.2    5e-04   
ref|XP_010665709.1|  PREDICTED: uncharacterized protein LOC104882970  45.8    6e-04   
ref|XP_004980564.1|  PREDICTED: uncharacterized protein LOC101786948  45.4    6e-04   
ref|XP_002449664.1|  hypothetical protein SORBIDRAFT_05g021283        44.3    6e-04   
emb|CAA40555.1|  TNP2                                                 45.8    7e-04   
ref|XP_004293089.1|  PREDICTED: uncharacterized protein LOC101311944  45.4    7e-04   
ref|XP_008675908.1|  PREDICTED: uncharacterized protein LOC103652028  45.8    7e-04   
ref|XP_004293050.1|  PREDICTED: uncharacterized protein LOC101297410  45.4    7e-04   
ref|XP_006601476.1|  PREDICTED: uncharacterized protein LOC100812115  45.8    7e-04   
ref|XP_010245784.1|  PREDICTED: uncharacterized protein LOC104589...  45.4    7e-04   
ref|XP_008671503.1|  PREDICTED: uncharacterized protein LOC103648903  45.4    7e-04   
ref|XP_008650270.1|  PREDICTED: uncharacterized protein LOC103631031  45.8    8e-04   
ref|XP_009124911.1|  PREDICTED: uncharacterized protein LOC103849961  45.8    8e-04   
ref|XP_006593251.1|  PREDICTED: uncharacterized protein LOC100779379  45.8    8e-04   
ref|XP_006598423.1|  PREDICTED: uncharacterized protein LOC100802838  45.4    8e-04   
ref|XP_010507081.1|  PREDICTED: uncharacterized protein LOC104783650  45.4    8e-04   
emb|CAN66404.1|  hypothetical protein VITISV_026850                   45.4    8e-04   
ref|XP_004980449.1|  PREDICTED: uncharacterized protein LOC101760103  45.1    8e-04   
gb|ACT32427.1|  putative transposase                                  44.3    9e-04   
ref|XP_006580679.1|  PREDICTED: uncharacterized protein LOC102662215  44.3    0.001   
ref|XP_004309389.1|  PREDICTED: uncharacterized protein LOC101295581  45.1    0.001   
ref|XP_008655993.1|  PREDICTED: uncharacterized protein LOC103635...  45.4    0.001   
ref|XP_008655992.1|  PREDICTED: uncharacterized protein LOC103635...  45.4    0.001   
ref|XP_006577551.1|  PREDICTED: uncharacterized protein LOC100791086  45.4    0.001   



>ref|XP_006590118.1| PREDICTED: uncharacterized protein LOC100778260 [Glycine max]
Length=531

 Score = 74.7 bits (182),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFMFLPSCHWKPLAELSVFFRNLCSTS  2
            K+ GMKSHDCH+FMQ+LLPIAF  LP   WKPL ELS FFR L ST+
Sbjct  80   KIHGMKSHDCHVFMQWLLPIAFDSLPKPIWKPLVELSQFFRELTSTT  126



>ref|XP_003605924.1| TdcA1-ORF2 protein [Medicago truncatula]
Length=1066

 Score = 75.1 bits (183),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFMFLPSCHWKPLAELSVFFRNLCSTS  2
            KL GMKSHDCH+FM+ LLPIAF  LP   WK + ELS FFR+LCSTS
Sbjct  185  KLHGMKSHDCHVFMERLLPIAFSSLPDQTWKAITELSQFFRDLCSTS  231



>ref|XP_004514600.1| PREDICTED: uncharacterized protein LOC101488279 [Cicer arietinum]
Length=694

 Score = 74.3 bits (181),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFMFLPSCHWKPLAELSVFFRNLCSTS  2
            KL GMKSHDCH+FM+ LLPIAF+ LP   WKPL ELS FFR+LCSTS
Sbjct  450  KLHGMKSHDCHVFMECLLPIAFISLPEQTWKPLTELSHFFRDLCSTS  496



>ref|XP_004515092.1| PREDICTED: uncharacterized protein LOC101501585 [Cicer arietinum]
Length=819

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 31/46 (67%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFMFLPSCHWKPLAELSVFFRNLCST  5
            KLIG+KSHDCH+FM+ LLPIAF  LP   W P+ ELS FF++LCST
Sbjct  80   KLIGIKSHDCHLFMERLLPIAFSALPHHVWNPIVELSKFFKDLCST  125



>ref|XP_004513979.1| PREDICTED: uncharacterized protein LOC101510347 [Cicer arietinum]
Length=492

 Score = 72.0 bits (175),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFMFLPSCHWKPLAELSVFFRNLCST  5
            KLIGMKSHDCH+FM+ LLPIAF  LP   W P+AELS FF++LCST
Sbjct  282  KLIGMKSHDCHVFMERLLPIAFSALPHHVWNPIAELSKFFKDLCST  327



>ref|XP_009627683.1| PREDICTED: uncharacterized protein LOC104118192 [Nicotiana tomentosiformis]
Length=130

 Score = 68.6 bits (166),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFMFLPSCHWKPLAELSVFFRNLCSTS  2
            KLI MKSHDCHIFM+ L+PIAF  LP   WKP  E+S+FF++LCST+
Sbjct  19   KLIHMKSHDCHIFMETLIPIAFYGLPENIWKPNTEISLFFKDLCSTT  65



>ref|XP_004514178.1| PREDICTED: uncharacterized protein LOC101496841 [Cicer arietinum]
Length=523

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 29/47 (62%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFMFLPSCHWKPLAELSVFFRNLCSTS  2
            ++ GMKSHDCH+FM+ LLP AF  LP   WKPL ELS FF+ LCS +
Sbjct  218  QMNGMKSHDCHVFMECLLPFAFSLLPDHVWKPLTELSQFFKGLCSNT  264



>ref|XP_004514785.1| PREDICTED: uncharacterized protein LOC101499773 [Cicer arietinum]
Length=660

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFMFLPSCHWKPLAELSVFFRNLCST  5
            KLIGMKSHDCH+FM+ LLPIAF  LP   W P+ ELS FF++LCST
Sbjct  543  KLIGMKSHDCHVFMERLLPIAFSALPHHVWNPIVELSKFFKDLCST  588



>ref|XP_004505399.1| PREDICTED: uncharacterized protein LOC101503093 [Cicer arietinum]
Length=884

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -2

Query  133  GMKSHDCHIFMQFLLPIAFMFLPSCHWKPLAELSVFFRNLCSTS  2
            GMKSHDCH+FM+ LLPIAF  LP   WKPL ELS FF++LC  +
Sbjct  530  GMKSHDCHVFMECLLPIAFHSLPEFVWKPLTELSQFFKDLCCNT  573



>ref|XP_004494054.1| PREDICTED: uncharacterized protein LOC101497833 [Cicer arietinum]
Length=802

 Score = 69.3 bits (168),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 29/47 (62%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFMFLPSCHWKPLAELSVFFRNLCSTS  2
            ++ GMKSHDCH+FM+ LLP AF  LP   WKPL ELS FF+ LCS +
Sbjct  211  QMNGMKSHDCHVFMECLLPFAFSSLPDHVWKPLTELSQFFKGLCSNT  257



>ref|XP_009631062.1| PREDICTED: uncharacterized protein LOC104120898 [Nicotiana tomentosiformis]
Length=173

 Score = 65.9 bits (159),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFMFLPSCHWKPLAELSVFFRNLCSTS  2
            KL+ MKSHDCHIFM+ LLPIAF  LP   WKP+ E+++FF++LCS +
Sbjct  45   KLMYMKSHDCHIFMESLLPIAFNALPERIWKPITEINLFFKDLCSNT  91



>ref|XP_009776422.1| PREDICTED: uncharacterized protein LOC104226201 isoform X2 [Nicotiana 
sylvestris]
Length=334

 Score = 67.4 bits (163),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFMFLPSCHWKPLAELSVFFRNLCSTS  2
            KL+ MKSHDCHIFM+ LLPIAF  LP   WKP+ E+S+FF++LCS +
Sbjct  94   KLMYMKSHDCHIFMESLLPIAFSALPERIWKPITEISLFFKDLCSNT  140



>ref|XP_004497958.1| PREDICTED: uncharacterized protein LOC101514137 [Cicer arietinum]
Length=493

 Score = 68.6 bits (166),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFMFLPSCHWKPLAELSVFFRNLCSTS  2
            +L G+KSHDCHIFM+ LLPIAF  LP   WKPL E S FFR+LCST+
Sbjct  395  RLFGLKSHDCHIFMKCLLPIAFCALPEPIWKPLTEFSQFFRDLCSTT  441



>ref|XP_004516322.1| PREDICTED: uncharacterized protein LOC101490274 [Cicer arietinum]
Length=579

 Score = 68.6 bits (166),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 29/47 (62%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFMFLPSCHWKPLAELSVFFRNLCSTS  2
            ++ GMKSHDCH+FM+ LLP AF  LP   WKPL ELS FF+ LCS +
Sbjct  218  QMNGMKSHDCHVFMECLLPFAFSSLPDHVWKPLTELSQFFKGLCSNT  264



>ref|XP_009776421.1| PREDICTED: uncharacterized protein LOC104226201 isoform X1 [Nicotiana 
sylvestris]
Length=376

 Score = 67.8 bits (164),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFMFLPSCHWKPLAELSVFFRNLCSTS  2
            KL+ MKSHDCHIFM+ LLPIAF  LP   WKP+ E+S+FF++LCS +
Sbjct  94   KLMYMKSHDCHIFMESLLPIAFSALPERIWKPITEISLFFKDLCSNT  140



>ref|XP_011039084.1| PREDICTED: uncharacterized protein LOC105135756 [Populus euphratica]
Length=1079

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 30/48 (63%), Positives = 38/48 (79%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCSTS  2
            K+ GMKSHDCH+F+Q LLP AF  +LP   W+ L ELSVFFR++CST+
Sbjct  179  KVSGMKSHDCHVFIQRLLPTAFRPYLPRPLWEALTELSVFFRDICSTN  226



>ref|XP_004488300.1| PREDICTED: uncharacterized protein LOC101515602 [Cicer arietinum]
Length=669

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 29/47 (62%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFMFLPSCHWKPLAELSVFFRNLCSTS  2
            ++ GMKSHDCH+FM+ LLP AF  LP   WKPL ELS FF+ LCS +
Sbjct  397  QMNGMKSHDCHVFMECLLPFAFSSLPDHVWKPLTELSQFFKGLCSNT  443



>ref|XP_011007650.1| PREDICTED: uncharacterized protein LOC105113251 [Populus euphratica]
Length=1473

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/48 (63%), Positives = 38/48 (79%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCSTS  2
            K+ GMKSHDCH+F+Q LLP AF  +LP   W+ L ELSVFFR++CST+
Sbjct  493  KVSGMKSHDCHVFIQRLLPTAFRPYLPRPLWEALTELSVFFRDICSTN  540



>ref|XP_004514879.1| PREDICTED: uncharacterized protein LOC101496630 [Cicer arietinum]
Length=1001

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 29/47 (62%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFMFLPSCHWKPLAELSVFFRNLCSTS  2
            ++ GMKSHDCH+FM+ LLP AF  LP   WKPL ELS FF+ LCS +
Sbjct  646  QMNGMKSHDCHVFMECLLPFAFSSLPDHVWKPLTELSQFFKGLCSNT  692



>ref|XP_004499474.1| PREDICTED: uncharacterized protein LOC101514915 [Cicer arietinum]
Length=1042

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 29/47 (62%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFMFLPSCHWKPLAELSVFFRNLCSTS  2
            ++ GMKSHDCH+FM+ LLP AF  LP   WKPL ELS FF+ LCS +
Sbjct  687  QMNGMKSHDCHVFMECLLPFAFSSLPDHVWKPLTELSQFFKGLCSNT  733



>ref|XP_006590084.1| PREDICTED: uncharacterized protein LOC102666495 [Glycine max]
Length=695

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFMFLPSCHWKPLAELSVFFRNLCSTS  2
            K+ GMKSHDCH+FMQ LLPIAF  LP   WKP  ELS FFR L ST+
Sbjct  351  KIHGMKSHDCHVFMQRLLPIAFDSLPKPIWKPFVELSQFFRELTSTT  397



>ref|XP_004488346.1| PREDICTED: uncharacterized protein LOC101505488 [Cicer arietinum]
Length=895

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFMFLPSCHWKPLAELSVFFRNLCSTS  2
            ++ GMKSHDCH+FM+ LLP AF  LP   WKPL ELS FF+  CS +
Sbjct  461  QMNGMKSHDCHVFMECLLPFAFSSLPDHAWKPLTELSQFFKGFCSNT  507



>ref|XP_006590077.1| PREDICTED: uncharacterized protein LOC102665163 [Glycine max]
Length=561

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFMFLPSCHWKPLAELSVFFRNLCSTS  2
            K+ GMKSHDCH+FMQ LLPIAF  LP   WKP  ELS FFR L ST+
Sbjct  351  KIHGMKSHDCHVFMQRLLPIAFDSLPKPIWKPFVELSQFFRELTSTT  397



>ref|XP_009773819.1| PREDICTED: uncharacterized protein LOC104223971 [Nicotiana sylvestris]
Length=438

 Score = 66.2 bits (160),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 31/48 (65%), Positives = 38/48 (79%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCSTS  2
            KL GMKSHDCH+FMQ L+PIAF   LP   W+ LAE+S+FFR+L ST+
Sbjct  250  KLFGMKSHDCHVFMQRLVPIAFRELLPQKVWELLAEMSLFFRDLTSTA  297



>dbj|BAB64937.1| TdcA1-ORF1-ORF2 [Daucus carota]
Length=988

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 29/48 (60%), Positives = 38/48 (79%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCSTS  2
            KL GMKSHDCH+FMQ L+PIAF  FLP+  W+ + ELS+FF++L S +
Sbjct  101  KLFGMKSHDCHVFMQRLMPIAFREFLPNNVWEAVTELSLFFKDLTSAT  148



>ref|XP_004488260.1| PREDICTED: uncharacterized protein LOC101500695 [Cicer arietinum]
Length=1217

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFMFLPSCHWKPLAELSVFFRNLCSTS  2
            ++ GMKSHDCH+FM+ LLP AF  LP   WKPL ELS FF+  CS +
Sbjct  677  QMNGMKSHDCHVFMECLLPFAFSSLPDHVWKPLTELSQFFKGFCSNT  723



>ref|XP_009769640.1| PREDICTED: uncharacterized protein LOC104220460 [Nicotiana sylvestris]
Length=710

 Score = 66.2 bits (160),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 30/48 (63%), Positives = 38/48 (79%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCSTS  2
            +L GMKSHDCH+FMQ L+PIAF   LPS  W+ L ELS+FF++L ST+
Sbjct  349  RLFGMKSHDCHVFMQRLMPIAFRELLPSNVWQALTELSLFFKDLTSTT  396



>ref|XP_004516027.1| PREDICTED: uncharacterized protein LOC101488515 [Cicer arietinum]
Length=1013

 Score = 66.2 bits (160),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFMFLPSCHWKPLAELSVFFRNLCSTS  2
            ++ GMKSHDCH+FM+ LLP AF  LP   WKPL ELS FF+ LC+ +
Sbjct  677  QMNGMKSHDCHVFMECLLPFAFSSLPDHVWKPLTELSQFFKGLCNNT  723



>ref|XP_004516953.1| PREDICTED: uncharacterized protein LOC101493202 [Cicer arietinum]
Length=711

 Score = 65.9 bits (159),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFMFLPSCHWKPLAELSVFFRNLCSTS  2
            ++ GMKSHDCH+FM+ LLP  F  LP   WKPL ELS FF+ LCS +
Sbjct  401  QMNGMKSHDCHVFMECLLPFLFSSLPDHVWKPLTELSQFFKGLCSNT  447



>ref|XP_010690165.1| PREDICTED: uncharacterized protein LOC104903750 [Beta vulgaris 
subsp. vulgaris]
Length=981

 Score = 65.9 bits (159),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 30/48 (63%), Positives = 36/48 (75%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCSTS  2
            +L G+KSHDCH+FMQ LLP+AF   LP   W  L ELS FFR++CSTS
Sbjct  647  RLFGLKSHDCHVFMQRLLPVAFKDLLPPNVWNALTELSQFFRDICSTS  694



>ref|XP_004515006.1| PREDICTED: uncharacterized protein LOC101494987 [Cicer arietinum]
Length=976

 Score = 65.9 bits (159),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -2

Query  133  GMKSHDCHIFMQFLLPIAFMFLPSCHWKPLAELSVFFRNLCSTS  2
            GMKSH CH+FM+ LLPIAF  LP   WKPL ELS FF++LC  +
Sbjct  608  GMKSHGCHVFMECLLPIAFHSLPEFVWKPLMELSRFFKDLCCNT  651



>ref|XP_011011885.1| PREDICTED: uncharacterized protein LOC105116299 [Populus euphratica]
Length=1095

 Score = 65.9 bits (159),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 30/48 (63%), Positives = 38/48 (79%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCSTS  2
            K+ GMKSHDCH+F+Q LLP AF  +LP   W+ L ELSVFFR++CST+
Sbjct  658  KVSGMKSHDCHVFIQRLLPTAFRPYLPRPLWEALTELSVFFRDICSTN  705



>emb|CAM59133.1| putative transposase [Antirrhinum majus]
Length=919

 Score = 65.9 bits (159),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 29/48 (60%), Positives = 36/48 (75%), Gaps = 1/48 (2%)
 Frame = -2

Query  145  IKLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCST  5
            ++L GM+SHDCH+FMQ L+P AF  FLP   W PL E+S FFR LC+T
Sbjct  556  LRLAGMRSHDCHVFMQRLMPNAFHDFLPDSVWGPLVEVSNFFRALCAT  603



>ref|XP_004515596.1| PREDICTED: uncharacterized protein LOC101488619 [Cicer arietinum]
Length=744

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFMFLPSCHWKPLAELSVFFRNLCSTS  2
            ++ GMKSHDCH+FM+ LLP AF  LP   WKPL ELS FF+ LCS +
Sbjct  286  QMNGMKSHDCHVFMECLLPFAFSSLPDHVWKPLTELSQFFKGLCSNT  332



>dbj|BAB64529.1| TdcA1-ORF2 [Daucus carota]
Length=812

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 29/48 (60%), Positives = 38/48 (79%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCSTS  2
            KL GMKSHDCH+FMQ L+PIAF  FLP+  W+ + ELS+FF++L S +
Sbjct  325  KLFGMKSHDCHVFMQRLMPIAFREFLPNNVWEAVTELSLFFKDLTSAT  372



>ref|XP_004513821.1| PREDICTED: uncharacterized protein LOC101493812 [Cicer arietinum]
Length=461

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFMFLPSCHWKPLAELSVFFRNLCSTS  2
            K+ GMKSHDCH+FM++LLP AF  LP   WKPL EL  FF+ L S +
Sbjct  185  KMNGMKSHDCHVFMEWLLPFAFSSLPDHVWKPLTELRQFFKGLGSNT  231



>ref|XP_004488505.1| PREDICTED: uncharacterized protein LOC101488681 [Cicer arietinum]
Length=978

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 29/45 (64%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFMFLPSCHWKPLAELSVFFRNLCS  8
            KL GMKSHDCH+F+Q LLPIAF  LP   W  L E S FFR L S
Sbjct  80   KLFGMKSHDCHVFLQRLLPIAFKALPKPIWNTLTEFSQFFRELTS  124



>ref|XP_004514735.1| PREDICTED: uncharacterized protein LOC101504463 [Cicer arietinum]
Length=967

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFMFLPSCHWKPLAELSVFFRNLCSTS  2
            ++ GMKSHDCH+FM+FLLP  F  LP   WKPL ELS FF+ LC+ +
Sbjct  651  QMNGMKSHDCHVFMEFLLPFVFSSLPDHVWKPLTELSQFFKGLCNNT  697



>ref|XP_004513822.1| PREDICTED: uncharacterized protein LOC101495419, partial [Cicer 
arietinum]
Length=506

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -2

Query  133  GMKSHDCHIFMQFLLPIAFMFLPSCHWKPLAELSVFFRNLC  11
            GMKSHDCH+FM+ LLPIAF  LP   WKPL ELS FF++LC
Sbjct  238  GMKSHDCHVFMECLLPIAFHSLPEFVWKPLTELSRFFKDLC  278



>ref|XP_006362685.1| PREDICTED: uncharacterized protein LOC102582826 [Solanum tuberosum]
Length=502

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 36/47 (77%), Gaps = 1/47 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCST  5
            KL GMKSHDCH+FMQ L+PIAF   LP   W+ L E+S+FFR++ +T
Sbjct  11   KLFGMKSHDCHVFMQRLVPIAFRELLPKKVWEALTEMSLFFRDVTAT  57



>ref|XP_004514610.1| PREDICTED: uncharacterized protein LOC101494042 [Cicer arietinum]
Length=866

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFMFLPSCHWKPLAELSVFFRNLCSTS  2
            ++ GMKSHDCH+FM+ LLP AF  LP   WKPL ELS FF+ LCS +
Sbjct  559  QMNGMKSHDCHVFMECLLPFAFSSLPDHVWKPLTELSQFFKGLCSNT  605



>ref|XP_004488345.1| PREDICTED: uncharacterized protein LOC101505173 [Cicer arietinum]
Length=1032

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFMFLPSCHWKPLAELSVFFRNLCSTS  2
            ++ GMKSHDCH+FM+ LLP AF  LP   WKPL ELS FF+ LCS +
Sbjct  677  QMNGMKSHDCHVFMECLLPFAFSSLPDHVWKPLTELSQFFKGLCSNT  723



>ref|XP_011016039.1| PREDICTED: uncharacterized protein LOC105119585 [Populus euphratica]
Length=802

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 38/48 (79%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCSTS  2
            K+ GMKSHDCH+F+Q LLP AF  +LP   W+ L ELSVFFR++CST+
Sbjct  540  KVSGMKSHDCHVFIQRLLPTAFRPYLPRPLWEALTELSVFFRDICSTN  587



>ref|XP_009784050.1| PREDICTED: uncharacterized protein LOC104232531 isoform X3 [Nicotiana 
sylvestris]
Length=486

 Score = 63.5 bits (153),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 28/48 (58%), Positives = 38/48 (79%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCSTS  2
            +L GMK+HDCH+FMQ L+PIAF   LPS  W+ L +LS+FF++L ST+
Sbjct  99   RLFGMKNHDCHVFMQRLMPIAFRELLPSNVWQTLTKLSLFFKDLTSTT  146



>ref|XP_009770563.1| PREDICTED: uncharacterized protein LOC104221243 [Nicotiana sylvestris]
Length=374

 Score = 63.2 bits (152),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 38/49 (78%), Gaps = 1/49 (2%)
 Frame = -2

Query  145  IKLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCSTS  2
            +KL GMKSHDCH+FMQ L+ IAF   LP   W+PL ELS+FF++L +T+
Sbjct  91   LKLFGMKSHDCHVFMQLLISIAFRELLPRNVWQPLTELSLFFKDLTATA  139



>ref|XP_006355770.1| PREDICTED: uncharacterized protein LOC102599843 [Solanum tuberosum]
Length=272

 Score = 61.6 bits (148),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 36/47 (77%), Gaps = 1/47 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCST  5
            KL GMKSHDCH+FMQ L+P+AF   LP   W+ L E+S+FFR++ ST
Sbjct  11   KLFGMKSHDCHVFMQRLVPVAFRELLPKKVWEALTEMSLFFRDITST  57



>ref|XP_004506447.1| PREDICTED: uncharacterized protein LOC101512105 [Cicer arietinum]
Length=420

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -2

Query  133  GMKSHDCHIFMQFLLPIAFMFLPSCHWKPLAELSVFFRNLC  11
            GMKSH CH+FM+ LLPIAF  LP   WKPL ELS FF++LC
Sbjct  321  GMKSHGCHVFMECLLPIAFHSLPEFVWKPLTELSRFFKDLC  361



>ref|XP_010693266.1| PREDICTED: uncharacterized protein LOC104906231 [Beta vulgaris 
subsp. vulgaris]
Length=1029

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 27/48 (56%), Positives = 36/48 (75%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCSTS  2
            +L GMKSHDCH+FM+ LLP+A    LPS  WK + E+S FFR LC+++
Sbjct  589  RLFGMKSHDCHVFMERLLPVALKELLPSHVWKAITEISQFFRELCTST  636



>ref|XP_009621288.1| PREDICTED: uncharacterized protein LOC104112945 [Nicotiana tomentosiformis]
Length=669

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFMFLPSCHWKPLAELSVFFRNLCSTS  2
            KL  +KSHDCHIF++ L+PIAF  LP   WKP+ E+++FF+ LCS++
Sbjct  528  KLTSIKSHDCHIFLESLMPIAFKALPDRIWKPINEINLFFKELCSST  574



>ref|XP_004488903.1| PREDICTED: uncharacterized protein LOC101501429 [Cicer arietinum]
Length=793

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFMFLPSCHWKPLAELSVFFRNLCSTS  2
            ++ GMKSHDCH+FM+ LLP  F  LP   WKPL ELS FF+ LCS +
Sbjct  585  QINGMKSHDCHVFMECLLPFLFSSLPDHVWKPLTELSQFFKGLCSNT  631



>ref|XP_009605089.1| PREDICTED: uncharacterized protein LOC104099716 [Nicotiana tomentosiformis]
Length=533

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFMFLPSCHWKPLAELSVFFRNLCSTS  2
            KL+ MKSHDCHIFM+ LLPIAF  LP   WK + E+S+F+++LCS +
Sbjct  368  KLMYMKSHDCHIFMESLLPIAFSALPQRLWKLITEISLFYKDLCSNT  414



>ref|XP_010555874.1| PREDICTED: uncharacterized protein LOC104825271 [Tarenaya hassleriana]
Length=577

 Score = 60.8 bits (146),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 36/47 (77%), Gaps = 1/47 (2%)
 Frame = -2

Query  145  IKLIGMKSHDCHIFMQFLLPIAFMFLPSCH-WKPLAELSVFFRNLCS  8
            +KL G+KSHDCH+FMQ LLP+A   LP  + ++PL  +S FFR++CS
Sbjct  258  VKLNGLKSHDCHVFMQRLLPVALAELPPHNVYEPLCGISTFFRDICS  304



>ref|XP_010532388.1| PREDICTED: uncharacterized protein LOC104808409 [Tarenaya hassleriana]
Length=1075

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 35/47 (74%), Gaps = 1/47 (2%)
 Frame = -2

Query  145  IKLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCS  8
            +KL GMKSHDCH+FMQ LLP+A    +P   ++PL  +S FFR++CS
Sbjct  749  VKLNGMKSHDCHVFMQRLLPVALAELVPHNVYEPLCGISTFFRDICS  795



>ref|XP_011004861.1| PREDICTED: uncharacterized protein LOC105111246, partial [Populus 
euphratica]
Length=763

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 38/48 (79%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCSTS  2
            K++ +KSHDCH+F+Q LLP AF  +LP   W+ L ELSVFFR++C+T+
Sbjct  293  KILKIKSHDCHVFIQRLLPTAFRPYLPRPLWEALTELSVFFRDICTTN  340



>ref|XP_010686699.1| PREDICTED: uncharacterized protein LOC104900868 [Beta vulgaris 
subsp. vulgaris]
Length=741

 Score = 60.5 bits (145),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 37/48 (77%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCSTS  2
            +L GMKSHDCH+FM+ LLP+A    LPS  WK + E+S FFR+LC+++
Sbjct  635  RLFGMKSHDCHVFMERLLPVALKELLPSHVWKAITEISQFFRDLCAST  682



>ref|XP_004506268.1| PREDICTED: uncharacterized protein LOC101494613 [Cicer arietinum]
Length=559

 Score = 60.1 bits (144),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 25/43 (58%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = -2

Query  130  MKSHDCHIFMQFLLPIAFMFLPSCHWKPLAELSVFFRNLCSTS  2
            MKSHDC +F++ LLP AF  LP   WKPL ELS FF+ LC+ +
Sbjct  162  MKSHDCRVFVECLLPFAFSSLPDHVWKPLTELSQFFKGLCNNT  204



>gb|ABG37655.1| integrase [Populus trichocarpa]
Length=1263

 Score = 60.5 bits (145),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 35/47 (74%), Gaps = 1/47 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCST  5
            +L GMKSHDCH+FMQ L+P+AF   LP   W  L E+S FFR++CS+
Sbjct  271  RLYGMKSHDCHVFMQTLIPLAFRDLLPKGIWDALTEISHFFRDICSS  317



>ref|XP_003597012.1| TdcA1-ORF2 protein [Medicago truncatula]
Length=984

 Score = 60.1 bits (144),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFMFLPSCHWKPLAELSVFFRNLCSTS  2
            +L GMKSHD HIFM+  +PIAF  LP     PL E+S FF+NLC+++
Sbjct  95   RLHGMKSHDSHIFMENFIPIAFSSLPKHVLDPLIEISQFFKNLCAST  141



>ref|XP_010545155.1| PREDICTED: uncharacterized protein LOC104817604 [Tarenaya hassleriana]
Length=1053

 Score = 60.1 bits (144),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 28/48 (58%), Positives = 34/48 (71%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCSTS  2
            KLIGMKSHDCH+FMQ LLPIAF   LP    + L+ + +FF  LCS +
Sbjct  59   KLIGMKSHDCHVFMQRLLPIAFADILPQNVHEALSGIGIFFHELCSRT  106



>ref|XP_010694139.1| PREDICTED: uncharacterized protein LOC104906988 [Beta vulgaris 
subsp. vulgaris]
Length=989

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 35/48 (73%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFMFLPSCH-WKPLAELSVFFRNLCSTS  2
            KL G+KSHDCH+FM+ LLP+    L   H WK + E+S FFR+LC+++
Sbjct  218  KLQGLKSHDCHVFMERLLPVGLKELLPLHVWKAITEISQFFRDLCAST  265



>gb|ABM55245.1| transposon-like protein [Beta vulgaris]
Length=1399

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 35/48 (73%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFMFLPSCH-WKPLAELSVFFRNLCSTS  2
            KL G+KSHDCH+FM+ LLP+    L   H WK + E+S FFR+LC+++
Sbjct  538  KLQGLKSHDCHVFMERLLPVGLKELLPLHVWKAITEISQFFRDLCAST  585



>ref|XP_010680482.1| PREDICTED: uncharacterized protein LOC104895620 [Beta vulgaris 
subsp. vulgaris]
Length=1371

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 35/48 (73%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFMFLPSCH-WKPLAELSVFFRNLCSTS  2
            KL G+KSHDCH+FM+ LLP+    L   H WK + E+S FFR+LC+++
Sbjct  637  KLQGLKSHDCHVFMERLLPVGLKELLPLHVWKAITEISQFFRDLCAST  684



>gb|ABB46852.1| transposon protein, putative, CACTA, En/Spm sub-class [Oryza 
sativa Japonica Group]
Length=955

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/46 (57%), Positives = 34/46 (74%), Gaps = 1/46 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCS  8
            K IG+KSHD HIF++ LLP+A   F+P   WK L+ELS F+R LC+
Sbjct  519  KFIGLKSHDFHIFIERLLPVALRGFIPEKEWKDLSELSFFYRQLCA  564



>ref|XP_009783976.1| PREDICTED: uncharacterized protein LOC104232461 [Nicotiana sylvestris]
Length=522

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = -2

Query  148  IIKLIGMKSHDCHIFMQFLLPIAFMFLPSCHWKPLAELSVFFRNLCSTS  2
            +I  +   SHDCHIF++ L+PIAF  LP   WKP+ E+S+FF+ LCS++
Sbjct  238  LIPRLKRXSHDCHIFLESLMPIAFKALPDRIWKPITEISLFFKELCSST  286



>ref|XP_010695922.1| PREDICTED: uncharacterized protein LOC104908504 [Beta vulgaris 
subsp. vulgaris]
Length=861

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 35/48 (73%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFMFLPSCH-WKPLAELSVFFRNLCSTS  2
            KL G+KSHDCH+FM+ LLP+    L   H WK + E+S FFR+LC+++
Sbjct  395  KLQGLKSHDCHVFMERLLPVGLKELLPLHVWKAITEISQFFRDLCAST  442



>ref|XP_010535289.1| PREDICTED: uncharacterized protein LOC104810640 [Tarenaya hassleriana]
Length=629

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 36/47 (77%), Gaps = 1/47 (2%)
 Frame = -2

Query  145  IKLIGMKSHDCHIFMQFLLPIAFMFLPSCH-WKPLAELSVFFRNLCS  8
            +KL GMKSHDCH+FMQ LLP+A   L S + ++PL  +S FFR++CS
Sbjct  190  VKLNGMKSHDCHVFMQRLLPVALAELLSRNVYEPLCGISTFFRDICS  236



>ref|XP_009591501.1| PREDICTED: uncharacterized protein LOC104088517 [Nicotiana tomentosiformis]
 ref|XP_009591502.1| PREDICTED: uncharacterized protein LOC104088517 [Nicotiana tomentosiformis]
 ref|XP_009591504.1| PREDICTED: uncharacterized protein LOC104088517 [Nicotiana tomentosiformis]
 ref|XP_009591505.1| PREDICTED: uncharacterized protein LOC104088517 [Nicotiana tomentosiformis]
 ref|XP_009591506.1| PREDICTED: uncharacterized protein LOC104088517 [Nicotiana tomentosiformis]
 ref|XP_009591507.1| PREDICTED: uncharacterized protein LOC104088517 [Nicotiana tomentosiformis]
 ref|XP_009591508.1| PREDICTED: uncharacterized protein LOC104088517 [Nicotiana tomentosiformis]
Length=364

 Score = 58.5 bits (140),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/48 (54%), Positives = 36/48 (75%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCSTS  2
            +L GMKSHDCH+FMQ L+ IAF   LP+  W+ + ELS+FF++L S +
Sbjct  87   RLFGMKSHDCHVFMQRLMSIAFHELLPNNVWQAVTELSLFFKDLSSIT  134



>gb|ABG37667.2| transposase tnp2 [Populus trichocarpa]
Length=654

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 33/46 (72%), Gaps = 1/46 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCS  8
            +L GM SHDCH+FMQ L+P+AF   LP   W  L E++ FFR++CS
Sbjct  443  RLYGMNSHDCHVFMQTLIPLAFRDLLPKGIWDALTEINHFFRDICS  488



>ref|XP_010682650.1| PREDICTED: uncharacterized protein LOC104897464 [Beta vulgaris 
subsp. vulgaris]
Length=927

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 35/48 (73%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFMFLPSCH-WKPLAELSVFFRNLCSTS  2
            KL G+KSHDCH+FM+ LLP+    L   H WK + E+S FFR+LC+++
Sbjct  448  KLQGLKSHDCHVFMERLLPVGLKELLPLHVWKAITEISQFFRDLCAST  495



>ref|XP_010684137.1| PREDICTED: uncharacterized protein LOC104898733 [Beta vulgaris 
subsp. vulgaris]
Length=1116

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 35/48 (73%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFMFLPSCH-WKPLAELSVFFRNLCSTS  2
            KL G+KSHDCH+FM+ LLP+    L   H WK + E+S FFR+LC+++
Sbjct  637  KLQGLKSHDCHVFMERLLPVGLKELLPLHVWKAITEISQFFRDLCAST  684



>gb|AAM74372.1|AC116603_8 Putative transposable element [Oryza sativa Japonica Group]
 gb|AAN04174.1| Putative transposable element [Oryza sativa Japonica Group]
Length=992

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/46 (57%), Positives = 34/46 (74%), Gaps = 1/46 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCS  8
            K IG+KSHD HIF++ LLP+A   F+P   WK L+ELS F+R LC+
Sbjct  552  KFIGLKSHDFHIFIERLLPVALRGFIPEKEWKDLSELSFFYRQLCA  597



>ref|XP_004517042.1| PREDICTED: uncharacterized protein LOC101505019 [Cicer arietinum]
Length=870

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFMFLPSCHWKPLAELSVFFRNLCS  8
            KL GMKSHDCH+F+Q  LPIAF  LP   W  L E S FFR L S
Sbjct  660  KLFGMKSHDCHVFLQHFLPIAFKALPKPIWNTLTEFSQFFRELTS  704



>ref|XP_010684970.1| PREDICTED: uncharacterized protein LOC104899469 [Beta vulgaris 
subsp. vulgaris]
Length=1001

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 35/48 (73%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFMFLPSCH-WKPLAELSVFFRNLCSTS  2
            KL G+KSHDCH+FM+ LLP+    L   H WK + E+S FFR+LC+++
Sbjct  637  KLQGLKSHDCHVFMERLLPVGLKELLPLHVWKAITEISQFFRDLCAST  684



>ref|XP_004492138.1| PREDICTED: uncharacterized protein LOC101505635 [Cicer arietinum]
Length=982

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFMFLPSCHWKPLAELSVFFRNLCSTS  2
            ++ GMKSHD H+F + LLP AF  L    WKPL ELS FF+ LCS +
Sbjct  563  QMNGMKSHDFHVFTECLLPFAFSSLSDHVWKPLTELSQFFKGLCSNT  609



>ref|XP_010530536.1| PREDICTED: uncharacterized protein LOC104807121 [Tarenaya hassleriana]
Length=450

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 34/46 (74%), Gaps = 1/46 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCS  8
            +L GMKSHDCH+FMQ LLP+A    +P   ++PL  +S FFR++CS
Sbjct  245  ELNGMKSHDCHVFMQRLLPVALAELVPRNVYEPLCGISTFFRDICS  290



>ref|XP_010669259.1| PREDICTED: uncharacterized protein LOC104886511 [Beta vulgaris 
subsp. vulgaris]
Length=504

 Score = 57.4 bits (137),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 28/48 (58%), Positives = 34/48 (71%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCSTS  2
            K+  MKSHDCH+FMQ LL  AF   LP    +PLAELS+FF+ LCS +
Sbjct  398  KISNMKSHDCHVFMQDLLIPAFQGILPKEVLEPLAELSLFFKQLCSKT  445



>ref|XP_006601486.1| PREDICTED: uncharacterized protein LOC102668025 [Glycine max]
Length=347

 Score = 56.2 bits (134),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -2

Query  133  GMKSHDCHIFMQFLLPIAFMFLPSCHWKPLAELSVFFRNLCSTS  2
            GMKSHDCH+F++ LLPIAF  LPS    PL E+S FF++LCS +
Sbjct  239  GMKSHDCHVFIECLLPIAFSSLPSHVLNPLIEISHFFKDLCSIT  282



>ref|XP_010672801.1| PREDICTED: uncharacterized protein LOC104889304 [Beta vulgaris 
subsp. vulgaris]
Length=1094

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 28/48 (58%), Positives = 34/48 (71%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCSTS  2
            K+  MKSHDCH+FMQ LL  AF   LP    +PLAELS+FF+ LCS +
Sbjct  604  KISNMKSHDCHVFMQDLLIPAFQGILPKEVLEPLAELSLFFKQLCSKT  651



>ref|XP_010555676.1| PREDICTED: uncharacterized protein LOC104825104 [Tarenaya hassleriana]
Length=483

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 3/47 (6%)
 Frame = -2

Query  136  IGMKSHDCHIFMQFLLPIAF--MFLPSCHWKPLAELSVFFRNLCSTS  2
            +GMKSHDCH+FMQ L+PIAF  +  PS H   L  +S FFR++C+ S
Sbjct  1    MGMKSHDCHVFMQILIPIAFAELLKPSVH-GALCGISTFFRDICARS  46



>ref|XP_010428128.1| PREDICTED: uncharacterized protein LOC104712847 [Camelina sativa]
Length=468

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/44 (57%), Positives = 32/44 (73%), Gaps = 1/44 (2%)
 Frame = -2

Query  130  MKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCSTS  2
            MKSHDCH+FMQ LLP AF+  LP    + +A +S FFR+LC+ S
Sbjct  1    MKSHDCHVFMQRLLPFAFVNLLPKNEHEAIAGISAFFRDLCTRS  44



>ref|XP_010558998.1| PREDICTED: uncharacterized protein LOC104827517 [Tarenaya hassleriana]
Length=814

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 35/47 (74%), Gaps = 3/47 (6%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAF--MFLPSCHWKPLAELSVFFRNLCS  8
            KLIGMKSHDCH+FMQ L+ IAF  +  PS H + L  +S FFR++C+
Sbjct  120  KLIGMKSHDCHVFMQRLIRIAFAELLKPSVH-EGLCGISSFFRDICA  165



>ref|XP_010693338.1| PREDICTED: uncharacterized protein LOC104906299 [Beta vulgaris 
subsp. vulgaris]
Length=743

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 35/48 (73%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFMFLPSCH-WKPLAELSVFFRNLCSTS  2
            KL G+KSHDCH+FM+ LLP+    L   H WK + E+S FFR+LC+++
Sbjct  637  KLQGLKSHDCHVFMERLLPVGLKELLPLHVWKAITEISQFFRDLCAST  684



>gb|ABA94910.1| transposon protein, putative, CACTA, En/Spm sub-class [Oryza 
sativa Japonica Group]
Length=1001

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 26/46 (57%), Positives = 33/46 (72%), Gaps = 1/46 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCS  8
            K+ G+KSHD H FM+ LL +AF  F+P   WK LAELS F+R LC+
Sbjct  626  KIFGLKSHDYHAFMERLLLVAFRGFIPESVWKCLAELSFFYRQLCA  671



>ref|XP_010682939.1| PREDICTED: uncharacterized protein LOC104897700 [Beta vulgaris 
subsp. vulgaris]
Length=744

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 35/48 (73%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFMFLPSCH-WKPLAELSVFFRNLCSTS  2
            KL G+KSHDCH+FM+ LLP+    L   H WK + E+S FFR+LC+++
Sbjct  638  KLQGLKSHDCHVFMERLLPVGLKELLPLHVWKAITEISQFFRDLCAST  685



>ref|XP_010667521.1| PREDICTED: uncharacterized protein LOC104884542 [Beta vulgaris 
subsp. vulgaris]
Length=447

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 35/48 (73%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFMFLPSCH-WKPLAELSVFFRNLCSTS  2
            KL  MKSHDCH+FM+ LLPIA   L   H WK + E+S+FFR+LC ++
Sbjct  234  KLHSMKSHDCHVFMERLLPIALKELLPVHVWKAVTEISLFFRDLCCST  281



>ref|XP_010541809.1| PREDICTED: uncharacterized protein LOC104815191 [Tarenaya hassleriana]
Length=752

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 35/47 (74%), Gaps = 3/47 (6%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAF--MFLPSCHWKPLAELSVFFRNLCS  8
            KLIGMKSHDCH+FMQ L+ IAF  +  PS H + L  +S FFR++C+
Sbjct  171  KLIGMKSHDCHVFMQRLIRIAFAELLKPSVH-EGLCGISGFFRDICA  216



>ref|XP_010690173.1| PREDICTED: uncharacterized protein LOC104903759 [Beta vulgaris 
subsp. vulgaris]
Length=662

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 36/48 (75%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCSTS  2
            +L GMKSHDCH+FM+ LLP+A    LPS   K + E+S FFR+LC+++
Sbjct  449  RLFGMKSHDCHVFMERLLPVALKELLPSHVLKAITEISQFFRDLCAST  496



>ref|XP_009107714.1| PREDICTED: uncharacterized protein LOC103833381 [Brassica rapa]
Length=682

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 26/46 (57%), Positives = 32/46 (70%), Gaps = 1/46 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAF-MFLPSCHWKPLAELSVFFRNLCS  8
            K  G+KSHDCH+ MQ LLP AF   LP    + +A +SVFFR+LCS
Sbjct  220  KFSGLKSHDCHVIMQRLLPFAFSALLPRNVHEAIAGISVFFRDLCS  265



>ref|XP_009128623.1| PREDICTED: uncharacterized protein LOC103853474 [Brassica rapa]
Length=743

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 26/46 (57%), Positives = 32/46 (70%), Gaps = 1/46 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAF-MFLPSCHWKPLAELSVFFRNLCS  8
            K  G+KSHDCH+ MQ LLP AF   LP    + +A +SVFFR+LCS
Sbjct  533  KFSGLKSHDCHVIMQRLLPFAFSALLPRNVHEAIAGISVFFRDLCS  578



>ref|XP_010681184.1| PREDICTED: uncharacterized protein LOC104896163 [Beta vulgaris 
subsp. vulgaris]
Length=768

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 34/48 (71%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFMFLPSCH-WKPLAELSVFFRNLCSTS  2
            K  G+KS DCH+FM+ LLP+A   L   H WK + E+S FFR+LC+++
Sbjct  289  KFQGLKSDDCHVFMERLLPVALKELLPLHVWKAIIEISQFFRDLCAST  336



>ref|XP_009123108.1| PREDICTED: uncharacterized protein LOC103847790 [Brassica rapa]
Length=819

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 26/46 (57%), Positives = 32/46 (70%), Gaps = 1/46 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAF-MFLPSCHWKPLAELSVFFRNLCS  8
            K  G+KSHDCH+ MQ LLP AF   LP    + +A +SVFFR+LCS
Sbjct  400  KFSGLKSHDCHVIMQRLLPFAFSALLPRNVHEAIAGISVFFRDLCS  445



>ref|XP_006664968.1| PREDICTED: uncharacterized protein LOC102717211 isoform X1 [Oryza 
brachyantha]
Length=1147

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 27/46 (59%), Positives = 33/46 (72%), Gaps = 1/46 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCS  8
            K+ G+KSHD HIFM+ LLP+AF  FL    W  LAELS F+R LC+
Sbjct  622  KIFGLKSHDYHIFMERLLPVAFRGFLREETWVCLAELSFFYRQLCA  667



>ref|XP_009140279.1| PREDICTED: uncharacterized protein LOC103864271 [Brassica rapa]
 ref|XP_009140857.1| PREDICTED: uncharacterized protein LOC103864836 [Brassica rapa]
 ref|XP_009102176.1| PREDICTED: uncharacterized protein LOC103828318 [Brassica rapa]
 ref|XP_009133166.1| PREDICTED: uncharacterized protein LOC103857695 [Brassica rapa]
 ref|XP_009137121.1| PREDICTED: uncharacterized protein LOC103861169 [Brassica rapa]
 ref|XP_009139304.1| PREDICTED: uncharacterized protein LOC103863291 [Brassica rapa]
 ref|XP_009149323.1| PREDICTED: uncharacterized protein LOC103872645 [Brassica rapa]
 ref|XP_009108146.1| PREDICTED: uncharacterized protein LOC103833840 [Brassica rapa]
Length=1085

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 26/46 (57%), Positives = 32/46 (70%), Gaps = 1/46 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAF-MFLPSCHWKPLAELSVFFRNLCS  8
            K  G+KSHDCH+ MQ LLP AF   LP    + +A +SVFFR+LCS
Sbjct  623  KFSGLKSHDCHVIMQRLLPFAFSALLPRNVHEAIAGISVFFRDLCS  668



>gb|ABD96944.1| hypothetical protein [Cleome spinosa]
Length=826

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 37/50 (74%), Gaps = 3/50 (6%)
 Frame = -2

Query  145  IKLIGMKSHDCHIFMQFLLPIAFMFL--PSCHWKPLAELSVFFRNLCSTS  2
            +KL+GMKSHDCH+FMQ L+PIAF  L  PS H   L  ++ FFR++C+ S
Sbjct  356  LKLMGMKSHDCHVFMQRLIPIAFAELLKPSVH-GALCGINTFFRDICARS  404



>ref|XP_010689504.1| PREDICTED: uncharacterized protein LOC104903203 [Beta vulgaris 
subsp. vulgaris]
Length=658

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 35/48 (73%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFMFLPSCH-WKPLAELSVFFRNLCSTS  2
            KL  MKSHDCH+FM+ LLPIA   L   H WK + E+S+FFR+LC ++
Sbjct  477  KLHSMKSHDCHVFMERLLPIALKELLPVHVWKAVTEISLFFRDLCCST  524



>ref|XP_010518611.1| PREDICTED: uncharacterized protein LOC104793884 [Camelina sativa]
Length=1092

 Score = 55.1 bits (131),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 26/48 (54%), Positives = 32/48 (67%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAF-MFLPSCHWKPLAELSVFFRNLCSTS  2
            K  GMKSHDCH+ MQ LLP AF   LPS   + +A +  FFR+LCS +
Sbjct  657  KFTGMKSHDCHVVMQRLLPFAFEHLLPSNVHQAIAGVGAFFRDLCSRT  704



>gb|ABA94136.1| transposon protein, putative, CACTA, En/Spm sub-class [Oryza 
sativa Japonica Group]
Length=1411

 Score = 55.5 bits (132),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 33/46 (72%), Gaps = 1/46 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCS  8
            ++  +KSHD HIF++ LLP+AF  FLP   W  LAELS F+R LC+
Sbjct  581  RIFDLKSHDYHIFIERLLPVAFRGFLPENIWVCLAELSFFYRQLCA  626



>ref|XP_010495881.1| PREDICTED: uncharacterized protein LOC104773034 [Camelina sativa]
Length=1128

 Score = 55.1 bits (131),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 26/48 (54%), Positives = 32/48 (67%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAF-MFLPSCHWKPLAELSVFFRNLCSTS  2
            K  GMKSHDCH+ MQ LLP AF   LPS   + +A +  FFR+LCS +
Sbjct  657  KFTGMKSHDCHVVMQRLLPFAFEHLLPSNVHQAIAGVGAFFRDLCSRT  704



>ref|XP_010544444.1| PREDICTED: uncharacterized protein LOC104817064 [Tarenaya hassleriana]
Length=775

 Score = 55.1 bits (131),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 31/45 (69%), Gaps = 1/45 (2%)
 Frame = -2

Query  133  GMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCSTS  2
            GMKSHDCH+FMQ LLPIAF   LP    + L+ + +FF  LCS +
Sbjct  244  GMKSHDCHVFMQRLLPIAFADILPQNVHEALSGIGIFFHELCSRT  288



>ref|XP_010670313.1| PREDICTED: uncharacterized protein LOC104887394 [Beta vulgaris 
subsp. vulgaris]
Length=1119

 Score = 55.1 bits (131),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 27/46 (59%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCS  8
            K+  MKSHD H+F++ LLP+A   FLP+  ++PL ELS FFRNLCS
Sbjct  614  KISCMKSHDHHMFIEQLLPLATRGFLPNNVYEPLVELSPFFRNLCS  659



>ref|XP_010668099.1| PREDICTED: uncharacterized protein LOC104885093 [Beta vulgaris 
subsp. vulgaris]
Length=562

 Score = 54.7 bits (130),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 33/48 (69%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCSTS  2
            KL  MKSHDCH+FMQ L+P  F   LP   W  + ELS FFR+LCST+
Sbjct  456  KLFCMKSHDCHVFMQRLIPFVFKDLLPLNVWNVITELSQFFRDLCSTT  503



>ref|XP_008389002.1| PREDICTED: uncharacterized protein LOC103451366 [Malus domestica]
Length=677

 Score = 54.3 bits (129),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 25/43 (58%), Positives = 32/43 (74%), Gaps = 1/43 (2%)
 Frame = -2

Query  133  GMKSHDCHIFMQFLLP-IAFMFLPSCHWKPLAELSVFFRNLCS  8
            GMK+HDCHIF++ LLP IA   LP   ++PL ELS FF+ LC+
Sbjct  374  GMKTHDCHIFLERLLPFIARELLPKDVYEPLIELSYFFKELCA  416



>ref|XP_010536309.1| PREDICTED: uncharacterized protein LOC104811343 [Tarenaya hassleriana]
Length=669

 Score = 54.3 bits (129),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 31/45 (69%), Gaps = 1/45 (2%)
 Frame = -2

Query  133  GMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCSTS  2
            GMKSHDCH+FMQ LLPIAF   LP    + L+ + +FF  LCS +
Sbjct  344  GMKSHDCHVFMQRLLPIAFADILPQNVHEALSGIGIFFHELCSRT  388



>ref|XP_010519132.1| PREDICTED: uncharacterized protein LOC104798660 [Tarenaya hassleriana]
Length=177

 Score = 51.6 bits (122),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 24/45 (53%), Positives = 32/45 (71%), Gaps = 3/45 (7%)
 Frame = -2

Query  130  MKSHDCHIFMQFLLPIAF--MFLPSCHWKPLAELSVFFRNLCSTS  2
            MKSHDCH+FMQ L+PIAF  +  PS H   L  ++ FFR++C+ S
Sbjct  1    MKSHDCHVFMQRLIPIAFAELLKPSVH-GALCGINTFFRDICARS  44



>ref|XP_010541813.1| PREDICTED: uncharacterized protein LOC104815196 [Tarenaya hassleriana]
Length=303

 Score = 53.1 bits (126),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 34/48 (71%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCSTS  2
            KL GMKSHDCH+FMQ LLPIAF   LP    + L+ +S FFR +CS +
Sbjct  236  KLTGMKSHDCHVFMQRLLPIAFAELLPHHVHESLSGISSFFRVICSRT  283



>dbj|BAB09502.1| transposon protein-like [Arabidopsis thaliana]
Length=1089

 Score = 54.3 bits (129),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 27/49 (55%), Positives = 34/49 (69%), Gaps = 3/49 (6%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFMFL--PSCHWKPLAELSVFFRNLCSTS  2
            KL GMKSHDCH+ MQ L PIAF  L   S H   L+ +S+FFR+LC+ +
Sbjct  656  KLTGMKSHDCHVLMQRLFPIAFAELMDKSVH-DALSSVSLFFRDLCART  703



>gb|ABF67953.1| CACTA TnpD transposase [Zea mays]
Length=1141

 Score = 54.3 bits (129),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 26/46 (57%), Positives = 32/46 (70%), Gaps = 1/46 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCS  8
            K+ G+KSHD HI M+ LLPI F  +L    WK LAELS F+R LC+
Sbjct  647  KITGLKSHDYHIMMERLLPIMFRGYLKVSIWKALAELSYFYRQLCA  692



>ref|XP_010675427.1| PREDICTED: uncharacterized protein LOC104891429 [Beta vulgaris 
subsp. vulgaris]
Length=394

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 26/44 (59%), Positives = 31/44 (70%), Gaps = 1/44 (2%)
 Frame = -2

Query  130  MKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCSTS  2
            MKSHD H+F++ LLPIA    LP    +PL ELS FFRNLCS +
Sbjct  1    MKSHDHHVFLEQLLPIAIRGLLPKNVCEPLIELSSFFRNLCSKT  44



>ref|XP_008657644.1| PREDICTED: uncharacterized protein LOC103637172 [Zea mays]
Length=497

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 32/46 (70%), Gaps = 1/46 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCS  8
            K+ G+KSHD HI M+ LLP+ F  +L    W+ LAELS F+R LC+
Sbjct  27   KITGLKSHDYHIMMERLLPVMFRGYLKVSIWQALAELSYFYRQLCA  72



>ref|XP_008646835.1| PREDICTED: uncharacterized protein LOC103628405 [Zea mays]
Length=572

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 32/46 (70%), Gaps = 1/46 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCS  8
            K+ G+KSHD HI M+ LLP+ F  +L    W+ LAELS F+R LC+
Sbjct  174  KITGLKSHDYHIMMERLLPVMFRGYLKVSIWQALAELSYFYRQLCA  219



>ref|XP_009128586.1| PREDICTED: uncharacterized protein LOC103853426 [Brassica rapa]
Length=607

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 32/48 (67%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCSTS  2
            K  GMKSHDCH+FMQ LLP AF   LP+   + LA +  FFR+L + +
Sbjct  196  KFSGMKSHDCHVFMQRLLPFAFAELLPANVHEALAAIGAFFRDLSTRT  243



>ref|XP_008392411.1| PREDICTED: uncharacterized protein LOC103454586, partial [Malus 
domestica]
Length=743

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/43 (58%), Positives = 31/43 (72%), Gaps = 1/43 (2%)
 Frame = -2

Query  133  GMKSHDCHIFMQFLLP-IAFMFLPSCHWKPLAELSVFFRNLCS  8
            GMK+HDCHIF++ LLP IA   LP    +PL ELS FF+ LC+
Sbjct  523  GMKTHDCHIFLERLLPFIARELLPKDVCEPLIELSYFFKELCA  565



>ref|XP_009135019.1| PREDICTED: uncharacterized protein LOC103859258 [Brassica rapa]
Length=713

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 32/48 (67%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCSTS  2
            K  GMKSHDCH+FMQ LLP AF   LP+   + LA +  FFR+L + +
Sbjct  238  KFSGMKSHDCHVFMQRLLPFAFAELLPANVHEALAAIGAFFRDLSTRT  285



>ref|XP_009102785.1| PREDICTED: uncharacterized protein LOC103828898 [Brassica rapa]
Length=1152

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 32/48 (67%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCSTS  2
            K  GMKSHDCH+FMQ LLP AF   LP+   + LA +  FFR+L + +
Sbjct  677  KFSGMKSHDCHVFMQRLLPFAFAELLPANVHEALAAIGAFFRDLSTRT  724



>ref|XP_004488629.1| PREDICTED: uncharacterized protein LOC101512250, partial [Cicer 
arietinum]
Length=495

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = -2

Query  133  GMKSHDCHIFMQFLLPIAFMFLPSCHWKPLAELSVFFRNLC  11
            GMKS+D H+FM+  L IAF +LP   WKPL ELS FF +LC
Sbjct  411  GMKSYDYHVFMECPLLIAFHYLPEFVWKPLIELSRFFNDLC  451



>ref|XP_010666521.1| PREDICTED: uncharacterized protein LOC104883671 [Beta vulgaris 
subsp. vulgaris]
Length=630

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 31/46 (67%), Gaps = 1/46 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCS  8
            K++ MK HDCH+FMQ LL   F   LP    +PL+ELS FF+ LCS
Sbjct  299  KVMNMKRHDCHVFMQDLLTPTFCGVLPKQVLEPLSELSSFFKQLCS  344



>ref|XP_009141157.1| PREDICTED: uncharacterized protein LOC103865128 [Brassica rapa]
Length=1025

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 32/48 (67%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCSTS  2
            K  GMKSHDCH+FMQ LLP AF   LP+   + LA +  FFR+L + +
Sbjct  550  KFSGMKSHDCHVFMQRLLPFAFAELLPANVHEALAAIGAFFRDLSTRT  597



>ref|XP_009113453.1| PREDICTED: uncharacterized protein LOC103838751 [Brassica rapa]
Length=914

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 32/48 (67%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCSTS  2
            K  GMKSHDCH+FMQ LLP AF   LP+   + LA +  FFR+L + +
Sbjct  677  KFSGMKSHDCHVFMQRLLPFAFAELLPANVHEALAAIGAFFRDLSTRT  724



>ref|XP_006653255.1| PREDICTED: uncharacterized protein LOC102712905 [Oryza brachyantha]
Length=650

 Score = 52.4 bits (124),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 23/45 (51%), Positives = 33/45 (73%), Gaps = 1/45 (2%)
 Frame = -2

Query  139  LIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCS  8
            L G+KSHD HI M+ LLP+ F  ++P+  W+ LAE+S F+R LC+
Sbjct  208  LNGLKSHDYHIMMERLLPVMFRGYMPTHVWEVLAEVSFFYRKLCA  252



>ref|XP_009623896.1| PREDICTED: uncharacterized protein LOC104115034 [Nicotiana tomentosiformis]
Length=738

 Score = 52.4 bits (124),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 32/48 (67%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCSTS  2
            K+ GMKSHD HI ++ LLP A    LP+  +  + ELS+FFR LCS +
Sbjct  289  KIYGMKSHDSHILLEQLLPFAIRGVLPNHAYNAITELSIFFRELCSKT  336



>ref|XP_009102149.1| PREDICTED: uncharacterized protein LOC103828288 [Brassica rapa]
Length=831

 Score = 52.4 bits (124),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 32/48 (67%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCSTS  2
            K  GMKSHDCH+FMQ LLP AF   LP+   + LA +  FFR+L + +
Sbjct  550  KFSGMKSHDCHVFMQRLLPFAFAELLPANVHEALAAIGAFFRDLSTRT  597



>ref|XP_010668296.1| PREDICTED: uncharacterized protein LOC104885300 [Beta vulgaris 
subsp. vulgaris]
Length=1125

 Score = 52.4 bits (124),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 26/48 (54%), Positives = 31/48 (65%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAF-MFLPSCHWKPLAELSVFFRNLCSTS  2
            K++G KSHD HI MQ LLP+A    LP     PL  LS FFR +CST+
Sbjct  640  KVLGYKSHDAHIIMQHLLPVAIRKVLPKHVVLPLIRLSAFFRAICSTT  687



>ref|XP_008235411.1| PREDICTED: uncharacterized protein LOC103334243 [Prunus mume]
Length=421

 Score = 51.6 bits (122),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 23/45 (51%), Positives = 32/45 (71%), Gaps = 1/45 (2%)
 Frame = -2

Query  139  LIGMKSHDCHIFMQFLLP-IAFMFLPSCHWKPLAELSVFFRNLCS  8
            + GMK+HDCH+F++ LLP +A   LP    +PL ELS FF+ LC+
Sbjct  96   IYGMKTHDCHVFLERLLPFVARDLLPKDVSEPLIELSYFFKELCA  140



>ref|XP_009775626.1| PREDICTED: uncharacterized protein LOC104225505 isoform X2 [Nicotiana 
sylvestris]
Length=546

 Score = 51.6 bits (122),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 31/48 (65%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCSTS  2
            ++ G++SHDCHI M+ LLPIA    LP+       ELS FFR LCS S
Sbjct  91   RIFGLRSHDCHIIMEQLLPIAIRNVLPNHVVAVFVELSSFFRQLCSKS  138



>ref|XP_009775625.1| PREDICTED: uncharacterized protein LOC104225505 isoform X1 [Nicotiana 
sylvestris]
Length=549

 Score = 51.6 bits (122),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 31/48 (65%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCSTS  2
            ++ G++SHDCHI M+ LLPIA    LP+       ELS FFR LCS S
Sbjct  91   RIFGLRSHDCHIIMEQLLPIAIRNVLPNHVVAVFVELSSFFRQLCSKS  138



>ref|XP_008662989.1| PREDICTED: uncharacterized protein LOC103641416 [Zea mays]
 ref|XP_008662990.1| PREDICTED: uncharacterized protein LOC103641416 [Zea mays]
Length=631

 Score = 51.6 bits (122),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 33/48 (69%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCSTS  2
            KL G+K+HDCHI +Q +LP+A   FL    ++ LA+L  FFR LCS +
Sbjct  287  KLQGLKTHDCHILLQRILPVAMRGFLDKDIYEALADLGKFFRELCSRT  334



>ref|XP_010468397.1| PREDICTED: uncharacterized protein LOC104748456 [Camelina sativa]
Length=855

 Score = 51.6 bits (122),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 26/48 (54%), Positives = 30/48 (63%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCSTS  2
            K  GMKSHDCH+FM+ LLP  F   LP      L+ L  FFR+LCS S
Sbjct  671  KFSGMKSHDCHVFMERLLPFIFAELLPRNVHLALSGLGAFFRDLCSRS  718



>ref|XP_010687513.1| PREDICTED: uncharacterized protein LOC104901621 [Beta vulgaris 
subsp. vulgaris]
Length=597

 Score = 51.6 bits (122),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFMFLPSCHWKPLAELSVFFRNLCSTS  2
            KL G+KSHD H+ M+ LLP+A    P     PL +LS FF+ LCS +
Sbjct  190  KLAGLKSHDYHVIMEHLLPLAIRDWPKSLSTPLIKLSSFFKELCSKT  236



>gb|AAK13155.1|AC078829_7 putative transposase [Oryza sativa Japonica Group]
 gb|AAP54277.1| transposon protein, putative, CACTA, En/Spm sub-class [Oryza 
sativa Japonica Group]
Length=938

 Score = 51.6 bits (122),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 21/47 (45%), Positives = 34/47 (72%), Gaps = 1/47 (2%)
 Frame = -2

Query  145  IKLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCS  8
            +++ G+KSHD HI M+ + P+ F  +LP+  W+ LAE+S F+R LC+
Sbjct  483  MRINGLKSHDYHIMMERIFPVMFRGYLPTHVWEVLAEVSFFYRKLCA  529



>gb|AAD20646.1| putative TNP2-like transposon protein [Arabidopsis thaliana]
Length=1040

 Score = 51.6 bits (122),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 33/48 (69%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCSTS  2
            K  GMKSHDCH+FMQ LLP   +  LP+   + +A + VFF++LC+ +
Sbjct  822  KFSGMKSHDCHVFMQRLLPFVLVELLPTNIHEAIAGIGVFFKDLCTRT  869



>ref|XP_006663384.1| PREDICTED: uncharacterized protein LOC102706425 [Oryza brachyantha]
Length=709

 Score = 51.2 bits (121),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 1/47 (2%)
 Frame = -2

Query  145  IKLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCS  8
            +K+ G+KSHD HIFM+ LLP+    F+    W+ LAELS F+R LC+
Sbjct  220  LKIHGLKSHDYHIFMERLLPVMIRGFVDRDVWEVLAELSYFYRRLCA  266



>ref|XP_008663863.1| PREDICTED: uncharacterized protein LOC103642341 [Zea mays]
Length=621

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 32/48 (67%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCSTS  2
            KL GMK+HDCH+ +  LLP     +LP+  ++PL ELS FFR L S +
Sbjct  186  KLSGMKTHDCHVMLNHLLPYVLRGYLPNRIYEPLLELSYFFRELNSKA  233



>emb|CAH67329.1| OSIGBa0102I15.9 [Oryza sativa Indica Group]
Length=961

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/45 (51%), Positives = 32/45 (71%), Gaps = 1/45 (2%)
 Frame = -2

Query  133  GMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCSTS  2
            G+K+HDCHI +Q +LP A   FL S  ++ +AEL +FFR LCS +
Sbjct  518  GLKTHDCHILLQRILPAAMRGFLDSDIYEAIAELGMFFRKLCSRT  562



>emb|CAH66101.1| OSIGBa0132O24.3 [Oryza sativa Indica Group]
Length=1078

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/45 (51%), Positives = 32/45 (71%), Gaps = 1/45 (2%)
 Frame = -2

Query  133  GMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCSTS  2
            G+K+HDCHI +Q +LP A   FL S  ++ +AEL +FFR LCS +
Sbjct  590  GLKTHDCHILLQRILPAAMRGFLDSDIYEAIAELGMFFRKLCSRT  634



>ref|XP_010695661.1| PREDICTED: uncharacterized protein LOC104908266 [Beta vulgaris 
subsp. vulgaris]
Length=886

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFMFLPSCHWKPLAELSVFFRNLCSTS  2
            KL G+KSHD H+ M+ LLP+A    P     PL +LS FF+ LCS +
Sbjct  479  KLAGLKSHDFHVIMEHLLPLAIRDWPKSLSTPLIKLSSFFKELCSKT  525



>ref|XP_004512662.1| PREDICTED: uncharacterized protein LOC101489810 [Cicer arietinum]
Length=686

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 1/47 (2%)
 Frame = -2

Query  145  IKLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCS  8
            +KL+G+KSHDCHI MQ LLP+A    LP    + L +L +FF ++CS
Sbjct  540  LKLVGLKSHDCHILMQQLLPVALRGILPKKVREVLTKLCLFFNSICS  586



>ref|XP_010683839.1| PREDICTED: uncharacterized protein LOC104898452 [Beta vulgaris 
subsp. vulgaris]
Length=1071

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFMFLPSCHWKPLAELSVFFRNLCSTS  2
            KL G+KSHD H+ M+ LLP+A    P     PL +LS FF+ LCS +
Sbjct  664  KLAGLKSHDFHVIMEHLLPLAIRDWPKSLSTPLIKLSSFFKELCSKT  710



>ref|XP_010495146.1| PREDICTED: uncharacterized protein LOC104772206 [Camelina sativa]
Length=827

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 31/48 (65%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCSTS  2
            K  GMKSHDCH+FM+ LLP  F   LP   +  ++ +  FFR+LCS S
Sbjct  668  KFSGMKSHDCHVFMERLLPFVFAELLPRDVYLAISGIGSFFRDLCSRS  715



>ref|XP_009124479.1| PREDICTED: uncharacterized protein LOC103849479 [Brassica rapa]
Length=1109

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/47 (47%), Positives = 33/47 (70%), Gaps = 1/47 (2%)
 Frame = -2

Query  145  IKLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCS  8
            +K+ G+KSHD HI+++ ++P+    F+P   W  LAELS FFR LC+
Sbjct  629  LKIFGLKSHDWHIWIERVMPVMLRGFIPEDEWLVLAELSYFFRVLCA  675



>ref|XP_010694719.1| PREDICTED: uncharacterized protein LOC104907482 [Beta vulgaris 
subsp. vulgaris]
Length=543

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFMFLPSCHWKPLAELSVFFRNLCSTS  2
            KL G+KSHD H+ M+ LLP+A    P     PL +LS FF+ LCS +
Sbjct  292  KLAGLKSHDYHVIMEHLLPLAIRDWPKSLSTPLIKLSSFFKELCSKT  338



>ref|XP_004498129.1| PREDICTED: uncharacterized protein LOC101501909 [Cicer arietinum]
Length=599

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 31/47 (66%), Gaps = 1/47 (2%)
 Frame = -2

Query  145  IKLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCS  8
            +KL+G+KSHDCHI MQ LLP+A    LP    + L  L +FF  +CS
Sbjct  426  LKLVGLKSHDCHILMQQLLPVALRGILPKKVREDLTRLCLFFNAICS  472



>gb|AAR01649.1| transposon protein, putative, CACTA, En/Spm sub-class [Oryza 
sativa Japonica Group]
 gb|ABF97701.1| transposon protein, putative, CACTA, En/Spm sub-class [Oryza 
sativa Japonica Group]
Length=912

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 21/47 (45%), Positives = 34/47 (72%), Gaps = 1/47 (2%)
 Frame = -2

Query  145  IKLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCS  8
            +++ G+KSHD HI M+ + P+ F  +LP+  W+ LAE+S F+R LC+
Sbjct  457  MRINGLKSHDYHIMMERIFPVMFRGYLPTHVWEVLAEVSFFYRKLCA  503



>ref|XP_008657774.1| PREDICTED: uncharacterized protein LOC103637333 [Zea mays]
Length=882

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 33/48 (69%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCSTS  2
            KL G+K+HDCHI +Q +LP+A   FL    ++ LA+L  FFR LCS +
Sbjct  636  KLQGLKTHDCHILLQRILPVAMRGFLDKDIYEALADLGKFFRELCSRT  683



>ref|XP_010695418.1| PREDICTED: uncharacterized protein LOC104908060 [Beta vulgaris 
subsp. vulgaris]
Length=755

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFMFLPSCHWKPLAELSVFFRNLCSTS  2
            KL G+KSHD H+ M+ LLP+A    P     PL +LS FF+ LCS +
Sbjct  391  KLAGLKSHDFHVIMEHLLPLAIRDWPKSLSTPLIKLSSFFKELCSKT  437



>ref|XP_008373084.1| PREDICTED: uncharacterized protein LOC103436432 [Malus domestica]
Length=576

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 29/46 (63%), Gaps = 1/46 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCS  8
            K+ G+KSHDCH+ MQ LLP+A    LP      L ELS  FR LCS
Sbjct  191  KIHGLKSHDCHVLMQQLLPLAIRPVLPKAVTMVLLELSAIFRQLCS  236



>gb|ABA98141.1| transposon protein, putative, CACTA, En/Spm sub-class [Oryza 
sativa Japonica Group]
Length=1097

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/47 (45%), Positives = 34/47 (72%), Gaps = 1/47 (2%)
 Frame = -2

Query  145  IKLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCS  8
            +++ G+KSHD HI M+ + P+ F  +LP+  W+ LAE+S F+R LC+
Sbjct  642  MRINGLKSHDYHIMMERIFPVMFRGYLPTHVWEVLAEVSFFYRKLCA  688



>ref|XP_010663960.1| PREDICTED: uncharacterized protein LOC104882445 [Vitis vinifera]
Length=568

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 31/48 (65%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAF-MFLPSCHWKPLAELSVFFRNLCSTS  2
            K++G+KSHDCH+ +Q LLPI    FL       L ELS FF+ LC+ S
Sbjct  83   KILGLKSHDCHVLLQRLLPIGIRKFLRKDISTTLTELSCFFQKLCAKS  130



>ref|XP_010436384.1| PREDICTED: uncharacterized protein LOC104720121 [Camelina sativa]
Length=506

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 30/48 (63%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCSTS  2
            K  GMKSHDCH+FM+ LLP  F   LP      ++ +  FFR+LCS +
Sbjct  176  KFSGMKSHDCHVFMERLLPFIFAELLPRNVHLAISGIGAFFRDLCSRT  223



>ref|XP_009123180.1| PREDICTED: uncharacterized protein LOC103847918 [Brassica rapa]
Length=1064

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 29/48 (60%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCSTS  2
            K  G+KSHDCH+ MQ L P  F   LP    + +A +  FFR+LCS S
Sbjct  599  KFSGLKSHDCHVMMQRLFPFCFAGLLPQNVHEAIAGMGAFFRDLCSRS  646



>ref|XP_008338260.1| PREDICTED: uncharacterized protein LOC103401325 [Malus domestica]
Length=439

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 29/46 (63%), Gaps = 1/46 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAF-MFLPSCHWKPLAELSVFFRNLCS  8
            K+ G+KSHDCH+ MQ LLP+A    LP      L ELS  FR LCS
Sbjct  77   KIHGLKSHDCHVLMQQLLPLAIRAVLPKSVSMILLELSAIFRQLCS  122



>ref|XP_004492006.1| PREDICTED: uncharacterized protein LOC101504571 [Cicer arietinum]
Length=996

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 31/47 (66%), Gaps = 1/47 (2%)
 Frame = -2

Query  145  IKLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCS  8
            +KL+G+KSHDCHI MQ LLP+A    LP    + L  L +FF  +CS
Sbjct  557  LKLVGLKSHDCHILMQQLLPVALRGILPKKVREVLTRLCLFFNAICS  603



>ref|XP_009608267.1| PREDICTED: uncharacterized protein LOC104102290 [Nicotiana tomentosiformis]
Length=436

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 32/48 (67%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCSTS  2
            K+ G KSHD HI ++ LLP A    LP+  +K + E+S+FFR LCS +
Sbjct  266  KIYGPKSHDSHILLEQLLPFAIREILPNHVYKAITEISIFFRELCSKT  313



>ref|XP_008363626.1| PREDICTED: uncharacterized protein LOC103427344 [Malus domestica]
Length=469

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 29/46 (63%), Gaps = 1/46 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAF-MFLPSCHWKPLAELSVFFRNLCS  8
            K+ G+KSHDCH+ MQ LLP+A    LP      L ELS  FR LCS
Sbjct  77   KIHGLKSHDCHVLMQQLLPLAIRAVLPKSVTMILLELSAIFRQLCS  122



>ref|XP_006346671.1| PREDICTED: uncharacterized protein LOC102584385 [Solanum tuberosum]
Length=443

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/48 (46%), Positives = 33/48 (69%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCSTS  2
            K+ G+KSHD HI ++ LLP+A    +P+  +  + ELS+FFR LCS +
Sbjct  83   KIYGLKSHDSHILLEQLLPLAIRGVVPNNVYDAITELSIFFRELCSKT  130



>emb|CAN78763.1| hypothetical protein VITISV_003315 [Vitis vinifera]
Length=1226

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 31/48 (65%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAF-MFLPSCHWKPLAELSVFFRNLCSTS  2
            K++G+KSHDCH+ +Q LLPI    FL       L ELS FF+ LC+ S
Sbjct  463  KILGLKSHDCHVLLQRLLPIGIRKFLRKDISTTLTELSCFFQKLCAKS  510



>ref|XP_006658479.1| PREDICTED: uncharacterized protein LOC102709387 [Oryza brachyantha]
Length=1019

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 33/47 (70%), Gaps = 1/47 (2%)
 Frame = -2

Query  145  IKLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCS  8
            +K+ G++SHD HIFM+ LLP+    F+    W+ LAELS F+R LC+
Sbjct  149  LKIHGLQSHDYHIFMERLLPVMIRGFVDKDVWEVLAELSYFYRRLCA  195



>gb|AAM18727.1|AC092548_5 putative TNP2-like transposon protein [Oryza sativa Japonica 
Group]
Length=1571

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 22/48 (46%), Positives = 32/48 (67%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCSTS  2
            K+ G+KSHDCH+ +  +LP+A    LP   ++PL ELS FF+ L S +
Sbjct  659  KMSGLKSHDCHVILNHILPLALRGLLPENIYEPLVELSQFFKKLNSKA  706



>gb|AAP53328.2| transposon protein, putative, CACTA, En/Spm sub-class [Oryza 
sativa Japonica Group]
Length=1647

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 22/48 (46%), Positives = 32/48 (67%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCSTS  2
            K+ G+KSHDCH+ +  +LP+A    LP   ++PL ELS FF+ L S +
Sbjct  659  KMSGLKSHDCHVILNHILPLALRGLLPENIYEPLVELSQFFKKLNSKA  706



>ref|XP_006588206.1| PREDICTED: uncharacterized protein LOC100803554 [Glycine max]
Length=1342

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 21/47 (45%), Positives = 29/47 (62%), Gaps = 1/47 (2%)
 Frame = -2

Query  145  IKLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCS  8
            +KL+G+KSHDCH+ MQ LLP+A    LP   W  +  +   F  +CS
Sbjct  566  LKLVGLKSHDCHVLMQQLLPVAIRGILPDKVWVAITRMCFVFNAICS  612



>ref|XP_010445608.1| PREDICTED: uncharacterized protein LOC104728307 [Camelina sativa]
Length=754

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 21/43 (49%), Positives = 32/43 (74%), Gaps = 1/43 (2%)
 Frame = -2

Query  133  GMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCS  8
            G+KSHDCH+ MQ LLPIAF+  LP      ++++S+FFR++ +
Sbjct  624  GLKSHDCHVIMQRLLPIAFLELLPEAIHTAISDISLFFRDISA  666



>ref|XP_009348845.1| PREDICTED: uncharacterized protein LOC103940453 [Pyrus x bretschneideri]
Length=1124

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 29/46 (63%), Gaps = 1/46 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCS  8
            K+ G+KSHDCH+ MQ LLP+A    LP      L ELS  FR LCS
Sbjct  650  KIHGLKSHDCHVLMQQLLPLAIRPVLPKAVTMVLLELSAIFRQLCS  695



>ref|XP_010481106.1| PREDICTED: uncharacterized protein LOC104759941 [Camelina sativa]
Length=1147

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 30/48 (63%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCSTS  2
            K  GMKSHDCH+FM+ LLP  F   LP      ++ +  FFR+LCS +
Sbjct  679  KFSGMKSHDCHVFMERLLPFIFAELLPRNVHLAISGIGAFFRDLCSRT  726



>ref|XP_009367775.1| PREDICTED: uncharacterized protein LOC103957344 [Pyrus x bretschneideri]
Length=1141

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 29/46 (63%), Gaps = 1/46 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCS  8
            K+ G+KSHDCH+ MQ LLP+A    LP      L ELS  FR LCS
Sbjct  667  KIHGLKSHDCHVLMQQLLPLAIRPVLPKAVTMVLLELSAIFRQLCS  712



>ref|XP_009351448.1| PREDICTED: uncharacterized protein LOC103942981 [Pyrus x bretschneideri]
Length=846

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 29/46 (63%), Gaps = 1/46 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCS  8
            K+ G+KSHDCH+ MQ LLP+A    LP      L ELS  FR LCS
Sbjct  373  KIHGLKSHDCHVLMQQLLPLAIRPVLPKAVTMVLLELSAIFRQLCS  418



>ref|XP_006590121.1| PREDICTED: uncharacterized protein LOC102664072 [Glycine max]
Length=537

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 29/47 (62%), Gaps = 1/47 (2%)
 Frame = -2

Query  145  IKLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCS  8
            +KLIG+KSHDCH+ MQ LLP+A    LP      +  L  FF  +CS
Sbjct  120  LKLIGLKSHDCHVLMQQLLPVAIRGILPEKVCNAITRLCFFFNAICS  166



>ref|XP_009365384.1| PREDICTED: uncharacterized protein LOC103955232 [Pyrus x bretschneideri]
Length=1124

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 29/46 (63%), Gaps = 1/46 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCS  8
            K+ G+KSHDCH+ MQ LLP+A    LP      L ELS  FR LCS
Sbjct  650  KIHGLKSHDCHVLMQQLLPLAIRPVLPKAVTMVLLELSAIFRQLCS  695



>ref|XP_010667637.1| PREDICTED: uncharacterized protein LOC104884650 [Beta vulgaris 
subsp. vulgaris]
Length=1014

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 26/48 (54%), Positives = 30/48 (63%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAF-MFLPSCHWKPLAELSVFFRNLCSTS  2
            KL+G KSHD HI MQ LL +A    LP     PL  LS FFR +CST+
Sbjct  559  KLLGYKSHDAHIIMQHLLLVAIRKVLPKHVALPLIRLSAFFRTICSTA  606



>ref|XP_006475270.1| PREDICTED: uncharacterized protein LOC102625722 [Citrus sinensis]
Length=921

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 22/47 (47%), Positives = 30/47 (64%), Gaps = 1/47 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCST  5
            K++G+KSHDCH+ MQ L+P+A    LP    K +  L  FF  LC+T
Sbjct  479  KVVGLKSHDCHVLMQQLIPVALRGILPKGPRKAIFRLCAFFNELCNT  525



>ref|XP_006360475.1| PREDICTED: uncharacterized protein LOC102601884 [Solanum tuberosum]
Length=1198

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 22/48 (46%), Positives = 33/48 (69%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCSTS  2
            K+ G+KSHD HI ++ LLP+A    +P+  +  + ELS+FFR LCS +
Sbjct  760  KIYGLKSHDSHILLEQLLPLAIRGVVPNNVYDAITELSIFFRELCSKT  807



>ref|XP_008359349.1| PREDICTED: uncharacterized protein LOC103423058 [Malus domestica]
Length=1124

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 29/46 (63%), Gaps = 1/46 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCS  8
            K+ G+KSHDCH+ MQ LLP+A    LP      L ELS  FR LCS
Sbjct  650  KIHGLKSHDCHVLMQQLLPLAIRPVLPKAVTMVLLELSAIFRQLCS  695



>ref|XP_004513297.1| PREDICTED: uncharacterized protein LOC101504995 [Cicer arietinum]
Length=908

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 30/47 (64%), Gaps = 1/47 (2%)
 Frame = -2

Query  145  IKLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCS  8
            +KL+G+KSHDCHI MQ LLP+A    LP      L  L +FF  +CS
Sbjct  421  LKLVGLKSHDCHILMQQLLPVALRGILPKKVRDVLTRLCLFFNAICS  467



>ref|XP_010665733.1| PREDICTED: uncharacterized protein LOC104882993 [Beta vulgaris 
subsp. vulgaris]
Length=580

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 32/48 (67%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCSTS  2
            K++GMK+HD H+FMQ LL  AF   L      PL ELS+FF+ LCS +
Sbjct  192  KVMGMKTHDFHVFMQDLLAPAFQGVLDENVLTPLQELSLFFKQLCSKT  239



>ref|XP_010468685.1| PREDICTED: uncharacterized protein LOC104748789 [Camelina sativa]
Length=446

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 30/48 (63%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCSTS  2
            K  GMKSHDCH+FM+ LLP  F   LP      ++ +  FFR+LCS S
Sbjct  223  KFSGMKSHDCHVFMERLLPFVFAELLPRDVHLAISGIGSFFRDLCSRS  270



>ref|XP_009343565.1| PREDICTED: uncharacterized protein LOC103935520 [Pyrus x bretschneideri]
Length=884

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 29/46 (63%), Gaps = 1/46 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCS  8
            K+ G+KSHDCH+ MQ LLP+A    LP      L ELS  FR LCS
Sbjct  572  KIHGLKSHDCHVLMQQLLPLAIRPVLPKAVTMVLLELSAIFRQLCS  617



>ref|XP_008671526.1| PREDICTED: uncharacterized protein LOC103648928 [Zea mays]
Length=552

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 21/46 (46%), Positives = 30/46 (65%), Gaps = 1/46 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCS  8
            K++G+K+HDCH+ MQ L+PI     LP      + ELS +FR +CS
Sbjct  187  KIVGLKTHDCHVLMQQLMPIGLRGLLPDDITAVIFELSAYFRGICS  232



>gb|ABA93762.1| transposon protein, putative, CACTA, En/Spm sub-class [Oryza 
sativa Japonica Group]
Length=853

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 20/47 (43%), Positives = 34/47 (72%), Gaps = 1/47 (2%)
 Frame = -2

Query  145  IKLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCS  8
            +++ G+KSHD H+ M+ + P+ F  +LP+  W+ LAE+S F+R LC+
Sbjct  642  MRINGLKSHDYHVMMERIFPVKFRGYLPTHVWEVLAEVSFFYRKLCA  688



>ref|XP_008229480.1| PREDICTED: uncharacterized protein LOC103328856 [Prunus mume]
Length=1392

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 22/48 (46%), Positives = 31/48 (65%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAF-MFLPSCHWKPLAELSVFFRNLCSTS  2
            KL G+KSHDCH+F+Q LL +    +L      PL ELS FF+ +C+ +
Sbjct  547  KLSGLKSHDCHVFLQHLLSVGVRKYLKKSISAPLIELSYFFQQICAKT  594



>ref|XP_008341191.1| PREDICTED: uncharacterized protein LOC103404112 [Malus domestica]
Length=980

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 20/48 (42%), Positives = 33/48 (69%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAF-MFLPSCHWKPLAELSVFFRNLCSTS  2
            K++G+KSHDCH+ MQ +LP+     L    ++P+ ELS FF+ +C+ +
Sbjct  589  KVLGLKSHDCHVLMQRVLPVGIRKHLKRQIYEPIVELSNFFQQICAKT  636



>ref|XP_008371756.1| PREDICTED: uncharacterized protein LOC103435145 [Malus domestica]
Length=1062

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 24/45 (53%), Positives = 28/45 (62%), Gaps = 1/45 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLC  11
            K+ G+KSHDCH+ MQ LLP+A    LP      L ELS  FR LC
Sbjct  588  KIHGLKSHDCHVLMQQLLPLAIRPVLPKAXTMVLLELSAIFRQLC  632



>ref|XP_006596863.1| PREDICTED: uncharacterized protein LOC100817210 [Glycine max]
Length=979

 Score = 49.3 bits (116),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 29/47 (62%), Gaps = 1/47 (2%)
 Frame = -2

Query  145  IKLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCS  8
            +KLIG+KSHDCH+ MQ LLP+A    LP      +  L  FF  +CS
Sbjct  562  LKLIGLKSHDCHVLMQQLLPVAIRGILPEKVRNAITRLCFFFNAICS  608



>ref|XP_008363631.1| PREDICTED: uncharacterized protein LOC103427350 [Malus domestica]
Length=782

 Score = 48.9 bits (115),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 29/46 (63%), Gaps = 1/46 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCS  8
            K+ G+KSHDCH+ MQ LLP+A    LP      L ELS  FR LCS
Sbjct  315  KIHGLKSHDCHVLMQQLLPLAVRPVLPKAVTMVLLELSAIFRQLCS  360



>ref|XP_008361424.1| PREDICTED: uncharacterized protein LOC103425132 [Malus domestica]
Length=744

 Score = 48.9 bits (115),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 29/46 (63%), Gaps = 1/46 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAF-MFLPSCHWKPLAELSVFFRNLCS  8
            K+ G+KSHDCH+ MQ LLP+A    LP      L ELS  FR LCS
Sbjct  535  KIHGLKSHDCHVLMQQLLPLAVRAVLPKSVTMILLELSAIFRQLCS  580



>ref|XP_010665698.1| PREDICTED: uncharacterized protein LOC104882960 [Beta vulgaris 
subsp. vulgaris]
Length=1139

 Score = 48.9 bits (115),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 22/47 (47%), Positives = 29/47 (62%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFMFLPSCHWKPLAELSVFFRNLCSTS  2
            KL G+KSHD H+ M+ LLP+A    P     PL +LS F + LCS +
Sbjct  653  KLAGLKSHDYHVIMEHLLPLAIRDWPKSLSTPLIKLSSFLKELCSKT  699



>ref|XP_010510109.1| PREDICTED: uncharacterized protein LOC104786397 [Camelina sativa]
Length=521

 Score = 48.5 bits (114),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 21/46 (46%), Positives = 33/46 (72%), Gaps = 1/46 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCS  8
            KL G+KSHDCH+ MQ LLP AF+  LP      ++++++FFR++ +
Sbjct  44   KLSGLKSHDCHVIMQRLLPFAFLELLPKNVHTAISDIALFFRDISA  89



>ref|XP_006338206.1| PREDICTED: uncharacterized protein LOC102584000 [Solanum tuberosum]
Length=593

 Score = 48.5 bits (114),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 22/48 (46%), Positives = 33/48 (69%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCSTS  2
            K+ G+KSHD HI ++ LLP+A    +P+  +  + ELS+FFR LCS +
Sbjct  182  KIYGLKSHDSHILLEQLLPLAIRGVVPNNVYDAITELSIFFRELCSKT  229



>ref|XP_010243168.1| PREDICTED: uncharacterized protein LOC104587313 [Nelumbo nucifera]
Length=515

 Score = 48.5 bits (114),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 30/46 (65%), Gaps = 1/46 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAF-MFLPSCHWKPLAELSVFFRNLCS  8
            K+ G+KSHDCH+ MQ LLP+A    LP   +  L EL  FFR LCS
Sbjct  438  KIWGLKSHDCHVLMQQLLPLAMRRTLPKNVYSSLTELCNFFRKLCS  483



>ref|XP_010694601.1| PREDICTED: uncharacterized protein LOC104907371 [Beta vulgaris 
subsp. vulgaris]
Length=575

 Score = 48.5 bits (114),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 29/47 (62%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFMFLPSCHWKPLAELSVFFRNLCSTS  2
            KL G+KSHD H+ M+ LLP+A          PL +LS FFR LCS +
Sbjct  292  KLAGLKSHDFHVIMEHLLPLAIRDWLKSLSTPLIKLSSFFRELCSKT  338



>ref|XP_010445388.1| PREDICTED: uncharacterized protein LOC104728042 [Camelina sativa]
Length=1030

 Score = 48.9 bits (115),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 30/48 (63%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAF-MFLPSCHWKPLAELSVFFRNLCSTS  2
            K  GMKSHD H+ MQ LLP AF   LP    + +A +  FFR+LCS +
Sbjct  647  KFTGMKSHDYHVVMQRLLPFAFEHLLPDNVHQAIAGVGAFFRDLCSRT  694



>ref|XP_008338384.1| PREDICTED: uncharacterized protein LOC103401455 [Malus domestica]
Length=939

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 29/46 (63%), Gaps = 1/46 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAF-MFLPSCHWKPLAELSVFFRNLCS  8
            K+ G+KSH+CH+ MQ LLP+A    LP      L ELS  FR LCS
Sbjct  481  KIHGLKSHBCHVLMQQLLPLAVRAVLPKSVTMILLELSAIFRQLCS  526



>ref|XP_010438349.1| PREDICTED: uncharacterized protein LOC104721965 isoform X2 [Camelina 
sativa]
Length=540

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 29/41 (71%), Gaps = 1/41 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFF  23
            +L GMKSHDCH+FMQ LLP AF+  LP    + +A +S FF
Sbjct  491  RLSGMKSHDCHVFMQRLLPFAFVELLPKNEHEAIAGISAFF  531



>ref|XP_008649875.1| PREDICTED: uncharacterized protein LOC103630603 [Zea mays]
Length=807

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 32/48 (67%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCSTS  2
            K+ GMK+HDCH+ +  LLP     +LP+  ++PL ELS FFR L S +
Sbjct  372  KISGMKTHDCHVMLNHLLPYVLRGYLPNRIYEPLLELSYFFRELNSKA  419



>ref|XP_008372814.1| PREDICTED: uncharacterized protein LOC103436169 [Malus domestica]
Length=1151

 Score = 48.9 bits (115),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 20/48 (42%), Positives = 32/48 (67%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAF-MFLPSCHWKPLAELSVFFRNLCSTS  2
            K+  +KSHDCH+ +Q L+P+    FLP    +P+ ELS FF+ +C+ +
Sbjct  657  KISXLKSHDCHVLLQRLIPVGIRKFLPENVVEPIIELSSFFQQICAKT  704



>ref|XP_010438346.1| PREDICTED: uncharacterized protein LOC104721965 isoform X1 [Camelina 
sativa]
 ref|XP_010438347.1| PREDICTED: uncharacterized protein LOC104721965 isoform X1 [Camelina 
sativa]
 ref|XP_010438348.1| PREDICTED: uncharacterized protein LOC104721965 isoform X1 [Camelina 
sativa]
Length=543

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 29/41 (71%), Gaps = 1/41 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFF  23
            +L GMKSHDCH+FMQ LLP AF+  LP    + +A +S FF
Sbjct  494  RLSGMKSHDCHVFMQRLLPFAFVELLPKNEHEAIAGISAFF  534



>ref|XP_006598374.1| PREDICTED: uncharacterized protein LOC100809757 [Glycine max]
Length=1016

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 29/47 (62%), Gaps = 1/47 (2%)
 Frame = -2

Query  145  IKLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCS  8
            +KLIG+KSHDCH+ MQ LLP+A    LP      +  L  FF  +CS
Sbjct  577  LKLIGLKSHDCHVLMQQLLPVAIRGILPEKVRNTITRLCFFFNAICS  623



>ref|XP_010424835.1| PREDICTED: uncharacterized protein LOC104710007 [Camelina sativa]
Length=940

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 30/48 (63%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAF-MFLPSCHWKPLAELSVFFRNLCSTS  2
            K  GMKSHD H+ MQ LLP AF   LP    + +A +  FFR+LCS +
Sbjct  647  KFTGMKSHDYHVVMQRLLPFAFEHLLPDNVHQAIAGVGAFFRDLCSRT  694



>gb|ABA91272.1| transposon protein, putative, CACTA, En/Spm sub-class [Oryza 
sativa Japonica Group]
Length=823

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 21/48 (44%), Positives = 31/48 (65%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCSTS  2
            K+ G+KSHDCH+ +  + P+A    LP   ++PL ELS FF+ L S +
Sbjct  393  KMSGLKSHDCHVILNHIFPLALRGLLPENIYEPLVELSQFFKKLNSKA  440



>emb|CAE05629.1| OSJNBb0061C13.11 [Oryza sativa Japonica Group]
Length=972

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 31/45 (69%), Gaps = 1/45 (2%)
 Frame = -2

Query  133  GMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCSTS  2
            G+K+HDCHI +Q +LP A   FL    ++ +AEL +FFR LCS +
Sbjct  529  GLKTHDCHILLQRILPAAMRGFLDIDIYEAIAELGMFFRKLCSRT  573



>ref|XP_008678805.1| PREDICTED: uncharacterized protein LOC103653780 [Zea mays]
Length=1114

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 21/46 (46%), Positives = 30/46 (65%), Gaps = 1/46 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCS  8
            K++G+K+HDCH+ MQ L+PI     LP      + ELS +FR +CS
Sbjct  635  KIVGLKTHDCHVLMQQLMPIGLRGLLPDDITAVIFELSAYFRGICS  680



>ref|XP_008659783.1| PREDICTED: uncharacterized protein LOC103638724 [Zea mays]
Length=1114

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 21/46 (46%), Positives = 30/46 (65%), Gaps = 1/46 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCS  8
            K++G+K+HDCH+ MQ L+PI     LP      + ELS +FR +CS
Sbjct  635  KIVGLKTHDCHVLMQQLMPIGLRGLLPDDITAVIFELSAYFRGICS  680



>ref|XP_010693301.1| PREDICTED: uncharacterized protein LOC104906262 [Beta vulgaris 
subsp. vulgaris]
Length=791

 Score = 48.5 bits (114),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 22/47 (47%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFMFLPSCHWKPLAELSVFFRNLCSTS  2
            KL G+KSH+ H+ M+ LLP+A    P     PL +LS FF+ LCS +
Sbjct  626  KLAGLKSHNYHVIMEHLLPLAIRDWPKSLSTPLIKLSSFFKELCSKT  672



>ref|XP_010548757.1| PREDICTED: uncharacterized protein LOC104820082 [Tarenaya hassleriana]
Length=192

 Score = 46.6 bits (109),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 29/44 (66%), Gaps = 1/44 (2%)
 Frame = -2

Query  130  MKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCSTS  2
            MKSHDCH+FMQ L+PIAF   L S     L  +  FFR++C+ S
Sbjct  1    MKSHDCHVFMQRLIPIAFAELLKSNVHGVLCGIITFFRDICARS  44



>ref|XP_010677867.1| PREDICTED: uncharacterized protein LOC104893460 [Beta vulgaris 
subsp. vulgaris]
Length=733

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 33/48 (69%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFMFLPSCH-WKPLAELSVFFRNLCSTS  2
            KL G+KSHDCH+FM+ LL +    L   H  K + E+S FFR+LC+++
Sbjct  637  KLQGLKSHDCHVFMERLLSVGLKELLPLHVRKAITEISQFFRDLCAST  684



>ref|XP_008660801.1| PREDICTED: uncharacterized protein LOC103639897 [Zea mays]
Length=780

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 22/46 (48%), Positives = 30/46 (65%), Gaps = 1/46 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCS  8
            K+IG+K+HDCH+ MQ  +PIA    LP      + ELS +FR +CS
Sbjct  357  KIIGLKTHDCHVLMQQFMPIALRGNLPDDITAVVFELSAYFRGICS  402



>ref|XP_010690984.1| PREDICTED: uncharacterized protein LOC104904438 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010690985.1| PREDICTED: uncharacterized protein LOC104904438 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010690986.1| PREDICTED: uncharacterized protein LOC104904438 [Beta vulgaris 
subsp. vulgaris]
Length=1120

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 32/48 (67%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFMFLPSCH-WKPLAELSVFFRNLCSTS  2
            K   +KS+DCH+FM  LLP+A   L   H W+ + ELS FFR+L S++
Sbjct  640  KFSRLKSYDCHVFMNRLLPVALKELLPLHVWEAVTELSQFFRDLSSST  687



>ref|XP_008666337.1| PREDICTED: uncharacterized protein LOC103644976 [Zea mays]
Length=1101

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/46 (46%), Positives = 30/46 (65%), Gaps = 1/46 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCS  8
            K++G+K+HDCH+ MQ L+PI     LP      + ELS +FR +CS
Sbjct  635  KIVGLKTHDCHVLMQQLMPIGLRGLLPDDITAVIFELSAYFRGICS  680



>gb|AAX95821.1| transposon protein, putative, CACTA, En/Spm sub-class [Oryza 
sativa Japonica Group]
 gb|ABA93143.1| transposon protein, putative, CACTA, En/Spm sub-class [Oryza 
sativa Japonica Group]
Length=1273

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/48 (44%), Positives = 32/48 (67%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCSTS  2
            K+ G+KSH+CH+ +  +LP+A    LP   ++PL ELS FF+ L S +
Sbjct  516  KMSGLKSHECHVILNHILPLALRGLLPENIYEPLVELSQFFKKLNSKA  563



>ref|XP_006590024.1| PREDICTED: uncharacterized protein LOC100780571 [Glycine max]
Length=1041

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 29/47 (62%), Gaps = 1/47 (2%)
 Frame = -2

Query  145  IKLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCS  8
            +KLIG+KSHDCH+ MQ LLP+A    LP      +  L  FF  +CS
Sbjct  624  LKLIGLKSHDCHVLMQQLLPVAIRGILPEKVRNTITRLCFFFNAICS  670



>ref|XP_009776780.1| PREDICTED: uncharacterized protein LOC104226462 [Nicotiana sylvestris]
Length=649

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 32/48 (67%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCSTS  2
            ++ G+KSHDCHI M+ LLPIA    LP+     L ELS FFR+LC  S
Sbjct  439  RIFGLKSHDCHILMEQLLPIAIRNVLPNQVVATLVELSSFFRHLCLKS  486



>ref|XP_010681526.1| PREDICTED: uncharacterized protein LOC104896473 [Beta vulgaris 
subsp. vulgaris]
Length=811

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 32/48 (67%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCSTS  2
            K+  MKS D H+F++ LLPIA    LP    +PL ELS +F+NLCS S
Sbjct  315  KMSCMKSDDHHVFLEQLLPIAIRGLLPKNVCEPLIELSSYFKNLCSKS  362



>ref|XP_008646998.1| PREDICTED: uncharacterized protein LOC103628606 [Zea mays]
Length=1277

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/47 (45%), Positives = 32/47 (68%), Gaps = 1/47 (2%)
 Frame = -2

Query  145  IKLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCS  8
            +K+ G+KSHD HI M+ L+P+    ++    WK +AELS F+R LC+
Sbjct  630  MKINGLKSHDYHIMMERLIPVMLRGYINEEVWKAIAELSYFYRQLCA  676



>ref|XP_008671492.1| PREDICTED: uncharacterized protein LOC103648889 [Zea mays]
Length=1347

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/47 (45%), Positives = 32/47 (68%), Gaps = 1/47 (2%)
 Frame = -2

Query  145  IKLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCS  8
            +K+ G+KSHD HI M+ L+P+    ++    WK +AELS F+R LC+
Sbjct  630  MKINGLKSHDYHIMMERLIPVMLRGYINEEVWKAIAELSYFYRQLCA  676



>ref|XP_006465241.1| PREDICTED: uncharacterized protein LOC102617989 isoform X1 [Citrus 
sinensis]
Length=779

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 28/47 (60%), Gaps = 1/47 (2%)
 Frame = -2

Query  145  IKLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCS  8
            +KLIG+KSHDCH  MQ LLP+A    LP      +  L  FF + CS
Sbjct  285  LKLIGLKSHDCHALMQQLLPLAIRGILPELVRYAITRLCFFFNDFCS  331



>ref|XP_009768699.1| PREDICTED: uncharacterized protein LOC104219689 [Nicotiana sylvestris]
Length=651

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 29/45 (64%), Gaps = 1/45 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLC  11
            ++ G+KSHDCHI M+ LLPIA    LP      L ELS FFR LC
Sbjct  115  RIFGLKSHDCHIIMEQLLPIAIRNVLPKEVVAVLVELSSFFRELC  159



>ref|XP_003553111.2| PREDICTED: uncharacterized protein LOC100782578 [Glycine max]
Length=1170

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 29/47 (62%), Gaps = 1/47 (2%)
 Frame = -2

Query  145  IKLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCS  8
            +KL+G+KSHDCH+ MQ LLPIA    LP      +  L  FF  +CS
Sbjct  624  MKLVGLKSHDCHVLMQQLLPIAIRGILPDKVRVAITRLCFFFNAICS  670



>ref|XP_006480458.1| PREDICTED: uncharacterized protein LOC102608724 isoform X1 [Citrus 
sinensis]
Length=1072

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 29/47 (62%), Gaps = 1/47 (2%)
 Frame = -2

Query  145  IKLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCS  8
            +KLIG+KSHDCH  MQ LLP+A    LP      +  L  FF +LCS
Sbjct  622  LKLIGLKSHDCHALMQQLLPLAIRGMLPKPVRYAITRLCFFFNDLCS  668



>ref|XP_008338261.1| PREDICTED: uncharacterized protein LOC103401326 [Malus domestica]
Length=1103

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 28/46 (61%), Gaps = 1/46 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAF-MFLPSCHWKPLAELSVFFRNLCS  8
            K+ G+KSHDCH  MQ LLP+A    LP      L ELS  FR LCS
Sbjct  629  KIHGLKSHDCHXLMQQLLPLAIRAVLPKSVXMILLELSAIFRQLCS  674



>ref|XP_004148721.1| PREDICTED: anaphase-promoting complex subunit 4-like [Cucumis 
sativus]
Length=1420

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 23/49 (47%), Positives = 30/49 (61%), Gaps = 1/49 (2%)
 Frame = -2

Query  145  IKLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCSTS  2
            +KL G+KSHDCH+ MQ LLPIA    LP      ++ L  FF  +C+ S
Sbjct  675  LKLTGLKSHDCHVLMQQLLPIAIRSVLPKNVRYTISRLCFFFNAICAKS  723



>ref|XP_010513142.1| PREDICTED: uncharacterized protein LOC104789093 [Camelina sativa]
Length=509

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 29/48 (60%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCSTS  2
            K  GMKSHDCH+FM+ LLP  F   LP      ++    FFR+LCS S
Sbjct  92   KFSGMKSHDCHVFMERLLPFVFAELLPRDVHLAISGNGSFFRDLCSRS  139



>ref|XP_008359569.1| PREDICTED: uncharacterized protein LOC103423276 [Malus domestica]
Length=451

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 27/44 (61%), Gaps = 1/44 (2%)
 Frame = -2

Query  139  LIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLC  11
            LIG+KSHDCH+ MQ LLP+A    LP      +  L VFF  LC
Sbjct  22   LIGLKSHDCHVLMQQLLPVAIRGLLPKGPKHAIFRLCVFFHELC  65



>emb|CAE04318.3| OSJNBb0016D16.9 [Oryza sativa Japonica Group]
Length=1097

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 33/48 (69%), Gaps = 3/48 (6%)
 Frame = -2

Query  145  IKLIGMKSHDCHIFMQFLLPIAF--MFLPSCHWKPLAELSVFFRNLCS  8
            +++ G+KSHD HI M+ LLP+ F   F P   W+ +AELS F+R LC+
Sbjct  648  MRINGLKSHDYHIMMERLLPVMFRGYFQPYL-WEVIAELSFFYRKLCA  694



>ref|XP_008343034.1| PREDICTED: uncharacterized protein LOC103405801 [Malus domestica]
Length=529

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 27/44 (61%), Gaps = 1/44 (2%)
 Frame = -2

Query  139  LIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLC  11
            LIG+KSHDCH+ MQ LLP+A    LP      +  L VFF  LC
Sbjct  22   LIGLKSHDCHVLMQQLLPVAIRGLLPKGPRHAIFRLCVFFHELC  65



>ref|XP_010684021.1| PREDICTED: uncharacterized protein LOC104898624 [Beta vulgaris 
subsp. vulgaris]
Length=499

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFMFLPSCHWKPLAELSVFFRNLCSTS  2
            KL G+KSHD H+ M+ LLP+A    P     PL +LS FF+ LCS +
Sbjct  391  KLAGLKSHDFHVIMEHLLPLAIHDWPKSLSTPLIKLSSFFKELCSKT  437



>ref|XP_010667535.1| PREDICTED: uncharacterized protein LOC104884557 [Beta vulgaris 
subsp. vulgaris]
Length=456

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 22/47 (47%), Positives = 28/47 (60%), Gaps = 1/47 (2%)
 Frame = -2

Query  145  IKLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCS  8
            +KLIG+KSHDCH+ MQ  LPIA    LP      +  L  FF  +C+
Sbjct  142  LKLIGLKSHDCHVMMQVFLPIAIRGILPKHVRLAITRLCSFFNTICN  188



>ref|XP_008661260.1| PREDICTED: uncharacterized protein LOC103640464 [Zea mays]
Length=724

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/46 (46%), Positives = 31/46 (67%), Gaps = 1/46 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCS  8
            K+ G+KSHD HI M+ L+P+    ++    WK +AELS F+R LC+
Sbjct  194  KINGLKSHDYHIMMERLIPVMLRGYINEEVWKAIAELSYFYRQLCA  239



>ref|XP_008655512.1| PREDICTED: uncharacterized protein LOC103634696 [Zea mays]
Length=776

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/46 (46%), Positives = 30/46 (65%), Gaps = 1/46 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCS  8
            K++G+K+HDCH+ MQ L+PI     LP      + ELS +FR +CS
Sbjct  297  KIVGLKTHDCHVLMQQLMPIGLRGLLPDDITAVIFELSSYFRGICS  342



>gb|ABA98912.1| transposon protein, putative, CACTA, En/Spm sub-class [Oryza 
sativa Japonica Group]
Length=569

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 32/48 (67%), Gaps = 3/48 (6%)
 Frame = -2

Query  145  IKLIGMKSHDCHIFMQFLLPIAF--MFLPSCHWKPLAELSVFFRNLCS  8
            +++ G KSHD HI M+ LLP+ F   F P   W+ +AELS F+R LC+
Sbjct  187  MRINGSKSHDYHIMMECLLPVMFRGYFQPYL-WEVIAELSFFYRKLCA  233



>ref|XP_008646978.1| PREDICTED: uncharacterized protein LOC103628584 [Zea mays]
Length=950

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 31/46 (67%), Gaps = 1/46 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCS  8
            K++G+K+HDCH+ MQ L+PIA    LP      L ELS FFR +CS
Sbjct  635  KIVGLKTHDCHVMMQQLMPIASRGILPDDITALLFELSAFFRGICS  680



>ref|XP_010678035.1| PREDICTED: uncharacterized protein LOC104893606 [Beta vulgaris 
subsp. vulgaris]
Length=497

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 31/48 (65%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFMFLPSCHWKP-LAELSVFFRNLCSTS  2
            KLI MKSHD HI MQ LLP+A +   +      L ELS FF+ +CST+
Sbjct  241  KLINMKSHDNHILMQDLLPVALIASNATKVTDLLEELSYFFKKICSTA  288



>ref|XP_009103337.1| PREDICTED: uncharacterized protein LOC103829419 [Brassica rapa]
Length=1026

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/47 (45%), Positives = 32/47 (68%), Gaps = 1/47 (2%)
 Frame = -2

Query  145  IKLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCS  8
            +KL G+KSHDCH+ MQ L P AF   LP      ++E+++FFR++ +
Sbjct  554  MKLSGLKSHDCHVIMQRLYPFAFRELLPKHVHTAISEIALFFRDISA  600



>gb|ACT98135.1| TNP2 [Glycine max]
Length=1063

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/47 (47%), Positives = 29/47 (62%), Gaps = 1/47 (2%)
 Frame = -2

Query  145  IKLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCS  8
            +KL+G+KSHDCH+ MQ LLP+A    LP      +  L  FF  +CS
Sbjct  624  MKLVGLKSHDCHVLMQQLLPVAIRGILPDKVRVAITRLCFFFNAICS  670



>ref|XP_010665585.1| PREDICTED: uncharacterized protein LOC104882866 [Beta vulgaris 
subsp. vulgaris]
Length=760

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/47 (47%), Positives = 28/47 (60%), Gaps = 1/47 (2%)
 Frame = -2

Query  145  IKLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCS  8
            +KLIG+KSHDCH+ MQ  LPIA    LP      +  L  FF  +C+
Sbjct  205  LKLIGLKSHDCHVMMQVFLPIAIRGILPKHVRLAITRLCSFFNTICN  251



>gb|AAA66266.1| unknown protein [Zea mays]
Length=897

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/47 (47%), Positives = 32/47 (68%), Gaps = 3/47 (6%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAF--MFLPSCHWKPLAELSVFFRNLCS  8
            KL+G+KSHD HI ++ L+P+ F   F P   WK  AELS F++ +C+
Sbjct  634  KLVGLKSHDYHILIERLVPVMFRGYFSPDV-WKIFAELSYFYKQICA  679



>ref|XP_008675660.1| PREDICTED: uncharacterized protein LOC103651739 [Zea mays]
Length=1148

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/51 (47%), Positives = 34/51 (67%), Gaps = 8/51 (16%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFMFLPSCH-----WKPLAELSVFFRNLCST  5
            KL G+KSHDCH+ ++ +LPIA   L SC+      K + +L+ FF+ LCST
Sbjct  734  KLSGLKSHDCHVLIEEILPIA---LRSCYPSKDVMKIVVDLASFFKGLCST  781



>ref|XP_006590031.1| PREDICTED: uncharacterized protein LOC100786982 [Glycine max]
Length=960

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 29/47 (62%), Gaps = 1/47 (2%)
 Frame = -2

Query  145  IKLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCS  8
            +KL+G+KSHDCH+ MQ LLPIA    LP      +  L  FF  +CS
Sbjct  624  LKLVGLKSHDCHVLMQQLLPIAIRGILPDKVRVAITRLCFFFNAICS  670



>ref|XP_010696424.1| PREDICTED: uncharacterized protein LOC104908951 [Beta vulgaris 
subsp. vulgaris]
Length=657

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/47 (47%), Positives = 28/47 (60%), Gaps = 1/47 (2%)
 Frame = -2

Query  145  IKLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCS  8
            +KLIG+KSHDCH+ MQ  LPIA    LP      +  L  FF  +C+
Sbjct  333  LKLIGLKSHDCHVMMQVFLPIAIRGILPKHVRLAITRLCSFFNTICN  379



>prf||1206239A ORF 1
Length=905

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/47 (47%), Positives = 32/47 (68%), Gaps = 3/47 (6%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAF--MFLPSCHWKPLAELSVFFRNLCS  8
            KL+G+KSHD HI ++ L+P+ F   F P   WK  AELS F++ +C+
Sbjct  642  KLVGLKSHDYHILIERLVPVMFRGYFSPDV-WKIFAELSYFYKQICA  687



>ref|XP_006598551.1| PREDICTED: uncharacterized protein LOC100806722 [Glycine max]
Length=1142

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 29/47 (62%), Gaps = 1/47 (2%)
 Frame = -2

Query  145  IKLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCS  8
            +KL+G+KSHDCHI MQ LLPIA    LP      +  L  FF  +CS
Sbjct  623  MKLVGLKSHDCHILMQQLLPIAIRGILPDKVRVAITRLCFFFNVICS  669



>ref|XP_010229766.1| PREDICTED: uncharacterized protein LOC100824246 [Brachypodium 
distachyon]
Length=930

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 32/47 (68%), Gaps = 1/47 (2%)
 Frame = -2

Query  145  IKLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCS  8
            +K+ G+KSHD HIFM+ LL +    ++    W+ LAELS FFR LC+
Sbjct  94   LKIHGLKSHDYHIFMERLLLVMMRGYVDDAVWEVLAELSYFFRFLCA  140



>ref|XP_003554943.1| PREDICTED: uncharacterized protein LOC100787031 [Glycine max]
Length=1063

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/47 (47%), Positives = 29/47 (62%), Gaps = 1/47 (2%)
 Frame = -2

Query  145  IKLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCS  8
            +KL+G+KSHDCH+ MQ LLP+A    LP      +  L  FF  +CS
Sbjct  624  MKLVGLKSHDCHVLMQQLLPVAIRGILPDKVRVAITRLCFFFNAICS  670



>ref|XP_010668257.1| PREDICTED: uncharacterized protein LOC104885256 [Beta vulgaris 
subsp. vulgaris]
Length=512

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 31/46 (67%), Gaps = 1/46 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFMFLPSCH-WKPLAELSVFFRNLCS  8
            KLIG+KSHDCHI MQ +LPIA   L S      L++L  +FR +CS
Sbjct  458  KLIGLKSHDCHILMQQILPIALRGLLSKDVVGVLSDLCGYFREVCS  503



>ref|XP_006588102.1| PREDICTED: uncharacterized protein LOC100812852 [Glycine max]
Length=900

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 29/47 (62%), Gaps = 1/47 (2%)
 Frame = -2

Query  145  IKLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCS  8
            +KL+G+KSHDCH+ MQ LLPIA    LP      +  L  FF  +CS
Sbjct  624  LKLVGLKSHDCHVLMQQLLPIAIRGILPDKVRVAITRLCFFFNAICS  670



>ref|XP_007044255.1| Transposase tnp2 [Theobroma cacao]
 gb|EOY00087.1| Transposase tnp2 [Theobroma cacao]
Length=573

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 30/48 (63%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCSTS  2
            K   MKSHDCHIF+Q LL I F   +P   W  +  +S FFR+LC+T 
Sbjct  289  KFYRMKSHDCHIFLQRLLLIVFHDMVPHSIWDAITGISHFFRDLCTTE  336



>emb|CAM57450.2| putative transposase [Antirrhinum majus]
Length=1108

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 27/38 (71%), Gaps = 3/38 (8%)
 Frame = -2

Query  145  IKLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAEL  35
            ++L GMKSHDCH+F+  L+PIAF  F P   W PL E+
Sbjct  640  LRLAGMKSHDCHVFI--LMPIAFRDFFPDSVWGPLVEV  675



>emb|CAD40757.2| OSJNBa0081G05.10 [Oryza sativa Japonica Group]
Length=1490

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/48 (44%), Positives = 31/48 (65%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCSTS  2
            K+ G+KSHDCH+ +  +LP+A    LP   ++P  ELS FF+ L S +
Sbjct  621  KMSGLKSHDCHVILNHILPLALRGLLPENIYEPHVELSQFFKKLNSKA  668



>emb|CAH66664.1| OSIGBa0110B10.1 [Oryza sativa Indica Group]
Length=1490

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/48 (44%), Positives = 31/48 (65%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCSTS  2
            K+ G+KSHDCH+ +  +LP+A    LP   ++P  ELS FF+ L S +
Sbjct  621  KMSGLKSHDCHVILNHILPLALRGLLPENIYEPHVELSQFFKKLNSKA  668



>gb|AAK91322.1|AC090441_4 Putative transposase protein [Oryza sativa Japonica Group]
 gb|AAP53150.1| transposon protein, putative, CACTA, En/Spm sub-class, expressed 
[Oryza sativa Japonica Group]
Length=870

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/46 (48%), Positives = 30/46 (65%), Gaps = 1/46 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCS  8
            K+ G+K+HDCH+ MQ L+PIA    LP      L +LS +FR +CS
Sbjct  455  KIHGLKTHDCHVLMQQLMPIALRGILPDEVTSVLFDLSAYFRGICS  500



>ref|XP_003551521.1| PREDICTED: uncharacterized protein LOC100800209 [Glycine max]
Length=1063

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/47 (47%), Positives = 29/47 (62%), Gaps = 1/47 (2%)
 Frame = -2

Query  145  IKLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCS  8
            +KL+G+KSHDCH+ MQ LLP+A    LP      +  L  FF  +CS
Sbjct  624  MKLVGLKSHDCHVLMQQLLPVAIHGILPDKVRVAITRLCFFFNAICS  670



>gb|AAF06087.1|AC007918_11 Similar to gi|4325351 T25H8.2 TNP2 protein homolog from Arabidopsis 
thaliana BAC gb|AF128394 [Arabidopsis thaliana]
Length=1121

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 24/49 (49%), Positives = 31/49 (63%), Gaps = 3/49 (6%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFMFL--PSCHWKPLAELSVFFRNLCSTS  2
            K  GMKSHDCH+FM+ LLP  F  L   + H   L+ +  FFR+LCS +
Sbjct  641  KFSGMKSHDCHVFMERLLPFIFAELLDRNVHLA-LSGIGAFFRDLCSRT  688



>gb|AAG17043.1|AF187822_1 transposase [Zea mays]
Length=854

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 31/48 (65%), Gaps = 1/48 (2%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFM-FLPSCHWKPLAELSVFFRNLCSTS  2
            KLIG+KSHD HI M+ L+P+ F  +     W   AELS F+R +C+ +
Sbjct  646  KLIGLKSHDYHIIMERLMPVMFRGYFKDELWSIFAELSYFYREVCAKT  693



>ref|XP_010667222.1| PREDICTED: uncharacterized protein LOC104884295 [Beta vulgaris 
subsp. vulgaris]
Length=832

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 21/44 (48%), Positives = 27/44 (61%), Gaps = 0/44 (0%)
 Frame = -2

Query  142  KLIGMKSHDCHIFMQFLLPIAFMFLPSCHWKPLAELSVFFRNLC  11
            KL G+KSHD H+ M+ LLP+A    P     PL +L  FF+ LC
Sbjct  505  KLAGLKSHDYHVIMEHLLPLAIRDWPKSLSTPLIKLRSFFKELC  548



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 525616678368