BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c103474_g1_i1 len=113 path=[91:0-112]

Length=113
                                                                      Score     E

ref|XP_006356453.1|  PREDICTED: TMV resistance protein N-like         69.3    4e-12   
ref|XP_009794563.1|  PREDICTED: TMV resistance protein N-like         64.3    2e-11   
ref|XP_004253017.1|  PREDICTED: TMV resistance protein N-like         63.9    2e-11   
ref|XP_009613120.1|  PREDICTED: TMV resistance protein N-like iso...  66.6    3e-11   
emb|CDP20523.1|  unnamed protein product                              65.9    7e-11   
ref|XP_009794564.1|  PREDICTED: TMV resistance protein N-like iso...  64.7    2e-10   
ref|XP_009794566.1|  PREDICTED: TMV resistance protein N-like iso...  64.7    2e-10   
ref|XP_009803029.1|  PREDICTED: TMV resistance protein N-like iso...  64.3    2e-10   
ref|XP_009630491.1|  PREDICTED: uncharacterized protein LOC104120435  64.3    2e-10   
ref|XP_004228809.1|  PREDICTED: TMV resistance protein N-like         64.3    2e-10   
ref|XP_009803027.1|  PREDICTED: TMV resistance protein N-like iso...  64.3    2e-10   
ref|XP_009803028.1|  PREDICTED: TMV resistance protein N-like iso...  64.3    3e-10   
ref|XP_004237584.1|  PREDICTED: TMV resistance protein N-like         63.9    3e-10   
ref|XP_006350421.1|  PREDICTED: TMV resistance protein N-like         63.5    3e-10   
ref|XP_010323796.1|  PREDICTED: TMV resistance protein N-like         60.1    5e-10   
ref|XP_009613117.1|  PREDICTED: TMV resistance protein N-like iso...  62.4    5e-10   
ref|XP_010263414.1|  PREDICTED: TMV resistance protein N-like         62.8    7e-10   
ref|XP_009628589.1|  PREDICTED: TMV resistance protein N-like iso...  62.0    1e-09   
ref|XP_009599523.1|  PREDICTED: TMV resistance protein N-like         62.0    1e-09   
ref|XP_009628590.1|  PREDICTED: TMV resistance protein N-like iso...  62.0    1e-09   
ref|XP_004310272.1|  PREDICTED: TMV resistance protein N-like         62.0    2e-09   
ref|XP_009803658.1|  PREDICTED: TMV resistance protein N-like         61.6    2e-09   
ref|XP_009622249.1|  PREDICTED: TMV resistance protein N-like         60.8    3e-09   
ref|XP_006367322.1|  PREDICTED: TMV resistance protein N-like         59.3    4e-09   
ref|XP_006360469.1|  PREDICTED: TMV resistance protein N-like         60.5    4e-09   
ref|XP_002325276.2|  hypothetical protein POPTR_0019s01160g           60.5    4e-09   Populus trichocarpa [western balsam poplar]
ref|XP_006380261.1|  hypothetical protein POPTR_0007s00630g           57.4    5e-09   
ref|XP_004246918.2|  PREDICTED: TMV resistance protein N-like         60.5    5e-09   
ref|XP_004243783.1|  PREDICTED: TMV resistance protein N-like         60.1    6e-09   
ref|XP_006371051.1|  hypothetical protein POPTR_0019s02990g           57.4    6e-09   
ref|XP_011013098.1|  PREDICTED: TMV resistance protein N-like iso...  60.1    6e-09   
ref|XP_004237202.1|  PREDICTED: TMV resistance protein N-like         60.1    6e-09   
ref|XP_009610977.1|  PREDICTED: TMV resistance protein N-like         57.4    7e-09   
ref|XP_010498130.1|  PREDICTED: TMV resistance protein N-like         60.1    7e-09   
ref|XP_003596687.1|  Disease-resistance protein                       60.1    7e-09   
gb|AAP44393.1|  nematode resistance-like protein                      59.7    7e-09   Solanum tuberosum [potatoes]
emb|CAC95124.1|  TIR/NBS/LRR protein                                  59.7    8e-09   Populus deltoides
ref|XP_011013099.1|  PREDICTED: TMV resistance protein N-like iso...  59.7    8e-09   
ref|XP_004296085.1|  PREDICTED: TMV resistance protein N-like         57.8    8e-09   
gb|AES66938.2|  disease resistance protein (TIR-NBS-LRR class), p...  59.7    9e-09   
gb|AAP44392.1|  nematode resistance-like protein                      59.3    1e-08   Solanum tuberosum [potatoes]
ref|XP_006371049.1|  hypothetical protein POPTR_0019s02970g           59.3    1e-08   
ref|XP_006371055.1|  hypothetical protein POPTR_0019s03015g           58.9    1e-08   
ref|XP_006478257.1|  PREDICTED: TMV resistance protein N-like iso...  59.3    1e-08   
ref|XP_006364843.1|  PREDICTED: TMV resistance protein N-like         59.3    1e-08   
gb|AAF79477.1|AC022492_21  F1L3.30                                    59.3    1e-08   Arabidopsis thaliana [mouse-ear cress]
gb|ACP30591.1|  disease resistance protein                            59.3    1e-08   Brassica rapa subsp. pekinensis [bai cai]
gb|AAP44390.1|  nematode resistance protein                           59.3    1e-08   Solanum tuberosum [potatoes]
ref|XP_002892959.1|  hypothetical protein ARALYDRAFT_471969           59.3    1e-08   
ref|XP_006367018.1|  PREDICTED: TMV resistance protein N-like         56.2    1e-08   
gb|ABF81459.1|  TIR-NBS type disease resistance protein               59.3    1e-08   Populus trichocarpa [western balsam poplar]
ref|NP_173203.2|  TIR-NBS-LRR class disease resistance protein        59.3    1e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006371043.1|  hypothetical protein POPTR_0019s029202g          57.4    1e-08   
gb|AAN73010.1|  NBS-LRR resistance protein RAS5-1                     58.5    1e-08   Helianthus annuus
ref|XP_007134526.1|  hypothetical protein PHAVU_010G054800g           56.2    1e-08   
emb|CDP07826.1|  unnamed protein product                              58.9    1e-08   
ref|XP_006385250.1|  hypothetical protein POPTR_0003s02110g           58.9    2e-08   
gb|ACP30554.1|  disease resistance protein                            58.5    2e-08   Brassica rapa subsp. pekinensis [bai cai]
emb|CDX81842.1|  BnaC08g37590D                                        58.5    2e-08   
gb|AAL07542.1|  resistance gene analog NBS7                           56.6    2e-08   Helianthus annuus
ref|XP_006367324.1|  PREDICTED: TMV resistance protein N-like         58.5    2e-08   
ref|XP_009117649.1|  PREDICTED: LOW QUALITY PROTEIN: putative dis...  58.5    2e-08   
ref|XP_006478256.1|  PREDICTED: TMV resistance protein N-like iso...  58.5    2e-08   
gb|KDO51715.1|  hypothetical protein CISIN_1g001277mg                 58.5    2e-08   
gb|ABF81471.1|  TIR-NBS type disease resistance protein               58.5    2e-08   Populus trichocarpa [western balsam poplar]
ref|XP_008227048.1|  PREDICTED: TMV resistance protein N-like         58.2    2e-08   
ref|XP_007134525.1|  hypothetical protein PHAVU_010G054800g           55.8    2e-08   
ref|XP_006478252.1|  PREDICTED: TMV resistance protein N-like iso...  58.5    2e-08   
ref|XP_004310257.1|  PREDICTED: TMV resistance protein N-like         58.2    2e-08   
emb|CDY21738.1|  BnaA09g44890D                                        58.2    2e-08   
ref|XP_004233763.1|  PREDICTED: TMV resistance protein N-like         58.5    2e-08   
ref|XP_004289196.1|  PREDICTED: protein SUPPRESSOR OF npr1-1, CON...  58.5    2e-08   
ref|XP_006441623.1|  hypothetical protein CICLE_v10023891mg           58.2    3e-08   
gb|KCW78212.1|  hypothetical protein EUGRSUZ_D02396                   58.5    3e-08   
ref|XP_002530627.1|  TMV resistance protein N, putative               58.2    3e-08   Ricinus communis
ref|XP_010519809.1|  PREDICTED: protein SUPPRESSOR OF npr1-1, CON...  58.2    3e-08   
ref|XP_006348979.1|  PREDICTED: TMV resistance protein N-like         58.2    3e-08   
ref|XP_006371041.1|  hypothetical protein POPTR_0019s02900g           58.2    3e-08   
emb|CAN65187.1|  hypothetical protein VITISV_026856                   55.1    3e-08   Vitis vinifera
ref|XP_007201150.1|  hypothetical protein PRUPE_ppa015450mg           58.2    3e-08   
ref|XP_009767766.1|  PREDICTED: TMV resistance protein N-like         55.8    3e-08   
gb|AAP44391.1|  nematode resistance-like protein                      58.2    3e-08   Solanum tuberosum [potatoes]
ref|XP_006371054.1|  hypothetical protein POPTR_0019s03010g           57.8    3e-08   
ref|XP_009790280.1|  PREDICTED: TMV resistance protein N-like         57.8    3e-08   
gb|AAF61452.1|AF139523_1  disease-resistance protein NRSA1            55.5    4e-08   Tagetes erecta [big marigold]
gb|ABB82029.1|  TIR-NBS disease resistance-like protein               57.8    4e-08   Populus trichocarpa [western balsam poplar]
ref|XP_006370866.1|  hypothetical protein POPTR_0019s01210g           57.4    4e-08   
ref|XP_006342406.1|  PREDICTED: TMV resistance protein N-like         56.2    4e-08   
ref|XP_010048876.1|  PREDICTED: TMV resistance protein N-like iso...  55.1    4e-08   
ref|XP_006386003.1|  hypothetical protein POPTR_0003s19910g           57.8    4e-08   
gb|ABF81466.1|  TIR-NBS type disease resistance protein               57.8    4e-08   Populus trichocarpa [western balsam poplar]
ref|XP_010245185.1|  PREDICTED: TMV resistance protein N-like         57.8    4e-08   
ref|XP_007023130.1|  Disease resistance protein, putative             57.8    4e-08   
ref|XP_006370852.1|  hypothetical protein POPTR_0019s00910g           54.7    4e-08   
ref|XP_006371227.1|  hypothetical protein POPTR_0019s06300g           57.4    5e-08   
ref|XP_010048875.1|  PREDICTED: TMV resistance protein N-like iso...  54.7    5e-08   
emb|CAC95127.1|  part I of G08 TIR/NBS/LRR protein                    55.1    5e-08   Populus deltoides
emb|CAN79900.1|  hypothetical protein VITISV_007865                   57.4    5e-08   Vitis vinifera
ref|XP_010104209.1|  TMV resistance protein N                         57.4    5e-08   
ref|XP_008237531.1|  PREDICTED: TMV resistance protein N-like         57.4    5e-08   
ref|XP_002524855.1|  ATP binding protein, putative                    57.0    5e-08   Ricinus communis
emb|CAD36200.1|  TIR-NBS disease resistance protein                   57.0    5e-08   Populus trichocarpa [western balsam poplar]
ref|XP_010644030.1|  PREDICTED: uncharacterized protein LOC100253289  57.4    5e-08   
ref|XP_002310389.2|  hypothetical protein POPTR_0007s00600g           57.4    6e-08   Populus trichocarpa [western balsam poplar]
gb|ABM55687.1|  TIR-NBS-LRR class disease resistance protein          57.0    6e-08   (Populus tomentosa x Populus bolleana) x Populus tomentosa
ref|XP_011011693.1|  PREDICTED: TMV resistance protein N-like         57.4    6e-08   
emb|CAN61853.1|  hypothetical protein VITISV_027841                   57.4    6e-08   Vitis vinifera
gb|KDO40203.1|  hypothetical protein CISIN_1g047667mg                 54.3    6e-08   
ref|XP_010644041.1|  PREDICTED: uncharacterized protein LOC104877471  57.4    6e-08   
gb|KDO40286.1|  hypothetical protein CISIN_1g000802mg                 57.0    7e-08   
ref|XP_008232097.1|  PREDICTED: TMV resistance protein N-like         57.0    7e-08   
ref|XP_010645936.1|  PREDICTED: TMV resistance protein N-like         57.0    7e-08   
ref|XP_006494999.1|  PREDICTED: TMV resistance protein N-like         57.0    7e-08   
ref|XP_004228499.1|  PREDICTED: TMV resistance protein N-like         57.0    7e-08   
ref|XP_006371047.1|  hypothetical protein POPTR_0019s02950g           57.0    7e-08   
ref|XP_009364329.1|  PREDICTED: uncharacterized protein LOC103954249  56.6    7e-08   
gb|AAF61210.1|  unknown                                               53.9    8e-08   Glycine max [soybeans]
emb|CAC95120.1|  TIR/NBS/LRR protein                                  54.7    8e-08   Populus deltoides
ref|XP_010665235.1|  PREDICTED: TMV resistance protein N-like         57.0    8e-08   
emb|CAN62576.1|  hypothetical protein VITISV_038321                   57.0    8e-08   Vitis vinifera
ref|XP_010312682.1|  PREDICTED: TMV resistance protein N-like iso...  57.0    8e-08   
ref|XP_008227045.1|  PREDICTED: TMV resistance protein N-like         57.0    8e-08   
ref|XP_010243120.1|  PREDICTED: TMV resistance protein N-like         56.6    9e-08   
ref|XP_008237565.1|  PREDICTED: TMV resistance protein N-like         56.6    9e-08   
ref|XP_006367168.1|  PREDICTED: TMV resistance protein N-like         53.9    9e-08   
ref|XP_008237860.1|  PREDICTED: TMV resistance protein N-like         56.6    9e-08   
ref|XP_006361823.1|  PREDICTED: TMV resistance protein N-like         54.3    9e-08   
ref|XP_007221062.1|  hypothetical protein PRUPE_ppa016235mg           54.7    1e-07   
ref|XP_010041311.1|  PREDICTED: toll/interleukin-1 receptor-like ...  54.3    1e-07   
ref|XP_004309895.1|  PREDICTED: TMV resistance protein N-like         56.6    1e-07   
ref|XP_010665341.1|  PREDICTED: TMV resistance protein N-like         56.6    1e-07   
ref|XP_006342679.1|  PREDICTED: TMV resistance protein N-like         56.6    1e-07   
ref|XP_007199069.1|  hypothetical protein PRUPE_ppa018765mg           56.6    1e-07   
ref|XP_006370864.1|  hypothetical protein POPTR_0019s01170g           56.6    1e-07   
ref|XP_002264704.2|  PREDICTED: TMV resistance protein N              56.6    1e-07   Vitis vinifera
ref|XP_008347087.1|  PREDICTED: toll/interleukin-1 receptor-like ...  53.5    1e-07   
ref|XP_010242716.1|  PREDICTED: TMV resistance protein N-like iso...  56.6    1e-07   
ref|XP_010242715.1|  PREDICTED: TMV resistance protein N-like iso...  56.6    1e-07   
gb|KCW60775.1|  hypothetical protein EUGRSUZ_H03503                   53.5    1e-07   
ref|XP_007199473.1|  hypothetical protein PRUPE_ppa027155mg           56.2    1e-07   
gb|AAL07537.1|  resistance gene analog NBS2                           54.3    1e-07   Helianthus annuus
ref|XP_006342676.1|  PREDICTED: TMV resistance protein N-like         53.5    1e-07   
ref|XP_010312685.1|  PREDICTED: TMV resistance protein N-like iso...  56.2    1e-07   
emb|CAN63551.1|  hypothetical protein VITISV_032106                   56.2    1e-07   Vitis vinifera
ref|XP_010312683.1|  PREDICTED: TMV resistance protein N-like iso...  56.2    1e-07   
ref|XP_011013489.1|  PREDICTED: TMV resistance protein N-like iso...  56.2    1e-07   
ref|XP_010039703.1|  PREDICTED: toll/interleukin-1 receptor-like ...  55.1    1e-07   
ref|XP_007199154.1|  hypothetical protein PRUPE_ppa019668mg           53.1    1e-07   
ref|XP_010050357.1|  PREDICTED: toll/interleukin-1 receptor-like ...  53.1    1e-07   
ref|XP_006342554.1|  PREDICTED: L-ascorbate oxidase homolog isofo...  55.8    1e-07   
ref|XP_011012882.1|  PREDICTED: TMV resistance protein N-like         56.2    1e-07   
ref|XP_008237473.1|  PREDICTED: TMV resistance protein N-like iso...  56.2    1e-07   
dbj|BAB09118.1|  unnamed protein product                              56.2    1e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010312671.1|  PREDICTED: uncharacterized protein LOC101265700  56.2    1e-07   
ref|XP_008237474.1|  PREDICTED: TMV resistance protein N-like iso...  56.2    1e-07   
gb|AEI27416.1|  TIR_3                                                 56.2    1e-07   
ref|XP_006478464.1|  PREDICTED: TMV resistance protein N-like         56.2    1e-07   
ref|XP_006367967.1|  PREDICTED: TMV resistance protein N-like         55.8    2e-07   
ref|XP_007201607.1|  hypothetical protein PRUPE_ppa019628mg           56.2    2e-07   
ref|XP_010242717.1|  PREDICTED: TMV resistance protein N-like iso...  55.8    2e-07   
emb|CDP04904.1|  unnamed protein product                              55.8    2e-07   
ref|XP_010048012.1|  PREDICTED: TMV resistance protein N-like         55.8    2e-07   
ref|XP_006389335.1|  hypothetical protein POPTR_0030s00570g           55.8    2e-07   
ref|NP_199688.1|  TIR-NBS-LRR class disease resistance protein        55.8    2e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010665295.1|  PREDICTED: toll/interleukin-1 receptor-like ...  52.8    2e-07   
ref|NP_198826.1|  TIR-NBS-LRR class disease resistance protein        55.8    2e-07   Arabidopsis thaliana [mouse-ear cress]
gb|AAO38222.1|  RCa11                                                 52.4    2e-07   Manihot esculenta [manioc]
ref|XP_007199428.1|  hypothetical protein PRUPE_ppa026529mg           55.8    2e-07   
ref|XP_004289198.1|  PREDICTED: TMV resistance protein N-like         55.5    2e-07   
ref|XP_010060724.1|  PREDICTED: TMV resistance protein N-like         55.8    2e-07   
gb|ABB82025.1|  TIR-NBS disease resistance-like protein               55.8    2e-07   Populus trichocarpa [western balsam poplar]
ref|XP_010056815.1|  PREDICTED: TMV resistance protein N-like         55.8    2e-07   
ref|XP_002276075.2|  PREDICTED: TMV resistance protein N-like iso...  55.8    2e-07   Vitis vinifera
ref|XP_006342678.1|  PREDICTED: uncharacterized protein LOC102595828  55.5    2e-07   
ref|XP_011005281.1|  PREDICTED: LOW QUALITY PROTEIN: TMV resistan...  55.8    2e-07   
sp|Q40392.1|TMVRN_NICGU  RecName: Full=TMV resistance protein N       55.8    2e-07   Nicotiana glutinosa
gb|AAL07544.1|  resistance gene analog NBS9                           54.7    2e-07   Helianthus annuus
ref|XP_006367016.1|  PREDICTED: TMV resistance protein N-like         55.5    2e-07   
ref|XP_002870725.1|  hypothetical protein ARALYDRAFT_916254           55.5    2e-07   
gb|AEE43928.1|  TIR-NBS-LRR resistance protein muRdr1D                55.5    2e-07   
ref|XP_008361342.1|  PREDICTED: TMV resistance protein N-like iso...  55.5    2e-07   
ref|XP_002325743.2|  hypothetical protein POPTR_0019s00880g           52.8    2e-07   Populus trichocarpa [western balsam poplar]
gb|AFP55552.1|  TIR-NBS-LRR                                           55.5    2e-07   
gb|AAL07539.1|  resistance gene analog NBS4                           54.3    2e-07   Helianthus annuus
ref|XP_010050156.1|  PREDICTED: TMV resistance protein N-like         53.1    2e-07   
ref|XP_008361338.1|  PREDICTED: TMV resistance protein N-like iso...  55.5    2e-07   
ref|XP_011015315.1|  PREDICTED: TMV resistance protein N-like         55.5    2e-07   
ref|XP_008391553.1|  PREDICTED: uncharacterized protein LOC103453763  55.5    2e-07   
ref|XP_011015316.1|  PREDICTED: TMV resistance protein N-like         52.8    2e-07   
ref|XP_006353757.1|  PREDICTED: TMV resistance protein N-like         55.5    2e-07   
ref|XP_002325273.2|  hypothetical protein POPTR_0019s01200g           55.5    2e-07   Populus trichocarpa [western balsam poplar]
ref|XP_010436827.1|  PREDICTED: putative disease resistance prote...  55.5    2e-07   
emb|CAN72303.1|  hypothetical protein VITISV_009715                   55.5    2e-07   Vitis vinifera
dbj|BAD12594.1|  N protein                                            55.5    2e-07   Nicotiana tabacum [American tobacco]
ref|XP_006283059.1|  hypothetical protein CARUB_v10004053mg           55.5    2e-07   
ref|XP_010450686.1|  PREDICTED: TMV resistance protein N-like iso...  55.5    2e-07   
ref|XP_007198927.1|  hypothetical protein PRUPE_ppa000477mg           55.5    2e-07   
ref|XP_010450684.1|  PREDICTED: TMV resistance protein N-like iso...  55.5    2e-07   
ref|XP_010245559.1|  PREDICTED: uncharacterized protein LOC104589071  55.5    3e-07   
gb|AFP55548.1|  TIR-NBS-LRR                                           55.5    3e-07   
gb|ABB82024.1|  TIR-NBS disease resistance-like protein               55.5    3e-07   Populus trichocarpa [western balsam poplar]
ref|XP_008237864.1|  PREDICTED: TMV resistance protein N-like         55.5    3e-07   
gb|AAY43787.1|  disease resistance protein                            54.7    3e-07   (Populus tomentosa x Populus bolleana) x Populus tomentosa var. truncata
gb|AEI27415.1|  TIR_2                                                 55.5    3e-07   
ref|XP_011047737.1|  PREDICTED: LOW QUALITY PROTEIN: TMV resistan...  55.5    3e-07   
ref|XP_002316567.2|  hypothetical protein POPTR_0011s01664g           53.5    3e-07   Populus trichocarpa [western balsam poplar]
ref|XP_010441159.1|  PREDICTED: TMV resistance protein N-like iso...  55.5    3e-07   
ref|XP_010450725.1|  PREDICTED: putative disease resistance prote...  55.1    3e-07   
ref|XP_010450726.1|  PREDICTED: putative disease resistance prote...  55.1    3e-07   
ref|XP_006466584.1|  PREDICTED: TMV resistance protein N-like         55.5    3e-07   
ref|XP_008237367.1|  PREDICTED: TMV resistance protein N              55.1    3e-07   
ref|XP_010441160.1|  PREDICTED: TMV resistance protein N-like iso...  55.5    3e-07   
ref|XP_003596702.1|  TIR-NBS-LRR type disease resistance protein      55.1    3e-07   
ref|XP_008245719.1|  PREDICTED: TMV resistance protein N-like         55.5    3e-07   
ref|XP_004136801.1|  PREDICTED: TMV resistance protein N-like         54.3    3e-07   
ref|XP_010054883.1|  PREDICTED: toll/interleukin-1 receptor-like ...  52.4    3e-07   
gb|AES66953.2|  disease resistance protein (TIR-NBS-LRR class), p...  55.1    3e-07   
ref|XP_011012884.1|  PREDICTED: TMV resistance protein N-like         55.1    3e-07   
emb|CAN74711.1|  hypothetical protein VITISV_009242                   55.5    3e-07   Vitis vinifera
ref|XP_011013492.1|  PREDICTED: TMV resistance protein N-like iso...  55.1    3e-07   
ref|XP_011013491.1|  PREDICTED: TMV resistance protein N-like iso...  55.1    3e-07   
ref|XP_006380263.1|  hypothetical protein POPTR_0007s00680g           54.3    3e-07   
ref|XP_010645912.1|  PREDICTED: TMV resistance protein N-like iso...  55.1    3e-07   
ref|XP_008237566.1|  PREDICTED: TMV resistance protein N-like         55.1    3e-07   
emb|CBI31297.3|  unnamed protein product                              55.1    3e-07   
ref|XP_008237764.1|  PREDICTED: TMV resistance protein N-like         52.4    3e-07   
gb|KCW67569.1|  hypothetical protein EUGRSUZ_F01321                   55.1    3e-07   
ref|XP_004159649.1|  PREDICTED: TMV resistance protein N-like         54.3    3e-07   
ref|XP_006441684.1|  hypothetical protein CICLE_v10024297mg           55.1    3e-07   
ref|XP_006380260.1|  hypothetical protein POPTR_0007s00620g           54.7    3e-07   
ref|XP_010645938.1|  PREDICTED: TMV resistance protein N-like         52.4    3e-07   
ref|XP_010665187.1|  PREDICTED: TMV resistance protein N-like iso...  55.1    3e-07   
ref|XP_010665186.1|  PREDICTED: TMV resistance protein N-like iso...  55.1    3e-07   
gb|KCW73676.1|  hypothetical protein EUGRSUZ_E02272                   55.1    3e-07   
ref|XP_011013488.1|  PREDICTED: TMV resistance protein N-like iso...  55.1    3e-07   
ref|XP_003635135.2|  PREDICTED: uncharacterized protein LOC100853815  55.1    3e-07   
ref|XP_010050773.1|  PREDICTED: toll/interleukin-1 receptor-like ...  52.4    3e-07   
ref|XP_010050608.1|  PREDICTED: toll/interleukin-1 receptor-like ...  52.4    3e-07   
ref|XP_011013487.1|  PREDICTED: TMV resistance protein N-like iso...  55.1    3e-07   
ref|XP_006362754.1|  PREDICTED: TMV resistance protein N-like iso...  55.1    3e-07   
ref|XP_011013490.1|  PREDICTED: TMV resistance protein N-like iso...  55.1    3e-07   
ref|XP_002325285.2|  hypothetical protein POPTR_0019s00890g           55.1    4e-07   Populus trichocarpa [western balsam poplar]
ref|XP_011011343.1|  PREDICTED: TMV resistance protein N-like         52.0    4e-07   
ref|XP_011044910.1|  PREDICTED: TMV resistance protein N-like         54.7    4e-07   
ref|XP_010050192.1|  PREDICTED: toll/interleukin-1 receptor-like ...  52.4    4e-07   
ref|XP_011044953.1|  PREDICTED: TMV resistance protein N-like         54.7    4e-07   
emb|CDY36822.1|  BnaC04g32150D                                        55.1    4e-07   
emb|CBI40962.3|  unnamed protein product                              55.1    4e-07   
ref|XP_004253023.1|  PREDICTED: protein PHLOEM PROTEIN 2-LIKE A8-...  54.3    4e-07   
ref|XP_006441871.1|  hypothetical protein CICLE_v10024379mg           55.1    4e-07   
ref|XP_007219398.1|  hypothetical protein PRUPE_ppa020421mg           54.7    4e-07   
ref|XP_008227882.1|  PREDICTED: TMV resistance protein N-like         55.1    4e-07   
ref|XP_008240874.1|  PREDICTED: LOW QUALITY PROTEIN: TMV resistan...  54.7    4e-07   
ref|XP_010644028.1|  PREDICTED: uncharacterized protein LOC100261885  55.1    4e-07   
ref|XP_010027051.1|  PREDICTED: TMV resistance protein N-like         52.8    4e-07   
ref|XP_006495365.1|  PREDICTED: TMV resistance protein N-like         52.0    4e-07   
ref|XP_006441742.1|  hypothetical protein CICLE_v10024129mg           52.8    4e-07   
ref|XP_004309607.1|  PREDICTED: uncharacterized protein LOC101302224  52.0    4e-07   
ref|XP_010059228.1|  PREDICTED: toll/interleukin-1 receptor-like ...  52.4    4e-07   
ref|XP_010645905.1|  PREDICTED: TMV resistance protein N-like         54.7    4e-07   
ref|XP_009779694.1|  PREDICTED: TMV resistance protein N-like         54.7    4e-07   
gb|ABB82026.1|  TIR-NBS disease resistance-like protein               54.7    4e-07   Populus trichocarpa [western balsam poplar]
ref|XP_010645853.1|  PREDICTED: TMV resistance protein N-like         54.7    4e-07   
ref|XP_002325898.2|  hypothetical protein POPTR_0019s07880g           54.7    4e-07   Populus trichocarpa [western balsam poplar]
ref|XP_010665445.1|  PREDICTED: TMV resistance protein N-like         52.8    4e-07   
ref|XP_006377200.1|  hypothetical protein POPTR_0011s01890g           51.6    4e-07   
ref|XP_011028529.1|  PREDICTED: TMV resistance protein N-like         52.0    4e-07   
ref|XP_010645868.1|  PREDICTED: TMV resistance protein N-like iso...  54.7    4e-07   
ref|XP_010645866.1|  PREDICTED: TMV resistance protein N-like iso...  54.7    5e-07   
ref|XP_006371058.1|  hypothetical protein POPTR_0019s03040g           54.3    5e-07   
ref|XP_006355114.1|  PREDICTED: TMV resistance protein N-like iso...  54.7    5e-07   
ref|XP_006355113.1|  PREDICTED: TMV resistance protein N-like iso...  54.7    5e-07   
ref|XP_006367017.1|  PREDICTED: TMV resistance protein N-like         54.7    5e-07   
emb|CBI31260.3|  unnamed protein product                              54.7    5e-07   
ref|XP_006367169.1|  PREDICTED: TMV resistance protein N-like iso...  52.0    5e-07   
gb|KHN26393.1|  TMV resistance protein N                              54.7    5e-07   
ref|XP_003526343.1|  PREDICTED: TMV resistance protein N-like         54.7    5e-07   
ref|XP_010665286.1|  PREDICTED: TMV resistance protein N-like         54.7    5e-07   
gb|KCW80494.1|  hypothetical protein EUGRSUZ_C01839                   51.6    5e-07   
ref|XP_008224240.1|  PREDICTED: TMV resistance protein N-like         54.7    5e-07   
ref|XP_010050186.1|  PREDICTED: toll/interleukin-1 receptor-like ...  52.4    5e-07   
gb|AFP55568.1|  TIR-NBS-LRR                                           54.7    5e-07   
dbj|BAD12595.1|  truncated N protein                                  54.3    5e-07   
ref|XP_004308445.1|  PREDICTED: TMV resistance protein N-like         54.7    5e-07   
gb|KGN59549.1|  hypothetical protein Csa_3G824940                     54.3    5e-07   
ref|XP_009759653.1|  PREDICTED: TMV resistance protein N-like         54.7    5e-07   
dbj|BAF95888.1|  N-like protein                                       54.7    5e-07   
ref|XP_006362839.1|  PREDICTED: TMV resistance protein N-like         54.7    5e-07   
ref|XP_006478373.1|  PREDICTED: TMV resistance protein N-like         54.7    5e-07   
ref|XP_009786757.1|  PREDICTED: TMV resistance protein N-like         54.7    5e-07   
ref|XP_007203308.1|  hypothetical protein PRUPE_ppa025905mg           54.3    5e-07   
gb|AAL07540.1|  resistance gene analog NBS5                           53.1    5e-07   
gb|AEE43927.1|  TIR-NBS-LRR resistance protein muRdr1C                54.3    6e-07   
ref|XP_006282439.1|  hypothetical protein CARUB_v10004054mg           54.3    6e-07   
ref|XP_002304785.2|  hypothetical protein POPTR_0003s19950g           54.3    6e-07   
ref|XP_008237366.1|  PREDICTED: TMV resistance protein N-like         54.3    6e-07   
gb|ABF81460.1|  TIR-NBS type disease resistance protein               54.3    6e-07   
ref|XP_011013794.1|  PREDICTED: TMV resistance protein N-like         51.6    6e-07   
ref|XP_006388459.1|  hypothetical protein POPTR_0182s00240g           54.3    6e-07   
ref|XP_011046325.1|  PREDICTED: TMV resistance protein N-like iso...  54.3    6e-07   
ref|XP_011046323.1|  PREDICTED: TMV resistance protein N-like iso...  54.3    6e-07   
ref|XP_003614284.1|  TMV resistance protein N                         54.3    6e-07   
gb|AAL07543.1|  resistance gene analog NBS8                           52.8    6e-07   
ref|XP_007199034.1|  hypothetical protein PRUPE_ppa018060mg           54.3    6e-07   
gb|ABF81464.1|  TIR-NBS-LRR type disease resistance protein           54.3    6e-07   
ref|XP_009615050.1|  PREDICTED: TMV resistance protein N-like         54.3    6e-07   
emb|CAN64588.1|  hypothetical protein VITISV_008452                   52.8    7e-07   
gb|KCW67571.1|  hypothetical protein EUGRSUZ_F01323                   54.3    7e-07   
ref|XP_010050661.1|  PREDICTED: toll/interleukin-1 receptor-like ...  52.8    7e-07   
emb|CAN61526.1|  hypothetical protein VITISV_036339                   54.3    7e-07   
emb|CAN78476.1|  hypothetical protein VITISV_009816                   53.9    7e-07   
ref|XP_007207681.1|  hypothetical protein PRUPE_ppa023596mg           53.9    7e-07   
ref|XP_007206681.1|  hypothetical protein PRUPE_ppa023688mg           54.3    7e-07   
ref|XP_008359692.1|  PREDICTED: TMV resistance protein N-like         54.3    7e-07   
ref|NP_001237821.1|  candidate disease-resistance protein             53.9    7e-07   
ref|XP_010034174.1|  PREDICTED: TMV resistance protein N-like         53.5    7e-07   
ref|XP_011001264.1|  PREDICTED: TMV resistance protein N-like iso...  53.9    7e-07   
ref|XP_010064474.1|  PREDICTED: TMV resistance protein N-like         53.5    7e-07   
ref|XP_009760755.1|  PREDICTED: LOW QUALITY PROTEIN: TMV resistan...  53.9    7e-07   
ref|XP_009779558.1|  PREDICTED: TMV resistance protein N-like         53.9    7e-07   
ref|XP_010041024.1|  PREDICTED: TMV resistance protein N-like         53.5    8e-07   
ref|XP_011001265.1|  PREDICTED: TMV resistance protein N-like iso...  53.9    8e-07   
ref|XP_010039997.1|  PREDICTED: TMV resistance protein N-like         53.1    8e-07   
ref|XP_011001263.1|  PREDICTED: TMV resistance protein N-like iso...  53.9    8e-07   
ref|XP_006441726.1|  hypothetical protein CICLE_v10023938mg           53.9    8e-07   
gb|AAG43546.1|AF211528_1  Avr9/Cf-9 rapidly elicited protein 4        53.5    8e-07   
ref|XP_011001262.1|  PREDICTED: TMV resistance protein N-like iso...  53.9    8e-07   
ref|XP_006388458.1|  hypothetical protein POPTR_0182s00230g           51.2    8e-07   
ref|XP_009367206.1|  PREDICTED: TMV resistance protein N-like         53.9    8e-07   
ref|XP_010645914.1|  PREDICTED: TMV resistance protein N-like         53.5    8e-07   
ref|XP_009336848.1|  PREDICTED: TMV resistance protein N-like         53.9    8e-07   
gb|KGN59547.1|  hypothetical protein Csa_3G824920                     53.9    8e-07   
ref|XP_009761928.1|  PREDICTED: TMV resistance protein N-like iso...  53.9    8e-07   
ref|XP_002264399.1|  PREDICTED: TMV resistance protein N-like         53.9    8e-07   
emb|CAD36199.1|  NLS-TIR-NBS disease resistance protein               53.5    8e-07   
gb|AAL07535.1|  resistance gene analog PU3                            53.9    8e-07   
gb|KCW74713.1|  hypothetical protein EUGRSUZ_E03438                   53.1    9e-07   
gb|KHN27958.1|  TMV resistance protein N                              53.9    9e-07   
ref|XP_008347062.1|  PREDICTED: toll/interleukin-1 receptor-like ...  50.8    9e-07   
ref|XP_010050172.1|  PREDICTED: TMV resistance protein N-like         52.4    9e-07   
ref|XP_009597713.1|  PREDICTED: TMV resistance protein N-like iso...  53.9    9e-07   
ref|XP_010054931.1|  PREDICTED: TMV resistance protein N-like         53.5    9e-07   
ref|XP_006388942.1|  hypothetical protein POPTR_0069s00200g           50.8    9e-07   
ref|XP_010059355.1|  PREDICTED: TMV resistance protein N-like         53.9    9e-07   
ref|XP_008237445.1|  PREDICTED: TMV resistance protein N-like         53.9    9e-07   
ref|XP_011002590.1|  PREDICTED: TMV resistance protein N-like         53.5    9e-07   
ref|XP_004292155.1|  PREDICTED: TMV resistance protein N-like         53.9    9e-07   
ref|XP_004301464.1|  PREDICTED: TMV resistance protein N-like         53.9    9e-07   
ref|XP_010431501.1|  PREDICTED: protein SUPPRESSOR OF npr1-1, CON...  53.9    9e-07   
ref|XP_009597696.1|  PREDICTED: TMV resistance protein N-like iso...  53.9    9e-07   
ref|XP_007221572.1|  hypothetical protein PRUPE_ppa025473mg           53.9    9e-07   
emb|CDY11142.1|  BnaC06g23940D                                        52.8    9e-07   
ref|XP_004307888.1|  PREDICTED: TMV resistance protein N-like         53.9    1e-06   
gb|KEH23209.1|  disease resistance protein (TIR-NBS-LRR class), p...  53.9    1e-06   
ref|XP_010476918.1|  PREDICTED: TMV resistance protein N-like         53.1    1e-06   
gb|KDO38417.1|  hypothetical protein CISIN_1g036738mg                 52.8    1e-06   
ref|XP_007204716.1|  hypothetical protein PRUPE_ppa014815mg           53.9    1e-06   
ref|XP_009127956.1|  PREDICTED: protein SUPPRESSOR OF npr1-1, CON...  53.5    1e-06   
ref|XP_009127955.1|  PREDICTED: protein SUPPRESSOR OF npr1-1, CON...  53.5    1e-06   
gb|AFP55572.1|  TIR-NBS-LRR                                           53.5    1e-06   
gb|AAT37497.1|  N-like protein                                        53.5    1e-06   
gb|AAL07536.1|  resistance gene analog NBS1                           52.8    1e-06   
gb|AEE43929.1|  TIR-NBS-LRR resistance protein muRdr1E                53.5    1e-06   
ref|XP_010650203.1|  PREDICTED: TMV resistance protein N-like         53.5    1e-06   
gb|AES69132.2|  disease resistance protein (TIR-NBS-LRR class)        53.5    1e-06   
gb|ACU19311.1|  unknown                                               50.4    1e-06   
ref|XP_003598881.1|  TMV resistance protein N                         53.5    1e-06   
ref|XP_010263216.1|  PREDICTED: TMV resistance protein N-like iso...  53.5    1e-06   
ref|XP_010657780.1|  PREDICTED: TMV resistance protein N-like iso...  53.5    1e-06   
gb|AAD55633.1|AC008017_6  Similar to downy mildew resistance prot...  53.5    1e-06   
gb|KDO36672.1|  hypothetical protein CISIN_1g035646mg                 53.1    1e-06   
ref|XP_010050160.1|  PREDICTED: TMV resistance protein N-like         53.5    1e-06   
gb|KHN43082.1|  TMV resistance protein N                              50.8    1e-06   
gb|AAL07541.1|  resistance gene analog NBS6                           52.4    1e-06   
ref|NP_177429.2|  TIR-NBS-LRR class disease resistance protein        53.5    1e-06   
gb|ABB82027.1|  TIR-NBS disease resistance-like protein               53.5    1e-06   
gb|KHG30618.1|  TMV resistance N                                      53.5    1e-06   
ref|XP_009785918.1|  PREDICTED: TMV resistance protein N-like         53.5    1e-06   
ref|XP_004309249.1|  PREDICTED: TMV resistance protein N-like         52.8    1e-06   
emb|CAN68030.1|  hypothetical protein VITISV_003124                   53.5    1e-06   
ref|XP_008347081.1|  PREDICTED: TMV resistance protein N-like         50.8    1e-06   
gb|KCW67541.1|  hypothetical protein EUGRSUZ_F01291                   53.5    1e-06   
ref|XP_006385577.1|  hypothetical protein POPTR_0003s08250g           53.5    1e-06   
ref|XP_002276056.1|  PREDICTED: TMV resistance protein N-like         53.5    1e-06   
ref|XP_010050653.1|  PREDICTED: TMV resistance protein N-like         53.1    1e-06   
ref|XP_010050840.1|  PREDICTED: TMV resistance protein N-like         52.4    1e-06   
ref|XP_010060729.1|  PREDICTED: TMV resistance protein N-like         53.5    1e-06   
gb|KDO36805.1|  hypothetical protein CISIN_1g031401mg                 50.4    1e-06   
gb|ABF81465.1|  TIR-NBS-LRR type disease resistance protein           53.5    1e-06   
ref|XP_010645836.1|  PREDICTED: toll/interleukin-1 receptor-like ...  50.8    1e-06   
ref|XP_004289202.1|  PREDICTED: TMV resistance protein N-like         51.6    1e-06   
ref|XP_008237436.1|  PREDICTED: TMV resistance protein N-like         53.5    1e-06   
ref|XP_010657779.1|  PREDICTED: TMV resistance protein N-like iso...  53.5    1e-06   
ref|XP_006380156.1|  hypothetical protein POPTR_0008s22420g           50.8    1e-06   
ref|XP_010024322.1|  PREDICTED: TMV resistance protein N-like         53.1    1e-06   
ref|XP_008390024.1|  PREDICTED: toll/interleukin-1 receptor-like ...  50.8    1e-06   
ref|XP_007134166.1|  hypothetical protein PHAVU_010G025000g           53.5    1e-06   
ref|XP_004301289.1|  PREDICTED: TMV resistance protein N-like         52.8    1e-06   
ref|XP_011014417.1|  PREDICTED: TMV resistance protein N-like         53.1    1e-06   
ref|XP_010459359.1|  PREDICTED: putative disease resistance prote...  53.1    1e-06   
ref|XP_009343898.1|  PREDICTED: toll/interleukin-1 receptor-like ...  50.4    1e-06   
ref|XP_010263322.1|  PREDICTED: TMV resistance protein N-like         50.8    1e-06   
ref|XP_010657777.1|  PREDICTED: TMV resistance protein N-like iso...  53.5    1e-06   
ref|XP_010023543.1|  PREDICTED: toll/interleukin-1 receptor-like ...  52.4    1e-06   
ref|XP_010320695.1|  PREDICTED: TMV resistance protein N-like iso...  53.5    1e-06   
ref|XP_010435942.1|  PREDICTED: TMV resistance protein N-like         53.1    1e-06   
ref|XP_010645869.1|  PREDICTED: putative disease resistance prote...  53.1    1e-06   
ref|XP_004288867.1|  PREDICTED: TMV resistance protein N-like         53.1    1e-06   
gb|ABO21407.1|  TMV resistance protein N                              53.1    1e-06   
ref|XP_009791999.1|  PREDICTED: TMV resistance protein N-like         52.4    1e-06   
ref|XP_010459360.1|  PREDICTED: putative disease resistance prote...  53.1    1e-06   
ref|XP_008375888.1|  PREDICTED: TMV resistance protein N-like         53.1    1e-06   
ref|XP_008380658.1|  PREDICTED: TMV resistance protein N-like         50.4    1e-06   
ref|XP_007023140.1|  Disease resistance protein                       53.1    1e-06   
ref|NP_001241468.1|  TMV resistance protein N-like                    52.8    1e-06   
ref|XP_007203412.1|  hypothetical protein PRUPE_ppa021441mg           53.1    1e-06   
emb|CBI23849.3|  unnamed protein product                              53.1    1e-06   
gb|AFP55556.1|  TIR-NBS-LRR                                           53.1    1e-06   
gb|KCW78535.1|  hypothetical protein EUGRSUZ_D02660                   52.8    1e-06   
gb|AAW28561.2|  TMV resistance protein N, putative                    52.8    1e-06   
ref|XP_004307562.1|  PREDICTED: TMV resistance protein N-like         53.1    2e-06   
ref|XP_004308838.1|  PREDICTED: TMV resistance protein N-like         53.1    2e-06   
emb|CAN61899.1|  hypothetical protein VITISV_029813                   50.4    2e-06   
ref|XP_010042728.1|  PREDICTED: TMV resistance protein N-like         50.4    2e-06   
gb|AGF69193.1|  TMV resistance protein N-like protein 7               53.1    2e-06   
emb|CDY11149.1|  BnaC06g24010D                                        53.1    2e-06   
gb|AEE43933.1|  TIR-NBS-LRR resistance protein muRdr1I                52.8    2e-06   
ref|XP_011003906.1|  PREDICTED: TMV resistance protein N-like iso...  53.1    2e-06   
gb|AFP55538.1|  TIR-NBS-LRR                                           53.1    2e-06   
gb|AEE43930.1|  TIR-NBS-LRR resistance protein muRdr1F                53.1    2e-06   
ref|XP_010050764.1|  PREDICTED: TMV resistance protein N-like         53.1    2e-06   
ref|XP_010665419.1|  PREDICTED: TMV resistance protein N-like         53.1    2e-06   
ref|XP_008219354.1|  PREDICTED: TMV resistance protein N-like         53.1    2e-06   
ref|XP_010320697.1|  PREDICTED: TMV resistance protein N-like iso...  53.1    2e-06   
ref|XP_002316558.2|  hypothetical protein POPTR_0011s00210g           52.8    2e-06   
ref|XP_006370901.1|  hypothetical protein POPTR_0019s01560g           52.8    2e-06   
ref|XP_004499788.1|  PREDICTED: TMV resistance protein N-like         53.1    2e-06   
ref|XP_010054872.1|  PREDICTED: TMV resistance protein N-like         52.8    2e-06   
ref|XP_008237536.1|  PREDICTED: TMV resistance protein N-like         53.1    2e-06   
ref|XP_007203338.1|  hypothetical protein PRUPE_ppa020234mg           49.7    2e-06   
ref|XP_006441743.1|  hypothetical protein CICLE_v10023421mg           53.1    2e-06   
ref|XP_010648148.1|  PREDICTED: TMV resistance protein N-like         53.1    2e-06   
ref|XP_010039689.1|  PREDICTED: probable WRKY transcription facto...  52.8    2e-06   
ref|XP_007148814.1|  hypothetical protein PHAVU_005G016500g           53.1    2e-06   
ref|XP_008443388.1|  PREDICTED: TMV resistance protein N              53.1    2e-06   
ref|XP_002514805.1|  ATP binding protein, putative                    53.1    2e-06   
emb|CAR94518.1|  nematode resistance-like protein                     53.1    2e-06   
ref|XP_004310258.1|  PREDICTED: TMV resistance protein N-like         52.8    2e-06   
gb|AEE43925.1|  TIR-NBS-LRR resistance protein muRdr1A                53.1    2e-06   
ref|XP_007214356.1|  hypothetical protein PRUPE_ppb025535mg           50.8    2e-06   
ref|XP_010042674.1|  PREDICTED: toll/interleukin-1 receptor-like ...  52.0    2e-06   
ref|XP_004136800.1|  PREDICTED: TMV resistance protein N-like         52.8    2e-06   
ref|XP_006342684.1|  PREDICTED: protein PHLOEM PROTEIN 2-LIKE A8-...  52.4    2e-06   
gb|KFK41713.1|  hypothetical protein AALP_AA2G163800                  52.8    2e-06   
gb|AFP55562.1|  TIR-NBS-LRR                                           52.8    2e-06   
ref|XP_010462757.1|  PREDICTED: TMV resistance protein N-like         52.4    2e-06   
ref|XP_006360960.1|  PREDICTED: TMV resistance protein N-like         52.4    2e-06   
ref|XP_010043415.1|  PREDICTED: TMV resistance protein N-like         52.8    2e-06   
ref|XP_006495475.1|  PREDICTED: TMV resistance protein N-like         50.1    2e-06   
ref|XP_009343054.1|  PREDICTED: TMV resistance protein N-like         52.8    2e-06   
ref|XP_008235925.1|  PREDICTED: TMV resistance protein N-like         52.8    2e-06   
ref|XP_003623322.1|  TIR-NBS-LRR type disease resistance protein      52.8    2e-06   
gb|AAU04776.1|  MRGH14                                                49.7    2e-06   
ref|XP_003610657.1|  TIR-NBS-LRR type disease resistance protein      52.8    2e-06   
ref|XP_004296311.1|  PREDICTED: TMV resistance protein N-like         52.0    2e-06   
ref|XP_006377205.1|  hypothetical protein POPTR_0011s01950g           49.7    2e-06   
ref|XP_008357193.1|  PREDICTED: toll/interleukin-1 receptor-like ...  50.4    2e-06   
ref|XP_004289883.1|  PREDICTED: TMV resistance protein N-like         50.4    2e-06   
ref|XP_007226605.1|  hypothetical protein PRUPE_ppa023385mg           52.8    2e-06   
ref|XP_010501499.1|  PREDICTED: putative disease resistance prote...  52.8    2e-06   
ref|XP_006356547.1|  PREDICTED: TMV resistance protein N-like         52.4    2e-06   
emb|CBI31335.3|  unnamed protein product                              52.8    2e-06   
ref|XP_008342525.1|  PREDICTED: TMV resistance protein N-like iso...  52.8    2e-06   
ref|XP_010023541.1|  PREDICTED: TMV resistance protein N-like iso...  52.4    2e-06   
ref|XP_010050310.1|  PREDICTED: TMV resistance protein N-like         52.4    2e-06   
ref|XP_010041324.1|  PREDICTED: TMV resistance protein N-like         50.4    2e-06   
ref|XP_008353720.1|  PREDICTED: TMV resistance protein N-like         50.1    2e-06   
ref|XP_010256443.1|  PREDICTED: TMV resistance protein N-like iso...  52.8    2e-06   
ref|XP_010256441.1|  PREDICTED: TMV resistance protein N-like iso...  52.8    2e-06   
gb|KHN01586.1|  TMV resistance protein N                              52.0    2e-06   
ref|XP_008244976.1|  PREDICTED: TMV resistance protein N-like         52.8    2e-06   
ref|XP_009353817.1|  PREDICTED: TMV resistance protein N-like         50.4    2e-06   
ref|XP_004159650.1|  PREDICTED: TMV resistance protein N-like         52.8    2e-06   
emb|CAR94514.1|  nematode resistance-like protein                     52.8    2e-06   
ref|XP_006492482.1|  PREDICTED: TMV resistance protein N-like         50.1    2e-06   
ref|XP_006377164.1|  hypothetical protein POPTR_0011s01315g           52.4    2e-06   
ref|XP_010645942.1|  PREDICTED: TMV resistance protein N-like         51.6    2e-06   
ref|XP_009366896.1|  PREDICTED: TMV resistance protein N-like         52.8    2e-06   
ref|XP_004305013.1|  PREDICTED: TMV resistance protein N-like         51.2    2e-06   
ref|XP_010050280.1|  PREDICTED: putative adenylate cyclase regula...  52.0    2e-06   
gb|ADL36719.1|  HD domain class transcription factor                  50.1    2e-06   
ref|XP_006385995.1|  hypothetical protein POPTR_0003s19850g           52.8    2e-06   
ref|XP_008343279.1|  PREDICTED: TMV resistance protein N-like         52.8    2e-06   
gb|ABE99701.1|  TIR-NBS-LRR disease resistance-like protein           52.8    2e-06   
emb|CBI32058.3|  unnamed protein product                              52.8    2e-06   
gb|KCW51851.1|  hypothetical protein EUGRSUZ_J01303                   52.8    2e-06   
ref|XP_007199954.1|  hypothetical protein PRUPE_ppa1027179mg          52.8    2e-06   
ref|XP_010048912.1|  PREDICTED: TMV resistance protein N-like         50.1    2e-06   
ref|XP_004492464.1|  PREDICTED: TMV resistance protein N-like iso...  52.8    2e-06   
gb|ABF81419.1|  TIR-NBS-LRR type disease resistance protein           52.8    2e-06   



>ref|XP_006356453.1| PREDICTED: TMV resistance protein N-like [Solanum tuberosum]
Length=1324

 Score = 69.3 bits (168),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 31/37 (84%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRKT V HLY+ LKQKG+H FKDDERL
Sbjct  12   DVFLSFRGEDTRKTFVGHLYYALKQKGIHTFKDDERL  48



>ref|XP_009794563.1| PREDICTED: TMV resistance protein N-like [Nicotiana sylvestris]
Length=166

 Score = 64.3 bits (155),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 29/37 (78%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGED RKT VDHLY  L+QKG+H FKDDE+L
Sbjct  20   DVFLSFRGEDVRKTFVDHLYVALQQKGIHTFKDDEKL  56



>ref|XP_004253017.1| PREDICTED: TMV resistance protein N-like [Solanum lycopersicum]
Length=195

 Score = 63.9 bits (154),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 28/37 (76%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            D+FLSFRGEDTR+T V HLY+ L+Q+G+HAFKDDERL
Sbjct  13   DIFLSFRGEDTRRTFVSHLYNALEQRGIHAFKDDERL  49



>ref|XP_009613120.1| PREDICTED: TMV resistance protein N-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009613121.1| PREDICTED: TMV resistance protein N-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009613122.1| PREDICTED: TMV resistance protein N-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009613123.1| PREDICTED: TMV resistance protein N-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009613124.1| PREDICTED: TMV resistance protein N-like isoform X1 [Nicotiana 
tomentosiformis]
Length=1421

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 29/37 (78%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRK  V HLY+ L+Q+G+HAFKDDERL
Sbjct  33   DVFLSFRGEDTRKNFVSHLYNALEQRGIHAFKDDERL  69



>emb|CDP20523.1| unnamed protein product [Coffea canephora]
Length=1150

 Score = 65.9 bits (159),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 29/37 (78%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGED RK IVDHLY  L+QKG+H FKDDE+L
Sbjct  27   DVFLSFRGEDVRKGIVDHLYSALEQKGIHTFKDDEKL  63



>ref|XP_009794564.1| PREDICTED: TMV resistance protein N-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009794565.1| PREDICTED: TMV resistance protein N-like isoform X1 [Nicotiana 
sylvestris]
Length=1156

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/37 (78%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGED RKT VDHLY  L+QKG+H FKDDE L
Sbjct  17   DVFLSFRGEDVRKTFVDHLYVALQQKGIHTFKDDENL  53



>ref|XP_009794566.1| PREDICTED: TMV resistance protein N-like isoform X2 [Nicotiana 
sylvestris]
Length=1107

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/37 (78%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGED RKT VDHLY  L+QKG+H FKDDE L
Sbjct  17   DVFLSFRGEDVRKTFVDHLYVALQQKGIHTFKDDENL  53



>ref|XP_009803029.1| PREDICTED: TMV resistance protein N-like isoform X3 [Nicotiana 
sylvestris]
Length=1368

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/37 (78%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRKT V HLY+ LK KG+H FKDD RL
Sbjct  14   DVFLSFRGEDTRKTFVGHLYYALKHKGIHTFKDDVRL  50



>ref|XP_009630491.1| PREDICTED: uncharacterized protein LOC104120435 [Nicotiana tomentosiformis]
Length=1980

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/37 (76%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +2

Query  2     DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
             DVFLSFRGED RKT VDHLY  L+Q+G+H FKDDE+L
Sbjct  1178  DVFLSFRGEDVRKTFVDHLYVALQQRGIHTFKDDEKL  1214


 Score = 63.2 bits (152),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 28/37 (76%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGED RK  VDHLY  L+QKG+H FKDDE+L
Sbjct  19   DVFLSFRGEDVRKKFVDHLYVALQQKGIHTFKDDEKL  55



>ref|XP_004228809.1| PREDICTED: TMV resistance protein N-like [Solanum lycopersicum]
Length=1326

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/37 (78%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRG+DTRKT V HL + LKQKG+H FKDDERL
Sbjct  12   DVFLSFRGKDTRKTFVGHLNYALKQKGIHTFKDDERL  48



>ref|XP_009803027.1| PREDICTED: TMV resistance protein N-like isoform X1 [Nicotiana 
sylvestris]
Length=1399

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/37 (78%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRKT V HLY+ LK KG+H FKDD RL
Sbjct  14   DVFLSFRGEDTRKTFVGHLYYALKHKGIHTFKDDVRL  50



>ref|XP_009803028.1| PREDICTED: TMV resistance protein N-like isoform X2 [Nicotiana 
sylvestris]
Length=1372

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 29/37 (78%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRKT V HLY+ LK KG+H FKDD RL
Sbjct  14   DVFLSFRGEDTRKTFVGHLYYALKHKGIHTFKDDVRL  50



>ref|XP_004237584.1| PREDICTED: TMV resistance protein N-like [Solanum lycopersicum]
Length=1154

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGED RK  VDHLY  L+Q+G+H FKDDE+L
Sbjct  19   DVFLSFRGEDVRKNFVDHLYTALQQRGIHTFKDDEKL  55



>ref|XP_006350421.1| PREDICTED: TMV resistance protein N-like [Solanum tuberosum]
Length=862

 Score = 63.5 bits (153),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGED RK  VDHLY  L+Q+G+H FKDDE+L
Sbjct  23   DVFLSFRGEDVRKNFVDHLYTALQQRGIHTFKDDEKL  59



>ref|XP_010323796.1| PREDICTED: TMV resistance protein N-like [Solanum lycopersicum]
Length=160

 Score = 60.1 bits (144),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            D+FLSF GEDTR+T V HLY+ L+Q+G+HAFKDDERL
Sbjct  13   DIFLSFGGEDTRRTFVSHLYNALEQRGIHAFKDDERL  49



>ref|XP_009613117.1| PREDICTED: TMV resistance protein N-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009613118.1| PREDICTED: TMV resistance protein N-like isoform X1 [Nicotiana 
tomentosiformis]
Length=426

 Score = 62.4 bits (150),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRK  V HLY+ L+Q+G+HAFKDD+RL
Sbjct  13   DVFLSFRGEDTRKNFVSHLYNALEQRGIHAFKDDDRL  49



>ref|XP_010263414.1| PREDICTED: TMV resistance protein N-like [Nelumbo nucifera]
Length=1134

 Score = 62.8 bits (151),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 26/37 (70%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRK+  DHLY+ L Q+G+H F+DDE+L
Sbjct  16   DVFLSFRGEDTRKSFTDHLYNALVQRGIHTFRDDEKL  52



>ref|XP_009628589.1| PREDICTED: TMV resistance protein N-like isoform X1 [Nicotiana 
tomentosiformis]
Length=1364

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 28/37 (76%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRG+DTRKT V HLY+ LK KG+H FKDD RL
Sbjct  14   DVFLSFRGKDTRKTFVGHLYYALKHKGVHTFKDDVRL  50



>ref|XP_009599523.1| PREDICTED: TMV resistance protein N-like [Nicotiana tomentosiformis]
 ref|XP_009599524.1| PREDICTED: TMV resistance protein N-like [Nicotiana tomentosiformis]
 ref|XP_009599525.1| PREDICTED: TMV resistance protein N-like [Nicotiana tomentosiformis]
 ref|XP_009599526.1| PREDICTED: TMV resistance protein N-like [Nicotiana tomentosiformis]
Length=1398

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 28/37 (76%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRK  V HLY+ LKQ+G+  FKDDERL
Sbjct  13   DVFLSFRGEDTRKNFVSHLYNALKQRGIDVFKDDERL  49



>ref|XP_009628590.1| PREDICTED: TMV resistance protein N-like isoform X2 [Nicotiana 
tomentosiformis]
Length=1337

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 28/37 (76%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRG+DTRKT V HLY+ LK KG+H FKDD RL
Sbjct  14   DVFLSFRGKDTRKTFVGHLYYALKHKGVHTFKDDVRL  50



>ref|XP_004310272.1| PREDICTED: TMV resistance protein N-like [Fragaria vesca subsp. 
vesca]
Length=1668

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRK   DHLY  L QKG+H F+DDE L
Sbjct  86   DVFLSFRGEDTRKNFTDHLYTALLQKGIHTFRDDEEL  122



>ref|XP_009803658.1| PREDICTED: TMV resistance protein N-like [Nicotiana sylvestris]
Length=1237

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRK+ VDHLY  L +KG+HAF+DD  L
Sbjct  27   DVFLSFRGEDTRKSFVDHLYTTLHEKGIHAFRDDIEL  63



>ref|XP_009622249.1| PREDICTED: TMV resistance protein N-like [Nicotiana tomentosiformis]
Length=1238

 Score = 60.8 bits (146),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRK+ VDHLY  L +KG+HAF+DD  L
Sbjct  29   DVFLSFRGEDTRKSFVDHLYTTLHEKGIHAFRDDIEL  65



>ref|XP_006367322.1| PREDICTED: TMV resistance protein N-like [Solanum tuberosum]
Length=320

 Score = 59.3 bits (142),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            D+FLSFRGEDTR+T V HLY  L+ +G+H FKDDERL
Sbjct  51   DIFLSFRGEDTRRTFVSHLYKALELRGIHTFKDDERL  87



>ref|XP_006360469.1| PREDICTED: TMV resistance protein N-like [Solanum tuberosum]
Length=1239

 Score = 60.5 bits (145),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGED RKT VDHLY  L+QKG++ FKD E+L
Sbjct  25   DVFLSFRGEDVRKTFVDHLYVALQQKGINTFKDSEKL  61



>ref|XP_002325276.2| hypothetical protein POPTR_0019s01160g [Populus trichocarpa]
 gb|EEE99657.2| hypothetical protein POPTR_0019s01160g [Populus trichocarpa]
Length=829

 Score = 60.5 bits (145),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRKT  DHLY  L Q G+HAF+DD+ L
Sbjct  16   DVFLSFRGEDTRKTFTDHLYSALVQAGIHAFRDDDDL  52



>ref|XP_006380261.1| hypothetical protein POPTR_0007s00630g, partial [Populus trichocarpa]
 gb|ERP58058.1| hypothetical protein POPTR_0007s00630g, partial [Populus trichocarpa]
Length=156

 Score = 57.4 bits (137),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRKT  DHLY  L Q G+H F+DD+ L
Sbjct  69   DVFLSFRGEDTRKTFTDHLYTALVQAGIHTFRDDDEL  105



>ref|XP_004246918.2| PREDICTED: TMV resistance protein N-like [Solanum lycopersicum]
Length=1079

 Score = 60.5 bits (145),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTR+T V HLY  L+Q G+  FKDDERL
Sbjct  13   DVFLSFRGEDTRRTFVSHLYKALEQSGIRIFKDDERL  49



>ref|XP_004243783.1| PREDICTED: TMV resistance protein N-like [Solanum lycopersicum]
Length=1147

 Score = 60.1 bits (144),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGED RKT VDHLY  L+QK ++ FKDDE+L
Sbjct  19   DVFLSFRGEDVRKTFVDHLYLALEQKCIYTFKDDEKL  55



>ref|XP_006371051.1| hypothetical protein POPTR_0019s02990g, partial [Populus trichocarpa]
 gb|ERP48848.1| hypothetical protein POPTR_0019s02990g, partial [Populus trichocarpa]
Length=212

 Score = 57.4 bits (137),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRKT  DHLY  L Q G+H F+DD+ L
Sbjct  16   DVFLSFRGEDTRKTFTDHLYAALDQAGIHTFRDDDEL  52



>ref|XP_011013098.1| PREDICTED: TMV resistance protein N-like isoform X1 [Populus 
euphratica]
Length=1166

 Score = 60.1 bits (144),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRKT  DHLY  L Q G+H F+DD+ L
Sbjct  16   DVFLSFRGEDTRKTFTDHLYAALDQAGIHTFRDDDEL  52



>ref|XP_004237202.1| PREDICTED: TMV resistance protein N-like [Solanum lycopersicum]
Length=1251

 Score = 60.1 bits (144),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 26/37 (70%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRG+D RKT VDHLY  L+QKG++ FKDD++L
Sbjct  24   DVFLSFRGKDVRKTFVDHLYVALQQKGINTFKDDDKL  60



>ref|XP_009610977.1| PREDICTED: TMV resistance protein N-like [Nicotiana tomentosiformis]
Length=231

 Score = 57.4 bits (137),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRK  V HLY  L +KG+H F+DD  L
Sbjct  10   DVFLSFRGEDTRKNFVSHLYRALTKKGVHTFRDDRSL  46



>ref|XP_010498130.1| PREDICTED: TMV resistance protein N-like [Camelina sativa]
Length=1047

 Score = 60.1 bits (144),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRKTIV HLY  L+ +G+  FKDD+RL
Sbjct  13   DVFLSFRGEDTRKTIVSHLYAALESRGIVTFKDDKRL  49



>ref|XP_003596687.1| Disease-resistance protein [Medicago truncatula]
Length=1288

 Score = 60.1 bits (144),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVF+SFRG DTR T VDHLY  LK+KG+ AFKDD+RL
Sbjct  65   DVFISFRGPDTRNTFVDHLYAHLKRKGIFAFKDDQRL  101



>gb|AAP44393.1| nematode resistance-like protein [Solanum tuberosum]
Length=1136

 Score = 59.7 bits (143),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGED RKT VDHLY  L+QK ++ FKDDE+L
Sbjct  19   DVFLSFRGEDVRKTFVDHLYLALQQKCINTFKDDEKL  55



>emb|CAC95124.1| TIR/NBS/LRR protein [Populus deltoides]
Length=1147

 Score = 59.7 bits (143),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRKT  DHLY  L Q G+H F+DD+ L
Sbjct  40   DVFLSFRGEDTRKTFTDHLYTALVQAGIHTFRDDDEL  76



>ref|XP_011013099.1| PREDICTED: TMV resistance protein N-like isoform X2 [Populus 
euphratica]
Length=1112

 Score = 59.7 bits (143),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRKT  DHLY  L Q G+H F+DD+ L
Sbjct  16   DVFLSFRGEDTRKTFTDHLYAALDQAGIHTFRDDDEL  52



>ref|XP_004296085.1| PREDICTED: TMV resistance protein N-like [Fragaria vesca subsp. 
vesca]
Length=263

 Score = 57.8 bits (138),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 26/37 (70%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRG+DTRK+  DHLY  L QKG+  F+DDERL
Sbjct  7    DVFLSFRGQDTRKSFTDHLYSGLVQKGIKTFRDDERL  43



>gb|AES66938.2| disease resistance protein (TIR-NBS-LRR class), putative [Medicago 
truncatula]
Length=1185

 Score = 59.7 bits (143),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVF+SFRG DTR T VDHLY  LK+KG+ AFKDD+RL
Sbjct  56   DVFISFRGPDTRNTFVDHLYAHLKRKGIFAFKDDQRL  92



>gb|AAP44392.1| nematode resistance-like protein [Solanum tuberosum]
Length=1136

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGED RKT VDHLY  L+QK ++ FKDDE+L
Sbjct  19   DVFLSFRGEDVRKTFVDHLYLALQQKCINTFKDDEKL  55



>ref|XP_006371049.1| hypothetical protein POPTR_0019s02970g, partial [Populus trichocarpa]
 gb|ERP48846.1| hypothetical protein POPTR_0019s02970g, partial [Populus trichocarpa]
Length=962

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRKT  DHLY  L Q G+H F+DD+ L
Sbjct  16   DVFLSFRGEDTRKTFTDHLYTALVQAGIHTFRDDDEL  52



>ref|XP_006371055.1| hypothetical protein POPTR_0019s03015g [Populus trichocarpa]
 gb|ERP48852.1| hypothetical protein POPTR_0019s03015g [Populus trichocarpa]
Length=512

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRKT VDHLY  L Q G+H F+DD+ L
Sbjct  16   DVFLSFRGEDTRKTFVDHLYTALVQAGIHTFRDDDEL  52



>ref|XP_006478257.1| PREDICTED: TMV resistance protein N-like isoform X6 [Citrus sinensis]
Length=931

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            D FLSFRGEDTRK+  DHLY  LK KG++ FKDD+ L
Sbjct  15   DAFLSFRGEDTRKSFTDHLYAALKNKGIYVFKDDKEL  51



>ref|XP_006364843.1| PREDICTED: TMV resistance protein N-like [Solanum tuberosum]
Length=1230

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRK+ VDHLY  L++KG+H F+DD+ L
Sbjct  21   DVFLSFRGEDTRKSFVDHLYTSLREKGIHTFRDDKEL  57



>gb|AAF79477.1|AC022492_21 F1L3.30 [Arabidopsis thaliana]
Length=1075

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRKTIV HLY  L  +G+  FKDD+RL
Sbjct  13   DVFLSFRGEDTRKTIVSHLYAALDSRGIVTFKDDQRL  49



>gb|ACP30591.1| disease resistance protein [Brassica rapa subsp. pekinensis]
Length=1555

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRKTIV HLY  L  +G+  FKDD+RL
Sbjct  16   DVFLSFRGEDTRKTIVSHLYAALDSRGIVTFKDDQRL  52



>gb|AAP44390.1| nematode resistance protein [Solanum tuberosum]
Length=1136

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGED RKT VDHLY  L+QK ++ FKDDE+L
Sbjct  19   DVFLSFRGEDVRKTFVDHLYLALEQKCINTFKDDEKL  55



>ref|XP_002892959.1| hypothetical protein ARALYDRAFT_471969 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69218.1| hypothetical protein ARALYDRAFT_471969 [Arabidopsis lyrata subsp. 
lyrata]
Length=963

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRKTIV HLY  L  +G+  FKDD+RL
Sbjct  13   DVFLSFRGEDTRKTIVSHLYAALDSRGIVTFKDDQRL  49



>ref|XP_006367018.1| PREDICTED: TMV resistance protein N-like [Solanum tuberosum]
Length=156

 Score = 56.2 bits (134),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTR+T V HL+  L+Q G+  FKDDERL
Sbjct  13   DVFLSFRGEDTRRTFVSHLHKALEQSGICIFKDDERL  49



>gb|ABF81459.1| TIR-NBS type disease resistance protein [Populus trichocarpa]
Length=1421

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRKT  DHLY  L Q G+H F+DD+ L
Sbjct  205  DVFLSFRGEDTRKTFTDHLYTALVQAGIHTFRDDDEL  241



>ref|NP_173203.2| TIR-NBS-LRR class disease resistance protein [Arabidopsis thaliana]
 gb|AEE29612.1| TIR-NBS-LRR class disease resistance protein [Arabidopsis thaliana]
Length=1049

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRKTIV HLY  L  +G+  FKDD+RL
Sbjct  13   DVFLSFRGEDTRKTIVSHLYAALDSRGIVTFKDDQRL  49



>ref|XP_006371043.1| hypothetical protein POPTR_0019s029202g, partial [Populus trichocarpa]
 gb|ERP48840.1| hypothetical protein POPTR_0019s029202g, partial [Populus trichocarpa]
Length=270

 Score = 57.4 bits (137),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRKT  DHLY  L Q G+H F+DD+ L
Sbjct  16   DVFLSFRGEDTRKTFTDHLYTALVQAGIHTFRDDDEL  52



>gb|AAN73010.1| NBS-LRR resistance protein RAS5-1 [Helianthus annuus]
Length=448

 Score = 58.5 bits (140),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTR + VDHLY  L Q+G+ A+KDDE L
Sbjct  85   DVFLSFRGEDTRNSFVDHLYAALAQQGIQAYKDDETL  121



>ref|XP_007134526.1| hypothetical protein PHAVU_010G054800g [Phaseolus vulgaris]
 ref|XP_007134527.1| hypothetical protein PHAVU_010G054800g [Phaseolus vulgaris]
 gb|ESW06520.1| hypothetical protein PHAVU_010G054800g [Phaseolus vulgaris]
 gb|ESW06521.1| hypothetical protein PHAVU_010G054800g [Phaseolus vulgaris]
Length=185

 Score = 56.2 bits (134),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVF+SFRGEDTR T  D L+H L+ KG++ FKDDE L
Sbjct  22   DVFVSFRGEDTRNTFTDFLFHSLRTKGINVFKDDEDL  58



>emb|CDP07826.1| unnamed protein product [Coffea canephora]
Length=1159

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/37 (70%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGED RK  VD LY  L+QKG++ FKDDE+L
Sbjct  22   DVFLSFRGEDVRKNFVDFLYSSLQQKGIYTFKDDEKL  58



>ref|XP_006385250.1| hypothetical protein POPTR_0003s02110g [Populus trichocarpa]
 gb|ABB82031.1| TIR-NBS disease resistance-like protein [Populus trichocarpa]
 gb|ERP63047.1| hypothetical protein POPTR_0003s02110g [Populus trichocarpa]
Length=1146

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRKT  DHLY  L Q G+H F+DD+ L
Sbjct  53   DVFLSFRGEDTRKTFTDHLYTALVQAGIHTFRDDDEL  89



>gb|ACP30554.1| disease resistance protein [Brassica rapa subsp. pekinensis]
Length=1035

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRKTIV HLY  L  +G+  FKDD+RL
Sbjct  17   DVFLSFRGEDTRKTIVSHLYAALDSRGIVTFKDDQRL  53



>emb|CDX81842.1| BnaC08g37590D [Brassica napus]
Length=1106

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRKTIV HLY  L  +G+  FKDD+RL
Sbjct  59   DVFLSFRGEDTRKTIVSHLYAALDSRGIVTFKDDQRL  95



>gb|AAL07542.1| resistance gene analog NBS7 [Helianthus annuus]
Length=259

 Score = 56.6 bits (135),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRG+DTRK+ VDHLY  L+Q+G++ +KDDE L
Sbjct  23   DVFLSFRGDDTRKSFVDHLYTALEQRGIYTYKDDETL  59



>ref|XP_006367324.1| PREDICTED: TMV resistance protein N-like, partial [Solanum tuberosum]
Length=871

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDE  106
            D+FLSFRGEDTR+T V HLY  L+Q+G+H FKDDE
Sbjct  18   DIFLSFRGEDTRRTFVSHLYKALEQRGIHTFKDDE  52



>ref|XP_009117649.1| PREDICTED: LOW QUALITY PROTEIN: putative disease resistance protein 
At4g11170 [Brassica rapa]
Length=1057

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRKTIV HLY  L  +G+  FKDD+RL
Sbjct  17   DVFLSFRGEDTRKTIVSHLYAALDSRGIVTFKDDQRL  53



>ref|XP_006478256.1| PREDICTED: TMV resistance protein N-like isoform X5 [Citrus sinensis]
Length=1101

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            D FLSFRGEDTRK+  DHLY  LK KG++ FKDD+ L
Sbjct  15   DAFLSFRGEDTRKSFTDHLYAALKNKGIYVFKDDKEL  51



>gb|KDO51715.1| hypothetical protein CISIN_1g001277mg [Citrus sinensis]
Length=1109

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            D FLSFRGEDTRK+  DHLY  LK KG++ FKDD+ L
Sbjct  15   DAFLSFRGEDTRKSFTDHLYAALKNKGIYVFKDDKEL  51



>gb|ABF81471.1| TIR-NBS type disease resistance protein [Populus trichocarpa]
Length=1368

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRKT  DHLY  L Q G+H F+DD+ L
Sbjct  122  DVFLSFRGEDTRKTFTDHLYTALVQAGIHTFRDDDEL  158



>ref|XP_008227048.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=510

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTR +  DHLYH L Q+G+  F+DDE+L
Sbjct  16   DVFLSFRGEDTRNSFTDHLYHALNQRGIDTFRDDEKL  52



>ref|XP_007134525.1| hypothetical protein PHAVU_010G054800g [Phaseolus vulgaris]
 gb|ESW06519.1| hypothetical protein PHAVU_010G054800g [Phaseolus vulgaris]
Length=205

 Score = 55.8 bits (133),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVF+SFRGEDTR T  D L+H L+ KG++ FKDDE L
Sbjct  22   DVFVSFRGEDTRNTFTDFLFHSLRTKGINVFKDDEDL  58



>ref|XP_006478252.1| PREDICTED: TMV resistance protein N-like isoform X1 [Citrus sinensis]
 ref|XP_006478253.1| PREDICTED: TMV resistance protein N-like isoform X2 [Citrus sinensis]
 ref|XP_006478254.1| PREDICTED: TMV resistance protein N-like isoform X3 [Citrus sinensis]
 ref|XP_006478255.1| PREDICTED: TMV resistance protein N-like isoform X4 [Citrus sinensis]
Length=1255

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            D FLSFRGEDTRK+  DHLY  LK KG++ FKDD+ L
Sbjct  15   DAFLSFRGEDTRKSFTDHLYAALKNKGIYVFKDDKEL  51



>ref|XP_004310257.1| PREDICTED: TMV resistance protein N-like [Fragaria vesca subsp. 
vesca]
Length=605

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRK   DHLY  L QKG+H F+DDE L
Sbjct  93   DVFLSFRGEDTRKNFTDHLYTALWQKGIHTFRDDEEL  129



>emb|CDY21738.1| BnaA09g44890D [Brassica napus]
Length=658

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRKTIV HLY  L  +G+  FKDD+RL
Sbjct  16   DVFLSFRGEDTRKTIVSHLYAALDSRGIVTFKDDQRL  52



>ref|XP_004233763.1| PREDICTED: TMV resistance protein N-like [Solanum lycopersicum]
Length=1228

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRK+ VDHLY  L  KG+HAF+DD+ L
Sbjct  19   DVFLSFRGEDTRKSFVDHLYTTLHDKGIHAFRDDKEL  55



>ref|XP_004289196.1| PREDICTED: protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1-like 
[Fragaria vesca subsp. vesca]
Length=1606

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTR    +HLYH   QKG++AF+D E+L
Sbjct  28   DVFLSFRGEDTRNNFTEHLYHAFNQKGINAFRDTEKL  64



>ref|XP_006441623.1| hypothetical protein CICLE_v10023891mg, partial [Citrus clementina]
 gb|ESR54863.1| hypothetical protein CICLE_v10023891mg, partial [Citrus clementina]
Length=1102

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            D FLSFRGEDTRK+  DHLY  LK KG++ FKDD+ L
Sbjct  15   DAFLSFRGEDTRKSFTDHLYAALKNKGIYVFKDDKEL  51



>gb|KCW78212.1| hypothetical protein EUGRSUZ_D02396 [Eucalyptus grandis]
Length=1643

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRKT VDHLY+ L   G+H F+DD  L
Sbjct  7    DVFLSFRGEDTRKTFVDHLYNGLVDVGIHVFRDDNDL  43



>ref|XP_002530627.1| TMV resistance protein N, putative [Ricinus communis]
 gb|EEF31770.1| TMV resistance protein N, putative [Ricinus communis]
Length=1116

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVF+SFRGEDTRK    HLY  L+QKG++AFKDD +L
Sbjct  12   DVFISFRGEDTRKNFTSHLYAALRQKGINAFKDDRQL  48



>ref|XP_010519809.1| PREDICTED: protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1-like 
[Tarenaya hassleriana]
Length=1561

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVF+SFRGEDTRK    HLYH L++KG+ AF D E+L
Sbjct  112  DVFISFRGEDTRKGFTSHLYHALRKKGIEAFMDSEKL  148



>ref|XP_006348979.1| PREDICTED: TMV resistance protein N-like [Solanum tuberosum]
Length=995

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/37 (70%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSF+GED RKT VDHLY  L+QK ++ FKDDE+L
Sbjct  19   DVFLSFKGEDIRKTFVDHLYLALQQKCINTFKDDEKL  55



>ref|XP_006371041.1| hypothetical protein POPTR_0019s02900g [Populus trichocarpa]
 gb|ERP48838.1| hypothetical protein POPTR_0019s02900g [Populus trichocarpa]
Length=1147

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRG+DTRKT  DHLY  L Q G+H F+DD+ L
Sbjct  16   DVFLSFRGKDTRKTFTDHLYTALVQAGIHTFRDDDEL  52



>emb|CAN65187.1| hypothetical protein VITISV_026856 [Vitis vinifera]
Length=160

 Score = 55.1 bits (131),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRK   DHLY+ L   G+H F+DDE L
Sbjct  13   DVFLSFRGEDTRKNFTDHLYNTLVAYGIHTFRDDEEL  49



>ref|XP_007201150.1| hypothetical protein PRUPE_ppa015450mg, partial [Prunus persica]
 gb|EMJ02349.1| hypothetical protein PRUPE_ppa015450mg, partial [Prunus persica]
Length=942

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTR + V HLYH L+ KG+  FKDD +L
Sbjct  8    DVFLSFRGEDTRLSFVSHLYHELQHKGIKTFKDDPKL  44



>ref|XP_009767766.1| PREDICTED: TMV resistance protein N-like [Nicotiana sylvestris]
Length=230

 Score = 55.8 bits (133),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDD  103
            DVFLSFRGEDTRK  V HLY  L +KG+H F+DD
Sbjct  10   DVFLSFRGEDTRKNFVSHLYRALTKKGVHTFRDD  43



>gb|AAP44391.1| nematode resistance-like protein [Solanum tuberosum]
Length=1121

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/37 (70%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGE+ RKT VDHLY  L+QK ++ FKDDE+L
Sbjct  19   DVFLSFRGENVRKTFVDHLYLALEQKCINTFKDDEKL  55



>ref|XP_006371054.1| hypothetical protein POPTR_0019s03010g, partial [Populus trichocarpa]
 gb|ERP48851.1| hypothetical protein POPTR_0019s03010g, partial [Populus trichocarpa]
Length=870

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTR+T  DHLY  L Q G+H F+DD+ L
Sbjct  16   DVFLSFRGEDTRQTFTDHLYTALVQAGIHTFRDDDEL  52



>ref|XP_009790280.1| PREDICTED: TMV resistance protein N-like [Nicotiana sylvestris]
Length=826

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/37 (70%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRKT V HLY  L++ G++ FKDDE L
Sbjct  18   DVFLSFRGEDTRKTFVAHLYRELRRAGINTFKDDETL  54



>gb|AAF61452.1|AF139523_1 disease-resistance protein NRSA1 [Tagetes erecta]
Length=221

 Score = 55.5 bits (132),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSF+G+DT KT VD+LYH L+QKG+  FK DER+
Sbjct  16   DVFLSFKGQDTPKTFVDNLYHALQQKGITTFKYDERI  52



>gb|ABB82029.1| TIR-NBS disease resistance-like protein [Populus trichocarpa]
Length=1147

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRG+DTRKT  DHLY  L Q G+H F+DD+ L
Sbjct  16   DVFLSFRGKDTRKTFTDHLYTALVQAGIHTFRDDDEL  52



>ref|XP_006370866.1| hypothetical protein POPTR_0019s01210g [Populus trichocarpa]
 gb|ABB82032.1| TIR-NBS disease resistance-like protein [Populus trichocarpa]
 gb|ERP48663.1| hypothetical protein POPTR_0019s01210g [Populus trichocarpa]
Length=509

 Score = 57.4 bits (137),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRKT  DHLY  L Q G+H F+DD+ L
Sbjct  16   DVFLSFRGEDTRKTFTDHLYTALVQAGIHTFRDDDEL  52



>ref|XP_006342406.1| PREDICTED: TMV resistance protein N-like [Solanum tuberosum]
Length=282

 Score = 56.2 bits (134),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDT +  V HLY+ L+Q+G+  FKDDERL
Sbjct  13   DVFLSFRGEDTCRNFVSHLYNALEQRGIRTFKDDERL  49



>ref|XP_010048876.1| PREDICTED: TMV resistance protein N-like isoform X2 [Eucalyptus 
grandis]
Length=176

 Score = 55.1 bits (131),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            +VFLSFRGEDTRKTI DHL+  L + G+  F+DDE L
Sbjct  28   EVFLSFRGEDTRKTITDHLHSRLTKAGIKVFRDDEEL  64



>ref|XP_006386003.1| hypothetical protein POPTR_0003s19910g, partial [Populus trichocarpa]
 gb|ERP63800.1| hypothetical protein POPTR_0003s19910g, partial [Populus trichocarpa]
Length=1354

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRK   DHLY  L Q G+H F+DDE+L
Sbjct  16   DVFLSFRGEDTRKNFTDHLYTALLQAGIHTFRDDEKL  52



>gb|ABF81466.1| TIR-NBS type disease resistance protein [Populus trichocarpa]
Length=1432

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRK   DHLY  L Q G+H F+DDE+L
Sbjct  87   DVFLSFRGEDTRKNFTDHLYTALLQAGIHTFRDDEKL  123



>ref|XP_010245185.1| PREDICTED: TMV resistance protein N-like [Nelumbo nucifera]
Length=1120

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRK   DHLY  L QKG++ F+DDE L
Sbjct  35   DVFLSFRGEDTRKNFTDHLYTALVQKGVYTFRDDEEL  71



>ref|XP_007023130.1| Disease resistance protein, putative [Theobroma cacao]
 gb|EOY25752.1| Disease resistance protein, putative [Theobroma cacao]
Length=1290

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRK+  DH Y  LK  G+  FKDDE+L
Sbjct  18   DVFLSFRGEDTRKSFTDHFYTCLKDHGIITFKDDEKL  54



>ref|XP_006370852.1| hypothetical protein POPTR_0019s00910g [Populus trichocarpa]
 gb|ERP48649.1| hypothetical protein POPTR_0019s00910g [Populus trichocarpa]
Length=149

 Score = 54.7 bits (130),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRK   DHLY  L Q G+H F+DD  L
Sbjct  24   DVFLSFRGEDTRKNFTDHLYTALIQAGIHTFRDDNEL  60



>ref|XP_006371227.1| hypothetical protein POPTR_0019s06300g [Populus trichocarpa]
 gb|ERP49024.1| hypothetical protein POPTR_0019s06300g [Populus trichocarpa]
Length=850

 Score = 57.4 bits (137),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRKT  DHLY  L Q G+H F+DD+ L
Sbjct  16   DVFLSFRGEDTRKTFTDHLYTALVQAGIHTFRDDDEL  52



>ref|XP_010048875.1| PREDICTED: TMV resistance protein N-like isoform X1 [Eucalyptus 
grandis]
Length=195

 Score = 54.7 bits (130),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            +VFLSFRGEDTRKTI DHL+  L + G+  F+DDE L
Sbjct  28   EVFLSFRGEDTRKTITDHLHSRLTKAGIKVFRDDEEL  64



>emb|CAC95127.1| part I of G08 TIR/NBS/LRR protein [Populus deltoides]
Length=226

 Score = 55.1 bits (131),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRKT  DHLY  L Q G++ F+DD+ L
Sbjct  16   DVFLSFRGEDTRKTFTDHLYTALVQAGIYTFRDDDEL  52



>emb|CAN79900.1| hypothetical protein VITISV_007865 [Vitis vinifera]
Length=826

 Score = 57.4 bits (137),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTR T  DHLY  L   G+H F+DDE L
Sbjct  677  DVFLSFRGEDTRSTFTDHLYSALVSNGIHTFRDDEEL  713



>ref|XP_010104209.1| TMV resistance protein N [Morus notabilis]
 gb|EXC47698.1| TMV resistance protein N [Morus notabilis]
Length=2037

 Score = 57.4 bits (137),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTR+   DHLY+ LK+KG+  F+DDE+L
Sbjct  20   DVFLSFRGEDTRRGFTDHLYNTLKRKGIDVFRDDEKL  56



>ref|XP_008237531.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=1228

 Score = 57.4 bits (137),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTR + V HLYH L+ +G+  FKDD +L
Sbjct  25   DVFLSFRGEDTRNSFVSHLYHELQHRGIKTFKDDPKL  61



>ref|XP_002524855.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF37479.1| ATP binding protein, putative [Ricinus communis]
Length=673

 Score = 57.0 bits (136),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRK   DHLY+ L Q G+HAF+DD+ L
Sbjct  24   DVFLSFRGEDTRKNFTDHLYNALLQAGIHAFRDDKHL  60



>emb|CAD36200.1| TIR-NBS disease resistance protein [Populus trichocarpa]
Length=567

 Score = 57.0 bits (136),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRKT  DHLY  L Q G+H F+DD+ L
Sbjct  16   DVFLSFRGEDTRKTFTDHLYTALVQAGIHTFRDDDEL  52



>ref|XP_010644030.1| PREDICTED: uncharacterized protein LOC100253289 [Vitis vinifera]
Length=2539

 Score = 57.4 bits (137),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRK+  DHLY  L +  +H F+DDE L
Sbjct  22   DVFLSFRGEDTRKSFTDHLYSALIRNNIHTFRDDEEL  58



>ref|XP_002310389.2| hypothetical protein POPTR_0007s00600g [Populus trichocarpa]
 gb|EEE90839.2| hypothetical protein POPTR_0007s00600g [Populus trichocarpa]
Length=1113

 Score = 57.4 bits (137),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRG+DTRKT  DHLY  L Q G+H F+DD+ L
Sbjct  16   DVFLSFRGKDTRKTFTDHLYTALVQAGIHTFRDDDEL  52



>gb|ABM55687.1| TIR-NBS-LRR class disease resistance protein [(Populus tomentosa 
x Populus bolleana) x Populus tomentosa]
Length=678

 Score = 57.0 bits (136),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRKT  DHLY  L Q G+H F+DD+ L
Sbjct  53   DVFLSFRGEDTRKTFTDHLYTALVQAGIHTFRDDDEL  89



>ref|XP_011011693.1| PREDICTED: TMV resistance protein N-like, partial [Populus euphratica]
Length=1094

 Score = 57.4 bits (137),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRKT  DHLY  L Q G+H F+DD+ L
Sbjct  44   DVFLSFRGEDTRKTFTDHLYTALVQAGIHTFRDDDEL  80



>emb|CAN61853.1| hypothetical protein VITISV_027841 [Vitis vinifera]
Length=1244

 Score = 57.4 bits (137),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTR++  DHLY  L +KG+  F+DDE L
Sbjct  18   DVFLSFRGEDTRRSFTDHLYAALVEKGVRTFRDDEEL  54



>gb|KDO40203.1| hypothetical protein CISIN_1g047667mg [Citrus sinensis]
Length=160

 Score = 54.3 bits (129),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRK+   HLY  LK KG++ F+DD+ L
Sbjct  15   DVFLSFRGEDTRKSFTGHLYAALKNKGIYVFRDDKEL  51



>ref|XP_010644041.1| PREDICTED: uncharacterized protein LOC104877471 [Vitis vinifera]
Length=2027

 Score = 57.4 bits (137),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRK+  DHLY  L +  +H F+DDE L
Sbjct  22   DVFLSFRGEDTRKSFTDHLYSALIRNNIHTFRDDEEL  58



>gb|KDO40286.1| hypothetical protein CISIN_1g000802mg [Citrus sinensis]
Length=1278

 Score = 57.0 bits (136),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRK+  +HLY  LK KG++ F+DD+ L
Sbjct  15   DVFLSFRGEDTRKSFTNHLYAALKNKGIYVFRDDKEL  51



>ref|XP_008232097.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=845

 Score = 57.0 bits (136),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDE  106
            DVFLS+RGEDTRKT +DHLY  L ++G+H F DDE
Sbjct  27   DVFLSYRGEDTRKTFIDHLYTALDRQGIHTFIDDE  61



>ref|XP_010645936.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
Length=1132

 Score = 57.0 bits (136),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRK   DHLY+ L   G+H F+DDE L
Sbjct  13   DVFLSFRGEDTRKNFTDHLYNTLVAYGIHTFRDDEEL  49



>ref|XP_006494999.1| PREDICTED: TMV resistance protein N-like [Citrus sinensis]
Length=1239

 Score = 57.0 bits (136),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRK+  +HLY  LK KG++ F+DD+ L
Sbjct  15   DVFLSFRGEDTRKSFTNHLYAALKNKGIYVFRDDKEL  51



>ref|XP_004228499.1| PREDICTED: TMV resistance protein N-like [Solanum lycopersicum]
Length=1335

 Score = 57.0 bits (136),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRKT   HLY  LK KG+  F+DD+RL
Sbjct  22   DVFLSFRGEDTRKTFTSHLYQALKNKGILTFQDDKRL  58



>ref|XP_006371047.1| hypothetical protein POPTR_0019s02950g [Populus trichocarpa]
 gb|ERP48844.1| hypothetical protein POPTR_0019s02950g [Populus trichocarpa]
Length=678

 Score = 57.0 bits (136),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRKT  DHLY  L Q G+H F+DD+ L
Sbjct  44   DVFLSFRGEDTRKTFTDHLYTALVQAGIHTFRDDDEL  80



>ref|XP_009364329.1| PREDICTED: uncharacterized protein LOC103954249 [Pyrus x bretschneideri]
 ref|XP_009364330.1| PREDICTED: uncharacterized protein LOC103954249 [Pyrus x bretschneideri]
 ref|XP_009364331.1| PREDICTED: uncharacterized protein LOC103954249 [Pyrus x bretschneideri]
 ref|XP_009364332.1| PREDICTED: uncharacterized protein LOC103954249 [Pyrus x bretschneideri]
 ref|XP_009364333.1| PREDICTED: uncharacterized protein LOC103954249 [Pyrus x bretschneideri]
 ref|XP_009364334.1| PREDICTED: uncharacterized protein LOC103954249 [Pyrus x bretschneideri]
 ref|XP_009364335.1| PREDICTED: uncharacterized protein LOC103954249 [Pyrus x bretschneideri]
Length=575

 Score = 56.6 bits (135),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVF+SFRG DTR  IVDH+YH LKQKG+  F+DD+ L
Sbjct  208  DVFMSFRGRDTRLNIVDHIYHSLKQKGITTFRDDKGL  244



>gb|AAF61210.1| unknown [Glycine max]
Length=148

 Score = 53.9 bits (128),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTR     HLY+ L+ KG+H F DDE+L
Sbjct  15   DVFLSFRGEDTRSAFTGHLYNTLQSKGIHTFIDDEKL  51



>emb|CAC95120.1| TIR/NBS/LRR protein [Populus deltoides]
Length=216

 Score = 54.7 bits (130),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTR T  DHLY  L Q G+H F+DD+ L
Sbjct  52   DVFLSFRGEDTRHTFTDHLYTALIQAGIHTFRDDDEL  88



>ref|XP_010665235.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
 ref|XP_010665237.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
Length=1276

 Score = 57.0 bits (136),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTR++  DHLY  L +KG+  F+DDE L
Sbjct  18   DVFLSFRGEDTRRSFTDHLYAALVEKGVRTFRDDEEL  54



>emb|CAN62576.1| hypothetical protein VITISV_038321 [Vitis vinifera]
Length=1256

 Score = 57.0 bits (136),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRG+DTRK   DHLY  L  +G+H F+DDE L
Sbjct  20   DVFLSFRGDDTRKNFTDHLYTSLVTRGIHTFRDDEEL  56



>ref|XP_010312682.1| PREDICTED: TMV resistance protein N-like isoform X1 [Solanum 
lycopersicum]
Length=1171

 Score = 57.0 bits (136),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRKT   HLY  LK +G+  F+DD+RL
Sbjct  20   DVFLSFRGEDTRKTFTGHLYEGLKNRGIFTFQDDKRL  56



>ref|XP_008227045.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=1361

 Score = 57.0 bits (136),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTR +  DHLYH L  KG+  F+D+E+L
Sbjct  58   DVFLSFRGEDTRNSFTDHLYHGLDLKGIDTFRDEEKL  94



>ref|XP_010243120.1| PREDICTED: TMV resistance protein N-like [Nelumbo nucifera]
Length=1134

 Score = 56.6 bits (135),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRK   DHLY  L Q+G++ F+DDE L
Sbjct  18   DVFLSFRGEDTRKNFTDHLYTALVQRGINTFRDDEAL  54



>ref|XP_008237565.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=1181

 Score = 56.6 bits (135),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTR + V HLYH L+ +G+  FKDD +L
Sbjct  25   DVFLSFRGEDTRNSFVSHLYHELQLRGIKTFKDDPKL  61



>ref|XP_006367168.1| PREDICTED: TMV resistance protein N-like [Solanum tuberosum]
Length=165

 Score = 53.9 bits (128),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            +VFLSFRGEDTRKT   HLY  LK +G+  F+DD+RL
Sbjct  22   NVFLSFRGEDTRKTFTGHLYEGLKNRGIFTFQDDKRL  58



>ref|XP_008237860.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=1225

 Score = 56.6 bits (135),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTR + V HLYH L+ +G+  FKDD +L
Sbjct  25   DVFLSFRGEDTRNSFVSHLYHELQLRGIKTFKDDPKL  61



>ref|XP_006361823.1| PREDICTED: TMV resistance protein N-like [Solanum tuberosum]
Length=210

 Score = 54.3 bits (129),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  5    VFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            VFLSFRGEDTRKT  DHLY  L Q G++ F+DDE L
Sbjct  25   VFLSFRGEDTRKTFTDHLYSNLVQAGVNTFRDDEEL  60



>ref|XP_007221062.1| hypothetical protein PRUPE_ppa016235mg [Prunus persica]
 gb|EMJ22261.1| hypothetical protein PRUPE_ppa016235mg [Prunus persica]
Length=237

 Score = 54.7 bits (130),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDE  106
            DVFLS+RGEDTRKT +DHLY  L ++G+H F DDE
Sbjct  34   DVFLSYRGEDTRKTFIDHLYTALDRQGIHTFIDDE  68



>ref|XP_010041311.1| PREDICTED: toll/interleukin-1 receptor-like protein [Eucalyptus 
grandis]
Length=220

 Score = 54.3 bits (129),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            +VFLSFRG DTR    DHLYH L + G+H F+DD+ L
Sbjct  71   EVFLSFRGPDTRHGFTDHLYHGLLRAGIHTFRDDDEL  107



>ref|XP_004309895.1| PREDICTED: TMV resistance protein N-like [Fragaria vesca subsp. 
vesca]
Length=1320

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            D+FLSFRGEDT K+  DHLY  L Q+G+ AF+DDE L
Sbjct  21   DIFLSFRGEDTHKSFTDHLYAALDQEGIFAFRDDEEL  57



>ref|XP_010665341.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
 ref|XP_010665342.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
 ref|XP_010665343.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
 ref|XP_010665344.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
 ref|XP_010665346.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
Length=1630

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRG+DTRK   DHLY  L  +G+H F+DDE L
Sbjct  20   DVFLSFRGDDTRKNFTDHLYTSLVTRGIHTFRDDEEL  56



>ref|XP_006342679.1| PREDICTED: TMV resistance protein N-like, partial [Solanum tuberosum]
Length=1028

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTR+  V HLY+ L+ +G+  FKDDERL
Sbjct  13   DVFLSFRGEDTRRNFVSHLYNSLELRGIRTFKDDERL  49



>ref|XP_007199069.1| hypothetical protein PRUPE_ppa018765mg, partial [Prunus persica]
 gb|EMJ00268.1| hypothetical protein PRUPE_ppa018765mg, partial [Prunus persica]
Length=1192

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTR + V HLYH L+ +G+  FKDD +L
Sbjct  25   DVFLSFRGEDTRHSFVSHLYHELQLRGIKTFKDDPKL  61



>ref|XP_006370864.1| hypothetical protein POPTR_0019s01170g [Populus trichocarpa]
 gb|ERP48661.1| hypothetical protein POPTR_0019s01170g [Populus trichocarpa]
Length=1058

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRKT  DHLY  L Q G+ AF+DD+ L
Sbjct  53   DVFLSFRGEDTRKTFTDHLYAALDQAGIRAFRDDDEL  89



>ref|XP_002264704.2| PREDICTED: TMV resistance protein N [Vitis vinifera]
Length=1254

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTR T  DHLY  L   G+H F+DDE L
Sbjct  23   DVFLSFRGEDTRSTFTDHLYSALVSNGIHTFRDDEEL  59



>ref|XP_008347087.1| PREDICTED: toll/interleukin-1 receptor-like protein [Malus domestica]
Length=128

 Score = 53.5 bits (127),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRKT  DHLY  LK  G   F+DD+ L
Sbjct  23   DVFLSFRGEDTRKTFTDHLYTALKSAGYRTFRDDDEL  59



>ref|XP_010242716.1| PREDICTED: TMV resistance protein N-like isoform X2 [Nelumbo 
nucifera]
Length=1246

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRK   DHLY  L + G++ F+DDE L
Sbjct  11   DVFLSFRGEDTRKNFTDHLYTALDRAGIYTFRDDEEL  47



>ref|XP_010242715.1| PREDICTED: TMV resistance protein N-like isoform X1 [Nelumbo 
nucifera]
Length=1247

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRK   DHLY  L + G++ F+DDE L
Sbjct  11   DVFLSFRGEDTRKNFTDHLYTALDRAGIYTFRDDEEL  47



>gb|KCW60775.1| hypothetical protein EUGRSUZ_H03503 [Eucalyptus grandis]
Length=141

 Score = 53.5 bits (127),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRG DTR  IV HLY  L Q+G++ FKDDE++
Sbjct  12   DVFLSFRGPDTRLGIVSHLYKDLDQRGIYTFKDDEKI  48



>ref|XP_007199473.1| hypothetical protein PRUPE_ppa027155mg [Prunus persica]
 gb|EMJ00672.1| hypothetical protein PRUPE_ppa027155mg [Prunus persica]
Length=1011

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTR + V HLYH L+ +G+  FKDD +L
Sbjct  25   DVFLSFRGEDTRNSFVSHLYHELQLRGIKTFKDDPKL  61



>gb|AAL07537.1| resistance gene analog NBS2 [Helianthus annuus]
Length=226

 Score = 54.3 bits (129),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            +VFLSFRGEDTR+  VDHLY  L Q+G+  +KDDE L
Sbjct  38   EVFLSFRGEDTRRNFVDHLYKDLAQQGIQTYKDDETL  74



>ref|XP_006342676.1| PREDICTED: TMV resistance protein N-like [Solanum tuberosum]
Length=160

 Score = 53.5 bits (127),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            D FLSFRGEDTRKT V HLY+ L Q  +  FKDDERL
Sbjct  13   DAFLSFRGEDTRKTFVSHLYNALIQGRIDVFKDDERL  49



>ref|XP_010312685.1| PREDICTED: TMV resistance protein N-like isoform X3 [Solanum 
lycopersicum]
Length=1069

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRKT   HLY  LK +G+  F+DD+RL
Sbjct  20   DVFLSFRGEDTRKTFTGHLYEGLKNRGIFTFQDDKRL  56



>emb|CAN63551.1| hypothetical protein VITISV_032106 [Vitis vinifera]
Length=924

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRK+  DHLY  L +  +H F+DDE L
Sbjct  22   DVFLSFRGEDTRKSFTDHLYSALIRNNIHTFRDDEEL  58



>ref|XP_010312683.1| PREDICTED: TMV resistance protein N-like isoform X2 [Solanum 
lycopersicum]
Length=1142

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRKT   HLY  LK +G+  F+DD+RL
Sbjct  20   DVFLSFRGEDTRKTFTGHLYEGLKNRGIFTFQDDKRL  56



>ref|XP_011013489.1| PREDICTED: TMV resistance protein N-like isoform X3 [Populus 
euphratica]
Length=1118

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGED RKT  DHLY  L Q G+H F+DD+ L
Sbjct  16   DVFLSFRGEDNRKTFTDHLYTALVQAGIHTFRDDDAL  52



>ref|XP_010039703.1| PREDICTED: toll/interleukin-1 receptor-like protein [Eucalyptus 
grandis]
Length=298

 Score = 55.1 bits (131),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 23/37 (62%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            +VFLSFRG DTR    DHLYH L   G+HAF+DD+ L
Sbjct  63   EVFLSFRGPDTRHNFTDHLYHGLLNAGIHAFRDDDEL  99



>ref|XP_007199154.1| hypothetical protein PRUPE_ppa019668mg, partial [Prunus persica]
 gb|EMJ00353.1| hypothetical protein PRUPE_ppa019668mg, partial [Prunus persica]
Length=122

 Score = 53.1 bits (126),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTR + V HLYH L+ +G+  FKDD +L
Sbjct  25   DVFLSFRGEDTRLSFVSHLYHELQLRGIKTFKDDPKL  61



>ref|XP_010050357.1| PREDICTED: toll/interleukin-1 receptor-like protein [Eucalyptus 
grandis]
Length=136

 Score = 53.1 bits (126),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 28/40 (70%), Gaps = 4/40 (10%)
 Frame = +2

Query  5    VFLSFRGEDTRKTIVDHLYHWLKQKGLH----AFKDDERL  112
            VFLSFRG DTRK  VDHLYH L + GLH     F+DDE L
Sbjct  32   VFLSFRGPDTRKGFVDHLYHELVRVGLHLPNFVFRDDENL  71



>ref|XP_006342554.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Solanum tuberosum]
Length=706

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  5    VFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            VFLSFRG DTR+  V HLY+ L+Q+G+  FKDDERL
Sbjct  14   VFLSFRGIDTRRNFVSHLYNALEQRGIDVFKDDERL  49



>ref|XP_011012882.1| PREDICTED: TMV resistance protein N-like [Populus euphratica]
Length=1103

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRK   DHLY  L+  G+H F+DD  L
Sbjct  20   DVFLSFRGEDTRKNFTDHLYTALQNAGIHTFRDDNEL  56



>ref|XP_008237473.1| PREDICTED: TMV resistance protein N-like isoform X1 [Prunus mume]
Length=1266

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRG DTR + V HLYH L+ KG+  FKDD +L
Sbjct  26   DVFLSFRGVDTRNSFVSHLYHELQHKGIKTFKDDPKL  62



>dbj|BAB09118.1| unnamed protein product [Arabidopsis thaliana]
Length=1031

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTR +IV HLY  L  +G+  FKDD+RL
Sbjct  13   DVFLSFRGEDTRHSIVSHLYEALTSRGIATFKDDKRL  49



>ref|XP_010312671.1| PREDICTED: uncharacterized protein LOC101265700 [Solanum lycopersicum]
Length=2880

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2     DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
             DVFLSFRGEDTR+T + HLY  LK +G+  F+ DERL
Sbjct  1139  DVFLSFRGEDTRRTFMSHLYQGLKNRGIFTFQGDERL  1175



>ref|XP_008237474.1| PREDICTED: TMV resistance protein N-like isoform X2 [Prunus mume]
Length=1238

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRG DTR + V HLYH L+ KG+  FKDD +L
Sbjct  26   DVFLSFRGVDTRNSFVSHLYHELQHKGIKTFKDDPKL  62



>gb|AEI27416.1| TIR_3 [Helianthus annuus]
Length=1111

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            +VFLSFRGEDTRK  VDHLY  L Q+G+H +KDD+ L
Sbjct  78   EVFLSFRGEDTRKNFVDHLYKDLVQQGIHTYKDDQTL  114



>ref|XP_006478464.1| PREDICTED: TMV resistance protein N-like [Citrus sinensis]
Length=1442

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            D FLSFRGEDTRK+   HLY  LK KG++AF+DD+ L
Sbjct  15   DAFLSFRGEDTRKSFTGHLYTALKNKGIYAFRDDKEL  51



>ref|XP_006367967.1| PREDICTED: TMV resistance protein N-like, partial [Solanum tuberosum]
Length=542

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRKT   HLY  LK +G+  F+DD+RL
Sbjct  20   DVFLSFRGEDTRKTFTSHLYEGLKNRGIFTFQDDKRL  56



>ref|XP_007201607.1| hypothetical protein PRUPE_ppa019628mg [Prunus persica]
 gb|EMJ02806.1| hypothetical protein PRUPE_ppa019628mg [Prunus persica]
Length=1142

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTR + V HLYH L+ +G+  FKDD +L
Sbjct  24   DVFLSFRGEDTRNSFVSHLYHELQLRGIKTFKDDPKL  60



>ref|XP_010242717.1| PREDICTED: TMV resistance protein N-like isoform X3 [Nelumbo 
nucifera]
Length=1069

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRK   DHLY  L + G++ F+DDE L
Sbjct  11   DVFLSFRGEDTRKNFTDHLYTALDRAGIYTFRDDEEL  47



>emb|CDP04904.1| unnamed protein product [Coffea canephora]
Length=1201

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGED RK  VD LY  L+QK ++ FKDDE+L
Sbjct  29   DVFLSFRGEDVRKNFVDFLYSSLQQKEIYTFKDDEKL  65



>ref|XP_010048012.1| PREDICTED: TMV resistance protein N-like [Eucalyptus grandis]
Length=852

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRK   DHLYH L   G H F+D+E L
Sbjct  104  DVFLSFRGEDTRKDFTDHLYHSLLSAGFHTFRDNEAL  140



>ref|XP_006389335.1| hypothetical protein POPTR_0030s00570g, partial [Populus trichocarpa]
 gb|ERP48249.1| hypothetical protein POPTR_0030s00570g, partial [Populus trichocarpa]
Length=1016

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRK   DHLY  L+  G+H F+DD  L
Sbjct  20   DVFLSFRGEDTRKNFTDHLYTALQNAGIHTFRDDNEL  56



>ref|NP_199688.1| TIR-NBS-LRR class disease resistance protein [Arabidopsis thaliana]
 dbj|BAB09430.1| disease resistance protein [Arabidopsis thaliana]
 gb|AED95722.1| TIR-NBS-LRR class disease resistance protein [Arabidopsis thaliana]
Length=1190

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTR+TIV HLY  L  KG+  FKDD+ L
Sbjct  15   DVFLSFRGEDTRRTIVSHLYAALGAKGIITFKDDQDL  51



>ref|XP_010665295.1| PREDICTED: toll/interleukin-1 receptor-like protein [Vitis vinifera]
Length=136

 Score = 52.8 bits (125),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTR    DHLY  L  +G+H F+DDE L
Sbjct  14   DVFLSFRGEDTRFNFTDHLYSALTSRGIHTFRDDEGL  50



>ref|NP_198826.1| TIR-NBS-LRR class disease resistance protein [Arabidopsis thaliana]
 gb|AED94510.1| TIR-NBS-LRR class disease resistance protein [Arabidopsis thaliana]
Length=1017

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTR +IV HLY  L  +G+  FKDD+RL
Sbjct  13   DVFLSFRGEDTRHSIVSHLYEALTSRGIATFKDDKRL  49



>gb|AAO38222.1| RCa11 [Manihot esculenta]
Length=98

 Score = 52.4 bits (124),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            +VFLSFRG+DTRK+  DHLY  L QKG+  F+DD  L
Sbjct  1    EVFLSFRGQDTRKSFTDHLYASLNQKGIIVFRDDPSL  37



>ref|XP_007199428.1| hypothetical protein PRUPE_ppa026529mg, partial [Prunus persica]
 gb|EMJ00627.1| hypothetical protein PRUPE_ppa026529mg, partial [Prunus persica]
Length=1102

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTR + V HLYH L+ +G+  FKDD +L
Sbjct  18   DVFLSFRGEDTRLSFVSHLYHELQLRGIKTFKDDPKL  54



>ref|XP_004289198.1| PREDICTED: TMV resistance protein N-like [Fragaria vesca subsp. 
vesca]
Length=564

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTR    DHLY+   QKG++AF+D E+L
Sbjct  28   DVFLSFRGEDTRNNFTDHLYYAFNQKGINAFRDTEKL  64



>ref|XP_010060724.1| PREDICTED: TMV resistance protein N-like [Eucalyptus grandis]
Length=1194

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDE  106
            DVFLSFRGEDTRK  VDHL+  L++KG+ AFKDD+
Sbjct  17   DVFLSFRGEDTRKNFVDHLHDALRRKGIVAFKDDD  51



>gb|ABB82025.1| TIR-NBS disease resistance-like protein [Populus trichocarpa]
Length=735

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRKT  DHLY  L Q G+ AF+DD+ L
Sbjct  53   DVFLSFRGEDTRKTFTDHLYSALVQAGIRAFRDDDDL  89



>ref|XP_010056815.1| PREDICTED: TMV resistance protein N-like [Eucalyptus grandis]
Length=1075

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  5    VFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            VFLSFRG D RK+ V HLY  LKQKG+H F+D+E L
Sbjct  13   VFLSFRGADLRKSFVSHLYQALKQKGIHTFRDNEEL  48



>ref|XP_002276075.2| PREDICTED: TMV resistance protein N-like isoform X1 [Vitis vinifera]
 ref|XP_010645910.1| PREDICTED: TMV resistance protein N-like isoform X1 [Vitis vinifera]
 ref|XP_010645911.1| PREDICTED: TMV resistance protein N-like isoform X1 [Vitis vinifera]
Length=1154

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTR     HLYH L QKG++ F DD++L
Sbjct  16   DVFLSFRGEDTRNNFTAHLYHALCQKGINTFIDDDKL  52



>ref|XP_006342678.1| PREDICTED: uncharacterized protein LOC102595828 [Solanum tuberosum]
Length=766

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTR+  V HLY+ L+ +G+  FKDDERL
Sbjct  13   DVFLSFRGEDTRRNFVSHLYNSLELRGIRTFKDDERL  49



>ref|XP_011005281.1| PREDICTED: LOW QUALITY PROTEIN: TMV resistance protein N-like 
[Populus euphratica]
Length=1609

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRKT  DHLY  L + G+H F++D+ L
Sbjct  301  DVFLSFRGEDTRKTFTDHLYTALVKAGIHTFREDDEL  337



>sp|Q40392.1|TMVRN_NICGU RecName: Full=TMV resistance protein N [Nicotiana glutinosa]
 gb|AAA50763.1| N [Nicotiana glutinosa]
Length=1144

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRKT   HLY  L  KG+  F+DD+RL
Sbjct  13   DVFLSFRGEDTRKTFTSHLYEVLNDKGIKTFQDDKRL  49



>gb|AAL07544.1| resistance gene analog NBS9 [Helianthus annuus]
Length=304

 Score = 54.7 bits (130),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            +VFLSFRGEDTRK  VDHLY  L Q+G+  +KDDE L
Sbjct  47   EVFLSFRGEDTRKNFVDHLYKDLVQQGIQTYKDDETL  83



>ref|XP_006367016.1| PREDICTED: TMV resistance protein N-like [Solanum tuberosum]
Length=532

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            +VFLSFRGEDTR+T V HL+  L+Q G+  FKDDERL
Sbjct  13   NVFLSFRGEDTRRTFVSHLHKALEQSGIRIFKDDERL  49


 Score = 45.4 bits (106),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +2

Query  11   LSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            +  RGEDTR+T V HL+  L+Q G+  FKDDERL
Sbjct  128  IGVRGEDTRRTFVSHLHKALEQSGIRIFKDDERL  161



>ref|XP_002870725.1| hypothetical protein ARALYDRAFT_916254 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46984.1| hypothetical protein ARALYDRAFT_916254 [Arabidopsis lyrata subsp. 
lyrata]
Length=984

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTR +IV HLY  L  +G+  FKDD+RL
Sbjct  13   DVFLSFRGEDTRHSIVSHLYEALTSRGIATFKDDKRL  49



>gb|AEE43928.1| TIR-NBS-LRR resistance protein muRdr1D [Rosa multiflora]
Length=1156

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/37 (62%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRK   D+LYH L+++G+  F+DD +L
Sbjct  20   DVFLSFRGEDTRKGFTDYLYHELERQGIRTFRDDPQL  56



>ref|XP_008361342.1| PREDICTED: TMV resistance protein N-like isoform X2 [Malus domestica]
Length=1232

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTR+   DHLY  L +KG+  F+DDE L
Sbjct  22   DVFLSFRGEDTRRNFSDHLYAALNRKGIFTFRDDEEL  58



>ref|XP_002325743.2| hypothetical protein POPTR_0019s00880g, partial [Populus trichocarpa]
 gb|EEF00125.2| hypothetical protein POPTR_0019s00880g, partial [Populus trichocarpa]
Length=163

 Score = 52.8 bits (125),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRG+DTRK   DHLY  L Q G+H F+DD  L
Sbjct  6    DVFLSFRGKDTRKNFTDHLYTALIQAGIHTFRDDNEL  42



>gb|AFP55552.1| TIR-NBS-LRR [Rosa rugosa]
Length=1144

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/37 (62%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRK   D+LYH L+++G+  F+DD +L
Sbjct  20   DVFLSFRGEDTRKGFTDYLYHELERQGIRTFRDDPQL  56



>gb|AAL07539.1| resistance gene analog NBS4 [Helianthus annuus]
Length=279

 Score = 54.3 bits (129),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTR + VDHLY  L Q+G+  +KDDE L
Sbjct  23   DVFLSFRGEDTRNSFVDHLYVALAQQGILTYKDDETL  59



>ref|XP_010050156.1| PREDICTED: TMV resistance protein N-like [Eucalyptus grandis]
Length=203

 Score = 53.1 bits (126),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/37 (62%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            +VFLSFRG D RK   DHLYH L   G+HAF+DD+ L
Sbjct  43   EVFLSFRGLDIRKGFADHLYHGLLDDGIHAFRDDDEL  79



>ref|XP_008361338.1| PREDICTED: TMV resistance protein N-like isoform X1 [Malus domestica]
Length=1647

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTR+   DHLY  L +KG+  F+DDE L
Sbjct  22   DVFLSFRGEDTRRNFSDHLYAALNRKGIFTFRDDEEL  58



>ref|XP_011015315.1| PREDICTED: TMV resistance protein N-like [Populus euphratica]
Length=1140

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRG+DTRK   DHLY  L Q G+H F+DD  L
Sbjct  24   DVFLSFRGKDTRKNFTDHLYTALIQAGIHTFRDDNEL  60



>ref|XP_008391553.1| PREDICTED: uncharacterized protein LOC103453763 [Malus domestica]
Length=1588

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTR+  VDHLY  LK++GL AF+DD  L
Sbjct  568  DVFLSFRGEDTRENFVDHLYAALKKEGLLAFRDDNEL  604


 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRG DTRK  VDH+Y  L+++G   F+D + L
Sbjct  23   DVFLSFRGGDTRKNFVDHVYAALEKEGFLIFRDGDEL  59



>ref|XP_011015316.1| PREDICTED: TMV resistance protein N-like, partial [Populus euphratica]
Length=173

 Score = 52.8 bits (125),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRG+DTRK   DHLY  L Q G+H F+DD  L
Sbjct  24   DVFLSFRGKDTRKNFTDHLYTALIQAGIHTFRDDNEL  60



>ref|XP_006353757.1| PREDICTED: TMV resistance protein N-like [Solanum tuberosum]
Length=1218

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            +VFLSFRGEDTRKTI+ +LY  L +KG+ AF+DD+RL
Sbjct  18   NVFLSFRGEDTRKTIIGYLYERLTRKGIIAFQDDKRL  54



>ref|XP_002325273.2| hypothetical protein POPTR_0019s01200g [Populus trichocarpa]
 gb|EEE99654.2| hypothetical protein POPTR_0019s01200g [Populus trichocarpa]
Length=766

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRKT  DHLY  L Q G+ AF+DD+ L
Sbjct  53   DVFLSFRGEDTRKTFTDHLYTALVQAGIRAFRDDDDL  89



>ref|XP_010436827.1| PREDICTED: putative disease resistance protein At4g11170 [Camelina 
sativa]
Length=774

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTR +IV HLY  L  +G+  FKDD+RL
Sbjct  13   DVFLSFRGEDTRHSIVSHLYAALASRGIATFKDDKRL  49



>emb|CAN72303.1| hypothetical protein VITISV_009715 [Vitis vinifera]
Length=1135

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTR     HLYH L QKG++ F DD++L
Sbjct  17   DVFLSFRGEDTRNNFTAHLYHALCQKGINTFIDDDKL  53



>dbj|BAD12594.1| N protein [Nicotiana tabacum]
Length=1128

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRKT   HLY  L  KG+  F+DD+RL
Sbjct  5    DVFLSFRGEDTRKTFTSHLYEVLNDKGIKTFQDDKRL  41



>ref|XP_006283059.1| hypothetical protein CARUB_v10004053mg [Capsella rubella]
 gb|EOA15957.1| hypothetical protein CARUB_v10004053mg [Capsella rubella]
Length=1024

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTR++IV HLY  L  +G+  FKDD RL
Sbjct  15   DVFLSFRGEDTRRSIVSHLYAALVSRGIITFKDDNRL  51



>ref|XP_010450686.1| PREDICTED: TMV resistance protein N-like isoform X2 [Camelina 
sativa]
Length=998

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTR +IV HLY  L  +G+  FKDD+RL
Sbjct  13   DVFLSFRGEDTRHSIVSHLYAALASRGIATFKDDKRL  49



>ref|XP_007198927.1| hypothetical protein PRUPE_ppa000477mg [Prunus persica]
 gb|EMJ00126.1| hypothetical protein PRUPE_ppa000477mg [Prunus persica]
Length=1140

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/37 (62%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLS+RGEDTRK   DHLY  L+Q G H F+DD+ +
Sbjct  20   DVFLSYRGEDTRKGFTDHLYRALEQAGFHTFRDDDEI  56



>ref|XP_010450684.1| PREDICTED: TMV resistance protein N-like isoform X1 [Camelina 
sativa]
 ref|XP_010450685.1| PREDICTED: TMV resistance protein N-like isoform X1 [Camelina 
sativa]
Length=1024

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTR +IV HLY  L  +G+  FKDD+RL
Sbjct  13   DVFLSFRGEDTRHSIVSHLYAALASRGIATFKDDKRL  49



>ref|XP_010245559.1| PREDICTED: uncharacterized protein LOC104589071 [Nelumbo nucifera]
Length=2320

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  2     DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
             DVFLSFRGEDTRK   DHLY  L Q+G++ F DDE L
Sbjct  1171  DVFLSFRGEDTRKNFTDHLYTALGQRGINTFIDDEEL  1207


 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/37 (62%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRK   DHL+  L Q+G++ F+DD+ L
Sbjct  11   DVFLSFRGEDTRKNFTDHLHTALVQRGINTFRDDKEL  47



>gb|AFP55548.1| TIR-NBS-LRR [Rosa rugosa]
Length=1115

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 23/37 (62%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRK   D+LYH L+++G+  F+DD +L
Sbjct  20   DVFLSFRGEDTRKGFTDYLYHELQRRGIRTFRDDPQL  56



>gb|ABB82024.1| TIR-NBS disease resistance-like protein [Populus trichocarpa]
Length=1078

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRKT  DHLY  L Q G+ AF+DD+ L
Sbjct  53   DVFLSFRGEDTRKTFTDHLYTALVQAGIRAFRDDDDL  89



>ref|XP_008237864.1| PREDICTED: TMV resistance protein N-like, partial [Prunus mume]
Length=1182

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTR + V HLYH L+ +G+  FKDD +L
Sbjct  25   DVFLSFRGEDTRLSFVSHLYHELQLRGIETFKDDPKL  61



>gb|AAY43787.1| disease resistance protein [(Populus tomentosa x Populus bolleana) 
x Populus tomentosa var. truncata]
Length=428

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRKT  DHLY  L Q G+  F+DD+ L
Sbjct  53   DVFLSFRGEDTRKTFTDHLYTALVQAGIRTFRDDDEL  89



>gb|AEI27415.1| TIR_2 [Helianthus annuus]
Length=1055

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            +VFLSFRGEDTR+  VDHLY  L QKG+  +KDDE L
Sbjct  79   EVFLSFRGEDTRRNFVDHLYKDLVQKGIQTYKDDETL  115



>ref|XP_011047737.1| PREDICTED: LOW QUALITY PROTEIN: TMV resistance protein N-like 
[Populus euphratica]
Length=1507

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRKT  DHLY  L + G+H F++D+ L
Sbjct  199  DVFLSFRGEDTRKTFTDHLYTALVKAGIHTFREDDEL  235



>ref|XP_002316567.2| hypothetical protein POPTR_0011s01664g [Populus trichocarpa]
 gb|EEE97179.2| hypothetical protein POPTR_0011s01664g [Populus trichocarpa]
Length=235

 Score = 53.5 bits (127),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +2

Query  5    VFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            VFLSFRGEDTRK   DHLY  L Q G+H F+DD  +
Sbjct  21   VFLSFRGEDTRKNFTDHLYTALVQAGIHTFRDDNEI  56



>ref|XP_010441159.1| PREDICTED: TMV resistance protein N-like isoform X1 [Camelina 
sativa]
Length=1022

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTR +IV HLY  L  +G+  FKDD+RL
Sbjct  13   DVFLSFRGEDTRHSIVSHLYAALANRGIATFKDDKRL  49



>ref|XP_010450725.1| PREDICTED: putative disease resistance protein At4g11170 isoform 
X1 [Camelina sativa]
Length=723

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTR +IV HLY  L  +G+  FKDD+RL
Sbjct  13   DVFLSFRGEDTRHSIVSHLYAALASRGIATFKDDKRL  49



>ref|XP_010450726.1| PREDICTED: putative disease resistance protein At4g11170 isoform 
X2 [Camelina sativa]
Length=723

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTR +IV HLY  L  +G+  FKDD+RL
Sbjct  13   DVFLSFRGEDTRHSIVSHLYAALASRGIATFKDDKRL  49



>ref|XP_006466584.1| PREDICTED: TMV resistance protein N-like [Citrus sinensis]
Length=1225

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRK+  DHL   LK KG++ F+DD+ L
Sbjct  15   DVFLSFRGEDTRKSFTDHLSAALKNKGIYVFRDDKEL  51



>ref|XP_008237367.1| PREDICTED: TMV resistance protein N [Prunus mume]
Length=951

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTR + V HLYH L+ +G+  FKDD  L
Sbjct  25   DVFLSFRGEDTRNSFVSHLYHELQLRGIKTFKDDREL  61



>ref|XP_010441160.1| PREDICTED: TMV resistance protein N-like isoform X2 [Camelina 
sativa]
Length=995

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTR +IV HLY  L  +G+  FKDD+RL
Sbjct  13   DVFLSFRGEDTRHSIVSHLYAALANRGIATFKDDKRL  49



>ref|XP_003596702.1| TIR-NBS-LRR type disease resistance protein [Medicago truncatula]
Length=747

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVF+SFRG DTR T VDHL+  L  KG+ AFKDD+RL
Sbjct  69   DVFISFRGADTRSTFVDHLHAHLTTKGIFAFKDDKRL  105



>ref|XP_008245719.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
 ref|XP_008245720.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
 ref|XP_008245721.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
 ref|XP_008245722.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=1233

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTR + V HLYH L+ +G+  FKDD  L
Sbjct  26   DVFLSFRGEDTRNSFVSHLYHELQLRGIKTFKDDREL  62



>ref|XP_004136801.1| PREDICTED: TMV resistance protein N-like [Cucumis sativus]
Length=381

 Score = 54.3 bits (129),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRK   DHLY+ LK  G++ F+DD  L
Sbjct  15   DVFLSFRGEDTRKNFTDHLYYALKDAGINVFRDDPEL  51



>ref|XP_010054883.1| PREDICTED: toll/interleukin-1 receptor-like protein [Eucalyptus 
grandis]
Length=157

 Score = 52.4 bits (124),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSF G+DTRKT VDHLY+ L   G+  FKDD  L
Sbjct  58   DVFLSFSGKDTRKTFVDHLYNKLVDAGIRVFKDDNEL  94



>gb|AES66953.2| disease resistance protein (TIR-NBS-LRR class), putative [Medicago 
truncatula]
Length=763

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVF+SFRG DTR T VDHL+  L  KG+ AFKDD+RL
Sbjct  40   DVFISFRGADTRSTFVDHLHAHLTTKGIFAFKDDKRL  76



>ref|XP_011012884.1| PREDICTED: TMV resistance protein N-like [Populus euphratica]
Length=867

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRK   DHLY  L Q G+H F+DD  L
Sbjct  17   DVFLSFRGEDTRKNFTDHLYTALLQAGIHTFRDDNEL  53



>emb|CAN74711.1| hypothetical protein VITISV_009242 [Vitis vinifera]
Length=1354

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRG DTRK   DHLY  L   G+H FKDDE L
Sbjct  20   DVFLSFRGGDTRKNFTDHLYTTLTSYGIHTFKDDEEL  56



>ref|XP_011013492.1| PREDICTED: TMV resistance protein N-like isoform X6 [Populus 
euphratica]
Length=935

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGED RKT  DHLY  L Q G+H F+DD+ L
Sbjct  16   DVFLSFRGEDNRKTFTDHLYTALVQAGIHTFRDDDAL  52



>ref|XP_011013491.1| PREDICTED: TMV resistance protein N-like isoform X5 [Populus 
euphratica]
Length=948

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGED RKT  DHLY  L Q G+H F+DD+ L
Sbjct  16   DVFLSFRGEDNRKTFTDHLYTALVQAGIHTFRDDDAL  52



>ref|XP_006380263.1| hypothetical protein POPTR_0007s00680g [Populus trichocarpa]
 gb|ERP58060.1| hypothetical protein POPTR_0007s00680g [Populus trichocarpa]
Length=377

 Score = 54.3 bits (129),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRKT  DHLY  L Q G+  F+DD+ L
Sbjct  16   DVFLSFRGEDTRKTFTDHLYTALVQAGIQTFRDDDEL  52



>ref|XP_010645912.1| PREDICTED: TMV resistance protein N-like isoform X2 [Vitis vinifera]
Length=889

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTR     HLYH L QKG++ F DD++L
Sbjct  16   DVFLSFRGEDTRNNFTAHLYHALCQKGINTFIDDDKL  52



>ref|XP_008237566.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=786

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTR + V HLYH L+ +G+  FKDD +L
Sbjct  25   DVFLSFRGEDTRLSFVSHLYHELQLRGIKTFKDDPKL  61



>emb|CBI31297.3| unnamed protein product [Vitis vinifera]
Length=667

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRK   DHLY+ L   G+H F+DDE L
Sbjct  13   DVFLSFRGEDTRKNFTDHLYNTLVAYGIHTFRDDEEL  49



>ref|XP_008237764.1| PREDICTED: TMV resistance protein N-like, partial [Prunus mume]
Length=177

 Score = 52.4 bits (124),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDE  106
            DVFLSFRGEDTR T  DHLYH L Q+ +  ++DDE
Sbjct  25   DVFLSFRGEDTRNTFTDHLYHALLQRRVIVYRDDE  59



>gb|KCW67569.1| hypothetical protein EUGRSUZ_F01321, partial [Eucalyptus grandis]
Length=1008

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDD  103
            DVFLSFRGEDTRK  VDHL + L++KG+ AFKDD
Sbjct  11   DVFLSFRGEDTRKNFVDHLNYHLQRKGIVAFKDD  44



>ref|XP_004159649.1| PREDICTED: TMV resistance protein N-like [Cucumis sativus]
Length=380

 Score = 54.3 bits (129),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRK   DHLY+ LK  G++ F+DD  L
Sbjct  15   DVFLSFRGEDTRKNFTDHLYYALKDAGINVFRDDPEL  51



>ref|XP_006441684.1| hypothetical protein CICLE_v10024297mg, partial [Citrus clementina]
 gb|ESR54924.1| hypothetical protein CICLE_v10024297mg, partial [Citrus clementina]
Length=1097

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 23/37 (62%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            D FLSFRGED RK+   HLY  LK KG++AF+DD+ L
Sbjct  15   DAFLSFRGEDARKSFTGHLYTALKNKGIYAFRDDKEL  51



>ref|XP_006380260.1| hypothetical protein POPTR_0007s00620g, partial [Populus trichocarpa]
 gb|ERP58057.1| hypothetical protein POPTR_0007s00620g, partial [Populus trichocarpa]
Length=470

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRKT  DHL+  L Q G+H F+DD+ L
Sbjct  44   DVFLSFRGEDTRKTFTDHLHTALVQAGIHTFQDDDEL  80



>ref|XP_010645938.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
Length=171

 Score = 52.4 bits (124),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 23/37 (62%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRK+  DHLY  L  K +H F+D+E +
Sbjct  29   DVFLSFRGEDTRKSFADHLYTALNGKRIHTFRDEEEI  65



>ref|XP_010665187.1| PREDICTED: TMV resistance protein N-like isoform X2 [Vitis vinifera]
Length=1720

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTR    DHLY  L+  G+H F+DDE L
Sbjct  14   DVFLSFRGEDTRYHFTDHLYSALRDNGVHTFRDDEEL  50



>ref|XP_010665186.1| PREDICTED: TMV resistance protein N-like isoform X1 [Vitis vinifera]
Length=1745

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTR    DHLY  L+  G+H F+DDE L
Sbjct  14   DVFLSFRGEDTRYHFTDHLYSALRDNGVHTFRDDEEL  50



>gb|KCW73676.1| hypothetical protein EUGRSUZ_E02272 [Eucalyptus grandis]
Length=885

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  5    VFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            VFLSFRG D RK+ V HLY  LKQKG+H F+D+E L
Sbjct  13   VFLSFRGADLRKSFVSHLYQALKQKGIHTFRDNEEL  48



>ref|XP_011013488.1| PREDICTED: TMV resistance protein N-like isoform X2 [Populus 
euphratica]
Length=1127

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGED RKT  DHLY  L Q G+H F+DD+ L
Sbjct  16   DVFLSFRGEDNRKTFTDHLYTALVQAGIHTFRDDDAL  52



>ref|XP_003635135.2| PREDICTED: uncharacterized protein LOC100853815 [Vitis vinifera]
Length=2622

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTR     HLYH L QKG++ F DD++L
Sbjct  26   DVFLSFRGEDTRNNFTAHLYHALCQKGIYTFIDDDKL  62


 Score = 45.4 bits (106),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 20/37 (54%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +2

Query  2     DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
             +VFLSFRGEDTR     HLY  L+++G++ F DD  L
Sbjct  1324  EVFLSFRGEDTRHGFTAHLYDALRRRGINTFIDDADL  1360



>ref|XP_010050773.1| PREDICTED: toll/interleukin-1 receptor-like protein [Eucalyptus 
grandis]
Length=198

 Score = 52.4 bits (124),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            +VFLSFRG DTRK   DHLY  L   G+HAFKDD  L
Sbjct  83   EVFLSFRGLDTRKGFTDHLYTRLVDAGIHAFKDDNEL  119



>ref|XP_010050608.1| PREDICTED: toll/interleukin-1 receptor-like protein [Eucalyptus 
grandis]
Length=168

 Score = 52.4 bits (124),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 23/37 (62%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            +VFLSFRG DTRK   DHLY  L ++G+HAF+DD  L
Sbjct  35   EVFLSFRGTDTRKGFTDHLYTNLIKEGIHAFRDDNEL  71



>ref|XP_011013487.1| PREDICTED: TMV resistance protein N-like isoform X1 [Populus 
euphratica]
Length=1128

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGED RKT  DHLY  L Q G+H F+DD+ L
Sbjct  16   DVFLSFRGEDNRKTFTDHLYTALVQAGIHTFRDDDAL  52



>ref|XP_006362754.1| PREDICTED: TMV resistance protein N-like isoform X1 [Solanum 
tuberosum]
Length=1307

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRG+DTRKT   HLY  LK KG+  F+DD+RL
Sbjct  22   DVFLSFRGKDTRKTFTSHLYQGLKYKGILTFQDDKRL  58



>ref|XP_011013490.1| PREDICTED: TMV resistance protein N-like isoform X4 [Populus 
euphratica]
Length=975

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGED RKT  DHLY  L Q G+H F+DD+ L
Sbjct  16   DVFLSFRGEDNRKTFTDHLYTALVQAGIHTFRDDDAL  52



>ref|XP_002325285.2| hypothetical protein POPTR_0019s00890g, partial [Populus trichocarpa]
 gb|EEE99666.2| hypothetical protein POPTR_0019s00890g, partial [Populus trichocarpa]
Length=1051

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  5    VFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            VFLSFRG DTRKT + HLY+ L Q G+H FKDDE L
Sbjct  20   VFLSFRGADTRKTFLGHLYNALVQAGIHTFKDDEEL  55



>ref|XP_011011343.1| PREDICTED: TMV resistance protein N-like [Populus euphratica]
Length=166

 Score = 52.0 bits (123),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +2

Query  5    VFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            VFLSFRGEDTRK   DHLY  L Q G+H F+DD  +
Sbjct  21   VFLSFRGEDTRKNFTDHLYTALVQAGIHTFRDDNEI  56



>ref|XP_011044910.1| PREDICTED: TMV resistance protein N-like [Populus euphratica]
Length=787

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRK   DHLY  L Q G+H F+DD  L
Sbjct  15   DVFLSFRGEDTRKNFTDHLYTALLQAGIHTFRDDNEL  51



>ref|XP_010050192.1| PREDICTED: toll/interleukin-1 receptor-like protein [Eucalyptus 
grandis]
Length=189

 Score = 52.4 bits (124),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            +VFLSFRG DTR    DHLYH L + G+H F+DD+ L
Sbjct  40   EVFLSFRGPDTRHGFTDHLYHGLLKAGIHTFRDDDEL  76



>ref|XP_011044953.1| PREDICTED: TMV resistance protein N-like, partial [Populus euphratica]
Length=542

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRK   DHLY  L Q G+H F+DD  L
Sbjct  15   DVFLSFRGEDTRKNFTDHLYTALLQAGIHTFRDDNEL  51



>emb|CDY36822.1| BnaC04g32150D [Brassica napus]
Length=961

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFL+FRGEDTR +IV HLY  L ++GL  FKDD++L
Sbjct  10   DVFLTFRGEDTRHSIVSHLYAALTRRGLFTFKDDKKL  46



>emb|CBI40962.3| unnamed protein product [Vitis vinifera]
Length=1284

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTR     HLYH L QKG++ F DD++L
Sbjct  26   DVFLSFRGEDTRNNFTAHLYHALCQKGIYTFIDDDKL  62



>ref|XP_004253023.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A8-like [Solanum lycopersicum]
Length=380

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            D FLSFRG D RKT V HLY+ L Q+G++ FKDDERL
Sbjct  13   DAFLSFRGVDIRKTFVSHLYNALVQRGINVFKDDERL  49



>ref|XP_006441871.1| hypothetical protein CICLE_v10024379mg [Citrus clementina]
 gb|ESR55111.1| hypothetical protein CICLE_v10024379mg [Citrus clementina]
Length=1094

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    DVFLSFRGEDTRKTIVDHLYHWLKQKGLHAFKDDERL  112
            DVFLSFRGEDTRK   DHLY  L +KG+  F+DD+ L
Sbjct  20   DVFLSFRGEDTRKNFTDHLYSALDEKGIIVFRDDKEL  56



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 522694794284