BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c1032_g1_i1 len=1415 path=[1:0-608 610:609-1414]

Length=1415
                                                                      Score     E

ref|XP_009595175.1|  PREDICTED: uncharacterized protein At3g28850       443   6e-149   
ref|XP_009799874.1|  PREDICTED: uncharacterized protein At3g28850       440   1e-147   
ref|XP_006341107.1|  PREDICTED: uncharacterized protein At5g39865...    436   3e-146   
ref|XP_004246512.1|  PREDICTED: glutaredoxin domain-containing cy...    426   2e-142   
emb|CDP15428.1|  unnamed protein product                                396   1e-130   
ref|XP_011094322.1|  PREDICTED: uncharacterized protein At3g28850       387   3e-127   
ref|XP_002276568.1|  PREDICTED: uncharacterized protein At5g39865       366   5e-119   Vitis vinifera
ref|XP_007204384.1|  hypothetical protein PRUPE_ppa006757mg             362   2e-117   
ref|XP_004149222.1|  PREDICTED: uncharacterized protein At5g39865...    356   3e-115   
ref|XP_002309426.1|  hypothetical protein POPTR_0006s22920g             354   3e-114   Populus trichocarpa [western balsam poplar]
ref|XP_008442848.1|  PREDICTED: uncharacterized protein At5g39865...    354   3e-114   
ref|XP_008359492.1|  PREDICTED: uncharacterized protein LOC103423198    352   2e-113   
ref|XP_002530319.1|  conserved hypothetical protein                     351   7e-113   Ricinus communis
gb|KGN59140.1|  hypothetical protein Csa_3G776990                       356   1e-112   
ref|XP_004305334.1|  PREDICTED: uncharacterized protein At5g39865...    349   2e-112   
ref|XP_011004237.1|  PREDICTED: uncharacterized protein At3g28850       350   2e-112   
ref|XP_009374710.1|  PREDICTED: uncharacterized protein LOC103963605    348   3e-112   
ref|XP_009336960.1|  PREDICTED: uncharacterized protein At5g39865...    347   8e-112   
ref|XP_006481760.1|  PREDICTED: uncharacterized protein At3g28850...    346   7e-111   
ref|XP_007027759.1|  Glutaredoxin family protein, putative              344   1e-110   
ref|XP_008243566.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    343   3e-110   
ref|XP_010271643.1|  PREDICTED: uncharacterized protein At3g28850       343   8e-110   
ref|XP_011004108.1|  PREDICTED: uncharacterized protein At3g28850...    343   9e-110   
ref|XP_006430185.1|  hypothetical protein CICLE_v10011852mg             342   2e-109   
ref|XP_002323426.2|  hypothetical protein POPTR_0016s08030g             342   3e-109   Populus trichocarpa [western balsam poplar]
ref|XP_008391818.1|  PREDICTED: uncharacterized protein At3g28850       330   3e-105   
ref|XP_009366685.1|  PREDICTED: uncharacterized protein LOC103956429    330   4e-105   
ref|XP_009337073.1|  PREDICTED: uncharacterized protein LOC103929576    329   2e-104   
ref|XP_010059772.1|  PREDICTED: uncharacterized protein At3g28850       314   3e-98    
ref|XP_007162909.1|  hypothetical protein PHAVU_001G190600g             311   8e-98    
ref|XP_003554438.1|  PREDICTED: uncharacterized protein At5g39865...    310   4e-97    
ref|XP_010101552.1|  Uncharacterized protein L484_015376                310   5e-97    
ref|NP_001241249.1|  uncharacterized protein LOC100781497               309   1e-96    
gb|KHN18777.1|  Hypothetical protein glysoja_021528                     308   2e-96    
gb|EYU35503.1|  hypothetical protein MIMGU_mgv1a021418mg                301   2e-93    
ref|XP_008442849.1|  PREDICTED: uncharacterized protein LOC103486...    293   4e-91    
gb|EPS64090.1|  hypothetical protein M569_10691                         288   9e-89    
ref|XP_010931132.1|  PREDICTED: uncharacterized protein At5g39865       288   1e-88    
ref|XP_004494189.1|  PREDICTED: uncharacterized protein At5g39865...    287   3e-88    
ref|XP_010683720.1|  PREDICTED: uncharacterized protein LOC104898354    286   2e-87    
emb|CBI30303.3|  unnamed protein product                                278   7e-86    
ref|XP_010558221.1|  PREDICTED: uncharacterized protein At3g28850...    279   3e-85    
gb|AFK41682.1|  unknown                                                 279   3e-85    
ref|XP_008787707.1|  PREDICTED: uncharacterized protein At5g39865...    279   3e-85    
ref|XP_009404359.1|  PREDICTED: uncharacterized protein At3g28850...    276   4e-84    
ref|XP_003625833.1|  hypothetical protein MTR_7g104720                  276   5e-84    
ref|XP_009390033.1|  PREDICTED: uncharacterized protein LOC103976524    274   2e-83    
gb|KDO70436.1|  hypothetical protein CISIN_1g038258mg                   272   7e-83    
ref|XP_006855070.1|  hypothetical protein AMTR_s00031p00132350          271   2e-82    
ref|XP_008784233.1|  PREDICTED: uncharacterized protein LOC103703228    271   5e-82    
ref|XP_002873121.1|  glutaredoxin family protein                        266   3e-80    
ref|XP_010912300.1|  PREDICTED: uncharacterized protein LOC105038254    265   1e-79    
ref|XP_006287909.1|  hypothetical protein CARUB_v10001143mg             259   1e-77    
ref|XP_009416033.1|  PREDICTED: uncharacterized protein At3g28850...    259   3e-77    
gb|ABY79171.1|  At5g03870-like protein                                  257   4e-77    Arabidopsis lyrata [lyrate rockcress]
ref|NP_196007.1|  Glutaredoxin family protein                           257   8e-77    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006398847.1|  hypothetical protein EUTSA_v10013788mg             256   1e-76    
ref|XP_009404925.1|  PREDICTED: uncharacterized protein At5g39865...    254   1e-75    
ref|XP_010452282.1|  PREDICTED: uncharacterized protein At3g28850...    248   2e-73    
gb|ABY79163.1|  At5g03870                                               247   2e-73    Arabidopsis thaliana [mouse-ear cress]
gb|ABY79158.1|  At5g03870                                               247   3e-73    Arabidopsis thaliana [mouse-ear cress]
gb|ABY79168.1|  At5g03870                                               247   3e-73    Arabidopsis thaliana [mouse-ear cress]
gb|ABY79165.1|  At5g03870                                               247   3e-73    Arabidopsis thaliana [mouse-ear cress]
gb|ABY79157.1|  At5g03870                                               245   2e-72    Arabidopsis thaliana [mouse-ear cress]
gb|KFK24849.1|  hypothetical protein AALP_AA8G032500                    244   4e-72    
ref|XP_010423654.1|  PREDICTED: uncharacterized protein At3g28850...    244   8e-72    
emb|CDP20406.1|  unnamed protein product                                236   2e-71    
ref|XP_010543494.1|  PREDICTED: uncharacterized protein At3g28850...    238   1e-69    
ref|XP_010490880.1|  PREDICTED: uncharacterized protein At3g28850...    238   1e-69    
ref|XP_009130788.1|  PREDICTED: uncharacterized protein At3g28850...    237   2e-69    
gb|KDP42502.1|  hypothetical protein JCGZ_00299                         229   5e-67    
ref|XP_009125525.1|  PREDICTED: uncharacterized protein At5g39865       228   4e-66    
emb|CDY04902.1|  BnaAnng00840D                                          223   2e-64    
gb|ABK25245.1|  unknown                                                 208   1e-57    Picea sitchensis
dbj|BAK03966.1|  predicted protein                                      200   5e-55    
ref|XP_002446415.1|  hypothetical protein SORBIDRAFT_06g015610          192   1e-51    Sorghum bicolor [broomcorn]
ref|NP_001136499.1|  hypothetical protein                               191   3e-51    Zea mays [maize]
ref|XP_006840647.1|  hypothetical protein AMTR_s00084p00178510          186   9e-51    
ref|XP_004975565.1|  PREDICTED: uncharacterized protein LOC101764798    186   1e-49    
ref|XP_006653372.1|  PREDICTED: uncharacterized protein At3g28850...    181   5e-49    
ref|NP_001052743.1|  Os04g0412800                                       183   2e-48    Oryza sativa Japonica Group [Japonica rice]
emb|CAH67358.1|  OSIGBa0134P10.4                                        183   3e-48    Oryza sativa [red rice]
ref|XP_011076870.1|  PREDICTED: uncharacterized protein At3g28850...    179   1e-47    
gb|ABK24666.1|  unknown                                                 182   1e-47    Picea sitchensis
ref|XP_010247808.1|  PREDICTED: uncharacterized protein LOC104590759    178   6e-47    
ref|XP_010090481.1|  Uncharacterized protein L484_012588                175   6e-46    
emb|CDO99947.1|  unnamed protein product                                173   2e-45    
gb|KDP27126.1|  hypothetical protein JCGZ_22035                         173   2e-45    
ref|XP_009761751.1|  PREDICTED: uncharacterized protein At5g39865...    173   3e-45    
ref|XP_009593837.1|  PREDICTED: uncharacterized protein At3g28850...    172   6e-45    
ref|XP_001784015.1|  predicted protein                                  166   6e-45    
ref|XP_006365670.1|  PREDICTED: uncharacterized protein LOC102605059    170   2e-44    
ref|XP_002993417.1|  hypothetical protein SELMODRAFT_137093             164   2e-44    
ref|XP_007039368.1|  Glutaredoxin family protein, putative              170   2e-44    
ref|XP_006388532.1|  hypothetical protein POPTR_0162s00230g             170   3e-44    
ref|XP_002982129.1|  hypothetical protein SELMODRAFT_116000             164   3e-44    
ref|XP_011033122.1|  PREDICTED: uncharacterized protein LOC105131711    170   4e-44    
ref|XP_008804469.1|  PREDICTED: uncharacterized protein At3g28850...    171   4e-44    
emb|CBI39127.3|  unnamed protein product                                164   5e-44    
ref|XP_010653249.1|  PREDICTED: uncharacterized protein At5g39865       167   6e-44    
ref|XP_002311930.2|  glutaredoxin family protein                        168   2e-43    Populus trichocarpa [western balsam poplar]
gb|EYU19855.1|  hypothetical protein MIMGU_mgv1a009488mg                166   3e-43    
ref|XP_010263058.1|  PREDICTED: uncharacterized protein LOC104601435    168   3e-43    
ref|XP_006430041.1|  hypothetical protein CICLE_v10012922mg             161   3e-43    
ref|XP_010100213.1|  Uncharacterized protein L484_015360                164   6e-43    
ref|XP_004249936.1|  PREDICTED: uncharacterized protein LOC101258323    166   7e-43    
gb|KGN46056.1|  hypothetical protein Csa_6G046340                       164   1e-42    
ref|XP_002316474.2|  hypothetical protein POPTR_0010s24990g             166   1e-42    Populus trichocarpa [western balsam poplar]
emb|CDY14169.1|  BnaC02g02860D                                          162   1e-42    
ref|XP_004140915.1|  PREDICTED: uncharacterized protein LOC101211414    164   1e-42    
ref|XP_007010494.1|  Glutaredoxin family protein, putative              165   2e-42    
ref|XP_006481620.1|  PREDICTED: uncharacterized protein At3g28850...    162   2e-42    
ref|XP_002514463.1|  electron transporter, putative                     165   5e-42    Ricinus communis
gb|KDP25281.1|  hypothetical protein JCGZ_20437                         164   5e-42    
ref|XP_003579702.1|  PREDICTED: uncharacterized protein LOC100837744    165   5e-42    
ref|XP_009758115.1|  PREDICTED: uncharacterized protein At5g39865...    162   7e-42    
ref|XP_011070395.1|  PREDICTED: uncharacterized protein At5g39865...    162   1e-41    
ref|NP_001265925.1|  Hop-interacting protein THI143                     162   1e-41    
ref|XP_011024139.1|  PREDICTED: uncharacterized protein At3g28850...    163   1e-41    
ref|XP_009626221.1|  PREDICTED: uncharacterized protein At5g39865...    161   1e-41    
ref|NP_001239943.1|  uncharacterized protein LOC100780345               160   1e-41    
ref|XP_006343770.1|  PREDICTED: uncharacterized protein At5g39865...    161   2e-41    
ref|XP_008456623.1|  PREDICTED: uncharacterized protein At3g28850       161   3e-41    
ref|XP_007203660.1|  hypothetical protein PRUPE_ppa1027144mg            159   4e-41    
gb|KDO70654.1|  hypothetical protein CISIN_1g047313mg                   155   4e-41    
ref|XP_011077914.1|  PREDICTED: uncharacterized protein LOC105161798    159   8e-41    
gb|EPS65733.1|  hypothetical protein M569_09043                         157   9e-41    
ref|XP_008241083.1|  PREDICTED: uncharacterized protein At5g39865       158   1e-40    
ref|XP_001769097.1|  predicted protein                                  154   1e-40    
ref|XP_003518166.2|  PREDICTED: uncharacterized protein At5g39865...    157   1e-40    
ref|XP_009613385.1|  PREDICTED: uncharacterized protein At5g39865...    159   1e-40    
ref|XP_002308331.2|  hypothetical protein POPTR_0006s21590g             157   1e-40    Populus trichocarpa [western balsam poplar]
emb|CDP12180.1|  unnamed protein product                                160   2e-40    
ref|XP_006589342.1|  PREDICTED: uncharacterized protein At5g39865...    159   2e-40    
ref|XP_010266554.1|  PREDICTED: glutaredoxin domain-containing cy...    159   3e-40    
ref|XP_010058933.1|  PREDICTED: uncharacterized protein At3g28850       157   3e-40    
ref|XP_001771726.1|  predicted protein                                  162   4e-40    
gb|KDO38523.1|  hypothetical protein CISIN_1g027825mg                   154   4e-40    
ref|XP_004143951.1|  PREDICTED: uncharacterized protein LOC101208965    158   6e-40    
ref|XP_006476355.1|  PREDICTED: glutaredoxin domain-containing cy...    158   7e-40    
ref|XP_006445793.1|  hypothetical protein CICLE_v10017624mg             159   7e-40    
ref|XP_009774426.1|  PREDICTED: uncharacterized protein At5g39865...    157   7e-40    
ref|XP_006485559.1|  PREDICTED: myb-like protein X-like                 158   7e-40    
ref|XP_001767427.1|  predicted protein                                  151   7e-40    
ref|XP_006348446.1|  PREDICTED: uncharacterized protein At5g39865...    153   7e-40    
ref|XP_007028020.1|  Glutaredoxin family protein, putative              155   8e-40    
ref|XP_004503297.1|  PREDICTED: uncharacterized protein At5g39865...    155   8e-40    
ref|XP_003555483.1|  PREDICTED: uncharacterized protein At5g39865...    158   9e-40    
ref|XP_004496102.1|  PREDICTED: uncharacterized protein At3g28850...    157   9e-40    
gb|KHN00977.1|  Hypothetical protein glysoja_000645                     158   9e-40    
gb|KDO48705.1|  hypothetical protein CISIN_1g039216mg                   158   9e-40    
gb|KDO76586.1|  hypothetical protein CISIN_1g0446791mg                  153   1e-39    
ref|XP_006439311.1|  hypothetical protein CICLE_v10020737mg             157   2e-39    
ref|XP_010543206.1|  PREDICTED: uncharacterized protein LOC104816194    159   2e-39    
gb|EYU26416.1|  hypothetical protein MIMGU_mgv1a024000mg                157   2e-39    
ref|XP_006343831.1|  PREDICTED: glutaredoxin domain-containing cy...    157   2e-39    
ref|XP_002303660.1|  glutaredoxin family protein                        156   2e-39    Populus trichocarpa [western balsam poplar]
ref|XP_002272456.1|  PREDICTED: uncharacterized protein At5g39865       155   2e-39    Vitis vinifera
ref|XP_006588876.1|  PREDICTED: uncharacterized protein At5g39865...    154   2e-39    
ref|XP_011046441.1|  PREDICTED: uncharacterized protein At5g39865       154   2e-39    
ref|XP_006343832.1|  PREDICTED: glutaredoxin domain-containing cy...    157   2e-39    
ref|XP_010925953.1|  PREDICTED: histone-lysine N-methyltransferas...    156   3e-39    
ref|XP_004136718.1|  PREDICTED: uncharacterized protein At5g39865...    154   3e-39    
gb|KHN22596.1|  Hypothetical protein glysoja_037746                     153   4e-39    
ref|XP_010031326.1|  PREDICTED: uncharacterized protein At5g39865...    156   4e-39    
ref|XP_004245502.1|  PREDICTED: glutaredoxin domain-containing cy...    156   4e-39    
ref|XP_007144213.1|  hypothetical protein PHAVU_007G137300g             156   4e-39    
ref|XP_010053060.1|  PREDICTED: uncharacterized protein At3g28850...    155   6e-39    
ref|XP_002266905.1|  PREDICTED: uncharacterized protein LOC100247840    155   6e-39    Vitis vinifera
ref|XP_011022479.1|  PREDICTED: glutaredoxin domain-containing cy...    155   6e-39    
ref|XP_007160510.1|  hypothetical protein PHAVU_002G327900g             153   6e-39    
emb|CAN76670.1|  hypothetical protein VITISV_042863                     151   7e-39    Vitis vinifera
ref|XP_003520720.1|  PREDICTED: uncharacterized protein At5g39865...    152   7e-39    
ref|XP_002968012.1|  hypothetical protein SELMODRAFT_68277              149   7e-39    
ref|XP_002977690.1|  hypothetical protein SELMODRAFT_107780             150   7e-39    
ref|XP_002992409.1|  hypothetical protein SELMODRAFT_48223              149   8e-39    
gb|EYU38714.1|  hypothetical protein MIMGU_mgv1a026914mg                152   8e-39    
ref|XP_009348807.1|  PREDICTED: uncharacterized protein At5g39865...    152   9e-39    
ref|XP_010455457.1|  PREDICTED: uncharacterized protein At5g39865...    154   9e-39    
ref|XP_002518846.1|  electron transporter, putative                     154   1e-38    Ricinus communis
ref|XP_009341571.1|  PREDICTED: uncharacterized protein At3g28850       154   2e-38    
ref|XP_004308564.1|  PREDICTED: uncharacterized protein At5g39865...    152   2e-38    
ref|XP_010452580.1|  PREDICTED: uncharacterized protein At3g28850...    150   2e-38    
ref|XP_008231936.1|  PREDICTED: uncharacterized protein At3g28850       154   3e-38    
gb|KHN04404.1|  Hypothetical protein glysoja_042230                     148   3e-38    
ref|XP_002970541.1|  hypothetical protein SELMODRAFT_15619              147   3e-38    
ref|XP_009362676.1|  PREDICTED: uncharacterized protein At5g39865       151   3e-38    
ref|XP_010907962.1|  PREDICTED: uncharacterized protein At3g28850       153   3e-38    
ref|XP_008783185.1|  PREDICTED: uncharacterized protein LOC103702504    153   3e-38    
ref|XP_010436865.1|  PREDICTED: uncharacterized protein At3g28850...    152   4e-38    
gb|KDP25217.1|  hypothetical protein JCGZ_20373                         152   4e-38    
ref|XP_002978620.1|  hypothetical protein SELMODRAFT_15618              147   5e-38    
ref|XP_010106976.1|  Uncharacterized protein L484_016904                150   5e-38    
gb|KHG05116.1|  hypothetical protein F383_30969                         152   5e-38    
ref|XP_010491210.1|  PREDICTED: uncharacterized protein At3g28850...    149   5e-38    
ref|XP_008391988.1|  PREDICTED: uncharacterized protein At5g39865...    150   6e-38    
ref|XP_008392638.1|  PREDICTED: uncharacterized protein At3g28850...    151   7e-38    
ref|XP_010694395.1|  PREDICTED: uncharacterized protein At3g28850...    152   7e-38    
ref|XP_007212831.1|  hypothetical protein PRUPE_ppa020739mg             152   8e-38    
ref|XP_002263752.1|  PREDICTED: uncharacterized protein At3g28850       152   9e-38    Vitis vinifera
emb|CAN72487.1|  hypothetical protein VITISV_020885                     152   1e-37    Vitis vinifera
gb|KCW90429.1|  hypothetical protein EUGRSUZ_A02563                     146   1e-37    
ref|XP_010421977.1|  PREDICTED: uncharacterized protein At5g39865...    151   1e-37    
ref|XP_010267402.1|  PREDICTED: uncharacterized protein At3g28850       151   1e-37    
emb|CBI24996.3|  unnamed protein product                                152   1e-37    
ref|XP_010661047.1|  PREDICTED: uncharacterized protein At5g39865       152   2e-37    
ref|XP_007209242.1|  hypothetical protein PRUPE_ppa007121mg             151   2e-37    
ref|XP_006286786.1|  hypothetical protein CARUB_v10003351mg             150   3e-37    
ref|XP_008387121.1|  PREDICTED: uncharacterized protein At5g39865       149   3e-37    
ref|XP_007210085.1|  hypothetical protein PRUPE_ppa019815mg             150   3e-37    
ref|XP_009130946.1|  PREDICTED: uncharacterized protein At3g28850...    147   3e-37    
ref|XP_009403223.1|  PREDICTED: uncharacterized protein At3g28850...    151   3e-37    
ref|XP_008366606.1|  PREDICTED: uncharacterized protein At5g39865...    148   3e-37    
ref|XP_010677559.1|  PREDICTED: uncharacterized protein At3g28850...    149   3e-37    
ref|XP_007162989.1|  hypothetical protein PHAVU_001G197100g             147   4e-37    
ref|XP_004305576.1|  PREDICTED: uncharacterized protein At5g39865...    147   4e-37    
ref|XP_008437411.1|  PREDICTED: uncharacterized protein LOC103482835    150   4e-37    
ref|XP_009610463.1|  PREDICTED: uncharacterized protein LOC104104162    149   4e-37    
ref|XP_008239265.1|  PREDICTED: uncharacterized protein At5g39865...    146   4e-37    
ref|NP_192801.1|  Glutaredoxin family protein                           149   4e-37    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008347050.1|  PREDICTED: uncharacterized protein At3g28850...    150   5e-37    
ref|XP_002873258.1|  glutaredoxin family protein                        146   5e-37    
ref|XP_010423337.1|  PREDICTED: uncharacterized protein At3g28850...    147   6e-37    
ref|NP_196265.1|  Glutaredoxin family protein                           146   6e-37    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002298963.2|  hypothetical protein POPTR_0001s45240g             149   7e-37    Populus trichocarpa [western balsam poplar]
ref|XP_003591668.1|  Glutaredoxin domain-containing cysteine-rich...    149   8e-37    
ref|XP_011013400.1|  PREDICTED: uncharacterized protein At5g39865...    149   8e-37    
ref|XP_009360198.1|  PREDICTED: uncharacterized protein At5g39865       148   8e-37    
ref|XP_004494260.1|  PREDICTED: uncharacterized protein At5g39865...    146   9e-37    
ref|XP_001753384.1|  predicted protein                                  143   1e-36    
ref|XP_008442942.1|  PREDICTED: uncharacterized protein At3g28850       147   1e-36    
ref|XP_008346655.1|  PREDICTED: uncharacterized protein At5g39865...    148   1e-36    
ref|XP_002874639.1|  glutaredoxin family protein                        148   1e-36    
emb|CDP12239.1|  unnamed protein product                                145   1e-36    
ref|XP_001773130.1|  predicted protein                                  142   2e-36    
ref|XP_007160186.1|  hypothetical protein PHAVU_002G300200g             148   2e-36    
ref|XP_007040570.1|  Electron transporter, putative                     149   2e-36    
ref|XP_004161302.1|  PREDICTED: uncharacterized protein At5g39865...    146   2e-36    
ref|XP_009122252.1|  PREDICTED: uncharacterized protein At5g39865       145   2e-36    
ref|XP_009793246.1|  PREDICTED: uncharacterized protein At5g39865...    145   2e-36    
gb|EPS70452.1|  hypothetical protein M569_04310                         143   2e-36    
ref|XP_011041075.1|  PREDICTED: uncharacterized protein At5g39865...    147   3e-36    
ref|XP_003553622.1|  PREDICTED: uncharacterized protein At5g39865...    144   4e-36    
ref|XP_003631079.1|  hypothetical protein MTR_8g106900                  145   5e-36    
ref|XP_002967841.1|  hypothetical protein SELMODRAFT_88028              143   5e-36    
ref|XP_002981678.1|  hypothetical protein SELMODRAFT_114914             143   5e-36    
ref|XP_010937069.1|  PREDICTED: uncharacterized protein At3g28850...    148   5e-36    
ref|XP_006399120.1|  hypothetical protein EUTSA_v10014515mg             144   5e-36    
ref|XP_004300885.1|  PREDICTED: uncharacterized protein LOC101315348    147   5e-36    
emb|CDY67834.1|  BnaA10g30280D                                          144   5e-36    
ref|XP_008801678.1|  PREDICTED: uncharacterized protein At5g39865...    147   6e-36    
ref|XP_009764745.1|  PREDICTED: uncharacterized protein At3g28850       147   6e-36    
ref|XP_004143838.1|  PREDICTED: uncharacterized protein At5g39865...    145   7e-36    
ref|XP_010109778.1|  hypothetical protein L484_003138                   146   7e-36    
ref|XP_002323371.2|  hypothetical protein POPTR_0016s06800g             143   8e-36    Populus trichocarpa [western balsam poplar]
ref|XP_009421470.1|  PREDICTED: glutaredoxin domain-containing cy...    146   9e-36    
ref|XP_002879921.1|  glutaredoxin family protein                        147   9e-36    
ref|XP_008437449.1|  PREDICTED: uncharacterized protein At3g28850       145   9e-36    
ref|XP_008374128.1|  PREDICTED: uncharacterized protein At5g39865...    145   1e-35    
gb|KDP36090.1|  hypothetical protein JCGZ_08734                         142   1e-35    
ref|XP_009631789.1|  PREDICTED: uncharacterized protein At3g28850       146   2e-35    
ref|XP_010676920.1|  PREDICTED: uncharacterized protein At3g28850...    145   2e-35    
ref|XP_004235070.1|  PREDICTED: uncharacterized protein At5g39865       143   2e-35    
gb|KEH21255.1|  glutaredoxin (GRX) family protein                       145   2e-35    
ref|XP_010667906.1|  PREDICTED: uncharacterized protein LOC104884902    145   2e-35    
ref|XP_010053158.1|  PREDICTED: glutaredoxin domain-containing cy...    145   2e-35    
ref|XP_006355140.1|  PREDICTED: uncharacterized protein At5g39865...    142   2e-35    
ref|XP_008784405.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    146   3e-35    
ref|XP_006290093.1|  hypothetical protein CARUB_v10003738mg             141   3e-35    
ref|XP_010939546.1|  PREDICTED: uncharacterized protein At3g28850...    146   4e-35    
ref|XP_009415583.1|  PREDICTED: uncharacterized protein At5g39865...    146   5e-35    
ref|XP_010490568.1|  PREDICTED: glutaredoxin domain-containing cy...    144   5e-35    
emb|CAN65189.1|  hypothetical protein VITISV_032100                     144   6e-35    Vitis vinifera
ref|XP_003525338.1|  PREDICTED: uncharacterized protein LOC100809536    143   7e-35    
gb|EAY94668.1|  hypothetical protein OsI_16447                          141   1e-34    Oryza sativa Indica Group [Indian rice]
ref|XP_009410381.1|  PREDICTED: uncharacterized protein At3g28850...    145   1e-34    
emb|CDY06138.1|  BnaA09g36420D                                          143   2e-34    
ref|XP_009116414.1|  PREDICTED: uncharacterized protein At5g39865       143   2e-34    
ref|NP_001173566.1|  Os03g0648800                                       141   2e-34    
ref|NP_001140433.1|  uncharacterized protein LOC100272492               140   3e-34    
ref|XP_006439209.1|  hypothetical protein CICLE_v10024406mg             140   3e-34    
ref|XP_010451987.1|  PREDICTED: glutaredoxin domain-containing cy...    142   3e-34    
ref|XP_010067741.1|  PREDICTED: uncharacterized protein At5g39865...    139   4e-34    
emb|CDX98926.1|  BnaC09g49090D                                          138   4e-34    
ref|XP_010525485.1|  PREDICTED: uncharacterized protein At3g28850       142   4e-34    
ref|XP_009395120.1|  PREDICTED: uncharacterized protein At3g28850...    142   5e-34    
gb|ACN34745.1|  unknown                                                 141   5e-34    
ref|XP_002452550.1|  hypothetical protein SORBIDRAFT_04g027900          141   6e-34    
gb|KFK38543.1|  hypothetical protein AALP_AA3G127700                    137   6e-34    
ref|XP_002276361.1|  PREDICTED: uncharacterized protein At5g39865       137   1e-33    
gb|EYU42945.1|  hypothetical protein MIMGU_mgv1a012063mg                138   1e-33    
ref|XP_006826437.1|  hypothetical protein AMTR_s00004p00169780          142   1e-33    
ref|XP_011088535.1|  PREDICTED: glutaredoxin domain-containing cy...    139   1e-33    
ref|XP_006293161.1|  hypothetical protein CARUB_v10019477mg             140   2e-33    
emb|CDY05109.1|  BnaC03g29070D                                          137   2e-33    
ref|XP_010516316.1|  PREDICTED: uncharacterized protein At5g39865...    140   2e-33    
gb|KEH24258.1|  glutaredoxin (GRX) family protein                       137   2e-33    
ref|XP_010543856.1|  PREDICTED: uncharacterized protein At5g39865...    137   2e-33    
ref|XP_010427570.1|  PREDICTED: uncharacterized protein At5g39865...    140   2e-33    
ref|XP_004953916.1|  PREDICTED: uncharacterized protein At3g28850...    140   2e-33    
ref|XP_006287912.1|  hypothetical protein CARUB_v10001146mg             140   2e-33    
ref|XP_010273192.1|  PREDICTED: uncharacterized protein At5g39865...    140   2e-33    
ref|XP_010937918.1|  PREDICTED: uncharacterized protein At5g39865...    137   3e-33    
ref|XP_010920997.1|  PREDICTED: uncharacterized protein At5g39865       135   3e-33    
ref|XP_010246872.1|  PREDICTED: uncharacterized protein At3g28850       140   3e-33    
gb|ABK26357.1|  unknown                                                 139   3e-33    
ref|XP_003570646.1|  PREDICTED: uncharacterized protein At3g28850...    139   4e-33    
ref|XP_011000556.1|  PREDICTED: uncharacterized protein At5g39865...    136   4e-33    
ref|XP_011026852.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    139   4e-33    
ref|XP_010547343.1|  PREDICTED: uncharacterized protein At5g39865...    136   5e-33    
ref|XP_010504629.1|  PREDICTED: uncharacterized protein At5g39865...    139   5e-33    
ref|XP_010423953.1|  PREDICTED: glutaredoxin domain-containing cy...    139   6e-33    
gb|EAZ27953.1|  hypothetical protein OsJ_11913                          137   6e-33    
emb|CDY04838.1|  BnaAnng00200D                                          138   6e-33    
gb|KCW65924.1|  hypothetical protein EUGRSUZ_G03241                     139   6e-33    
ref|XP_003561793.1|  PREDICTED: uncharacterized protein At3g28850       137   7e-33    
ref|XP_006852612.1|  hypothetical protein AMTR_s00021p00225580          138   8e-33    
ref|XP_009617415.1|  PREDICTED: uncharacterized protein At5g39865...    135   8e-33    
ref|XP_009760470.1|  PREDICTED: uncharacterized protein At3g28850...    139   8e-33    
ref|XP_003522948.1|  PREDICTED: uncharacterized protein At5g39865...    135   9e-33    
dbj|BAC42628.1|  unknown protein                                        138   1e-32    
emb|CDX72074.1|  BnaC08g28000D                                          138   1e-32    
ref|NP_195762.1|  Glutaredoxin family protein                           138   1e-32    
ref|XP_009125417.1|  PREDICTED: uncharacterized protein LOC103850417    137   1e-32    
ref|XP_002989571.1|  hypothetical protein SELMODRAFT_129903             133   1e-32    
ref|XP_006398616.1|  hypothetical protein EUTSA_v10013790mg             138   1e-32    
ref|XP_004309532.1|  PREDICTED: uncharacterized protein At5g39865...    136   1e-32    
gb|KDP40521.1|  hypothetical protein JCGZ_24520                         135   1e-32    
ref|XP_008392400.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    138   1e-32    
ref|XP_002518923.1|  electron transporter, putative                     136   1e-32    
emb|CDP13704.1|  unnamed protein product                                135   1e-32    
ref|XP_010242414.1|  PREDICTED: uncharacterized protein At3g28850...    139   1e-32    
ref|XP_010670465.1|  PREDICTED: uncharacterized protein At5g39865       135   2e-32    
ref|XP_006477503.1|  PREDICTED: uncharacterized protein At5g39865...    135   2e-32    
emb|CBI34599.3|  unnamed protein product                                135   2e-32    
ref|XP_010106733.1|  Uncharacterized protein L484_020750                135   2e-32    
ref|XP_011081373.1|  PREDICTED: uncharacterized protein At5g39865...    136   2e-32    
ref|XP_002870921.1|  hypothetical protein ARALYDRAFT_486934             137   2e-32    
ref|NP_001058935.1|  Os07g0159900                                       134   2e-32    
ref|XP_002964242.1|  hypothetical protein SELMODRAFT_80915              132   2e-32    
gb|EAY87532.1|  hypothetical protein OsI_08940                          136   3e-32    
ref|NP_001048121.2|  Os02g0748800                                       136   3e-32    
dbj|BAJ89660.1|  predicted protein                                      137   3e-32    
ref|XP_002297745.1|  hypothetical protein POPTR_0001s06390g             134   4e-32    
ref|XP_002464161.1|  hypothetical protein SORBIDRAFT_01g013330          135   4e-32    
ref|XP_002876394.1|  hypothetical protein ARALYDRAFT_486152             137   4e-32    
ref|XP_002459365.1|  hypothetical protein SORBIDRAFT_02g003370          134   4e-32    
ref|XP_011091844.1|  PREDICTED: uncharacterized protein LOC105172180    134   4e-32    
ref|NP_001145886.1|  uncharacterized protein LOC100279402               135   5e-32    
ref|XP_003632735.1|  PREDICTED: uncharacterized protein At5g39865       136   5e-32    
ref|XP_004307118.1|  PREDICTED: uncharacterized protein At5g39865...    133   5e-32    
ref|XP_004982303.1|  PREDICTED: uncharacterized protein LOC101775789    134   7e-32    
gb|EYU38276.1|  hypothetical protein MIMGU_mgv1a025485mg                134   7e-32    
gb|AEW09344.1|  hypothetical protein UMN_5432_02                        128   8e-32    
ref|XP_010557859.1|  PREDICTED: uncharacterized protein At5g39865...    133   8e-32    
ref|XP_009627390.1|  PREDICTED: uncharacterized protein At3g28850...    135   9e-32    
ref|XP_006397027.1|  hypothetical protein EUTSA_v10028781mg             134   1e-31    
ref|XP_006647893.1|  PREDICTED: uncharacterized protein At5g39865...    134   1e-31    
ref|NP_567043.2|  Glutaredoxin family protein                           135   1e-31    
ref|XP_008789161.1|  PREDICTED: uncharacterized protein At5g39865...    132   1e-31    
gb|AEW09345.1|  hypothetical protein UMN_5432_02                        127   2e-31    
ref|XP_008794238.1|  PREDICTED: uncharacterized protein LOC103710342    132   2e-31    
ref|XP_007011067.1|  Glutaredoxin family protein                        132   2e-31    
ref|XP_008797154.1|  PREDICTED: uncharacterized protein At3g28850...    134   2e-31    
ref|XP_009790682.1|  PREDICTED: uncharacterized protein At5g39865...    131   3e-31    
ref|XP_008446946.1|  PREDICTED: uncharacterized protein At3g28850       131   3e-31    
ref|NP_001151422.1|  electron transporter/ thiol-disulfide exchan...    133   3e-31    
ref|XP_011077932.1|  PREDICTED: uncharacterized protein LOC105161815    132   4e-31    
ref|XP_002270142.1|  PREDICTED: uncharacterized protein At5g39865       130   4e-31    
ref|XP_009358729.1|  PREDICTED: uncharacterized protein LOC103949336    133   4e-31    
ref|XP_010044364.1|  PREDICTED: uncharacterized protein At5g39865       133   6e-31    
ref|XP_009361968.1|  PREDICTED: uncharacterized protein At5g39865...    130   6e-31    
ref|XP_010556253.1|  PREDICTED: uncharacterized protein At5g39865...    130   7e-31    
ref|NP_001060529.1|  Os07g0659900                                       128   7e-31    
gb|EPS73665.1|  hypothetical protein M569_01091                         126   8e-31    
emb|CAN73338.1|  hypothetical protein VITISV_042400                     130   8e-31    
ref|XP_010650875.1|  PREDICTED: uncharacterized protein At3g28850       129   9e-31    
ref|XP_006482583.1|  PREDICTED: uncharacterized protein At3g28850...    133   1e-30    
ref|XP_009354469.1|  PREDICTED: uncharacterized protein At5g39865...    129   1e-30    
ref|XP_006470850.1|  PREDICTED: uncharacterized protein At5g39865...    130   1e-30    
gb|EMT22121.1|  hypothetical protein F775_08709                         129   1e-30    
gb|KFK31858.1|  hypothetical protein AALP_AA6G167600                    131   1e-30    
emb|CDY47842.1|  BnaA09g12210D                                          131   1e-30    
ref|XP_009124662.1|  PREDICTED: uncharacterized protein At3g28850       131   1e-30    
ref|XP_006652897.1|  PREDICTED: uncharacterized protein At3g28850...    132   1e-30    
ref|XP_006351105.1|  PREDICTED: uncharacterized protein At5g39865...    129   1e-30    
gb|KDO76750.1|  hypothetical protein CISIN_1g041824mg                   129   1e-30    
ref|XP_008443286.1|  PREDICTED: uncharacterized protein At5g39865...    131   2e-30    
ref|XP_006827160.1|  hypothetical protein AMTR_s00010p00253600          133   2e-30    
ref|XP_004169024.1|  PREDICTED: uncharacterized protein At5g39865...    129   2e-30    
ref|XP_011020384.1|  PREDICTED: uncharacterized protein At5g39865...    128   2e-30    
ref|XP_008379341.1|  PREDICTED: uncharacterized protein At5g39865       132   2e-30    
ref|XP_008665088.1|  PREDICTED: uncharacterized protein LOC103643684    130   2e-30    
ref|XP_007028546.1|  Glutaredoxin family protein, putative              131   2e-30    
ref|XP_003557580.1|  PREDICTED: uncharacterized protein At5g39865...    129   2e-30    
ref|XP_006391612.1|  hypothetical protein EUTSA_v10023539mg             130   2e-30    
ref|XP_003598625.1|  hypothetical protein MTR_3g017490                  129   2e-30    
ref|NP_001142038.1|  uncharacterized protein LOC100274193               131   2e-30    
ref|XP_004136649.1|  PREDICTED: uncharacterized protein At5g39865...    130   3e-30    
ref|XP_002304790.1|  hypothetical protein POPTR_0003s19770g             128   3e-30    
ref|XP_007162117.1|  hypothetical protein PHAVU_001G125300g             131   3e-30    
ref|XP_004142428.1|  PREDICTED: uncharacterized protein At5g39865...    128   3e-30    
ref|XP_003557901.1|  PREDICTED: uncharacterized protein At3g28850...    126   3e-30    
ref|XP_007204897.1|  hypothetical protein PRUPE_ppa006250mg             131   3e-30    
ref|XP_010032351.1|  PREDICTED: uncharacterized protein At3g28850       131   4e-30    
ref|XP_004958579.1|  PREDICTED: uncharacterized protein At5g39865...    126   4e-30    
ref|XP_007016949.1|  Glutaredoxin family protein, putative              127   4e-30    
ref|XP_004976994.1|  PREDICTED: uncharacterized protein At3g28850...    131   4e-30    
gb|KDO72558.1|  hypothetical protein CISIN_1g045109mg                   130   4e-30    
ref|XP_008231508.1|  PREDICTED: uncharacterized protein At5g39865       128   4e-30    
ref|XP_008375314.1|  PREDICTED: uncharacterized protein At5g39865...    128   5e-30    
ref|XP_006646759.1|  PREDICTED: uncharacterized protein At3g28850...    128   5e-30    
gb|AFW68137.1|  electron transporter/ thiol-disulfide exchange in...    130   5e-30    
dbj|BAJ94272.1|  predicted protein                                      127   6e-30    
gb|EPS59730.1|  hypothetical protein M569_15074                         126   6e-30    
ref|XP_010090900.1|  Uncharacterized protein L484_005224                130   7e-30    
ref|XP_001754947.1|  predicted protein                                  123   7e-30    
ref|XP_009402227.1|  PREDICTED: uncharacterized protein At5g39865...    126   8e-30    
ref|XP_010492161.1|  PREDICTED: uncharacterized protein At5g39865...    127   9e-30    
ref|XP_010499824.1|  PREDICTED: uncharacterized protein At3g28850...    128   9e-30    
ref|XP_009406920.1|  PREDICTED: uncharacterized protein At5g39865...    126   9e-30    
ref|XP_010473717.1|  PREDICTED: uncharacterized protein LOC104753...    129   1e-29    
ref|XP_010430586.1|  PREDICTED: uncharacterized protein LOC104714...    129   1e-29    
ref|XP_008348309.1|  PREDICTED: uncharacterized protein At5g39865...    127   1e-29    
gb|KHN14909.1|  Hypothetical protein glysoja_024029                     129   1e-29    
ref|XP_003554133.1|  PREDICTED: uncharacterized protein At5g39865...    129   1e-29    
ref|XP_006854753.1|  hypothetical protein AMTR_s00063p00014550          130   1e-29    
emb|CDY01245.1|  BnaC05g24870D                                          126   1e-29    
ref|XP_010418523.1|  PREDICTED: uncharacterized protein LOC104704...    128   1e-29    
emb|CAC09456.2|  H0423H10.2                                             129   1e-29    
ref|NP_001054043.1|  Os04g0641300                                       129   1e-29    
ref|XP_008240798.1|  PREDICTED: uncharacterized protein At3g28850       129   1e-29    
gb|AAL36338.1|  putative peptide transporter protein                    128   1e-29    
ref|XP_006431135.1|  hypothetical protein CICLE_v10011708mg             129   1e-29    
ref|XP_004232227.1|  PREDICTED: uncharacterized protein At3g28850       129   1e-29    
ref|XP_002308899.2|  glutaredoxin family protein                        129   1e-29    
emb|CDX90765.1|  BnaA03g24450D                                          126   2e-29    
gb|KDO36407.1|  hypothetical protein CISIN_1g048504mg                   126   2e-29    
ref|XP_010453483.1|  PREDICTED: uncharacterized protein At5g39865...    126   2e-29    
ref|XP_006420735.1|  hypothetical protein CICLE_v10005597mg             126   2e-29    
ref|NP_196885.1|  Glutaredoxin family protein                           126   2e-29    
ref|NP_176631.1|  glutaredoxin-like protein                             128   2e-29    
ref|XP_006301204.1|  hypothetical protein CARUB_v10021603mg             128   2e-29    
ref|XP_009134200.1|  PREDICTED: uncharacterized protein At5g39865       127   2e-29    
ref|XP_010922599.1|  PREDICTED: uncharacterized protein At5g39865...    125   2e-29    
ref|XP_008221452.1|  PREDICTED: uncharacterized protein At5g39865       125   2e-29    
ref|XP_007208696.1|  hypothetical protein PRUPE_ppa024332mg             125   2e-29    
ref|XP_008356843.1|  PREDICTED: uncharacterized protein LOC103420561    127   2e-29    
ref|XP_010555824.1|  PREDICTED: uncharacterized protein LOC104825229    129   3e-29    
gb|KFK32157.1|  hypothetical protein AALP_AA6G205200                    127   3e-29    
ref|XP_004143166.1|  PREDICTED: uncharacterized protein At5g39865...    125   3e-29    
ref|XP_010089529.1|  Uncharacterized protein L484_011693                125   3e-29    
ref|XP_002887881.1|  glutaredoxin family protein                        127   3e-29    
gb|KEH41459.1|  glutaredoxin (GRX) family protein                       127   3e-29    
ref|XP_003537494.1|  PREDICTED: uncharacterized protein At5g39865...    124   3e-29    
ref|XP_004249863.1|  PREDICTED: uncharacterized protein At5g39865...    125   3e-29    
gb|EYU31548.1|  hypothetical protein MIMGU_mgv1a022765mg                126   3e-29    
ref|XP_009799808.1|  PREDICTED: uncharacterized protein At5g39865...    127   4e-29    
ref|XP_002871586.1|  glutaredoxin family protein                        125   4e-29    
ref|XP_006399879.1|  hypothetical protein EUTSA_v10014389mg             125   4e-29    
ref|XP_002891008.1|  hypothetical protein ARALYDRAFT_473461             126   4e-29    
ref|XP_009114862.1|  PREDICTED: uncharacterized protein At5g39865       125   4e-29    
ref|XP_007218804.1|  hypothetical protein PRUPE_ppa009830mg             125   4e-29    
ref|XP_010419990.1|  PREDICTED: uncharacterized protein At5g39865...    125   4e-29    
ref|XP_002447201.1|  hypothetical protein SORBIDRAFT_06g030320          128   4e-29    
ref|XP_006288432.1|  hypothetical protein CARUB_v10001690mg             125   4e-29    
ref|XP_007133772.1|  hypothetical protein PHAVU_011G207600g             124   5e-29    
ref|XP_006338464.1|  PREDICTED: uncharacterized protein At3g28850...    127   5e-29    
ref|XP_009602439.1|  PREDICTED: uncharacterized protein At5g39865...    126   6e-29    
ref|NP_174553.1|  glutaredoxin family protein                           125   6e-29    
ref|XP_008341560.1|  PREDICTED: uncharacterized protein At5g39865       127   6e-29    
ref|XP_008362747.1|  PREDICTED: uncharacterized protein At5g39865...    123   6e-29    
ref|XP_003616680.1|  hypothetical protein MTR_5g083110                  124   7e-29    
ref|XP_007148957.1|  hypothetical protein PHAVU_005G028700g             124   7e-29    
ref|XP_009369270.1|  PREDICTED: uncharacterized protein At5g39865...    123   7e-29    
emb|CDY62024.1|  BnaCnng39030D                                          126   7e-29    
ref|XP_002513069.1|  electron transporter, putative                     124   7e-29    
ref|XP_008649254.1|  PREDICTED: uncharacterized protein At5g39865...    127   7e-29    
emb|CBI22186.3|  unnamed protein product                                125   7e-29    
ref|XP_004493419.1|  PREDICTED: uncharacterized protein At5g39865...    127   8e-29    
ref|XP_010473718.1|  PREDICTED: uncharacterized protein LOC104753...    126   1e-28    
emb|CDX85224.1|  BnaC07g25350D                                          126   1e-28    
ref|XP_003625034.1|  hypothetical protein MTR_7g090230                  126   1e-28    
ref|XP_003552836.1|  PREDICTED: uncharacterized protein At3g28850...    122   1e-28    
ref|XP_011027282.1|  PREDICTED: uncharacterized protein At5g39865       126   1e-28    
ref|XP_006350854.1|  PREDICTED: uncharacterized protein At5g39865...    122   1e-28    
ref|XP_010918301.1|  PREDICTED: uncharacterized protein At5g39865...    122   2e-28    
dbj|BAK07661.1|  predicted protein                                      127   2e-28    
ref|XP_003546721.1|  PREDICTED: uncharacterized protein At5g39865...    123   2e-28    
ref|XP_006402914.1|  hypothetical protein EUTSA_v10005993mg             126   2e-28    
emb|CDX93821.1|  BnaA09g24210D                                          123   2e-28    
ref|XP_004966827.1|  PREDICTED: uncharacterized protein At3g28850...    125   2e-28    
ref|XP_004242508.1|  PREDICTED: uncharacterized protein At5g39865...    122   2e-28    
ref|XP_010032308.1|  PREDICTED: uncharacterized protein At5g39865...    123   2e-28    
ref|XP_008465270.1|  PREDICTED: uncharacterized protein At5g39865       122   2e-28    
dbj|BAJ99516.1|  predicted protein                                      121   2e-28    
ref|XP_008369287.1|  PREDICTED: uncharacterized protein At5g39865...    122   2e-28    
gb|KFK27380.1|  hypothetical protein AALP_AA8G375300                    122   3e-28    
ref|XP_010917118.1|  PREDICTED: uncharacterized protein At3g28850       125   3e-28    
emb|CDP02217.1|  unnamed protein product                                125   4e-28    



>ref|XP_009595175.1| PREDICTED: uncharacterized protein At3g28850 [Nicotiana tomentosiformis]
Length=409

 Score =   443 bits (1140),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 266/415 (64%), Positives = 324/415 (78%), Gaps = 25/415 (6%)
 Frame = +1

Query  40    MGCVSSKLFPKD-KDFPFAGDGGCATH-VVSLTSSTYGVLKLDKDSHQQQTPPQCIKECV  213
             MGCVSSKLF  D K      +G   TH +VSLTSSTYG L LDK  +  Q P  CIKECV
Sbjct  1     MGCVSSKLFRNDFKQEILCKNGEDYTHHIVSLTSSTYGALNLDKVQNFTQNPLPCIKECV  60

Query  214   VEVKKASPAREKPPEVINAWELMEGLDE-TEMPAAKKSPKARSFL------DHRRSPLKF  372
              EVKK SP R+   EVIN WELMEGLDE   +P +K SPK+R FL      D R SPLKF
Sbjct  61    REVKK-SPPRDVSHEVINTWELMEGLDEELVVPNSKISPKSRGFLRGFADIDARSSPLKF  119

Query  373   LNQLASPGKLRRSGGKENK-----PGRAMGRSEFSPKTVPK-AYNLQESPWRVSPRLRSL  534
             LNQ++SP KL++ GGKENK      G  +GRS+FSPK+V K +  +Q+SPW+++PRLR+ 
Sbjct  120   LNQMSSPRKLKKFGGKENKGKANGVGNFVGRSDFSPKSVLKESKKMQQSPWKMTPRLRN-  178

Query  535   KKGSPKLSPNELKCDSMRAESMAVCTRR-SLNPLFNPeigek---lsseeeeqikkMISS  702
                S + SPNELKCDS++ +S+ + +RR SL+PLF+P++        SEEEEQIKKM+S 
Sbjct  179   ---SKQESPNELKCDSLKVDSVVISSRRRSLSPLFDPQLVAAFEKELSEEEEQIKKMVSV  235

Query  703   TPVSRKSRKSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESH  882
             TP+SRK+R SQEA +++LE F++KCPP GEN+VVIYTTTLRGIRKTFEDCNTAR+ILES+
Sbjct  236   TPLSRKARNSQEA-ESMLELFDEKCPPGGENAVVIYTTTLRGIRKTFEDCNTARAILESN  294

Query  883   HVRTFERDVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgills  1062
              ++ FERD+SMHSG+KEELRGLMG   VKVPLVFVKGR+IGGADE+VKLEEEGKLGILL 
Sbjct  295   DIQMFERDISMHSGYKEELRGLMGKKEVKVPLVFVKGRLIGGADEMVKLEEEGKLGILLD  354

Query  1063  giPQAGAGCDGCAGVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPICC  1227
             GIP+A A C+GCAG+RFV+C++CNGS KV+ +D K+TVKCGECNENGLIQCPICC
Sbjct  355   GIPRAVAACEGCAGIRFVMCMDCNGSRKVMAKDGKSTVKCGECNENGLIQCPICC  409



>ref|XP_009799874.1| PREDICTED: uncharacterized protein At3g28850 [Nicotiana sylvestris]
Length=409

 Score =   440 bits (1131),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 264/415 (64%), Positives = 321/415 (77%), Gaps = 25/415 (6%)
 Frame = +1

Query  40    MGCVSSKLFPKDKDFPFAGDGG--CATHVVSLTSSTYGVLKLDKDSHQQQTPPQCIKECV  213
             MGCVSSKLF  D         G   A H+VSLTSSTYG L LDK  +  Q P  CIKECV
Sbjct  1     MGCVSSKLFRNDFKQEILCKNGEDYAHHIVSLTSSTYGALNLDKVQNFTQNPIPCIKECV  60

Query  214   VEVKKASPAREKPPEVINAWELMEGLDE-TEMPAAKKSPKARSFL------DHRRSPLKF  372
              EVKK SP R+   EVIN WELMEGLDE   +P +K SPK+R FL      D R SPLKF
Sbjct  61    REVKK-SPPRDVSHEVINTWELMEGLDEELVVPNSKISPKSRVFLRGFGDIDARSSPLKF  119

Query  373   LNQLASPGKLRRSGGKENK-----PGRAMGRSEFSPKTVPK-AYNLQESPWRVSPRLRSL  534
             LNQ++SP KL++ GGKENK      G  +GRS+FSPK V K +  +Q+SPW+++P+LR+ 
Sbjct  120   LNQMSSPRKLKKFGGKENKGKANGVGNFVGRSDFSPKNVLKESKKMQQSPWKMTPKLRN-  178

Query  535   KKGSPKLSPNELKCDSMRAESMAVCTRR-SLNPLFNPeigek---lsseeeeqikkMISS  702
                S + SPNELKCDS++ +S+ + +RR SL+PLF+P++        SEEEEQIKKM+S+
Sbjct  179   ---SKQESPNELKCDSLKVDSIVISSRRRSLSPLFDPQLVAAFEKELSEEEEQIKKMVSA  235

Query  703   TPVSRKSRKSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESH  882
             TP+SRK+R SQEA +++LE F++KCPP GEN+VVIYTTTLRGIRKTFEDCNTAR+ILES+
Sbjct  236   TPLSRKARNSQEA-ESMLELFDEKCPPGGENAVVIYTTTLRGIRKTFEDCNTARAILESN  294

Query  883   HVRTFERDVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgills  1062
              ++ FERD+SMHSG+KEELRGLMG   VKVPLVFVKGR+IGGADE+VKLEEEGKLGILL 
Sbjct  295   DIQMFERDISMHSGYKEELRGLMGKKEVKVPLVFVKGRLIGGADEMVKLEEEGKLGILLD  354

Query  1063  giPQAGAGCDGCAGVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPICC  1227
             GIP+A A C GCAG+RFV+C++CNGS KVL ++ K+TVKCGECNENGLIQCPICC
Sbjct  355   GIPRAVAACGGCAGIRFVMCMDCNGSRKVLVKEGKSTVKCGECNENGLIQCPICC  409



>ref|XP_006341107.1| PREDICTED: uncharacterized protein At5g39865-like [Solanum tuberosum]
Length=400

 Score =   436 bits (1121),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 263/408 (64%), Positives = 314/408 (77%), Gaps = 20/408 (5%)
 Frame = +1

Query  40    MGCVSSKLFPKDKDFPFAGDGGCATHVVSLTSSTYGVLKLDKDSHQQQTPPQCIKECVVE  219
             MGCV SKLF K K+    GD     HVVSLTSSTYGVL L+KDS+  + PP  IKECV E
Sbjct  1     MGCVPSKLF-KKKNLSKNGDD-YPDHVVSLTSSTYGVLNLEKDSNFTRNPPLSIKECVKE  58

Query  220   VKKASPAREKPPEVINAWELMEGLDE-TEMPAAKKSPKARSFLD-----HRRSPLKFLNQ  381
             +KK SP  E+  EVIN WELMEGLDE   +  +K SPK+R FL        RSPLKFLNQ
Sbjct  59    IKK-SPPHEESHEVINTWELMEGLDEEVVVQNSKISPKSRVFLRGFVDIDARSPLKFLNQ  117

Query  382   LASPGKLRRSGGKENKPGRA--MGRSEFSPKTVPKAYNLQESPWRVSPRLRSLKKGSPKL  555
             ++SP K ++  GKENK GR       +FSPK V K   L +SPW++SPRL   KKGSP  
Sbjct  118   MSSPRKFKKLSGKENKGGRGNEANLVDFSPKNVLKESKLMQSPWKMSPRLNFSKKGSP--  175

Query  556   SPNELKCDSMRAESMAVCTRR-SLNPLFNPeigek---lsseeeeqikkMISSTPVSRKS  723
               NE+KCDS++ +S+ V TRR SL+PLF+P++ E      SEEEEQIKKM+ +TP+SRK+
Sbjct  176   --NEVKCDSLKVDSVVVSTRRRSLSPLFDPQLVEAFEKEMSEEEEQIKKMVFATPISRKA  233

Query  724   RKSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFER  903
             R SQEA +T+L+ F +KCPP GEN+VVIYTTTLRGIRKTFEDCNTAR+ILES+ +R  ER
Sbjct  234   RNSQEA-ETMLDLFEKKCPPEGENAVVIYTTTLRGIRKTFEDCNTARAILESNDIRVIER  292

Query  904   DVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQAGA  1083
             D+SM SG+KEELRGLMGT  VKVPLVFVKGR+IGGADE++KLEEEGKLGILL GIP+A A
Sbjct  293   DISMDSGYKEELRGLMGTKEVKVPLVFVKGRLIGGADEMLKLEEEGKLGILLDGIPRAAA  352

Query  1084  GCDGCAGVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPICC  1227
              CDGCAG+RFV+C++CNGS K+L +D K+TVKCGECNENGLIQCPICC
Sbjct  353   TCDGCAGIRFVMCMDCNGSRKLLAKDGKSTVKCGECNENGLIQCPICC  400



>ref|XP_004246512.1| PREDICTED: glutaredoxin domain-containing cysteine-rich protein 
1 [Solanum lycopersicum]
Length=399

 Score =   426 bits (1095),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 259/407 (64%), Positives = 310/407 (76%), Gaps = 19/407 (5%)
 Frame = +1

Query  40    MGCVSSKLFPKDKDFPFAGDGGCATHVVSLTSSTYGVLKLDKDSHQQQTPPQCIKECVVE  219
             MGCV SKLF K K+    GD     HVVSLTSSTYGVL L+KDS+  + PP  IKECV E
Sbjct  1     MGCVPSKLFNK-KNLRKNGDD-YPDHVVSLTSSTYGVLNLEKDSNFVRNPPLSIKECVKE  58

Query  220   VKKASPAREKPPEVINAWELMEGLDE-TEMPAAKKSPKARSFLD-----HRRSPLKFLNQ  381
             +KK SP  E+  EVIN WELME LDE   +  +K SPK+R FL        RSPLKFLNQ
Sbjct  59    IKK-SPPHEESHEVINTWELMEDLDEEVVVKNSKISPKSRVFLRGFGDIDARSPLKFLNQ  117

Query  382   LASPGKLRRSGGKENKP-GRAMGRSEFSPKTVPKAYNLQESPWRVSPRLRSLKKGSPKLS  558
             ++SP K ++  GKEN+  G      +FSPK V K   L +SPW++ PRL   KKGSP   
Sbjct  118   MSSPRKFKKLSGKENRGRGNETNLVDFSPKNVLKDCKLMQSPWKMPPRLNFSKKGSP---  174

Query  559   PNELKCDSMRAESMAVCTRR-SLNPLFNPeigek---lsseeeeqikkMISSTPVSRKSR  726
              NE+KCDS++ +S+ V  RR SL+PLF+P++ E      S EEEQIKKM+S+TP+SRK+R
Sbjct  175   -NEVKCDSLKVDSVLVSRRRRSLSPLFDPQLVEAFEKEMSAEEEQIKKMVSATPISRKAR  233

Query  727   KSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERD  906
              SQEA +T+LE F +KCPP GEN+VVIYTTTLRGIRKTFEDCNTAR+ILES+ VR  ERD
Sbjct  234   HSQEA-ETMLELFEKKCPPEGENAVVIYTTTLRGIRKTFEDCNTARAILESNDVRVIERD  292

Query  907   VSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQAGAG  1086
             +SM SG+KEELRGLMGT  VKVPLVFVKGR+IGGADE++KLEEEGKLGILL GIP+A A 
Sbjct  293   ISMDSGYKEELRGLMGTKEVKVPLVFVKGRLIGGADEMLKLEEEGKLGILLDGIPRAAAT  352

Query  1087  CDGCAGVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPICC  1227
             CDGCAG+RFV+C++CNGS K+L +D K+TVKCG+CNENGLIQCPICC
Sbjct  353   CDGCAGIRFVMCMDCNGSRKLLAKDGKSTVKCGDCNENGLIQCPICC  399



>emb|CDP15428.1| unnamed protein product [Coffea canephora]
Length=404

 Score =   396 bits (1018),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 253/420 (60%), Positives = 305/420 (73%), Gaps = 42/420 (10%)
 Frame = +1

Query  40    MGCVSSKLFPKD--KDFPFAGDGGCATHVVSLTSSTYGVLKLDKDSHQQQTPPQ------  195
             MGCVSSKLF KD  ++         + HVVSLTSSTYGVL+LDK++ QQQ   Q      
Sbjct  1     MGCVSSKLFRKDLSQENLVQKADNISNHVVSLTSSTYGVLRLDKENQQQQQQGQHLHLQQ  60

Query  196   ---CIKECVVEVKKASPAREKPPEVINAWELMEGLDETEMPAA-----KKSPKARSFLD-  348
                 IK+C +++KK SP R++P EVINAWE+M+GL+E E+P +     KKSPK+R  L  
Sbjct  61    QLQSIKKCGIDLKKPSPPRQEP-EVINAWEIMQGLEE-EVPLSNLIPDKKSPKSRLLLRG  118

Query  349   ----HRRSPLKFLNQLASPGKLRRSGGKENKPGRAMGRSEFSPKTVPKAYNLQESPWRVS  516
                   RSPLKFLNQ+ASP KL++ GGKEN           +PKTV KA NLQ S  + S
Sbjct  119   FGDLDARSPLKFLNQMASPRKLKKFGGKENA----------TPKTVFKACNLQGSSQKAS  168

Query  517   PRLRSLKKGSPKLSPNELKCDSMRAESMAVCTRR-SLNPLFNPeigek---lsseeeeqi  684
             P LR  +K SP    N+ KC+S+R +S  V +RR SL PLF+PE+        SEE+EQI
Sbjct  169   PMLRVPRKDSP----NDAKCESLRIDSGVVLSRRRSLGPLFDPELVASFEKELSEEKEQI  224

Query  685   kkMISSTPVSRKSRKSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTAR  864
             KKM+S TP + K R SQ++  +ILE F +KCPP GE +VV+YTTTLRGIRKTFEDCNTAR
Sbjct  225   KKMVSGTPTAVKKRNSQDSV-SILENFEEKCPPGGEKAVVLYTTTLRGIRKTFEDCNTAR  283

Query  865   SILESHHVRTFERDVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegk  1044
             S++ESH V+ FERDVSMHSGFK+ELRGLMGT  VKVPLVFVKGR+IGGADE+VKLEE+GK
Sbjct  284   SVIESHQVQMFERDVSMHSGFKDELRGLMGTKEVKVPLVFVKGRLIGGADEIVKLEEDGK  343

Query  1045  lgillsgiPQAGAGCDGCAGVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPIC  1224
             LG L SGIP+A A C+GCAGVRFV+C++CNGSCKVL E  K TVKC ECNENGLIQCP C
Sbjct  344   LGTLFSGIPKAVAICNGCAGVRFVMCIDCNGSCKVLDEKGKKTVKCKECNENGLIQCPFC  403



>ref|XP_011094322.1| PREDICTED: uncharacterized protein At3g28850 [Sesamum indicum]
Length=410

 Score =   387 bits (995),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 252/417 (60%), Positives = 306/417 (73%), Gaps = 28/417 (7%)
 Frame = +1

Query  40    MGCVSSKLFPKD--KDFPFAGDGGCATHVVSLTSSTYGVLKLDKDSHQQQ-------TPP  192
             MGCVSSKL  K+  ++  +   G    HVVSLTSSTYGVLKLDKD    Q          
Sbjct  1     MGCVSSKLIAKEIKQENSYRRKGDYTHHVVSLTSSTYGVLKLDKDKESAQPQKQDQVEVK  60

Query  193   QCIKECVVEVKKASPAREKPPEVINAWELMEGLDETEMPA---AKKSPKARSFLDHRRSP  363
             Q IKECVVEVKKASP+RE+P E+INAWELMEGL+E  +P    +KKSPK+R F    RSP
Sbjct  61    QSIKECVVEVKKASPSREEPSEIINAWELMEGLEEEVVPVVVQSKKSPKSRPF--DARSP  118

Query  364   LKFLNQLASPGKLRRSGGKENKP--GRAMGRSEFSPKTVPKA-YNLQESPWRVSPRLRSL  534
             LKFLNQ++SP K+++ GGKENK      +G  + SPKTV K   NL+ES  + SPRL + 
Sbjct  119   LKFLNQMSSPRKVKKVGGKENKGSGNGGIGPLQNSPKTVLKECNNLKESVKKPSPRLWAS  178

Query  535   KKGSPKLSPNELKCDSMRAESMAVCTRR-SLNPLFNPeigeklsseeeeqikkM-----I  696
              +GSP    +  +CDS+R +S  V +RR SL PLF+PE+   L  E  E+ +++     I
Sbjct  179   IRGSP----HGKRCDSLRFDSGVVMSRRRSLGPLFDPELVASLEKEVSEEEEEIKKMVSI  234

Query  697   SSTPVSRKSRKSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILE  876
             SS P SRK+R S ++ D ILE + +KCPP GEN+VVIYTTTLRGIRKTFEDCN ARSI+E
Sbjct  235   SSPPTSRKARNSHDS-DAILEVYKKKCPPGGENAVVIYTTTLRGIRKTFEDCNVARSIIE  293

Query  877   SHHVRTFERDVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgil  1056
             S +VR  ERD+SMHSGFKEELR LM    VKVPLVFVKGR+IGGADE+VKL+EEGKLG L
Sbjct  294   SQNVRMIERDISMHSGFKEELRALMSCKEVKVPLVFVKGRLIGGADEMVKLDEEGKLGHL  353

Query  1057  lsgiPQAGAGCDGCAGVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPICC  1227
             L+GIP+A AGC GCAG+RF++C+ CNGSCKVLGED K +VKC +CNENGLIQCP+CC
Sbjct  354   LAGIPEAAAGCGGCAGIRFMMCVECNGSCKVLGEDGKKSVKCNKCNENGLIQCPLCC  410



>ref|XP_002276568.1| PREDICTED: uncharacterized protein At5g39865 [Vitis vinifera]
Length=398

 Score =   366 bits (940),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 242/413 (59%), Positives = 281/413 (68%), Gaps = 32/413 (8%)
 Frame = +1

Query  40    MGCVSSKLFPKD-KDFPFAGDGGCATHVVSLTSSTYGVLKLDKDSHQQQTPPQCIKECVV  216
             MGC SSKLF KD +      +G C  HVVSLTSSTYG LKLD D           KE V 
Sbjct  1     MGCASSKLFRKDLQQEILDKNGECLNHVVSLTSSTYGALKLDNDLRN--------KESVA  52

Query  217   EVKKASPAREKPPEVINAWELMEGLDETEMPAA---KKSPKARSFLD-----HRRSPLKF  372
             E K++ P  E   EVINAWELMEGL E  +P A   KKSPK+  FL        RSPLKF
Sbjct  53    EPKRSPPREE--AEVINAWELMEGL-EDGIPIAVPVKKSPKSLGFLRGFGDIDARSPLKF  109

Query  373   LNQLASPGKLRRSGGKENKP-----GRAMGRSEFSPKTVPKAYNLQESPWRVSPRLRSLK  537
             LNQ+ASP +++RSGGKENK      G   GRS+ SPK V +     E+  RV P LR   
Sbjct  110   LNQIASPKRIKRSGGKENKQRANGFGGGGGRSDCSPKLVLRDSTPSENIKRVVPTLRVPV  169

Query  538   KGSPKLSPNELKCDSMRAESMAVCTRRSLNPLFNPeigek---lsseeeeqikkMISSTP  708
             K +P     + K D+  +   +   R SL+PLF+PE+        SEE+EQIKK++S  P
Sbjct  170   KRTP---VGDGKADNFESGRGSSLRRMSLSPLFDPELLASFEKELSEEKEQIKKIVSPIP  226

Query  709   VSRKSRKSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHV  888
               +K R S++  ++IL+ F +KCPP G N+VVIYTTTLRGIRKTFEDCN  RSILESHH+
Sbjct  227   KVQKLRNSRDC-ESILDLFEKKCPPGGANAVVIYTTTLRGIRKTFEDCNHVRSILESHHI  285

Query  889   RTFERDVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgi  1068
               FERD+SM SG KEELRGLMGT  VKVPLVFVKGR+IGGADEVVKLEEEGKL IL  GI
Sbjct  286   HMFERDISMDSGLKEELRGLMGTKEVKVPLVFVKGRLIGGADEVVKLEEEGKLDILFDGI  345

Query  1069  PQAGAGCDGCAGVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPICC  1227
             P+A AGC GCAGVRFV+C+ CNGSCK+L ED K  VKC ECNENGLIQCPICC
Sbjct  346   PRALAGCQGCAGVRFVMCMACNGSCKLLDEDQKKMVKCSECNENGLIQCPICC  398



>ref|XP_007204384.1| hypothetical protein PRUPE_ppa006757mg [Prunus persica]
 gb|EMJ05583.1| hypothetical protein PRUPE_ppa006757mg [Prunus persica]
Length=396

 Score =   362 bits (928),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 234/415 (56%), Positives = 280/415 (67%), Gaps = 38/415 (9%)
 Frame = +1

Query  40    MGCVSSKLFPKD--KDFPFAGDGG--CATHVVSLTSSTYGVLKLDKDSHQQQTPPQCIKE  207
             MGCVSSKLF KD  K+     +GG     HVVSLTSSTYGVL L+ +        + IKE
Sbjct  1     MGCVSSKLFKKDLIKEDVIINNGGDYVINHVVSLTSSTYGVLNLENE--------RPIKE  52

Query  208   CVVEVKKA---SPAREKPPEVINAWELMEGLDETEMP---AAKKSPKARSFLD-----HR  354
             CV E K+A   SP+RE P EVINAWELMEGL+E  +P   +AKKSPK+R+ L        
Sbjct  53    CVAESKRAMKSSPSREDP-EVINAWELMEGLEEA-IPISNSAKKSPKSRALLRGFADFDA  110

Query  355   RSPLKFLNQLASPGKLRRSGGKENKPGRAMGRSEFSPKTVPKAYNLQESPWRVSPRLRSL  534
             R+P K LNQ+ SP KL+R GGKEN+ GR +    +SPK V K  N  E+  + +  L   
Sbjct  111   RTPFKLLNQIGSPMKLKRFGGKENR-GRVIHGLGYSPKQVLKPNNGGENSCKKALNLSPE  169

Query  535   KKGSPKLSPNE-LKCDSMRAESMAVCTRRSLNPLFNPeigeklsseeee---qikkMISS  702
              KGSP  +       DS R        R+S +PLF+PE+      E  E   QIK+M+  
Sbjct  170   VKGSPISAIRRSFGSDSSR--------RKSFSPLFDPELVASYEKEMSEEEEQIKRMVPP  221

Query  703   TPVSRKSRKSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESH  882
             +P +RK R S   ++++L  F +KCPP GEN+VV+YTTTLRGIRKTFEDCN  RSI+ESH
Sbjct  222   SPKARKLRNSSRDSESMLRLFEKKCPPGGENAVVVYTTTLRGIRKTFEDCNNVRSIIESH  281

Query  883   HVRTFERDVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgills  1062
              V   ERD+SM SGFKEE+RGLMGT  VKVPLVFVKGR+IGGADE+VKLEEEGKLG+L  
Sbjct  282   LVHVLERDISMDSGFKEEIRGLMGTKDVKVPLVFVKGRLIGGADEIVKLEEEGKLGVLFH  341

Query  1063  giPQAGAGCDGCAGVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPICC  1227
             GIP A  GC GCAG+RFV+C+ CNGSCKVL E  K  VKCGECNENGLI CPICC
Sbjct  342   GIPTALVGCQGCAGMRFVMCMECNGSCKVLDEGQKKMVKCGECNENGLIHCPICC  396



>ref|XP_004149222.1| PREDICTED: uncharacterized protein At5g39865-like [Cucumis sativus]
 ref|XP_004168347.1| PREDICTED: uncharacterized protein At5g39865-like [Cucumis sativus]
Length=397

 Score =   356 bits (914),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 234/413 (57%), Positives = 284/413 (69%), Gaps = 35/413 (8%)
 Frame = +1

Query  40    MGCVSSKLFPKD--KDFPFAGDGGCATHVVSLTSSTYGVLKLDKDSHQQQTPPQCIKECV  213
             MGCVSSKL+ KD  +D      G    HVVSLTSSTYGVL LD D        Q  KE V
Sbjct  1     MGCVSSKLYQKDLQRDIIVNNGGEYLNHVVSLTSSTYGVLNLDAD--------QKSKELV  52

Query  214   VEVKKASPAREKPPEVINAWELMEGLDETEMPAA---KKSPKARSFLD-----HRRSPLK  369
              E  K SP RE+P EVINAWELM+GL+E  +P A   KKSPK R FL       RRSPLK
Sbjct  53    SEPTKKSPPREEP-EVINAWELMDGLEEG-VPIANRGKKSPKPRVFLRGLADFDRRSPLK  110

Query  370   FLNQLASPGKLRRSGGKENKPGRA--MGRSEFSPKTVPKAYNLQESPWRVSPRLRSLKKG  543
             F NQ+ +P K  +SGGKEN+ GRA  +GR ++SPK + K  N      +VSP+  +LK  
Sbjct  111   FFNQIGTPKKAMKSGGKENR-GRANGVGRLDYSPKEILKVNN----SSKVSPK-SALKLT  164

Query  544   SP-KLSPNELKCDSMRAES-MAVCTRRSLNPLFNPeigeklsseeee---qikkMISSTP  708
              P K +P   +  S  ++S +    RRSL+PLF+PE+      +  E   QIK+++S TP
Sbjct  165   VPVKSTPISARRQSFGSDSGLLSARRRSLSPLFDPELVASYEKQLTEEGEQIKRIVSETP  224

Query  709   VSRKSRKSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHV  888
              SR +R  QE+ +T L++F + CPP GE SVVIYTTTLRGIRKTFEDCN  RSI+ES+ +
Sbjct  225   KSRAARHFQES-ETALKKFEELCPPGGETSVVIYTTTLRGIRKTFEDCNKVRSIVESYGI  283

Query  889   RTFERDVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgi  1068
                ERDVSM SGFKEELR LMG+  VKVP VFVKGR+IGGA EV+K+EEEGKLG+L  GI
Sbjct  284   HVVERDVSMDSGFKEELRALMGSKEVKVPAVFVKGRLIGGAAEVLKMEEEGKLGVLFEGI  343

Query  1069  PQ-AGAGCDGCAGVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPIC  1224
             P  AG+GC+GC G+RFV+CL+CNGSCKVL +  K T KCGECNENGLI+CPIC
Sbjct  344   PTAAGSGCEGCGGMRFVMCLDCNGSCKVLDQTKKKTTKCGECNENGLIRCPIC  396



>ref|XP_002309426.1| hypothetical protein POPTR_0006s22920g [Populus trichocarpa]
 gb|EEE92949.1| hypothetical protein POPTR_0006s22920g [Populus trichocarpa]
Length=407

 Score =   354 bits (909),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 235/416 (56%), Positives = 282/416 (68%), Gaps = 29/416 (7%)
 Frame = +1

Query  40    MGCVSSKLFPKD--KDFPFAGDGGCATHVVSLTSSTYGVLKLDKDSHQQQTPPQC---IK  204
             MGCVSSKLF K+  ++  F   G C  HVVSLTSSTYG LKLD ++ Q     Q    IK
Sbjct  1     MGCVSSKLFKKELRQEIKFNNGGRCVNHVVSLTSSTYGALKLDCNNQQPPQQEQKQEPIK  60

Query  205   ECVVEVK---KASPAREKPPEVINAWELMEGLDETEMPA---AKKSPKAR----SFLD-H  351
             E   E K   + SP +E+P EVIN WELM  L+E  +PA    K+SPK+R     F D  
Sbjct  61    EIAEESKIMQQRSPTKEEP-EVINTWELMGDLEEG-VPALNQTKRSPKSRVLRRGFADLD  118

Query  352   RRSPLKFLNQLASPGKLRRSGGKENKPGRAMGRSEFSPKTVPKAYNLQESPWRVSPRLRS  531
              RSPLKFLNQ+ SP K +  GGKENK  R+   S+FSPK V +A N   +  +   RL  
Sbjct  119   VRSPLKFLNQIGSPRKAKTFGGKENKVKRS---SDFSPKPVLRASNSSGNSSKAVLRLSY  175

Query  532   LKKGSPKLSPNELKCDSMRAES-MAVCTRRSLNPLFNPeigeklsseeeeqikkMISSTP  708
               KGSP       K +S R+ES ++   RRS +PLF+PE+      E  E+ +++     
Sbjct  176   PVKGSPVGD----KTESFRSESGVSPKRRRSFSPLFDPELVALYEKELSEEEEQIKRIIL  231

Query  709   VSRKSRKSQEAAD--TILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESH  882
              S +++K ++  D  +IL+ F QKCPP GEN VVIYTTTLRGIRKTFEDCNTARSI+ESH
Sbjct  232   PSSRTKKVKDLRDLESILQSFEQKCPPGGENKVVIYTTTLRGIRKTFEDCNTARSIIESH  291

Query  883   HVRTFERDVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgills  1062
             H+   ERDVSM SGFKEELR LMGT  VKVPLVFVKGR+IGGAD+VVKLEEEGKL IL  
Sbjct  292   HIHIVERDVSMDSGFKEELRRLMGTKEVKVPLVFVKGRLIGGADQVVKLEEEGKLEILFD  351

Query  1063  giPQAGA-GCDGCAGVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPICC  1227
             GIP+  A GC+GCAGVRF++C+ CNGSCKVL E  K  V+CGECNENGLIQCPICC
Sbjct  352   GIPRGLAGGCEGCAGVRFMMCVQCNGSCKVLDEMQKKMVRCGECNENGLIQCPICC  407



>ref|XP_008442848.1| PREDICTED: uncharacterized protein At5g39865 isoform X1 [Cucumis 
melo]
Length=397

 Score =   354 bits (908),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 230/413 (56%), Positives = 283/413 (69%), Gaps = 35/413 (8%)
 Frame = +1

Query  40    MGCVSSKLFPKD--KDFPFAGDGGCATHVVSLTSSTYGVLKLDKDSHQQQTPPQCIKECV  213
             MGCVSSKL+ KD  +D      G    HVVSLTSSTYGVL LD D        Q  KE V
Sbjct  1     MGCVSSKLYRKDLQRDIIVNNGGEYLNHVVSLTSSTYGVLNLDAD--------QKSKELV  52

Query  214   VEVKKASPAREKPPEVINAWELMEGLDETEMPAA---KKSPKARSFLD-----HRRSPLK  369
             +E  K SP RE+P EVINAWELM+GL+E  +P A   KKSPK R FL       RRSPLK
Sbjct  53    LETTKKSPPREEP-EVINAWELMDGLEEG-IPIANRGKKSPKTRVFLRGLADFDRRSPLK  110

Query  370   FLNQLASPGKLRRSGGKENKPGR--AMGRSEFSPKTVPKAYNLQESPWRVSPRLRSLKKG  543
             F NQ+ +P K  +SGGKEN+ GR   +GR ++SPK + K  N      +VSP+  +LK  
Sbjct  111   FFNQIGTPKKAMKSGGKENR-GRVNGVGRLDYSPKEILKVNN----SSKVSPK-SALKLT  164

Query  544   SP-KLSPNELKCDSMRAES-MAVCTRRSLNPLFNPeigeklsseeee---qikkMISSTP  708
              P K +P   +  S  ++S +    RRSL+PLF+PE+      +  E   QIK+++S TP
Sbjct  165   VPVKSTPISARRQSFGSDSGLLSARRRSLSPLFDPELVASYERQLTEEGEQIKRIVSETP  224

Query  709   VSRKSRKSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHV  888
              S+ +R  QE+ +T L+ F + CPP GE SVVIYTTTLRGIRKTFEDCN  RSI+ES+ +
Sbjct  225   KSKAARHFQES-ETALKHFEELCPPGGETSVVIYTTTLRGIRKTFEDCNKVRSIVESYGI  283

Query  889   RTFERDVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgi  1068
                ERDVSM SGFKE+LR LMG+  VKVP +FVKGR+IGGA EV+K+EEEGKLG+L  GI
Sbjct  284   HVVERDVSMDSGFKEDLRALMGSKEVKVPALFVKGRLIGGAAEVLKMEEEGKLGVLFEGI  343

Query  1069  PQ-AGAGCDGCAGVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPIC  1224
             P  AG+GC+GC G+RFV+CL+CNGSCKVL +  K T KCGECNENGLI+CPIC
Sbjct  344   PTAAGSGCEGCGGMRFVMCLDCNGSCKVLDQTKKKTTKCGECNENGLIRCPIC  396



>ref|XP_008359492.1| PREDICTED: uncharacterized protein LOC103423198 [Malus domestica]
Length=394

 Score =   352 bits (903),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 227/412 (55%), Positives = 275/412 (67%), Gaps = 35/412 (8%)
 Frame = +1

Query  40    MGCVSSKLFPKDKDFPFAGDGGCATHVVSLTSSTYGVLKLDKDSHQQQTPPQCIKECVVE  219
             MGCVSSKLF K+ +    G      HVVSLTSSTYGVL L+ D       PQ  K+   E
Sbjct  1     MGCVSSKLFKKEDNN--GGGEYVINHVVSLTSSTYGVLNLEND-------PQSTKDGAEE  51

Query  220   ---VKKASPAREKPPEVINAWELMEGLDETEMPA---AKKSPKARSFLD-----HRRSPL  366
                V+K+SP RE P EVINAWELMEGL+E  MP    AKKSPK+R+ L        RSP 
Sbjct  52    SKRVEKSSPPREDP-EVINAWELMEGLEEG-MPISNPAKKSPKSRALLRGFADFDSRSPF  109

Query  367   KFLNQLASPGKLRRSGGKENKPGRAMGRSE--FSPKTVPKAYNLQESPWRVSPRLRSLKK  540
             K LNQ+ SP K +R GGKEN  GR +  +   +SPK V K  N  E+  +         K
Sbjct  110   KLLNQIGSPMKSKRFGGKENSKGRVVNVNALGYSPKQVLKQKNGGENSCKKMLNWSPSVK  169

Query  541   GSPKLSPNELKCDSMRAESMAVCTRRSLNPLFNPeigeklsseeeeqikk---MISSTPV  711
             GSP  +    K  S  ++S    ++RS +PLF+PE+      E  E+ ++   M+  +P 
Sbjct  170   GSPVAA----KRQSFGSDS----SQRSFSPLFDPELVASYEKEISEEKEQIKRMVPPSPR  221

Query  712   SRKSRKSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVR  891
              RK R S + ++++L+ F +KCPP GEN+VV+YTTTLRGIRKTFEDCN  RSI+ESH + 
Sbjct  222   PRKLRNSSKDSESMLQLFEKKCPPGGENAVVVYTTTLRGIRKTFEDCNNVRSIVESHLIH  281

Query  892   TFERDVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiP  1071
               ERD+SM SGFKEE+RGLMGT  VKVPLVFVKGR+IGGADEVVKLEEEGKLG+L  GIP
Sbjct  282   VLERDISMDSGFKEEIRGLMGTKEVKVPLVFVKGRLIGGADEVVKLEEEGKLGVLFDGIP  341

Query  1072  QAGAGCDGCAGVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPICC  1227
             +A  GC GCAG+RFV+C+ CNGSCKVL E  K  VKCGECNENGLI CPICC
Sbjct  342   RAVMGCKGCAGMRFVMCMVCNGSCKVLDELRKRMVKCGECNENGLIHCPICC  393



>ref|XP_002530319.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF32035.1| conserved hypothetical protein [Ricinus communis]
Length=427

 Score =   351 bits (901),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 236/434 (54%), Positives = 285/434 (66%), Gaps = 45/434 (10%)
 Frame = +1

Query  40    MGCVSSKLFPKD--KDFPFAGDGG-CATHVVSLTSSTYGVLKLD-------------KDS  171
             MGCVSSKLF ++  +D      GG C +HVVSLTSSTYG LKLD             K++
Sbjct  1     MGCVSSKLFKRELHQDIIVNNGGGHCVSHVVSLTSSTYGALKLDISEKLQQQQQWQGKEN  60

Query  172   HQQQTPPQC-----IKECVVEVKK----ASPAREKPPEVINAWELMEGLDETEMPAAKKS  324
              Q++   +      IKE VVE KK    +SP R++ PEVIN WELME L+E E    KKS
Sbjct  61    RQEEEQEEDVEEVPIKEIVVESKKVEERSSPPRDQEPEVINTWELMEDLEE-EGGVHKKS  119

Query  325   PKARS-------FLD-HRRSPLKFLNQLASPGKLRRSGGKENKPGRAMGRSEFSPKTVPK  480
             PK+R        F D   RSPLKFLNQ+ SP K +  GGKENK  R    S+FSP+ V K
Sbjct  120   PKSRGGGILFRGFKDVDVRSPLKFLNQIGSPRKAKTFGGKENKVRRM---SDFSPRPVFK  176

Query  481   AYNLQESPWRVSPRLRSLKKGSPKLSPNELKCDSMRAESMAVCTR-RSLNPLFNPeigek  657
               N      +   RL    KGS   +  E   ++   +  A+ +R RS +PLF+PE+   
Sbjct  177   EINSSGKSNKAVMRLSYPIKGSSISTRTE---NAAAGDYSALSSRTRSFSPLFDPELVAL  233

Query  658   lsseeee---qikkMISSTPVSRKSRKSQEAADTILEQFNQKCPPAGENSVVIYTTTLRG  828
                E  E   ++K++IS TP   +  K+    ++IL+ F QKCPP GEN+VV+YTTTLRG
Sbjct  234   YERELTEEEEKVKRIISITPKPHQKFKNSLQLESILQSFEQKCPPGGENAVVLYTTTLRG  293

Query  829   IRKTFEDCNTARSILESHHVRTFERDVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGG  1008
             IRKTFEDCNT RSI+ESHH+   ERD+SM SG KEELR LMGT VVKVPLVFVKGR+IGG
Sbjct  294   IRKTFEDCNTVRSIIESHHIHMLERDISMDSGLKEELRRLMGTKVVKVPLVFVKGRLIGG  353

Query  1009  ADEVVkleeegklgillsgiPQAGA-GCDGCAGVRFVLCLNCNGSCKVLGEDLKNTVKCG  1185
             AD+VVKLEEEGKLGIL  GIP+  A GC+GCAGVRFV+C+ CNGSCKVL  + K  VKCG
Sbjct  354   ADQVVKLEEEGKLGILFDGIPRGLAGGCEGCAGVRFVMCMECNGSCKVLDNEQKKMVKCG  413

Query  1186  ECNENGLIQCPICC  1227
             ECNENGLIQCPICC
Sbjct  414   ECNENGLIQCPICC  427



>gb|KGN59140.1| hypothetical protein Csa_3G776990 [Cucumis sativus]
Length=572

 Score =   356 bits (913),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 234/413 (57%), Positives = 284/413 (69%), Gaps = 35/413 (8%)
 Frame = +1

Query  40    MGCVSSKLFPKD--KDFPFAGDGGCATHVVSLTSSTYGVLKLDKDSHQQQTPPQCIKECV  213
             MGCVSSKL+ KD  +D      G    HVVSLTSSTYGVL LD D        Q  KE V
Sbjct  176   MGCVSSKLYQKDLQRDIIVNNGGEYLNHVVSLTSSTYGVLNLDAD--------QKSKELV  227

Query  214   VEVKKASPAREKPPEVINAWELMEGLDETEMPAA---KKSPKARSFLD-----HRRSPLK  369
              E  K SP RE+P EVINAWELM+GL+E  +P A   KKSPK R FL       RRSPLK
Sbjct  228   SEPTKKSPPREEP-EVINAWELMDGLEEG-VPIANRGKKSPKPRVFLRGLADFDRRSPLK  285

Query  370   FLNQLASPGKLRRSGGKENKPGRA--MGRSEFSPKTVPKAYNLQESPWRVSPRLRSLKKG  543
             F NQ+ +P K  +SGGKEN+ GRA  +GR ++SPK + K  N      +VSP+  +LK  
Sbjct  286   FFNQIGTPKKAMKSGGKENR-GRANGVGRLDYSPKEILKVNNSS----KVSPK-SALKLT  339

Query  544   SP-KLSPNELKCDSMRAES-MAVCTRRSLNPLFNPeigeklsseeee---qikkMISSTP  708
              P K +P   +  S  ++S +    RRSL+PLF+PE+      +  E   QIK+++S TP
Sbjct  340   VPVKSTPISARRQSFGSDSGLLSARRRSLSPLFDPELVASYEKQLTEEGEQIKRIVSETP  399

Query  709   VSRKSRKSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHV  888
              SR +R  QE+ +T L++F + CPP GE SVVIYTTTLRGIRKTFEDCN  RSI+ES+ +
Sbjct  400   KSRAARHFQES-ETALKKFEELCPPGGETSVVIYTTTLRGIRKTFEDCNKVRSIVESYGI  458

Query  889   RTFERDVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgi  1068
                ERDVSM SGFKEELR LMG+  VKVP VFVKGR+IGGA EV+K+EEEGKLG+L  GI
Sbjct  459   HVVERDVSMDSGFKEELRALMGSKEVKVPAVFVKGRLIGGAAEVLKMEEEGKLGVLFEGI  518

Query  1069  PQ-AGAGCDGCAGVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPIC  1224
             P  AG+GC+GC G+RFV+CL+CNGSCKVL +  K T KCGECNENGLI+CPIC
Sbjct  519   PTAAGSGCEGCGGMRFVMCLDCNGSCKVLDQTKKKTTKCGECNENGLIRCPIC  571



>ref|XP_004305334.1| PREDICTED: uncharacterized protein At5g39865-like [Fragaria vesca 
subsp. vesca]
Length=380

 Score =   349 bits (895),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 221/405 (55%), Positives = 270/405 (67%), Gaps = 34/405 (8%)
 Frame = +1

Query  40    MGCVSSKLFPKDKDFPFAGDGGCATHVVSLTSSTYGVLKLDKDSHQQQTPPQCIKECVVE  219
             MGCVSSKLF  D         G   HVVSLTSSTYG+L LDKD       P  + E  + 
Sbjct  1     MGCVSSKLFKNDLREEVIITHGALNHVVSLTSSTYGLLNLDKD-------PIVVSEATL-  52

Query  220   VKKASPAREKPPEVINAWELMEGLDETEMPAAKKSPKARS----FLDH-RRSPLKFLNQL  384
              K++SP +E P EVINAWELMEGL+E  +P  + SPK+RS    F+D   RSPLK LNQL
Sbjct  53    -KQSSPKKEDP-EVINAWELMEGLEEA-VPVKRSSPKSRSVLRGFVDFDARSPLKMLNQL  109

Query  385   ASPGKLRRSGGKENKPGRAMGRSEFSPKTVPKAYNLQESPWRVSPRLRSLKKGSP-KLSP  561
              SP K RR GGKENK GR      +SPK   K+    E+  + +  +    KGSP     
Sbjct  110   GSPMKGRRFGGKENK-GRG-----YSPKGWVKSNIGSENSCKKALNMSPAVKGSPVSAQR  163

Query  562   NELKCDSMRAESMAVCTRRSLNPLFNPeigeklsseeeeqikkM---ISSTPVSRKSRKS  732
                  DS R        R+S++PLF+PE+      E  E+ +++   +  +P +RK R  
Sbjct  164   RSFGSDSSR--------RKSISPLFDPELVASYEKEMFEEEEQIKRVVLPSPKTRKMRYC  215

Query  733   QEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVS  912
                ++++L+ F +KCPP GEN+VVIYTTTLRGIRKTFEDCN  RSI+ESH VR  ERD+S
Sbjct  216   TRDSESMLKLFEKKCPPGGENAVVIYTTTLRGIRKTFEDCNNVRSIVESHLVRVLERDIS  275

Query  913   MHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQAGAGCD  1092
             M SGFKEE+RGLMG+  V+VPLVFVKGR+IGGADE+VKLEEEGKLG+L  GIP+A  GC 
Sbjct  276   MDSGFKEEIRGLMGSKEVRVPLVFVKGRLIGGADEIVKLEEEGKLGVLFDGIPKALVGCQ  335

Query  1093  GCAGVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPICC  1227
             GCAG+RFV+C+ CNGSCKVL E  K  VKCGECNENGLI CP+CC
Sbjct  336   GCAGMRFVMCVECNGSCKVLDEAQKKMVKCGECNENGLIHCPLCC  380



>ref|XP_011004237.1| PREDICTED: uncharacterized protein At3g28850 [Populus euphratica]
Length=407

 Score =   350 bits (897),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 233/415 (56%), Positives = 280/415 (67%), Gaps = 29/415 (7%)
 Frame = +1

Query  40    MGCVSSKLFPKD--KDFPFAGDGGCATHVVSLTSSTYGVLKLDKDSHQQQTPPQC---IK  204
             MGCVSSKLF K+  ++  F   G C  HVVSLTSSTYG LKLD ++ Q     Q    IK
Sbjct  1     MGCVSSKLFKKELRQEIKFNNGGRCVNHVVSLTSSTYGALKLDCNNQQPPQQEQKQEPIK  60

Query  205   ECVVEVK---KASPAREKPPEVINAWELMEGLDETEMPA---AKKSPKAR----SFLD-H  351
             E   E K   + SP +E+P EVIN WELM  L+E  +PA    K+SPK+R     F D  
Sbjct  61    EIAEESKIMQQRSPTKEEP-EVINTWELMGDLEEG-VPALNQTKRSPKSRVLRRGFADLD  118

Query  352   RRSPLKFLNQLASPGKLRRSGGKENKPGRAMGRSEFSPKTVPKAYNLQESPWRVSPRLRS  531
              RSPLKFLNQ+ SP K +  GGKENK  R+   S+FSPK V +A N      +   RL  
Sbjct  119   VRSPLKFLNQIGSPRKAKTFGGKENKAKRS---SDFSPKPVLRASNSSGYSSKAVLRLSY  175

Query  532   LKKGSPKLSPNELKCDSMRAES-MAVCTRRSLNPLFNPeigeklsseeeeqikkMISSTP  708
               KGSP       K +S R+ES ++   RRS +PLF+PE+      E  E+ +++     
Sbjct  176   PVKGSPVGD----KTESFRSESGVSPKRRRSFSPLFDPELVALYEKELSEEEEQIKRIIL  231

Query  709   VSRKSRKSQEAAD--TILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESH  882
              S +++K ++  D  +IL+ F QKCPP GEN VVIYTTTLRGIRKTFEDCNTARSI+ESH
Sbjct  232   PSSRTKKVKDLRDLESILQSFEQKCPPGGENKVVIYTTTLRGIRKTFEDCNTARSIIESH  291

Query  883   HVRTFERDVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgills  1062
             H+   ERDVSM SGFKEELR LMGT  VKVPLVFVKGR+IGGAD+VVKLEEEGKL IL  
Sbjct  292   HIHIVERDVSMDSGFKEELRRLMGTKEVKVPLVFVKGRLIGGADQVVKLEEEGKLEILFD  351

Query  1063  giPQAGA-GCDGCAGVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPIC  1224
             GIP+  A GC+GCAGVRF++C+ CNGSCKVL E  K  V+CG+CNENGLIQCPIC
Sbjct  352   GIPRGLAGGCEGCAGVRFMMCVQCNGSCKVLDEMQKKMVRCGKCNENGLIQCPIC  406



>ref|XP_009374710.1| PREDICTED: uncharacterized protein LOC103963605 [Pyrus x bretschneideri]
Length=394

 Score =   348 bits (894),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 226/409 (55%), Positives = 276/409 (67%), Gaps = 29/409 (7%)
 Frame = +1

Query  40    MGCVSSKLFPKDKDFPFAGDGGCATHVVSLTSSTYGVLKLDKDSHQQQTPPQCIKECVVE  219
             MGCVSSKLF K+ +    G      HVVSLTSSTYGVL L+ D    + P +   E    
Sbjct  1     MGCVSSKLFKKEDNN--GGGEYVINHVVSLTSSTYGVLNLEND----RQPTKDSAEENKR  54

Query  220   VKKASPAREKPPEVINAWELMEGLDETEMPAA---KKSPKARS----FLDH-RRSPLKFL  375
             V K+SP RE P EVINAWELMEGL+E  +P A   KKSP +R+    F+D   RSP K L
Sbjct  55    VAKSSPPREDP-EVINAWELMEGLEEG-VPIANPVKKSPNSRALRRGFVDFDSRSPFKLL  112

Query  376   NQLASPGKLRRSGGKENKPGRAMGRS--EFSPKTVPKAYNLQESPWRVSPRLRSLKKGSP  549
             NQ+ SP KL+R GGKEN  GR +  +   +SPK V K  N  E+  +         KGSP
Sbjct  113   NQIGSPLKLKRYGGKENSKGRVVNVNVLGYSPKQVLKPKNGGENSCKKMLNWSPGVKGSP  172

Query  550   KLSPNELKCDSMRAESMAVCTRRSLNPLFNPeigeklsseeeeqikk---MISSTPVSRK  720
               +    K  S  ++S    ++RS +PLF+PE+      E  E+ ++   M+  +P  RK
Sbjct  173   VAA----KRQSFGSDS----SQRSFSPLFDPELVASYEKEMSEEKEQIKRMVPPSPKPRK  224

Query  721   SRKSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFE  900
              R S + ++++L+ F +KCPP GEN+VV+YTTTLRGIRKTFEDCN  RSI+ESH +   E
Sbjct  225   LRNSSKDSESMLQLFEKKCPPGGENAVVVYTTTLRGIRKTFEDCNNVRSIVESHLIHVLE  284

Query  901   RDVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQAG  1080
             RD+SM SGFKEE+RGLMGT  VKVPLVFVKGR+IGGADEVVKLEEEGKLGIL +GIP+A 
Sbjct  285   RDISMDSGFKEEIRGLMGTKEVKVPLVFVKGRLIGGADEVVKLEEEGKLGILFNGIPRAV  344

Query  1081  AGCDGCAGVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPICC  1227
              GC GCAG+RFV+C+ CNGSCKVL E  K  VKCGECNENGLI CPICC
Sbjct  345   MGCKGCAGMRFVMCMVCNGSCKVLDELQKKMVKCGECNENGLIHCPICC  393



>ref|XP_009336960.1| PREDICTED: uncharacterized protein At5g39865-like [Pyrus x bretschneideri]
Length=394

 Score =   347 bits (891),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 226/408 (55%), Positives = 274/408 (67%), Gaps = 27/408 (7%)
 Frame = +1

Query  40    MGCVSSKLFPKDKDFPFAGDGGCATHVVSLTSSTYGVLKLDKDSHQQQTPPQCIKECVVE  219
             MGCVSSKLF K+ +    G      HVVSLTSSTYGVL L+ D    + P +   E    
Sbjct  1     MGCVSSKLFKKEDNN--GGGEYVINHVVSLTSSTYGVLNLEND----RQPTKDSAEESKR  54

Query  220   VKKASPAREKPPEVINAWELMEGLDETEMPA--AKKSPKARS----FLDH-RRSPLKFLN  378
             V K+SP RE P EVINAWELMEGL+E    A  AKKSPK+R+    F+D   RSP K LN
Sbjct  55    VAKSSPPREDP-EVINAWELMEGLEEGVPIANPAKKSPKSRALLRGFVDFDSRSPFKLLN  113

Query  379   QLASPGKLRRSGGKENKPGRAMGRS--EFSPKTVPKAYNLQESPWRVSPRLRSLKKGSPK  552
             Q+ SP KL+R GGKEN  GR +  +   +SPK V K  N  E+  +         KGSP 
Sbjct  114   QIGSPLKLKRYGGKENSKGRVVNVNVLGYSPKQVLKPKNGGENSCKKMLNWSPGVKGSPV  173

Query  553   LSPNELKCDSMRAESMAVCTRRSLNPLFNPeigeklsseeeeqikk---MISSTPVSRKS  723
              +    K  S  ++S    ++RS + LF+PE+      E  E+ ++   M+  +P  RK 
Sbjct  174   AA----KRQSFGSDS----SQRSFSLLFDPELVASYEKEMSEEKEQIKRMVPPSPKPRKL  225

Query  724   RKSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFER  903
             R S + ++++L+ F +KCPP GEN+VV+YTTTLRGIRKTFEDCN  RSI+ESH +   ER
Sbjct  226   RNSSKDSESMLQLFKKKCPPGGENAVVVYTTTLRGIRKTFEDCNNVRSIVESHLIHVLER  285

Query  904   DVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQAGA  1083
             D+SM SGFKEE+RGLMGT  VKVPLVFVKGR+IGGADEVVKLEEEGKLGIL  GIP+A  
Sbjct  286   DISMDSGFKEEIRGLMGTKEVKVPLVFVKGRLIGGADEVVKLEEEGKLGILFDGIPRAVM  345

Query  1084  GCDGCAGVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPICC  1227
             GC GCAG+RFV+C+ CNGSCKVL E  K  VKCGECNENGLI CPICC
Sbjct  346   GCKGCAGMRFVMCMVCNGSCKVLDELQKKMVKCGECNENGLIHCPICC  393



>ref|XP_006481760.1| PREDICTED: uncharacterized protein At3g28850-like [Citrus sinensis]
Length=413

 Score =   346 bits (887),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 221/426 (52%), Positives = 279/426 (65%), Gaps = 44/426 (10%)
 Frame = +1

Query  40    MGCVSSKLFPKD--KDFPF-AGDGG---CATHVVSLTSSTYGVLKLD------KDSHQQQ  183
             MGCVSSK   ++  +D     GDGG      HVVSLTSSTYGVLKLD      +D  ++Q
Sbjct  2     MGCVSSKHVKRELRRDILLNHGDGGEEYVVNHVVSLTSSTYGVLKLDNEQKLKQDEEKEQ  61

Query  184   TPPQCIKECVVEVKK------ASPAREKPPEVINAWELMEGLDE-TEMPAA---KKSPKA  333
               P   K+ V E  K       SP RE PPEVINAWELMEGL+E  ++P +   KKSPKA
Sbjct  62    EIP--TKDIVAETTKKKKVVKGSPPRE-PPEVINAWELMEGLEEEVQVPISNLTKKSPKA  118

Query  334   RSFLD-----HRRSPLKFLNQLASPGKLRRSGGKENKPGRAMG--RSEFSPKTVPKAYNL  492
             R  L        RSPLKFLNQ  SP K ++ GGKENK  R  G  +S+FSPK+V K  N 
Sbjct  119   RVLLRGFADMDARSPLKFLNQFGSPRKAKKFGGKENKV-RVNGPVKSDFSPKSVLKVKNF  177

Query  493   QESPWRVSPRLRSLKKGSPKLSPNELKCDSMRAESMAVCTRRSLNPLFNPeigeklssee  672
             Q+S  + +  L  +           +K +S+  +S     RRS +PLF+P++      E 
Sbjct  178   QDSSCKKALNLNIVP----------VKNESLGCDSEVSLWRRSFSPLFDPDLIANYEREL  227

Query  673   eeqikkMISSTPVSRKSRKSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDC  852
              E  +++      +  +R  + +++++L  +++KCPP GEN+VVIYTTTLRGIRKTFEDC
Sbjct  228   SEGEEQIKRIISPTFSNRNCKSSSESLLNVYDKKCPPGGENAVVIYTTTLRGIRKTFEDC  287

Query  853   NTARSILESHHVRTFERDVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkle  1032
             N  RSI+ESH V+T ERD+SM SGFKEELR LM +  VKVPLVFVKGR+IGG DEV+KLE
Sbjct  288   NKVRSIIESHQVQTLERDISMDSGFKEELRALMESKQVKVPLVFVKGRLIGGVDEVMKLE  347

Query  1033  eegklgillsgiPQAG-AGCDGCAGVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLI  1209
             EEGKL IL   IP+A   GC+GCAGVRF++C+ CNGSCKVL  + K  ++CGECNENGLI
Sbjct  348   EEGKLEILFDRIPKAAIGGCEGCAGVRFMMCMECNGSCKVLDGEQKKMIRCGECNENGLI  407

Query  1210  QCPICC  1227
             QCP+CC
Sbjct  408   QCPVCC  413



>ref|XP_007027759.1| Glutaredoxin family protein, putative [Theobroma cacao]
 gb|EOY08261.1| Glutaredoxin family protein, putative [Theobroma cacao]
Length=389

 Score =   344 bits (883),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 228/411 (55%), Positives = 274/411 (67%), Gaps = 37/411 (9%)
 Frame = +1

Query  40    MGCVSSKLFPKD--KDFPFAGDGGCATHVVSLTSSTYGVLKLDKDSHQQQTPPQCIKECV  213
             MGCVSSKL  K+  ++      G    HVVSL SSTYGVLKLD +  QQ+         +
Sbjct  1     MGCVSSKLVKKEIKREILLNNGGDYVNHVVSLKSSTYGVLKLDNEIEQQEEVG------I  54

Query  214   VEVKKA--SPAREKPPEVINAWELMEGLDETEMPAAKKSPKARSFL-----DHRRSPLKF  372
              E K+   SP RE+P EVINAWELME L+E      K+SPK+R F         RSPLKF
Sbjct  55    SETKRVQRSPPREEP-EVINAWELMEDLEED--GTIKRSPKSRVFARGVGQKDVRSPLKF  111

Query  373   LNQLASPGKLRRSGGKENKPGRAMGRSEFSPKTVPKAYNLQESPWRVSPRLRSLKKGSPK  552
             LNQ+ SP K+RR GGKENK GR  G+S+FSPK++           RV+  L    K   K
Sbjct  112   LNQIGSPLKMRRFGGKENK-GRVDGKSDFSPKSI----------LRVNNSLDGSCKAVLK  160

Query  553   LSPNELKCDSMRAE---SMAVCTRRSLNPLFNPeigeklsseeee---qikkMISSTPVS  714
             LS    +  S   E   S     RRS +PLF+PE+      E  E   QIK++IS  P  
Sbjct  161   LSYPVKRTRSEGFEGGDSGFSARRRSFSPLFDPELVALYEKELSEEEEQIKRIISPEPEI  220

Query  715   RKSRKSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRT  894
             RK +KSQ++   IL+ F +KCP AGEN+VVIYTTTLRGIRKTFE+CNT RSI+ES+ ++ 
Sbjct  221   RKWKKSQDSK-AILQVFEEKCPAAGENAVVIYTTTLRGIRKTFEECNTVRSIIESYDIQM  279

Query  895   FERDVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQ  1074
             FERD+SM SGFKEELR L GT  VKVPLVFVKGR+IGG +E+VKLEEEGKL IL +GIP+
Sbjct  280   FERDISMDSGFKEELRKLTGTKEVKVPLVFVKGRLIGGVEEIVKLEEEGKLEILFNGIPR  339

Query  1075  AGAGCDGCAGVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPICC  1227
             A  GC+GCAGVRFV+C  CNGSCKVL  D K  ++CGECNENGL+QCPICC
Sbjct  340   AIPGCEGCAGVRFVMCTECNGSCKVLDGDQKK-IRCGECNENGLVQCPICC  389



>ref|XP_008243566.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein At3g28850 
[Prunus mume]
Length=387

 Score =   343 bits (880),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 225/415 (54%), Positives = 270/415 (65%), Gaps = 47/415 (11%)
 Frame = +1

Query  40    MGCVSSKLFPKD--KDFPFAGDGG--CATHVVSLTSSTYGVLKLDKDSHQQQTPPQCIKE  207
             MGCVSSKLF KD  K+     +GG     HVVSLTSSTYGVL L+ +        + IK+
Sbjct  1     MGCVSSKLFKKDLIKEDVIINNGGDYVINHVVSLTSSTYGVLNLENE--------RPIKD  52

Query  208   CVVEVKKA---SPAREKPPEVINAWELMEGLDETEMP---AAKKSPKARSFLD-----HR  354
             CV E K+A   SP+RE P EVINAWELMEGL+E  +P   +AKKSPK+R+ L        
Sbjct  53    CVAESKRAMKSSPSREDP-EVINAWELMEGLEEA-IPISNSAKKSPKSRALLRGFADFDA  110

Query  355   RSPLKFLNQLASPGKLRRSGGKENKPGRAMGRSEFSPKTVPKAYNLQESPWRVSPRLRSL  534
             R+P K LNQ+ SP             GR +    +SPK V K  N  E+  + +  L   
Sbjct  111   RTPFKLLNQIGSP----------XNRGRVIHGLGYSPKQVLKPNNGGENSCKKALNLSPE  160

Query  535   KKGSPKLSPNE-LKCDSMRAESMAVCTRRSLNPLFNPeigeklsseeee---qikkMISS  702
              KGSP  +      CDS R        R+S +PLF+PE+      E  E    IK+M+  
Sbjct  161   VKGSPISAIRRSFGCDSTR--------RKSFSPLFDPELVASYEKEMSEEEEHIKRMVPP  212

Query  703   TPVSRKSRKSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESH  882
             +P +RK R S   ++++L  F +KCPP GEN+VV+YTTTLRGIRKTFEDCN  RSI+ESH
Sbjct  213   SPKARKFRNSSRDSESMLRLFEKKCPPGGENAVVVYTTTLRGIRKTFEDCNIVRSIIESH  272

Query  883   HVRTFERDVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgills  1062
              V   ERD+SM SGFKEE+RGLMGT  VKVPLVFVKGR+IGGADE+VKLEEEGKLG+L  
Sbjct  273   LVHVLERDISMDSGFKEEIRGLMGTKDVKVPLVFVKGRLIGGADEIVKLEEEGKLGVLFD  332

Query  1063  giPQAGAGCDGCAGVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPICC  1227
             GIP A  GC GCAG+RFV+C+ CNGSCKVL E  K  VKCGECNENGLI CPICC
Sbjct  333   GIPTALVGCQGCAGMRFVMCMECNGSCKVLDEGQKKMVKCGECNENGLIHCPICC  387



>ref|XP_010271643.1| PREDICTED: uncharacterized protein At3g28850 [Nelumbo nucifera]
Length=403

 Score =   343 bits (879),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 231/423 (55%), Positives = 287/423 (68%), Gaps = 47/423 (11%)
 Frame = +1

Query  40    MGCVSSKLFPKD--KDFPFAGDGGCATHVVSLTSSTYGVLKLDKDSHQQQTPPQCIKECV  213
             MGCVSSKL  K+  ++  F G+G    HVVSLTSSTYGVLKLD+++         IKE  
Sbjct  1     MGCVSSKLIRKELNQELLF-GNGDYVNHVVSLTSSTYGVLKLDEET---------IKEPD  50

Query  214   VEVKKASPAREKP---------PEVINAWELMEGLDETEMPAA---KKSPKARSFLDHR-  354
              EVK +SP    P         PEVINAWELM+ L E E+P +   KKSPK + FL    
Sbjct  51    KEVK-SSPRIVLPRFQKKGSEEPEVINAWELMKDL-EDEIPVSVQVKKSPKPQGFLRKVA  108

Query  355   ----RSPLKFLNQLASPGKLRRSGGKENKPGRA-----MGRSEFSPKTVPKAYNLQESPW  507
                 ++P KF ++L+SP K ++  GKENK  R+     + RSE SPK V +  N   S  
Sbjct  109   GMDIKTPSKFFSELSSPRKQKKFAGKENKHRRSGSDGGVARSEPSPKQVLQPLN---SVD  165

Query  508   RVSPRLRSLKKGSPKLSPNELKCDSMRAESMAVCTRRSLNPLFNPeigeklsse---eee  678
              V  R+ SL   + K +P  LK +S R  S    +RRSL+PLF+PE+      E   E E
Sbjct  166   NVQKRIVSLNIPT-KNTPTNLKANSFRNHSGLSMSRRSLSPLFDPELVVSFEKELCEEGE  224

Query  679   qikkMISSTPVSRKSRKSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNT  858
             QIKKM+SS P + K+R     A+++LE F +KCPP GEN+VVIYTTTLRGIRKTFEDCN 
Sbjct  225   QIKKMVSSQPKTCKTRD----AESMLELFEKKCPPGGENAVVIYTTTLRGIRKTFEDCNV  280

Query  859   ARSILESHHVRTFERDVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleee  1038
              RS++ESH V   ERD+SM SGF+EELR LMGT  V+VP+VFVKGR+IGGA+E+VK+EEE
Sbjct  281   VRSVIESHRVHMIERDISMDSGFREELRRLMGTKDVRVPVVFVKGRLIGGAEEMVKMEEE  340

Query  1039  gklgillsgiPQAGAGCDGCAGVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCP  1218
             GKL IL +GIP+A AGC+GC GVRFVLC++C+GSCKVL E+ K  V+CGECNENGLIQCP
Sbjct  341   GKLSILFNGIPRAMAGCEGCGGVRFVLCMDCSGSCKVLDEEQKKMVRCGECNENGLIQCP  400

Query  1219  ICC  1227
             ICC
Sbjct  401   ICC  403



>ref|XP_011004108.1| PREDICTED: uncharacterized protein At3g28850-like [Populus euphratica]
 ref|XP_011004109.1| PREDICTED: uncharacterized protein At3g28850-like [Populus euphratica]
 ref|XP_011004110.1| PREDICTED: uncharacterized protein At3g28850-like [Populus euphratica]
Length=409

 Score =   343 bits (879),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 228/418 (55%), Positives = 277/418 (66%), Gaps = 31/418 (7%)
 Frame = +1

Query  40    MGCVSSKLFPKD--KDFPFAGDGGCATHVVSLTSSTYGVLKLD--KDSHQQQTPPQCIKE  207
             MGCVSSKLF K+  +   F   G C  HVVSLTSSTYG LKLD      QQ+   + IKE
Sbjct  1     MGCVSSKLFKKELHQQIIFNNGGQCVDHVVSLTSSTYGALKLDCNNQHQQQEQKQEHIKE  60

Query  208   CVVEVKK---ASPAREKPPEVINAWELMEGLDETEMPAA---KKSPKARSFLD-----HR  354
              V E K+    SP +E  PEV+N WELM  L+E  +P +   K+SP +R  L        
Sbjct  61    IVEESKRLQQISPTKED-PEVVNTWELMGDLEEG-VPVSSQTKRSPNSRVLLRGFADLDL  118

Query  355   RSPLKFLNQLASPGKLRRSGGKENKPGRAMGRSEFSPKTVPKAYNLQESPWRVSPRLRSL  534
             RSPLKFLNQ+ SP K +  GGKENK  R+   S+FSP+ V KA N   +  +   RL   
Sbjct  119   RSPLKFLNQIGSPRKAKTYGGKENKVKRS---SDFSPRPVLKANNSSRNSCKAVLRLSYP  175

Query  535   KKGSPKLSPNELKCDSMRAESMAVCTRR-SLNPLFNPeigeklsseeeeqikkMISST--  705
              K SP  +    K +++R+ES     RR S +PLF+PE+      +  E+ ++       
Sbjct  176   VKASPFGA----KTENVRSESGFSPRRRSSFSPLFDPELVALYEKDLSEEEEEEEEIERI  231

Query  706   --PVSRKSR-KSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILE  876
               P SR ++ K+    ++IL+ F QK PP GEN VVIYTTTLRGIRKTFEDCNT RSI+E
Sbjct  232   ILPSSRTTKVKNLRDLESILQSFEQKRPPGGENKVVIYTTTLRGIRKTFEDCNTVRSIIE  291

Query  877   SHHVRTFERDVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgil  1056
             SHH+   ERDVSM SGFKEELRGLMGT  VKVPLVFVKGR+IGGAD+VVKLEEEGKL IL
Sbjct  292   SHHIHVVERDVSMDSGFKEELRGLMGTNEVKVPLVFVKGRLIGGADQVVKLEEEGKLEIL  351

Query  1057  lsgiPQAGAG-CDGCAGVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPICC  1227
               GIP+  AG C+GCAGVRFV+C+ CNGSCKVL ++ K  V+CGECNENGL+QCPICC
Sbjct  352   FDGIPKGLAGRCEGCAGVRFVMCVECNGSCKVLHKEQKKMVRCGECNENGLLQCPICC  409



>ref|XP_006430185.1| hypothetical protein CICLE_v10011852mg [Citrus clementina]
 gb|ESR43425.1| hypothetical protein CICLE_v10011852mg [Citrus clementina]
Length=413

 Score =   342 bits (878),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 220/426 (52%), Positives = 280/426 (66%), Gaps = 44/426 (10%)
 Frame = +1

Query  40    MGCVSSKLFPKD--KDFPFA-GDGG---CATHVVSLTSSTYGVLKLD------KDSHQQQ  183
             MGCVSSK   ++  +D     GDGG      HVVSLTSSTYGVLKLD      +D  ++Q
Sbjct  2     MGCVSSKHVKRELRRDMLLNNGDGGEEYVVNHVVSLTSSTYGVLKLDNEQKLKQDEEKEQ  61

Query  184   TPPQCIKECVVEVKK------ASPAREKPPEVINAWELMEGLDE-TEMPAA---KKSPKA  333
               P   K+ V E  K       SP RE PPEVINAWELMEGL+E  ++P +   KKSPKA
Sbjct  62    EIPA--KDIVAETTKKKKVVKGSPPRE-PPEVINAWELMEGLEEEVQVPISNLTKKSPKA  118

Query  334   RSFLD-----HRRSPLKFLNQLASPGKLRRSGGKENKPGRAMG--RSEFSPKTVPKAYNL  492
             R  L        RSPLKFLNQ  SP K ++ GGKENK  R  G  +S+FSPK+V K  N 
Sbjct  119   RVLLRGFADMDARSPLKFLNQFGSPRKAKKFGGKENKV-RVNGPVKSDFSPKSVLKVKNF  177

Query  493   QESPWRVSPRLRSLKKGSPKLSPNELKCDSMRAESMAVCTRRSLNPLFNPeigeklssee  672
             Q+S  + +  L  +           +K +S+  +S     RRS +PLF+P++      E 
Sbjct  178   QDSSCKKALNLNIVP----------VKNESLDCDSEVSLRRRSFSPLFDPDLIANYEREL  227

Query  673   eeqikkMISSTPVSRKSRKSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDC  852
              E  +++      +  +R  + +++++L+ +++KCPP GEN+VVIYTTTLRGIRKTFEDC
Sbjct  228   SEGEEQIKRIISPTFSNRNCKSSSESLLKVYDKKCPPGGENAVVIYTTTLRGIRKTFEDC  287

Query  853   NTARSILESHHVRTFERDVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkle  1032
             N  RSI+ESH V+T ERD+SM SGFKEELR LM +  VKVPLVFVKGR+IGG DEV+KLE
Sbjct  288   NKVRSIIESHQVQTSERDISMDSGFKEELRALMESKQVKVPLVFVKGRLIGGVDEVMKLE  347

Query  1033  eegklgillsgiPQAG-AGCDGCAGVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLI  1209
             EEGKL IL  G+P+A   GC+GCAGVRF++C+ CNGSCKVL  + K  ++C ECNENGLI
Sbjct  348   EEGKLEILFDGMPKAAIGGCEGCAGVRFMMCMECNGSCKVLDGEQKKMIRCVECNENGLI  407

Query  1210  QCPICC  1227
             QCP+CC
Sbjct  408   QCPVCC  413



>ref|XP_002323426.2| hypothetical protein POPTR_0016s08030g [Populus trichocarpa]
 gb|EEF05187.2| hypothetical protein POPTR_0016s08030g [Populus trichocarpa]
Length=412

 Score =   342 bits (876),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 224/421 (53%), Positives = 275/421 (65%), Gaps = 34/421 (8%)
 Frame = +1

Query  40    MGCVSSKLFPKD--KDFPFAGDGGCATHVVSLTSSTYGVLKLDKDSH----------QQQ  183
             MGCVSSKLF K+  +   F   G C  HVVSLTSSTYG LKLD ++            +Q
Sbjct  1     MGCVSSKLFKKELHQQIIFNNGGQCVDHVVSLTSSTYGALKLDCNNQHQQQPPLQQAHKQ  60

Query  184   TPPQCIKECVVEVKKASPAREKPPEVINAWELMEGLDETEMPAA---KKSPKARSFLD--  348
              P + I E    +++ SP +E P EV+N WELM  L+E  +P +   K+SP +R  L   
Sbjct  61    DPIKEIVEESKRLQQISPTKEDP-EVVNTWELMGDLEEG-VPVSSQTKRSPNSRVLLRGF  118

Query  349   ---HRRSPLKFLNQLASPGKLRRSGGKENKPGRAMGRSEFSPKTVPKAYNLQESPWRVSP  519
                  RSPLKFLNQ+ SP K +  GGKENK  R+   S+FSP+ V KA N   +  +   
Sbjct  119   ADLDLRSPLKFLNQIGSPRKAKTYGGKENKVKRS---SDFSPRPVLKANNSSGNSCKAVL  175

Query  520   RLRSLKKGSPKLSPNELKCDSMRAESMAVCTRRS-LNPLFNPeigeklsseeeeqikkMI  696
             RL    K SP  +    K +++R ES     R+S   PLF+PE+      +  E+ ++ I
Sbjct  176   RLSYPVKASPVGA----KTENLRRESGFSPRRKSSFIPLFDPELVALYEKDLSEEEEEEI  231

Query  697   SST--PVSRKSR-KSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARS  867
                  P SR ++ K+    ++IL+ F QK PP GEN VVIYTTTLRGIRKTFEDCNT RS
Sbjct  232   ERIILPSSRTTKVKNLRDLESILQSFEQKRPPGGENKVVIYTTTLRGIRKTFEDCNTVRS  291

Query  868   ILESHHVRTFERDVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegkl  1047
             I+ESHH+   ERDVSM SGFKEELRGLMGT  VKVPLVFVKGR+IGGAD+VVKLE EGKL
Sbjct  292   IIESHHIHIVERDVSMDSGFKEELRGLMGTNEVKVPLVFVKGRLIGGADQVVKLEVEGKL  351

Query  1048  gillsgiPQAGA-GCDGCAGVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPIC  1224
              IL  GIP+  A GC+GCAGVRFV+C+ CNGSCKVL E+ K  V+CGECNENGL+QCPIC
Sbjct  352   EILFDGIPKGLAGGCEGCAGVRFVMCVECNGSCKVLHEEQKKMVRCGECNENGLMQCPIC  411

Query  1225  C  1227
             C
Sbjct  412   C  412



>ref|XP_008391818.1| PREDICTED: uncharacterized protein At3g28850 [Malus domestica]
 ref|XP_008351462.1| PREDICTED: uncharacterized protein At3g28850-like [Malus domestica]
Length=396

 Score =   330 bits (847),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 223/409 (55%), Positives = 268/409 (66%), Gaps = 27/409 (7%)
 Frame = +1

Query  40    MGCVSSKLFPKDKDFPFAGDGGCATHVVSLTSSTYGVLKLDKDSHQQQTPPQCIKECVVE  219
             MGC SSKLF K  +    G      HVVSLTSSTYGVL L+   + QQ     + E    
Sbjct  1     MGCASSKLFKKXDNN--GGGEYVINHVVSLTSSTYGVLNLE---NGQQPTKDXVAESKRA  55

Query  220   VKKASPAREKPPEVINAWELMEGLDETEMPAA---KKSPKA----RSFLDH-RRSPLKFL  375
               K+SP RE P EVINAWELMEGL+E  +P +   KKSPK+    R F D   R+P K L
Sbjct  56    AMKSSPPREDP-EVINAWELMEGLEEG-IPISNPTKKSPKSSALLRGFADFGSRTPFKLL  113

Query  376   NQLASPGKLRRSGGKENKPGRAMGRS--EFSPKTVPKAYNLQESPWRVSPRLRSLKKGSP  549
             +Q+ SP K +R GGKEN   R +  +   +SPK V K  N  E+  +         KGSP
Sbjct  114   SQIGSPMKSKRFGGKENNKERGVNVNVLXYSPKQVLKPNNGGENSCKKMLNWSPGVKGSP  173

Query  550   KLSPNELKCDSMRAESMAVCTRRSLNPLFNPeigeklsseeee---qikkMISSTPVSRK  720
               +    K  S  ++   +  RRSL+PLF+PE+      E  E   QIK+M+  +P  RK
Sbjct  174   VXA----KRQSFDSD---LSRRRSLSPLFDPELVASYEKEMSEEEEQIKRMVPLSPKPRK  226

Query  721   SRKSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFE  900
              R S +  +++L+ F +KCPP GEN+VV+YTTTLRGIRKTFEDCN  RSI+ESH V   E
Sbjct  227   LRISSKDXESMLQLFEKKCPPGGENAVVVYTTTLRGIRKTFEDCNNLRSIVESHLVHVLE  286

Query  901   RDVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQAG  1080
             RD+SM SGFKEE+R LMGT  VKVPLVFVKGR+IGGADEVVKLEEEGKLGIL  GIP+A 
Sbjct  287   RDISMDSGFKEEIRRLMGTKEVKVPLVFVKGRLIGGADEVVKLEEEGKLGILFDGIPRAV  346

Query  1081  AGCDGCAGVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPICC  1227
              GC GCAG+RFV+C+ CNGSCKVL E  K  VKCGECNENGLI CP+CC
Sbjct  347   IGCQGCAGMRFVMCMVCNGSCKVLDEVKKKMVKCGECNENGLIHCPLCC  395



>ref|XP_009366685.1| PREDICTED: uncharacterized protein LOC103956429 [Pyrus x bretschneideri]
Length=396

 Score =   330 bits (847),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 222/413 (54%), Positives = 269/413 (65%), Gaps = 35/413 (8%)
 Frame = +1

Query  40    MGCVSSKLFPKDKDFPFAGDGGCATHVVSLTSSTYGVLKLDKDSHQQQTPPQCIKECVVE  219
             MGC SSKLF K+ +    G      HVVSLTSSTYGVL L+          Q IK+ V E
Sbjct  1     MGCASSKLFKKEDNN--GGGEYVINHVVSLTSSTYGVLNLENGQ-------QPIKDGVAE  51

Query  220   VKKA----SPAREKPPEVINAWELMEGLDETEMPAA---KKSPKA----RSFLDH-RRSP  363
              K+A    SP RE P EVINAWELMEGL+E  +P +   KKSPK+    R F D   R+P
Sbjct  52    SKRAAMKSSPPREDP-EVINAWELMEGLEEG-IPISNPTKKSPKSGALLRGFADFGSRTP  109

Query  364   LKFLNQLASPGKLRRSGGKENKPGRAMGRS--EFSPKTVPKAYNLQESPWRVSPRLRSLK  537
              K L+Q+ SP K +R GGKEN   R +  +   +SPK V K  N  E+  +         
Sbjct  110   FKLLSQIGSPMKSKRFGGKENNKERVVNVNVLGYSPKQVLKPNNGGENSCKKMLNWSPGV  169

Query  538   KGSPKLSPNELKCDSMRAESMAVCTRRSLNPLFNPeigeklsseeee---qikkMISSTP  708
             KGSP  +  +       +    +  RRSL+PLF+PE+      E  E    IK+M+  +P
Sbjct  170   KGSPVAAKRQ-------SFGSDLSRRRSLSPLFDPELVASYEKEMSEEEEHIKRMVPPSP  222

Query  709   VSRKSRKSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHV  888
               RK R S + ++++L+ F +KCPP GEN+VV+YTTTLRGIRKTFEDCN  RSI+ESH V
Sbjct  223   RPRKLRNSSKDSESMLQLFEKKCPPGGENAVVVYTTTLRGIRKTFEDCNNLRSIVESHLV  282

Query  889   RTFERDVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgi  1068
                ERD+SM SGFKEE+R LMGT  VKVPLVFVKGR+IGGADEVVKLEEEGKLGIL  GI
Sbjct  283   HVLERDISMDSGFKEEIRRLMGTKEVKVPLVFVKGRLIGGADEVVKLEEEGKLGILFDGI  342

Query  1069  PQAGAGCDGCAGVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPICC  1227
             P+A  GC GCAG+RFV+C+ CNGSCKVL +  K  VKCGECNENGLI CP+CC
Sbjct  343   PRAVIGCQGCAGMRFVMCMVCNGSCKVLDKVQKKMVKCGECNENGLIHCPLCC  395



>ref|XP_009337073.1| PREDICTED: uncharacterized protein LOC103929576 [Pyrus x bretschneideri]
Length=396

 Score =   329 bits (843),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 223/413 (54%), Positives = 270/413 (65%), Gaps = 35/413 (8%)
 Frame = +1

Query  40    MGCVSSKLFPKDKDFPFAGDGGCATHVVSLTSSTYGVLKLDKDSHQQQTPPQCIKECVVE  219
             MGC SSKLF K+ +    G      HVVSLTSSTYGVL L+          Q IK+ V E
Sbjct  1     MGCASSKLFKKEDNN--GGGEYVINHVVSLTSSTYGVLNLENGQ-------QPIKDGVAE  51

Query  220   VKKAS----PAREKPPEVINAWELMEGLDETEMPAA---KKSPKA----RSFLDHR-RSP  363
              K+AS    P RE P EVINAWELMEGL+E  +P +   KKSPK+    R F D   R+P
Sbjct  52    SKRASMKSSPPREDP-EVINAWELMEGLEEG-IPISNPTKKSPKSGALLRGFADFSSRTP  109

Query  364   LKFLNQLASPGKLRRSGGKENKPGRAMGRS--EFSPKTVPKAYNLQESPWRVSPRLRSLK  537
              K L+Q+ SP K +R GGKEN   R +  +   +SP  V K  N  E+  +         
Sbjct  110   FKLLSQIGSPMKSKRFGGKENNKERVVNVNVLGYSPNQVLKPNNGGENSCKKMLNWSPGV  169

Query  538   KGSPKLSPNELKCDSMRAESMAVCTRRSLNPLFNPeigeklsseeee---qikkMISSTP  708
             KGSP  +    K  S  ++   +  RRSL+PLF+PE+      E  E    IK+M+  +P
Sbjct  170   KGSPVAA----KRQSFGSD---LSRRRSLSPLFDPELVASYEKEMSEEEEHIKRMVPPSP  222

Query  709   VSRKSRKSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHV  888
               RK R S + ++++L+ F +KCPP GEN+VV+YTTTLRGIRKTFEDCN  RSI+ESH V
Sbjct  223   RPRKLRNSSKDSESMLQLFEKKCPPGGENAVVVYTTTLRGIRKTFEDCNNLRSIVESHLV  282

Query  889   RTFERDVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgi  1068
                ERD+SM SGFKEE+R LMGT  VKVPLVFVKGR+IGGADEVVKLEEEGKLGIL  GI
Sbjct  283   HVLERDISMDSGFKEEIRRLMGTKEVKVPLVFVKGRLIGGADEVVKLEEEGKLGILFDGI  342

Query  1069  PQAGAGCDGCAGVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPICC  1227
             P+A  GC GCAG+RFV+C+ CNGSCKVL +  K  VKCGECNENGLI CP+CC
Sbjct  343   PRAVIGCQGCAGMRFVMCMVCNGSCKVLDKVQKKMVKCGECNENGLIHCPLCC  395



>ref|XP_010059772.1| PREDICTED: uncharacterized protein At3g28850 [Eucalyptus grandis]
 gb|KCW90546.1| hypothetical protein EUGRSUZ_A02658 [Eucalyptus grandis]
Length=439

 Score =   314 bits (805),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 219/445 (49%), Positives = 270/445 (61%), Gaps = 57/445 (13%)
 Frame = +1

Query  40    MGCVSSKLFPKDKDF---------------PFAGDGG--------CATHVVSLTSSTYGV  150
             MGCVSSK   K+++                  + DGG           HVVSLTSSTYGV
Sbjct  1     MGCVSSKHVRKEREREDRQHRPRHGHGHGQAVSDDGGRHATRAAPVPDHVVSLTSSTYGV  60

Query  151   LKLDKDSHQQQTPPQC--IKECVVEVKKASPAR---EKPPEVINAWELMEGLDE--TEMP  309
             L+LD +     +P Q   +      +K  SPAR   E+PPEVINAWELMEGL+E     P
Sbjct  61    LRLDSEERGLPSPLQRGEVAAQSKRLKGGSPARGSGEEPPEVINAWELMEGLEEDGATAP  120

Query  310   AAKK----SPKARSFLDHR-----RSPLKFLNQLASPGKLRRSGGKENK------PGRAM  444
             A +     SP+ R  L        ++PL+F+NQ+ SP K    GGKEN+        R  
Sbjct  121   ADRDRKTPSPRPRGLLQGLTGIGVKTPLRFMNQIGSPRKANTYGGKENRGSAGNGSNRVA  180

Query  445   GRSEFSPKTVPKAYNLQESPWRVSPRLRSLKKGSP-KLSPNELKCDSMRAESMAVCTRRS  621
             GRS+ +PK   +++   ES  R +  LR    G P     N    D        V +RRS
Sbjct  181   GRSDVTPKEALRSHKSLESSCRAAKNLRISTVGIPFGGKRNSFGSDH------GVTSRRS  234

Query  622   LNPLFNPe---igeklsseeeeqikkMISSTPVSRKSRKSQEAADTILEQFNQKCPPAGE  792
             L PLF+P      EK  S+ EE IKKMIS +   RK R  ++  +++L  F QKCPP G+
Sbjct  235   LGPLFDPALLDSYEKELSQGEEHIKKMISPSAKIRKKRNFKDP-ESVLRTFQQKCPPGGD  293

Query  793   NSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKEELRGLMGTMVVKV  972
             N+ VIYTTTLRGIRKTFEDCN  RS +ESH V+  ERDVSM SG+KEELR L+G+  VKV
Sbjct  294   NAAVIYTTTLRGIRKTFEDCNAVRSAMESHCVQMLERDVSMDSGYKEELRKLVGSKEVKV  353

Query  973   PLVFVKGRMIGGADEVVkleeegklgillsgiPQAGAG-CDGCAGVRFVLCLNCNGSCKV  1149
             P+VFVKGR+IGGADEVVKLEEEGKLG+LL GIP+   G C+GC GVRFV+C+ C+GSCKV
Sbjct  354   PVVFVKGRLIGGADEVVKLEEEGKLGVLLDGIPRTSMGCCEGCGGVRFVMCMECSGSCKV  413

Query  1150  LGEDLKNTVKCGECNENGLIQCPIC  1224
               E+ K  V+CGECNENGLI CPIC
Sbjct  414   FDEEEKKPVRCGECNENGLIHCPIC  438



>ref|XP_007162909.1| hypothetical protein PHAVU_001G190600g [Phaseolus vulgaris]
 gb|ESW34903.1| hypothetical protein PHAVU_001G190600g [Phaseolus vulgaris]
Length=391

 Score =   311 bits (798),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 208/417 (50%), Positives = 263/417 (63%), Gaps = 49/417 (12%)
 Frame = +1

Query  40    MGCVSSKLFP---KDKDFPFAGDGGCATHVVSLTSSTYGVLKLDKDSHQQQTPPQCIKEC  210
             MGCVSSKL     K +       GG   H+VSLTSSTYG L LDK+  Q    P  ++E 
Sbjct  1     MGCVSSKLVKRELKQEQVTITNGGGYMNHIVSLTSSTYGALMLDKEKEQ----PLPVEES  56

Query  211   VVEVKKASPAREKP-PEVINAWELMEGLDETEMPAA---KKSPKARSFL-----DHRRSP  363
               +  K SP R +  PEVINAWELMEGL+E  +P +   KKSPK+  FL        ++P
Sbjct  57    --KTAKVSPPRNREEPEVINAWELMEGLEEG-VPISNHPKKSPKSTPFLRGFLATDTKTP  113

Query  364   LKFLNQLASPGKLRRSGGKENKP-GRAMG---RSEF--SPKTVPKAYNLQESPWRVSPRL  525
             LKFLNQ  SP  L++  GKENK  G+A G   R ++  SPK + K+ N   SP + SP +
Sbjct  114   LKFLNQFGSPRSLKKFTGKENKAQGQANGGVRRLDYNVSPKGILKSSNFS-SPLKASP-I  171

Query  526   RSLKKGSPKLSPNELKCDSMRAESMAVCTRRSLNPLFNPeigeklsseeee---qikkMI  696
             R+ +        N    D+          RRS +PLF+PE+      E  E   QIK+M+
Sbjct  172   RARR--------NSFGSDT---------KRRSPSPLFDPELLASYEKELTEEEEQIKRMV  214

Query  697   SSTPVSRKSRKSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILE  876
              +TP +R+ RKS +   T +  F +KCPP GEN VVIYTTTLRGIR+TFE+CN  RSI+E
Sbjct  215   WATPRTRRVRKSLDT-QTFVNTFEEKCPPKGENCVVIYTTTLRGIRQTFEECNKVRSIVE  273

Query  877   SHHVRTFERDVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleee-gklgi  1053
             S+ V   ERDVSM SGFKEELR LMGT  VKVP+VFVKGR++GGA+EVVKLEEE     +
Sbjct  274   SYCVHVIERDVSMDSGFKEELRKLMGTKQVKVPVVFVKGRLVGGAEEVVKLEEEGKLGVL  333

Query  1054  llsgiPQAGAGCDGCAGVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPIC  1224
                 +P+    C+GC G+RFV+C+ CNGSCKVL E+ K  V+CG CNENGL+QCP+C
Sbjct  334   FEGILPKTLGDCEGCGGMRFVMCVECNGSCKVLDEECKKNVRCGHCNENGLVQCPLC  390



>ref|XP_003554438.1| PREDICTED: uncharacterized protein At5g39865-like [Glycine max]
 gb|KHN02218.1| Hypothetical protein glysoja_002242 [Glycine soja]
Length=398

 Score =   310 bits (794),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 222/425 (52%), Positives = 265/425 (62%), Gaps = 58/425 (14%)
 Frame = +1

Query  40    MGCVSSKLFPKD--KDFPFAGDGGC-ATHVVSLTSSTYGVLKLDKD--SHQQQTPPQCIK  204
             MGCVSSK   KD  ++   A +GG    HVVSLTSSTYG L LDK+   HQ Q P     
Sbjct  1     MGCVSSKHIKKDLKQEEVIATNGGSYVNHVVSLTSSTYGALMLDKEKEQHQLQLP-----  55

Query  205   ECVVEVKKASPAR-EKPPEVINAWELMEGLDE------TEMPAAKKSPKARSFLDH----  351
                VE  K SP R  + PEVINAWELMEGL+E        M   K +P  R F+      
Sbjct  56    ---VEESKTSPPRIREEPEVINAWELMEGLEEGVPISNNPMKIPKSTPFLRGFISTDPKP  112

Query  352   --RRSPLKFLNQLASPGKLRRSGGKENK--------PGRAMGRSEFSPKTVPKAYNLQES  501
               + +P KFLNQL SP  LR+  GKENK         G       FSPK + K  N   S
Sbjct  113   KTKTTPFKFLNQLGSPKSLRKFTGKENKIEVQVHHNAGVRRLDYNFSPKGILKPSNFC-S  171

Query  502   PWRVSPRLRSLKKGSPKLSPNELKCDSMRAESMAVCTRRSLNPLFNP---eigeklssee  672
             P   SP +R+ +        N    D+          RRS +PLF+P      EK  S+E
Sbjct  172   PLNGSP-IRARR--------NSFGSDT---------KRRSPSPLFDPELLASYEKELSQE  213

Query  673   eeqikkMISSTPVSRKSRKSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDC  852
             EEQIK+M+ +TP +R+ RKS ++  T ++ F +K PP GEN VVIYTTTLRGIRKTFE+C
Sbjct  214   EEQIKRMVWATPKTRRVRKSLDS-QTFIKTFEEKLPPGGENCVVIYTTTLRGIRKTFEEC  272

Query  853   NTARSILESHHVRTFERDVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkle  1032
             N  RSI+ES+ V   ERDVSM S FKEELR LMGT  VKVP+VFVKGR +GGA+EVVKLE
Sbjct  273   NKVRSIIESYCVHVLERDVSMDSRFKEELRKLMGTEQVKVPVVFVKGRFVGGAEEVVKLE  332

Query  1033  eegklgillsgiPQAGAG-CDGCAGVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLI  1209
             EEGKLG+L  GIP    G C+GC GVRFV+C+ CNGSCKVL ED K T++CG+CNENGLI
Sbjct  333   EEGKLGVLFEGIPPKALGECEGCGGVRFVMCVECNGSCKVLDEDRKKTLRCGQCNENGLI  392

Query  1210  QCPIC  1224
             QCP+C
Sbjct  393   QCPMC  397



>ref|XP_010101552.1| Uncharacterized protein L484_015376 [Morus notabilis]
 gb|EXB88691.1| Uncharacterized protein L484_015376 [Morus notabilis]
Length=413

 Score =   310 bits (794),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 216/429 (50%), Positives = 259/429 (60%), Gaps = 50/429 (12%)
 Frame = +1

Query  40    MGCVSSKLFPKD-------KDFPFAGDGGCATHVVSLTSSTYGVLKLDKDSHQQQTPPQC  198
             MGCVSSKLF K+       K     G G  A HVVSLTSSTYGVLKLD +  QQ+   + 
Sbjct  1     MGCVSSKLFRKELEREIITKHNNGGGGGDFANHVVSLTSSTYGVLKLDNERQQQKPVEER  60

Query  199   IKECVVEVKKASPAREKPPEVINAWELMEGLDETEMPA------------AKKSPKARSF  342
             +     +  + SP RE P EVINAWELMEGL+E E                KKSPK R+ 
Sbjct  61    VVAETAKKSQYSPPRENP-EVINAWELMEGLEEKEEEEEEEEERKSISNQVKKSPKTRAL  119

Query  343   LD-----HRRSPLKFLNQLASPGKLRRSGGKENKPGR-------AMGRSEFSPKTVPKAY  486
             L        +SPLKFLNQ+ SP K +  GG+EN+            G+ ++SP+ V +  
Sbjct  120   LKGFGDIDAKSPLKFLNQIGSPRKAKSGGGEENRVSNQSYGISGGRGKWDYSPRQVLRVR  179

Query  487   NLQESPWRVSPRLRSLKKGSPKLSPNELKCDSMRAESMAVCTRRSLNPLFNPeigeklss  666
             N  E+  +    L    KGSP          S + ES         +PLF+PE+      
Sbjct  180   NSSENRCKAVLSLSFPAKGSP---------ISAKRESFG------KSPLFDPELVASYEK  224

Query  667   eeeeq---ikkMISSTPVSRKSRKSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRK  837
             E   +   IK+M+S +P  +KSR     ++ IL  F +KCPP GENSVVIYT TLRGIRK
Sbjct  225   ELSAEGGEIKRMVSFSPNVKKSRDFSVDSEAILLSFEKKCPPGGENSVVIYTATLRGIRK  284

Query  838   TFEDCNTARSILESHHVRTFERDVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADE  1017
             TFEDCN  RSI +SH +   ERDVSM SGF+EELR LMGT  VKVPLVFVKGR++GGADE
Sbjct  285   TFEDCNKVRSIFQSHLIHVIERDVSMDSGFREELRRLMGTKEVKVPLVFVKGRLVGGADE  344

Query  1018  VVkleeegklgillsgiPQAGAGCDGCAGVRFVLCLNCNGSCKVLGEDLKNTVKCGECNE  1197
             VVKLEEEGKLG L  GIP+A   C+GCAG RFV+C  CNGSCKVL E  K  V+CG CNE
Sbjct  345   VVKLEEEGKLGALFVGIPRAFGCCEGCAGFRFVMCGKCNGSCKVLDEQQKKMVRCGGCNE  404

Query  1198  NGLIQCPIC  1224
             NGL+ CPIC
Sbjct  405   NGLVHCPIC  413



>ref|NP_001241249.1| uncharacterized protein LOC100781497 [Glycine max]
 gb|ACU18865.1| unknown [Glycine max]
Length=398

 Score =   309 bits (791),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 217/425 (51%), Positives = 263/425 (62%), Gaps = 58/425 (14%)
 Frame = +1

Query  40    MGCVSSKLFPKD----KDFPFAGDGGCATHVVSLTSSTYGVLKLDKDSHQQQTPPQCIKE  207
             MGCVSSK   KD    ++      GG   HVVSLTSSTYG L LDK+  Q Q  P     
Sbjct  1     MGCVSSKHIKKDLKQEEEVTVTNGGGYVNHVVSLTSSTYGALMLDKEKEQLQLQPT----  56

Query  208   CVVEVKKASPAR-EKPPEVINAWELMEGLDE------TEMPAAKKSPKARSFLDH----R  354
              V E  K SP R  + PEVINAWELMEGL+E        M + K +P  R F+      +
Sbjct  57    -VEEESKTSPPRIREEPEVINAWELMEGLEEGVPISNNPMKSPKSTPFLRGFISTDPKPK  115

Query  355   RSPLKFLNQLASPGKLRRSGGKENK-----PGRAMGRSE--FSPKTVPKAYNLQESPWRV  513
              +P KFLNQ  SP  LR+  GKENK     P   + R +  FSPK + K  N        
Sbjct  116   ITPFKFLNQFGSPKSLRKFTGKENKVQVQPPNAGVRRLDYNFSPKGILKPSNF------C  169

Query  514   SPRLRSLKKGSPKLSPNELKCDSMRAESMAVCT---RRSLNPLFNPeigeklsseeee--  678
             SP      KGSP           +RA   +  T   RRS +PLF+PE+      E  E  
Sbjct  170   SPL-----KGSP-----------IRARRNSFGTDIKRRSPSPLFDPELLASYEKELSEEE  213

Query  679   -qikkMISSTPVSRKSRKSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCN  855
              QIK+M+ +TP +R+ RK  ++  T ++ F +K PP GEN VVIYTTTLRGIRKTFE+CN
Sbjct  214   EQIKRMVWATPKTRRVRKPLDS-QTFIKTFEEKLPPGGENCVVIYTTTLRGIRKTFEECN  272

Query  856   TARSILESHHVRTFERDVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVklee  1035
               RSI+ES+ V   ERDVSM SGFKEELR LMGT  VKVP+VFVKGR++GGA+E+VKLEE
Sbjct  273   KVRSIVESYCVHVVERDVSMDSGFKEELRKLMGTKQVKVPVVFVKGRLVGGAEEIVKLEE  332

Query  1036  egklgillsgiPQAGAG-CDGCAGVRFVLCLNCNGSCKVLG-EDLKNTVKCGECNENGLI  1209
             EGKLG+L  GIP    G C+GC GVRFV+C+ CNGSCKVL  E+ K T++CG+CNENGLI
Sbjct  333   EGKLGVLFEGIPHKALGECEGCGGVRFVMCVECNGSCKVLDHENHKKTLRCGQCNENGLI  392

Query  1210  QCPIC  1224
             QCP+C
Sbjct  393   QCPMC  397



>gb|KHN18777.1| Hypothetical protein glysoja_021528 [Glycine soja]
Length=399

 Score =   308 bits (790),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 217/426 (51%), Positives = 263/426 (62%), Gaps = 59/426 (14%)
 Frame = +1

Query  40    MGCVSSKLFPKD-----KDFPFAGDGGCATHVVSLTSSTYGVLKLDKDSHQQQTPPQCIK  204
             MGCVSSK   KD     ++      GG   HVVSLTSSTYG L LDK+  Q Q  P    
Sbjct  1     MGCVSSKHIKKDLKQEEEEVTVTNGGGYVNHVVSLTSSTYGALMLDKEKEQLQLQPT---  57

Query  205   ECVVEVKKASPAR-EKPPEVINAWELMEGLDE------TEMPAAKKSPKARSFLDH----  351
               V E  K SP R  + PEVINAWELMEGL+E        M + K +P  R F+      
Sbjct  58    --VEEESKTSPPRIREEPEVINAWELMEGLEEGVPISNNPMKSPKSTPFLRGFISTDPKP  115

Query  352   RRSPLKFLNQLASPGKLRRSGGKENK-----PGRAMGRSE--FSPKTVPKAYNLQESPWR  510
             + +P KFLNQ  SP  LR+  GKENK     P   + R +  FSPK + K  N       
Sbjct  116   KITPFKFLNQFGSPKSLRKFTGKENKVQVQPPNAGVRRLDYNFSPKGILKPSNF------  169

Query  511   VSPRLRSLKKGSPKLSPNELKCDSMRAESMAVCT---RRSLNPLFNPeigeklsseeee-  678
              SP      KGSP           +RA   +  T   RRS +PLF+PE+      E  E 
Sbjct  170   CSPL-----KGSP-----------IRARRNSFGTDIKRRSPSPLFDPELLASYEKELSEE  213

Query  679   --qikkMISSTPVSRKSRKSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDC  852
               QIK+M+ +TP +R+ RK  ++  T ++ F +K PP GEN VVIYTTTLRGIRKTFE+C
Sbjct  214   EEQIKRMVWATPKTRRVRKPLDS-QTFIKTFEEKLPPGGENCVVIYTTTLRGIRKTFEEC  272

Query  853   NTARSILESHHVRTFERDVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkle  1032
             N  RSI+ES+ V   ERDVSM SGFKEELR LMGT  VKVP+VFVKGR++GGA+E+VKLE
Sbjct  273   NKVRSIVESYCVHVVERDVSMDSGFKEELRKLMGTKQVKVPVVFVKGRLVGGAEEIVKLE  332

Query  1033  eegklgillsgiPQAGAG-CDGCAGVRFVLCLNCNGSCKVLG-EDLKNTVKCGECNENGL  1206
             EEGKLG+L  GIP    G C+GC GVRFV+C+ CNGSCKVL  E+ K T++CG+CNENGL
Sbjct  333   EEGKLGVLFEGIPHKALGECEGCGGVRFVMCVECNGSCKVLDHENHKKTLRCGQCNENGL  392

Query  1207  IQCPIC  1224
             IQCP+C
Sbjct  393   IQCPMC  398



>gb|EYU35503.1| hypothetical protein MIMGU_mgv1a021418mg [Erythranthe guttata]
Length=399

 Score =   301 bits (770),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 221/426 (52%), Positives = 280/426 (66%), Gaps = 57/426 (13%)
 Frame = +1

Query  40    MGCVSSKLFPKD--KDFPFAGDGGCATHVVSLTSSTYGVLKLD--------------KDS  171
             MGCVSSK+  K+  ++  +        H VSLTS+TYG L LD              K++
Sbjct  1     MGCVSSKMVAKEIEQENLYRRSTEYTHHFVSLTSTTYGALNLDGGEKQAPPPLPPPEKEN  60

Query  172   HQQQTPPQCIKECVVEVKKASPARE-KPPEVINAWELMEGLDETEMPA--AKKSPKARSF  342
              + +   + I+     + K SP+RE +P E+IN WELMEGL++    +  +KKSPK+R F
Sbjct  61    QEAEVVKKIIQPTAEVMIKTSPSREDQPSEIINTWELMEGLEDGGPGSVQSKKSPKSRLF  120

Query  343   LD-----HRRSPLKFLNQLASPGKLRRSGGKENKPGRAMGRS---EFSPKTVPKAYN-LQ  495
             L        RSPLKFLNQ+ SP K+++ GGKEN+ GR  G +   + SPKTV K  N L+
Sbjct  121   LRGFSDMDPRSPLKFLNQMGSPKKVKKVGGKENR-GRINGGTKSLDNSPKTVFKECNVLK  179

Query  496   ESPWRV-SPRLRSLKKGSPKLSPNELKCDSMRAESMAVCTRRSLNPLFNPeigeklssee  672
             ++  R  SPRL +  +G    SPN  +CDS     +    RRSL PLF        + EE
Sbjct  180   DNTVRKPSPRLWASIRG----SPNVKRCDS----GIDFSKRRSLGPLF-------CTEEE  224

Query  673   eeqikkMISSTPVSRKSRKSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDC  852
              ++   M SST           AA   L+ + +KCPP GE +VVIYTTTLRGIRKTFEDC
Sbjct  225   IKKSGSMNSST-----------AAVLDLDSYKKKCPPGGETAVVIYTTTLRGIRKTFEDC  273

Query  853   NTARSILESHHVRTFERDVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkle  1032
             N ARS++ESH V+ FERDVSMHSG+KEELRGLM +  V+VPLVFVKGR+IGGADE+VKL+
Sbjct  274   NVARSVIESHGVQMFERDVSMHSGYKEELRGLMSSKEVRVPLVFVKGRLIGGADELVKLD  333

Query  1033  eegklgillsgiPQ-AGAGCDGCAGVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLI  1209
             EEGKLGILL GIP+ A A C GCAG+RF++C+NCNGSCK+LGED K +VKC +CNENGLI
Sbjct  334   EEGKLGILLDGIPRAAAASCGGCAGIRFLMCVNCNGSCKILGEDGKKSVKCNKCNENGLI  393

Query  1210  QCPICC  1227
             QCPICC
Sbjct  394   QCPICC  399



>ref|XP_008442849.1| PREDICTED: uncharacterized protein LOC103486619 isoform X2 [Cucumis 
melo]
Length=366

 Score =   293 bits (750),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 202/377 (54%), Positives = 252/377 (67%), Gaps = 35/377 (9%)
 Frame = +1

Query  40    MGCVSSKLFPKD--KDFPFAGDGGCATHVVSLTSSTYGVLKLDKDSHQQQTPPQCIKECV  213
             MGCVSSKL+ KD  +D      G    HVVSLTSSTYGVL LD D        Q  KE V
Sbjct  1     MGCVSSKLYRKDLQRDIIVNNGGEYLNHVVSLTSSTYGVLNLDAD--------QKSKELV  52

Query  214   VEVKKASPAREKPPEVINAWELMEGLDETEMPAA---KKSPKARSFLD-----HRRSPLK  369
             +E  K SP RE+P EVINAWELM+GL+E  +P A   KKSPK R FL       RRSPLK
Sbjct  53    LETTKKSPPREEP-EVINAWELMDGLEEG-IPIANRGKKSPKTRVFLRGLADFDRRSPLK  110

Query  370   FLNQLASPGKLRRSGGKENKPGR--AMGRSEFSPKTVPKAYNLQESPWRVSPRLRSLKKG  543
             F NQ+ +P K  +SGGKEN+ GR   +GR ++SPK + K  N      +VSP+  +LK  
Sbjct  111   FFNQIGTPKKAMKSGGKENR-GRVNGVGRLDYSPKEILKVNN----SSKVSPK-SALKLT  164

Query  544   SP-KLSPNELKCDSMRAES-MAVCTRRSLNPLFNPeigeklsseeee---qikkMISSTP  708
              P K +P   +  S  ++S +    RRSL+PLF+PE+      +  E   QIK+++S TP
Sbjct  165   VPVKSTPISARRQSFGSDSGLLSARRRSLSPLFDPELVASYERQLTEEGEQIKRIVSETP  224

Query  709   VSRKSRKSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHV  888
              S+ +R  QE+ +T L+ F + CPP GE SVVIYTTTLRGIRKTFEDCN  RSI+ES+ +
Sbjct  225   KSKAARHFQES-ETALKHFEELCPPGGETSVVIYTTTLRGIRKTFEDCNKVRSIVESYGI  283

Query  889   RTFERDVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgi  1068
                ERDVSM SGFKE+LR LMG+  VKVP +FVKGR+IGGA EV+K+EEEGKLG+L  GI
Sbjct  284   HVVERDVSMDSGFKEDLRALMGSKEVKVPALFVKGRLIGGAAEVLKMEEEGKLGVLFEGI  343

Query  1069  PQ-AGAGCDGCAGVRFV  1116
             P  AG+GC+GC G+RF+
Sbjct  344   PTAAGSGCEGCGGMRFL  360



>gb|EPS64090.1| hypothetical protein M569_10691 [Genlisea aurea]
Length=395

 Score =   288 bits (737),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 194/423 (46%), Positives = 257/423 (61%), Gaps = 55/423 (13%)
 Frame = +1

Query  40    MGCVSSKLFP----------KDKDFPFAGDGGCATHVVSLTSSTYGVLKLDKDSHQQQTP  189
             MGCVSS LFP          K ++F        + HVVSLTS+TYGVL LDK S   ++P
Sbjct  1     MGCVSSVLFPRGIRRGSRVPKKREF--------SHHVVSLTSTTYGVLNLDKPS---ESP  49

Query  190   PQCIK----ECVVEVKKA-SPAREKPPEVINAWELMEGLDETE--MPAAKKSPKARSFLD  348
             P+  +       VEVKK  SPARE+P E+INAWELMEGL+E    +  +K++PK   F  
Sbjct  50    PREEEGEAGRNSVEVKKTTSPAREQPSEIINAWELMEGLEEESSFVVPSKRTPKMGPFSR  109

Query  349   HR--RSPLKFLNQLASPGKLRRSGGKENKPGRAMGRSEFSPKTVPKAYNLQESPWRVSPR  522
                 RSPLK  NQ+ SP KL++ GGKEN P +           V    N ++S  + SP+
Sbjct  110   EGFCRSPLKMFNQVGSPRKLKKIGGKENSPMKI---------AVKGCNNFRDSK-KNSPK  159

Query  523   LRSLKKGSPKLSPNELKCDSMRAESMAV--CTRRSLNPLFNPeigeklsseeeeqikkMI  696
             L S        +PN  K DS R +S       RRSL PLF+PE+      E       + 
Sbjct  160   LWSSSIIRGTGTPNSAKSDSFRFDSGVTPPSRRRSLGPLFDPELLNSFEKE-------LS  212

Query  697   SSTPVSRKSRKSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILE  876
             +   ++ +  +S   + +IL  + +KCPP GE++V++YTTTLRGIRKTFE+CN ARSI+E
Sbjct  213   AEQKIASRRSRSSHDSASILNSYKKKCPPGGESAVILYTTTLRGIRKTFEECNLARSIIE  272

Query  877   SHHVRTFERDVSMHSGFKEELRGLMGTMV------VKVPLVFVKGRMIGGADEVVkleee  1038
             S  V+ FERD+SM SG+++EL+ LMG         + VPL+F+KGR+IGG +E++KLE+ 
Sbjct  273   SQDVQMFERDISMDSGYRQELKSLMGGGGGGTHKNIGVPLLFIKGRLIGGVEEILKLEDN  332

Query  1039  gklgillsgiPQAGAGCDGCAGVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCP  1218
             GKL  LL GIP A   C  C G+RF++C+ CNGSCKVL E    + KC +CNENGLIQCP
Sbjct  333   GKLAALLEGIPPAPPDCRSCGGIRFLMCVECNGSCKVLEEGKTKSRKCSKCNENGLIQCP  392

Query  1219  ICC  1227
              CC
Sbjct  393   FCC  395



>ref|XP_010931132.1| PREDICTED: uncharacterized protein At5g39865 [Elaeis guineensis]
Length=410

 Score =   288 bits (737),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 195/431 (45%), Positives = 263/431 (61%), Gaps = 56/431 (13%)
 Frame = +1

Query  40    MGCVSSKLFPK---DKDFPFAGD----GGCATHVVSLTSSTYGVLKLDKDSHQQ------  180
             MGC+SSKL      D++  F G     G C  HVVSLTSSTYGVL LD++  +       
Sbjct  1     MGCISSKLLATTNIDREIRFYGSKAAAGDCPNHVVSLTSSTYGVLNLDRNEAKGKEEEKE  60

Query  181   -------------QTPPQCIKECVVEVKKASPAREKPPEVINAWELMEGLDETEMP---A  312
                            PP      ++   K    +E+P E+INAWELM  LD +E+P   +
Sbjct  61    EEEEAATKKWKRFSVPP------IITPSKRRVLKEEPSEIINAWELMGDLD-SEIPIWSS  113

Query  313   AKKSPKARSFLDHRRSPLKFLNQLASPGK-LRRSGGKENKP-GRAMGRSEFSPKTVPKAY  486
              KKS K  + + H  SP KF    ASP K +++  GKEN P G+   RS+     + + +
Sbjct  114   LKKSTKLHASV-HLFSPTKFT---ASPKKQMKKCVGKENSPLGQGSERSDLDSNRILRPF  169

Query  487   ----NLQESPWRVSPRLRSLKKGSPKLSPNELKCDSMRAESMAVCTRRSLNPLFNPeige  654
                 N+Q S +   P          K++P   K      +S    +RRSL+PLF+PE+ +
Sbjct  170   SSSENMQWSGYSAIPN---------KITPINAKIQKSGRDSGVSGSRRSLSPLFDPELLD  220

Query  655   klsseeeeqikkMISSTPVSRKSRKSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIR  834
                 E  E+ +K+ ++    R+ +K  +A   +L  F +KCP  GEN VV+YTTTLRGIR
Sbjct  221   SFEKEHYEEREKIKNTVCPVRRDKKVHDAG-LLLRSFEEKCPTGGENVVVLYTTTLRGIR  279

Query  835   KTFEDCNTARSILESHHVRTFERDVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGAD  1014
             KTFEDCN  RS +ES++V+T ERD+SM SG++EELR LMG   V+VP++FVKGR+IGGA 
Sbjct  280   KTFEDCNAVRSTIESYNVKTVERDISMDSGYREELRLLMGNKEVRVPVLFVKGRLIGGAA  339

Query  1015  EVVkleeegklgillsgiPQAGAGCDGCAGVRFVLCLNCNGSCKVLGEDLKNTVKCGECN  1194
             EV+KLEEEGKLG+LL GIP+A   C GC GV FV+C++CNGSCKVLG++ K  V+CG+CN
Sbjct  340   EVLKLEEEGKLGLLLDGIPRAEVWCKGCGGVGFVMCVDCNGSCKVLGKEQKKMVRCGQCN  399

Query  1195  ENGLIQCPICC  1227
             ENGLI+CP+CC
Sbjct  400   ENGLIRCPLCC  410



>ref|XP_004494189.1| PREDICTED: uncharacterized protein At5g39865-like [Cicer arietinum]
Length=398

 Score =   287 bits (734),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 215/425 (51%), Positives = 262/425 (62%), Gaps = 56/425 (13%)
 Frame = +1

Query  40    MGCVSSKLFPKDKDFPFAGDGGCATHVVSLTSSTYGVLKLDKDSHQQ-----QTPPQCIK  204
             MGCVSSK   KD       +     HVVSLTSSTYG L LD ++        +T PQ   
Sbjct  1     MGCVSSKHIKKDIQ---QREHAYVNHVVSLTSSTYGALNLDNNNETSIVSGIETEPQ---  54

Query  205   ECVVEVKKASPAREKPPEVI---NAWELMEGLDETEMPAA---KKSPKARSFL-----DH  351
                    K+SP   K PE I   NAWELMEGL+E   P +   KK+PK+  FL       
Sbjct  55    ------SKSSP--NKDPETIININAWELMEGLEEG-APISNFQKKTPKSTPFLRGFVASD  105

Query  352   RRSPLKFLNQLASP-GKLRRSGGKENKPGRAMGRS-----EFSPKTVPKAYNLQESPWRV  513
              +SPLKFLNQ  SP   L++S GKENK    M R      ++SPK + K  N   S  + 
Sbjct  106   TKSPLKFLNQFVSPKTSLKKSSGKENKGQVNMVRGGVRRLDYSPKGIFKQNNSSSSSPKS  165

Query  514   SPRLRSLKKGSPKLSPNELKCDSMRAESMAVCTRRSL----NPLFNPe---igeklssee  672
             S       KGSP          + R        R+SL    NPLF+PE     EK +SEE
Sbjct  166   S---SFQLKGSP--------FSTRRKSFGGDSVRKSLGSVPNPLFDPELRESYEKENSEE  214

Query  673   eeqikkMISSTPVSRKSRKSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDC  852
             +EQIK+++ +TP +R++RKS ++ + +L  F  KCPP GENSVVIYTTTLRGIRKTFEDC
Sbjct  215   KEQIKRIVFATPKTRRARKSLDSIN-LLNLFENKCPPGGENSVVIYTTTLRGIRKTFEDC  273

Query  853   NTARSILESHHVRTFERDVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkle  1032
             N  RSI+ES+ V   ERDVSM SGFKEEL+ L+    V+VP+VFVKGR +GG DEVVKLE
Sbjct  274   NKVRSIIESYCVCMRERDVSMDSGFKEELKKLVEMKQVQVPVVFVKGRFVGGVDEVVKLE  333

Query  1033  eegklgillsgiPQAGAGCDGCAGVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQ  1212
             E+ KLG+LL GIP+A   C+GC G+RFV+C  CNGSCKVL E  K TVKCG CNENG+I+
Sbjct  334   EDEKLGVLLEGIPKALGVCEGCGGMRFVMCKECNGSCKVLDEKQKKTVKCGYCNENGIIR  393

Query  1213  CPICC  1227
             C ICC
Sbjct  394   CAICC  398



>ref|XP_010683720.1| PREDICTED: uncharacterized protein LOC104898354 [Beta vulgaris 
subsp. vulgaris]
Length=441

 Score =   286 bits (733),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 212/446 (48%), Positives = 268/446 (60%), Gaps = 58/446 (13%)
 Frame = +1

Query  40    MGCVSSKLFPKD-KDFPFAGDGGCATHVVSLTSSTYGVLKLD------------------  162
             MGCVSSKL  K+ K     G+G    HVVSLTSSTYGVLKL+                  
Sbjct  1     MGCVSSKLLKKNLKQELLFGNGDLPNHVVSLTSSTYGVLKLENQNKTHVISPTSFINQTI  60

Query  163   --KDSHQQQTPPQCIKE----CVVEVKKASPAREKPPEVINAWELMEGLDETEMPAAKKS  324
               KD+++++   Q  +E      V V K+S  +E+  EVIN WELME L E E+P + + 
Sbjct  61    KKKDTNEEEKSVQKTEENGTKVGVFVSKSSQCQEEL-EVINTWELMEDLIE-EIPNSNQM  118

Query  325   PKARSFLDHR--------RSPLK-FLNQLASPGKLRRSGGKENKPGRAMGRSEFSPKTVP  477
              K+      R        RSP K  +NQ++SP  +++  GKEN+ G           T  
Sbjct  119   NKSTISTSIRGGCGEKGERSPFKRLINQVSSPKGVKKVDGKENR-GVQSNWVNIGVDTTK  177

Query  478   KA--YNLQES----PWRVSPR-LRSLKKGSPKLSPNELKCDSMRAESMAVCTRRSLNPLF  636
             +   Y+   S     W+ S      L+K S   SP         A   +   RRSL PLF
Sbjct  178   RQQCYSTPRSGLLKSWKFSSNSTNKLRKASSFESPRR-----SNAGVSSSSRRRSLGPLF  232

Query  637   NPe---igeklsseeeeqikkMIS------STPVSRKSRKSQEAADTILEQFNQKCPPAG  789
             +PE     EK  S+E EQIK+M+S      S  +   SR S  ++  +L+ + +KCPP G
Sbjct  233   DPELIDSLEKELSQENEQIKEMLSPKQAKPSIKIRCFSRNSPNSSSILLKNYVEKCPPGG  292

Query  790   ENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKEELRGLMGTMVVK  969
             EN VV+YTTTLRGIRKTFE CN  RS++ES+H+R  ERDVSM SGFKEELR LMGT  VK
Sbjct  293   ENCVVMYTTTLRGIRKTFEHCNAVRSVIESYHIRVIERDVSMDSGFKEELRKLMGTKEVK  352

Query  970   VPLVFVKGRMIGGADEVVkleeegklgillsgiPQAGAGCDGCAGVRFVLCLNCNGSCKV  1149
             VPLVFVKGR+IGGA++VVKLEEEGKL  L  GIP+A + C+GC G+RFV+C++CNGSCKV
Sbjct  353   VPLVFVKGRLIGGAEDVVKLEEEGKLEGLFQGIPKALSMCEGCGGIRFVMCMDCNGSCKV  412

Query  1150  LGEDLKNTVKCGECNENGLIQCPICC  1227
             L E+ KN V+CGECNENGLI CPICC
Sbjct  413   LDENNKNMVRCGECNENGLIHCPICC  438



>emb|CBI30303.3| unnamed protein product [Vitis vinifera]
Length=310

 Score =   278 bits (710),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 199/405 (49%), Positives = 226/405 (56%), Gaps = 104/405 (26%)
 Frame = +1

Query  40    MGCVSSKLFPKD-KDFPFAGDGGCATHVVSLTSSTYGVLKLDKDSHQQQTPPQCIKECVV  216
             MGC SSKLF KD +      +G C  HVVSLTSSTYG LKLD D           KE V 
Sbjct  1     MGCASSKLFRKDLQQEILDKNGECLNHVVSLTSSTYGALKLDNDLRN--------KESVA  52

Query  217   EVKKASPAREKPPEVINAWELMEGLDETEMPAA---KKSPKARSFLD-----HRRSPLKF  372
             E K++ P  E   EVINAWELMEGL E  +P A   KKSPK+  FL        RSPLKF
Sbjct  53    EPKRSPPREE--AEVINAWELMEGL-EDGIPIAVPVKKSPKSLGFLRGFGDIDARSPLKF  109

Query  373   LNQLASPGKLRRSGGKENKPGRAMGRSEFSPKTVPKAYNLQESPWRVSPRLRSLKKGSPK  552
             LNQ+ASP +++RSGGKENK      R+  +P    KA N +      S R  SL+     
Sbjct  110   LNQIASPKRIKRSGGKENKQ-----RANGTPVGDGKADNFE------SGRGSSLR-----  153

Query  553   LSPNELKCDSMRAESMAVCTRRSLNPLFNPeigeklsseeeeqikkMISSTPVSRKSRKS  732
                                 R SL+PLF+P                              
Sbjct  154   --------------------RMSLSPLFDP------------------------------  163

Query  733   QEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVS  912
                   +L  F ++     E            I+K   DCN  RSILESHH+  FERD+S
Sbjct  164   -----ELLASFEKELSEEKEQ-----------IKKI--DCNHVRSILESHHIHMFERDIS  205

Query  913   MHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQAGAGCD  1092
             M SG KEELRGLMGT  VKVPLVFVKGR+IGGADEVVKLEEEGKL IL  GIP+A AGC 
Sbjct  206   MDSGLKEELRGLMGTKEVKVPLVFVKGRLIGGADEVVKLEEEGKLDILFDGIPRALAGCQ  265

Query  1093  GCAGVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPICC  1227
             GCAGVRFV+C+ CNGSCK+L ED K  VKC ECNENGLIQCPICC
Sbjct  266   GCAGVRFVMCMACNGSCKLLDEDQKKMVKCSECNENGLIQCPICC  310



>ref|XP_010558221.1| PREDICTED: uncharacterized protein At3g28850-like [Tarenaya hassleriana]
Length=389

 Score =   279 bits (713),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 198/409 (48%), Positives = 266/409 (65%), Gaps = 35/409 (9%)
 Frame = +1

Query  40    MGCVSSKLFPKDKDFPFAGDGGCATHVVSLTSSTYGVLKLDKDSHQQQTPPQCIKECVVE  219
             MGCVSSKL  K+       + G   H+VSLTS+TYG+LKLD+   Q Q P    K+ V+E
Sbjct  1     MGCVSSKLVKKELVREIRVNNG-GDHIVSLTSTTYGLLKLDETVPQLQEPA---KDVVLE  56

Query  220   VKKASPAREKP---PEVINAWELMEGLDETEMPAA---KKSPKARSFLDHR-RSPLKFLN  378
               K  P R  P   PE+IN WELME L++  +P +   + SPK+R F      SP++ ++
Sbjct  57    SDK--PKRSPPSEEPEIINTWELMEDLEDA-VPVSHPQRISPKSRGFFGKSWMSPMRSVD  113

Query  379   QLASPGKLRRSGGKENK--PGRAMGRSEFSPKTVPKAYNLQESPWRVSPRLRSLKKGSPK  552
             ++ SP + +R  GKEN+   G ++    FSP  V K  N+ E+P          K+G  +
Sbjct  114   KMDSPNRSKRFCGKENRGTAGNSLNSRGFSPNQVLKPKNVLETP----------KRGVMR  163

Query  553   LSPNELKCDSMRAESMAVCTRRSLNPLFNPeigeklsseeeeqikkM---ISSTPVSRKS  723
             LS   LK D     ++    R+S +PLF+P++      E  ++ +++   IS  P   K 
Sbjct  164   LS-FPLKSDE--PSTVMTQRRKSFSPLFDPDLVASYERELNQEQEQIKTVISPVPEILKP  220

Query  724   RKSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFER  903
              K+QE  ++ILE F + CPP GE+SV+IYTTTLRGIRKTFEDCNT R+ILESH ++  ER
Sbjct  221   MKTQEI-ESILENFKEICPPGGESSVIIYTTTLRGIRKTFEDCNTVRAILESHQIQLSER  279

Query  904   DVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQA--  1077
             DVSMHSG+K+E+RG+MGT  VK+P VF++GR+IG  +EVVKLEEEGKLGILL G+P A  
Sbjct  280   DVSMHSGYKDEIRGIMGTKEVKIPAVFIRGRLIGRVEEVVKLEEEGKLGILLEGMPSARQ  339

Query  1078  GAGCDGCAGVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPIC  1224
             G  C GC G+RFV+C+ CNGSCKV+ E+ K T++C ECNENGLI CPIC
Sbjct  340   GGCCRGCGGLRFVMCVVCNGSCKVMDEEKKKTIRCLECNENGLILCPIC  388



>gb|AFK41682.1| unknown [Medicago truncatula]
Length=405

 Score =   279 bits (714),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 204/426 (48%), Positives = 257/426 (60%), Gaps = 51/426 (12%)
 Frame = +1

Query  40    MGCVSSKLFPKDKDFPFAGDGGCATHVVSLTSSTYGVLKLDKDSHQQQTPPQCIKECVVE  219
             MGCVSSK   K+ +           HVVSLTSSTYG LKLD +S+   +    + E   +
Sbjct  1     MGCVSSKHIKKEIN---QEKNPYINHVVSLTSSTYGALKLDNNSNNNDSSNSIVSETETQ  57

Query  220   VKKASPAREKP------PEV---INAWELMEGLDETEMPAA---KKSPKARSFL-----D  348
              +  +  +  P      PE    INAWELMEGL+E  +P +   KKSPK+  FL      
Sbjct  58    TESKTEPKSNPSPPHKDPETVFNINAWELMEGLEEG-VPISNFPKKSPKSAPFLRGFMAS  116

Query  349   HRRSPLKFLNQLASP-GKLRRSGGKENKPGR------AMGRSEFSPKTVPKAYNLQESPW  507
               RSPLKFL+Q  SP   L++  GKENK          + R ++SPK +           
Sbjct  117   DTRSPLKFLSQYGSPKSTLKKPLGKENKAQVTNMVRGGVRRLDYSPKGI-----------  165

Query  508   RVSPRLRSLKKGSPKL---SPNELKCDSMRAESMAVCTRRSLNPLFNPeigeklsseeee  678
                  L+S    SPK    SP   + +S   ES+  C     +PLF+PEI      E  E
Sbjct  166   -----LKSTTNSSPKNLKGSPFSARRNSFGNESVRKCPGSVPSPLFDPEIIASYEKELSE  220

Query  679   ---qikkMISSTPVSRKSRKSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFED  849
                QIK+++ +TP +R++RKS ++   +L  F  KCPP GENSVVIYTTTLRGIRKTFED
Sbjct  221   EEEQIKRIVFATPKTRRARKSLDSI-ALLNLFENKCPPEGENSVVIYTTTLRGIRKTFED  279

Query  850   CNTARSILESHHVRTFERDVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkl  1029
             CN  RSI+ES+ V   ERDVSM SGFKEELR LMG   V+VP+VFVKGR +GG DE++KL
Sbjct  280   CNKVRSIIESYCVCLRERDVSMDSGFKEELRKLMGMKQVQVPVVFVKGRFVGGVDEIMKL  339

Query  1030  eeegklgillsgiPQAGAGCDGCAGVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLI  1209
             E+E KLG+LL GIP+A   C+GC  +RFV+C  CNGSCKVL E  K TVKCG CNENG+I
Sbjct  340   EDEEKLGVLLEGIPRALGVCEGCGSLRFVMCKECNGSCKVLDEKQKKTVKCGYCNENGII  399

Query  1210  QCPICC  1227
             +C +CC
Sbjct  400   RCSLCC  405



>ref|XP_008787707.1| PREDICTED: uncharacterized protein At5g39865-like [Phoenix dactylifera]
Length=410

 Score =   279 bits (714),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 189/419 (45%), Positives = 250/419 (60%), Gaps = 32/419 (8%)
 Frame = +1

Query  40    MGCVSSKLFPK---DKDFPFAGD----GGCATHVVSLTSSTYGVLKLDKDSHQQQTP---  189
             MGC+SSKL      D+D  F G     G C  HVVSLTSSTYGVL LD++  + +     
Sbjct  1     MGCISSKLLATTDIDRDIRFYGSKAAAGDCPNHVVSLTSSTYGVLNLDRNEAKGKEEEEE  60

Query  190   ---------PQCIKECVVEVKKASPAREKPPEVINAWELMEGLD-ETEMPAAKKSPKARS  339
                       +      +   K    +E+P E+INAWELM  LD E  + ++ K P    
Sbjct  61    EEEAATKKWKRSSPPPTIPSSKRRVLKEEPSEIINAWELMRDLDSEIPIWSSLKKPTKLH  120

Query  340   FLDHRRSPLKFLNQLASPGKLRR-SGGKENKP-GRAMGRSEFSPKTVPKAYNLQES-PWR  510
                H  SP KF    ASP K ++ S GKEN P  +   R +     + + +   ES  W 
Sbjct  121   ASVHLFSPCKFT---ASPKKQKKQSAGKENSPLSQGSERLDLDSNRILRPFRSSESMQWS  177

Query  511   VSPRLRSLKKGSPKLSPNELKCDSMRAESMAVCTRRSLNPLFNPeigeklsseeeeqikk  690
              S         S K++P   K      +S     RRSL+PLF+PE+   +  E  E+ ++
Sbjct  178   GSH-----SAISKKITPINAKIQKSGRDSGVSGWRRSLSPLFDPELLASIEKEHYEEQEQ  232

Query  691   MISSTPVSRKSRKSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSI  870
             + +     R+ +K  +    +L+ F +KCP  GEN VV+YTTTLRGIRKTFEDCN  RS 
Sbjct  233   IKNMAFPVRRDKKVHDVG-LLLQSFEEKCPTGGENIVVLYTTTLRGIRKTFEDCNAVRST  291

Query  871   LESHHVRTFERDVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklg  1050
             +ES++V+T ERD+SM SG++EELR LMG   V+VP+VFVKGR+IGGA EV+KLEEEGKLG
Sbjct  292   IESYNVKTVERDISMDSGYREELRLLMGKKEVRVPVVFVKGRLIGGAPEVLKLEEEGKLG  351

Query  1051  illsgiPQAGAGCDGCAGVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPICC  1227
             +LL GIP+A   C GC G RFV+C++CNGSCKVL  + K  V+CG+CNENGLI+CP+CC
Sbjct  352   LLLDGIPRAEVWCKGCGGGRFVVCMDCNGSCKVLEREQKKMVRCGQCNENGLIRCPLCC  410



>ref|XP_009404359.1| PREDICTED: uncharacterized protein At3g28850-like [Musa acuminata 
subsp. malaccensis]
Length=404

 Score =   276 bits (706),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 188/422 (45%), Positives = 255/422 (60%), Gaps = 44/422 (10%)
 Frame = +1

Query  40    MGCVSSKLFPKDKDFP--FAGDG-----GCATHVVSLTSSTYGVLKLDK-DSHQQQTPPQ  195
             MGC+SSK   +D   P  F  DG      C  HVV LTS+TYGVL LD+ + H ++   +
Sbjct  1     MGCISSKPLAEDDLDPGIFISDGVGLASECPNHVVLLTSTTYGVLNLDRSEPHGKKCDAE  60

Query  196   CIKECVVEVKKASP-------------AREKPPEVINAWELMEGL-DETEMPAAKKSPKA  333
               +E +    + SP             A+E P EVI+A ELME L DET      K P  
Sbjct  61    EAEEVIKRECRRSPRADLTIDRFDKSVAKEVPSEVIDARELMEDLVDETPFWTPLKKP--  118

Query  334   RSFLDHRRSPLKFLNQLASPGK-LRRSGGKENKPGRAMGRSEFSPKTVPKAYNLQESPWR  510
                     + L      ASP K +RR+ GKEN P R        PK+     N    P+ 
Sbjct  119   --------AKLHASKVSASPKKQIRRALGKENAPQRR------DPKSGDLDKNRILRPFS  164

Query  511   VSPRLRSLKKGSPKLSPNELKCDSMRA---ESMAVCTRRSLNPLFNPeigeklsseeeeq  681
              S   + +   +     N L  D+ +A   +S    +RRSL+P F+PE+   L  E  ++
Sbjct  165   SSDNGKRIGLAAQTPCKNSLT-DAGKASGRDSRGSASRRSLSPFFDPELVASLEREYFQE  223

Query  682   ikkMISSTPVSRKSRKSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTA  861
              +++     +S ++RK+ + +  +L  + +KCPP G+N+VV+YTTTLRGIRKTFEDCN  
Sbjct  224   GEQIKKMVLLSPRNRKAHDPS-FLLRSYQEKCPPGGQNTVVLYTTTLRGIRKTFEDCNAV  282

Query  862   RSILESHHVRTFERDVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeeg  1041
             RS LES+HVR  ERD+SM SG++EELR LMG+  VKVP  FV+GR+IGGA+EV++LE+EG
Sbjct  283   RSTLESYHVRIMERDISMDSGYREELRSLMGSKEVKVPAAFVRGRLIGGAEEVLRLEDEG  342

Query  1042  klgillsgiPQAGAGCDGCAGVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPI  1221
             KL +LL GIP+A + C+GCAG+RF++C++C+GSCKVL E+ K  VKCG CNENGLI CPI
Sbjct  343   KLELLLEGIPRAASSCEGCAGLRFIMCMDCSGSCKVLDEEQKKMVKCGVCNENGLIHCPI  402

Query  1222  CC  1227
             CC
Sbjct  403   CC  404



>ref|XP_003625833.1| hypothetical protein MTR_7g104720 [Medicago truncatula]
 gb|AES82051.1| glutaredoxin (GRX) family protein [Medicago truncatula]
Length=405

 Score =   276 bits (706),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 204/429 (48%), Positives = 258/429 (60%), Gaps = 57/429 (13%)
 Frame = +1

Query  40    MGCVSSKLFPKDKDFPFAGDGGCATHVVSLTSSTYGVLKLDKDSHQQQTPPQCIKECVVE  219
             MGCVSSK   K+ +           HVVSLTSSTYG LKLD +S+   +    + E   +
Sbjct  1     MGCVSSKHIKKEIN---QEKNPYINHVVSLTSSTYGALKLDNNSNNNDSSNSIVSETETQ  57

Query  220   VKKASPAREKP------PEV---INAWELMEGLDETEMPAA---KKSPKARSFL-----D  348
              +  +  +  P      PE    INAWELMEGL+E  +P +   KKSPK+  FL      
Sbjct  58    TESKTEPKSNPSPPHKDPETVFNINAWELMEGLEEG-VPISNFPKKSPKSAPFLRGFMAS  116

Query  349   HRRSPLKFLNQLASP-GKLRRSGGKENKPGR------AMGRSEFSPKTVPKAY------N  489
               RSPLKFL+Q  SP   L++  GKENK          + R ++SPK + K+       N
Sbjct  117   DTRSPLKFLSQYGSPKSTLKKPLGKENKVQVTNMVRGGVRRLDYSPKGILKSTTNSSPKN  176

Query  490   LQESPWRVSPRLRSLKKGSPKLSPNELKCDSMRAESMAVCTRRSLNPLFNPeigeklsse  669
             L+ SP+  S R  S    S + SP  +                  +PLF+PEI      E
Sbjct  177   LKGSPF--SARRNSFGNESVRKSPGSVP-----------------SPLFDPEIIASYEKE  217

Query  670   eee---qikkMISSTPVSRKSRKSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKT  840
               E   QIK+++ +TP +R++RKS ++   +L  F  KCPP GENSVVIYTTTLRGIRKT
Sbjct  218   LSEEEEQIKRIVFATPKTRRARKSLDSI-ALLNLFENKCPPGGENSVVIYTTTLRGIRKT  276

Query  841   FEDCNTARSILESHHVRTFERDVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEV  1020
             FEDCN  RSI+ES+ V   ERDVSM SGFKEELR LMG   V+VP+VFVKGR +GG DE+
Sbjct  277   FEDCNKVRSIIESYCVCLRERDVSMDSGFKEELRKLMGMKQVQVPVVFVKGRFVGGVDEI  336

Query  1021  VkleeegklgillsgiPQAGAGCDGCAGVRFVLCLNCNGSCKVLGEDLKNTVKCGECNEN  1200
             +KLE+E KLG+LL GIP+A   C+GC  +RFV+C  CNGSCKVL E  K TVKCG CNEN
Sbjct  337   MKLEDEEKLGVLLEGIPRALGVCEGCGSLRFVMCKECNGSCKVLDEKQKKTVKCGYCNEN  396

Query  1201  GLIQCPICC  1227
             G+I+C +CC
Sbjct  397   GIIRCSLCC  405



>ref|XP_009390033.1| PREDICTED: uncharacterized protein LOC103976524 [Musa acuminata 
subsp. malaccensis]
Length=370

 Score =   274 bits (700),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 180/399 (45%), Positives = 239/399 (60%), Gaps = 32/399 (8%)
 Frame = +1

Query  40    MGCVSSKLFPKDKDFPFAGDGGCATHVVSLTSSTYGVLKLDKDSHQQQTPPQCIKECVVE  219
             MGCVSSKL  ++ D         A HVV LTS+TYGVL LD++    +         V++
Sbjct  1     MGCVSSKLLVREDDEE-------ANHVVFLTSTTYGVLNLDRNEAGGKREDDEGGREVIK  53

Query  220   VKKASPAREKPPEVINAWELMEGL-DETEMPAAKKSPKARSFLDHRRSPLKFLNQLASPG  396
              +  S A+E+P EVI+AWELMEGL DET +     SP  RS   H  +    ++      
Sbjct  54    REWRSDAKEEPAEVIDAWELMEGLADETPV----SSPLKRSPKPHPSTHASIVSPSPRSR  109

Query  397   KLRRSGGKEN-KPGRAMGRSEFSPKTVPKAYNLQESPWRVSPRLRSLKKGSPKLSPNELK  573
             K RR  GKEN +P R   R +  P  + + ++  ++  R           +  L+P +  
Sbjct  110   KTRRESGKENTEPRRDSARWDLDPNRILRPFSSSDNARRAGL--------ASSLTPRK--  159

Query  574   CDSMRAESMAVCTRRSLNPLFNPeigeklsseeeeqikkMISSTPVSRKSRKSQEAADTI  753
                 R       +RRS  P+F+P++   L  E  E+ ++M     ++R S         +
Sbjct  160   -KHGRDSGGGSVSRRSHGPVFDPDLLASLEREHVEEGEQMKKMVALARDS-------SVL  211

Query  754   LEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKE  933
             L+ + +KCPP G+NSVVIYTTTLRGIRKTFEDCN+ RS LESH VR  ERD+SM SG++ 
Sbjct  212   LQYYEEKCPPGGQNSVVIYTTTLRGIRKTFEDCNSVRSTLESHRVRVMERDISMDSGYRA  271

Query  934   ELRGLMG-TMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQAGAGCDGCAGVR  1110
             ELR LMG    VKVP VFVKGR++GGA E+ KLEE+G LG LL GIP+A   C+GC GV 
Sbjct  272   ELRTLMGGAREVKVPAVFVKGRLLGGAAELAKLEEDGALGPLLQGIPRAATACEGCGGVS  331

Query  1111  FVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPICC  1227
             FV+C++C+GSCKVL E+ K  VKCG+CNENGL  CP+CC
Sbjct  332   FVVCVDCSGSCKVLDEEEKKMVKCGKCNENGLRHCPMCC  370



>gb|KDO70436.1| hypothetical protein CISIN_1g038258mg, partial [Citrus sinensis]
Length=366

 Score =   272 bits (695),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 189/378 (50%), Positives = 239/378 (63%), Gaps = 43/378 (11%)
 Frame = +1

Query  40    MGCVSSKLFPKD--KDFPFA-GDGG---CATHVVSLTSSTYGVLKLD------KDSHQQQ  183
             MGCVSSK   ++  +D     GDGG      HVVSLTSSTYGVLKLD      +D  ++Q
Sbjct  2     MGCVSSKHVKRELRRDILLNHGDGGEEYVVNHVVSLTSSTYGVLKLDNEQKLKQDEEKEQ  61

Query  184   TPPQCIKECVVEVKK------ASPAREKPPEVINAWELMEGLDE-TEMPAA---KKSPKA  333
               P   K+ V E  K       SP RE PPEVINAWELMEGL+E  ++P +   KKSPKA
Sbjct  62    EIP--TKDIVAETTKKKKVVKGSPPRE-PPEVINAWELMEGLEEEVQVPISNLTKKSPKA  118

Query  334   RSFLD-----HRRSPLKFLNQLASPGKLRRSGGKENKPGRAMG--RSEFSPKTVPKAYNL  492
             R  L        RSPLKFLNQ  SP K ++ GGKENK  R  G  +S+FSPK+V K  N 
Sbjct  119   RVLLRGFADMDARSPLKFLNQFGSPRKAKKFGGKENKV-RVNGPVKSDFSPKSVLKVKNF  177

Query  493   QESPWRVSPRLRSLKKGSPKLSPNELKCDSMRAESMAVCTRRSLNPLFNPeigeklssee  672
             Q+S  + +  L         + P  +K +S+  +S     RRS +PLF+P++      E 
Sbjct  178   QDSSCKKALNL--------NIVP--VKNESLDCDSEVSLRRRSFSPLFDPDLIANYEREL  227

Query  673   eeqikkMISSTPVSRKSRKSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDC  852
              E  +++      +  +R  + +++++L  +++KCPP GEN+VVIYTTTLRGIRKTFEDC
Sbjct  228   SEGEEQIKRIISPTFSNRNCKSSSESLLNVYDKKCPPGGENAVVIYTTTLRGIRKTFEDC  287

Query  853   NTARSILESHHVRTFERDVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkle  1032
             N  RSI+ESH V+T ERD+SM SGFKEELR LM +  VKVPLVFVKGR+IGG DEV+KLE
Sbjct  288   NKVRSIIESHQVQTLERDISMDSGFKEELRALMESKQVKVPLVFVKGRLIGGVDEVMKLE  347

Query  1033  eegklgillsgiPQAGAG  1086
             EEGKL IL   IP+A  G
Sbjct  348   EEGKLEILFDRIPKAAIG  365



>ref|XP_006855070.1| hypothetical protein AMTR_s00031p00132350 [Amborella trichopoda]
 gb|ERN16537.1| hypothetical protein AMTR_s00031p00132350 [Amborella trichopoda]
Length=389

 Score =   271 bits (694),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 187/416 (45%), Positives = 244/416 (59%), Gaps = 47/416 (11%)
 Frame = +1

Query  40    MGCVSSKLFPKDKD-----FPFAGDGGCATHVVSLTSSTYGVLKLDKDSHQQQTPP--QC  198
             MGCVSSKL  ++ D      P++     + H+VSLTSSTYG LKLD      +TP     
Sbjct  1     MGCVSSKLAREEADRERETSPYSH----SHHIVSLTSSTYGALKLDHPQGFTETPETHHG  56

Query  199   IKECVVEVKKASP---AREKPPEVINAWELMEGL-DETEMPAAKKSPKA---RSFLDHRR  357
                  V+   +SP        PE+INAWELMEGL DE     + K P      S  ++  
Sbjct  57    FFRFGVDSLTSSPKACGFRGEPEIINAWELMEGLEDEAPQSVSSKKPSKVSLSSVAENES  116

Query  358   SPLKFLNQLASPGKLRR-SGGKENKPGRAMGRSEFSPKTVPKAYNLQESPWRVSPRLRSL  534
                +  NQL SP K ++ SGGKENKPG     +E   + V K +N  E+  R  P+    
Sbjct  117   RARRSSNQLKSPLKPKKYSGGKENKPGVEAQPNE---RQVLKPFNSLENLERDKPKTEYG  173

Query  535   KKGSPKLSPNELKCDSMRAESMAVCTRRSLN-PLFNPeigeklsseeeeqikkMISSTP-  708
              K +P++   ++K  S R  +      +  N PLF+PE               +I+S   
Sbjct  174   SK-NPQI---DVKPHSFRKPATNFSASKGSNSPLFDPE---------------LIASLER  214

Query  709   -VSRKSRKSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHH  885
              +  + + +Q++    LE+F ++CPP GENSV++YTTTLRGIRKTFEDCN  RS  E+  
Sbjct  215   ELYEEPKTNQKSPSFPLEKFEKRCPPGGENSVILYTTTLRGIRKTFEDCNRVRSATEAFD  274

Query  886   VRTFERDVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsg  1065
             VR  ERD+SM SGF+EELRGLMG     VP++FVKGR+IG  DEVV +EEE KLG L  G
Sbjct  275   VRLIERDISMDSGFREELRGLMGGKTANVPMLFVKGRLIGSVDEVVSMEEEEKLGFLFRG  334

Query  1066  iPQAGA--GCDGCAGVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPICC  1227
             +P++G    CDGC GVRFVLC++CNGSCKV  +D    V+CG+CNENGLI CPICC
Sbjct  335   LPRSGGIKACDGCGGVRFVLCVDCNGSCKVR-DDENKVVRCGDCNENGLIHCPICC  389



>ref|XP_008784233.1| PREDICTED: uncharacterized protein LOC103703228 [Phoenix dactylifera]
Length=407

 Score =   271 bits (693),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 186/419 (44%), Positives = 250/419 (60%), Gaps = 35/419 (8%)
 Frame = +1

Query  40    MGCVSSKLFPK---DKDFPFAGD----GGCATHVVSLTSSTYGVLKLDKDSHQQQTPP--  192
             MGC+SSKL      D++  F G     G C  HVV L SSTYGVL LD+   + +     
Sbjct  1     MGCISSKLLAATDLDREVRFYGSKAAAGDCPNHVVLLASSTYGVLNLDRSEDKGKEDEDE  60

Query  193   ----------QCIKECVVEVKKASPAREKPPEVINAWELMEGLDETEMPAAKKSPKARSF  342
                       +C    ++   K    +E+P E+INAWELM  LDE EM     SP  +S 
Sbjct  61    EEEFATKKWNRCSPASMIRPSKRRVLKEEPSEIINAWELMGDLDE-EMYIW--SPLKKSH  117

Query  343   LDHR-RSPLKFLNQLASPGKLRR-SGGKENKP-GRAMGRSEFSPKTVPKAYN-LQESPWR  510
                R  SP K     A+P K R+ S GKEN P G+   RS+     V + ++  + + W 
Sbjct  118   APMRPSSPAKVT---ATPKKQRKKSVGKENSPLGQGSERSDLDSNRVLRPFSSFENAQW-  173

Query  511   VSPRLRSLKKGSPKLSPNELKCDSMRAESMAVCTRRSLNPLFNPeigeklsseeeeqikk  690
                 + S+     K +P          +     +RRSL+PLF+PE+   L     E+ ++
Sbjct  174   ----VGSVSTIPKKNTPTSATMQKSGRDYGGSGSRRSLSPLFDPELLASLEKAHHEEGEQ  229

Query  691   MISSTPVSRKSRKSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSI  870
             +      +R+ R+  +    +L+ F +KCPP GEN V++YTTTLRGIRKT+EDCN  R  
Sbjct  230   IKKMIDPARRHRRGHDLG-LLLQSFQEKCPPGGENVVILYTTTLRGIRKTYEDCNAVRCA  288

Query  871   LESHHVRTFERDVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklg  1050
             +ESH VRT ERD+SM SG++EELR LMG   V+VP+VFVKGR+IGGA+EV++LEEEGKLG
Sbjct  289   IESHDVRTVERDISMDSGYREELRLLMGEKEVRVPVVFVKGRLIGGAEEVLELEEEGKLG  348

Query  1051  illsgiPQAGAGCDGCAGVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPICC  1227
             +LL GIP+A + C GC G+RFV+C++CNGSCKVL  + K  V+CG CNENGLI CP+CC
Sbjct  349   LLLEGIPRAESWCKGCGGMRFVMCMDCNGSCKVLDREQKKMVRCGRCNENGLIHCPLCC  407



>ref|XP_002873121.1| glutaredoxin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49380.1| glutaredoxin family protein [Arabidopsis lyrata subsp. lyrata]
Length=387

 Score =   266 bits (679),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 194/408 (48%), Positives = 254/408 (62%), Gaps = 35/408 (9%)
 Frame = +1

Query  40    MGCVSSKLFPKDKDFPFAGDGGCATHVVSLTSSTYGVLKLDKDSHQQQTPPQCIKECVVE  219
             MGCVSSKL  K        + G   H+VSLTS+TYG L LD+ +       +  K  V E
Sbjct  1     MGCVSSKLGKKKLIREIRVNNG-GDHIVSLTSTTYGHLDLDERAETSPKSLEVTKGEVFE  59

Query  220   --VKKASPAREKPPEVINAWELMEGLDETEMPA--AKKSPKARS-FLDHRRSPLKFLNQL  384
               +K     +   PE+IN WELME L+++   +   K SPK+R  F    ++P+K + + 
Sbjct  60    SEIKARRSIQRDDPEIINTWELMEDLEDSMHVSNPQKISPKSRGIFGKSWKTPVKSVVES  119

Query  385   ASPGKLRRSGGKENKPGRAMGRSEFSPKTVPKAYNLQESPWRVSPRLR-SLKKGSPKLSP  561
                G  +R GGKEN   R +     SP  + K  N+ E+P R   RL   LK   P    
Sbjct  120   PKRGSSKRFGGKENN-SRGV-----SPNQILKPKNILETPKRGVMRLSFPLKSEEP----  169

Query  562   NELKCDSMRAESMAVCTRR-SLNPLFNPeigeklsseeeeqikkM-ISSTPVSRKSRKSQ  735
                        S+ +  RR S +P+F+P++      E  ++ +++ +  +PV  +SRK++
Sbjct  170   -----------SVVITQRRKSYSPMFDPDLVASYERELSQEQEQIKMVISPVVHESRKTE  218

Query  736   EA--ADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDV  909
             +   ++ ILE+F +KCPP GENSVVIY TTLRGIRKTFEDCN  RSIL+SH VR  ERDV
Sbjct  219   KTRESERILEKFPEKCPPGGENSVVIYITTLRGIRKTFEDCNVVRSILDSHEVRFSERDV  278

Query  910   SMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQA---G  1080
             SMHS FKEE+RG+MGT  VK+P VFVKGRM+G  +EV+KLEEEGKLGILL GIP A   G
Sbjct  279   SMHSVFKEEIRGIMGTKHVKIPAVFVKGRMLGSVEEVMKLEEEGKLGILLEGIPAARLGG  338

Query  1081  AGCDGCAGVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPIC  1224
             + C GC G+RFV+C+ C+GSCKV GED K+ VKC ECNENGL+ CPIC
Sbjct  339   SCCRGCGGMRFVMCVVCDGSCKVRGEDKKSMVKCLECNENGLVLCPIC  386



>ref|XP_010912300.1| PREDICTED: uncharacterized protein LOC105038254 [Elaeis guineensis]
Length=407

 Score =   265 bits (677),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 188/422 (45%), Positives = 251/422 (59%), Gaps = 41/422 (10%)
 Frame = +1

Query  40    MGCVSSKLFPK-DKDFPF------AGDGGCATHVVSLTSSTYGVLKLDKDSHQ-------  177
             MGC+SSKL    D D         A  G    HVVSLTSSTYG+L LD++  +       
Sbjct  1     MGCISSKLLATADLDSEVRCYGSKAAAGDSPNHVVSLTSSTYGLLNLDRNEAKGKEEEEE  60

Query  178   -------QQTPPQCIKECVVEVKKASPAREKPPEVINAWELMEGLDETEMPAAKKSPKAR  336
                     ++PP  I    +   K S  +E+P E+INAWELM  LDE EM     SP  +
Sbjct  61    EAATKKWNRSPPASI----IPPFKRSVLKEEPSEIINAWELMGDLDE-EMSIW--SPLKK  113

Query  337   SFLDHRRSPLKFLN---QLASPGKLRR-SGGKENKP-GRAMGRSEFSPKTVPKAYNLQES  501
                 H  +P++  +     ASP K ++ S GKEN P G+   R +     V + ++  E+
Sbjct  114   CTKSH--APMRLFSPAKVTASPRKQKKKSIGKENSPLGQGSERLDLDSNRVLRPFSSVEN  171

Query  502   PWRVSPRLRSLKKGSPKLSPNELKCDSMRAESMAVCTRRSLNPLFNPeigeklsseeeeq  681
                +       KK +P  + N  K    R  S    +RRSL+PLF+PE+   L  E  E+
Sbjct  172   TQWIGSVSTISKKNTP--TANMQKSGRDRGGSG---SRRSLSPLFDPELLASLEKEHHEE  226

Query  682   ikkMISSTPVSRKSRKSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTA  861
              +++       R+ +K  +    +++ F +KCPP GEN VV+YTTTLRGIRKTFEDCN  
Sbjct  227   GEQIKKIIDPVRRRQKGHDLG-LLVQSFEEKCPPGGENIVVLYTTTLRGIRKTFEDCNAV  285

Query  862   RSILESHHVRTFERDVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeeg  1041
             R  +ESH V+  ERD+SM SG++EELR LMG   V+VP+VFVKGR+IGGA+EV+ LEEEG
Sbjct  286   RCAIESHDVKIVERDISMDSGYREELRLLMGIKEVRVPVVFVKGRLIGGAEEVLMLEEEG  345

Query  1042  klgillsgiPQAGAGCDGCAGVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPI  1221
             KLG+LL GIP+A   C GC G+RFV+C++CNGSCKVL  + K  V+C +CNENGLI CP+
Sbjct  346   KLGLLLEGIPRAEVCCKGCGGMRFVMCMDCNGSCKVLDREQKKMVRCEQCNENGLIHCPL  405

Query  1222  CC  1227
             CC
Sbjct  406   CC  407



>ref|XP_006287909.1| hypothetical protein CARUB_v10001143mg [Capsella rubella]
 gb|EOA20807.1| hypothetical protein CARUB_v10001143mg [Capsella rubella]
Length=392

 Score =   259 bits (662),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 188/412 (46%), Positives = 256/412 (62%), Gaps = 38/412 (9%)
 Frame = +1

Query  40    MGCVSSKLFPKDKDFPFAGDGGCATHVVSLTSSTYGVLKLDKDS------HQQQTPPQCI  201
             MGCVSSKL  K        + G   H+VSLTS+TYG L +++ +       Q+ T  +  
Sbjct  1     MGCVSSKLGKKKLIREIRVNNG-GDHIVSLTSTTYGHLDIEERAVTSPPKLQEVTKGEVF  59

Query  202   KECVVEVKKASPAREKPPEVINAWELMEGLDETEMPAA--KKSPKARS-FLDHRRSPLKF  372
             +E   E+K     +   PE+IN WELME L+++   +   K SPK+R  F    ++P+K 
Sbjct  60    EES--EIKPRRSVKRDDPEIINTWELMEDLEDSMHVSNPNKISPKSRGIFGKSWKTPVKS  117

Query  373   LNQLASP--GKLRRSGGKENKPGRAMGRSEFSPKTVPKAYNLQESPWRVSPRLRSLKKGS  546
                + SP  G  +R GGKEN+ G        SP  + K  N+ E+P          K+G 
Sbjct  118   SISVESPKRGSSKRFGGKENRGGN--NSRGVSPNQILKPKNILETP----------KRGV  165

Query  547   PKLSPNELKCDSMRAESMAVCTRRSLNPLFNPeigeklsseeeeqikkM-ISSTPVSRKS  723
              +LS        +++E  +   R+S +P+F+P++      E  ++ +++ +  +PV  +S
Sbjct  166   MRLS------FPLKSEEPSTQRRKSYSPMFDPDLVASYERELSQEKEQIKMVISPVVHES  219

Query  724   RKSQEA--ADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTF  897
             R++++   ++ ILE F +KCPP GENSVVIY TTLRGIRKTFEDCN  RS+L+S+ VR  
Sbjct  220   RRTEKTRESERILENFPEKCPPGGENSVVIYITTLRGIRKTFEDCNVVRSVLDSYEVRFS  279

Query  898   ERDVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQA  1077
             ERDVSMHS FKEE+RG+MG   VK+P VFVKGRMIG  +EV+KLEEEGKLGILL GIP A
Sbjct  280   ERDVSMHSVFKEEIRGIMGAKHVKIPAVFVKGRMIGSVEEVMKLEEEGKLGILLQGIPAA  339

Query  1078  ---GAGCDGCAGVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPIC  1224
                G  C GC G+RFV+C  CNGSCKV+ ++ KN VKC ECNENGL+ CPIC
Sbjct  340   RLGGGCCRGCGGMRFVMCAVCNGSCKVMEKEKKNMVKCLECNENGLVLCPIC  391



>ref|XP_009416033.1| PREDICTED: uncharacterized protein At3g28850-like [Musa acuminata 
subsp. malaccensis]
Length=413

 Score =   259 bits (661),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 183/430 (43%), Positives = 243/430 (57%), Gaps = 51/430 (12%)
 Frame = +1

Query  40    MGCVSSKLFPK---DKDFPFAGD-----GGCATHVVSLTSSTYGVLKLDKDSHQQQTP--  189
             MGC+SSKL       ++  F+GD     G C  H VSLTS+TYG L LD+       P  
Sbjct  1     MGCISSKLLAAADLGEELLFSGDANPTAGDCPNHFVSLTSTTYGALSLDRGDDGASIPDA  60

Query  190   ---PQCIKECVVEVKKASPA-------------REKPPEVINAWELMEGL-DET--EMPA  312
                 +   E   +V++  P+              E+P EVI+A ELM  L DET    P+
Sbjct  61    PAGTEVEPEAATKVERGRPSPSPHLDEKRTVAEEERPSEVIDARELMGDLADETPSRSPS  120

Query  313   AKKSPKARSFLDHRRSPLKFLNQLASPGKLRRSGGKENKPGRAM-GRSEFSPKTVPKAY-  486
              +K P   S   HR   ++ +     P   R   GKEN P R+   RS+     + KA+ 
Sbjct  121   QRKRPLKPSPTAHRSPAVRAVFSPVMP--RRWFAGKENTPLRSEPKRSDLDAHRISKAFR  178

Query  487   NLQESPWRVSPRLRSLKKG-SPKLSPNELKCDSMRAESMAVCTRRSLNPLFNPeigekls  663
             +L  +PW        L    S K +PN         +S    +RRSL PLF+PE+     
Sbjct  179   SLDNTPW------AGLASAISKKCTPNSTGSKKSERDSGNSRSRRSLVPLFDPELVAFFE  232

Query  664   seeeeqikkMISSTPVSRKSRKSQEAADTI--LEQFNQKCPPAGENSVVIYTTTLRGIRK  837
              E  ++ ++         K     +  D++  L+ + +KCP  GEN VV+YTTTLRGIRK
Sbjct  233   KEHHQEGEQT--------KKVVQGKVCDSVLLLQSYEEKCPRGGENIVVLYTTTLRGIRK  284

Query  838   TFEDCNTARSILESHHVRTFERDVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADE  1017
             TFEDCNT RS+ ES+ V   ERD+SM SG++EELR LMG   VKVP+VF+KGR +GG +E
Sbjct  285   TFEDCNTVRSLFESYSVHIVERDISMDSGYREELRVLMGKKEVKVPVVFIKGRCVGGTEE  344

Query  1018  VVkleeegklgillsgiPQAGAGCDGCAGVRFVLCLNCNGSCKVLGEDLKNTVKCGECNE  1197
             V++LEEE KLG++L G+P+A   CDGC G+RFV+C+ CNGSCKVL  + K  VKCGECNE
Sbjct  345   VLRLEEEAKLGLILEGLPRATKWCDGCGGLRFVMCMGCNGSCKVLDSE-KKKVKCGECNE  403

Query  1198  NGLIQCPICC  1227
             NGLI CP+CC
Sbjct  404   NGLIHCPMCC  413



>gb|ABY79171.1| At5g03870-like protein [Arabidopsis lyrata]
Length=375

 Score =   257 bits (657),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 184/382 (48%), Positives = 242/382 (63%), Gaps = 30/382 (8%)
 Frame = +1

Query  115   HVVSLTSSTYGVLKLDKDSHQQQTPPQCIKECVVE--VKKASPAREKPPEVINAWELMEG  288
             H+VSLTS+TYG L LD+ +       +  K  V E  +K     +   PE+IN WELME 
Sbjct  11    HIVSLTSTTYGHLDLDERAETSPKSLEVTKGEVFESEIKARRSIQRDDPEIINTWELMED  70

Query  289   LDETEMPA--AKKSPKARS-FLDHRRSPLKFLNQLASPGKLRRSGGKENKPGRAMGRSEF  459
             L+++   +   K SPK+R  F    ++P+K + +    G  +R GGKEN+ G        
Sbjct  71    LEDSMHVSNPQKISPKSRGIFGKSWKTPVKSVVESPKRGSSKRFGGKENRGGN--NSRGV  128

Query  460   SPKTVPKAYNLQESPWRVSPRLR-SLKKGSPKLSPNELKCDSMRAESMAVCTRR-SLNPL  633
             SP  + K  N+ E+P R   RL   LK   P               S+ +  RR S +P+
Sbjct  129   SPNQILKPKNILETPKRGVMRLSFPLKFEEP---------------SVVITQRRKSYSPM  173

Query  634   FNPeigeklsseeeeqikkM-ISSTPVSRKSRKSQEAADT--ILEQFNQKCPPAGENSVV  804
             F+P++      E  ++ +++ +  +PV  +SRK+++  ++  ILE+F +KCPP GENSVV
Sbjct  174   FDPDLVASYERELSQEQEQIKMVISPVVHESRKTEKTRESERILEKFPEKCPPGGENSVV  233

Query  805   IYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKEELRGLMGTMVVKVPLVF  984
             IY TTLRGIRKTFEDCN  RSIL+SH VR  ERDVSMHS FKEE+RG+MGT  VK+P VF
Sbjct  234   IYITTLRGIRKTFEDCNVVRSILDSHEVRFSERDVSMHSVFKEEIRGIMGTKHVKIPAVF  293

Query  985   VKGRMIGGADEVVkleeegklgillsgiPQA---GAGCDGCAGVRFVLCLNCNGSCKVLG  1155
             VKGRM+G  +EV+KLEEEGKLGILL GIP A   G+ C GC G+RFV+C+ CNGSCKV G
Sbjct  294   VKGRMLGSVEEVMKLEEEGKLGILLEGIPAARLGGSCCRGCGGMRFVMCVVCNGSCKVRG  353

Query  1156  EDLKNTVKCGECNENGLIQCPI  1221
             ED K+ VKC ECNENGL+ CPI
Sbjct  354   EDKKSMVKCLECNENGLVLCPI  375



>ref|NP_196007.1| Glutaredoxin family protein [Arabidopsis thaliana]
 emb|CAB85507.1| putative protein [Arabidopsis thaliana]
 dbj|BAB08613.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED90665.1| Glutaredoxin family protein [Arabidopsis thaliana]
Length=384

 Score =   257 bits (656),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 188/405 (46%), Positives = 252/405 (62%), Gaps = 32/405 (8%)
 Frame = +1

Query  40    MGCVSSKLFPKDKDFPFAGDGGCATHVVSLTSSTYGVLKLDKDSHQQQTPPQCIKECVVE  219
             MGCVSSKL  K        + G   H+VSLTS+TYG L LD+ +       +  K  V E
Sbjct  1     MGCVSSKLGKKKLIREIRVNNG-GDHIVSLTSTTYGHLDLDERAETSPKSLEVTKGEVFE  59

Query  220   ---VKKASPAREKPPEVINAWELMEGLDETEMPA--AKKSPKARS-FLDHRRSPLKFLNQ  381
                + + S  R+ P E+IN WELME L+++   +   K SPK+R  F    ++P+K + +
Sbjct  60    SEIIPRRSIKRDDP-EIINTWELMEDLEDSMHVSNPQKISPKSRGIFGKSWKTPVKSVVE  118

Query  382   LASPGKLRRSGGKENKPGRAMGRSEFSPKTVPKAYNLQESPWRVSPRLRSLKKGSPKLSP  561
                 G  +R GGKEN   R +     SP  + K  N+ E+P          K+G  +LS 
Sbjct  119   SPKRGSSKRFGGKENN-SRGV-----SPNQILKPKNILETP----------KRGVMRLS-  161

Query  562   NELKCDSMRAESMAVCTRRSLNPLFNPeigeklsseeeeqikkM-ISSTPVSRKSRKSQE  738
                   S  +       R+S +P+F+P++      E  ++ +++ +  +PV  +SRK+ E
Sbjct  162   --FPLKSEESSVTVTQRRKSYSPMFDPDLVASYERELSQEKEQIKMVISPVVHESRKT-E  218

Query  739   AADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMH  918
               + ILE+F +KCPP GE+SVVIY TTLRGIRKTFEDCN  RSIL+SH VR  ERDVSMH
Sbjct  219   KTERILEKFPEKCPPGGEHSVVIYITTLRGIRKTFEDCNVVRSILDSHEVRFSERDVSMH  278

Query  919   SGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQA---GAGC  1089
             S FKEE+RG+MGT  VK+P VFVKGRM+G  +EV++LEEEGKLGILL GIP A   G+ C
Sbjct  279   SVFKEEIRGIMGTKHVKIPAVFVKGRMVGSVEEVMRLEEEGKLGILLEGIPAARLGGSCC  338

Query  1090  DGCAGVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPIC  1224
              GC G+RF++C+ CNGSCKV  E+ K+ VKC +CNENGL+ CPIC
Sbjct  339   RGCGGMRFMMCVVCNGSCKVREEEKKSMVKCLKCNENGLVLCPIC  383



>ref|XP_006398847.1| hypothetical protein EUTSA_v10013788mg [Eutrema salsugineum]
 gb|ESQ40300.1| hypothetical protein EUTSA_v10013788mg [Eutrema salsugineum]
Length=386

 Score =   256 bits (654),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 185/405 (46%), Positives = 253/405 (62%), Gaps = 30/405 (7%)
 Frame = +1

Query  40    MGCVSSKLFPKDKDFPFAGDGGCATHVVSLTSSTYGVLKLDKDSHQQQTPPQCIKECVVE  219
             MGCVSSKL  K        + G   H+VSLTS+TYG L L+K +    T  +  K  V E
Sbjct  1     MGCVSSKLGKKKLIREIRVNNG-GDHIVSLTSTTYGHLDLEKRAETSPTLQELTKGDVFE  59

Query  220   VK---KASPAREKPPEVINAWELMEGLDETEMPAAKKSPKARS-FLDHRRSPLKFLNQLA  387
              +   + S  +   PE+IN WELME L+++  P  + SPK+R  F    ++P+K + +  
Sbjct  60    SEIKPRRSITQRDDPEIINTWELMEDLEDSMHPQ-RISPKSRGIFGKSWKTPVKSIVESP  118

Query  388   SPGKLRRSGGKENKPGRAMGRSEFSPKTVPKAYNLQESPWRVSPRLRSLKKGSPKLSPNE  567
                  +R  GKEN+ G        SP  + K  N+ E+P          K+G  +LS   
Sbjct  119   KRNSSKRFVGKENRGGN--NSRGVSPNQILKPRNILETP----------KRGVMRLS---  163

Query  568   LKCDSMRAESMAVCTRRSLNPLFNPeigeklsseeeeqikkM-ISSTPVSRKSRKSQEAA  744
                  +++E  +V  R+S +P+F+P +      E  ++ +++ +  +PV R++RK+++  
Sbjct  164   ---FPLKSEEPSVQRRKSFSPMFDPNLVASYERELSQEQEQIKMVISPVVRETRKTEKTI  220

Query  745   DT--ILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMH  918
             ++  IL+ F +KCPP GENSVVIY T+LRGIRKTFEDCN  RSIL+SH VR  ERDVSMH
Sbjct  221   ESERILKSFPEKCPPGGENSVVIYITSLRGIRKTFEDCNAVRSILDSHEVRFSERDVSMH  280

Query  919   SGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQA---GAGC  1089
             S +KEE+RG+MGT  VK+P VFVKGRMIG  +EVV+LEEEGKLGILL  +P+A   G  C
Sbjct  281   SVYKEEIRGIMGTKQVKIPAVFVKGRMIGSVEEVVRLEEEGKLGILLECMPKARLGGRCC  340

Query  1090  DGCAGVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPIC  1224
              GC G+RFV+C  CNGSCKV+ E+ K+ VKC ECNENGL+ CP C
Sbjct  341   RGCGGMRFVMCAVCNGSCKVMEEEKKSMVKCLECNENGLVICPFC  385



>ref|XP_009404925.1| PREDICTED: uncharacterized protein At5g39865-like [Musa acuminata 
subsp. malaccensis]
Length=411

 Score =   254 bits (649),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 184/438 (42%), Positives = 248/438 (57%), Gaps = 69/438 (16%)
 Frame = +1

Query  40    MGCVSSKLFPK---DKDFPFAGDGG----CATHVVSLTSSTYGVLKLDKDSHQQQTP---  189
             MGC+SSKL       ++  F+GD G    C  H VSLTS+TYG L LD+   +   P   
Sbjct  1     MGCISSKLLAVAEVGEELLFSGDAGPDGDCPNHFVSLTSTTYGALSLDRGDEKANDPKAP  60

Query  190   --------PQCIKEC------VVEVKKASPAREKPPEVINAWELMEGL-DET--------  300
                          EC       V+ K A+   E+P EVI+A ELM  L DET        
Sbjct  61    AEKEVEPDAASASECGQPSPPHVDKKSAAAEEERPSEVIDARELMGDLADETPSRSPPQK  120

Query  301   -----EMPAAKKSPKARSFLDHRRSPLKFLNQLASPGKLRRSGGKENKPGRAM-GRSEFS  462
                    PA ++SP  R+ +    SP+   N  A         GKEN P R    RS+  
Sbjct  121   KRPHKPSPALRRSPAVRAAM----SPVMPRNWFA---------GKENTPLRLEPKRSDHD  167

Query  463   PKTVPKAY-NLQESPWRVSPRLRSLKKGSPKLSPNELKCDSMRAESMAVCTRRSLNPLFN  639
                  K + +L  +PW        +   S K +PN  + ++   +     +RRSL+PLF+
Sbjct  168   AYRASKPFRSLDNTPW-----TNLVSAISKKGTPNSARSNNSNRDFSNSKSRRSLSPLFD  222

Query  640   PeigeklsseeeeqikkMISSTPVSRKSRKSQEAADTI--LEQFNQKCPPAGENSVVIYT  813
             PE+  +   E  E+ +++     V        +  D++  L+ F +KCPP GE++VV+YT
Sbjct  223   PELLARFEREHCEEGEQIKRMVHV--------KICDSVILLQSFEEKCPPGGEDTVVLYT  274

Query  814   TTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKEELRGLMGTMVVKVPLVFVKG  993
             TTLRGIRKTFEDCNT RS++ES+     ERD+SM SG++EELR LMG   VKVP+VFVKG
Sbjct  275   TTLRGIRKTFEDCNTVRSLIESYGGHIVERDISMDSGYREELRLLMGRKEVKVPIVFVKG  334

Query  994   RMIGGADEVVkleeegklgillsgiPQAGAGCDGCAGVRFVLCLNCNGSCKVLGEDLKNT  1173
             R +GGA+E+V+LEEE +LG+LL G+P+A   C+GC G+RFV+C++CNGSCKVL  + K  
Sbjct  335   RCVGGAEEIVRLEEEDELGLLLEGLPRATKWCEGCGGLRFVMCMDCNGSCKVLDSE-KKK  393

Query  1174  VKCGECNENGLIQCPICC  1227
             VKC  CNENGLI CPICC
Sbjct  394   VKCEGCNENGLIHCPICC  411



>ref|XP_010452282.1| PREDICTED: uncharacterized protein At3g28850-like [Camelina sativa]
Length=407

 Score =   248 bits (634),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 193/425 (45%), Positives = 252/425 (59%), Gaps = 49/425 (12%)
 Frame = +1

Query  40    MGCVSSKLFPKDKDFPFAGDGGCATHVVSLTSSTYGVLKLDKDSHQQQTPP---------  192
             MGCVSSKL  K        + G   H+VSLTS+TYG L +++ +     PP         
Sbjct  1     MGCVSSKLGKKKLIREIRVNNG-GDHIVSLTSTTYGHLDIEERAETSPPPPPKLLQELTK  59

Query  193   -QCIKECVVEVKKASPAREKPPEVINAWELMEGLDE-----TEMPAAKKSPKARS-FLDH  351
              +   E V++ +++   +   PE+IN WELME L++     T  P    SPK+RS F   
Sbjct  60    GEVFDESVIKPRRS--VKRDDPEIINTWELMEDLEDSMHVSTNNPQKLISPKSRSIFGKS  117

Query  352   RRSPLKFLNQ-LASP--GKLRRSGGKENKPGRAMGRSE-----FSPKTVPKAYN-LQESP  504
              ++P+K  N  + SP  G  +R GGKEN        +       SP  + K  N L E+P
Sbjct  118   WKTPVKSTNNSVESPKRGSSKRFGGKENNNRGGNNNNNNNSRGVSPSQILKPKNILLETP  177

Query  505   WRVSPRLR-SLKKGSPKLSPNELKCDSMRAESMAVCTRRSLNPLFNPeigeklsseeeeq  681
              R   RL   LK   P L   + +             R+S +P+F+P++      E  ++
Sbjct  178   KRGVMRLSFPLKSEEPSLVIAQTQ------------RRKSYSPMFDPDLVASYERELSQE  225

Query  682   ikkM-ISSTPVSRKSRKSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNT  858
              +++ +  +PV ++ RK++     ILE F  KCPP GENSVVIY TTLRGIRKTFEDCN 
Sbjct  226   QEQIKMVISPVVQEGRKTER----ILENFPVKCPPGGENSVVIYITTLRGIRKTFEDCNV  281

Query  859   ARSILESHHVRTFERDVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleee  1038
              RSIL+SH VR  ERDVSMHS FKEE+RGL+G   VK+P VFVKGRM+G  +EV+KLEEE
Sbjct  282   VRSILDSHEVRFSERDVSMHSVFKEEIRGLVGAKQVKIPAVFVKGRMVGSVEEVMKLEEE  341

Query  1039  gklgillsgiPQA---GAGCDGCAGVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLI  1209
             GKLGILL GIP A   G  C GC G+RFV+C+ CNGSCKV+ +D K+ VKC ECNENGL+
Sbjct  342   GKLGILLEGIPAARLGGGCCRGCGGMRFVMCVVCNGSCKVMEKDKKSMVKCLECNENGLV  401

Query  1210  QCPIC  1224
              CPIC
Sbjct  402   LCPIC  406



>gb|ABY79163.1| At5g03870 [Arabidopsis thaliana]
 gb|ABY79167.1| At5g03870 [Arabidopsis thaliana]
Length=368

 Score =   247 bits (631),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 180/387 (47%), Positives = 243/387 (63%), Gaps = 33/387 (9%)
 Frame = +1

Query  91    AGDGGCATHVVSLTSSTYGVLKLDKDSHQQQTPPQCIKECVVE---VKKASPAREKPPEV  261
               +GG   H+VSLTS+TYG L LD+ +       +  K  V E   + + S  R+ P E+
Sbjct  5     VNNGG--DHIVSLTSTTYGHLDLDERAETSPKSLEVTKGEVFESEIIPRRSIKRDDP-EI  61

Query  262   INAWELMEGLDETEMPA--AKKSPKARS-FLDHRRSPLKFLNQLASPGKLRRSGGKENKP  432
             IN WELME L+++   +   K SPK+R  F    ++P+K + +    G  +R GGKEN  
Sbjct  62    INTWELMEDLEDSMHVSNPQKISPKSRGIFGKSWKTPVKSVVESPKRGSSKRFGGKENN-  120

Query  433   GRAMGRSEFSPKTVPKAYNLQESPWRVSPRLRSLKKGSPKLSPNELKCDSMRAESMAVCT  612
              R +     SP  + K  N+ E+P          K+G  +LS       S  +       
Sbjct  121   SRGV-----SPNQILKPKNILETP----------KRGVMRLS---FPLKSEESSVTVTQR  162

Query  613   RRSLNPLFNPeigeklsseeeeqikkM-ISSTPVSRKSRKSQEAADTILEQFNQKCPPAG  789
             R+S +P+F+P++      E  ++ +++ +  +PV  +SRK+ E  + ILE+F +KCPP G
Sbjct  163   RKSYSPMFDPDLVASYERELSQEKEQIKMVISPVVHESRKT-EKTERILEKFPEKCPPGG  221

Query  790   ENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKEELRGLMGTMVVK  969
             E+SVVIY TTLRGIRKTFEDCN  RSIL+SH VR  ERDVSMHS FKEE+RG+MGT  VK
Sbjct  222   EHSVVIYITTLRGIRKTFEDCNVVRSILDSHEVRFSERDVSMHSVFKEEIRGIMGTKHVK  281

Query  970   VPLVFVKGRMIGGADEVVkleeegklgillsgiPQA---GAGCDGCAGVRFVLCLNCNGS  1140
             +P VFVKGRM+G  +EV++LEEEGKLGILL GIP A   G+ C GC G+RF++C+ CNGS
Sbjct  282   IPAVFVKGRMVGSVEEVMRLEEEGKLGILLEGIPAARLGGSCCRGCGGMRFMMCVVCNGS  341

Query  1141  CKVLGEDLKNTVKCGECNENGLIQCPI  1221
             CKV  E+ K+ VKC ECNENGL+ CPI
Sbjct  342   CKVREEEKKSMVKCVECNENGLVLCPI  368



>gb|ABY79158.1| At5g03870 [Arabidopsis thaliana]
 gb|ABY79159.1| At5g03870 [Arabidopsis thaliana]
 gb|ABY79160.1| At5g03870 [Arabidopsis thaliana]
 gb|ABY79162.1| At5g03870 [Arabidopsis thaliana]
 gb|ABY79166.1| At5g03870 [Arabidopsis thaliana]
 gb|ABY79169.1| At5g03870 [Arabidopsis thaliana]
 gb|ABY79170.1| At5g03870 [Arabidopsis thaliana]
Length=368

 Score =   247 bits (631),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 181/387 (47%), Positives = 243/387 (63%), Gaps = 33/387 (9%)
 Frame = +1

Query  91    AGDGGCATHVVSLTSSTYGVLKLDKDSHQQQTPPQCIKECVVE---VKKASPAREKPPEV  261
               +GG   H+VSLTS+TYG L LD+ +       +  K  V E   + + S  R+ P E+
Sbjct  5     VNNGG--DHIVSLTSTTYGHLDLDERAETSPKSLEVTKGEVFESEIIPRRSIKRDDP-EI  61

Query  262   INAWELMEGLDETEMPA--AKKSPKARS-FLDHRRSPLKFLNQLASPGKLRRSGGKENKP  432
             IN WELME L+++   +   K SPK+R  F    ++P+K + +    G  +R GGKEN  
Sbjct  62    INTWELMEDLEDSMHVSNPQKISPKSRGIFGKSWKTPVKSVVESPKRGSSKRFGGKENN-  120

Query  433   GRAMGRSEFSPKTVPKAYNLQESPWRVSPRLRSLKKGSPKLSPNELKCDSMRAESMAVCT  612
              R +     SP  + K  N+ E+P          K+G  +LS       S  +       
Sbjct  121   SRGV-----SPNQILKPKNILETP----------KRGVMRLS---FPLKSEESSVTVTQR  162

Query  613   RRSLNPLFNPeigeklsseeeeqikkM-ISSTPVSRKSRKSQEAADTILEQFNQKCPPAG  789
             R+S +P+F+P++      E  ++ +++ +  +PV  +SRK+ E  + ILE+F +KCPP G
Sbjct  163   RKSYSPMFDPDLVASYERELSQEKEQIKMVISPVVHESRKT-EKTERILEKFPEKCPPGG  221

Query  790   ENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKEELRGLMGTMVVK  969
             E+SVVIY TTLRGIRKTFEDCN  RSIL+SH VR  ERDVSMHS FKEE+RG+MGT  VK
Sbjct  222   EHSVVIYITTLRGIRKTFEDCNVVRSILDSHEVRFSERDVSMHSVFKEEIRGIMGTKHVK  281

Query  970   VPLVFVKGRMIGGADEVVkleeegklgillsgiPQA---GAGCDGCAGVRFVLCLNCNGS  1140
             +P VFVKGRM+G  +EV+KLEEEGKLGILL GIP A   G+ C GC G+RF++C+ CNGS
Sbjct  282   IPAVFVKGRMVGSVEEVMKLEEEGKLGILLEGIPAARLGGSCCRGCGGMRFMMCVVCNGS  341

Query  1141  CKVLGEDLKNTVKCGECNENGLIQCPI  1221
             CKV  E+ K+ VKC ECNENGL+ CPI
Sbjct  342   CKVREEEKKSMVKCLECNENGLVLCPI  368



>gb|ABY79168.1| At5g03870 [Arabidopsis thaliana]
Length=368

 Score =   247 bits (630),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 180/387 (47%), Positives = 243/387 (63%), Gaps = 33/387 (9%)
 Frame = +1

Query  91    AGDGGCATHVVSLTSSTYGVLKLDKDSHQQQTPPQCIKECVVE---VKKASPAREKPPEV  261
               +GG   H+VSLTS+TYG L LD+ +       +  K  V E   + + S  R+ P E+
Sbjct  5     VNNGG--DHIVSLTSTTYGHLDLDERAETSPKSLEVTKGEVFESEIIPRRSIKRDDP-EI  61

Query  262   INAWELMEGLDETEMPA--AKKSPKARS-FLDHRRSPLKFLNQLASPGKLRRSGGKENKP  432
             IN WELME L+++   +   K SPK+R  F    ++P+K + +    G  +R GGKEN  
Sbjct  62    INTWELMEDLEDSMHVSNPQKISPKSRGIFGKSWKTPVKSVVESPKRGSSKRFGGKENN-  120

Query  433   GRAMGRSEFSPKTVPKAYNLQESPWRVSPRLRSLKKGSPKLSPNELKCDSMRAESMAVCT  612
              R +     SP  + K  N+ E+P          K+G  +LS       S  +       
Sbjct  121   SRGV-----SPNQILKPKNILETP----------KRGVMRLS---FPLKSEESSVTVTQR  162

Query  613   RRSLNPLFNPeigeklsseeeeqikkM-ISSTPVSRKSRKSQEAADTILEQFNQKCPPAG  789
             R+S +P+F+P++      E  ++ +++ +  +PV  +SRK+ E  + ILE+F +KCPP G
Sbjct  163   RKSYSPMFDPDLVASYERELSQEKEQIKMVISPVVHESRKT-EKTERILEKFPEKCPPGG  221

Query  790   ENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKEELRGLMGTMVVK  969
             E+SVVIY TTLRGIRKTFEDCN  RSIL+SH VR  ERDVSMHS FKEE+RG+MGT  VK
Sbjct  222   EHSVVIYITTLRGIRKTFEDCNVVRSILDSHEVRFSERDVSMHSVFKEEIRGIMGTKHVK  281

Query  970   VPLVFVKGRMIGGADEVVkleeegklgillsgiPQA---GAGCDGCAGVRFVLCLNCNGS  1140
             +P VFVKGRM+G  +EV+KLEEEGKLG+LL GIP A   G+ C GC G+RF++C+ CNGS
Sbjct  282   IPAVFVKGRMVGSVEEVMKLEEEGKLGVLLEGIPAARLGGSCCRGCGGMRFMMCVVCNGS  341

Query  1141  CKVLGEDLKNTVKCGECNENGLIQCPI  1221
             CKV  E+ K+ VKC ECNENGL+ CPI
Sbjct  342   CKVREEEKKSMVKCLECNENGLVLCPI  368



>gb|ABY79165.1| At5g03870 [Arabidopsis thaliana]
Length=368

 Score =   247 bits (630),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 180/387 (47%), Positives = 243/387 (63%), Gaps = 33/387 (9%)
 Frame = +1

Query  91    AGDGGCATHVVSLTSSTYGVLKLDKDSHQQQTPPQCIKECVVE---VKKASPAREKPPEV  261
               +GG   H+VSLTS+TYG L LD+ +       +  K  V E   + + S  R+ P E+
Sbjct  5     VNNGG--DHIVSLTSTTYGHLDLDERAETSPKSLEVTKGEVFESEIIPRRSIKRDDP-EI  61

Query  262   INAWELMEGLDETEMPA--AKKSPKARS-FLDHRRSPLKFLNQLASPGKLRRSGGKENKP  432
             IN WELME L+++   +   K SPK+R  F    ++P+K + +    G  +R GGKEN  
Sbjct  62    INTWELMEDLEDSLHVSNPQKISPKSRGIFGKSWKTPVKSVVESPKRGSSKRFGGKENN-  120

Query  433   GRAMGRSEFSPKTVPKAYNLQESPWRVSPRLRSLKKGSPKLSPNELKCDSMRAESMAVCT  612
              R +     SP  + K  N+ E+P          K+G  +LS       S  +       
Sbjct  121   SRGV-----SPNQILKPKNILETP----------KRGVMRLS---FPLKSEESSVTVTQR  162

Query  613   RRSLNPLFNPeigeklsseeeeqikkM-ISSTPVSRKSRKSQEAADTILEQFNQKCPPAG  789
             R+S +P+F+P++      E  ++ +++ +  +PV  +SRK+ E  + ILE+F +KCPP G
Sbjct  163   RKSYSPMFDPDLVASYERELSQEKEQIKMVISPVVHESRKT-EKTERILEKFPEKCPPGG  221

Query  790   ENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKEELRGLMGTMVVK  969
             E+SVVIY TTLRGIRKTFEDCN  RSIL+SH VR  ERDVSMHS FKEE+RG+MGT  VK
Sbjct  222   EHSVVIYITTLRGIRKTFEDCNVVRSILDSHEVRFSERDVSMHSVFKEEIRGIMGTKHVK  281

Query  970   VPLVFVKGRMIGGADEVVkleeegklgillsgiPQA---GAGCDGCAGVRFVLCLNCNGS  1140
             +P VFVKGRM+G  +EV++LEEEGKLGILL GIP A   G+ C GC G+RF++C+ CNGS
Sbjct  282   IPAVFVKGRMVGSVEEVMRLEEEGKLGILLEGIPAARLGGSCCRGCGGMRFMMCVVCNGS  341

Query  1141  CKVLGEDLKNTVKCGECNENGLIQCPI  1221
             CKV  E+ K+ VKC ECNENGL+ CPI
Sbjct  342   CKVREEEKKSMVKCVECNENGLVLCPI  368



>gb|ABY79157.1| At5g03870 [Arabidopsis thaliana]
 gb|ABY79161.1| At5g03870 [Arabidopsis thaliana]
 gb|ABY79164.1| At5g03870 [Arabidopsis thaliana]
Length=368

 Score =   245 bits (625),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 179/387 (46%), Positives = 243/387 (63%), Gaps = 33/387 (9%)
 Frame = +1

Query  91    AGDGGCATHVVSLTSSTYGVLKLDKDSHQQQTPPQCIKECVVE---VKKASPAREKPPEV  261
               +GG   H+VSLTS+TYG L LD+ +       +  K  V E   + + S  R+ P E+
Sbjct  5     VNNGG--DHIVSLTSTTYGHLDLDERAETSPKSLEVTKGEVFESEIIPRRSIKRDDP-EI  61

Query  262   INAWELMEGLDETEMPA--AKKSPKARS-FLDHRRSPLKFLNQLASPGKLRRSGGKENKP  432
             IN WELME L+++   +   K SPK+R  F    ++P+K + +    G  +R GGKEN  
Sbjct  62    INTWELMEDLEDSMHVSNPQKISPKSRGIFGKSWKTPVKSVVESPKRGSSKRFGGKENN-  120

Query  433   GRAMGRSEFSPKTVPKAYNLQESPWRVSPRLRSLKKGSPKLSPNELKCDSMRAESMAVCT  612
              R +     SP  + K  N+ E+P          K+G  +LS       S  +       
Sbjct  121   SRGV-----SPNQILKPKNILETP----------KRGVMRLS---FPLKSEESSVTVTQR  162

Query  613   RRSLNPLFNPeigeklsseeeeqikkM-ISSTPVSRKSRKSQEAADTILEQFNQKCPPAG  789
             R+S +P+F+P++      E  ++ +++ +  +PV  +SRK+ E  + ILE+F +KCPP G
Sbjct  163   RKSYSPMFDPDLVASYERELSQEKEQIKMVISPVVHESRKT-EKTERILEKFPEKCPPGG  221

Query  790   ENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKEELRGLMGTMVVK  969
             E+SVVIY TTLRGIRKTFEDCN  RSIL+SH VR  ERDVSMHS FKEE+RG+MGT  VK
Sbjct  222   EHSVVIYITTLRGIRKTFEDCNVVRSILDSHEVRFSERDVSMHSVFKEEIRGIMGTKHVK  281

Query  970   VPLVFVKGRMIGGADEVVkleeegklgillsgiPQA---GAGCDGCAGVRFVLCLNCNGS  1140
             +P VFVKGRM+G  +EV++LEEEGKLGILL GIP A   G+ C GC G+RF++C+ CNGS
Sbjct  282   IPAVFVKGRMVGSVEEVMRLEEEGKLGILLEGIPAARLGGSCCRGCGGMRFMMCVVCNGS  341

Query  1141  CKVLGEDLKNTVKCGECNENGLIQCPI  1221
             CKV  E+ K+ VKC +CNENGL+ CPI
Sbjct  342   CKVREEEKKSMVKCLKCNENGLVLCPI  368



>gb|KFK24849.1| hypothetical protein AALP_AA8G032500 [Arabis alpina]
Length=374

 Score =   244 bits (623),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 189/406 (47%), Positives = 243/406 (60%), Gaps = 44/406 (11%)
 Frame = +1

Query  40    MGCVSSKLFPKDKDFPFAGDGGCATHVVSLTSSTYGVLKLDKDSHQQQTPPQCIKECVVE  219
             MGCVSSKL  K        + G   H+VSLTS+TYG L L++ S       +  K    E
Sbjct  1     MGCVSSKLGKKKLTREIRVNNG-GDHIVSLTSTTYGHLDLEERSEISPKLQELSKGEDFE  59

Query  220   VKKASPARE--KPPEVINAWELMEGLDETEMPAAKKSPKARSFLDHR-RSPLKFLNQLAS  390
               +  P R     PEVIN WELME L+++ M   K SPK+R F     ++P+K L+ + S
Sbjct  60    -SEIKPRRSITDDPEVINTWELMEDLEDS-MHTQKISPKSRGFFGKSWKTPVKSLSIMES  117

Query  391   P-----GKLRRSGGKENKPGRAMGRSEFSPKTVPKAYNLQESPWRVSPRLRSLKKGSPKL  555
             P     G  +R  GKEN+ G    R   SP  + K+ N+ ++P R   RL      S  L
Sbjct  118   PKRGGGGSSKRFVGKENRGGSCNSRG-VSPNQILKSKNVLQTPKRSVMRL------SFPL  170

Query  556   SPNELKCDSMRAESMAVCTRRSLNPLFNPeigeklsseeeeqikkMISSTPVSRKSRKSQ  735
                E              +R+S +P+F+P++      E  ++ +  I     S K+R+S 
Sbjct  171   KLEE--------------SRKSFSPMFDPDLVASYEKELSQEKE-QIKMVITSEKTRES-  214

Query  736   EAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSM  915
                    E F +KCPP GENSVV+Y T+LRGIRKTFEDCN  RS+L+SH VR  ERDVSM
Sbjct  215   -------EDFAEKCPPGGENSVVVYITSLRGIRKTFEDCNAVRSLLDSHEVRFSERDVSM  267

Query  916   HSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQA---GAG  1086
             HS FKEE+RG+MGT  VK+P VFVKGR+IG  +E+V+LEEEGKLGILL GIP A   G  
Sbjct  268   HSVFKEEIRGIMGTKQVKIPAVFVKGRLIGSVEELVRLEEEGKLGILLEGIPAARLGGGC  327

Query  1087  CDGCAGVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPIC  1224
             C GC G+RFV+C+ CNGSCKV+ ++ KN VKC ECNENGL+ CPIC
Sbjct  328   CRGCGGLRFVMCVVCNGSCKVMDDEKKNMVKCLECNENGLVLCPIC  373



>ref|XP_010423654.1| PREDICTED: uncharacterized protein At3g28850-like [Camelina sativa]
Length=404

 Score =   244 bits (623),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 193/425 (45%), Positives = 251/425 (59%), Gaps = 52/425 (12%)
 Frame = +1

Query  40    MGCVSSKLFPKDKDFPFAGDGGCATHVVSLTSSTYGVLKLDKDSHQQQTPP---------  192
             MGCVSSKL  K        + G   H+VSLTS+TYG L +++ +     PP         
Sbjct  1     MGCVSSKLGKKKLIREIRVNNG-GDHIVSLTSTTYGHLDIEERAETSPPPPPKLLQELTK  59

Query  193   -QCIKECVVEVKKASPAREKPPEVINAWELMEGLDE-----TEMPAAKKSPKARS-FLDH  351
              +   E V++ +++   +   PE+IN WELME L++     T  P    SPK+R  F   
Sbjct  60    GEVFDESVIKPRRS--VKRYDPEIINTWELMEDLEDSMHVSTTNPQKLISPKSRGIFGKS  117

Query  352   RRSPLKFLN-QLASP--GKLRRSGGKENKPGRAMGRSE----FSPKTVPKAYN-LQESPW  507
              ++P+K  N  + SP  G  +R GGKEN        +      SP  + K  N L E+P 
Sbjct  118   WKTPVKSTNISVESPKRGSSKRFGGKENNNRGVGNNNSSSRGVSPNQILKPKNILLETP-  176

Query  508   RVSPRLRSLKKGSPKLSPNELKCDSMRAESMAVCT--RRSLNPLFNPeigeklsseeeeq  681
                      K+G  +LS   LK D   +  +A  T  R+S +P+F+P++      E  ++
Sbjct  177   ---------KRGVMRLS-FPLKSDEPSSLVIAQTTQRRKSYSPMFDPDLVASYERELSQE  226

Query  682   ikkM-ISSTPVSRKSRKSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNT  858
              +++ +  +PV R  R        ILE F  KCPP GENSVVIY TTLRGIRKTFEDCN 
Sbjct  227   QEQIKMVISPVRRTER--------ILENFPVKCPPGGENSVVIYITTLRGIRKTFEDCNV  278

Query  859   ARSILESHHVRTFERDVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleee  1038
              RSIL+SH VR  ERDVSMHS FKEE+RGL+G   VK+P VFVKGRM+G  +EV+KLEEE
Sbjct  279   VRSILDSHEVRFSERDVSMHSVFKEEIRGLVGAKQVKIPAVFVKGRMVGSVEEVMKLEEE  338

Query  1039  gklgillsgiPQA---GAGCDGCAGVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLI  1209
             GKLGILL GIP A   G  C GC G+RFV+C+ CNGSCKV+ ++ K+ VKC ECNENGL+
Sbjct  339   GKLGILLEGIPAARLGGGCCRGCGGMRFVMCVVCNGSCKVMEKEKKSMVKCLECNENGLV  398

Query  1210  QCPIC  1224
              CPIC
Sbjct  399   LCPIC  403



>emb|CDP20406.1| unnamed protein product [Coffea canephora]
Length=177

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 126/178 (71%), Positives = 147/178 (83%), Gaps = 1/178 (1%)
 Frame = +1

Query  691   MISSTPVSRKSRKSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSI  870
             M+S TP + K R SQ++  +ILE F +KCP  GEN+VV+YTTTLRGIRKTFEDCNTARS+
Sbjct  1     MVSGTPTAVKKRNSQDSV-SILENFEEKCPLGGENAVVLYTTTLRGIRKTFEDCNTARSV  59

Query  871   LESHHVRTFERDVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklg  1050
             +ESH V+ F+ DVSMHSGFK+ELRGLMGT  VKVPLVFVKGR+IGGADE VKLEE+GKL 
Sbjct  60    IESHQVQMFKHDVSMHSGFKDELRGLMGTKEVKVPLVFVKGRLIGGADETVKLEEDGKLS  119

Query  1051  illsgiPQAGAGCDGCAGVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPIC  1224
              + SGIP+A A C+GCA VRFV+C+  NGSCKVL E  K TVKC ECN+NGLIQCP C
Sbjct  120   TVFSGIPKAVAICNGCAVVRFVMCIGGNGSCKVLDEKGKKTVKCKECNKNGLIQCPFC  177



>ref|XP_010543494.1| PREDICTED: uncharacterized protein At3g28850-like [Tarenaya hassleriana]
Length=400

 Score =   238 bits (608),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 203/421 (48%), Positives = 260/421 (62%), Gaps = 48/421 (11%)
 Frame = +1

Query  40    MGCVSSKLFPKDKDFPFAGDGGCATHVVSLTSSTYGVLKLDKDSHQQQTPPQCIKECVVE  219
             MGCVSSKL  K+       + G   H+VSLTS+TYG+LKLD    Q Q P   IK   +E
Sbjct  1     MGCVSSKLVKKELIREIRVNHG-GDHIVSLTSTTYGLLKLDDPVPQVQEP---IKYVGLE  56

Query  220   VKK--ASPAREKPPEVINAWELMEGLDETEMPAA---KKSPKARSFLDHR-RSPLKFLNQ  381
               K   S A E+P E+IN WELME L+++ +P +   + SPK+R F      SP+K   +
Sbjct  57    SDKPKISLASEEP-EIINTWELMEDLEDS-VPVSHPQRISPKSRGFFGKSWMSPMKSTEK  114

Query  382   LASPGKLRRSGGKENK--PGRAMGRSEFSPKTVPKAYNLQESPWRVSPRLR-SLKKGSPK  552
             + SP + +R  GKENK   G  +     SP  V K  N QE+  R   RL   +K   P 
Sbjct  115   MDSPKRSKRFVGKENKGTVGNGLISRGVSPNQVLKPRNAQETQKRGVLRLSFPVKSEEP-  173

Query  553   LSPNELKCDSMRAESMAVCTRR-SLNPLFNPeigeklss---eeeeqikkMISSTPVSRK  720
                           SMA   RR S +PLF+P++         +E+EQIK++IS+ P   K
Sbjct  174   --------------SMATTQRRKSFSPLFDPDLVASYERELCQEQEQIKQVISTVPEILK  219

Query  721   SRKSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFE  900
              ++++E  + IL+ F + CPP G+NSVVIYTTTLRGIRKTFEDCNT RSILESH ++  E
Sbjct  220   PQRTREI-ERILKNFREICPPGGQNSVVIYTTTLRGIRKTFEDCNTVRSILESHQIQLSE  278

Query  901   RDVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQA-  1077
             RDVSMHSGFK+E+R + GT  VK+P VF++GR+IGG +EVVKLEEEGKLGILL G+P A 
Sbjct  279   RDVSMHSGFKDEIRRITGTKQVKIPAVFMRGRLIGGVEEVVKLEEEGKLGILLEGLPAAR  338

Query  1078  --GAGCDGCAGVRFVLCLNCNGSCKVLGED----------LKNTVKCGECNENGLIQCPI  1221
               G GC GC G+RFV+C  C+GSCKV+ ++           K  VKC ECNENGLI CP 
Sbjct  339   LGGGGCHGCGGMRFVMCGLCHGSCKVMDKEEDENMPMKKKKKKMVKCMECNENGLIVCPF  398

Query  1222  C  1224
             C
Sbjct  399   C  399



>ref|XP_010490880.1| PREDICTED: uncharacterized protein At3g28850-like [Camelina sativa]
Length=403

 Score =   238 bits (608),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 187/424 (44%), Positives = 244/424 (58%), Gaps = 51/424 (12%)
 Frame = +1

Query  40    MGCVSSKLFPKDKDFPFAGDGGCATHVVSLTSSTYGVLKLDKDSH----------QQQTP  189
             MGCVSSKL  K        + G   H+VSLTS+TYG L +++ +           Q+ T 
Sbjct  1     MGCVSSKLGKKKLIREIRVNNG-GDHIVSLTSTTYGHLDIEERAETSPPLPPKLLQEVTK  59

Query  190   PQCIKECVVEVKKASPAREKPPEVINAWELMEGLDE------TEMPAAKKSPKARS-FLD  348
              +   E V++ +++   +   PE+IN WELME L++      T  P    SPK+R  F  
Sbjct  60    GEVFDESVIKPRRS--VKRDDPEIINTWELMEDLEDSMHVSTTTNPQKLISPKSRGIFGK  117

Query  349   HRRSPLKFLNQLASPGKLRRSGGKENKPGRAMGRSEFS------PKTVPKAYN-LQESPW  507
               ++P+K   +    G  +R GGKEN        +  +      P  + K  N L E+P 
Sbjct  118   SWKTPVKSSVESPKRGSSKRFGGKENNNRGVGNNNNNNNSRGVSPNQILKPKNILLETPK  177

Query  508   RVSPRLR-SLKKGSPKLSPNELKCDSMRAESMAVCTRRSLNPLFNPeigeklsseeeeqi  684
             R   RL   LK   P L             +     R+S +P+F+P++      E  ++ 
Sbjct  178   RGVMRLSFPLKSDEPSL-----------VIAQTTQRRKSYSPMFDPDLVASYERELSQEQ  226

Query  685   kkM-ISSTPVSRKSRKSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTA  861
             +++ +  +PV R  R        ILE F  KCPP GENSVVIY TTLRGIRKTFEDCN  
Sbjct  227   EQIKMVISPVRRTER--------ILENFPVKCPPGGENSVVIYITTLRGIRKTFEDCNVV  278

Query  862   RSILESHHVRTFERDVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeeg  1041
             RSIL+SH VR  ERDVSMHS FKEE+RGL+G   VK+P VFVKGRM+G  +EV+KLEEEG
Sbjct  279   RSILDSHEVRFSERDVSMHSVFKEEIRGLVGAKQVKIPAVFVKGRMVGSVEEVMKLEEEG  338

Query  1042  klgillsgiPQA---GAGCDGCAGVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQ  1212
             KLGILL GIP A   G  C GC G+RFV+C+ CNGSCKV+ ++ K+ VKC ECNENGL+ 
Sbjct  339   KLGILLEGIPAARLGGGCCRGCGGMRFVMCVVCNGSCKVMEKEKKSMVKCLECNENGLVL  398

Query  1213  CPIC  1224
             CPIC
Sbjct  399   CPIC  402



>ref|XP_009130788.1| PREDICTED: uncharacterized protein At3g28850-like [Brassica rapa]
Length=367

 Score =   237 bits (604),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 185/410 (45%), Positives = 239/410 (58%), Gaps = 59/410 (14%)
 Frame = +1

Query  40    MGCVSSKLFPKDKDFPFAGDGGCATHVVSLTSSTYGVLKLDKDSHQQQTPPQCIKECVVE  219
             MGCVSSKL  K        + G   H+VSLTS+TYG   LD D   + T P+ ++E   E
Sbjct  1     MGCVSSKLVKKKLVREIRVNNG-GDHIVSLTSTTYG--HLDLDQRAETTSPK-LQELTYE  56

Query  220   VKKASP-----AREKPPEVINAWELMEGLDETEMPAAKKSPKARS-FLDHRRSPLKFLNQ  381
              +   P      R+  PE+IN WELM+ L++    + K SPK+R  F    ++P K  + 
Sbjct  57    SETIKPRRSTTQRDDHPEIINTWELMKDLED----STKISPKSRGMFGKSWKTPAK--SS  110

Query  382   LASP---GKLRRSGGKENKPGRAMGRSEFSPKTVPKAYNLQESPWRVSPRLRSLKKGSPK  552
             L SP   G  +R  GKEN+  +       SP  VPK         R+S  L+S       
Sbjct  111   LESPKRNGSSKRFRGKENRGEKQ------SPNQVPK-----RGVMRLSFPLKS-------  152

Query  553   LSPNELKCDSMRAESMAVC--TRRSLNPLFNPeigeklsseeeeqikkMISSTPVSRKSR  726
                          E +AV    R+S +P+F+PE+      E  ++ +++        K+R
Sbjct  153   ------------EEPLAVTRQRRKSFSPMFDPELVASYERELSQEKEQIKMVIKTEDKNR  200

Query  727   KSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERD  906
              S      ILE F +KCPP GE+SVV+YTTTLRGIRKTFEDCN  RS+L+SH VR  ERD
Sbjct  201   GSVR----ILESFPEKCPPGGEDSVVVYTTTLRGIRKTFEDCNKVRSVLDSHEVRFSERD  256

Query  907   VSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQ---A  1077
             VSMHS FKEE+RG++GT  VK+P VFVKGRM+G  +EV++LEEEG+LGILL  +P+    
Sbjct  257   VSMHSVFKEEIRGILGTRQVKIPAVFVKGRMVGSVEEVMRLEEEGRLGILLECMPKQKMG  316

Query  1078  GAGCDGCAGVRFVLCLNCNGSCKVLG-EDLKNTVKCGECNENGLIQCPIC  1224
             G  C GC G+RFV+C  CNGSCKV   E  KNTVKC  CNENGL+ CPIC
Sbjct  317   GGCCCGCGGLRFVMCDVCNGSCKVRDVEKKKNTVKCLVCNENGLVLCPIC  366



>gb|KDP42502.1| hypothetical protein JCGZ_00299 [Jatropha curcas]
Length=318

 Score =   229 bits (584),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 120/171 (70%), Positives = 138/171 (81%), Gaps = 1/171 (1%)
 Frame = +1

Query  718   KSRKSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTF  897
             K  K+ +  ++IL  F +KCPP G+N+VVIYTTTLRGIRKTFEDCN  RSI+ESHH+   
Sbjct  148   KENKNVKELESILNTFEKKCPPGGDNAVVIYTTTLRGIRKTFEDCNIVRSIIESHHIHLV  207

Query  898   ERDVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQA  1077
             ERD+SM SGFKEELRGLMG   VKVPLVFVKGR+IGGAD+VVKL+EEGKL  L  GIP+ 
Sbjct  208   ERDISMDSGFKEELRGLMGKKEVKVPLVFVKGRLIGGADQVVKLDEEGKLETLFHGIPKR  267

Query  1078  GAG-CDGCAGVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPICC  1227
              AG C+GC GVRFV+C+ CNGSCKVL  + K  VKCGECNENGLI CPICC
Sbjct  268   LAGECEGCGGVRFVMCMECNGSCKVLDVEQKKMVKCGECNENGLIHCPICC  318


 Score = 96.7 bits (239),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 91/152 (60%), Gaps = 23/152 (15%)
 Frame = +1

Query  40   MGCVSSKLFPKD--KDFPFAGDGG----CATHVVSLTSSTYGVLKLDKDSHQQQTPPQC-  198
            MGCVSSK F K+  +D     +GG    C  HVVSLTS+TYG LKL+ +  +QQ   +  
Sbjct  1    MGCVSSKHFRKELKEDNIIVNNGGGGGKCVNHVVSLTSTTYGALKLESNEKRQQQHQEEE  60

Query  199  ---IKECVVEVKKA---SPAREKPPEVINAWELMEGLDE-TEMPA---AKKSPKARSFLD  348
               IKE V E KK    SP +E+ PEVIN WELME L+E   +P    +KKSPK R  L 
Sbjct  61   EEPIKEIVTESKKMQQRSPVKEE-PEVINTWELMEDLEEGGGIPISNHSKKSPKTRVLLR  119

Query  349  -----HRRSPLKFLNQLASPGKLRRSGGKENK  429
                   RSPLKFLNQ+ SP K +  GGKENK
Sbjct  120  GFADMEARSPLKFLNQIGSPRKAKTFGGKENK  151



>ref|XP_009125525.1| PREDICTED: uncharacterized protein At5g39865 [Brassica rapa]
Length=349

 Score =   228 bits (580),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 177/404 (44%), Positives = 235/404 (58%), Gaps = 65/404 (16%)
 Frame = +1

Query  40    MGCVSSKLFPKDKDFPFAGDGGCATHVVSLTSSTYGVLKLDKDSHQQQTPPQCIKECVVE  219
             MGCVSSK   K        + G   H+VSLTS+TYG L +      QQ      K    E
Sbjct  1     MGCVSSKPVKKKLVREIRVNNG-GDHIVSLTSTTYGHLDV------QQRAETSPKGDDFE  53

Query  220   VKKASPAREKPPEVINAWELMEGLDETEMPAAKKSPKARS-FLDHRRSPLKFLNQLASP-  393
              ++ S A+ + PE+IN WELME L++    + K SPK+R  F    ++P+K +  + SP 
Sbjct  54    SERRSNAQREDPEIINTWELMEDLED----STKVSPKSRGIFGKSWKTPVKSI--VESPK  107

Query  394   --GKLRRSGGKENKPGRAMGRSEFSPKTVPKAYNLQESPWRVSPRLRSLKKGSPKLSPNE  567
               G  +R  GKEN+            K  P   N+ E+P          K+G  +LS   
Sbjct  108   RNGSSKRFRGKENR----------GEKQSPNQKNILETP----------KRGVMRLS---  144

Query  568   LKCDSMRAESMAVCTRRSLNPLFNPeigeklsseeeeqikkMISSTPVSRKSRKSQEAAD  747
                  +++E +    R+S +P+F+P+               +++S    R+  + +E   
Sbjct  145   ---FPLKSEEITQRRRKSFSPMFDPD---------------LVAS--YERELSQEKEQIK  184

Query  748   TIL---EQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMH  918
              ++   +   +KCPP GENSVV+Y TTLRGIRKTFEDCN  RSIL+SH VR  ERDVSMH
Sbjct  185   MVISPPDPLPEKCPPGGENSVVVYITTLRGIRKTFEDCNAVRSILDSHEVRYSERDVSMH  244

Query  919   SGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQA--GAGCD  1092
             S FKEE+RG+MGT  VK+P VFVKGRMIG  +EVV+LEEEGKLGILL  +P+A     C 
Sbjct  245   SVFKEEIRGIMGTKQVKIPAVFVKGRMIGSVEEVVRLEEEGKLGILLECMPKARVSGCCC  304

Query  1093  GCAGVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPIC  1224
             GC G+RFV+C  CNGSCKV   + K+TVKC ECNENGL+ CP+C
Sbjct  305   GCGGMRFVMCGVCNGSCKVRDAEKKDTVKCLECNENGLVVCPMC  348



>emb|CDY04902.1| BnaAnng00840D [Brassica napus]
Length=347

 Score =   223 bits (568),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 175/404 (43%), Positives = 237/404 (59%), Gaps = 67/404 (17%)
 Frame = +1

Query  40    MGCVSSKLFPKDKDFPFAGDGGCATHVVSLTSSTYGVLKLDKDSHQQQTPPQCIKECVVE  219
             MGCVSSK   K        + G   H+VSLTS+TYG L +      QQ      K    E
Sbjct  1     MGCVSSKPVKKKLVREIRVNNG-GDHIVSLTSTTYGHLDV------QQRAETSPKGDDFE  53

Query  220   VKKASPAREKPPEVINAWELMEGLDETEMPAAKKSPKARS-FLDHRRSPLKFLNQLASP-  393
              ++ S A+ + PE+IN WELME L++    + K SPK+R  F    ++P+K +  + SP 
Sbjct  54    SERRSNAQREDPEIINTWELMEDLED----STKISPKSRGIFGKSWKTPVKSI--VESPK  107

Query  394   --GKLRRSGGKENKPGRAMGRSEFSPKTVPKAYNLQESPWRVSPRLRSLKKGSPKLSPNE  567
               G  +R  GKEN+                     ++SP ++   L++ K+G  +LS   
Sbjct  108   RNGSSKRFRGKENR-------------------GEKQSPNQI---LKTPKRGVMRLS---  142

Query  568   LKCDSMRAESMAVCTRRSLNPLFNPeigeklsseeeeqikkMISSTPVSRKSRKSQEAAD  747
                  +++E +    R+S +P+F+P+               +++S    R+  + +E   
Sbjct  143   ---FPLKSEEITQRRRKSFSPMFDPD---------------LVAS--YERELSQEKEQIK  182

Query  748   TIL---EQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMH  918
              ++   +   +KCPP GENSVV+Y TTLRGIRKTFEDCN  RSIL+SH VR  ERDVSMH
Sbjct  183   MVISPPDPLPEKCPPGGENSVVVYITTLRGIRKTFEDCNAVRSILDSHEVRYSERDVSMH  242

Query  919   SGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQA--GAGCD  1092
             S FKEE+RG+MGT  VK+P VFVKGRMIG  +EVV+LEEEGKLGILL  +P+A     C 
Sbjct  243   SVFKEEIRGIMGTKQVKIPAVFVKGRMIGSVEEVVRLEEEGKLGILLECMPKARVSGCCC  302

Query  1093  GCAGVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPIC  1224
             GC G+RFV+C  CNGSCKV   + K+TVKC ECNENGL+ CP+C
Sbjct  303   GCGGMRFVMCGVCNGSCKVRDAEKKDTVKCLECNENGLVVCPMC  346



>gb|ABK25245.1| unknown [Picea sitchensis]
Length=471

 Score =   208 bits (530),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 162/440 (37%), Positives = 223/440 (51%), Gaps = 76/440 (17%)
 Frame = +1

Query  127   LTSSTYGVLKLD-----------KDSHQQQTP-------------------PQCIKECVV  216
             LTSSTYGVL++D           K  +Q Q                        +++ V+
Sbjct  35    LTSSTYGVLRVDSSPRAEAKCKAKAENQNQVEVNKSLNQTSKSHPLKGLDGNNWVEKKVI  94

Query  217   EVKKA--SPAREKPPEVINAWELMEGLDETEMPAAKKSPKARSFLDHRRSPL-----KFL  375
             E + A  S   ++P   INAWELM GLD+     AKK  + ++F+  +++       +  
Sbjct  95    EEENAGTSGTEDQPVTTINAWELMAGLDDIGESPAKKCLQKQAFILEKKTSFYHTVEEID  154

Query  376   NQLASPGKLRRSGGKENK-------PGRAMGRSEFSPKTVPKAYNLQESPWRVS------  516
              Q +     ++  GKEN        PG+       S       +N   SP  V       
Sbjct  155   AQASGNASEKKCFGKENARPKQISTPGKVKSAFCLSSPLGEIDFNKSNSPENVGFHVGSV  214

Query  517   PRLRSLKKGSPKLSPNELKCDSMRAESMAVCTRRSLN-------PLFNPeigeklsseee  675
             P  + +++     S  +LK  + R   +    R SL+       PLF+P +        E
Sbjct  215   PSKQRMRRPGSHGSMTDLKFAASR--RLDSSLRLSLDLIKEPSSPLFDPNLLASFEKALE  272

Query  676   eqikkMISSTPVS-----RKS---------RKSQEAADTILEQFNQKCPPAGENSVVIYT  813
                ++  ++   S     RKS          +S +  D  L  F +KCPP G N+VV+YT
Sbjct  273   NLSEEEWNTIKKSEGQHRRKSPREGRFPWAAESDKNKDNPLGSFEEKCPPGGANAVVLYT  332

Query  814   TTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKEELRGLMGTMVVKVPLVFVKG  993
             TTLRGIRKTFEDCN  R  LES+ +   ERDVSMH  F+ ELR LMG  +V VP +F+KG
Sbjct  333   TTLRGIRKTFEDCNNVRDALESYGICISERDVSMHFEFRNELRKLMGGKLVTVPRLFIKG  392

Query  994   RMIGGADEVVkleeegklgillsgiPQAGAG--CDGCAGVRFVLCLNCNGSCKVLGEDLK  1167
             R IGGADE +++ EEGK+  LL+GIP   AG  CDGC GVRF+ C+ C+GSCK++ +D  
Sbjct  393   RYIGGADEALRIHEEGKMAELLAGIPTGMAGIICDGCGGVRFIPCMECSGSCKLVNDD-N  451

Query  1168  NTVKCGECNENGLIQCPICC  1227
               V+C ECNENGLIQCPICC
Sbjct  452   MVVRCPECNENGLIQCPICC  471



>dbj|BAK03966.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=420

 Score =   200 bits (509),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 171/437 (39%), Positives = 238/437 (54%), Gaps = 60/437 (14%)
 Frame = +1

Query  40    MGCVSSKLFPKDKDFPFAGDG-------GCATHVVSLTSSTYGVLKLD----KDSHQQQT  186
             MGC+SSKL P     P   +G       G   HVVSLTS+TYGVL L       +  ++ 
Sbjct  1     MGCISSKLLPPG---PGGRNGAERATVRGRVDHVVSLTSTTYGVLDLQIKHGAAAGAKEL  57

Query  187   P-PQCIKECVVEVKKASPAREKPP-------------------EVINAWELMEGLDETEM  306
             P PQ  ++ +    K +PA+  PP                   EVINAWE+M GL++ + 
Sbjct  58    PLPQEQEKPISREWKRAPAKRPPPLVVPGAKKPAPALKPESGMEVINAWEIMAGLEDADS  117

Query  307   PAAKKSPKARSFLDHRRSPLKFLNQ-LASP----GKLRRSGGKENKP-GRAMGRSEFS--  462
             PA K +   R       SP + L   L+SP     K R + GKEN P  R  G S+ S  
Sbjct  118   PAKKPAKPGRW------SPARVLAMALSSPKRSSAKRRNTPGKENSPLQRCSGNSKPSDV  171

Query  463   --PKTVPKAYNLQESPWRVSPRLRSLKKGSPKLSPNELKCDSMRAESMAVCTRRSLNPLF  636
                  + + YN  ++  ++S   +    GS +++      ++    S         +P  
Sbjct  172   ADEDRILRPYNSIDNS-KLSRASKRFSPGSARVARKPTGAETGGMSSSRRSLSPLFDPEL  230

Query  637   NPeigeklsseeeeqikkMISSTPVSRKSRKSQEAADTILEQFNQKCPPAGENSVVIYTT  816
                I  +LS E     + + S  P      K  +    I+ +   KCPP G ++VV+YTT
Sbjct  231   LASIERELSEEGAHIKRVIGSEKP------KQPKVIPAIVAE--GKCPPGGADAVVLYTT  282

Query  817   TLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKEELRGLMGTMVVKVPLVFVKGR  996
             TLRGIR+TFE+CN  R+ +E+H V+  ERDVSM SG++EELR L+G   ++VP VFV+G+
Sbjct  283   TLRGIRRTFEECNAVRAAIEAHDVKVIERDVSMDSGYREELRLLLGGRELRVPAVFVRGK  342

Query  997   MIGGADEVVkleeegklgillsgiPQAGAGCDGCAGVRFVLCLNCNGSCKV-LGEDLKNT  1173
              +GGA EV ++EEEGKL  LL G+P+A   C GCAGVRFV+C +CNGS KV +  + K T
Sbjct  343   HVGGAAEVTRMEEEGKLKALLQGLPRARVWCAGCAGVRFVMCRDCNGSRKVRVDGEPKET  402

Query  1174  VKCGECNENGLIQCPIC  1224
             V+CGECNENGL++CPIC
Sbjct  403   VQCGECNENGLVRCPIC  419



>ref|XP_002446415.1| hypothetical protein SORBIDRAFT_06g015610 [Sorghum bicolor]
 gb|EES10743.1| hypothetical protein SORBIDRAFT_06g015610 [Sorghum bicolor]
Length=451

 Score =   192 bits (488),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 102/166 (61%), Positives = 125/166 (75%), Gaps = 0/166 (0%)
 Frame = +1

Query  727   KSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERD  906
             K  +AA   +     KCPP G  +VV+YTTTLRGIR+TFE+CN  R+ +E+H V+  ERD
Sbjct  285   KHPKAAPPAIVAAEGKCPPGGAEAVVLYTTTLRGIRRTFEECNAVRAAIEAHDVKVIERD  344

Query  907   VSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQAGAG  1086
             VSM SG++EELR L+G   V+VP VFV+GR +GGA EV KLEEEGKL  LL G+P+A   
Sbjct  345   VSMDSGYREELRLLLGGREVRVPAVFVRGRHVGGAAEVAKLEEEGKLKALLEGLPRARVW  404

Query  1087  CDGCAGVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPIC  1224
             C GCAGVRFV+C +CNGS KVL  + K TVKCGECNENGL++CPIC
Sbjct  405   CAGCAGVRFVMCRDCNGSRKVLDAERKETVKCGECNENGLVRCPIC  450



>ref|NP_001136499.1| hypothetical protein [Zea mays]
 gb|ACF82057.1| unknown [Zea mays]
 tpg|DAA37909.1| TPA: hypothetical protein ZEAMMB73_435438 [Zea mays]
Length=447

 Score =   191 bits (485),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 100/151 (66%), Positives = 120/151 (79%), Gaps = 0/151 (0%)
 Frame = +1

Query  772   KCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKEELRGLM  951
             KCPP G ++VV+YTTTLRGIR+TFE+CN  R+ +E H V+  ERDVSM SG++EELR L+
Sbjct  296   KCPPGGADAVVLYTTTLRGIRRTFEECNAVRAAMEVHDVKLIERDVSMDSGYREELRLLL  355

Query  952   GTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQAGAGCDGCAGVRFVLCLNC  1131
             G   V+VP VFV+GR +GGA EV KLEEEGKL  LL G+P+A   C GCAGVRFV+C +C
Sbjct  356   GGREVRVPAVFVRGRHVGGAAEVAKLEEEGKLKPLLEGLPRARVWCAGCAGVRFVMCRDC  415

Query  1132  NGSCKVLGEDLKNTVKCGECNENGLIQCPIC  1224
             NGS KVL  D K TVKCGECNENGL++CPIC
Sbjct  416   NGSRKVLDADRKETVKCGECNENGLVRCPIC  446



>ref|XP_006840647.1| hypothetical protein AMTR_s00084p00178510 [Amborella trichopoda]
 gb|ERN02322.1| hypothetical protein AMTR_s00084p00178510 [Amborella trichopoda]
Length=323

 Score =   186 bits (473),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 154/402 (38%), Positives = 204/402 (51%), Gaps = 85/402 (21%)
 Frame = +1

Query  40    MGCVSSKLFPKDKDFPFAGDGGCATHVVSLTSSTYGVLKLDKDSHQQQTPPQCIKECVVE  219
             MGCVSS+L       P  G      H+VSLTS+TYG++ LD  S +  +P        + 
Sbjct  1     MGCVSSRL-----TGPELGGDDLKGHIVSLTSTTYGLVTLDYPSPKPSSPFTLTFAPSLP  55

Query  220   VKKASPAREKP-PEVINAWELMEGLDETEMPAAKKSPKARSFLDHRRSPLKFLNQLASPG  396
             +  +SP    P  EVIN WE M+GL +T+                R SPL  L+   SP 
Sbjct  56    LMSSSPILNNPESEVINTWEFMDGLSDTD--------------SFRFSPLPALS--PSPF  99

Query  397   KLRRSGG---KENKPGRAMGRSEFSPKTVPKAYNLQESPWRVSPRLRSLKKGSPKLSPNE  567
             K  +SGG   KEN     +  S +                             P   P E
Sbjct  100   KTPKSGGSLGKENACNPFLANSRY-----------------------------PPFQPTE  130

Query  568   LKCDSMRAESMAVCTRRSLNPLFNPeigeklsseeeeqikkMISSTPVSRKSRKSQEAAD  747
             +  DS               PLF+PE+   L  E       MI     +  S+  +E   
Sbjct  131   ILKDSNSG------------PLFDPELLASLERE-------MIKENRENEGSKTKREKGG  171

Query  748   TILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGF  927
                   N+  P   EN+VV+YTTTLRGIRKTFE+CN  R++LE   V+  ERD+SM SGF
Sbjct  172   K-----NKGFP---ENAVVLYTTTLRGIRKTFEECNRVRTVLEGLGVQLVERDISMDSGF  223

Query  928   KEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQAGA--GCDGCA  1101
             ++EL  LMG   + VP VFVKG  IGG+++V+++ EEG+L  L+ G+P+A A   CDGC 
Sbjct  224   RDELATLMGGKPM-VPRVFVKGVDIGGSEDVLRIHEEGQLVKLVEGVPKARATRTCDGCG  282

Query  1102  GVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPICC  1227
             GVRFV C +C GS K++ E+    ++C ECNENGLIQCPICC
Sbjct  283   GVRFVPCFDCCGSRKIV-EERGKVLRCSECNENGLIQCPICC  323



>ref|XP_004975565.1| PREDICTED: uncharacterized protein LOC101764798 [Setaria italica]
Length=447

 Score =   186 bits (473),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 96/153 (63%), Positives = 120/153 (78%), Gaps = 0/153 (0%)
 Frame = +1

Query  766   NQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKEELRG  945
             + KCPP G ++VV+YTTTLRGIR+TFE+CN  R+ +E+H V+  ERDVSM SG++EELR 
Sbjct  294   DGKCPPGGADAVVLYTTTLRGIRRTFEECNAVRAAIEAHDVKVIERDVSMDSGYREELRL  353

Query  946   LMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQAGAGCDGCAGVRFVLCL  1125
             L+G   V+VP VFV+GR +GGA EV KLEE+GKL  LL G+P+A   C GCAGVRFV+C 
Sbjct  354   LLGGREVRVPAVFVRGRHVGGAAEVAKLEEDGKLKALLEGLPRARVWCAGCAGVRFVMCR  413

Query  1126  NCNGSCKVLGEDLKNTVKCGECNENGLIQCPIC  1224
             +CNGS KVL  + K T KC ECNENGL++CPIC
Sbjct  414   DCNGSRKVLDAERKETTKCDECNENGLVRCPIC  446



>ref|XP_006653372.1| PREDICTED: uncharacterized protein At3g28850-like [Oryza brachyantha]
Length=327

 Score =   181 bits (460),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 97/152 (64%), Positives = 121/152 (80%), Gaps = 1/152 (1%)
 Frame = +1

Query  772   KCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKEELRGLM  951
             KCPP G ++VV+YTTTLRGIR+TFE+CN  R+ +E+H V+  ERDVSM SG++EELR L+
Sbjct  175   KCPPGGADAVVLYTTTLRGIRRTFEECNAVRAAIEAHDVKVIERDVSMDSGYREELRLLL  234

Query  952   GTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQAGAGCDGCAGVRFVLCLNC  1131
             G   V+VP VFV+GR +GGA EV KLEEEGKL  LL G+P+A   C GCAGVRFV+C +C
Sbjct  235   GGREVRVPAVFVRGRHVGGAAEVTKLEEEGKLKALLQGLPRARVWCAGCAGVRFVMCRDC  294

Query  1132  NGSCKV-LGEDLKNTVKCGECNENGLIQCPIC  1224
             NGS KV +  + K TV+CGECNENGL++CPIC
Sbjct  295   NGSRKVRVDGERKETVQCGECNENGLVRCPIC  326



>ref|NP_001052743.1| Os04g0412800 [Oryza sativa Japonica Group]
 emb|CAD40594.2| OJ000126_13.3 [Oryza sativa Japonica Group]
 emb|CAD40652.2| OSJNBa0073L04.11 [Oryza sativa Japonica Group]
 dbj|BAF14657.1| Os04g0412800 [Oryza sativa Japonica Group]
 gb|EAY94037.1| hypothetical protein OsI_15816 [Oryza sativa Indica Group]
 gb|EAZ30676.1| hypothetical protein OsJ_14734 [Oryza sativa Japonica Group]
 dbj|BAG87472.1| unnamed protein product [Oryza sativa Japonica Group]
Length=448

 Score =   183 bits (464),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 97/152 (64%), Positives = 121/152 (80%), Gaps = 1/152 (1%)
 Frame = +1

Query  772   KCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKEELRGLM  951
             KCPP G ++VV+YTTTLRGIR+TFE+CN  R+ +E+H V+  ERDVSM SG++EELR L+
Sbjct  296   KCPPGGADAVVLYTTTLRGIRRTFEECNAVRAAIEAHDVKLIERDVSMDSGYREELRLLL  355

Query  952   GTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQAGAGCDGCAGVRFVLCLNC  1131
             G   V+VP VFV+GR +GGA EV KLEEEGKL  LL G+P+A   C GCAGVRFV+C +C
Sbjct  356   GGREVRVPAVFVRGRHVGGAAEVTKLEEEGKLKALLQGLPRARVWCAGCAGVRFVMCRDC  415

Query  1132  NGSCKV-LGEDLKNTVKCGECNENGLIQCPIC  1224
             NGS KV +  + K TV+CGECNENGL++CPIC
Sbjct  416   NGSRKVRVDGERKETVQCGECNENGLVRCPIC  447



>emb|CAH67358.1| OSIGBa0134P10.4 [Oryza sativa Indica Group]
Length=448

 Score =   183 bits (464),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 97/152 (64%), Positives = 121/152 (80%), Gaps = 1/152 (1%)
 Frame = +1

Query  772   KCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKEELRGLM  951
             KCPP G ++VV+YTTTLRGIR+TFE+CN  R+ +E+H V+  ERDVSM SG++EELR L+
Sbjct  296   KCPPGGADAVVLYTTTLRGIRRTFEECNAVRAAIEAHDVKLIERDVSMDSGYREELRLLL  355

Query  952   GTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQAGAGCDGCAGVRFVLCLNC  1131
             G   V+VP VFV+GR +GGA EV KLEEEGKL  LL G+P+A   C GCAGVRFV+C +C
Sbjct  356   GGREVRVPAVFVRGRHVGGAAEVTKLEEEGKLKALLQGLPRARVWCAGCAGVRFVMCRDC  415

Query  1132  NGSCKV-LGEDLKNTVKCGECNENGLIQCPIC  1224
             NGS KV +  + K TV+CGECNENGL++CPIC
Sbjct  416   NGSRKVRVDGERKETVQCGECNENGLVRCPIC  447



>ref|XP_011076870.1| PREDICTED: uncharacterized protein At3g28850-like [Sesamum indicum]
Length=368

 Score =   179 bits (455),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 95/172 (55%), Positives = 126/172 (73%), Gaps = 4/172 (2%)
 Frame = +1

Query  718   KSRKSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTF  897
             K+RK ++  D +LE F +KCPP G +SVV+YTT LRGIRKTFEDC   RS+LE+  +  F
Sbjct  199   KARKIEQVTDPLLE-FEEKCPPGGSDSVVLYTTGLRGIRKTFEDCQKIRSLLENLRILFF  257

Query  898   ERDVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiP--  1071
             ERD+SMHSGFKEE+ G++G  +V  P +F+KGR IGGA+EV+ L E+GKL  L+ GIP  
Sbjct  258   ERDISMHSGFKEEMWGVLGGKIVP-PRLFIKGRYIGGAEEVLGLHEQGKLRPLIEGIPLD  316

Query  1072  QAGAGCDGCAGVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPICC  1227
             +    C+GCAG RF++C NCNGS K++ E    ++ C ECNENG++ CP CC
Sbjct  317   RNEGPCEGCAGFRFIVCFNCNGSRKIVPEGDGESMNCSECNENGVVICPFCC  368



>gb|ABK24666.1| unknown [Picea sitchensis]
Length=497

 Score =   182 bits (461),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 100/160 (63%), Positives = 122/160 (76%), Gaps = 4/160 (3%)
 Frame = +1

Query  754   LEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKE  933
             LE + +KCPP G+N+VV+YTTTLRGIRKTFEDCN+ R +LES+ +   ERDVSMH  F+ 
Sbjct  340   LENYEEKCPPGGQNAVVLYTTTLRGIRKTFEDCNSVRCVLESYGICISERDVSMHMPFRN  399

Query  934   ELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQAGAG--CDGCAGV  1107
             EL  LMG  +V VP +F+KGR IGGA+EV++L EE K G LL GIP    G  CDGC GV
Sbjct  400   ELEQLMG-RIVPVPRLFIKGRYIGGAEEVLRLHEEDKFGGLLEGIPADTLGKVCDGCGGV  458

Query  1108  RFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPICC  1227
             RFV CL C+GSCK++ ED  + V+C +CNENGLIQCPICC
Sbjct  459   RFVPCLECSGSCKLVDED-NSVVRCPDCNENGLIQCPICC  497



>ref|XP_010247808.1| PREDICTED: uncharacterized protein LOC104590759 [Nelumbo nucifera]
Length=397

 Score =   178 bits (451),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 97/165 (59%), Positives = 121/165 (73%), Gaps = 8/165 (5%)
 Frame = +1

Query  754   LEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKE  933
             L +F ++CPP G +SV++YTT+LRGIRKTFEDC + R +L S  +  +ERDVSMH GF+E
Sbjct  234   LSEFQERCPPGGRDSVILYTTSLRGIRKTFEDCRSIRFLLGSFRILFYERDVSMHMGFRE  293

Query  934   ELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiP--QAGAGCDGCAGV  1107
             EL  +MG  VV  P +F++GR IGGADEVV L E+GKL  LL G+P  ++GA CDGCAG+
Sbjct  294   ELWRIMGGRVVP-PRLFIRGRYIGGADEVVSLHEQGKLLPLLQGVPADRSGAPCDGCAGI  352

Query  1108  RFVLCLNCNGSCKVLGEDLKNTV-----KCGECNENGLIQCPICC  1227
             RFVLC NCNGSCKV     + T      +C ECNENGLI CP+CC
Sbjct  353   RFVLCFNCNGSCKVNDTPDERTDDGWPNRCPECNENGLIICPMCC  397



>ref|XP_010090481.1| Uncharacterized protein L484_012588 [Morus notabilis]
 gb|EXB39580.1| Uncharacterized protein L484_012588 [Morus notabilis]
Length=389

 Score =   175 bits (444),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 96/176 (55%), Positives = 123/176 (70%), Gaps = 4/176 (2%)
 Frame = +1

Query  706   PVSRKSRKSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHH  885
             P S+  R   E  +  L QF++KCPP G +SV++YTTTLRGIRKTFE CN+ R +LES  
Sbjct  216   PPSKAPRVEIEQEEDPLLQFDEKCPPGGADSVILYTTTLRGIRKTFEGCNSVRFLLESFR  275

Query  886   VRTFERDVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsg  1065
             V  FERDVSMHS F+EELR ++    V  P +F++GR IGGA+EV+ L E+G+L  L   
Sbjct  276   VAYFERDVSMHSEFREELRTILDGKAVP-PKLFIRGRYIGGAEEVLGLHEQGRLRPLFKT  334

Query  1066  iP--QAGAGCDGCAGVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPICC  1227
             +P  ++   C+GCAG+RFVLC NCNGS KV+ E+ +    C  CNENGLI CPICC
Sbjct  335   VPIDRSNGPCEGCAGMRFVLCFNCNGSHKVVAENGQCN-NCSICNENGLIICPICC  389



>emb|CDO99947.1| unnamed protein product [Coffea canephora]
Length=376

 Score =   173 bits (439),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 95/174 (55%), Positives = 126/174 (72%), Gaps = 6/174 (3%)
 Frame = +1

Query  718   KSRKSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTF  897
             K+RK +E AD +L  F +KCPP G +SV++YTT LRGIRKTFEDC++ R +LE+  +  F
Sbjct  205   KARKIEETADPLL-NFEEKCPPGGSDSVILYTTGLRGIRKTFEDCHSIRFLLENFRILFF  263

Query  898   ERDVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiP--  1071
             ERD+SMHS F+EEL  + G  VV  P +F+KGR +GGA+EV+ L E+G+L  LL GIP  
Sbjct  264   ERDISMHSEFREELWQIFGGKVVP-PRLFIKGRYVGGAEEVLGLHEQGRLRPLLGGIPID  322

Query  1072  QAGAGCDGCAGVRFVLCLNCNGSCKVLGEDLKN--TVKCGECNENGLIQCPICC  1227
              +   C+GCAGVRF++C NCNGS K+  ED     +V C +CNENGL+ CP+CC
Sbjct  323   SSNGHCEGCAGVRFIMCFNCNGSRKIKLEDGGGGESVNCPQCNENGLLICPMCC  376



>gb|KDP27126.1| hypothetical protein JCGZ_22035 [Jatropha curcas]
Length=364

 Score =   173 bits (438),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 94/169 (56%), Positives = 121/169 (72%), Gaps = 3/169 (2%)
 Frame = +1

Query  727   KSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERD  906
             K++   +  L  F +KCPP G +SV++YTTTL+GIRKTFEDCN+ R +LES  V  +ERD
Sbjct  197   KARRIEENPLSGFEEKCPPGGNDSVILYTTTLKGIRKTFEDCNSVRFLLESFRVIFYERD  256

Query  907   VSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiP--QAG  1080
             VSMH  FKEEL  +M    +  P +F+KGR IGGA+EV+ L E+GKL +L  G+P  Q+ 
Sbjct  257   VSMHMEFKEELWNVMEGKAMP-PRLFIKGRYIGGAEEVIGLHEQGKLKLLFEGVPIDQSV  315

Query  1081  AGCDGCAGVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPICC  1227
               C+GCAG RFVLC NCNGS +V+ ED   + KC +CNENGLI CP+CC
Sbjct  316   GPCEGCAGFRFVLCFNCNGSHRVIEEDDGLSRKCQDCNENGLIICPLCC  364



>ref|XP_009761751.1| PREDICTED: uncharacterized protein At5g39865-like [Nicotiana 
sylvestris]
Length=378

 Score =   173 bits (438),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 97/172 (56%), Positives = 124/172 (72%), Gaps = 4/172 (2%)
 Frame = +1

Query  718   KSRKSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTF  897
             K+RK +E  D +LE F +KCPP G +SV++YTT LRGIRKTFE+C++ R +LE+  V  F
Sbjct  209   KTRKIEETIDPLLE-FEEKCPPGGCDSVILYTTGLRGIRKTFEECHSIRFLLENFRVIFF  267

Query  898   ERDVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiP--  1071
             ERD+SMHS FKEEL  ++   VV  P +F+KGR IGGA+EV+ L E+GKL  LL GIP  
Sbjct  268   ERDISMHSEFKEELWRILDGKVVP-PRLFIKGRYIGGAEEVLTLHEQGKLRPLLEGIPIE  326

Query  1072  QAGAGCDGCAGVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPICC  1227
             Q    C+GC G+RF++C  CNGS K++ ED    +KC ECNENGLI CP CC
Sbjct  327   QFQCPCEGCVGMRFIVCFKCNGSQKIVVEDGVEAMKCPECNENGLIVCPYCC  378



>ref|XP_009593837.1| PREDICTED: uncharacterized protein At3g28850-like [Nicotiana 
tomentosiformis]
Length=380

 Score =   172 bits (436),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 96/172 (56%), Positives = 123/172 (72%), Gaps = 4/172 (2%)
 Frame = +1

Query  718   KSRKSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTF  897
             K+RK +E  D +LE F +KCPP G +SV++YTT LRGIRKTFE+C++ R +LE+  V  F
Sbjct  211   KTRKIEEIIDPLLE-FEEKCPPGGCDSVILYTTGLRGIRKTFEECHSIRFLLENFRVIFF  269

Query  898   ERDVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiP--  1071
             ERD+SMHS FKEEL  ++   VV  P +F+KGR IGGA+EV+ L E+GK   LL GIP  
Sbjct  270   ERDISMHSEFKEELWRILDGKVVP-PRLFIKGRYIGGAEEVLTLHEQGKFRPLLEGIPID  328

Query  1072  QAGAGCDGCAGVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPICC  1227
             Q    C+GC G+RF++C  CNGS K++ ED    +KC ECNENGLI CP CC
Sbjct  329   QFQCPCEGCVGMRFIVCFKCNGSQKIVVEDGVEAMKCPECNENGLIVCPYCC  380



>ref|XP_001784015.1| predicted protein [Physcomitrella patens]
 gb|EDQ51183.1| predicted protein [Physcomitrella patens]
Length=188

 Score =   166 bits (421),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 89/157 (57%), Positives = 116/157 (74%), Gaps = 4/157 (3%)
 Frame = +1

Query  760   QFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKEEL  939
             Q+ +KCPPAG++ +V+YTTTLRGIRKTFEDCN AR ILES +V   ERDVS+H+ F++EL
Sbjct  33    QYARKCPPAGKDRIVLYTTTLRGIRKTFEDCNNARFILESFNVEIDERDVSIHAEFRQEL  92

Query  940   RGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiP--QAGAGCDGCAGVRF  1113
             + L G + V VP  F+KGR IGG D +++L E+G L   + G+P  ++   CDGC G+RF
Sbjct  93    KKLAGKL-VSVPQTFIKGRYIGGVDTLIRLHEDGTLASFVDGMPSQKSREECDGCGGIRF  151

Query  1114  VLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPIC  1224
             V C NC+GS KV+ E     V+C ECNENGLI+CPIC
Sbjct  152   VPCSNCSGSTKVVNE-ANEVVRCSECNENGLIRCPIC  187



>ref|XP_006365670.1| PREDICTED: uncharacterized protein LOC102605059 [Solanum tuberosum]
Length=367

 Score =   170 bits (431),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 98/175 (56%), Positives = 123/175 (70%), Gaps = 7/175 (4%)
 Frame = +1

Query  718   KSRKSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTF  897
             K+RK +E  D +LE F +KCPP G +SV++YTT LRGIRKTFEDC + R +LE+  V  F
Sbjct  195   KARKLEEIIDPLLE-FEEKCPPGGCDSVILYTTGLRGIRKTFEDCYSIRFLLENFRVVFF  253

Query  898   ERDVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiP--  1071
             ERD+SMHS FKEEL  ++   VV  P +FVKGR IGGADEV+ L E+GK   LL GIP  
Sbjct  254   ERDISMHSEFKEELWRILDGKVVP-PRLFVKGRYIGGADEVLTLHEQGKFRPLLEGIPID  312

Query  1072  QAGAGCDGCAGVRFVLCLNCNGSCKVL---GEDLKNTVKCGECNENGLIQCPICC  1227
                  C+GCAG+RF++C  CNGS K++    +D   ++KC ECNENGLI CP CC
Sbjct  313   NFQCPCEGCAGMRFIMCFKCNGSRKIVLDNDDDEVESMKCPECNENGLIVCPYCC  367



>ref|XP_002993417.1| hypothetical protein SELMODRAFT_137093 [Selaginella moellendorffii]
 gb|EFJ05510.1| hypothetical protein SELMODRAFT_137093 [Selaginella moellendorffii]
Length=163

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 113/160 (71%), Gaps = 4/160 (3%)
 Frame = +1

Query  751   ILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFK  930
             +L+   ++CPP GEN  V+Y+T+LRGIRKTFEDCNT R+IL S +V   ERDVSM S F+
Sbjct  5     LLQHCPKRCPPDGENKAVLYSTSLRGIRKTFEDCNTVRNILHSTNVEVDERDVSMDSQFR  64

Query  931   EELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQAGAG--CDGCAG  1104
             +EL+ LM    V VP +F+KGR IGGA+EVV   E G L  +L G+P       CDGC G
Sbjct  65    QELKDLM-DKPVPVPRLFIKGRYIGGAEEVVAAHESGALARMLHGLPHGNLSKDCDGCGG  123

Query  1105  VRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPIC  1224
             VRF+ C +C+GSCK +G D    VKC ECNENGL++CPIC
Sbjct  124   VRFIPCTDCSGSCKSVGAD-GGVVKCPECNENGLVRCPIC  162



>ref|XP_007039368.1| Glutaredoxin family protein, putative [Theobroma cacao]
 gb|EOY23869.1| Glutaredoxin family protein, putative [Theobroma cacao]
Length=357

 Score =   170 bits (430),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 104/197 (53%), Positives = 126/197 (64%), Gaps = 20/197 (10%)
 Frame = +1

Query  694   ISSTPVSRKS--RKSQEAADTIL-----EQFNQKCPPAGENSVVIYTTTLRGIRKTFEDC  852
             IS  P+SR S   K     D +L     ++F Q CPP GEN VVIYTTTLRGIRKTFEDC
Sbjct  160   ISKPPLSRSSLLEKFYSGNDAVLKPSALDKFEQICPPNGENRVVIYTTTLRGIRKTFEDC  219

Query  853   NTARSILESHHVRTFERDVSMHSGFKEELRGLM------GTMVVKVPLVFVKGRMIGGAD  1014
             N  RS +ES+ +   ERD+SM  GFKEELR LM       T     P VF+KGR IGGA+
Sbjct  220   NAIRSAIESYGIVVCERDISMDRGFKEELRELMKGKERESTNQTTPPRVFIKGRYIGGAE  279

Query  1015  EVVkleeegklgillsgiPQAGAG--CDGCAGVRFVLCLNCNGSCK---VLGEDLKNT--  1173
             EV+++ +EG    LL G+P+  AG  CDGC  V+F+ C  CNGSCK   V+ E+   T  
Sbjct  280   EVMRIVDEGWFEDLLKGLPKKRAGEVCDGCGDVKFLPCFRCNGSCKVAVVVKEEGSRTVV  339

Query  1174  VKCGECNENGLIQCPIC  1224
             V+C ECNENGL+ CPIC
Sbjct  340   VRCTECNENGLVHCPIC  356


 Score = 58.9 bits (141),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 48/93 (52%), Gaps = 8/93 (9%)
 Frame = +1

Query  40   MGCVSSKLFPKDKDFPFAGDGGCATHVVSLTSSTYGVLKLDKDSHQQQTPPQCIKE----  207
            MGCVSS L  ++ +F   G      H+VSLTS+TYG+L LD       TPP         
Sbjct  1    MGCVSSNLLNQEDEFTQLGSSALGHHIVSLTSTTYGLLTLDPPPQSTTTPPTPPPPFTLG  60

Query  208  CVVEVKKASPAREKP----PEVINAWELMEGLD  294
                  K+  +  +P    PEVIN+WELM GLD
Sbjct  61   STFNESKSLWSEPRPVPIRPEVINSWELMSGLD  93



>ref|XP_006388532.1| hypothetical protein POPTR_0162s00230g [Populus trichocarpa]
 gb|ERP47446.1| hypothetical protein POPTR_0162s00230g [Populus trichocarpa]
Length=364

 Score =   170 bits (430),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 95/175 (54%), Positives = 122/175 (70%), Gaps = 6/175 (3%)
 Frame = +1

Query  712   SRKSRKSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVR  891
             +R+     +  D IL  F +KCPP G +SV++YTTTLRGIRKTFEDCN+ R +LES  V 
Sbjct  193   ARRIEDDDDTGDPIL-GFPEKCPPGGSDSVILYTTTLRGIRKTFEDCNSIRFLLESIQVL  251

Query  892   TFERDVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiP  1071
              FERDVSMH  FKEEL  ++    V  P +F+KGR IGG++EV+ L E+G   +L  GIP
Sbjct  252   FFERDVSMHMEFKEELWRILDGK-VNPPRLFIKGRYIGGSEEVLGLHEQGWFRVLFEGIP  310

Query  1072  Q---AGAGCDGCAGVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPICC  1227
                  G+ C+GCAGVRFVLC NC+GS KV+ E+  + + C +CNENGLI CP+CC
Sbjct  311   IDRFIGSPCEGCAGVRFVLCFNCSGSHKVVAENGLSNI-CQDCNENGLITCPLCC  364



>ref|XP_002982129.1| hypothetical protein SELMODRAFT_116000 [Selaginella moellendorffii]
 gb|EFJ16797.1| hypothetical protein SELMODRAFT_116000 [Selaginella moellendorffii]
Length=163

 Score =   164 bits (414),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 113/160 (71%), Gaps = 4/160 (3%)
 Frame = +1

Query  751   ILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFK  930
             +L+   ++CPP GEN  V+Y+T+LRGIRKTFEDCNT R+IL S +V   ERDVSM S F+
Sbjct  5     LLQHCPKRCPPDGENKAVLYSTSLRGIRKTFEDCNTVRNILHSTNVELDERDVSMDSQFR  64

Query  931   EELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQAGAG--CDGCAG  1104
             +EL+ LM    V VP +F+KGR IGGA+EVV   E G L  +L G+P       CDGC G
Sbjct  65    QELKDLM-DKPVPVPRLFIKGRYIGGAEEVVAAHESGALARMLHGLPHGNLSKDCDGCGG  123

Query  1105  VRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPIC  1224
             VRF+ C +C+GSCK +G D    VKC ECNENGL++CPIC
Sbjct  124   VRFIPCTDCSGSCKSVGAD-GGVVKCPECNENGLVRCPIC  162



>ref|XP_011033122.1| PREDICTED: uncharacterized protein LOC105131711 [Populus euphratica]
Length=390

 Score =   170 bits (430),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 95/175 (54%), Positives = 122/175 (70%), Gaps = 6/175 (3%)
 Frame = +1

Query  712   SRKSRKSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVR  891
             +R+     +  D IL  F +KCPP G +SV++YTTTLRGIRKTFEDCN+ R +LES  V 
Sbjct  219   ARRIEDDDDTGDPIL-GFPEKCPPGGSDSVILYTTTLRGIRKTFEDCNSIRFLLESFQVL  277

Query  892   TFERDVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiP  1071
              FERDVSMH  FKEEL  ++    V  P +F+KGR IGG++EV+ L E+G   +L  GIP
Sbjct  278   FFERDVSMHMEFKEELWRILDGK-VNPPRLFIKGRYIGGSEEVLGLHEQGWFRVLFEGIP  336

Query  1072  Q---AGAGCDGCAGVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPICC  1227
                  G+ C+GCAGVRFVLC NC+GS KV+ E+  + + C +CNENGLI CP+CC
Sbjct  337   IDRFIGSPCEGCAGVRFVLCFNCSGSHKVVAENGLSNI-CQDCNENGLITCPLCC  390



>ref|XP_008804469.1| PREDICTED: uncharacterized protein At3g28850-like [Phoenix dactylifera]
Length=434

 Score =   171 bits (433),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 150/424 (35%), Positives = 200/424 (47%), Gaps = 86/424 (20%)
 Frame = +1

Query  115   HVVSLTSSTYGVLKLDK----------DSHQQQTP--------------PQCIKECVVEV  222
             HVV+L SST G LKLD+          D    ++               P+   E +   
Sbjct  44    HVVTLASSTLGSLKLDRGPRPDDLAGSDEEMMKSSNDCGRDRLADELGKPKAWSEMIEHR  103

Query  223   KKASPAREKP--PEVINAWELMEGLDETEMPAAKKSPKARSFLDHR-RSPL---------  366
                +P +  P  PE INAWELMEGL++T  P    S   RSF  H  R  L         
Sbjct  104   IPKTPTKTPPNEPETINAWELMEGLEDTS-PLRPTSAADRSFSFHTTRDALPAPESLPSS  162

Query  367   KFLNQLASPGKLRRSGGKENKPGRAMGRSEFSPKTVPKAYNLQESPWRVSPRLRSLKKGS  546
             K  N   SP    + G  +  PG ++  S+F P+ +    N+ E     SP   +L++  
Sbjct  163   KLANGCLSP----KPGWMQLGPGDSI-ISDFDPEILATFRNVLEE---FSPPHPALER--  212

Query  547   PKLSPNELKCDSMRAESMAVCTRRSLNPLFNPeigeklsseeeeqikkMISSTPVSRKSR  726
               L P E   D   +  M         P F              +I          R S 
Sbjct  213   -HLEPPEKVTDCRHSGDM---------PKFQ--------GIVRARINAFQERIDARRASF  254

Query  727   KSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERD  906
              S  A  T L+    KCPP G+  VV Y T+LRGIRKT+EDC + R IL+ + VR  ERD
Sbjct  255   NSNAAKVTPLD----KCPPGGQGKVVFYFTSLRGIRKTYEDCWSVRVILQGYGVRIDERD  310

Query  907   VSMHSGFKEELRGLMGTMV--VKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQAG  1080
             VSMH GFKEEL+ ++G      ++P +F  G+ +GGADEV ++ E G+LG  + G   A 
Sbjct  311   VSMHGGFKEELKEILGAEYGSGRLPRIFADGKYLGGADEVRQMHEAGELGTAVEGCEMAA  370

Query  1081  AG--------CDGCAGVRFVLCLNCNGSCKV-LGEDLKNTV------KCGECNENGLIQC  1215
              G        C+GC GVRFV C  C+GSCKV + ED K         +C +CNENGL++C
Sbjct  371   VGKGGGVVEACEGCGGVRFVPCETCSGSCKVYVVEDGKEEEEEAGFRRCPDCNENGLVRC  430

Query  1216  PICC  1227
             P+CC
Sbjct  431   PLCC  434



>emb|CBI39127.3| unnamed protein product [Vitis vinifera]
Length=183

 Score =   164 bits (414),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 97/180 (54%), Positives = 125/180 (69%), Gaps = 10/180 (6%)
 Frame = +1

Query  712   SRKSRKSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVR  891
             + K++   E   ++L+ F +KCPP G +SV+ YTT+LRGIRKTFEDC+  R +LES  V 
Sbjct  6     THKAKVEIEEHPSLLD-FEEKCPPGGRDSVIFYTTSLRGIRKTFEDCSAIRFLLESFRVL  64

Query  892   TFERDVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiP  1071
               ERDVSMH  F+EEL  +MG  VV  P +F+KGR IGGADEVV L E+GKL  LL GIP
Sbjct  65    FQERDVSMHMEFREELWRMMGGRVVP-PRLFIKGRHIGGADEVVGLHEQGKLKKLLEGIP  123

Query  1072  QA---GAGCDGCAGVRFVLCLNCNGSCKVLGEDLKNT-----VKCGECNENGLIQCPICC  1227
              +    + C GC G++F+LC NCNGSCKV+ +   +      ++C ECNENGLI+CPICC
Sbjct  124   LSPTNNSPCKGCGGMKFLLCFNCNGSCKVIADGDGDGDDLLHIRCPECNENGLIKCPICC  183



>ref|XP_010653249.1| PREDICTED: uncharacterized protein At5g39865 [Vitis vinifera]
Length=290

 Score =   167 bits (423),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 117/166 (70%), Gaps = 9/166 (5%)
 Frame = +1

Query  754   LEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKE  933
             L  F +KCPP G +SV+ YTT+LRGIRKTFEDC+  R +LES  V   ERDVSMH  F+E
Sbjct  126   LLDFEEKCPPGGRDSVIFYTTSLRGIRKTFEDCSAIRFLLESFRVLFQERDVSMHMEFRE  185

Query  934   ELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQA---GAGCDGCAG  1104
             EL  +MG  VV  P +F+KGR IGGADEVV L E+GKL  LL GIP +    + C GC G
Sbjct  186   ELWRMMGGRVVP-PRLFIKGRHIGGADEVVGLHEQGKLKKLLEGIPLSPTNNSPCKGCGG  244

Query  1105  VRFVLCLNCNGSCKVLGEDLKNT-----VKCGECNENGLIQCPICC  1227
             ++F+LC NCNGSCKV+ +   +      ++C ECNENGLI+CPICC
Sbjct  245   MKFLLCFNCNGSCKVIADGDGDGDDLLHIRCPECNENGLIKCPICC  290



>ref|XP_002311930.2| glutaredoxin family protein [Populus trichocarpa]
 gb|EEE89297.2| glutaredoxin family protein [Populus trichocarpa]
Length=402

 Score =   168 bits (426),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 121/175 (69%), Gaps = 6/175 (3%)
 Frame = +1

Query  712   SRKSRKSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVR  891
             +R+     +  D IL  F +KCPP G +SV++YTTTLRGIRKTFEDCN+ R +LES  V 
Sbjct  231   ARRIEDDDDTGDPIL-GFPEKCPPGGSDSVILYTTTLRGIRKTFEDCNSIRFLLESFQVL  289

Query  892   TFERDVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiP  1071
              FERDVSMH  FKEEL  ++    V  P +F+KGR IGG++EV+ L E+G   +L  GIP
Sbjct  290   FFERDVSMHMEFKEELWRILDGK-VNPPRLFIKGRYIGGSEEVLGLHEQGWFRVLFEGIP  348

Query  1072  Q---AGAGCDGCAGVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPICC  1227
                  G+ C+GCAGVRFVLC NC+G  KV+ E+  + + C +CNENGLI CP+CC
Sbjct  349   IDRFIGSPCEGCAGVRFVLCFNCSGCHKVVAENGLSNI-CQDCNENGLITCPLCC  402



>gb|EYU19855.1| hypothetical protein MIMGU_mgv1a009488mg [Erythranthe guttata]
Length=340

 Score =   166 bits (421),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 91/172 (53%), Positives = 120/172 (70%), Gaps = 3/172 (2%)
 Frame = +1

Query  718   KSRKSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTF  897
             KSRK  +     + +F ++CPP G  S+V+YTT +RGIRKTFEDC   RS+L++  V  F
Sbjct  170   KSRKIDQIMKNPITEFEERCPPGGGESIVLYTTGIRGIRKTFEDCTKIRSLLQNLKVSFF  229

Query  898   ERDVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiP--  1071
             ERDVSMHS FKEE+  ++G   V  P +F+KGR IGGA+EV+ L E+GKL  L+ GIP  
Sbjct  230   ERDVSMHSEFKEEMWRILGGKFVP-PRLFIKGRYIGGAEEVLGLHEQGKLKPLIEGIPID  288

Query  1072  QAGAGCDGCAGVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPICC  1227
             +    C+GCAG RFV+C +C+GS K+L E+   +V C ECNENG+I CP CC
Sbjct  289   RNEGPCEGCAGFRFVVCFDCSGSQKILPENGGESVDCSECNENGVIVCPFCC  340



>ref|XP_010263058.1| PREDICTED: uncharacterized protein LOC104601435 [Nelumbo nucifera]
Length=402

 Score =   168 bits (425),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 91/163 (56%), Positives = 116/163 (71%), Gaps = 3/163 (2%)
 Frame = +1

Query  745   DTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSG  924
             D  L +F +KCPP G +SV++YTT LRGIRKTFEDC++ R +L S  +  +ERDVSMH  
Sbjct  241   DNPLLEFEEKCPPGGSDSVILYTTNLRGIRKTFEDCSSIRFLLGSFRILFYERDVSMHLE  300

Query  925   FKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiP--QAGAGCDGC  1098
             F+EEL  ++G  VV  P +F+KGR IGGADEVV L E+GKL  LL G+P   +   C+GC
Sbjct  301   FREELWRILGGRVVP-PRLFIKGRYIGGADEVVSLHEQGKLRQLLQGVPMDHSDGPCEGC  359

Query  1099  AGVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPICC  1227
             +G+RFVLC NC GSC+V      +  +C ECNENGLI CP+CC
Sbjct  360   SGIRFVLCFNCCGSCRVSPGTDGSPTRCPECNENGLIICPLCC  402



>ref|XP_006430041.1| hypothetical protein CICLE_v10012922mg [Citrus clementina]
 gb|ESR43281.1| hypothetical protein CICLE_v10012922mg [Citrus clementina]
Length=174

 Score =   161 bits (408),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 122/174 (70%), Gaps = 10/174 (6%)
 Frame = +1

Query  724   RKSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFER  903
             + SQE+    L+ + +KCPP GE+SV+ YTT+LRGIRKTFEDC T R +L+S  V  +ER
Sbjct  3     KDSQESP--FLKGYEEKCPPGGEDSVIFYTTSLRGIRKTFEDCRTIRFLLQSFKVTFYER  60

Query  904   DVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQ--A  1077
             DVS+H  F++EL  L+   V+  P +F+KGR IGGADEVV L E+GKL  LL GIP+  +
Sbjct  61    DVSLHMEFRDELWSLLSGRVIP-PRLFIKGRYIGGADEVVGLHEQGKLKKLLEGIPRNLS  119

Query  1078  GAGCDGCAGVRFVLCLNCNGSCKVLGEDLKNT-----VKCGECNENGLIQCPIC  1224
                C+GC  +RFVLC NC+GSCKV  +   +      ++C ECNENGL+QCPIC
Sbjct  120   DCSCNGCGNIRFVLCSNCSGSCKVFRDGDDDDDDELHIRCPECNENGLVQCPIC  173



>ref|XP_010100213.1| Uncharacterized protein L484_015360 [Morus notabilis]
 gb|EXB81884.1| Uncharacterized protein L484_015360 [Morus notabilis]
Length=300

 Score =   164 bits (416),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 90/172 (52%), Positives = 118/172 (69%), Gaps = 6/172 (3%)
 Frame = +1

Query  727   KSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERD  906
             K + +    L++F + CPP GEN VV+YTTTLRG+R+TFE CN  R+ +E   V   ERD
Sbjct  128   KPKASVGNPLDRFERICPPGGENRVVVYTTTLRGVRRTFEACNAVRAAIEGFGVAICERD  187

Query  907   VSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiP--QAG  1080
             VSM  GF+EELR L+    V  P VFVKGR +GGA+EV++  EEG LG +L  +P  ++G
Sbjct  188   VSMDRGFREELRELLKETAVVPPRVFVKGRYVGGAEEVLRFAEEGLLGEILEDLPKRKSG  247

Query  1081  AGCDGCAGVRFVLCLNCNGSCKVL--GEDLKNTV--KCGECNENGLIQCPIC  1224
             + CDGC  VRF+ C  CNGSCKV+   ED + +V  +C +CNENGL+ CPIC
Sbjct  248   SVCDGCGDVRFLPCFQCNGSCKVIVRAEDAETSVVSRCPDCNENGLVLCPIC  299


 Score = 67.0 bits (162),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 42/98 (43%), Positives = 50/98 (51%), Gaps = 13/98 (13%)
 Frame = +1

Query  40   MGCVSSKLFPKDKDFPFAGDGGCATHVVSLTSSTYGVLKLDKDSHQQQTPPQCIKECVVE  219
            MGCVSS L   D +F   G    + H+VSLTSSTYG+L LD     + +P        V 
Sbjct  1    MGCVSSNLLGHDDEFTQLGSSALSHHIVSLTSSTYGLLTLDPPPSNRPSPTTPPLRFTVG  60

Query  220  VKKASPARE---------KP----PEVINAWELMEGLD  294
                SP+ E         KP    PEVIN+WELM GLD
Sbjct  61   PTAPSPSLEPKSTPAPTPKPVRSGPEVINSWELMAGLD  98



>ref|XP_004249936.1| PREDICTED: uncharacterized protein LOC101258323 [Solanum lycopersicum]
Length=361

 Score =   166 bits (420),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 97/176 (55%), Positives = 124/176 (70%), Gaps = 8/176 (5%)
 Frame = +1

Query  718   KSRKSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTF  897
             K+RK +E  + +LE F +KCPP G +SV++YTT LRGIRKTFEDC++ R +LE+  V  F
Sbjct  188   KARKLEEIVNPLLE-FEEKCPPGGCDSVILYTTGLRGIRKTFEDCHSIRFLLENFRVVFF  246

Query  898   ERDVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiP--  1071
             ERD+SMHS FKEEL  ++   VV  P +FVKGR IGGADEV+ L E+GK   LL GIP  
Sbjct  247   ERDISMHSEFKEELWRILDGKVVP-PRLFVKGRYIGGADEVLTLHEQGKFRPLLEGIPID  305

Query  1072  QAGAGCDGCAGVRFVLCLNCNGSCKVL----GEDLKNTVKCGECNENGLIQCPICC  1227
                  C+GCAG+RF++C  CNGS K++     E+   ++KC ECNENGLI CP CC
Sbjct  306   NFQCPCEGCAGMRFIMCFKCNGSRKIVLDDDDEEEVESMKCPECNENGLIVCPYCC  361



>gb|KGN46056.1| hypothetical protein Csa_6G046340 [Cucumis sativus]
Length=337

 Score =   164 bits (416),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 113/158 (72%), Gaps = 3/158 (2%)
 Frame = +1

Query  763   FNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKEELR  942
             F +KCPP G +SV++Y+TTLRGIRKTFEDCN+ R +LE+  V+  ERDVSMH+ FKEEL 
Sbjct  180   FEEKCPPGGSDSVILYSTTLRGIRKTFEDCNSIRFLLETFKVKFHERDVSMHTEFKEELW  239

Query  943   GLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiP---QAGAGCDGCAGVRF  1113
              ++ T     P +F++G+ IGGA+EV+ L E+GKL  L  GIP    +G  C+GC GVRF
Sbjct  240   RVLETNRALPPKLFIRGKYIGGAEEVLGLHEQGKLRALFEGIPIDQFSGIPCEGCGGVRF  299

Query  1114  VLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPICC  1227
             VLC  CNGS KV+ ++     KC ECNENGLI CP CC
Sbjct  300   VLCYKCNGSRKVVDDESDEQRKCSECNENGLIICPYCC  337



>ref|XP_002316474.2| hypothetical protein POPTR_0010s24990g [Populus trichocarpa]
 gb|EEF02645.2| hypothetical protein POPTR_0010s24990g [Populus trichocarpa]
Length=379

 Score =   166 bits (419),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 100/177 (56%), Positives = 125/177 (71%), Gaps = 12/177 (7%)
 Frame = +1

Query  718   KSRKSQEAADT--ILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVR  891
             K+R+ +E  D   IL  F + CPP G +SV++YTT+LRGIRKTFEDCN+ R +LES  V 
Sbjct  208   KARRIEEGDDIDPIL-GFQEMCPPGGSDSVILYTTSLRGIRKTFEDCNSIRFLLESFRVL  266

Query  892   TFERDVSMHSGFKEEL-RGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgi  1068
              FERDVSMH  FKEEL R L G   V  P +F+KGR IGGA+EV+ L E+G+  +L  GI
Sbjct  267   FFERDVSMHMEFKEELWRVLDGR--VNPPRLFIKGRYIGGAEEVLALHEQGRFRVLFEGI  324

Query  1069  P---QAGAGCDGCAGVRFVLCLNCNGSCKVLGED-LKNTVKCGECNENGLIQCPICC  1227
             P     G+ C+GCAG RFVLC +CNGS KV+ E+ L +T  C +CNENGLI CP+CC
Sbjct  325   PIDIFIGSPCEGCAGFRFVLCFHCNGSHKVVAENGLSST--CQDCNENGLIICPLCC  379



>emb|CDY14169.1| BnaC02g02860D [Brassica napus]
Length=245

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 100/146 (68%), Positives = 117/146 (80%), Gaps = 2/146 (1%)
 Frame = +1

Query  793   NSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKEELRGLMGTMVVKV  972
             NSVV+Y TTLRGIRKTFEDCN  RSIL+SH VR  ERDVSMHS FKEE+RG+MGT  VK+
Sbjct  99    NSVVVYITTLRGIRKTFEDCNAVRSILDSHEVRYSERDVSMHSVFKEEIRGIMGTKQVKI  158

Query  973   PLVFVKGRMIGGADEVVkleeegklgillsgiPQA--GAGCDGCAGVRFVLCLNCNGSCK  1146
             P VFV+GRMIG  +EVV+LEEEGKLGILL  +P+A     C GC G+RFV+C  CNGSCK
Sbjct  159   PAVFVRGRMIGSVEEVVRLEEEGKLGILLECMPKARLSGCCCGCGGMRFVMCGVCNGSCK  218

Query  1147  VLGEDLKNTVKCGECNENGLIQCPIC  1224
             V+  + K+ VKC ECNENGL+ CP+C
Sbjct  219   VMDAEKKDMVKCSECNENGLVLCPMC  244


 Score = 57.0 bits (136),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 55/102 (54%), Gaps = 11/102 (11%)
 Frame = +1

Query  40   MGCVSSKLFPKDKDFPFAGDGGCATHVVSLTSSTYGVLKLDKDSHQQQTPPQCIKECVVE  219
            MGCVSSK   K        + G   H+VSLTS+TYG L + +   + +T P   K    E
Sbjct  1    MGCVSSKPVKKKLVREIRVNNG-GDHIVSLTSTTYGHLDVQQ---RAETSP---KGDDFE  53

Query  220  VKKASPAREKPPEVINAWELMEGLDETEMPAAKKSPKARSFL  345
             ++ S A+   PE+IN WELME L++    + K SPK+R   
Sbjct  54   SERRSSAQRDDPEIINTWELMEDLED----STKVSPKSRGIF  91



>ref|XP_004140915.1| PREDICTED: uncharacterized protein LOC101211414 [Cucumis sativus]
Length=342

 Score =   164 bits (416),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 113/158 (72%), Gaps = 3/158 (2%)
 Frame = +1

Query  763   FNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKEELR  942
             F +KCPP G +SV++Y+TTLRGIRKTFEDCN+ R +LE+  V+  ERDVSMH+ FKEEL 
Sbjct  185   FEEKCPPGGSDSVILYSTTLRGIRKTFEDCNSIRFLLETFKVKFHERDVSMHTEFKEELW  244

Query  943   GLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiP---QAGAGCDGCAGVRF  1113
              ++ T     P +F++G+ IGGA+EV+ L E+GKL  L  GIP    +G  C+GC GVRF
Sbjct  245   RVLETNRALPPKLFIRGKYIGGAEEVLGLHEQGKLRALFEGIPIDQFSGIPCEGCGGVRF  304

Query  1114  VLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPICC  1227
             VLC  CNGS KV+ ++     KC ECNENGLI CP CC
Sbjct  305   VLCYKCNGSRKVVDDESDEQRKCSECNENGLIICPYCC  342



>ref|XP_007010494.1| Glutaredoxin family protein, putative [Theobroma cacao]
 gb|EOY19304.1| Glutaredoxin family protein, putative [Theobroma cacao]
Length=379

 Score =   165 bits (418),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 89/157 (57%), Positives = 118/157 (75%), Gaps = 4/157 (3%)
 Frame = +1

Query  763   FNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKEELR  942
             F +KCPP G+ SV++YTTTL+GIRKTFE CN+ R +LES  V  +ERD+SMH+ +KEEL 
Sbjct  225   FEEKCPPGGDGSVILYTTTLKGIRKTFEGCNSVRFLLESFRVIFYERDISMHTEYKEELW  284

Query  943   GLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiP--QAGAGCDGCAGVRFV  1116
              ++   V+  P +F+KGR IGGA+EV+ L E+GKL +L  GIP   + A C+GCAGVRFV
Sbjct  285   RILDGKVMP-PRLFIKGRYIGGAEEVLTLHEQGKLKLLFQGIPADTSNAPCEGCAGVRFV  343

Query  1117  LCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPICC  1227
             LC  CNGS +++ +D  ++ KC +CNENGLI CPICC
Sbjct  344   LCFKCNGSHRIIADDGLSS-KCLQCNENGLIICPICC  379



>ref|XP_006481620.1| PREDICTED: uncharacterized protein At3g28850-like [Citrus sinensis]
Length=279

 Score =   162 bits (411),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 93/178 (52%), Positives = 123/178 (69%), Gaps = 9/178 (5%)
 Frame = +1

Query  709   VSRKSRKSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHV  888
             V    + SQE+    L+ + +KCPP GE+SV+ YTT+LRGIRKTFEDC T R +L+S  V
Sbjct  104   VQEMEKDSQESP--FLKGYEEKCPPGGEDSVIFYTTSLRGIRKTFEDCRTIRFLLQSFKV  161

Query  889   RTFERDVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgi  1068
               +ERDVS+H  F++EL  L+   V+  P +F+KGR IGGADEVV L E+GKL  LL GI
Sbjct  162   TFYERDVSLHMEFRDELWSLLSGRVIP-PRLFIKGRYIGGADEVVGLHEQGKLKKLLEGI  220

Query  1069  PQ--AGAGCDGCAGVRFVLCLNCNGSCKVLGEDLKNT----VKCGECNENGLIQCPIC  1224
             P+  +   C+GC  +RFVLC NC+GSCKV  +   +     ++C ECNENGL++CPIC
Sbjct  221   PRNLSDCSCNGCGNIRFVLCSNCSGSCKVFRDGDDDDDELHIRCPECNENGLVKCPIC  278



>ref|XP_002514463.1| electron transporter, putative [Ricinus communis]
 gb|EEF47959.1| electron transporter, putative [Ricinus communis]
Length=415

 Score =   165 bits (417),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 91/158 (58%), Positives = 117/158 (74%), Gaps = 6/158 (4%)
 Frame = +1

Query  763   FNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKEEL-  939
             F +KCPP G +SV++YTTTLRG+RKTFEDCN+ R +LES  V  +ERDVSMH+ +KEEL 
Sbjct  261   FEEKCPPGGSDSVILYTTTLRGVRKTFEDCNSIRFLLESFRVIFYERDVSMHTEYKEELW  320

Query  940   RGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQAGA--GCDGCAGVRF  1113
             R L G ++   P +F+KGR IGGA+EV++L E+GK   L  GIP  G+   C+GCAG RF
Sbjct  321   RVLEGKIL--PPRLFIKGRHIGGAEEVLRLHEQGKFRQLFQGIPADGSIGRCEGCAGFRF  378

Query  1114  VLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPICC  1227
             VLC +CNGS +V+ ED   +  C +CNENGLI CP+CC
Sbjct  379   VLCFHCNGSHRVV-EDDGLSRNCQDCNENGLIICPLCC  415



>gb|KDP25281.1| hypothetical protein JCGZ_20437 [Jatropha curcas]
Length=368

 Score =   164 bits (414),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 112/161 (70%), Gaps = 7/161 (4%)
 Frame = +1

Query  754   LEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKE  933
             L  + +KCPP+G++SVVIYTT+LRG+RKT+EDCN  R ++E H V   ERDVS+H  F +
Sbjct  210   LSDYPEKCPPSGDDSVVIYTTSLRGVRKTYEDCNRVRVLMELHRVVFDERDVSLHGEFLK  269

Query  934   ELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegkl-gillsgiPQAGAG---CDGCA  1101
             ELR L+G     VP VFVKGR IGG DEVV+L E  +L  IL     + G G   C+GC 
Sbjct  270   ELRELLGEE-TSVPRVFVKGRYIGGVDEVVELNESSRLGRILNWARVERGLGRQACEGCG  328

Query  1102  GVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPIC  1224
             G RFV CL+C GSCKVL + +K   +CG+CNENGL+ CP C
Sbjct  329   GARFVPCLDCGGSCKVLVDGIKE--RCGQCNENGLVLCPAC  367



>ref|XP_003579702.1| PREDICTED: uncharacterized protein LOC100837744 [Brachypodium 
distachyon]
Length=429

 Score =   165 bits (418),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 94/152 (62%), Positives = 121/152 (80%), Gaps = 1/152 (1%)
 Frame = +1

Query  772   KCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKEELRGLM  951
             KCPP G ++VV+YTTTLRGIR+TFE+CN  R+ +E+H V+  ERDVSM SG++EELR L+
Sbjct  277   KCPPGGADAVVLYTTTLRGIRRTFEECNAVRAAIEAHDVKVIERDVSMDSGYREELRLLL  336

Query  952   GTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQAGAGCDGCAGVRFVLCLNC  1131
             G   ++VP VFV+G+ +GGA EV KLEEEGKL  +L G+P+A   C GCAGVRFV+C +C
Sbjct  337   GGRELRVPAVFVRGKHVGGAAEVTKLEEEGKLRAMLQGLPRARVWCAGCAGVRFVMCRDC  396

Query  1132  NGSCKV-LGEDLKNTVKCGECNENGLIQCPIC  1224
             NGS KV +  + K TV+CGECNENGL++CPIC
Sbjct  397   NGSRKVRVDGEKKETVQCGECNENGLVRCPIC  428



>ref|XP_009758115.1| PREDICTED: uncharacterized protein At5g39865-like [Nicotiana 
sylvestris]
Length=307

 Score =   162 bits (409),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 111/162 (69%), Gaps = 6/162 (4%)
 Frame = +1

Query  754   LEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKE  933
             L  F +KCPP G + V+ YTT+LRGIRKTFEDCN  R +LES  V  +ERDVSMH  ++E
Sbjct  146   LSNFEEKCPPGGSDKVIFYTTSLRGIRKTFEDCNIIRFLLESFRVVYYERDVSMHVEYRE  205

Query  934   ELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQ--AGAGCDGCAGV  1107
             EL  ++   VV  P +F++GR IGGADEVV L E+G L  LL GIP     + C GC G+
Sbjct  206   ELWKILDGRVVP-PRIFIRGRDIGGADEVVGLHEQGILKKLLHGIPLLPLTSPCKGCCGI  264

Query  1108  RFVLCLNCNGSCKVLGEDLKNT---VKCGECNENGLIQCPIC  1224
             RFVLC NC+GSCK+   + K      +C ECNENGLI+CPIC
Sbjct  265   RFVLCFNCHGSCKITDSEGKANEFPSRCPECNENGLIKCPIC  306



>ref|XP_011070395.1| PREDICTED: uncharacterized protein At5g39865-like [Sesamum indicum]
Length=334

 Score =   162 bits (410),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 95/189 (50%), Positives = 118/189 (62%), Gaps = 11/189 (6%)
 Frame = +1

Query  691   MISSTPVSRKSRKSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSI  870
             ++ S+   RKS +     D  L  F   CPP GEN VVIYTTTLRG+RKTFEDCN  R  
Sbjct  145   VVQSSIEVRKSSEGSSDRDDFLHGFEMICPPNGENKVVIYTTTLRGVRKTFEDCNAVRLA  204

Query  871   LESHHVRTFERDVSMHSGFKEELRGLM---GTMVVKVPLVFVKGRMIGGADEVVkleeeg  1041
             +E       ERD+SM  GF++ELR LM   G+     P VFVKGR IGG +E++++ EEG
Sbjct  205   IEGLGTSFCERDISMDRGFRDELRELMKGKGSNESIPPRVFVKGRYIGGVEEMMRVVEEG  264

Query  1042  klgillsgiPQAGAG--CDGCAGVRFVLCLNCNGSCKVL------GEDLKNTVKCGECNE  1197
              L  LL G+P+   G  C+GC GVRF+ C  CNGSCKV+       ED    V+C +CNE
Sbjct  265   NLVKLLQGLPKVRGGHVCEGCGGVRFLPCFTCNGSCKVMVDVKEDTEDRSVAVRCSDCNE  324

Query  1198  NGLIQCPIC  1224
             NGL+ CPIC
Sbjct  325   NGLVLCPIC  333


 Score = 58.5 bits (140),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 54/112 (48%), Gaps = 16/112 (14%)
 Frame = +1

Query  40   MGCVSSKLFPKDKDFP-FAGDGGCATHVVSLTSSTYGVLKLD-------KDSHQQQTPPQ  195
            MGC SS L  +D++F    G    + H+VSLTS+TYG+L LD       +       PP 
Sbjct  1    MGCTSSTLLNQDEEFSQTGGSAAFSHHIVSLTSTTYGLLTLDPPPLNRIQPRSPTTVPPT  60

Query  196  CIKECVVEVKKASPA--------REKPPEVINAWELMEGLDETEMPAAKKSP  327
             +    + +    P+        R +P E +++WELM  LD   +P  + SP
Sbjct  61   PLAPPRITLGSLFPSPLSEPRSVRSQPLETVSSWELMSTLDSYHIPTFRFSP  112



>ref|NP_001265925.1| Hop-interacting protein THI143 [Solanum lycopersicum]
 ref|XP_010325292.1| PREDICTED: hop-interacting protein THI143 isoform X1 [Solanum 
lycopersicum]
 gb|AEW69786.1| Hop-interacting protein THI143 [Solanum lycopersicum]
Length=327

 Score =   162 bits (409),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 90/175 (51%), Positives = 122/175 (70%), Gaps = 13/175 (7%)
 Frame = +1

Query  739   AADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMH  918
             ++ ++L+ F + CPP G++ +VIYTTTLRG+RKTFE CN  RS +E   V   ERD+SM 
Sbjct  154   SSASVLDGFERICPPNGDDKIVIYTTTLRGVRKTFEACNAVRSAIEGLGVLYSERDISMD  213

Query  919   SGFKEELRGLM----GTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiP--QAG  1080
              GF+EEL+ LM     T ++  P VF KGR IGGA+EV+++ EEG  G LL G+P  +AG
Sbjct  214   KGFREELKQLMKGKESTELIP-PRVFFKGRYIGGAEEVMRIVEEGNFGDLLQGLPKMKAG  272

Query  1081  AGCDGCAGVRFVLCLNCNGSCKVLGEDLKN------TVKCGECNENGLIQCPICC  1227
             + C+GC G+RF+ C  CNGSCK++ ED++        V+C ECNENGL+ CPICC
Sbjct  273   SVCEGCGGIRFMPCFTCNGSCKMVKEDVEQNEGRAVVVRCSECNENGLVLCPICC  327


 Score = 54.7 bits (130),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 52/116 (45%), Gaps = 12/116 (10%)
 Frame = +1

Query  40   MGCVSSKLFPKDKDFPFAGD--GGCATHVVSLTSSTYGVLKLDKDSHQQQTPPQCIKECV  213
            MGCVSS L  ++ +F   G    G + H+VSLTS+TYG+L LD  S              
Sbjct  1    MGCVSSTLLNQENEFTQMGGSAAGFSHHIVSLTSTTYGLLTLDPPSTPPPITVPPTPTLP  60

Query  214  VEVKKASPA-------REKPPEVINAWELMEGLDETEMPAAKKSPKARSFLDHRRS  360
                  S         R    ++IN+WELM GLD T       S +   FL  R+S
Sbjct  61   PRHTLGSLVPSPLFEPRILKSDIINSWELMAGLDSTSTTPISDSFR---FLSLRKS  113



>ref|XP_011024139.1| PREDICTED: uncharacterized protein At3g28850-like [Populus euphratica]
Length=377

 Score =   163 bits (412),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 98/176 (56%), Positives = 124/176 (70%), Gaps = 10/176 (6%)
 Frame = +1

Query  718   KSRKSQEAADT--ILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVR  891
             K+R+ +E  D   IL  F + CPP G +SV++YTT+LRGIRKTFEDCN+ R +LES  V 
Sbjct  206   KARRIEEGDDIDPIL-GFPEMCPPGGSDSVILYTTSLRGIRKTFEDCNSIRFLLESFRVL  264

Query  892   TFERDVSMHSGFKEEL-RGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgi  1068
              FERDVSMH  FKEEL R L G   V  P +F+KGR IGGA+EV+ L E+G+  +L  GI
Sbjct  265   FFERDVSMHMEFKEELWRVLDGR--VNPPRLFIKGRYIGGAEEVLALHEQGRFRVLFEGI  322

Query  1069  PQ---AGAGCDGCAGVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPICC  1227
             P     G+ C+GCAG RFVLC +CNGS KV+ E+   ++ C +CNENGLI CP+CC
Sbjct  323   PIDIFIGSPCEGCAGFRFVLCFHCNGSHKVVVENGLPSI-CQDCNENGLIICPLCC  377



>ref|XP_009626221.1| PREDICTED: uncharacterized protein At5g39865-like [Nicotiana 
tomentosiformis]
Length=307

 Score =   161 bits (408),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 112/162 (69%), Gaps = 6/162 (4%)
 Frame = +1

Query  754   LEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKE  933
             L  F +KCPP G + V+ YTT+LRGIRKTFEDCN  R +LES  V  +ERDVSMH  ++E
Sbjct  146   LSNFEEKCPPGGSDKVIFYTTSLRGIRKTFEDCNIIRFLLESFRVVYYERDVSMHVEYRE  205

Query  934   ELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQ--AGAGCDGCAGV  1107
             EL  ++   VV  P +F++GR IGGADEVV L E+G L  LL GIP   + + C GC G+
Sbjct  206   ELWRILSGRVVP-PRLFIRGRDIGGADEVVGLHEQGILKKLLHGIPLLPSTSPCKGCCGI  264

Query  1108  RFVLCLNCNGSCKVLGEDLKNT---VKCGECNENGLIQCPIC  1224
             RFVLC NC+GSCK+   + K      +C ECNENGLI+CPIC
Sbjct  265   RFVLCFNCHGSCKITDPEGKANEFPSRCPECNENGLIKCPIC  306



>ref|NP_001239943.1| uncharacterized protein LOC100780345 [Glycine max]
 gb|ACU22113.1| unknown [Glycine max]
Length=270

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 115/164 (70%), Gaps = 5/164 (3%)
 Frame = +1

Query  748   TILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGF  927
             T+ ++F + CPP GE  VVIYTT+LRG+R TFE CN  R+ LE   V   ERDVSMHSGF
Sbjct  106   TLADRFEKICPPNGEKRVVIYTTSLRGVRTTFEACNAVRAALEGFGVVICERDVSMHSGF  165

Query  928   KEELRGLM-GTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiP--QAGAGCDGC  1098
             +EELR L+ G  V+  P VFVKG  IGGADE++K+ EEG LG LL G+P  + GA C GC
Sbjct  166   REELRTLLKGKQVMVPPRVFVKGLYIGGADEMLKVAEEGLLGDLLDGLPRKKVGAVCVGC  225

Query  1099  AGVRFVLCLNCNGSCKVLGEDLKNT--VKCGECNENGLIQCPIC  1224
               +RF+ C NCNGSCK L ++   T  VKC  CNENGL+ CP+C
Sbjct  226   GDLRFLPCFNCNGSCKTLVKEQGRTVVVKCTHCNENGLVLCPLC  269


 Score = 63.5 bits (153),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 48/86 (56%), Gaps = 13/86 (15%)
 Frame = +1

Query  40   MGCVSSKLFPKDKDFPF-AGDGGCATHVVSLTSSTYGVLKLDKDSHQQQTPPQCIKECVV  216
            MGCVSS L  +D+DF    G      H+VSLTS+TYG+L LD  S    TPP        
Sbjct  1    MGCVSSNLLNQDEDFSTQLGSSALGHHIVSLTSTTYGLLTLDPPS----TPPS-----RF  51

Query  217  EVKKASPAREKPPEVINAWELMEGLD  294
             +    P+    PEVIN+WELM GLD
Sbjct  52   TLGSLFPSE---PEVINSWELMSGLD  74



>ref|XP_006343770.1| PREDICTED: uncharacterized protein At5g39865-like isoform X1 
[Solanum tuberosum]
 ref|XP_006343771.1| PREDICTED: uncharacterized protein At5g39865-like isoform X2 
[Solanum tuberosum]
Length=330

 Score =   161 bits (408),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 118/171 (69%), Gaps = 11/171 (6%)
 Frame = +1

Query  748   TILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGF  927
             ++L+ F + CPP GE  +VIYTTTLRG+RKTFE CN  RS +E   V   ERD+SM  GF
Sbjct  160   SVLDGFEKLCPPNGEGKIVIYTTTLRGVRKTFEACNVVRSAIEGLGVLYSERDISMDRGF  219

Query  928   KEELRGLMG---TMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiP--QAGAGCD  1092
             +EEL+ LM    +  +  P VF KGR IGGA++V+++ EEG  G LL G+P  +AG+ C+
Sbjct  220   REELKELMKGKESTELIPPRVFFKGRYIGGAEDVMRIVEEGNFGDLLQGLPKMKAGSVCE  279

Query  1093  GCAGVRFVLCLNCNGSCKVLGEDLKN------TVKCGECNENGLIQCPICC  1227
             GC GVRF+ C  CNGSCK++ ED++        V+C ECNENGL+ CPICC
Sbjct  280   GCGGVRFMPCFTCNGSCKMVKEDMEQNEGRAVVVRCTECNENGLVLCPICC  330


 Score = 58.9 bits (141),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 57/175 (33%), Positives = 78/175 (45%), Gaps = 35/175 (20%)
 Frame = +1

Query  40   MGCVSSKLFPKDKDFPFAGD--GGCATHVVSLTSSTYGVLKLDKDSHQQQTPPQCIKECV  213
            MGCVSS L  +D +F   G    G + H+VSLTS+TYG+L LD  S    T         
Sbjct  1    MGCVSSTLLNQDNEFTNMGGSAAGFSHHIVSLTSTTYGLLTLDPPSTPPPTTTTVPPTPT  60

Query  214  VEVKKA---------SPAREKPPEVINAWELMEGLDETE---------MPAAKKSPKARS  339
               +           S  R    ++IN+WELM GLD T           P+ +KS    S
Sbjct  61   PPPRHTLGSLFPSPLSEPRILKSDIINSWELMAGLDSTSTTPISDSFRFPSLRKSTPDSS  120

Query  340  FLDHRRSPLKFLNQLASPGKLRRSGGKENKPG--RAMGRSE-FSPKTVPKAYNLQ  495
            F        +FLN+ +SP K   S    N P    A+ +++ F+P  +P A  L 
Sbjct  121  F--------RFLNK-SSPNKENSS---PNIPSFTDALDKADIFNPTRLPSASVLD  163



>ref|XP_008456623.1| PREDICTED: uncharacterized protein At3g28850 [Cucumis melo]
Length=351

 Score =   161 bits (408),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 87/157 (55%), Positives = 113/157 (72%), Gaps = 3/157 (2%)
 Frame = +1

Query  763   FNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKEELR  942
             F +KCPP G +SV++YTTTLRGIRKTFEDCN+ R +LE+  V+  ERDVSMH+ FKE+L 
Sbjct  194   FEEKCPPGGSDSVILYTTTLRGIRKTFEDCNSIRFLLETFKVKFHERDVSMHTEFKEDLW  253

Query  943   GLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiP---QAGAGCDGCAGVRF  1113
              ++ T     P +F++G+ IGGA+EV++L E+GKL  L  GIP    +G  C+GC GVRF
Sbjct  254   KVLETNRALPPKLFIRGKYIGGAEEVLELHEKGKLRPLFEGIPIDQFSGIPCEGCGGVRF  313

Query  1114  VLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPIC  1224
             VLC  C+GS KV+ ++     KC ECNENGLI CP C
Sbjct  314   VLCFKCHGSRKVVDDESDEQRKCTECNENGLIICPYC  350



>ref|XP_007203660.1| hypothetical protein PRUPE_ppa1027144mg [Prunus persica]
 gb|EMJ04859.1| hypothetical protein PRUPE_ppa1027144mg [Prunus persica]
Length=281

 Score =   159 bits (402),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 91/180 (51%), Positives = 120/180 (67%), Gaps = 8/180 (4%)
 Frame = +1

Query  709   VSRKSRKSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHV  888
             +  +++  +E     L  F +KCPP G NSV++Y+T+L G+RKTFE C   R +LES  V
Sbjct  103   IFHEAKDEEEEQHPSLSDFEEKCPPGGGNSVILYSTSLTGVRKTFEACKAIRFLLESFKV  162

Query  889   RTFERDVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgi  1068
                ERDVSMH GF+EEL  + G  V+  P +F+KGR IGGADEV+ L E+GKL  LL GI
Sbjct  163   SVHERDVSMHMGFREELWRIFGGRVIP-PRLFIKGRYIGGADEVIGLHEQGKLKKLLKGI  221

Query  1069  P--QAGAGCDGCAGVRFVLCLNCNGSCKVLGE-DLKNT----VKCGECNENGLIQCPICC  1227
             P   + + C GCA +RFV+C NCNGS +V  + DL  T    ++C ECNENGL++C ICC
Sbjct  222   PIDLSNSPCTGCANMRFVVCFNCNGSRRVFKDSDLDETDELHIRCPECNENGLVKCSICC  281



>gb|KDO70654.1| hypothetical protein CISIN_1g047313mg [Citrus sinensis]
Length=174

 Score =   155 bits (393),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 120/174 (69%), Gaps = 10/174 (6%)
 Frame = +1

Query  724   RKSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFER  903
             + SQE+    L+ + +KCPP GE+SV+ YTT+LRGIRKTFEDC T R +L+S  V  +ER
Sbjct  3     KDSQESP--FLKGYEEKCPPGGEDSVIFYTTSLRGIRKTFEDCRTIRFLLQSFKVTFYER  60

Query  904   DVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQ--A  1077
             DVS+H  F++EL   +   V+  P +F+KGR IGGADEVV L E+GKL  LL GIP+  +
Sbjct  61    DVSLHMEFRDELWSSLSGRVIP-PRLFIKGRYIGGADEVVGLHEQGKLKKLLEGIPRNLS  119

Query  1078  GAGCDGCAGVRFVLCLNCNGSCKVLGEDLKNT-----VKCGECNENGLIQCPIC  1224
                C+GC  +RFVLC NC+GSCKV  +   +      ++C ECNENGL++CP C
Sbjct  120   DCSCNGCGNIRFVLCSNCSGSCKVFRDGDDDDDDELHIRCPECNENGLVKCPFC  173



>ref|XP_011077914.1| PREDICTED: uncharacterized protein LOC105161798 [Sesamum indicum]
Length=310

 Score =   159 bits (402),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 89/162 (55%), Positives = 116/162 (72%), Gaps = 5/162 (3%)
 Frame = +1

Query  751   ILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFK  930
             ++  F  +CPP G++S+V+YTT+LRGIRKTFEDCNT R +LES  V   ERDVSMH  ++
Sbjct  149   MIYDFEDRCPPGGKDSLVLYTTSLRGIRKTFEDCNTIRFLLESFRVVYSERDVSMHLEYR  208

Query  931   EELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQAGAG-CDGCAGV  1107
             +EL  ++G  VV  P +F+KGR IGGADEVV L E G L  LL GIP + +  C GCAG+
Sbjct  209   DELWRILGGRVVP-PRLFIKGRYIGGADEVVGLHENGMLQDLLQGIPLSPSNTCRGCAGM  267

Query  1108  RFVLCLNCNGSCKVLGEDLKN---TVKCGECNENGLIQCPIC  1224
             RFVLC +CNGS KV+ E       +++C +CNENGLI+C +C
Sbjct  268   RFVLCFSCNGSRKVMAEGENRGGISIRCPDCNENGLIKCSVC  309



>gb|EPS65733.1| hypothetical protein M569_09043 [Genlisea aurea]
Length=255

 Score =   157 bits (397),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 89/159 (56%), Positives = 108/159 (68%), Gaps = 11/159 (7%)
 Frame = +1

Query  775   CPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKEELRGLM-  951
             CPP GE+ VV+YTTTLRG+RKTFEDCN  RS +    +   ERDVSM  GF+EELR LM 
Sbjct  96    CPPNGEDRVVVYTTTLRGVRKTFEDCNAVRSAIRGLGIEICERDVSMDRGFREELRELMK  155

Query  952   ----GTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQAGAGCDGCAGVRFVL  1119
                 G+ +   P VFV+GR +GGADEV+ + E G LG LL  +P+A   CDGC GVRF+ 
Sbjct  156   GKEDGSSI--PPRVFVRGRYVGGADEVLSMAEGGCLGELLRSLPKARRRCDGCGGVRFLP  213

Query  1120  CLNCNGSCKVL----GEDLKNTVKCGECNENGLIQCPIC  1224
             C +C+GSCKV      E     V+CG CNENGLI+CPIC
Sbjct  214   CFDCSGSCKVWVDAKEEGRAMLVRCGNCNENGLIRCPIC  252


 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 46/94 (49%), Gaps = 13/94 (14%)
 Frame = +1

Query  40   MGCVSSKLFPKDKDFPFAGDGGCATHVVSLTSSTYGVLKLDKDSHQQQTPPQCIKECVVE  219
            MGC SS L   D D           H+VSLTS+TYG+L LD    +++T           
Sbjct  1    MGCASSALL--DHDHRATTTAAFTHHIVSLTSTTYGLLSLDPPLPRRRT----------T  48

Query  220  VKKASPAREKPP-EVINAWELMEGLDETEMPAAK  318
            +    PA   PP E IN+W+LM GLD   + + +
Sbjct  49   LASLFPASPPPPVETINSWDLMSGLDSNRISSLR  82



>ref|XP_008241083.1| PREDICTED: uncharacterized protein At5g39865 [Prunus mume]
Length=281

 Score =   158 bits (399),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 90/180 (50%), Positives = 119/180 (66%), Gaps = 8/180 (4%)
 Frame = +1

Query  709   VSRKSRKSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHV  888
             +  ++   +E     L  F +KCPP G NSV++Y+T+L G+RKTFE C   R +LES  V
Sbjct  103   IFHEANDDEEEQHPSLSDFEEKCPPGGGNSVILYSTSLTGVRKTFEACKAIRFLLESFKV  162

Query  889   RTFERDVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgi  1068
                ERDVSMH GF+EEL  + G  V+  P +F+KGR IGGADEV+ L E+GKL  LL GI
Sbjct  163   SVHERDVSMHMGFREELWRIFGGRVIP-PRLFIKGRYIGGADEVIGLHEQGKLKKLLKGI  221

Query  1069  PQ--AGAGCDGCAGVRFVLCLNCNGSCKV-----LGEDLKNTVKCGECNENGLIQCPICC  1227
             P   + + C GCA +RFV+C NCNGS +V     L E+ +  ++C ECNENGL++C ICC
Sbjct  222   PMDLSNSPCTGCANMRFVVCFNCNGSRRVFKDSDLDENDELHIRCPECNENGLVKCSICC  281



>ref|XP_001769097.1| predicted protein [Physcomitrella patens]
 gb|EDQ66071.1| predicted protein [Physcomitrella patens]
Length=169

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 90/165 (55%), Positives = 117/165 (71%), Gaps = 5/165 (3%)
 Frame = +1

Query  736   EAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSM  915
             E AD +L QF +KCPP GE  VV+Y T+LRG+RKTFEDC++ + IL+S  V   ERDVSM
Sbjct  7     EIADPLL-QFERKCPPGGERRVVLYLTSLRGVRKTFEDCHSLKMILQSFPVWVDERDVSM  65

Query  916   HSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiP--QAGAGC  1089
             H+ F++E+  L+G  V+ VP VF+KG  IGG DEV +L E+GKLG LL  +P  Q    C
Sbjct  66    HAEFRQEVTDLLGGPVI-VPRVFIKGHYIGGPDEVRRLHEDGKLGALLQDLPVVQYRKPC  124

Query  1090  DGCAGVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPIC  1224
             DGC  VRFV C  C+GSCK++  D  +  +C +CNENGLI+CP+C
Sbjct  125   DGCGDVRFVPCPECSGSCKII-TDTNDVAQCPDCNENGLIRCPVC  168



>ref|XP_003518166.2| PREDICTED: uncharacterized protein At5g39865-like [Glycine max]
 gb|KHN35921.1| Hypothetical protein glysoja_037807 [Glycine soja]
Length=270

 Score =   157 bits (397),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 88/186 (47%), Positives = 120/186 (65%), Gaps = 8/186 (4%)
 Frame = +1

Query  691   MISSTPVSRKSRKSQEAADT-ILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARS  867
             +++++P     +K Q   +   L  F +  PP G  +V++YTT++RGIRKTF+DCNT   
Sbjct  86    LVATSPSKSMHQKIQGIEEYPSLTDFEEIHPPGGSQAVILYTTSMRGIRKTFQDCNTVCF  145

Query  868   ILESHHVRTFERDVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegkl  1047
             +L S  +R  ERDVS+H  ++EEL  ++G+ V+  P +F+KGR IGGADEVV L E G L
Sbjct  146   LLRSFKIRYHERDVSLHLEYREELWKILGSKVIP-PRLFIKGRYIGGADEVVGLHEMGWL  204

Query  1048  gillsgiPQ--AGAGCDGCAGVRFVLCLNCNGSCKVLGEDLKNT----VKCGECNENGLI  1209
             G LL   P   A   C GCA +RF +C NCNGSCKV   +  N     ++C ECNENGL+
Sbjct  205   GKLLEETPMDFADGPCKGCACMRFSICFNCNGSCKVFTTNGDNKNECFIRCPECNENGLV  264

Query  1210  QCPICC  1227
             +CPICC
Sbjct  265   KCPICC  270



>ref|XP_009613385.1| PREDICTED: uncharacterized protein At5g39865-like [Nicotiana 
tomentosiformis]
Length=340

 Score =   159 bits (402),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 95/177 (54%), Positives = 120/177 (68%), Gaps = 14/177 (8%)
 Frame = +1

Query  739   AADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMH  918
             + D+ L+ F   CPP GE+ +VIYTTTLRG+R+TFE CN  RS +E   V   ERD+SM 
Sbjct  164   SCDSKLDGFENLCPPNGEDKIVIYTTTLRGVRRTFEACNAVRSAIEGLGVLYSERDISMD  223

Query  919   SGFKEELRGLM-GTMVVKV--PLVFVKGRMIGGADEVVkleeegklgillsgiPQAGAG-  1086
              GF++EL+ LM G    ++  P VF KGR IGGA+EV+++ EEG LG LL G+P+  AG 
Sbjct  224   RGFRDELKELMKGKKSTELIPPRVFFKGRYIGGAEEVMRIVEEGNLGDLLQGLPKVKAGF  283

Query  1087  -CDGCAGVRFVLCLNCNGSCK---VLGEDLKN------TVKCGECNENGLIQCPICC  1227
              CDGC GVRF+ C  CNGSCK   V+ ED++        VKC ECNENGL+ CPICC
Sbjct  284   VCDGCGGVRFLPCFACNGSCKMVMVVKEDMEQKEGRTLVVKCTECNENGLVLCPICC  340


 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 57/136 (42%), Gaps = 19/136 (14%)
 Frame = +1

Query  40   MGCVSSKLFPKDKDFPFAGD--GGCATHVVSLTSSTYGVLKLDKDSHQQQTPPQCIKECV  213
            MGCVSS L  +D +F   G    G + H+VSLTS+TYG+L LD  S    +         
Sbjct  1    MGCVSSTLLNQDNEFTQMGGSAAGFSHHIVSLTSTTYGLLTLDPPSSPPPSSTPTTIVPP  60

Query  214  VEVKKA---------SPARE------KPPEVINAWELMEGLDETEMPAAKKSPKARSFLD  348
                           SP  E         ++IN+WELM GLD T M     S +  + L 
Sbjct  61   TPTPPPRHTLGSLFPSPLSEPRTLKSHTSDIINSWELMAGLDSTSMTPISDSFRFSTLLK  120

Query  349  HRR--SPLKFLNQLAS  390
                 S  +FL    S
Sbjct  121  LSTPDSSFRFLKSFPS  136



>ref|XP_002308331.2| hypothetical protein POPTR_0006s21590g [Populus trichocarpa]
 gb|EEE91854.2| hypothetical protein POPTR_0006s21590g [Populus trichocarpa]
Length=290

 Score =   157 bits (398),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 92/184 (50%), Positives = 121/184 (66%), Gaps = 10/184 (5%)
 Frame = +1

Query  700   STPVSRKSRKSQEAADTI-----LEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTAR  864
             ST ++ +     EA   I     L  F +KC P G  SV++YTT+LR IRKTFEDC+  R
Sbjct  107   STEITVEQDTENEAEKKIEEHPSLSDFEEKCLPGGSQSVILYTTSLRSIRKTFEDCHAIR  166

Query  865   SILESHHVRTFERDVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegk  1044
              +LES  V  +ERDVS+H  F+EEL  ++G  V+  P +F+KGR IGGADEV+ L E+G+
Sbjct  167   FLLESLKVMFYERDVSLHLEFREELWRILGGRVIP-PRLFIKGRYIGGADEVIGLHEQGR  225

Query  1045  lgillsgiP--QAGAGCDGCAGVRFVLCLNCNGSCKVLGEDL--KNTVKCGECNENGLIQ  1212
             L  LL GIP   + + C+GC   RFV+C NCNGSCKV  +D   +  ++C ECNENGL +
Sbjct  226   LKKLLVGIPLNLSNSPCNGCGNKRFVVCSNCNGSCKVFEDDQNEEKCIRCPECNENGLAK  285

Query  1213  CPIC  1224
             CPIC
Sbjct  286   CPIC  289



>emb|CDP12180.1| unnamed protein product [Coffea canephora]
Length=398

 Score =   160 bits (405),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 87/162 (54%), Positives = 102/162 (63%), Gaps = 6/162 (4%)
 Frame = +1

Query  754   LEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKE  933
             L  F + CPP GE SVVIYTT+L G+R+TFEDCN  R I+ESH     ERDVS+H  F +
Sbjct  237   LNDFPEMCPPGGEESVVIYTTSLGGVRRTFEDCNKVRLIMESHRFVFDERDVSLHGEFLK  296

Query  934   ELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleee----gklgillsgiPQAGAGCDGCA  1101
             ELR L+G   V VP +FVKGR +GG DEVV L E       L            GC+GC 
Sbjct  297   ELRELLGEG-VSVPRMFVKGRYVGGVDEVVNLNETGRLGRILNWARVERGIGRLGCEGCG  355

Query  1102  GVRFVLCLNCNGSCKVL-GEDLKNTVKCGECNENGLIQCPIC  1224
             G RFV CL+C GSCKVL G+D K   +C  CNENGL+ CP C
Sbjct  356   GARFVPCLDCGGSCKVLVGDDKKEKERCPSCNENGLVLCPAC  397



>ref|XP_006589342.1| PREDICTED: uncharacterized protein At5g39865-like [Glycine max]
 gb|KHN37903.1| Hypothetical protein glysoja_017027 [Glycine soja]
Length=369

 Score =   159 bits (403),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 92/185 (50%), Positives = 120/185 (65%), Gaps = 13/185 (7%)
 Frame = +1

Query  703   TPVSRKSRKSQEAADTI-------LEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTA  861
             T   R+SR  +E++  +       L  F +KCPP G+  V+ YTTTLRGI KTFEDCN  
Sbjct  188   TEEQRRSRVEEESSQKVEDDDPDPLMFFEEKCPPGGDGMVIFYTTTLRGILKTFEDCNKI  247

Query  862   RSILESHHVRTFERDVSMHSGFKEEL-RGLMGTMVVKVPLVFVKGRMIGGADEVVkleee  1038
             R +L+S  V  FERD+SMH  F++EL   L G +V   P +FVKGR IGGA+EV+ L E+
Sbjct  248   RFLLQSFKVLYFERDISMHKEFRDELWSSLEGKLV--PPRLFVKGRYIGGAEEVLSLHEQ  305

Query  1039  gklgillsgiPQ--AGAGCDGCAGVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQ  1212
             GKL  +  G+P   +   CD C G+RFVLC  CNGS KV+ E+ ++  +C +CNENGLI 
Sbjct  306   GKLRKIFEGVPMDYSNGPCDACGGIRFVLCFKCNGSHKVMAENGESN-QCLQCNENGLIL  364

Query  1213  CPICC  1227
             CP CC
Sbjct  365   CPYCC  369



>ref|XP_010266554.1| PREDICTED: glutaredoxin domain-containing cysteine-rich protein 
CG12206 [Nelumbo nucifera]
Length=371

 Score =   159 bits (402),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 111/161 (69%), Gaps = 7/161 (4%)
 Frame = +1

Query  754   LEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKE  933
             L ++ +KCPP G +S V+YTTTL G+R+TFEDCN ARS+LE+  V   ERDVS+H  F  
Sbjct  213   LSEYPEKCPPGGADSAVLYTTTLGGVRRTFEDCNRARSVLEAQQVDIDERDVSLHGEFLN  272

Query  934   ELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQA-GAG---CDGCA  1101
             EL+ L+G     VP +FVKGR IGG D+VV+L E G+LG LL       G G   C+GC 
Sbjct  273   ELKELVGEE-CSVPRLFVKGRYIGGIDKVVELNESGRLGKLLKWAGIVRGVGRRACEGCG  331

Query  1102  GVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPIC  1224
             G RFV CL C GSCKVL ED K   +C +CNENGL+QCP+C
Sbjct  332   GARFVPCLECGGSCKVLIEDKKE--RCSKCNENGLVQCPLC  370



>ref|XP_010058933.1| PREDICTED: uncharacterized protein At3g28850 [Eucalyptus grandis]
Length=309

 Score =   157 bits (397),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 89/172 (52%), Positives = 118/172 (69%), Gaps = 4/172 (2%)
 Frame = +1

Query  721   SRKSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFE  900
             SR ++E     L  F +KCPP G +SV+ YTT+L GIRKTFEDCN  R +L S  +   E
Sbjct  139   SRDNKERYHLSLLDFQEKCPPGGRDSVIFYTTSLTGIRKTFEDCNAVRFLLRSFKINFQE  198

Query  901   RDVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiP--Q  1074
             RDVS+H  + EELR ++G  VV  P +F+KGR IGGADEV+ L E+G L  L  GIP   
Sbjct  199   RDVSLHLQYLEELRKILGQGVVP-PKLFIKGRCIGGADEVITLHEQGSLRKLFEGIPLDL  257

Query  1075  AGAGCDGCAGVRFVLCLNCNGSCKVLGE-DLKNTVKCGECNENGLIQCPICC  1227
             + + C  CA VRFV+CL C+GSC+V+ + + ++ ++C ECNENGLI+CP CC
Sbjct  258   SRSTCVQCANVRFVICLACHGSCRVVRDREEESWIRCPECNENGLIKCPTCC  309



>ref|XP_001771726.1| predicted protein [Physcomitrella patens]
 gb|EDQ63509.1| predicted protein [Physcomitrella patens]
Length=655

 Score =   162 bits (411),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 88/159 (55%), Positives = 114/159 (72%), Gaps = 4/159 (3%)
 Frame = +1

Query  754   LEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKE  933
             L ++ +KCPP G++ VV+Y T+LRGIRKTFEDC++ R IL+SH V   ERDVSMH+ F++
Sbjct  461   LYKYEEKCPPGGDDRVVLYLTSLRGIRKTFEDCHSLRMILQSHSVWVDERDVSMHAEFRQ  520

Query  934   ELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiP--QAGAGCDGCAGV  1107
             ELR L+   V+ VP +F+KGR IGG+DEV KL E+GKL  LL   P  Q    CDGC GV
Sbjct  521   ELRDLLDGPVI-VPRLFIKGRYIGGSDEVRKLHEDGKLSDLLRDFPVVQFRKACDGCGGV  579

Query  1108  RFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPIC  1224
             RFV C +C+GSCK++        +C +CNENGLI+CP C
Sbjct  580   RFVPCPDCSGSCKIITA-ANEVARCPDCNENGLIRCPRC  617



>gb|KDO38523.1| hypothetical protein CISIN_1g027825mg [Citrus sinensis]
Length=218

 Score =   154 bits (390),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 85/175 (49%), Positives = 108/175 (62%), Gaps = 9/175 (5%)
 Frame = +1

Query  718   KSRKSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTF  897
             K  K ++    +L  F +KCPP G + VVIYTT+LRG+R+T+EDCN  RS  E + V T 
Sbjct  45    KQAKYEKLIRDLLSDFPEKCPPGGSDGVVIYTTSLRGVRRTYEDCNRVRSTFEVNRVVTD  104

Query  898   ERDVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVk-leeegklgillsgiPQ  1074
             ERDVS+H  F  EL+ L+G   V VP VF+KGR +GG DE+ +  E      +L S   +
Sbjct  105   ERDVSLHGQFLNELKDLLGGETVTVPRVFIKGRYVGGVDELTELNESGKLGRMLRSARVE  164

Query  1075  AGAG---CDGCAGVRFVLCLNCNGSCKVLGEDLKNTVK--CGECNENGLIQCPIC  1224
              G G   C+GC G RFV C +C GSCKV+   L N  K  CG CNENGL+ CP C
Sbjct  165   MGIGRQACEGCGGARFVPCFDCGGSCKVV---LANGDKQRCGVCNENGLVHCPAC  216



>ref|XP_004143951.1| PREDICTED: uncharacterized protein LOC101208965 [Cucumis sativus]
 ref|XP_004165778.1| PREDICTED: uncharacterized LOC101208965 [Cucumis sativus]
 gb|KGN50006.1| hypothetical protein Csa_5G148770 [Cucumis sativus]
Length=361

 Score =   158 bits (399),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 87/161 (54%), Positives = 107/161 (66%), Gaps = 7/161 (4%)
 Frame = +1

Query  754   LEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKE  933
             L +F +KCPP G  +VV+YTT+LRG+R+TFEDCN  +S+LE   V   ERDV++H  F +
Sbjct  203   LSEFPEKCPPGGAETVVLYTTSLRGVRRTFEDCNRVKSVLELQQVVVDERDVALHGEFLK  262

Query  934   ELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiP-QAGA---GCDGCA  1101
             EL+ L+G     VP +FVKGR IGGADEVV L E GKL  +L     + GA   GC+GC 
Sbjct  263   ELKELLGDEAT-VPKMFVKGRYIGGADEVVALNEMGKLRRILRRAAVETGAGRQGCEGCG  321

Query  1102  GVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPIC  1224
             G RFV C  C GSCKV+  D K   +CG CNENGL  CP C
Sbjct  322   GARFVPCYECGGSCKVIKGDTKE--RCGACNENGLAHCPAC  360



>ref|XP_006476355.1| PREDICTED: glutaredoxin domain-containing cysteine-rich protein 
CG12206-like [Citrus sinensis]
Length=364

 Score =   158 bits (399),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 109/175 (62%), Gaps = 9/175 (5%)
 Frame = +1

Query  718   KSRKSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTF  897
             K  K ++    +L  F +KCPP G + VVIYTT+LRG+R+T+EDCN  RS  E + V T 
Sbjct  191   KQAKYEKLIRDLLSDFPEKCPPGGSDGVVIYTTSLRGVRRTYEDCNRVRSTFEVNRVVTD  250

Query  898   ERDVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleee-gklgillsgiPQ  1074
             ERDVS+H  F  EL+ L+G   V VP VF+KGR +GG DE+ +L E      +L S   +
Sbjct  251   ERDVSLHGQFLNELKDLLGGETVTVPRVFIKGRYVGGVDELTELNESGKLGRMLRSARVE  310

Query  1075  AGAG---CDGCAGVRFVLCLNCNGSCKVLGEDLKNTVK--CGECNENGLIQCPIC  1224
              G G   C+GC G RFV C +C GSCKV+   L N  K  CG CNENGL+ CP C
Sbjct  311   MGIGRQACEGCGGARFVPCFDCGGSCKVV---LANGDKQRCGVCNENGLVHCPAC  362



>ref|XP_006445793.1| hypothetical protein CICLE_v10017624mg [Citrus clementina]
 gb|ESR59033.1| hypothetical protein CICLE_v10017624mg [Citrus clementina]
Length=394

 Score =   159 bits (401),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 92/160 (58%), Positives = 110/160 (69%), Gaps = 4/160 (3%)
 Frame = +1

Query  754   LEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKE  933
             L  F  KCPP G+ SV+ YTTTLRGIRKTFEDC++ R +LES  V  FERDVSMH  F+E
Sbjct  237   LLNFELKCPPGGDESVIFYTTTLRGIRKTFEDCSSVRFLLESFKVIFFERDVSMHIEFRE  296

Query  934   ELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiP--QAGAGCDGCAGV  1107
             EL  ++    V  P +F+KGR IGGA EV+ L E+GKL  L  G+P  ++   CDGCAGV
Sbjct  297   ELWKVLDCKAVP-PRLFIKGRYIGGAAEVLTLHEQGKLRPLFDGMPIDRSDGPCDGCAGV  355

Query  1108  RFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPICC  1227
             RFVLC  C GS KV+  D   + +C ECNENGLI CP CC
Sbjct  356   RFVLCFRCCGSHKVVAGDGLAS-QCQECNENGLIICPYCC  394



>ref|XP_009774426.1| PREDICTED: uncharacterized protein At5g39865-like [Nicotiana 
sylvestris]
Length=338

 Score =   157 bits (397),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 94/178 (53%), Positives = 120/178 (67%), Gaps = 16/178 (9%)
 Frame = +1

Query  739   AADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMH  918
             + D+ L+ F + CPP GE+ +VIYTTTLRG+RKTFE CN  RS +E   V   ERD+SM 
Sbjct  162   SFDSKLDGFEKLCPPNGEDKIVIYTTTLRGVRKTFEACNAVRSAIEGLGVLYSERDISMD  221

Query  919   SGFKEELRGLM----GTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQAGAG  1086
              GF++EL+ LM     T ++  P VF +GR IGG +EV+++ EEG LG LL G+P+  AG
Sbjct  222   RGFRDELKELMKGKESTELIP-PRVFFRGRYIGGVEEVMRIVEEGNLGDLLQGLPKVKAG  280

Query  1087  --CDGCAGVRFVLCLNCNGSCK---VLGEDLKN------TVKCGECNENGLIQCPICC  1227
               C+GC GVRF+ C  CNGSCK   VL ED++        VKC ECNENGL+ CPICC
Sbjct  281   FVCEGCGGVRFLPCFACNGSCKMVMVLKEDMEQKEGRTVVVKCTECNENGLVLCPICC  338


 Score = 57.4 bits (137),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 58/132 (44%), Gaps = 17/132 (13%)
 Frame = +1

Query  40   MGCVSSKLFPKDKDFPFAGD--GGCATHVVSLTSSTYGVLKLDKDSHQQQTPPQCIKECV  213
            MGCVSS L  +D +F   G    G + H+VSLTS+TYG+L LD  S    +    +    
Sbjct  1    MGCVSSTLLNQDNEFTQMGGSAAGFSHHIVSLTSTTYGLLTLDPPSSPPPSSTTTVPPTP  60

Query  214  VEVKKA-------SPARE------KPPEVINAWELMEGLDETEMPAAKKSPKARSF--LD  348
                +        SP  E         ++IN+WELM GLD T M     S +  S   L 
Sbjct  61   TPPPRHTLGSLFPSPLSEPRTLKSHTSDIINSWELMAGLDSTSMTPISDSFRFSSLPKLS  120

Query  349  HRRSPLKFLNQL  384
               S  +FL   
Sbjct  121  TPDSSFRFLKSF  132



>ref|XP_006485559.1| PREDICTED: myb-like protein X-like [Citrus sinensis]
Length=391

 Score =   158 bits (400),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 92/160 (58%), Positives = 110/160 (69%), Gaps = 4/160 (3%)
 Frame = +1

Query  754   LEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKE  933
             L  F  KCPP G+ SV+ YTTTLRGIRKTFEDC++ R +LES  V  FERDVSMH  F+E
Sbjct  234   LLNFELKCPPGGDESVIFYTTTLRGIRKTFEDCSSVRFLLESFKVIFFERDVSMHIEFRE  293

Query  934   ELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiP--QAGAGCDGCAGV  1107
             EL  ++    V  P +F+KGR IGGA EV+ L E+GKL  L  G+P  ++   CDGCAGV
Sbjct  294   ELWKVLDCKAVP-PRLFIKGRYIGGAAEVLTLHEQGKLRPLFDGMPIDRSDGPCDGCAGV  352

Query  1108  RFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPICC  1227
             RFVLC  C GS KV+  D   + +C ECNENGLI CP CC
Sbjct  353   RFVLCFRCCGSHKVVAGDGLAS-QCQECNENGLIICPYCC  391



>ref|XP_001767427.1| predicted protein [Physcomitrella patens]
 gb|EDQ67751.1| predicted protein [Physcomitrella patens]
Length=148

 Score =   151 bits (382),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 111/150 (74%), Gaps = 4/150 (3%)
 Frame = +1

Query  781   PAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKEELRGLMGTM  960
             PAGE+ +V+YTT+LRGIRKTFEDCN AR I ES +V   ERDVS+H+ F++EL+ L G M
Sbjct  1     PAGEDRIVLYTTSLRGIRKTFEDCNNARFIFESFNVEIDERDVSIHAEFRQELKDLAG-M  59

Query  961   VVKVPLVFVKGRMIGGADEVVkleeegklgillsgiP--QAGAGCDGCAGVRFVLCLNCN  1134
              V VP  F+KGR IGGA+ + +L E+G LG L+ GIP  ++   CDGC GVRFV C +C+
Sbjct  60    PVPVPQAFIKGRYIGGAETITQLHEDGTLGTLVDGIPPQKSREECDGCGGVRFVPCSDCS  119

Query  1135  GSCKVLGEDLKNTVKCGECNENGLIQCPIC  1224
             GS KV+  D    V+C ECNENGL++CPIC
Sbjct  120   GSTKVV-NDANEVVRCSECNENGLMRCPIC  148



>ref|XP_006348446.1| PREDICTED: uncharacterized protein At5g39865-like [Solanum tuberosum]
Length=202

 Score =   153 bits (386),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 85/167 (51%), Positives = 119/167 (71%), Gaps = 8/167 (5%)
 Frame = +1

Query  745   DTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSG  924
             + +L  F  KCP  G++++++YTT+LRGIRKTFEDCN  R +LES  V  +ERDVSMH  
Sbjct  36    NKLLCDFEYKCPQGGKDAIILYTTSLRGIRKTFEDCNMIRFLLESFRVVYYERDVSMHIE  95

Query  925   FKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQAGAG--CDGC  1098
             ++EEL  ++G  +V  P +F+KGR IG A+EVV L E+G L  LL  IP   +   C+GC
Sbjct  96    YREELWRILGGRIVP-PRLFIKGRDIGRANEVVGLHEQGILKKLLHDIPLISSNFPCNGC  154

Query  1099  AGVRFVLCLNCNGSCKVLGEDL-KNT----VKCGECNENGLIQCPIC  1224
              G+RFVLCL+C+G CK++ +D  K+T    ++C +CNENGLI+CP+C
Sbjct  155   CGIRFVLCLSCHGCCKIIDQDQGKDTNGYRIRCPKCNENGLIKCPVC  201



>ref|XP_007028020.1| Glutaredoxin family protein, putative [Theobroma cacao]
 gb|EOY08522.1| Glutaredoxin family protein, putative [Theobroma cacao]
Length=288

 Score =   155 bits (393),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 112/162 (69%), Gaps = 5/162 (3%)
 Frame = +1

Query  754   LEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKE  933
             L  F +KCPP GE SV+ YTT+LRGIRKTFEDC++ R +L+S  +   ERDVSM   F+E
Sbjct  128   LIDFEEKCPPGGEESVIFYTTSLRGIRKTFEDCSSIRFLLDSFKILVHERDVSMDKEFRE  187

Query  934   ELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQA--GAGCDGCAGV  1107
             EL  ++G  V+  P +F+KGR IGGADEVV L E+GKL  LL GIP       C GCA +
Sbjct  188   ELWRILGGRVIP-PKLFIKGRYIGGADEVVGLHEQGKLKKLLEGIPSGVPNCLCTGCANM  246

Query  1108  RFVLCLNCNGSCKVLGEDLKNTV--KCGECNENGLIQCPICC  1227
             RF++C NCNGS KV  E   + +  KC +CNENGLI CP+CC
Sbjct  247   RFLVCSNCNGSRKVYAEKEGDELCMKCPDCNENGLINCPVCC  288



>ref|XP_004503297.1| PREDICTED: uncharacterized protein At5g39865-like [Cicer arietinum]
Length=273

 Score =   155 bits (392),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 94/192 (49%), Positives = 124/192 (65%), Gaps = 18/192 (9%)
 Frame = +1

Query  691   MISSTPVSRKSRKSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSI  870
             +I +TP    S+  Q+    + ++F + CPP GEN VVIYTTTLRG+R TFE CN  RS 
Sbjct  85    LIDTTP----SKSFQKPGSVLSDRFQRICPPNGENKVVIYTTTLRGVRTTFEACNAVRSA  140

Query  871   LESHHVRTFERDVSMHSGFKEELRGLMG-----TMVVKVPLVFVKGRMIGGADEVVklee  1035
              +S  V+  ERDVSM SGFKEEL+ L+      + V+  P VFVKG  IGGA+E++K+ E
Sbjct  141   FDSFGVQICERDVSMDSGFKEELKELLKGKEKESTVIVPPRVFVKGFYIGGAEEMLKVVE  200

Query  1036  egklgillsgiPQ--AGAGCDGCAGVRFVLCLNCNGSCKVL-------GEDLKNTVKCGE  1188
             EG LG +L G+P+   GA C+GC  +RF+ C  CNGSCK++       G      VKC +
Sbjct  201   EGLLGEVLYGLPRKVVGAVCEGCGDMRFLPCFRCNGSCKMVIVRDHKQGTTTTLVVKCTD  260

Query  1189  CNENGLIQCPIC  1224
             CNENGL+ CP+C
Sbjct  261   CNENGLVLCPLC  272


 Score = 60.8 bits (146),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 49/88 (56%), Gaps = 25/88 (28%)
 Frame = +1

Query  40   MGCVSSKLFPKDKDFPFAGDG--GCATHVVSLTSSTYGVLK-LDKDSHQQQTPPQCIKEC  210
            MGCVSS LF  + +FP   +   G   H+VSLTS+TYG+L  LD        PP+     
Sbjct  1    MGCVSSNLFNHEDEFPQLANSALGVGHHIVSLTSTTYGLLSTLD--------PPK-----  47

Query  211  VVEVKKASPAREKPPEVINAWELMEGLD  294
                    P R +P EVIN+WELMEGLD
Sbjct  48   --------PLRSEP-EVINSWELMEGLD  66



>ref|XP_003555483.1| PREDICTED: uncharacterized protein At5g39865-like [Glycine max]
Length=380

 Score =   158 bits (399),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 86/157 (55%), Positives = 110/157 (70%), Gaps = 4/157 (3%)
 Frame = +1

Query  763   FNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKEELR  942
             F +KCPP G+ +V+ YTTTLRGIRKTFEDCN  R +L+S  V  FERD+SMH  FK+EL 
Sbjct  226   FEEKCPPGGDGTVIFYTTTLRGIRKTFEDCNKIRFLLQSFKVLYFERDISMHKEFKDELW  285

Query  943   GLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQ--AGAGCDGCAGVRFV  1116
               +    +  P +FVKGR IGGA+EV+ L E+GKL  +L G+P   +   CD C G+RFV
Sbjct  286   SSLEGKSLP-PRLFVKGRYIGGAEEVLSLHEQGKLRKILVGVPMDYSNGPCDACGGIRFV  344

Query  1117  LCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPICC  1227
             LC  CNGS KV+ E+ ++  +C +CNENGLI CP CC
Sbjct  345   LCFKCNGSHKVVEENGESN-QCLQCNENGLIVCPYCC  380



>ref|XP_004496102.1| PREDICTED: uncharacterized protein At3g28850-like [Cicer arietinum]
Length=373

 Score =   157 bits (398),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 107/156 (69%), Gaps = 4/156 (3%)
 Frame = +1

Query  763   FNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKEELR  942
             F +KCPP G+ +V+ YTT+LRGIRKTFEDCN  R +L+S  V   ERD+SMH  F++EL 
Sbjct  219   FEEKCPPGGDGTVIFYTTSLRGIRKTFEDCNKVRFLLQSFKVLYLERDISMHKEFRDELW  278

Query  943   GLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQAGAG--CDGCAGVRFV  1116
              ++G  +V  P +FVKGR IG A+EV+ L E+GKL  +  G+P   +   CDGC G+RFV
Sbjct  279   NILGEQIVP-PRLFVKGRYIGAAEEVLSLHEQGKLKKIFEGVPMDWSNGPCDGCGGIRFV  337

Query  1117  LCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPIC  1224
             +C  CNGS KV+ E+ +    C  CNENGLI CP C
Sbjct  338   MCFKCNGSHKVIAEN-EEMNPCLLCNENGLIVCPYC  372



>gb|KHN00977.1| Hypothetical protein glysoja_000645 [Glycine soja]
Length=378

 Score =   158 bits (399),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 86/157 (55%), Positives = 110/157 (70%), Gaps = 4/157 (3%)
 Frame = +1

Query  763   FNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKEELR  942
             F +KCPP G+ +V+ YTTTLRGIRKTFEDCN  R +L+S  V  FERD+SMH  FK+EL 
Sbjct  224   FEEKCPPGGDGTVIFYTTTLRGIRKTFEDCNKIRFLLQSFKVLYFERDISMHKEFKDELW  283

Query  943   GLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQ--AGAGCDGCAGVRFV  1116
               +    +  P +FVKGR IGGA+EV+ L E+GKL  +L G+P   +   CD C G+RFV
Sbjct  284   SSLEGKSLP-PRLFVKGRYIGGAEEVLSLHEQGKLRKILVGVPMDYSNGPCDACGGIRFV  342

Query  1117  LCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPICC  1227
             LC  CNGS KV+ E+ ++  +C +CNENGLI CP CC
Sbjct  343   LCFKCNGSHKVVEENGESN-QCLQCNENGLIVCPYCC  378



>gb|KDO48705.1| hypothetical protein CISIN_1g039216mg [Citrus sinensis]
Length=394

 Score =   158 bits (400),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 112/161 (70%), Gaps = 6/161 (4%)
 Frame = +1

Query  754   LEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKE  933
             L  F  KCPP G+ SV+ YTTTLRGIRKTFEDC++ R +LES  V  FERDVSMH  F+E
Sbjct  237   LLNFELKCPPGGDESVIFYTTTLRGIRKTFEDCSSVRFLLESFKVIFFERDVSMHIEFRE  296

Query  934   ELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiP--QAGAGCDGCAGV  1107
             EL  ++    V  P +F+KGR IGGA EV+ L E+GKL  L  GIP  ++   CDGCAGV
Sbjct  297   ELWKVLDCKAVP-PRLFIKGRYIGGAAEVLTLHEQGKLRPLFDGIPIDRSDGPCDGCAGV  355

Query  1108  RFVLCLNCNGSCKVL-GEDLKNTVKCGECNENGLIQCPICC  1227
             RFVLC  C GS KV+ G+ L +  +C ECNENGLI CP CC
Sbjct  356   RFVLCFRCCGSHKVVTGDGLAS--QCQECNENGLIICPYCC  394



>gb|KDO76586.1| hypothetical protein CISIN_1g0446791mg, partial [Citrus sinensis]
Length=224

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 81/161 (50%), Positives = 102/161 (63%), Gaps = 5/161 (3%)
 Frame = +1

Query  754   LEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKE  933
             L  F +KCPP G + VVIYTT+LRG+R+T+EDCN  RSI E + V T ERDVS+H  F  
Sbjct  63    LSDFPEKCPPGGSDGVVIYTTSLRGVRRTYEDCNRVRSIFEVNRVVTDERDVSLHGQFLN  122

Query  934   ELRGLMGTMVVKVPLVFVKGRMIGGADEVVk-leeegklgillsgiPQAGAG---CDGCA  1101
             EL+ L G   V VP VF+KGR +GG DE+ +  E      +L S   + G G   C+GC 
Sbjct  123   ELKDLFGGETVTVPRVFIKGRYVGGVDELTELNESGKLGRMLRSARVEMGIGRQACEGCG  182

Query  1102  GVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPIC  1224
             G RFV C +C GSCKV+     +  +CG CNENGL+ CP C
Sbjct  183   GARFVPCFDCGGSCKVV-LATGDKQRCGVCNENGLVHCPAC  222



>ref|XP_006439311.1| hypothetical protein CICLE_v10020737mg [Citrus clementina]
 gb|ESR52551.1| hypothetical protein CICLE_v10020737mg [Citrus clementina]
Length=364

 Score =   157 bits (396),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 82/161 (51%), Positives = 103/161 (64%), Gaps = 5/161 (3%)
 Frame = +1

Query  754   LEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKE  933
             L  F +KCPP G + VVIYTT+LRG+R+T+EDCN  RSI E + V T ERDVS+H  F  
Sbjct  203   LSDFPEKCPPGGSDGVVIYTTSLRGVRRTYEDCNRVRSIFEVNRVVTDERDVSLHGQFLN  262

Query  934   ELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleee-gklgillsgiPQAGAG---CDGCA  1101
             EL+ L G   V VP VF+KGR +GG DE+ +L E      +L S   + G G   C+GC 
Sbjct  263   ELKDLFGGETVTVPRVFIKGRYVGGVDELTELNESGKLGRMLRSARVEMGIGRQACEGCG  322

Query  1102  GVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPIC  1224
             G RFV C +C GSCKV+     +  +CG CNENGL+ CP C
Sbjct  323   GARFVPCFDCGGSCKVVLA-TGDKQRCGVCNENGLVHCPAC  362



>ref|XP_010543206.1| PREDICTED: uncharacterized protein LOC104816194 [Tarenaya hassleriana]
Length=473

 Score =   159 bits (402),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 86/156 (55%), Positives = 110/156 (71%), Gaps = 3/156 (2%)
 Frame = +1

Query  763   FNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKEELR  942
             F  +CPP GENSVV+YTTTLRGIR TF+DCN  R +L+S  V  +ERDVSMH  ++E+LR
Sbjct  318   FEARCPPGGENSVVLYTTTLRGIRNTFDDCNKVRFLLDSFRVSYYERDVSMHREYREDLR  377

Query  943   GLMGT-MVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQAGAG-CDGCAGVRFV  1116
              +M      ++P++FVKG  +GGA  V+ L E+GKL  L  G+P AGAG C  C GVRF+
Sbjct  378   RIMAAETATELPVLFVKGECVGGAHRVLGLHEQGKLRALFDGVPAAGAGRCRRCDGVRFL  437

Query  1117  LCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPIC  1224
             +C  C GS K++G+D K  V+C  CNENGLI CP C
Sbjct  438   MCDGCRGSRKIVGDDGKR-VECSICNENGLIVCPSC  472



>gb|EYU26416.1| hypothetical protein MIMGU_mgv1a024000mg [Erythranthe guttata]
Length=369

 Score =   157 bits (396),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 106/162 (65%), Gaps = 5/162 (3%)
 Frame = +1

Query  754   LEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKE  933
             L  F + CPP G ++VV+YTT+LRG+R+T EDC   R ++E+H V   ERDV+M  GF  
Sbjct  207   LADFEENCPPGGGDAVVVYTTSLRGVRRTHEDCQRVRQLMETHQVVFDERDVAMDGGFLT  266

Query  934   ELRGLMGT-MVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiP-QAGA---GCDGC  1098
             ELR L+G      VP VFVKGR +GG +EVV L E G+L  +L+    + GA   GC GC
Sbjct  267   ELRELLGEGAAAAVPRVFVKGRYVGGVEEVVGLNETGRLSRILNWAKVERGAGRVGCAGC  326

Query  1099  AGVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPIC  1224
              G RFV CL C GSCKV+ E  K   +CG CNENGL+ CPIC
Sbjct  327   GGARFVPCLECGGSCKVVVEGKKERERCGVCNENGLVHCPIC  368



>ref|XP_006343831.1| PREDICTED: glutaredoxin domain-containing cysteine-rich protein 
1-like isoform X1 [Solanum tuberosum]
Length=391

 Score =   157 bits (397),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 112/162 (69%), Gaps = 7/162 (4%)
 Frame = +1

Query  754   LEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKE  933
             L  + +KCPP G++S+V+YTT+L G+R+TFEDCN  R ILESH V   ERDV++H  F++
Sbjct  231   LSDYPEKCPPRGDDSLVVYTTSLGGVRRTFEDCNKVRLILESHRVVFDERDVALHGEFRQ  290

Query  934   ELRGLMGT-MVVKVPLVFVKGRMIGGADEVVkleeegklgills-giPQAGA---GCDGC  1098
             EL+ L+G      VP +FVKGR IGG +EVV L E  +LG +L+    + G    GC+GC
Sbjct  291   ELKELLGDGEDTGVPRLFVKGRYIGGVEEVVHLNETKRLGRILNWARVERGVGRLGCEGC  350

Query  1099  AGVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPIC  1224
              G RFV C +C GSCKV+  D+K   +C ECNENGLI CPIC
Sbjct  351   GGARFVPCFDCGGSCKVVNGDIKE--RCPECNENGLIHCPIC  390



>ref|XP_002303660.1| glutaredoxin family protein [Populus trichocarpa]
 gb|EEE78639.1| glutaredoxin family protein [Populus trichocarpa]
Length=364

 Score =   156 bits (395),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 83/161 (52%), Positives = 104/161 (65%), Gaps = 7/161 (4%)
 Frame = +1

Query  754   LEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKE  933
             L  F +KCPP G +SVV+YTT+LRGIR+TF+DC   +++ E HHV   ERDVS+H  F  
Sbjct  206   LSGFEEKCPPGGADSVVLYTTSLRGIRRTFDDCTRVKTLFELHHVVFDERDVSLHGEFLN  265

Query  934   ELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleee----gklgillsgiPQAGAGCDGCA  1101
             ELR L+G     VP VF+KGR IGG DEVV+L E       L     G  +    C+GC 
Sbjct  266   ELRDLVGEG-TSVPRVFIKGRYIGGVDEVVELNESGQLGRMLVWARVGRVEGRQACEGCG  324

Query  1102  GVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPIC  1224
               RFV CL C+GSCKVL +  K   +CG+CNENGL++CP C
Sbjct  325   DARFVPCLECSGSCKVLIDGAKE--RCGKCNENGLVRCPTC  363



>ref|XP_002272456.1| PREDICTED: uncharacterized protein At5g39865 [Vitis vinifera]
Length=320

 Score =   155 bits (392),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 93/173 (54%), Positives = 119/173 (69%), Gaps = 14/173 (8%)
 Frame = +1

Query  748   TILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGF  927
              +L+ F + CPP GEN VV+YTTTLRG+RKTFEDCN  R+ +E   V   ERD+SM  GF
Sbjct  147   ALLDGFERLCPPNGENRVVVYTTTLRGVRKTFEDCNAVRAAIEGLGVSLCERDISMDRGF  206

Query  928   KEELRGLM---GTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQAGAG--CD  1092
             KEELR LM    +  +  P VFVKGR +GGA+EV+K+ EEG LG LL G+P+  AG  C+
Sbjct  207   KEELRELMKGKDSCQMVPPRVFVKGRYVGGAEEVLKIVEEGCLGELLQGLPKIRAGEVCE  266

Query  1093  GCAGVRFVLCLNCNGSCK---VLGEDLKN------TVKCGECNENGLIQCPIC  1224
             GC GVRF+ C  CNGSCK   ++ E+++        V+C +CNENGL+ CPIC
Sbjct  267   GCGGVRFLPCFQCNGSCKMVMMVKEEMEQKQGRSVVVRCPDCNENGLVLCPIC  319


 Score = 57.8 bits (138),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 52/111 (47%), Gaps = 11/111 (10%)
 Frame = +1

Query  40   MGCVSSKLFPKDKDFPFAGDGGCATHVVSLTSSTYGVLKLDKDSHQQQTPPQCIKECVVE  219
            MGCVSS L   +++           H+VSLTS+TYG+L LD        P    +  +  
Sbjct  1    MGCVSSTLLNHEEELGQLSGSTLGHHIVSLTSTTYGLLNLDPPPQPTHPPTLTPRFTLGS  60

Query  220  VKKASPARE-----KPPEVINAWELMEGLDETE-----MPAAKKSPKARSF  342
            V   SP  E       PEVIN+WELM GLD        +P A   PKA + 
Sbjct  61   V-FPSPLSEPRGIRSEPEVINSWELMAGLDADSFRFPPLPLAPSKPKALAI  110



>ref|XP_006588876.1| PREDICTED: uncharacterized protein At5g39865-like [Glycine max]
Length=276

 Score =   154 bits (389),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 88/185 (48%), Positives = 117/185 (63%), Gaps = 7/185 (4%)
 Frame = +1

Query  691   MISSTPVSRKSRKSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSI  870
             ++ S+P     ++ Q      L  F +  PP G  +V++YTT+LRGIRKTF+DCNT R +
Sbjct  92    LVVSSPSKSMHQQIQVKEYPSLTDFEEIHPPGGSQAVILYTTSLRGIRKTFQDCNTVRFL  151

Query  871   LESHHVRTFERDVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklg  1050
             + S  +   ERDVS+H  ++EEL  ++G  V+  P +F+KGR IGGADEVV L E G LG
Sbjct  152   MRSFKITYHERDVSLHLEYREELWKILGCKVIP-PRLFIKGRYIGGADEVVGLHEMGWLG  210

Query  1051  illsgiPQ--AGAGCDGCAGVRFVLCLNCNGSCKVLGEDLKNT----VKCGECNENGLIQ  1212
              LL G P   A   C GCA +RF +C NCNGSCKV   +  N     ++C ECNENGL++
Sbjct  211   KLLEGTPMDFADGPCKGCACMRFSICSNCNGSCKVFTTNGDNKNECFIRCPECNENGLVK  270

Query  1213  CPICC  1227
             C ICC
Sbjct  271   CTICC  275



>ref|XP_011046441.1| PREDICTED: uncharacterized protein At5g39865 [Populus euphratica]
Length=290

 Score =   154 bits (390),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 112/161 (70%), Gaps = 5/161 (3%)
 Frame = +1

Query  754   LEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKE  933
             L  F +KC P G  SV++YTT+LR IRKTFEDC+  R +LES  V   ERDVS+H  F+E
Sbjct  130   LSDFEEKCLPGGSQSVILYTTSLRSIRKTFEDCHAIRFLLESLKVMFCERDVSLHLEFRE  189

Query  934   ELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiP--QAGAGCDGCAGV  1107
             EL  ++G  V+  P +F+KGR IGGADEV+ L E+G+L  LL+GIP   + + C GC   
Sbjct  190   ELWRILGGRVIP-PRLFIKGRYIGGADEVIGLHEQGRLKKLLAGIPLNLSNSPCIGCGNK  248

Query  1108  RFVLCLNCNGSCKVLGEDLKNT--VKCGECNENGLIQCPIC  1224
             RFV+C NCNGSCKV  +D  N   ++C ECNENGL +CPIC
Sbjct  249   RFVVCSNCNGSCKVFEDDQNNEKCIRCPECNENGLAKCPIC  289



>ref|XP_006343832.1| PREDICTED: glutaredoxin domain-containing cysteine-rich protein 
1-like isoform X2 [Solanum tuberosum]
Length=389

 Score =   157 bits (396),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 112/162 (69%), Gaps = 7/162 (4%)
 Frame = +1

Query  754   LEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKE  933
             L  + +KCPP G++S+V+YTT+L G+R+TFEDCN  R ILESH V   ERDV++H  F++
Sbjct  229   LSDYPEKCPPRGDDSLVVYTTSLGGVRRTFEDCNKVRLILESHRVVFDERDVALHGEFRQ  288

Query  934   ELRGLMGT-MVVKVPLVFVKGRMIGGADEVVkleeegklgills-giPQAGA---GCDGC  1098
             EL+ L+G      VP +FVKGR IGG +EVV L E  +LG +L+    + G    GC+GC
Sbjct  289   ELKELLGDGEDTGVPRLFVKGRYIGGVEEVVHLNETKRLGRILNWARVERGVGRLGCEGC  348

Query  1099  AGVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPIC  1224
              G RFV C +C GSCKV+  D+K   +C ECNENGLI CPIC
Sbjct  349   GGARFVPCFDCGGSCKVVNGDIKE--RCPECNENGLIHCPIC  388



>ref|XP_010925953.1| PREDICTED: histone-lysine N-methyltransferase 2D-like [Elaeis 
guineensis]
Length=366

 Score =   156 bits (394),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 83/168 (49%), Positives = 107/168 (64%), Gaps = 12/168 (7%)
 Frame = +1

Query  754   LEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTF----ERDVSMHS  921
             LE + ++CPP   + VV+YTTTLRG+R+TFEDC  AR  +E+H V       ERDVS+H 
Sbjct  199   LEGYPERCPPGNGDGVVLYTTTLRGVRRTFEDCERARRAVEAHAVEAGVEVEERDVSLHG  258

Query  922   GFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegk-------lgillsgiPQAG  1080
              + +E+R L+G     VP +F++GR  GG +EVV+L E GK       +           
Sbjct  259   EYLKEVRELVGEGAA-VPRLFIRGRYAGGVEEVVELGETGKLREMLRWVAARGGKGKGGW  317

Query  1081  AGCDGCAGVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPIC  1224
               C+GC G RFV CL CNGSCKV+GED K  V+CGECNENGL+ CPIC
Sbjct  318   RECEGCGGARFVPCLECNGSCKVVGEDGKVAVRCGECNENGLVLCPIC  365



>ref|XP_004136718.1| PREDICTED: uncharacterized protein At5g39865-like [Cucumis sativus]
 gb|KGN59229.1| hypothetical protein Csa_3G782760 [Cucumis sativus]
Length=296

 Score =   154 bits (389),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 90/166 (54%), Positives = 114/166 (69%), Gaps = 9/166 (5%)
 Frame = +1

Query  754   LEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKE  933
             L  F  +CPP G  SV+ Y+T+LR IRKTFE+CN+ R +LES  V  +ERDVSMH  F++
Sbjct  132   LLDFEDRCPPGGSESVIFYSTSLRSIRKTFEECNSIRFLLESFKVLFYERDVSMHLEFRK  191

Query  934   ELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiP--QAGAGCDGCAGV  1107
             EL  ++G  V+  P +F+KGR IGGADEV+ L E+GKL  LL GIP   A + C  CA  
Sbjct  192   ELWEVLGGRVIP-PRLFIKGRYIGGADEVIGLHEQGKLRKLLEGIPLDLANSPCSCCANT  250

Query  1108  RFVLCLNCNGSCKVL-----GEDLKNTV-KCGECNENGLIQCPICC  1227
             RF++C NCNGSCKVL     G+D  N   +C +CNENGL +CPICC
Sbjct  251   RFLVCPNCNGSCKVLRDAYDGDDDNNLYNRCTDCNENGLAKCPICC  296



>gb|KHN22596.1| Hypothetical protein glysoja_037746 [Glycine soja]
Length=264

 Score =   153 bits (386),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 84/162 (52%), Positives = 111/162 (69%), Gaps = 5/162 (3%)
 Frame = +1

Query  754   LEQFNQKCPPAGEN-SVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFK  930
             L  F + CPP G N S+++YTT+LRGIRKTF++CNT R +L S  +   ERDVS+H  F+
Sbjct  104   LSDFKELCPPGGSNHSIILYTTSLRGIRKTFQECNTIRFLLRSFKIMYHERDVSLHLEFR  163

Query  931   EELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQAGAG--CDGCAG  1104
             EEL  ++G  V+  P +F+KGR IGGADEVV L E G LG  L G P   +   C GCA 
Sbjct  164   EELWKILGGKVIP-PKLFIKGRYIGGADEVVGLHEMGWLGKFLEGTPTHSSDSPCSGCAN  222

Query  1105  VRFVLCLNCNGSCKVLGEDLKN-TVKCGECNENGLIQCPICC  1227
             +RF +C NC GSCKV  ++  +  V+C +CNENGL++CP+CC
Sbjct  223   MRFAICSNCCGSCKVFTDNNDDCFVRCSQCNENGLVKCPVCC  264



>ref|XP_010031326.1| PREDICTED: uncharacterized protein At5g39865-like [Eucalyptus 
grandis]
 gb|KCW50589.1| hypothetical protein EUGRSUZ_J00303 [Eucalyptus grandis]
Length=393

 Score =   156 bits (395),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 85/160 (53%), Positives = 110/160 (69%), Gaps = 3/160 (2%)
 Frame = +1

Query  754   LEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKE  933
             L  F +KCPP G  +V+ YTT+LRGIRKTFEDC   R +L S  +   ERDVSMH+ FKE
Sbjct  235   LLAFEEKCPPGGCGAVIFYTTSLRGIRKTFEDCGKIRFLLNSFRILYCERDVSMHTEFKE  294

Query  934   ELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiP--QAGAGCDGCAGV  1107
             EL  ++G   V  P VF+KGR IGGA++V+ L E+GKL  +L G+P   +   C+GC G+
Sbjct  295   ELWDVLGGKAVP-PRVFIKGRYIGGAEQVLGLHEQGKLKKILEGVPIDSSTGPCEGCGGM  353

Query  1108  RFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPICC  1227
             +FV+C  CNGS K++GED      C +CNENGLI CP+CC
Sbjct  354   KFVVCFKCNGSHKLIGEDSPVATICSDCNENGLIICPLCC  393



>ref|XP_004245502.1| PREDICTED: glutaredoxin domain-containing cysteine-rich protein 
1 [Solanum lycopersicum]
Length=393

 Score =   156 bits (395),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 84/162 (52%), Positives = 106/162 (65%), Gaps = 7/162 (4%)
 Frame = +1

Query  754   LEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKE  933
             L  + +KCPP G++S+VIYTT+L G+R+TFEDCN  R ILESH V   ERDV++H  F++
Sbjct  233   LSDYPEKCPPRGDDSLVIYTTSLGGVRRTFEDCNKLRLILESHRVVFDERDVALHGEFRQ  292

Query  934   ELRGLMGT-MVVKVPLVFVKGRMIGGADEVVkleeegk----lgillsgiPQAGAGCDGC  1098
             EL+ L+G      VP +FVKGR IGG +EVV L E  K    L            GC+GC
Sbjct  293   ELKELLGDGEDAGVPRLFVKGRYIGGVEEVVHLNETKKLGRILNWARVERGLGRLGCEGC  352

Query  1099  AGVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPIC  1224
              G RFV C +C GSCKV+  D+K   +C +CNENGLI CPIC
Sbjct  353   GGARFVPCFDCGGSCKVVNGDVKE--RCPKCNENGLIHCPIC  392



>ref|XP_007144213.1| hypothetical protein PHAVU_007G137300g [Phaseolus vulgaris]
 gb|ESW16207.1| hypothetical protein PHAVU_007G137300g [Phaseolus vulgaris]
Length=383

 Score =   156 bits (394),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 87/158 (55%), Positives = 109/158 (69%), Gaps = 6/158 (4%)
 Frame = +1

Query  763   FNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKEELR  942
             F + CPP G+ +V+ YTTTLRGIRKTFEDCN  R +L+S  V  FERD+SMH  F++EL 
Sbjct  229   FEENCPPGGDGNVIFYTTTLRGIRKTFEDCNKIRFLLQSFKVLYFERDISMHKEFRDELW  288

Query  943   -GLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQ--AGAGCDGCAGVRF  1113
               L G +V   P +FVKGR IGGA+EV+ L E+GKL  +L G+P   +   CD C G+RF
Sbjct  289   CSLDGKLV--PPRLFVKGRYIGGAEEVLNLHEQGKLRKILEGVPMDYSSGPCDACGGIRF  346

Query  1114  VLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPICC  1227
             VLC  CNGS KV+ E+     +C +CNENGLI CP CC
Sbjct  347   VLCFKCNGSHKVMEEN-GECNQCSQCNENGLIVCPYCC  383



>ref|XP_010053060.1| PREDICTED: uncharacterized protein At3g28850-like [Eucalyptus 
grandis]
 gb|KCW77308.1| hypothetical protein EUGRSUZ_D01672 [Eucalyptus grandis]
Length=367

 Score =   155 bits (392),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 94/176 (53%), Positives = 118/176 (67%), Gaps = 19/176 (11%)
 Frame = +1

Query  754   LEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKE  933
             L++F+  CPP GE+ VVIYTTTLRG+RKTFEDC+  R+ +E   V   ERDVSM SGFKE
Sbjct  191   LDRFDYLCPPRGEDRVVIYTTTLRGVRKTFEDCSAVRAAVEGLGVAVCERDVSMDSGFKE  250

Query  934   ELRGLMGTMV---VKVPLVFVKGRMIGGADEVVkleeegklgillsgiP--QAGAGCDGC  1098
             ELR LM       V  P VFV+GR +GGA+EV+++ EEG LG LL G+P  +AG  C+GC
Sbjct  251   ELRELMKGRAREEVVPPRVFVRGRYLGGAEEVMRIAEEGGLGELLKGLPKRKAGVLCEGC  310

Query  1099  AGVRFVLCLNCNGSCKVL---------GEDLKN-----TVKCGECNENGLIQCPIC  1224
              GVRF+ C  CNGSCKV+         GE  +       ++C +CNENGL+ CPIC
Sbjct  311   GGVRFLPCFQCNGSCKVVVNLVMVKEEGEGGQKPERVVVIRCSDCNENGLVLCPIC  366



>ref|XP_002266905.1| PREDICTED: uncharacterized protein LOC100247840 [Vitis vinifera]
Length=371

 Score =   155 bits (392),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 108/161 (67%), Gaps = 7/161 (4%)
 Frame = +1

Query  754   LEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKE  933
             L ++ +KCPP G +S+V+YTT+L G+R+T+EDCN  RS+LESH V   ERDVS+H  F +
Sbjct  213   LSEYPEKCPPGGADSLVLYTTSLGGVRRTYEDCNRLRSVLESHRVVFDERDVSLHGEFLK  272

Query  934   ELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgi----llsgiPQAGAGCDGCA  1101
             ELR L+G     VP +FVKGR +GG +EVV+L E G+LG               GC+GC 
Sbjct  273   ELRELLGEE-SSVPRLFVKGRYVGGVEEVVELNEWGRLGKLLNCAKVERGVGRQGCEGCG  331

Query  1102  GVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPIC  1224
             G RFV CL C GSCKV+  + K   +C ECNENGL+QCP C
Sbjct  332   GARFVPCLECGGSCKVMVGETKE--RCSECNENGLVQCPAC  370



>ref|XP_011022479.1| PREDICTED: glutaredoxin domain-containing cysteine-rich protein 
CG12206-like [Populus euphratica]
Length=364

 Score =   155 bits (392),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 83/161 (52%), Positives = 106/161 (66%), Gaps = 7/161 (4%)
 Frame = +1

Query  754   LEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKE  933
             L  F +KCPP G +SVV+YTT+LRGIR+TF+DC   +++ E HHV   ERDVS+H  F  
Sbjct  206   LSGFEEKCPPGGAHSVVLYTTSLRGIRRTFDDCTRVKTLFELHHVVFDERDVSLHGEFLN  265

Query  934   ELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegk----lgillsgiPQAGAGCDGCA  1101
             ELR L+G     VP VF+KGR IGG DE V+L E G+    L     G  +    C+GC 
Sbjct  266   ELRDLVGEG-ASVPRVFIKGRYIGGVDEAVELNESGQLGRILVWARVGRVEGRQACEGCG  324

Query  1102  GVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPIC  1224
               RFV CL C+GSCKVL +  K+  +CG+CNENGL++CP C
Sbjct  325   DARFVPCLECSGSCKVLIDGAKD--RCGKCNENGLVRCPTC  363



>ref|XP_007160510.1| hypothetical protein PHAVU_002G327900g [Phaseolus vulgaris]
 gb|ESW32504.1| hypothetical protein PHAVU_002G327900g [Phaseolus vulgaris]
Length=286

 Score =   153 bits (386),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 112/162 (69%), Gaps = 7/162 (4%)
 Frame = +1

Query  760   QFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKEEL  939
             +F++ CPP GEN VVIYTTTLRG+RKTFE CN  R+  E+  V   ERDVSM SGF+EEL
Sbjct  124   RFDRICPPRGENRVVIYTTTLRGVRKTFEACNAVRAAFEALGVAVCERDVSMDSGFREEL  183

Query  940   RGLMGTM---VVKVPLVFVKGRMIGGADEVVkleeegklgillsgiP--QAGAGCDGCAG  1104
             RGL+       V  P VFVKG  IGGA+E++++ E+G LG LL G+P  + GA C+GC  
Sbjct  184   RGLLKGKQREAVVPPRVFVKGLYIGGAEEMLRVAEDGVLGELLKGLPKKKVGAVCEGCGD  243

Query  1105  VRFVLCLNCNGSCK--VLGEDLKNTVKCGECNENGLIQCPIC  1224
             +RF+ C NCNGSCK  V  E     VKC  CNENGL+ CP+C
Sbjct  244   MRFLPCFNCNGSCKSVVKEEGRVFVVKCLHCNENGLVLCPLC  285


 Score = 60.5 bits (145),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 38/107 (36%), Positives = 52/107 (49%), Gaps = 13/107 (12%)
 Frame = +1

Query  40   MGCVSSKLFPKDKDFPFAGDGGCATHVVSLTSSTYGVLKLDKDSHQQQTPPQCIKECVVE  219
            MGCVSS L  +D +F   G      H+VSLTS+TYG+L LD       T P   +  +  
Sbjct  1    MGCVSSNLLNQDDEFTQLGSSALGHHIVSLTSTTYGLLTLDPPHTTTPTTPPS-RFTLAS  59

Query  220  VKKASPARE------------KPPEVINAWELMEGLDETEMPAAKKS  324
            +  + P  E              PE+IN+WELM GLD      +K++
Sbjct  60   LFPSDPNSEPKSLWSEPRPFRSEPEIINSWELMSGLDAESFRFSKEN  106



>emb|CAN76670.1| hypothetical protein VITISV_042863 [Vitis vinifera]
Length=236

 Score =   151 bits (382),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 91/173 (53%), Positives = 117/173 (68%), Gaps = 14/173 (8%)
 Frame = +1

Query  748   TILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGF  927
              +L+ F + CPP GEN VV+YTTTLRG+RKTFEDCN  R+ +E   V   ERD+SM  GF
Sbjct  63    ALLDGFERLCPPNGENRVVVYTTTLRGVRKTFEDCNAVRAAIEGLGVSLCERDISMDRGF  122

Query  928   KEELRGLM---GTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQAGAG--CD  1092
             KEELR LM    +  +  P VFVKGR +GGA+EV+ + EEG LG LL G+P+  AG  C+
Sbjct  123   KEELRELMKGKDSCQMVPPRVFVKGRYVGGAEEVLXIVEEGCLGELLQGLPKIRAGEVCE  182

Query  1093  GCAGVRFVLCLNCNGSCK---VLGEDLKN------TVKCGECNENGLIQCPIC  1224
             GC GVR + C  CNGSCK   ++ E+++        V+C +CNENGL+ CPIC
Sbjct  183   GCGGVRXLPCFQCNGSCKMVMMVKEEMEQKQGRSVVVRCPDCNENGLVLCPIC  235



>ref|XP_003520720.1| PREDICTED: uncharacterized protein At5g39865-like [Glycine max]
Length=264

 Score =   152 bits (384),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 84/162 (52%), Positives = 110/162 (68%), Gaps = 5/162 (3%)
 Frame = +1

Query  754   LEQFNQKCPPAGEN-SVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFK  930
             L  F + CPP G N S+++YTT+LRGIRKTF++CNT R +L S  +   ERDVS+H  F+
Sbjct  104   LSDFKELCPPGGSNHSIILYTTSLRGIRKTFQECNTIRFLLRSFKIMYHERDVSLHLEFR  163

Query  931   EELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQAGAG--CDGCAG  1104
             EEL  ++G  V+  P +F+KGR IGGADEVV L E G LG  L G P   +   C GCA 
Sbjct  164   EELWKILGGKVIP-PKLFIKGRYIGGADEVVGLHEMGWLGKFLEGTPTHSSDSPCSGCAN  222

Query  1105  VRFVLCLNCNGSCKVLGEDLKN-TVKCGECNENGLIQCPICC  1227
             +RF +C NC GSCKV  ++     V+C +CNENGL++CP+CC
Sbjct  223   MRFAICSNCCGSCKVFTDNNDECFVRCSQCNENGLVKCPVCC  264



>ref|XP_002968012.1| hypothetical protein SELMODRAFT_68277, partial [Selaginella moellendorffii]
 gb|EFJ31359.1| hypothetical protein SELMODRAFT_68277, partial [Selaginella moellendorffii]
Length=166

 Score =   149 bits (376),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 75/160 (47%), Positives = 101/160 (63%), Gaps = 5/160 (3%)
 Frame = +1

Query  754   LEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKE  933
             L  F   CPPAGE+  V+Y T+LRG+R+T E+C+T   I+ S+ V   ERD+SMH  F++
Sbjct  9     LRDFQLLCPPAGESKAVVYYTSLRGVRRTHEECSTVLEIVRSYGVSVGERDLSMHQAFRQ  68

Query  934   ELRGLMGTMVVKVPLVFVKGRMIGGADEV--VkleeegklgillsgiPQAGAGCDGCAGV  1107
             EL+ L  +    VP +FV+GR+IGG +EV     +      +           CDGC G 
Sbjct  69    ELKEL--SQSCAVPRLFVRGRLIGGLEEVSRAHEKGLLARLLQGIRREDHSKACDGCGGA  126

Query  1108  RFVLCLNCNGSCKVLGEDLKNT-VKCGECNENGLIQCPIC  1224
             RF+LCL+CNGSCK+L ED     ++C ECNENGLI+CPIC
Sbjct  127   RFMLCLDCNGSCKILAEDGSGEKIQCLECNENGLIRCPIC  166



>ref|XP_002977690.1| hypothetical protein SELMODRAFT_107780 [Selaginella moellendorffii]
 ref|XP_002979585.1| hypothetical protein SELMODRAFT_110851 [Selaginella moellendorffii]
 gb|EFJ19474.1| hypothetical protein SELMODRAFT_110851 [Selaginella moellendorffii]
 gb|EFJ21028.1| hypothetical protein SELMODRAFT_107780 [Selaginella moellendorffii]
Length=184

 Score =   150 bits (378),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 81/179 (45%), Positives = 115/179 (64%), Gaps = 10/179 (6%)
 Frame = +1

Query  721   SRKSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFE  900
             S + ++ A   LE+F  +CPP GEN+VV+Y T+LRGIRKT+E+C+  + IL S  V   E
Sbjct  6     SEEDEDDAKDPLERFELRCPPGGENNVVLYCTSLRGIRKTYEECHGVQMILHSLGVYIDE  65

Query  901   RDVSMHSGFKEELRGLMGTM----VVKVPLVFVKGRMIGGADEV--Vkleeegklgills  1062
             RDVSMHS F+ EL+ L+  +       VP +F++GR IGGA+EV  +  E +    +   
Sbjct  66    RDVSMHSDFRLELKELLDNIEPAAACCVPRLFIRGRYIGGAEEVRRLHEEGKLVKMLEGI  125

Query  1063  giPQAGAGCDGCAGVRFVLCLNCNGSCKVLGEDLKNTV----KCGECNENGLIQCPICC  1227
                   + CDGC G+RF+ CL C+GSCK++  DL + +    +C +CNENGLI+CPICC
Sbjct  126   RKEDPFSVCDGCGGLRFIPCLECSGSCKLVVRDLPSGMSQVSRCPDCNENGLIRCPICC  184



>ref|XP_002992409.1| hypothetical protein SELMODRAFT_48223, partial [Selaginella moellendorffii]
 gb|EFJ06559.1| hypothetical protein SELMODRAFT_48223, partial [Selaginella moellendorffii]
Length=166

 Score =   149 bits (376),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 75/160 (47%), Positives = 101/160 (63%), Gaps = 5/160 (3%)
 Frame = +1

Query  754   LEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKE  933
             L  F   CPPAGE+  V+Y T+LRG+R+T E+C+T   I+ S+ V   ERD+SMH  F++
Sbjct  9     LRDFQLLCPPAGESKAVVYYTSLRGVRRTHEECSTVLEIVRSYGVSVDERDLSMHQAFRQ  68

Query  934   ELRGLMGTMVVKVPLVFVKGRMIGGADEV--VkleeegklgillsgiPQAGAGCDGCAGV  1107
             EL+ L  +    VP +FV+GR+IGG +EV     +      +           CDGC G 
Sbjct  69    ELKEL--SQSCAVPRLFVRGRLIGGLEEVSKAHEKGLLARLLQGIRREDHSKACDGCGGA  126

Query  1108  RFVLCLNCNGSCKVLGEDLKNT-VKCGECNENGLIQCPIC  1224
             RF+LCL+CNGSCK+L ED     ++C ECNENGLI+CPIC
Sbjct  127   RFMLCLDCNGSCKILAEDGSGEKIQCLECNENGLIRCPIC  166



>gb|EYU38714.1| hypothetical protein MIMGU_mgv1a026914mg [Erythranthe guttata]
Length=262

 Score =   152 bits (384),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 88/157 (56%), Positives = 110/157 (70%), Gaps = 6/157 (4%)
 Frame = +1

Query  769   QKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKEELRGL  948
              +CPP G + +V+YTT+LRGIRKTFEDCNT R +LES  V   ERDVSMH  ++EEL G+
Sbjct  106   DRCPPGGRDGLVLYTTSLRGIRKTFEDCNTIRFLLESFRVVYSERDVSMHLEYREELWGV  165

Query  949   MGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQAGAG---CDGCAGVRFVL  1119
             +G  VV  P +FV+GR IGGADEVV L E+G L  LL GIP   +    C GCAG+RF++
Sbjct  166   LGGRVVP-PRLFVRGRCIGGADEVVGLHEKGMLKNLLQGIPLVSSCNNPCRGCAGIRFLM  224

Query  1120  CLNCNGSCKVLGEDLKN--TVKCGECNENGLIQCPIC  1224
             C  CNGS KV  E+      +KC +CNENGLI+C +C
Sbjct  225   CCTCNGSRKVTNEEGNEGVVIKCPDCNENGLIKCSVC  261



>ref|XP_009348807.1| PREDICTED: uncharacterized protein At5g39865-like [Pyrus x bretschneideri]
Length=279

 Score =   152 bits (385),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 114/164 (70%), Gaps = 7/164 (4%)
 Frame = +1

Query  754   LEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKE  933
             L  F +KCPP G +SV++Y+T++ G+RKTFEDC   R +LES  V  +ERDVSMH  F+E
Sbjct  117   LLDFEEKCPPGGGDSVILYSTSMTGVRKTFEDCKAIRFLLESFKVSVYERDVSMHMEFRE  176

Query  934   ELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiP--QAGAGCDGCAGV  1107
             EL  L G  V+  P +F+KGR IGGA+EV++L E+G+L  LL GIP   + + C GCA V
Sbjct  177   ELWTLFGGKVIP-PRLFIKGRYIGGAEEVIRLHEQGRLKKLLEGIPINLSSSPCTGCANV  235

Query  1108  RFVLCLNCNGSCKVL----GEDLKNTVKCGECNENGLIQCPICC  1227
             RF++C+NCNGS KV      E  +  V+C ECNENGL +C ICC
Sbjct  236   RFIVCVNCNGSRKVFTDGDHEHDELCVRCPECNENGLTKCSICC  279



>ref|XP_010455457.1| PREDICTED: uncharacterized protein At5g39865-like [Camelina sativa]
Length=342

 Score =   154 bits (389),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 94/171 (55%), Positives = 111/171 (65%), Gaps = 15/171 (9%)
 Frame = +1

Query  757   EQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKEE  936
             E+F + CPP GEN VVIYTT+LRG+R+TFE CN  RS +ES  V   ERDVSM  GFKEE
Sbjct  171   ERFERICPPGGENRVVIYTTSLRGVRQTFEACNAVRSAVESLGVVVCERDVSMDRGFKEE  230

Query  937   LRGLM-------GTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQAGAG---  1086
             L  LM       G      P VFVKGR IGGA+EV++L EEG  G L+SGIP+  AG   
Sbjct  231   LVSLMAKRVGNDGAATALPPRVFVKGRYIGGAEEVLRLVEEGSFGELISGIPKKKAGGCE  290

Query  1087  ---CDGCAGVRFVLCLNCNGSCKVL--GEDLKNTVKCGECNENGLIQCPIC  1224
                CDGC G+ F+ C  CNGSCK++         V+C ECNENGL+ CPIC
Sbjct  291   SGACDGCGGLFFLPCFRCNGSCKMVKGWGSAAVVVRCNECNENGLVPCPIC  341


 Score = 55.5 bits (132),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 52/145 (36%), Positives = 63/145 (43%), Gaps = 34/145 (23%)
 Frame = +1

Query  40   MGCVSSKLFPKDKDFP--FAGDGGCATHVVSLTSSTYGVLKLDKDSHQQ-----------  180
            MGCVSS L   D+DFP    G  G   H+V LTS+TYG+L LD                 
Sbjct  1    MGCVSSNLLNHDEDFPQIGGGSSGFGHHIVKLTSTTYGLLTLDPPPSSPPPSSAAFSSDM  60

Query  181  -QTPPQCIKECVVEVKKASPAREKP------PEVINAWELMEGLDETEM---PAAKKSPK  330
              TPP+  K   +  K  S    +P      PEVIN+W LM GLD       P  K   K
Sbjct  61   PMTPPEKFK---IGTKSKSSLWSEPRVIKSEPEVINSWALMSGLDGESFRFTPLPKTPVK  117

Query  331  ARSFLD--------HRRSPLKFLNQ  381
             + F          +RR+P K LN 
Sbjct  118  YKVFGGENKENSEPNRRNPRKNLND  142



>ref|XP_002518846.1| electron transporter, putative [Ricinus communis]
 gb|EEF43379.1| electron transporter, putative [Ricinus communis]
Length=376

 Score =   154 bits (390),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 89/162 (55%), Positives = 110/162 (68%), Gaps = 8/162 (5%)
 Frame = +1

Query  754   LEQFNQKCPP-AGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFK  930
             L ++ +K PP  G  SVVIYTT+LRG+RKTFEDCN  RS+LE H V   ERDVS+H  F 
Sbjct  217   LSEYPEKIPPNGGAESVVIYTTSLRGVRKTFEDCNRVRSLLEGHRVVFDERDVSLHGDFL  276

Query  931   EELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgills-giPQAGAG---CDGC  1098
              ELR L+G     VP VFVKGR  GG D V++L E G+LG ++S    + G G   C+GC
Sbjct  277   NELRELLGEE-ASVPRVFVKGRYFGGVDNVIELNETGRLGRIMSWARVERGVGRQACEGC  335

Query  1099  AGVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPIC  1224
              G RFV C++C GSCKVL + +K   +CGECNENGL+ CP C
Sbjct  336   GGARFVPCVDCGGSCKVLVDGVKE--RCGECNENGLMLCPAC  375



>ref|XP_009341571.1| PREDICTED: uncharacterized protein At3g28850 [Pyrus x bretschneideri]
Length=381

 Score =   154 bits (390),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 87/161 (54%), Positives = 114/161 (71%), Gaps = 5/161 (3%)
 Frame = +1

Query  754   LEQFNQKCPPAG-ENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFK  930
             L  F +KCPP   ++SVV+YTTTLRGIRKTF+DCN+ R +LES  V  +ERDVSMH  F+
Sbjct  223   LLAFEEKCPPGSLDSSVVLYTTTLRGIRKTFDDCNSVRFLLESFRVVFYERDVSMHMEFR  282

Query  931   EELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiP--QAGAGCDGCAG  1104
             +EL  ++    V  P +F+KGR IGGA+EV+ L E+GKL  L  G+P  ++   C+ C G
Sbjct  283   QELWKILDCKAVP-PKLFIKGRYIGGAEEVLTLHEQGKLKPLFEGVPLDRSIGPCEACDG  341

Query  1105  VRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPICC  1227
             VRFV+C  C+GSCK++  D   + KC ECNENGLI CP+CC
Sbjct  342   VRFVVCFRCSGSCKLIA-DEGQSDKCPECNENGLIICPLCC  381



>ref|XP_004308564.1| PREDICTED: uncharacterized protein At5g39865-like [Fragaria vesca 
subsp. vesca]
Length=302

 Score =   152 bits (384),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 86/157 (55%), Positives = 113/157 (72%), Gaps = 4/157 (3%)
 Frame = +1

Query  763   FNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKEELR  942
             F +K PP   +SV++YTT+LRGIRKTF+DCN+ R +LES  V  FERDVSMH  F++EL 
Sbjct  148   FQEKRPPGSIDSVILYTTSLRGIRKTFDDCNSIRFLLESFRVAYFERDVSMHMEFRQELC  207

Query  943   GLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiP--QAGAGCDGCAGVRFV  1116
              ++G   V  P +F+KGR IGGA+EV+ L E+GKL  LL+G+P   +   C GCAGVRFV
Sbjct  208   SILGCNSVP-PKLFIKGRYIGGAEEVLALHEQGKLRPLLAGVPLDLSQGSCQGCAGVRFV  266

Query  1117  LCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPICC  1227
             +C  CNGS K++ +  ++ V C +CNENGLI CP CC
Sbjct  267   VCFKCNGSHKLIADKGESNV-CPQCNENGLIICPYCC  302



>ref|XP_010452580.1| PREDICTED: uncharacterized protein At3g28850-like [Camelina sativa]
Length=240

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 89/173 (51%), Positives = 114/173 (66%), Gaps = 8/173 (5%)
 Frame = +1

Query  727   KSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERD  906
             +S E    IL +F   CPP GE+SVV YTT LRG+RKTFE C   R +LE+H V   ERD
Sbjct  68    QSLEEERRILLEFEDNCPPGGEDSVVFYTTGLRGVRKTFEACRRVRFLLENHKVMFRERD  127

Query  907   VSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQAGAG  1086
             VSM S F+EE+  L+G  V   P +F++GR IGGA+EVV L E GKL  LLSGI Q  + 
Sbjct  128   VSMDSEFREEMWRLLGGKVTS-PRLFIRGRYIGGAEEVVALNENGKLKKLLSGISQVDSP  186

Query  1087  CDGCAGVRFVLCLNCNGSCKVLGE-------DLKNTVKCGECNENGLIQCPIC  1224
             C+ C   RF++C +CNGS KVL +       + K  ++C ECNENGL++CP+C
Sbjct  187   CESCENERFLICSSCNGSSKVLADHHDEETSNDKMWMRCIECNENGLVRCPLC  239



>ref|XP_008231936.1| PREDICTED: uncharacterized protein At3g28850 [Prunus mume]
Length=376

 Score =   154 bits (388),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 85/158 (54%), Positives = 115/158 (73%), Gaps = 5/158 (3%)
 Frame = +1

Query  763   FNQKCPP-AGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKEEL  939
             F +KC P + ++SV++YTTTLRGIRKTF+DCN+ R +LES  V  +ERDVSMH  F+EEL
Sbjct  221   FEEKCVPGSSDSSVILYTTTLRGIRKTFDDCNSVRFLLESFRVVFYERDVSMHMEFREEL  280

Query  940   RGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiP--QAGAGCDGCAGVRF  1113
               ++    V  P +F+KGR IGGA+EV+ L E+GKL  L  G+P  ++   C+ C GVRF
Sbjct  281   WQVLDCKAVP-PKLFIKGRYIGGAEEVLTLHEQGKLKPLFHGVPIDRSIGPCEACDGVRF  339

Query  1114  VLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPICC  1227
             V+C  C+GSCKV+G++ ++  KC  CNENGLI CP+CC
Sbjct  340   VVCFKCSGSCKVIGQEGQSD-KCSVCNENGLIICPLCC  376



>gb|KHN04404.1| Hypothetical protein glysoja_042230 [Glycine soja]
Length=176

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 85/164 (52%), Positives = 109/164 (66%), Gaps = 7/164 (4%)
 Frame = +1

Query  754   LEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKE  933
             L  F +  PP G  +V++YTT+LRGIRKTF+DCNT R ++ S  +   ERDVS+H  ++E
Sbjct  13    LTDFEEIHPPGGSQAVILYTTSLRGIRKTFQDCNTVRFLMRSFKITYHERDVSLHLEYRE  72

Query  934   ELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQ--AGAGCDGCAGV  1107
             EL  ++G  V+  P +F+KGR IGGADEVV L E G LG LL G P   A   C GCA +
Sbjct  73    ELWKILGCKVIP-PRLFIKGRYIGGADEVVGLHEMGWLGKLLEGTPMDFADGPCKGCACM  131

Query  1108  RFVLCLNCNGSCKVLGEDLKN----TVKCGECNENGLIQCPICC  1227
             RF +C NCNGSCKV   +  N     ++C ECNENGL++C ICC
Sbjct  132   RFSICSNCNGSCKVFTTNGDNKNECFIRCPECNENGLVKCTICC  175



>ref|XP_002970541.1| hypothetical protein SELMODRAFT_15619, partial [Selaginella moellendorffii]
 gb|EFJ28671.1| hypothetical protein SELMODRAFT_15619, partial [Selaginella moellendorffii]
Length=164

 Score =   147 bits (372),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 84/166 (51%), Positives = 111/166 (67%), Gaps = 10/166 (6%)
 Frame = +1

Query  751   ILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFK  930
             +LE+F++KCPP GEN VV+Y T+L+GIRKT E C   R+ILE +  R  ERDV+MH+ F+
Sbjct  1     LLERFDRKCPPGGENRVVLYVTSLQGIRKTHELCRAVRTILEVNFARIDERDVAMHAEFR  60

Query  931   EELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQ--AGAGCDGCAG  1104
              ELR L+G     VP +F+KGR IGG +EV+ L E G L  LL GIP+      C+GC G
Sbjct  61    RELRDLVGA--APVPRLFIKGRHIGGGEEVMALNESGVLRELLEGIPKERVKRSCEGCGG  118

Query  1105  VRFVLCLNCNGSCKVL------GEDLKNTVKCGECNENGLIQCPIC  1224
              RF+ C+ C GSCK+L          +  V+C +CNENGL++CPIC
Sbjct  119   ARFIPCVECGGSCKLLVGDGDGDGSGQAIVRCWDCNENGLVRCPIC  164



>ref|XP_009362676.1| PREDICTED: uncharacterized protein At5g39865 [Pyrus x bretschneideri]
Length=291

 Score =   151 bits (382),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 113/164 (69%), Gaps = 7/164 (4%)
 Frame = +1

Query  754   LEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKE  933
             L  F +KCPP G + VV+Y+T++ G+RKTFEDC   R +LES  V  +ERD+SMH  F+E
Sbjct  129   LLDFEEKCPPGGGDCVVLYSTSVTGVRKTFEDCKAIRFLLESFKVPVYERDLSMHMEFRE  188

Query  934   ELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiP--QAGAGCDGCAGV  1107
             EL  + G+ V+  P +F+KGR IGGA+EV  L E+GKL  L  GIP   + + C GCA V
Sbjct  189   ELWRIFGSRVIP-PRLFIKGRYIGGAEEVTALHEQGKLKKLFEGIPIDLSSSPCTGCANV  247

Query  1108  RFVLCLNCNGSCKVLGE-DLKNT---VKCGECNENGLIQCPICC  1227
             RFV+C NCNGS KV  + D +N    ++C ECNENGLI+C ICC
Sbjct  248   RFVVCFNCNGSRKVFTDGDHENDELCIRCPECNENGLIKCSICC  291



>ref|XP_010907962.1| PREDICTED: uncharacterized protein At3g28850 [Elaeis guineensis]
Length=360

 Score =   153 bits (386),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 86/177 (49%), Positives = 119/177 (67%), Gaps = 4/177 (2%)
 Frame = +1

Query  706   PVSRKSRKSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHH  885
             P S+  RKS++  + ++E   + CPP G  ++V+YTTTLRG+RKTFEDCN+ R +L S  
Sbjct  185   PPSKVPRKSEDYFNPLMECEERCCPPGGMGAIVLYTTTLRGVRKTFEDCNSVRFLLRSLK  244

Query  886   VRTFERDVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsg  1065
             +   ERDVSMH  F+EEL  ++G   +  P +F+KGR IGGADEV+ L E+GKL  L+  
Sbjct  245   LLFLERDVSMHMEFREELWRVLGGRTIP-PRLFIKGRYIGGADEVLGLHEQGKLLPLVQD  303

Query  1066  iP---QAGAGCDGCAGVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPICC  1227
             +P     G  C+GC GVRF++C  C+GS K+  ++    ++C  CNENGLI CPICC
Sbjct  304   LPLDRSGGVACEGCGGVRFMMCSECSGSRKLYHDENVMHIQCSHCNENGLILCPICC  360



>ref|XP_008783185.1| PREDICTED: uncharacterized protein LOC103702504 [Phoenix dactylifera]
Length=370

 Score =   153 bits (387),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 84/168 (50%), Positives = 111/168 (66%), Gaps = 12/168 (7%)
 Frame = +1

Query  754   LEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTF----ERDVSMHS  921
             LE + ++CPP   N VV+YTTTLRG+R+TFEDC  AR  +E+H V       ERDVS+H 
Sbjct  203   LEGYPERCPPGNGNGVVLYTTTLRGVRRTFEDCERARRAVEAHAVEAGVEVEERDVSLHG  262

Query  922   GFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgil---lsgiPQAGAG--  1086
              + +E+R L+G     VP +FV GR +GG +EVV+L E GKL  +   ++   + G G  
Sbjct  263   DYLKEVRELVGEGAA-VPRLFVWGRYVGGVEEVVELGETGKLREMLRWVAARGERGKGGW  321

Query  1087  --CDGCAGVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPIC  1224
               C+GC G RFV CL CNGSCKV  ED +  V+CG+CNENGL+ CP+C
Sbjct  322   RECEGCGGARFVPCLECNGSCKVAAEDGEGVVRCGKCNENGLMLCPLC  369



>ref|XP_010436865.1| PREDICTED: uncharacterized protein At3g28850-like [Camelina sativa]
Length=342

 Score =   152 bits (385),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 92/171 (54%), Positives = 110/171 (64%), Gaps = 15/171 (9%)
 Frame = +1

Query  757   EQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKEE  936
             E+F + CPP GEN VVIYTT+LRG+R+TFE+CN  RS +ES  V   ERDVSM  GFKEE
Sbjct  171   ERFERICPPGGENRVVIYTTSLRGVRRTFEECNAVRSAVESLGVVVCERDVSMDRGFKEE  230

Query  937   LRGLM-------GTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQAGAG---  1086
             L  LM       G      P VFVKG  IGGA+EV++L EEG  G L+ GIP+  AG   
Sbjct  231   LVSLMAKRVKDDGAATALPPRVFVKGMYIGGAEEVLRLVEEGSFGELIGGIPKKKAGGCE  290

Query  1087  ---CDGCAGVRFVLCLNCNGSCKVL--GEDLKNTVKCGECNENGLIQCPIC  1224
                CDGC G+ F+ C  CNGSCK++         V+C ECNENGL+ CPIC
Sbjct  291   SSACDGCGGLFFLPCFRCNGSCKMVKGWGSAAVVVRCNECNENGLVPCPIC  341


 Score = 57.0 bits (136),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 65/145 (45%), Gaps = 34/145 (23%)
 Frame = +1

Query  40   MGCVSSKLFPKDKDFP--FAGDGGCATHVVSLTSSTYGVLKLD------------KDSHQ  177
            MGCVSS L   D+DFP    G  G   H+V LTS+TYG+L LD              S  
Sbjct  1    MGCVSSNLLNHDEDFPQLGGGSSGFGHHIVKLTSTTYGLLTLDPPPSSPPPSSAAFSSDM  60

Query  178  QQTPPQCIKECVVEVKKASPAREKP------PEVINAWELMEGLDETEM---PAAKKSPK  330
              TPP+  K   +  K  S    +P      PEVIN+WELM GLD       P  K   K
Sbjct  61   PMTPPEKFK---IGTKSKSSLWSEPRVIKSEPEVINSWELMSGLDGESFRFTPLPKTPVK  117

Query  331  ARSFLD--------HRRSPLKFLNQ  381
             + F          +RR+P K LN 
Sbjct  118  YKVFGGENKENSEPNRRNPRKNLND  142



>gb|KDP25217.1| hypothetical protein JCGZ_20373 [Jatropha curcas]
Length=319

 Score =   152 bits (383),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 113/171 (66%), Gaps = 14/171 (8%)
 Frame = +1

Query  754   LEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKE  933
             L++F + CPP GEN VVIYTTTLRGIRKTFE CN  R+ +E   V   ERDVSM  GF+E
Sbjct  148   LDRFEKLCPPNGENRVVIYTTTLRGIRKTFEACNVVRTAIEGFGVVICERDVSMDRGFRE  207

Query  934   ELRGLMGTM---VVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQAGAG--CDGC  1098
             ELR LMG        +P VFVKGR +GG ++V+++ EEG +G LL G+P+   G  CDGC
Sbjct  208   ELRELMGEKEREATLLPRVFVKGRYVGGVEDVMRIMEEGWMGELLQGLPKKRVGDVCDGC  267

Query  1099  AGVRFVLCLNCNGSCK---VLGEDLKN------TVKCGECNENGLIQCPIC  1224
               VRF+ C +CNGS K   V+ +D          V+C +CNENGL+ CPIC
Sbjct  268   GDVRFLPCFSCNGSSKMVMVVKDDFGQKQGRTMAVRCPDCNENGLVLCPIC  318


 Score = 62.8 bits (151),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 46/99 (46%), Gaps = 14/99 (14%)
 Frame = +1

Query  40   MGCVSSKLFPKDKDFPFAGDGGCATHVVSLTSSTYGVLKLDKDSHQQQTPP---------  192
            MGCVSS L   + DF   G      H+VSLTS+TYG+L LD       T P         
Sbjct  1    MGCVSSNLLNNEDDFTQLGSSALGHHIVSLTSTTYGLLNLDPPPQSSVTTPPTPPARFTL  60

Query  193  -QCIKECVVEVK----KASPAREKPPEVINAWELMEGLD  294
                   + E K    +  P R   PE IN+WELM GLD
Sbjct  61   GSIFPSPLCEPKSLWSEPRPLRSDCPETINSWELMSGLD  99



>ref|XP_002978620.1| hypothetical protein SELMODRAFT_15618, partial [Selaginella moellendorffii]
 gb|EFJ20606.1| hypothetical protein SELMODRAFT_15618, partial [Selaginella moellendorffii]
Length=164

 Score =   147 bits (370),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 84/166 (51%), Positives = 111/166 (67%), Gaps = 10/166 (6%)
 Frame = +1

Query  751   ILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFK  930
             +LE+F++KCPP GEN VV+Y T+L+GIRKT E C   R+ILE +  R  ERDV+MH+ F+
Sbjct  1     LLERFDRKCPPGGENRVVLYVTSLQGIRKTHELCRAVRTILEVNFARIDERDVAMHAEFR  60

Query  931   EELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQ--AGAGCDGCAG  1104
              ELR L+G     VP +F+KGR IGG +EV+ L E G L  LL GIP+      C+GC G
Sbjct  61    RELRDLVGA--APVPRLFIKGRHIGGGEEVMALNESGVLRELLEGIPKERVKRSCEGCGG  118

Query  1105  VRFVLCLNCNGSCKVL------GEDLKNTVKCGECNENGLIQCPIC  1224
              RF+ C+ C GSCK+L          +  V+C +CNENGL++CPIC
Sbjct  119   ARFIPCVECGGSCKLLVAGGGGDGGGQGIVRCWDCNENGLVRCPIC  164



>ref|XP_010106976.1| Uncharacterized protein L484_016904 [Morus notabilis]
 gb|EXC12974.1| Uncharacterized protein L484_016904 [Morus notabilis]
Length=285

 Score =   150 bits (380),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 94/176 (53%), Positives = 117/176 (66%), Gaps = 11/176 (6%)
 Frame = +1

Query  730   SQEAADTI---LEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFE  900
             +QE  D I   L  F +KCPP G + VV+YTT+LRGIRKTFEDCN  R +LES  V   E
Sbjct  111   NQETPDEICSSLLDFEEKCPPGGSDKVVLYTTSLRGIRKTFEDCNAIRFLLESFKVSFSE  170

Query  901   RDVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVV-kleeegklgillsgiPQA  1077
             RDVS+H  F+EEL  ++    +  P +F+KGR IGGAD+VV  L E+GKL  LL GIP A
Sbjct  171   RDVSLHQEFREELWKILDGKAIP-PRLFIKGRYIGGADQVVGVLHEQGKLKKLLEGIPPA  229

Query  1078  --GAGCDGCAGVRFVLCLNCNGSCKVLGE----DLKNTVKCGECNENGLIQCPICC  1227
                + C GCA VRF +C NCNGS KV+ +    D    ++C ECNENGL++C ICC
Sbjct  230   PSNSPCAGCANVRFSVCCNCNGSRKVVADGENGDEVCYIRCPECNENGLVKCVICC  285



>gb|KHG05116.1| hypothetical protein F383_30969 [Gossypium arboreum]
Length=361

 Score =   152 bits (385),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 94/182 (52%), Positives = 120/182 (66%), Gaps = 13/182 (7%)
 Frame = +1

Query  694   ISSTPVSRKSRKSQEAADTI-----LEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNT  858
             ++ TP S    K    +D I     L++F   CPP GEN VVIYTTTLRGIRKTFEDCN 
Sbjct  160   VAKTPFSSL-HKYDSGSDAISKPSPLDKFENICPPNGENRVVIYTTTLRGIRKTFEDCNA  218

Query  859   ARSILESHHVRTFERDVSMHSGFKEELRGLM-GTMVVKVPLVFVKGRMIGGADEVVklee  1035
              RS +ES+ V   ERD+SM  GFKEELR LM  T     P VF++GR IGGA++V+K+ +
Sbjct  219   VRSAIESYGVVICERDISMDRGFKEELRELMKATNQTTPPQVFIQGRYIGGAEQVMKIVD  278

Query  1036  egklgillsgiPQAGAG--CDGCAGVRFVLCLNCNGSCKV--LGEDLKNT--VKCGECNE  1197
             EG  G L++G+P+  AG  CDGC  V+F+ C  CNGSCK+    E+ + T  V+C +CNE
Sbjct  279   EGWFGDLINGLPKKKAGEVCDGCGDVKFLPCFRCNGSCKMAAAAEEGRRTVVVRCTDCNE  338

Query  1198  NG  1203
             NG
Sbjct  339   NG  340


 Score = 73.9 bits (180),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 50/93 (54%), Gaps = 8/93 (9%)
 Frame = +1

Query  40   MGCVSSKLFPKDKDFPFAGDGGCATHVVSLTSSTYGVLKLDKDSHQQQTP----PQCIKE  207
            MGCVSS L  +D +F   G      H+VSLTS+TYG+L LD  SH   TP    P     
Sbjct  1    MGCVSSNLLNRDDEFTQLGSSAFGNHIVSLTSTTYGLLTLDPPSHSTTTPPSPQPSFTSG  60

Query  208  CVVEVKKASPAREKP----PEVINAWELMEGLD  294
                  K+  +  +P    PEVIN+WELM GLD
Sbjct  61   STFSESKSLWSEPRPVPTRPEVINSWELMSGLD  93



>ref|XP_010491210.1| PREDICTED: uncharacterized protein At3g28850-like [Camelina sativa]
Length=241

 Score =   149 bits (376),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 86/165 (52%), Positives = 111/165 (67%), Gaps = 8/165 (5%)
 Frame = +1

Query  751   ILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFK  930
             IL +F + CPP GE+SVV YTT LRG+RKTFE C   R +LE+H V   ERDVSM S F+
Sbjct  77    ILLEFEENCPPGGEDSVVFYTTGLRGVRKTFEACRRVRFLLENHKVMFRERDVSMDSEFR  136

Query  931   EELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQAGAGCDGCAGVR  1110
             EE+  L+G  V   P +F++GR IGGA+EVV L E GKL  LL+GI Q  + C+ C   R
Sbjct  137   EEMWRLLGGKVTS-PRLFIRGRYIGGAEEVVALNENGKLKKLLTGISQVDSPCEACENER  195

Query  1111  FVLCLNCNGSCKVLGE-------DLKNTVKCGECNENGLIQCPIC  1224
             F++C +CNGS KVL +       + K   +C ECNENGL++CP+C
Sbjct  196   FLICSSCNGSSKVLADHHDEETSNDKMWTRCIECNENGLVRCPLC  240



>ref|XP_008391988.1| PREDICTED: uncharacterized protein At5g39865-like [Malus domestica]
Length=290

 Score =   150 bits (380),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 114/164 (70%), Gaps = 7/164 (4%)
 Frame = +1

Query  754   LEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKE  933
             L  F +KCPP G +SV++Y+T++ G+RKTFEDC   R +LES  V  +ERDVSMH  F++
Sbjct  128   LLDFEEKCPPGGGDSVILYSTSMTGVRKTFEDCKAIRFLLESFKVSVYERDVSMHMEFRQ  187

Query  934   ELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiP--QAGAGCDGCAGV  1107
             EL  L G  V+  P +F+KGR IGGA+EV++L E+GKL  LL GIP   + + C GCA V
Sbjct  188   ELWTLFGGRVIP-PSLFIKGRHIGGAEEVIRLHEQGKLKKLLEGIPINLSSSPCTGCANV  246

Query  1108  RFVLCLNCNGSCKVL----GEDLKNTVKCGECNENGLIQCPICC  1227
             RF++C+NC+GS KV      E  +  V+C ECNENGL +C ICC
Sbjct  247   RFIVCVNCBGSRKVFTDGDHEHDELCVRCPECNENGLTKCSICC  290



>ref|XP_008392638.1| PREDICTED: uncharacterized protein At3g28850-like [Malus domestica]
Length=328

 Score =   151 bits (382),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 90/172 (52%), Positives = 114/172 (66%), Gaps = 15/172 (9%)
 Frame = +1

Query  754   LEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKE  933
             L++F + CPP GE+ VV+YTTTLRG+R+TFE+CN  R+ +E   V   ERDVSM  GF+E
Sbjct  156   LDRFEKICPPGGESKVVVYTTTLRGVRRTFEECNAVRAAIEGLGVMIVERDVSMDRGFRE  215

Query  934   ELRGLM---GTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiP--QAGAGCDGC  1098
             EL  LM   G  V   P VFVKGR IGGA+EV+K+ EEG L  +L+G P  +AG+ C+GC
Sbjct  216   ELNDLMKGKGKDVAVPPQVFVKGRYIGGAEEVLKILEEGLLVEILAGCPKKKAGSVCEGC  275

Query  1099  AGVRFVLCLNCNGSCK---VLGEDLKN-------TVKCGECNENGLIQCPIC  1224
                RF+ C  CNGS K   V+ +D+          VKC ECNENGL+ CPIC
Sbjct  276   GEARFLPCFQCNGSSKMVLVVKDDVAGQRQGTTVVVKCPECNENGLVLCPIC  327


 Score = 61.2 bits (147),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 48/104 (46%), Gaps = 19/104 (18%)
 Frame = +1

Query  40   MGCVSSKLFPKDKDFPFAGDGGCATHVVSLTSSTYGVLKLDKDSHQQQTPPQCIKECVVE  219
            MGCVSS LF  D +F   G    + H+VSLTSSTYG+L LD       TPP       + 
Sbjct  1    MGCVSSNLFNHDDEFSQLGSSALSHHIVSLTSSTYGLLTLDPPPPAPTTPPTPPPRFTLG  60

Query  220  VKKASPARE-------------------KPPEVINAWELMEGLD  294
                SP  E                     PEVIN+WELM GLD
Sbjct  61   SIFPSPLSEPKSLWSEPRSLWSDPRPLRSDPEVINSWELMAGLD  104



>ref|XP_010694395.1| PREDICTED: uncharacterized protein At3g28850-like [Beta vulgaris 
subsp. vulgaris]
Length=364

 Score =   152 bits (384),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 85/170 (50%), Positives = 115/170 (68%), Gaps = 8/170 (5%)
 Frame = +1

Query  736   EAADTI--LEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDV  909
             E  D I  LE+F  KCPP G ++V+ YTT+LRGIRKTFEDC   R +LES  +  FERDV
Sbjct  196   EFEDQINPLEEFEDKCPPGGSDAVIFYTTSLRGIRKTFEDCQNIRFLLESFGLIYFERDV  255

Query  910   SMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiP--QAGA  1083
             S+HS F++EL  +MG   +  P +F++GR IGGA++V+ L E+G+L  L   IP   +  
Sbjct  256   SVHSEFRDELWRIMGERCLP-PRLFIRGRYIGGAEQVLTLNEQGRLRPLFRDIPINFSEG  314

Query  1084  GCDGCAGVRFVLCLNCNGSCKVLGEDLKN---TVKCGECNENGLIQCPIC  1224
              C+ C+G+RF+LC NCNGS KV   D +     +KC +CNENGL+ CP+C
Sbjct  315   PCNVCSGLRFMLCYNCNGSRKVFEHDDQEGGLWIKCLKCNENGLVVCPLC  364



>ref|XP_007212831.1| hypothetical protein PRUPE_ppa020739mg [Prunus persica]
 gb|EMJ14030.1| hypothetical protein PRUPE_ppa020739mg [Prunus persica]
Length=376

 Score =   152 bits (384),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 84/158 (53%), Positives = 115/158 (73%), Gaps = 5/158 (3%)
 Frame = +1

Query  763   FNQKCPP-AGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKEEL  939
             F +KC P + ++SV++Y+TTLRGIRKTF+DCN+ R +LES  V  +ERDVSMH  F+EEL
Sbjct  221   FEEKCVPGSSDSSVILYSTTLRGIRKTFDDCNSVRFLLESFRVVFYERDVSMHMEFREEL  280

Query  940   RGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiP--QAGAGCDGCAGVRF  1113
               ++    V  P +F+KGR IGGA+EV+ L E+GKL  L  G+P  ++   C+ C GVRF
Sbjct  281   WQVLDCKAVP-PKLFIKGRYIGGAEEVLTLHEQGKLKPLFHGVPIDRSIGPCEACDGVRF  339

Query  1114  VLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPICC  1227
             V+C  C+GSCKV+G++ ++  KC  CNENGLI CP+CC
Sbjct  340   VVCFKCSGSCKVIGQEGQSD-KCSVCNENGLIICPLCC  376



>ref|XP_002263752.1| PREDICTED: uncharacterized protein At3g28850 [Vitis vinifera]
Length=376

 Score =   152 bits (384),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 120/174 (69%), Gaps = 6/174 (3%)
 Frame = +1

Query  718   KSRKSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTF  897
             K+R+ ++  + +L  F ++CPP G ++VV+YTT+LRGIRKTFEDC + R +LES  V  +
Sbjct  205   KARRVEDDTNPLL-GFEERCPPGGSDAVVLYTTSLRGIRKTFEDCTSIRFLLESFRVIFY  263

Query  898   ERDVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiP--  1071
             ERDVSMH  F+EEL  ++    +  P +F+KGR IGGA++V+ L E+G+L  L  G+P  
Sbjct  264   ERDVSMHLEFREELWRILDCKALP-PRLFIKGRYIGGAEQVLGLHEQGRLRALFHGLPID  322

Query  1072  QAGAGCDGCAGVRFVLCLNCNGSCKVLGEDLKNTV--KCGECNENGLIQCPICC  1227
              +   C+GCAG+RFV+C  C GS K++ +D  + +   C  CNENGLI CPICC
Sbjct  323   HSKGPCEGCAGIRFVMCYKCCGSRKIVSDDGNHGLSNNCPHCNENGLIICPICC  376



>emb|CAN72487.1| hypothetical protein VITISV_020885 [Vitis vinifera]
Length=376

 Score =   152 bits (384),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 120/174 (69%), Gaps = 6/174 (3%)
 Frame = +1

Query  718   KSRKSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTF  897
             K+R+ ++  + +L  F ++CPP G ++VV+YTT+LRGIRKTFEDC + R +LES  V  +
Sbjct  205   KARRVEDDTNPLL-GFEERCPPGGSDAVVLYTTSLRGIRKTFEDCTSIRFLLESFRVIFY  263

Query  898   ERDVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiP--  1071
             ERDVSMH  F+EEL  ++    +  P +F+KGR IGGA++V+ L E+G+L  L  G+P  
Sbjct  264   ERDVSMHLEFREELWRILDCKALP-PRLFIKGRYIGGAEQVLGLHEQGRLRALFHGLPID  322

Query  1072  QAGAGCDGCAGVRFVLCLNCNGSCKVLGEDLKNTV--KCGECNENGLIQCPICC  1227
              +   C+GCAG+RFV+C  C GS K++ +D  + +   C  CNENGLI CPICC
Sbjct  323   HSKGPCEGCAGIRFVMCYKCCGSRKIVSDDGNHGLSNNCPHCNENGLIICPICC  376



>gb|KCW90429.1| hypothetical protein EUGRSUZ_A02563, partial [Eucalyptus grandis]
Length=176

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 85/166 (51%), Positives = 113/166 (68%), Gaps = 4/166 (2%)
 Frame = +1

Query  721   SRKSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFE  900
             SR ++E     L  F +KCPP G +SV+ YTT+L GIRKTFEDCN  R +L S  +   E
Sbjct  12    SRDNKERYHLSLLDFQEKCPPGGRDSVIFYTTSLTGIRKTFEDCNAVRFLLRSFKINFQE  71

Query  901   RDVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiP--Q  1074
             RDVS+H  + EELR ++G  VV  P +F+KGR IGGADEV+ L E+G L  L  GIP   
Sbjct  72    RDVSLHLQYLEELRKILGQGVVP-PKLFIKGRCIGGADEVITLHEQGSLRKLFEGIPLDL  130

Query  1075  AGAGCDGCAGVRFVLCLNCNGSCKVLGE-DLKNTVKCGECNENGLI  1209
             + + C  CA VRFV+CL C+GSC+V+ + + ++ ++C ECNENGLI
Sbjct  131   SRSTCVQCANVRFVICLACHGSCRVVRDREEESWIRCPECNENGLI  176



>ref|XP_010421977.1| PREDICTED: uncharacterized protein At5g39865-like [Camelina sativa]
Length=342

 Score =   151 bits (381),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 92/171 (54%), Positives = 109/171 (64%), Gaps = 15/171 (9%)
 Frame = +1

Query  757   EQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKEE  936
             E+F + CPP GEN VVIYTT+LRG+R+TFE CN  RS +ES  V   ERDVSM  GFKEE
Sbjct  171   ERFERICPPGGENRVVIYTTSLRGVRRTFEACNAVRSAVESLGVVVCERDVSMDRGFKEE  230

Query  937   LRGLM-------GTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQAGAG---  1086
             L  LM       G      P VFVKG  IGGA+EV++L EEG  G L+ GIP+  AG   
Sbjct  231   LVSLMAKRVKDDGAATALPPRVFVKGMYIGGAEEVLRLVEEGSFGELIGGIPKKKAGGCE  290

Query  1087  ---CDGCAGVRFVLCLNCNGSCKVL--GEDLKNTVKCGECNENGLIQCPIC  1224
                CDGC G+ F+ C  CNGSCK++         V+C ECNENGL+ CPIC
Sbjct  291   SGACDGCGGLFFLPCFRCNGSCKMVKGWGSAAVVVRCNECNENGLVPCPIC  341


 Score = 67.8 bits (164),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 65/145 (45%), Gaps = 34/145 (23%)
 Frame = +1

Query  40   MGCVSSKLFPKDKDFPFAGDGGCA--THVVSLTSSTYGVLKLDKDSHQQ-----------  180
            MGCVSS L   D+DFP  G G  A   H+V LTS+TYG+L LD                 
Sbjct  1    MGCVSSNLLNHDEDFPQLGGGSSAFGHHIVKLTSTTYGLLTLDPPPSSPPPSSAAFSSDM  60

Query  181  -QTPPQCIKECVVEVKKASPAREKP------PEVINAWELMEGLDETEM---PAAKKSPK  330
              TPP+  K   +  K  S    +P      PEVIN+WELM GLD       P  K   K
Sbjct  61   PMTPPEKFK---IGTKSKSSLWSEPRVIKSEPEVINSWELMSGLDGESFRFTPLPKTPVK  117

Query  331  ARSFLD--------HRRSPLKFLNQ  381
             + F          +RR+P K LN 
Sbjct  118  YKVFGGENKENSEPNRRNPRKNLND  142



>ref|XP_010267402.1| PREDICTED: uncharacterized protein At3g28850 [Nelumbo nucifera]
 ref|XP_010267403.1| PREDICTED: uncharacterized protein At3g28850 [Nelumbo nucifera]
 ref|XP_010267404.1| PREDICTED: uncharacterized protein At3g28850 [Nelumbo nucifera]
 ref|XP_010267405.1| PREDICTED: uncharacterized protein At3g28850 [Nelumbo nucifera]
 ref|XP_010267406.1| PREDICTED: uncharacterized protein At3g28850 [Nelumbo nucifera]
Length=352

 Score =   151 bits (381),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 91/177 (51%), Positives = 118/177 (67%), Gaps = 15/177 (8%)
 Frame = +1

Query  739   AADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMH  918
             +   +L+ F ++CPP GE+ VVIYTTTLRG+RKTFE CN  R+ LE   V   ERDVSM 
Sbjct  175   SVKNLLDGFEKRCPPNGESKVVIYTTTLRGVRKTFEACNAVRAALEGFGVLITERDVSMD  234

Query  919   SGFKEELRGLMG---TMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQA--GA  1083
              GF++ELR L+    +  +  P VFV GR IGGA+EV++L EEG L  LL G+P+A  GA
Sbjct  235   RGFRDELRELLKGKESGAIVPPRVFVNGRYIGGAEEVLRLHEEGCLAQLLEGLPKATVGA  294

Query  1084  GCDGCAGVRFVLCLNCNGSCK---VLGEDLKN-------TVKCGECNENGLIQCPIC  1224
              C+GC GVRF+ C  C+GSCK   V+ E  ++        V+C +CNENGL+ CPIC
Sbjct  295   VCEGCGGVRFLPCFQCSGSCKLVMVVEEQSQHQPPGSEVVVRCPDCNENGLVLCPIC  351


 Score = 67.4 bits (163),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 48/95 (51%), Gaps = 14/95 (15%)
 Frame = +1

Query  40   MGCVSSKLFPKDKDFPFAGDGGCATHVVSLTSSTYGVLKLDKDSHQQQ-----TPPQCIK  204
            MGCVSS L   D +F      G   H+VSLTS+TYG+L LD   H        TPP+   
Sbjct  1    MGCVSSTLLDHDDEFSHLAGSGLGHHIVSLTSTTYGLLTLDPPPHADHHLLPPTPPRFTL  60

Query  205  ECVVEVKKASPARE-----KPPEVINAWELMEGLD  294
              +      SP  E       PEVIN+WELM GLD
Sbjct  61   GSLF----PSPLPELRSLRSEPEVINSWELMAGLD  91



>emb|CBI24996.3| unnamed protein product [Vitis vinifera]
Length=399

 Score =   152 bits (384),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 120/174 (69%), Gaps = 6/174 (3%)
 Frame = +1

Query  718   KSRKSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTF  897
             K+R+ ++  + +L  F ++CPP G ++VV+YTT+LRGIRKTFEDC + R +LES  V  +
Sbjct  228   KARRVEDDTNPLL-GFEERCPPGGSDAVVLYTTSLRGIRKTFEDCTSIRFLLESFRVIFY  286

Query  898   ERDVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiP--  1071
             ERDVSMH  F+EEL  ++    +  P +F+KGR IGGA++V+ L E+G+L  L  G+P  
Sbjct  287   ERDVSMHLEFREELWRILDCKALP-PRLFIKGRYIGGAEQVLGLHEQGRLRALFHGLPID  345

Query  1072  QAGAGCDGCAGVRFVLCLNCNGSCKVLGEDLKNTV--KCGECNENGLIQCPICC  1227
              +   C+GCAG+RFV+C  C GS K++ +D  + +   C  CNENGLI CPICC
Sbjct  346   HSKGPCEGCAGIRFVMCYKCCGSRKIVSDDGNHGLSNNCPHCNENGLIICPICC  399



>ref|XP_010661047.1| PREDICTED: uncharacterized protein At5g39865 [Vitis vinifera]
Length=450

 Score =   152 bits (385),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 141/444 (32%), Positives = 209/444 (47%), Gaps = 100/444 (23%)
 Frame = +1

Query  103   GCATHVVSLTSSTYGVLKLD-----KDSH-------------------------------  174
             G + HVV+LTS+T G LKLD     ++SH                               
Sbjct  37    GDSYHVVALTSTTLGTLKLDTSHQNRNSHVNGTIVEEEEDKENKVNGNENVKAGDKKNKG  96

Query  175   ------QQQTPPQCIKECVVEVKKASPAREKP--PEVINAWELMEGLDETEMPAAKKSPK  330
                   + +T    I E + ++   +P R  P  PE INAWELMEGL++     +    +
Sbjct  97    FSMGLIEAKTWSSMINEKIPKIAPKTPIRTPPGEPETINAWELMEGLEDASPLRSPNHLR  156

Query  331   ARSFLDHRRSPLKFLNQLASPGKLRRSGGKENKPGRAMGRSEFSPKTVPKAYNLQESPWR  510
             + SF   RRS       + +P +L +S  +EN         E SP+  P   NL +S   
Sbjct  157   SFSFDIDRRS-------IPAPFELPKSRFQEN--------GEASPR--PMWLNLVDS--E  197

Query  511   VSPRLRSLKKGSPKLSPNELKCDSMRAESMAVCTRRSLNPLFNPeigeklsseeeeqikk  690
             ++P   S K   P+  P          E ++V  R+SL  L + +       E+ +  + 
Sbjct  198   MNPNSNS-KTAVPEFDP----------EVISV-FRKSLQELPSDDPFHIKDDEKVQAREV  245

Query  691   MISSTPVSRKSRKSQEAADT-------ILEQFNQKCPPAGENSVVIYTTTLRGIRKTFED  849
             M +      +  +++E  D          +  + K     +++VV+Y T+LRG+RKT+ED
Sbjct  246   MDAKKVNDDEKVQAREVMDVKKVNDDYDFDVLDHKSQSFAKDTVVVYFTSLRGVRKTYED  305

Query  850   CNTARSILESHHVRTFERDVSMHSGFKEELRGLMGTMVV--KVPLVFVKGRMIGGADEVV  1023
             C   R IL+S  +R  ERDVSMHSGFKEEL+ L+G       +P VF+  R IGGA++V 
Sbjct  306   CCHVRVILKSLGIRLDERDVSMHSGFKEELKDLLGDAFNSGSLPRVFLGRRYIGGAEDVR  365

Query  1024  kleeegklgillsgiPQAGAG-------CDGCAGVRFVLCLNCNGSCKVLGEDLKNTV--  1176
             ++ EEG+L   L    +  AG       C+ C  +RFV C  C+GSCK+  E  +     
Sbjct  366   RMHEEGQLEKTLEDSEKTEAGGNSGSRTCEACGDIRFVPCETCSGSCKIYYEGDEEDDDE  425

Query  1177  -------KCGECNENGLIQCPICC  1227
                    +C +CNENGLI+CPICC
Sbjct  426   EGEFGFQRCPDCNENGLIRCPICC  449



>ref|XP_007209242.1| hypothetical protein PRUPE_ppa007121mg [Prunus persica]
 gb|EMJ10441.1| hypothetical protein PRUPE_ppa007121mg [Prunus persica]
Length=381

 Score =   151 bits (381),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 82/167 (49%), Positives = 109/167 (65%), Gaps = 12/167 (7%)
 Frame = +1

Query  754   LEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKE  933
             L ++ ++CPP G +SVV+YTT+LRG+R+TFEDC   + +LE H V   ERDV++H  F  
Sbjct  213   LSEYPERCPPGGSDSVVVYTTSLRGVRRTFEDCQKVKGVLEGHRVVYDERDVALHGEFLG  272

Query  934   ELRGLMGTMV------VKVPLVFVKGRMIGGADEVVkleeegklgillsgiP-QAGAG--  1086
             ELRGL+G         V VP VFVKGR +GGA+EVV+L E G  G ++     + G G  
Sbjct  273   ELRGLLGEESNNSDGGVGVPRVFVKGRYLGGAEEVVELNESGVFGRMVKLAGVERGVGWR  332

Query  1087  -CDGCAGVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPIC  1224
              C+GC G RFV C+ C GSCKV+  D +   +C +CNENGL+QC  C
Sbjct  333   ACEGCGGARFVPCMECGGSCKVVVGDKRE--RCPKCNENGLVQCVAC  377



>ref|XP_006286786.1| hypothetical protein CARUB_v10003351mg [Capsella rubella]
 gb|EOA19684.1| hypothetical protein CARUB_v10003351mg [Capsella rubella]
Length=345

 Score =   150 bits (379),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 109/171 (64%), Gaps = 13/171 (8%)
 Frame = +1

Query  751   ILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFK  930
             + E+F + CPP GEN VVIYTT+LRG+R+TFE CN  RS +ES  V   ERDVSM  GFK
Sbjct  174   LTEKFEKICPPGGENRVVIYTTSLRGVRRTFEACNAVRSAVESFGVVVCERDVSMDRGFK  233

Query  931   EELRGLMGTMV------VKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQAGAG--  1086
             EEL  LM   V         P VFVKG  IGGA+EV++L EEG  G L+ GIP+   G  
Sbjct  234   EELVSLMAKRVKDDGAAALPPRVFVKGMYIGGAEEVLRLVEEGSFGELIRGIPRKKVGCE  293

Query  1087  ---CDGCAGVRFVLCLNCNGSCKVL--GEDLKNTVKCGECNENGLIQCPIC  1224
                CDGC G+ F+ C  CNGSCK++         V+C ECNENGL+ CPIC
Sbjct  294   SGACDGCGGLFFLPCFRCNGSCKMVKGWGSAAVIVRCNECNENGLVPCPIC  344


 Score = 68.2 bits (165),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 65/143 (45%), Gaps = 32/143 (22%)
 Frame = +1

Query  40   MGCVSSKLFPKDKDFPFAGDGGCA--THVVSLTSSTYGVLKLDKDSHQQQ----------  183
            MGCVSS L  +D+DFP    G  A   H+V LTS+TYG+L LD                 
Sbjct  1    MGCVSSNLLNRDEDFPQISGGSSAFGHHIVKLTSTTYGLLTLDPPPSSPPPSSAALSSDI  60

Query  184  TPPQCIKECVVEVKKASPAREKP------PEVINAWELMEGLDETEM---PAAKKSPKAR  336
            TPP+  K   +  K  S    +P      PEVIN+WELM GLD       P  K   K +
Sbjct  61   TPPEKFK---IGTKSKSSLWSEPRVIKSEPEVINSWELMSGLDGESFRFTPLPKTPVKYK  117

Query  337  SFLD--------HRRSPLKFLNQ  381
             F          +RR+P K LN 
Sbjct  118  VFGGENKENSEPNRRNPRKILND  140



>ref|XP_008387121.1| PREDICTED: uncharacterized protein At5g39865 [Malus domestica]
Length=286

 Score =   149 bits (375),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 111/164 (68%), Gaps = 7/164 (4%)
 Frame = +1

Query  754   LEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKE  933
             L  F +KCPP G + VV+Y+T++ G+RKTFEDC   R +LES  V  +ERD+SMH  F+E
Sbjct  124   LXDFEEKCPPGGGDCVVLYSTSVTGVRKTFEDCKAIRFLLESFKVPVYERDLSMHMEFRE  183

Query  934   ELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiP--QAGAGCDGCAGV  1107
             EL  + G   +  P +F+KGR IGGA+EV  L E+GKL  L  GIP   + + C GCA V
Sbjct  184   ELWRIFGGRXIP-PRLFIKGRYIGGAEEVTALHEQGKLKKLFEGIPIDLSSSPCTGCANV  242

Query  1108  RFVLCLNCNGSCKVLGE-DLKNT---VKCGECNENGLIQCPICC  1227
             RFV+C NCNGS KV  + D +N    ++C ECNENGLI+C ICC
Sbjct  243   RFVVCFNCNGSRKVFTDGDHENDELCIRCPECNENGLIKCSICC  286



>ref|XP_007210085.1| hypothetical protein PRUPE_ppa019815mg [Prunus persica]
 gb|EMJ11284.1| hypothetical protein PRUPE_ppa019815mg [Prunus persica]
Length=327

 Score =   150 bits (378),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 92/170 (54%), Positives = 115/170 (68%), Gaps = 13/170 (8%)
 Frame = +1

Query  754   LEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKE  933
             L++F + CPPAGEN VV+YTTTLRG+R+TFE CN  R+ +E   V   ERDVSM  GF+E
Sbjct  157   LDRFEKICPPAGENKVVVYTTTLRGVRRTFEACNAVRAAIEGLGVMIVERDVSMDRGFRE  216

Query  934   ELRGLM-GTMVVKV-PLVFVKGRMIGGADEVVkleeegklgillsgiP--QAGAGCDGCA  1101
             ELR LM G     V P VFVKGR +GGA+EV+K+ EEG LG +L G P  +AG+ C+GC 
Sbjct  217   ELRDLMDGKEEAGVPPRVFVKGRYVGGAEEVLKILEEGLLGAILDGCPKKKAGSVCEGCG  276

Query  1102  GVRFVLCLNCNGSCK---VLGEDLKN------TVKCGECNENGLIQCPIC  1224
               +F+ C  CNGS K   V+ E+L         V+C ECNENGL+ CPIC
Sbjct  277   EAKFLPCFQCNGSSKMVLVVKEELGQRQGSTVVVRCPECNENGLVLCPIC  326


 Score = 63.5 bits (153),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 59/126 (47%), Gaps = 25/126 (20%)
 Frame = +1

Query  40   MGCVSSKLFPKDKDFPFAGDGGCATHVVSLTSSTYGVLKLDKDSHQQQT-----------  186
            MGCVSS LF  D +F   G    + H+VSLTSSTYG+L LD    Q  T           
Sbjct  1    MGCVSSNLFNHDDEFTQLGSSALSHHIVSLTSSTYGLLTLDPPPPQTPTTPPTPPSRFTL  60

Query  187  -----PPQCIKECVVEVKKASPAREKP------PEVINAWELMEGLDETEMPAAK-KSPK  330
                  P C  + +    K  P R +P      PEVIN+WELM GLD      +    PK
Sbjct  61   GSIFPSPLCEPKSLWSDPK--PLRSEPRPLRSDPEVINSWELMAGLDADSFRFSPLPPPK  118

Query  331  ARSFLD  348
            A +F D
Sbjct  119  AFNFRD  124



>ref|XP_009130946.1| PREDICTED: uncharacterized protein At3g28850-like [Brassica rapa]
Length=247

 Score =   147 bits (371),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 85/173 (49%), Positives = 112/173 (65%), Gaps = 10/173 (6%)
 Frame = +1

Query  733   QEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVS  912
             QE    IL +F + CPP GE+S+V YTT LRG+RKTFE C   R +LE+H V+  ERDVS
Sbjct  75    QEEEREILLEFEENCPPGGEDSIVFYTTGLRGVRKTFEACRRVRFLLENHRVKYKERDVS  134

Query  913   MHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQAGAGCD  1092
             M S F++++  L+G  V   P +FV+GR IGGADEVV L E GKL  LL GI    + C+
Sbjct  135   MDSEFRDQMWRLLGGKVTS-PRLFVRGRYIGGADEVVALNENGKLKKLLEGISLVDSPCE  193

Query  1093  GCAGVRFVLCLNCNGSCKVLGE---------DLKNTVKCGECNENGLIQCPIC  1224
              C   RF++C +CNGS +++ E         D K   +C ECNENGL++CP+C
Sbjct  194   FCENERFLICSSCNGSSRLIVEHHDEEETSNDSKMWTRCRECNENGLVKCPLC  246



>ref|XP_009403223.1| PREDICTED: uncharacterized protein At3g28850-like [Musa acuminata 
subsp. malaccensis]
Length=391

 Score =   151 bits (381),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 86/167 (51%), Positives = 110/167 (66%), Gaps = 10/167 (6%)
 Frame = +1

Query  754   LEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKE  933
             L +F  +CPP G  SV++YTTTLRGIRKTFEDCN  R +L+S  VR  ERDVSMH  F+E
Sbjct  226   LTEFEHRCPPGGRESVILYTTTLRGIRKTFEDCNGVRFLLDSLKVRFTERDVSMHLEFRE  285

Query  934   ELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQ---AG-AGCDGCA  1101
             EL  ++G   +  P +F++GR +GGADEV+ L E+G+L  LL G  +   AG   C GC 
Sbjct  286   ELWRVLGYRAIP-PSLFIRGRYVGGADEVLGLHEQGRLLALLRGAARDRSAGEEACRGCG  344

Query  1102  GVRFVLCLNCNGSCKVLGEDLKNT-----VKCGECNENGLIQCPICC  1227
             GVRFV+C  CNGS K+   + +        +C  CNENGL+ CPICC
Sbjct  345   GVRFVVCWECNGSRKIYHGEEEEEEDACPAQCRHCNENGLVVCPICC  391



>ref|XP_008366606.1| PREDICTED: uncharacterized protein At5g39865-like [Malus domestica]
Length=275

 Score =   148 bits (374),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 112/164 (68%), Gaps = 7/164 (4%)
 Frame = +1

Query  754   LEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKE  933
             L  F +KCPP G + VV+Y+T++ G+RKTFEDC   R +LES  V  +ERD+SMH  F+E
Sbjct  113   LLDFEEKCPPGGGDCVVLYSTSVTGVRKTFEDCKAIRFLLESFKVPVYERDLSMHMEFRE  172

Query  934   ELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiP--QAGAGCDGCAGV  1107
             EL  + G  ++  P +F+KGR IGGA+EV  L E+GKL  L  GIP   + + C GCA V
Sbjct  173   ELWRIFGGRMIP-PRLFIKGRYIGGAEEVTALHEQGKLKKLFEGIPIDLSSSPCTGCANV  231

Query  1108  RFVLCLNCNGSCKVLGE-DLKNT---VKCGECNENGLIQCPICC  1227
             RFV+C NCNGS KV  + D +N    ++C ECNENGLI+C ICC
Sbjct  232   RFVVCFNCNGSRKVFTDGDHENDELCIRCPECNENGLIKCSICC  275



>ref|XP_010677559.1| PREDICTED: uncharacterized protein At3g28850-like [Beta vulgaris 
subsp. vulgaris]
Length=290

 Score =   149 bits (375),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 89/166 (54%), Positives = 108/166 (65%), Gaps = 10/166 (6%)
 Frame = +1

Query  754   LEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKE  933
             L  F +  PP G + VV+YTT++RGIRKTFEDC   + +LES  V   ERDVSMH  F++
Sbjct  124   LSNFEEINPPGGTDKVVLYTTSVRGIRKTFEDCRAIKFLLESFRVVYIERDVSMHLKFRD  183

Query  934   ELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiP-----QAGAGCDGC  1098
             EL  ++G  VV  P +F+KGR IGGADEVV L+E G L  LL GIP      A   C  C
Sbjct  184   ELWEVLGGRVVP-PRLFIKGRYIGGADEVVMLQEVGMLKKLLQGIPVIDSLTANVKCCHC  242

Query  1099  AGVRFVLCLNCNGSCKVLGEDLKN----TVKCGECNENGLIQCPIC  1224
              GVRF+LCL+C+GSCKV   D  +     V+C  CNENGLIQCP C
Sbjct  243   GGVRFLLCLHCSGSCKVYKGDQVDEGTLFVRCTNCNENGLIQCPTC  288



>ref|XP_007162989.1| hypothetical protein PHAVU_001G197100g [Phaseolus vulgaris]
 gb|ESW34983.1| hypothetical protein PHAVU_001G197100g [Phaseolus vulgaris]
Length=263

 Score =   147 bits (372),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 82/164 (50%), Positives = 108/164 (66%), Gaps = 7/164 (4%)
 Frame = +1

Query  754   LEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKE  933
             L  F + CPP G +S+++YTT+LRGIRKTF DCNT R +L S  +   ERDVS+H  F+E
Sbjct  101   LRDFKELCPPGGNHSIILYTTSLRGIRKTFHDCNTIRFLLRSFRIMYHERDVSLHLEFRE  160

Query  934   ELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQ--AGAGCDGCAGV  1107
             EL  ++G  V+  P +F++GR IGGADEVV L E G LG  L G P   + A C GCA +
Sbjct  161   ELWKILGGKVIP-PKLFIRGRYIGGADEVVGLHETGWLGKFLEGAPTHCSNAPCTGCANM  219

Query  1108  RFVLCLNCNGSCKVLGEDLKNT----VKCGECNENGLIQCPICC  1227
              F +C NC GSCKV   +  +     V+C +CNENGL++C +CC
Sbjct  220   GFAICSNCCGSCKVFTGNRDSNDECFVRCPDCNENGLVKCLVCC  263



>ref|XP_004305576.1| PREDICTED: uncharacterized protein At5g39865-like [Fragaria vesca 
subsp. vesca]
Length=252

 Score =   147 bits (371),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 112/164 (68%), Gaps = 7/164 (4%)
 Frame = +1

Query  754   LEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKE  933
             L  F +KCPP G + V++Y+T+L GIRKTFEDC   R +LES  V   ERDVSMH  F+E
Sbjct  90    LLDFEEKCPPGGGDCVILYSTSLTGIRKTFEDCKAIRFLLESFKVTVQERDVSMHIEFRE  149

Query  934   ELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiP--QAGAGCDGCAGV  1107
             EL  +  T V+  P +F+KGR IGGA EVV L E+GKL  LL GIP   + + C  CA +
Sbjct  150   ELWKMFDTKVIP-PRLFIKGRYIGGAAEVVVLHEQGKLKKLLEGIPLDLSESPCSSCANM  208

Query  1108  RFVLCLNCNGSCKVL--GEDLKNT--VKCGECNENGLIQCPICC  1227
             RFV+C NC+GS KV   G+++ +   V+C ECNENGLI+C ICC
Sbjct  209   RFVVCFNCHGSRKVFADGDNVNDELHVRCAECNENGLIRCSICC  252



>ref|XP_008437411.1| PREDICTED: uncharacterized protein LOC103482835 [Cucumis melo]
Length=361

 Score =   150 bits (378),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 105/161 (65%), Gaps = 7/161 (4%)
 Frame = +1

Query  754   LEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKE  933
             L +F + CPP G  +VV+YTT+LRG+R+TFEDCN  +S+LE   V   ERDV++H  F +
Sbjct  203   LSEFPEMCPPGGAETVVLYTTSLRGVRRTFEDCNRVKSVLELQQVVVDERDVALHGEFLK  262

Query  934   ELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiP-QAGA---GCDGCA  1101
             EL+ L+G     VP +FVKGR IGGAD+VV L E GKL  +L     + GA   GC+GC 
Sbjct  263   ELKELLGDEAT-VPKMFVKGRYIGGADQVVALNEMGKLRRILRRAAVETGAGRQGCEGCG  321

Query  1102  GVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPIC  1224
             G RFV C  C GS KV+  D K   +CG CNENGL  CP C
Sbjct  322   GARFVPCYECGGSRKVIKGDTKE--RCGACNENGLAHCPAC  360



>ref|XP_009610463.1| PREDICTED: uncharacterized protein LOC104104162 [Nicotiana tomentosiformis]
Length=320

 Score =   149 bits (375),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 79/151 (52%), Positives = 106/151 (70%), Gaps = 2/151 (1%)
 Frame = +1

Query  781   PAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKEELRGLMGTM  960
             P  E+SVVIY T+LRGIR+TFEDC T R IL+S+ V+  ERD+SM S +K+EL+ ++G  
Sbjct  169   PGTEDSVVIYFTSLRGIRRTFEDCYTVRMILKSYRVKIDERDISMDSAYKKELQNVLGEK  228

Query  961   VVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQ--AGAGCDGCAGVRFVLCLNCN  1134
              V +P VFVKG+ IGGA+ + ++ E G+L  LL G+P    G  C+GC  VRF+ C NC+
Sbjct  229   SVTLPQVFVKGKYIGGAEVIKQMNEVGELAKLLRGLPLRPPGYTCEGCGDVRFLPCSNCD  288

Query  1135  GSCKVLGEDLKNTVKCGECNENGLIQCPICC  1227
             GS K   ED     +C ECNENGL++CP+CC
Sbjct  289   GSRKYFDEDEAQLRRCPECNENGLVRCPLCC  319



>ref|XP_008239265.1| PREDICTED: uncharacterized protein At5g39865-like [Prunus mume]
Length=226

 Score =   146 bits (369),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 91/170 (54%), Positives = 114/170 (67%), Gaps = 13/170 (8%)
 Frame = +1

Query  754   LEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKE  933
             L++F + CPP GEN VV+YTTTLRG+R+TFE CN  R+ +E   V   ERDVSM  GF+E
Sbjct  56    LDRFEKICPPGGENKVVVYTTTLRGVRRTFEACNAVRAAIEGLGVMIVERDVSMDRGFRE  115

Query  934   ELRGLM-GTMVVKV-PLVFVKGRMIGGADEVVkleeegklgillsgiP--QAGAGCDGCA  1101
             ELR LM G     V P VFVKGR +GGA+EV+K+ EEG LG +L G P  +AG+ C+GC 
Sbjct  116   ELRDLMDGKEEAGVPPRVFVKGRYVGGAEEVLKILEEGLLGEILDGCPKKKAGSVCEGCG  175

Query  1102  GVRFVLCLNCNGSCK---VLGEDLKN------TVKCGECNENGLIQCPIC  1224
               +F+ C  CNGS K   V+ E+L         V+C ECNENGL+ CPIC
Sbjct  176   EAKFLPCFQCNGSSKMVLVVKEELGQRQGSTVVVRCPECNENGLVLCPIC  225



>ref|NP_192801.1| Glutaredoxin family protein [Arabidopsis thaliana]
 gb|AAD03427.1| F3H7.9 gene product [Arabidopsis thaliana]
 emb|CAB40029.1| putative protein [Arabidopsis thaliana]
 emb|CAB78186.1| putative protein [Arabidopsis thaliana]
 gb|AEE82911.1| Glutaredoxin family protein [Arabidopsis thaliana]
Length=334

 Score =   149 bits (376),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 96/186 (52%), Positives = 117/186 (63%), Gaps = 15/186 (8%)
 Frame = +1

Query  712   SRKSRKSQEAADTIL-EQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHV  888
             SR  RKS +  D  L E+F + CPP GEN VV+YTT+LRG+R+TFE CN  R+ +ES  V
Sbjct  148   SRSPRKSFKPLDLKLDEKFERICPPGGENRVVMYTTSLRGVRQTFEACNAVRAAVESFGV  207

Query  889   RTFERDVSMHSGFKEELRGLMGTMV------VKVPLVFVKGRMIGGADEVVkleeegklg  1050
                ERDVSM   F+EEL  LM   V         P VFVKGR IGG +EV++L EEG  G
Sbjct  208   VVCERDVSMDRRFREELVSLMAKRVGDEGVAALPPRVFVKGRYIGGGEEVLRLVEEGSFG  267

Query  1051  illsgiPQAGAG------CDGCAGVRFVLCLNCNGSCKVL--GEDLKNTVKCGECNENGL  1206
              L+SGIP+  AG      CDGC G+ F+ C  CNGSCK++         V+C ECNENGL
Sbjct  268   ELISGIPRKKAGGCESGACDGCGGLFFLPCFRCNGSCKMVKGWGSASVVVRCNECNENGL  327

Query  1207  IQCPIC  1224
             + CPIC
Sbjct  328   VPCPIC  333


 Score = 64.7 bits (156),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 53/148 (36%), Positives = 66/148 (45%), Gaps = 20/148 (14%)
 Frame = +1

Query  40   MGCVSSKLFPKDKDFPFAGDGGCA--THVVSLTSSTYGVLKLDKDSHQQQTPPQCIKECV  213
            MGCVSS L   D+DF   G G  A   H+V LTS+TYG+L LD             ++  
Sbjct  1    MGCVSSNLLNHDEDFSQIGGGSSAFGHHIVKLTSTTYGLLTLDPPPPPSPPMTP-PEKFT  59

Query  214  VEVKKASPARE-----KPPEVINAWELMEGLDETEM---PAAKKSPKARSFLDH------  351
            V+ K  S   E       PE+IN+WELM GLD       P  K   K + F         
Sbjct  60   VDTKSKSIWSEPRVIKSEPEIINSWELMSGLDGESFRFTPLPKTPVKYKVFGGENKENSD  119

Query  352  --RRSPLKFLN-QLASPGKLRRSGGKEN  426
              RR+P K LN ++  P  L R     N
Sbjct  120  PSRRNPRKNLNDEVLKPLDLNREDSDSN  147



>ref|XP_008347050.1| PREDICTED: uncharacterized protein At3g28850-like [Malus domestica]
Length=370

 Score =   150 bits (378),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 111/158 (70%), Gaps = 5/158 (3%)
 Frame = +1

Query  763   FNQKCPPAG-ENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKEEL  939
             F +KCPP   E+SVV+YTTTLRGIRKTF+DCN+ R +LES  V  +ERDVSMH  F++EL
Sbjct  215   FEEKCPPGSLESSVVLYTTTLRGIRKTFDDCNSVRFLLESFWVVFYERDVSMHMEFRQEL  274

Query  940   RGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiP--QAGAGCDGCAGVRF  1113
               ++    V  P +F+KGR IGGA+EV+ L E+GKL  L  G+P  ++   C+ C  VRF
Sbjct  275   WKILDCKAVP-PNLFIKGRYIGGAEEVLTLHEQGKLKPLFEGVPMDRSIGPCEACDRVRF  333

Query  1114  VLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPICC  1227
             V+C  C+GSCK++  D     KC ECNENGLI CP+CC
Sbjct  334   VICFRCSGSCKLVA-DEGQPDKCPECNENGLIICPLCC  370



>ref|XP_002873258.1| glutaredoxin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49517.1| glutaredoxin family protein [Arabidopsis lyrata subsp. lyrata]
Length=239

 Score =   146 bits (369),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 85/165 (52%), Positives = 109/165 (66%), Gaps = 8/165 (5%)
 Frame = +1

Query  751   ILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFK  930
             IL +F + CPP GE+SVV YTT LRG+RKTFE C   R +LE+H V   ERDVSM S F+
Sbjct  75    ILLEFKENCPPGGEDSVVFYTTGLRGVRKTFEACRRVRFLLENHQVMYRERDVSMDSEFR  134

Query  931   EELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQAGAGCDGCAGVR  1110
             EE+  L+G      P +F++GR IGGA+EVV L E GKL  LL GI Q  + C+ C   R
Sbjct  135   EEMWRLLGGKATS-PRLFIRGRYIGGAEEVVALNENGKLKKLLEGISQVDSPCESCENER  193

Query  1111  FVLCLNCNGSCKVL----GEDLKNT---VKCGECNENGLIQCPIC  1224
             F++C +CNGS K+L     E+  N     +C ECNENGL++CP+C
Sbjct  194   FLICSSCNGSSKLLVDHHDEETSNDNMWTRCRECNENGLVKCPLC  238



>ref|XP_010423337.1| PREDICTED: uncharacterized protein At3g28850-like [Camelina sativa]
Length=248

 Score =   147 bits (370),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 112/181 (62%), Gaps = 16/181 (9%)
 Frame = +1

Query  727   KSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERD  906
             +S E    IL +F   CPP GE+SVV YTT LRG+RKTFE C   R +LE+H V   ERD
Sbjct  68    QSLEEERRILLEFEDNCPPGGEDSVVFYTTGLRGVRKTFEACRRVRFLLENHKVMFRERD  127

Query  907   VSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQAGAG  1086
             VSM S F+EE+  L+G  V   P +F++GR IGGA+EVV L E GKL  LLSGI Q  + 
Sbjct  128   VSMDSEFREEMWRLLGGKVTS-PRLFIRGRYIGGAEEVVALNENGKLKKLLSGISQVDSP  186

Query  1087  CDGCAGVRFVLCLNCNGSCKVLGEDL---------------KNTVKCGECNENGLIQCPI  1221
             C+ C   RF++C +CNGS KVL +                 K   +C ECNENGL++CP+
Sbjct  187   CEACENERFLICSSCNGSSKVLADHHDEETSNDKMWTRCIDKMWTRCIECNENGLVRCPL  246

Query  1222  C  1224
             C
Sbjct  247   C  247



>ref|NP_196265.1| Glutaredoxin family protein [Arabidopsis thaliana]
 dbj|BAB08969.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED91021.1| Glutaredoxin family protein [Arabidopsis thaliana]
Length=239

 Score =   146 bits (369),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 83/165 (50%), Positives = 107/165 (65%), Gaps = 8/165 (5%)
 Frame = +1

Query  751   ILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFK  930
             IL +F + CPP GE+SVV YTT LR +RKTFE C   R +LE+H V   ERDVSM S F+
Sbjct  75    ILLEFKENCPPGGEDSVVFYTTGLRSVRKTFEACRRVRFLLENHQVMYRERDVSMDSEFR  134

Query  931   EELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQAGAGCDGCAGVR  1110
             EE+  L+G  V   P +F++GR IGGA+EVV L E GKL  LL GI Q  + C+ C   R
Sbjct  135   EEMWRLLGGKVTS-PRLFIRGRYIGGAEEVVALNENGKLKKLLQGISQVDSPCESCENER  193

Query  1111  FVLCLNCNGSCKVLGEDLKNT-------VKCGECNENGLIQCPIC  1224
             F++C +CNGS ++L E             +C ECNENGL++CP+C
Sbjct  194   FLICSSCNGSTRLLAEHHDEESSNDNMWTRCRECNENGLVKCPLC  238



>ref|XP_002298963.2| hypothetical protein POPTR_0001s45240g [Populus trichocarpa]
 gb|EEE83768.2| hypothetical protein POPTR_0001s45240g [Populus trichocarpa]
Length=341

 Score =   149 bits (376),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 92/174 (53%), Positives = 116/174 (67%), Gaps = 18/174 (10%)
 Frame = +1

Query  751   ILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFK  930
             ++++F + CPP+GE+ VVIYTTTLRGIRKTFE CN  R+  E   V   ERDVSM  GFK
Sbjct  169   LIDKFERLCPPSGEDRVVIYTTTLRGIRKTFEACNVVRAAFEGFGVLICERDVSMDKGFK  228

Query  931   EELRGLM-----GTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQAGAG--C  1089
             EEL  LM       MV   P VFVKGR +GGA+EV++L EEG +G +L G+P+ G    C
Sbjct  229   EELMELMRGKEREAMV--PPRVFVKGRYMGGAEEVMRLVEEGIMGDVLEGLPKKGVKGVC  286

Query  1090  DGCAGVRFVLCLNCNGSCKV-------LGEDLKNTV--KCGECNENGLIQCPIC  1224
             +GC  VRF+ C +CNGSCK+       LG+    TV  +C +CNENGL+ CPIC
Sbjct  287   EGCGDVRFLPCFSCNGSCKMVMVVKEELGQKQGRTVVLRCPDCNENGLVLCPIC  340


 Score = 58.9 bits (141),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 45/138 (33%), Positives = 62/138 (45%), Gaps = 16/138 (12%)
 Frame = +1

Query  40   MGCVSSKLFPKDKDFPFAGDGGCATHVVSLTSSTYGVLKLDKDSHQQQTPPQCIKECVVE  219
            MGCVSS L   + +F   G    + H+VSLTS+TYG+L LD        P          
Sbjct  1    MGCVSSNLLNNEDEFAQLGSSALSHHIVSLTSTTYGLLNLDPLPPPTPPPQTTTTPPTPS  60

Query  220  VKKA------SPARE--KPPEVINAWELMEGLDETEM---PAAKKSPKARSFLD----HR  354
             +        +P  E    PE+I++WELM GLD       P  KK  ++  F      H+
Sbjct  61   HRFTLGSIFPTPLTEPKSKPEIIDSWELMSGLDTDSFRFSPIIKKDQESSHFSSFFKKHQ  120

Query  355  RSPLKFLNQLASPGKLRR  408
             +PL F  +  SP  L +
Sbjct  121  ETPL-FSKENTSPKLLLK  137



>ref|XP_003591668.1| Glutaredoxin domain-containing cysteine-rich protein [Medicago 
truncatula]
 ref|XP_003637089.1| Glutaredoxin domain-containing cysteine-rich protein [Medicago 
truncatula]
 gb|AES61919.1| glutaredoxin (GRX) family protein [Medicago truncatula]
Length=369

 Score =   149 bits (377),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 106/159 (67%), Gaps = 4/159 (3%)
 Frame = +1

Query  754   LEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKE  933
             L  F +KCPP G+ +V+ YTT+LRGIRKTFEDC   R +L+S  V   ERD+SMH  +K+
Sbjct  212   LTLFEEKCPPGGDGTVIFYTTSLRGIRKTFEDCQKIRFLLQSFKVLYLERDISMHKEYKD  271

Query  934   ELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQ--AGAGCDGCAGV  1107
             EL  L+G  VV  P +FVKGR IG  +EV+ L E+GKL  +L G+P   +   CD C G+
Sbjct  272   ELWSLLGEKVVP-PRLFVKGRYIGATEEVLSLHEQGKLKKILEGVPIDCSNGPCDACGGL  330

Query  1108  RFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPIC  1224
             RFV+C  CNGS K++ E  K   +C  CNENGL+ CP C
Sbjct  331   RFVMCFKCNGSHKIMAEKEK-IDECLLCNENGLMVCPYC  368



>ref|XP_011013400.1| PREDICTED: uncharacterized protein At5g39865-like [Populus euphratica]
Length=341

 Score =   149 bits (375),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 92/174 (53%), Positives = 116/174 (67%), Gaps = 18/174 (10%)
 Frame = +1

Query  751   ILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFK  930
             ++++F + CPP+GE+ VVIYTTTLRGIRKTFE CN  R+  E   V   ERDVSM  GFK
Sbjct  169   LIDKFERLCPPSGEDRVVIYTTTLRGIRKTFEACNVVRAAFEGFGVLICERDVSMDKGFK  228

Query  931   EELRGLM-----GTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQAGAG--C  1089
             EEL  LM       MV   P VFVKGR +GGA+EV++L EEG +G +L G+P+ G    C
Sbjct  229   EELMELMRGKEREAMV--PPRVFVKGRYMGGAEEVMRLVEEGIMGDVLEGLPKKGVKGVC  286

Query  1090  DGCAGVRFVLCLNCNGSCKV-------LGEDLKNTV--KCGECNENGLIQCPIC  1224
             +GC  VRF+ C +CNGSCK+       LG+    TV  +C +CNENGL+ CPIC
Sbjct  287   EGCGDVRFLPCFSCNGSCKMVMVVKEELGQKQGRTVVLRCPDCNENGLVLCPIC  340


 Score = 59.3 bits (142),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 45/138 (33%), Positives = 62/138 (45%), Gaps = 16/138 (12%)
 Frame = +1

Query  40   MGCVSSKLFPKDKDFPFAGDGGCATHVVSLTSSTYGVLKLDKDSHQQQTPPQCIKECVVE  219
            MGCVSS L   + +F   G    + H+VSLTS+TYG+L LD        P          
Sbjct  1    MGCVSSNLLNNEDEFAQLGSSALSHHIVSLTSTTYGLLNLDPLPPPTPPPQATTTPPTPS  60

Query  220  VKKA------SPARE--KPPEVINAWELMEGLDETEM---PAAKKSPKARSFLD----HR  354
             +        +P  E    PE+I++WELM GLD       P  KK  ++  F      H+
Sbjct  61   PRFTLGSIFPTPLTEPKSRPEIIDSWELMSGLDTDSFRFSPIIKKDQESSHFSSFFKKHQ  120

Query  355  RSPLKFLNQLASPGKLRR  408
             +PL F  +  SP  L +
Sbjct  121  ETPL-FSKENTSPKLLLK  137



>ref|XP_009360198.1| PREDICTED: uncharacterized protein At5g39865 [Pyrus x bretschneideri]
Length=328

 Score =   148 bits (374),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 90/172 (52%), Positives = 113/172 (66%), Gaps = 15/172 (9%)
 Frame = +1

Query  754   LEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKE  933
             L++F + CPP GEN VV+YTTTLRG+R+TFE+CN  R+ +E   V   ERDVSM  GF+E
Sbjct  156   LDRFEKTCPPGGENKVVVYTTTLRGVRRTFEECNAVRAEIEGLGVMIVERDVSMDRGFRE  215

Query  934   ELRGLM---GTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiP--QAGAGCDGC  1098
             EL  LM   G      P VFVKGR IGG++EV+K+ EEG LG +L+G P  +AG+ C+GC
Sbjct  216   ELSDLMKGKGKEAAVPPRVFVKGRYIGGSEEVLKILEEGLLGEILAGCPKKKAGSVCEGC  275

Query  1099  AGVRFVLCLNCNGSCK--------VLGEDLKNTV--KCGECNENGLIQCPIC  1224
                RF+ C  CNGS K        V G+    TV  +C ECNENGL+ CPIC
Sbjct  276   GEARFLPCFQCNGSSKMVLMVNDDVAGQRKGTTVVTRCPECNENGLVLCPIC  327


 Score = 58.9 bits (141),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 53/123 (43%), Gaps = 20/123 (16%)
 Frame = +1

Query  40   MGCVSSKLFPKDKDFPFAGDGGCATHVVSLTSSTYGVLKLDKDSHQQQTPPQCIKECVVE  219
            MGC SS LF  + +F   G    + H+VSLTSSTYG+L LD       TP        + 
Sbjct  1    MGCASSNLFNHNDEFSQLGSSALSHHIVSLTSSTYGLLTLDPPLPAPTTPSTPPSRFTLG  60

Query  220  VKKASPARE-------------------KPPEVINAWELMEGLDETEMPAAK-KSPKARS  339
                SP  +                     PEVIN+WELM+GLD      +    PK   
Sbjct  61   SIFPSPLSQPKSLESEPKSLLSDPRPLPSDPEVINSWELMDGLDADSFRFSPLPPPKPFV  120

Query  340  FLD  348
            FLD
Sbjct  121  FLD  123



>ref|XP_004494260.1| PREDICTED: uncharacterized protein At5g39865-like [Cicer arietinum]
Length=246

 Score =   146 bits (368),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 79/160 (49%), Positives = 108/160 (68%), Gaps = 4/160 (3%)
 Frame = +1

Query  754   LEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKE  933
             L  F +KCPP G  S+++YTT+LRGIRKTF+DCNT R +L +  +   ERDVS+H  ++E
Sbjct  89    LNDFEEKCPPGGTKSIILYTTSLRGIRKTFQDCNTIRFLLRNLRILYHERDVSLHLEYRE  148

Query  934   ELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQAGAG--CDGCAGV  1107
             EL  ++G  V+  P +F+KGR IGGADEV+ L E G LG +L G P   +   C GCA +
Sbjct  149   ELWNVLGGKVIP-PKLFIKGRYIGGADEVIGLHEMGWLGKILEGTPNVTSDCVCIGCANM  207

Query  1108  RFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPICC  1227
              F +C  C GSCK+   + +  ++C ECNENGL++C ICC
Sbjct  208   GFTICSTCCGSCKIFTNN-ECFLRCHECNENGLVKCHICC  246



>ref|XP_001753384.1| predicted protein [Physcomitrella patens]
 gb|EDQ81607.1| predicted protein [Physcomitrella patens]
Length=162

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 78/155 (50%), Positives = 113/155 (73%), Gaps = 4/155 (3%)
 Frame = +1

Query  766   NQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKEELRG  945
             ++KCPP G+   V+YTT+LRGIRKTFEDC+  ++IL++ +V+  ERD+++H+ F+ EL  
Sbjct  9     DEKCPPGGKERCVLYTTSLRGIRKTFEDCSQLKTILQNSNVQIDERDIAIHAEFRHELTK  68

Query  946   LMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQAGAG--CDGCAGVRFVL  1119
             L+G     VP +F++G+ IGG +EV +L E+G L +LL  +P+ GA   C+GC GVRF+ 
Sbjct  69    LLGR-AAPVPRLFIRGKYIGGREEVSQLHEDGILSMLLEDLPKQGAQAICEGCGGVRFIP  127

Query  1120  CLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPIC  1224
             C  C+GSCKV+ E+ K T  C ECNENGL +CP+C
Sbjct  128   CSTCSGSCKVITEEGKFTF-CKECNENGLSRCPLC  161



>ref|XP_008442942.1| PREDICTED: uncharacterized protein At3g28850 [Cucumis melo]
Length=291

 Score =   147 bits (371),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 88/168 (52%), Positives = 112/168 (67%), Gaps = 13/168 (8%)
 Frame = +1

Query  754   LEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKE  933
             L  F  +CPP G  SV+ Y+T+LR IRKTFE+CN+ R +LES  V  FERDVSMH  F++
Sbjct  127   LLDFEDRCPPGGSESVIFYSTSLRSIRKTFEECNSIRFLLESFKVLFFERDVSMHLEFRK  186

Query  934   ELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiP--QAGAGCDGCAGV  1107
             EL  ++G  V+  P +F+ GR IGGADEV+ L E+GKL  LL GIP   A + C  CA  
Sbjct  187   ELWEVLGGRVIP-PRLFINGRYIGGADEVIGLHEQGKLMKLLEGIPLDLANSPCSCCANT  245

Query  1108  RFVLCLNCNGSCKVLG--------EDLKNTVKCGECNENGLIQCPICC  1227
             RF++C +CNGSCKVL          +L N  +C +CNENGL +CPICC
Sbjct  246   RFLVCPSCNGSCKVLKDDYDDDDVNNLYN--RCTDCNENGLAKCPICC  291



>ref|XP_008346655.1| PREDICTED: uncharacterized protein At5g39865-like [Malus domestica]
Length=328

 Score =   148 bits (373),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 90/172 (52%), Positives = 113/172 (66%), Gaps = 15/172 (9%)
 Frame = +1

Query  754   LEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKE  933
             L++F + CPP GEN VV+YTTTLRG+R+TFE+CN  R+ +E   V   ERDVSM  GF+E
Sbjct  156   LDRFEKICPPGGENKVVVYTTTLRGVRRTFEECNAVRAEIEGLGVMIVERDVSMDRGFRE  215

Query  934   ELRGLM---GTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiP--QAGAGCDGC  1098
             EL  LM   G      P VFVKGR IGG++EV+K+ EEG LG +L+G P  +AG+ C+GC
Sbjct  216   ELSDLMKGKGKEXAVXPRVFVKGRYIGGSEEVLKILEEGLLGEILAGCPKKKAGSVCEGC  275

Query  1099  AGVRFVLCLNCNGSCK--------VLGEDLKNTV--KCGECNENGLIQCPIC  1224
                RF+ C  CNGS K        V G+    TV  +C ECNENGL+ CPIC
Sbjct  276   GEARFLPCFQCNGSSKMVLMVNDDVAGQRQGTTVVTRCPECNENGLVLCPIC  327


 Score = 58.5 bits (140),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 48/104 (46%), Gaps = 19/104 (18%)
 Frame = +1

Query  40   MGCVSSKLFPKDKDFPFAGDGGCATHVVSLTSSTYGVLKLDKDSHQQQ------------  183
            MGC SS  F  + +F   G    + H+VSLTSSTYG+L LD                   
Sbjct  1    MGCASSNJFNHNDEFSQLGSSALSHHIVSLTSSTYGLLTLDPPPPAPTTPSTPPSRFTLG  60

Query  184  ----TPPQCIKECVVEVKK-ASPAREKP--PEVINAWELMEGLD  294
                +P    K    E K   S  R  P  PEVIN+WELM+GLD
Sbjct  61   SIFPSPLSQPKSLXSEPKSLLSDPRPLPSDPEVINSWELMDGLD  104



>ref|XP_002874639.1| glutaredoxin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50898.1| glutaredoxin family protein [Arabidopsis lyrata subsp. lyrata]
Length=325

 Score =   148 bits (373),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 92/186 (49%), Positives = 116/186 (62%), Gaps = 12/186 (6%)
 Frame = +1

Query  697   SSTPVSRKSRKSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILE  876
             +S P  R  RKS +    + E+F + CPP GEN VV+YTT+LRG+R+TFE CN  R+ +E
Sbjct  141   NSDPNLRNPRKSLDL--KLDEKFERICPPGGENRVVMYTTSLRGVRRTFEACNAVRAAVE  198

Query  877   SHHVRTFERDVSMHSGFKEELRGLMGTMV------VKVPLVFVKGRMIGGADEVVkleee  1038
             S  V   ERDVSM  GF+EEL  LM   V         P VFVKG  IGG +EV++L EE
Sbjct  199   SFGVVVCERDVSMDRGFREELVSLMAKRVKDDGVAALPPRVFVKGMYIGGVEEVLRLVEE  258

Query  1039  gklgillsgiP--QAGAGCDGCAGVRFVLCLNCNGSCKVL--GEDLKNTVKCGECNENGL  1206
             G  G L+ GIP  +A   CDGC G+ F+ C  C+GSCK++         V+C ECNENGL
Sbjct  259   GSFGELIRGIPRKKADGACDGCGGMFFLPCFRCDGSCKMVKGWGSAAVVVRCSECNENGL  318

Query  1207  IQCPIC  1224
             + CPIC
Sbjct  319   VPCPIC  324


 Score = 68.6 bits (166),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 51/136 (38%), Positives = 63/136 (46%), Gaps = 26/136 (19%)
 Frame = +1

Query  40   MGCVSSKLFPKDKDFPFAGDGGCA--THVVSLTSSTYGVLKLD---------KDSHQQQT  186
            MGCVSS L   D+DFP  G G  A   H+V LTS+TYG+L LD            +   T
Sbjct  1    MGCVSSNLLNHDEDFPQIGGGSSAFGHHIVKLTSTTYGLLTLDPPPPSSAAFSSDNMPMT  60

Query  187  PPQCIKECVVEVKKASPAREKPPEVINAWELMEGLDETEM---PAAKKSPKARSFLD---  348
            PP   K    E +      +  PE+IN+WELM GLD       P  K   K + F     
Sbjct  61   PPDKSKSLWSEPRLI----KSEPEIINSWELMSGLDGESFRFTPLPKTPVKYKVFGGENK  116

Query  349  -----HRRSPLKFLNQ  381
                 +RR+P K LN 
Sbjct  117  ENSDPNRRNPRKILND  132



>emb|CDP12239.1| unnamed protein product [Coffea canephora]
Length=254

 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 87/182 (48%), Positives = 115/182 (63%), Gaps = 27/182 (15%)
 Frame = +1

Query  760   QFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKEEL  939
             +F + CPP GE+ VVIYTTTLRGIRKTFE CN  RS ++ + V   ERDVSM  GF++EL
Sbjct  72    EFEKLCPPNGESKVVIYTTTLRGIRKTFEACNAVRSAIQGYGVLICERDVSMDRGFRDEL  131

Query  940   RGLM-----------GTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQAGAG  1086
             R LM            + ++  P VF+KGR IGG +EV+++ E+G LG LL+G+P+   G
Sbjct  132   RELMLMIKPRPCHNGNSSLMIPPRVFIKGRYIGGVEEVMRIAEDGALGGLLAGLPKLRPG  191

Query  1087  ----CDGCAGVRFVLCLNCNGSCKVLG---EDLKNT---------VKCGECNENGLIQCP  1218
                 CDGC G RF+ C  CNGSCK++    +++  T         V+C  CNENGL+ CP
Sbjct  192   HNNVCDGCGGARFLPCFQCNGSCKMVSPMEDEMDQTHNSLERTVVVRCSHCNENGLVLCP  251

Query  1219  IC  1224
             IC
Sbjct  252   IC  253



>ref|XP_001773130.1| predicted protein [Physcomitrella patens]
 gb|EDQ61983.1| predicted protein [Physcomitrella patens]
Length=148

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 109/150 (73%), Gaps = 4/150 (3%)
 Frame = +1

Query  781   PAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKEELRGLMGTM  960
             P GE+ VV+Y T+LRGIRKTFEDC++ R IL+S  V   ERDVSMH+ F++E+  L+G  
Sbjct  1     PGGEHRVVLYLTSLRGIRKTFEDCHSLRMILQSFTVWIDERDVSMHAEFRQEVTDLLGGP  60

Query  961   VVKVPLVFVKGRMIGGADEVVkleeegklgillsgiP--QAGAGCDGCAGVRFVLCLNCN  1134
             V+ VP +F+KGR IGG+DEV +L EEG LG LL  +P  Q    CDGC GVRFV C  C+
Sbjct  61    VM-VPRLFIKGRYIGGSDEVRRLHEEGNLGPLLQDLPVVQYRQPCDGCGGVRFVPCPECS  119

Query  1135  GSCKVLGEDLKNTVKCGECNENGLIQCPIC  1224
             GSCK++ E   +  +C +CNENGLI+CP+C
Sbjct  120   GSCKIITET-NDVAQCPDCNENGLIRCPVC  148



>ref|XP_007160186.1| hypothetical protein PHAVU_002G300200g [Phaseolus vulgaris]
 gb|ESW32180.1| hypothetical protein PHAVU_002G300200g [Phaseolus vulgaris]
Length=342

 Score =   148 bits (373),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 82/161 (51%), Positives = 103/161 (64%), Gaps = 6/161 (4%)
 Frame = +1

Query  754   LEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKE  933
             L    +KCPP G  +VV+YTT+LRG+RKTFEDCN  R +LE+H V   ERDVS+H  F  
Sbjct  183   LSALPEKCPPGGSETVVVYTTSLRGVRKTFEDCNRVRDVLETHRVVFDERDVSLHGDFLR  242

Query  934   ELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleee-gklgillsgiPQAGAG---CDGCA  1101
             E++ L+G  V  +P VFVKGR +GG +E+V+L E      IL +   + G G   C GC 
Sbjct  243   EVKELVGEAVA-LPRVFVKGRYVGGLEELVELNETGRLGRILRATRVERGIGRQTCGGCG  301

Query  1102  GVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPIC  1224
             G RFV CL C GSCKVL   + +  KC  CNENGL+ CP C
Sbjct  302   GARFVPCLECGGSCKVLVNGV-DKQKCPNCNENGLVHCPSC  341



>ref|XP_007040570.1| Electron transporter, putative [Theobroma cacao]
 gb|EOY25071.1| Electron transporter, putative [Theobroma cacao]
Length=396

 Score =   149 bits (376),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 83/161 (52%), Positives = 100/161 (62%), Gaps = 6/161 (4%)
 Frame = +1

Query  754   LEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKE  933
             L QF + CPP G +SVVIYTT+LRG+R+TFEDC   R I E   V   ERDVS+H  F  
Sbjct  237   LSQFPEMCPPGGADSVVIYTTSLRGVRRTFEDCTKVREIFEIQRVVFDERDVSLHGEFLN  296

Query  934   ELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleee-gklgillsgiPQAGAG---CDGCA  1101
             ELR ++G     VP VFVKGR +GG +EV +L+E      IL     + G G   C GC 
Sbjct  297   ELRSILGKE-ASVPRVFVKGRYVGGVEEVSELDESGKLGKILNKARVEKGVGRQACGGCG  355

Query  1102  GVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPIC  1224
             G RFV CL C GSCKV+    K   +CG+CNENGL+ CP C
Sbjct  356   GARFVPCLECGGSCKVVVSGDKRE-RCGKCNENGLVHCPAC  395



>ref|XP_004161302.1| PREDICTED: uncharacterized protein At5g39865-like [Cucumis sativus]
Length=296

 Score =   146 bits (369),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 111/166 (67%), Gaps = 9/166 (5%)
 Frame = +1

Query  754   LEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKE  933
             L  F  +CPP G  SV+ Y+T+LR IRKTFE+CN+ R +LES  V  +ERDVSMH  F++
Sbjct  132   LLDFEDRCPPGGSESVIFYSTSLRSIRKTFEECNSIRFLLESFKVLFYERDVSMHLEFRK  191

Query  934   ELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiP--QAGAGCDGCAGV  1107
             EL  ++G  V+  P +F+KGR IGGADEV+ L E+GKL  LL GIP   A + C  CA  
Sbjct  192   ELWEVLGGRVIP-PRLFIKGRYIGGADEVIGLHEQGKLRKLLEGIPLDLANSPCSCCANT  250

Query  1108  RFVLCLNCNGSCKV------LGEDLKNTVKCGECNENGLIQCPICC  1227
             RF++C NCNGSCKV        +D     +C +CNENGL +CPICC
Sbjct  251   RFLVCPNCNGSCKVLRDAYDDDDDNNLYNRCTDCNENGLAKCPICC  296



>ref|XP_009122252.1| PREDICTED: uncharacterized protein At5g39865 [Brassica rapa]
Length=242

 Score =   145 bits (365),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 80/163 (49%), Positives = 110/163 (67%), Gaps = 6/163 (4%)
 Frame = +1

Query  751   ILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFK  930
             IL +F + CPP GE+SVV Y T LRG+RKTFE C   R +LE+H VR  ERDVS+ S ++
Sbjct  80    ILSEFEENCPPGGEDSVVFYATGLRGVRKTFEACRRVRFLLENHMVRYKERDVSVDSEYR  139

Query  931   EELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQAGAGCDGCAGVR  1110
             +E+  L+G  V   P +F++GR IGGADEVV L E GKL  LL GI +  + C+ C   R
Sbjct  140   DEMWRLLGRKVTS-PRLFIRGRYIGGADEVVALNENGKLKKLLQGISRVHSPCECCLNER  198

Query  1111  FVLCLNCNGSCKVLGEDLKNT-----VKCGECNENGLIQCPIC  1224
             F++C +CNGS +++ ED + +      +C ECNE GL++CP+C
Sbjct  199   FLICSSCNGSSRLIAEDEETSNGTMWTRCRECNEKGLVRCPLC  241



>ref|XP_009793246.1| PREDICTED: uncharacterized protein At5g39865-like [Nicotiana 
sylvestris]
Length=270

 Score =   145 bits (367),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 78/151 (52%), Positives = 105/151 (70%), Gaps = 2/151 (1%)
 Frame = +1

Query  781   PAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKEELRGLMGTM  960
             P  E+SVVIY T+LRGIR+TFEDC T R IL+S+ V+  ERD+SM S +K+EL+ ++   
Sbjct  119   PGTEDSVVIYFTSLRGIRRTFEDCYTVRMILKSYRVKIDERDISMDSVYKKELQNVLAEK  178

Query  961   VVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQ--AGAGCDGCAGVRFVLCLNCN  1134
              V +P VFVKG+ IGGA+ + ++ E G+L  LL G+P    G  C+GC  VRF+ C NC+
Sbjct  179   CVTLPQVFVKGKYIGGAEVIKQMNEVGELAKLLRGLPLRPPGYTCEGCGDVRFLPCSNCD  238

Query  1135  GSCKVLGEDLKNTVKCGECNENGLIQCPICC  1227
             GS K   ED     +C ECNENGL++CP+CC
Sbjct  239   GSRKYFDEDEAQLRRCPECNENGLVRCPLCC  269



>gb|EPS70452.1| hypothetical protein M569_04310, partial [Genlisea aurea]
Length=193

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 81/181 (45%), Positives = 113/181 (62%), Gaps = 7/181 (4%)
 Frame = +1

Query  703   TPVSRKSRKSQEAADTILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESH  882
             +P ++  +  ++     L +F  +CPP G ++V++YTT+LRGIRKTF+DC   RS+LE+ 
Sbjct  14    SPATKTRKVEEDDNHPQLHEFPVRCPPGGSDAVILYTTSLRGIRKTFDDCQKVRSLLENM  73

Query  883   HVRTFERDVSMHSGFKEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgills  1062
              V   ERD+SMHS FK+EL   +   V+  P +F+KGR IGGADEVV L E G    L+ 
Sbjct  74    RVLFVERDLSMHSEFKQELLRTLEKKVLP-PKLFIKGRYIGGADEVVGLHERGHFRPLIQ  132

Query  1063  giPQAG--AGCDGCAGVRFVLCLNCNGSCKVL----GEDLKNTVKCGECNENGLIQCPIC  1224
             G+P       C+GCAG+RF++C NC+GS K+     G        C  CNENG++ CP C
Sbjct  133   GVPVVANEIPCEGCAGIRFIICFNCHGSRKIPVQCGGGSAGERETCPHCNENGILICPNC  192

Query  1225  C  1227
             C
Sbjct  193   C  193



>ref|XP_011041075.1| PREDICTED: uncharacterized protein At5g39865-like [Populus euphratica]
Length=341

 Score =   147 bits (371),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 92/174 (53%), Positives = 115/174 (66%), Gaps = 18/174 (10%)
 Frame = +1

Query  751   ILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFK  930
             ++++F + CPP+GE+ VVIYTTTLRGIRKTFE CN  R+  E   V   ERDVSM  GFK
Sbjct  169   LIDKFERLCPPSGEDRVVIYTTTLRGIRKTFEACNVVRAAFEGFGVLICERDVSMDKGFK  228

Query  931   EELRGLM-----GTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQAGAG--C  1089
             EEL  LM       MV   P VFVKG  IGGA+EV++L EEG +G +L G+P+ G    C
Sbjct  229   EELMELMRGKEREAMV--PPRVFVKGSYIGGAEEVMRLVEEGIIGDVLEGLPKKGVKGVC  286

Query  1090  DGCAGVRFVLCLNCNGSCKV-------LGEDLKNTV--KCGECNENGLIQCPIC  1224
             +GC  VRF+ C +CNGSCK+       LG+    TV  +C +CNENGL+ CPIC
Sbjct  287   EGCGDVRFLPCFSCNGSCKMVMVVKEELGQKQGRTVVLRCPDCNENGLVLCPIC  340


 Score = 57.8 bits (138),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 44/138 (32%), Positives = 61/138 (44%), Gaps = 16/138 (12%)
 Frame = +1

Query  40   MGCVSSKLFPKDKDFPFAGDGGCATHVVSLTSSTYGVLKLDKDSHQQQTPPQCIKECVVE  219
            MGCVSS L   + +F   G    + H+VSLTS+TYG+L LD        P          
Sbjct  1    MGCVSSNLLNNEDEFAQLGSSALSHHIVSLTSTTYGLLNLDPLPPPTPPPQATTTPPTPS  60

Query  220  VKKA------SPARE--KPPEVINAWELMEGLDETEM---PAAKKSPKARSFLD----HR  354
             +        +P  E    PE+I++WELM GLD       P  KK  ++  F      H+
Sbjct  61   PRFTLGSIFPTPLTEPKSRPEIIDSWELMSGLDTDSFRFSPIIKKDQESSHFSSFFKKHQ  120

Query  355  RSPLKFLNQLASPGKLRR  408
             +P  F  +  SP  L +
Sbjct  121  ETPF-FSKENTSPKLLLK  137



>ref|XP_003553622.1| PREDICTED: uncharacterized protein At5g39865-like [Glycine max]
Length=254

 Score =   144 bits (364),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 83/167 (50%), Positives = 108/167 (65%), Gaps = 10/167 (6%)
 Frame = +1

Query  754   LEQFNQKCPPAGE-NSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFK  930
             L  F +  P  G  +S+++YTT+LRGIRKTF+DCNT R +L S  +   ERDVS+H  F+
Sbjct  89    LSDFKELRPQGGNSHSIILYTTSLRGIRKTFQDCNTIRFLLRSFKIMYHERDVSLHLEFR  148

Query  931   EELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQAGAG--CDGCAG  1104
             EEL  ++G  V+  P +F+KGR IGGADEVV L E G LG  L G P   +   C GCA 
Sbjct  149   EELWKILGGKVIP-PKLFIKGRYIGGADEVVGLHEMGWLGKFLEGTPTHSSDSPCTGCAN  207

Query  1105  VRFVLCLNCNGSCKVLGEDLKNT------VKCGECNENGLIQCPICC  1227
             +RF +C NC GSCKV  ++  N       V+C  CNENGL++CP+CC
Sbjct  208   MRFTICSNCCGSCKVFTDNSDNKNNDECFVRCSLCNENGLVKCPVCC  254



>ref|XP_003631079.1| hypothetical protein MTR_8g106900 [Medicago truncatula]
 gb|ABE80146.1| Thioredoxin fold [Medicago truncatula]
 gb|AET05555.1| glutaredoxin (GRX) family protein [Medicago truncatula]
 gb|AFK47600.1| unknown [Medicago truncatula]
Length=274

 Score =   145 bits (365),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 116/166 (70%), Gaps = 7/166 (4%)
 Frame = +1

Query  748   TILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGF  927
             T+ ++F + CPP GE  VVIYTTTLRG+R+TFE CN  R+  ++  V+  ERDVSM SGF
Sbjct  108   TLSDRFERICPPNGEKKVVIYTTTLRGVRRTFEACNAVRAAFDAFGVQICERDVSMDSGF  167

Query  928   KEELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQAG----AGCDG  1095
             KEELR L+   +V  P VFVKG  IGGA+E++K+ EEG LG ++ G+P+        C+G
Sbjct  168   KEELRELLKEKMVVPPRVFVKGYYIGGAEEMLKVVEEGLLGEVIQGLPRKAVGGGGVCEG  227

Query  1096  CAGVRFVLCLNCNGSCKVLGEDLKN---TVKCGECNENGLIQCPIC  1224
             C  +RF+ C  CNGSCK++ +  +     VKCG+CNENGL+QCPIC
Sbjct  228   CGDMRFLPCFRCNGSCKMVNKQKQGNTVVVKCGDCNENGLVQCPIC  273



>ref|XP_002967841.1| hypothetical protein SELMODRAFT_88028 [Selaginella moellendorffii]
 gb|EFJ31188.1| hypothetical protein SELMODRAFT_88028 [Selaginella moellendorffii]
Length=223

 Score =   143 bits (361),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 81/161 (50%), Positives = 105/161 (65%), Gaps = 4/161 (2%)
 Frame = +1

Query  751   ILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFK  930
              +E F Q CPP GE+SVV+Y T+LRGIRKT+EDC + + +  +  +   ERDVSMHSGF+
Sbjct  21    FVESFQQCCPPGGESSVVLYCTSLRGIRKTYEDCRSMQMLFRTLGINIDERDVSMHSGFR  80

Query  931   EELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQ---AGAGCDGCA  1101
              ELR L+G   V +P VF+ GR IGGA+EV  + E+G L  LL G+     +   CDGC 
Sbjct  81    TELRQLLGA-PVGLPRVFIGGRFIGGAEEVRSMHEQGNLARLLQGMVSRHGSFLACDGCG  139

Query  1102  GVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPIC  1224
             G+RFV C  C GSCK+         KC  CNENG+++CPIC
Sbjct  140   GMRFVPCRWCRGSCKLFLVGGGGVKKCPHCNENGIVRCPIC  180



>ref|XP_002981678.1| hypothetical protein SELMODRAFT_114914 [Selaginella moellendorffii]
 gb|EFJ17160.1| hypothetical protein SELMODRAFT_114914 [Selaginella moellendorffii]
Length=228

 Score =   143 bits (361),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 81/161 (50%), Positives = 105/161 (65%), Gaps = 4/161 (2%)
 Frame = +1

Query  751   ILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFK  930
              +E F Q CPP GE+SVV+Y T+LRGIRKT+EDC + + +  +  +   ERDVSMHSGF+
Sbjct  26    FVESFQQCCPPGGESSVVLYCTSLRGIRKTYEDCRSMQMLFRTLGINIDERDVSMHSGFR  85

Query  931   EELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQ---AGAGCDGCA  1101
              ELR L+G   V +P VF+ GR IGGA+EV  + E+G L  LL G+     +   CDGC 
Sbjct  86    TELRQLLGA-PVGLPRVFIAGRFIGGAEEVRSMHEQGNLARLLQGMVSRHGSFLACDGCG  144

Query  1102  GVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPIC  1224
             G+RFV C  C GSCK+         KC  CNENG+++CPIC
Sbjct  145   GMRFVPCRWCRGSCKLFLVGGGGVKKCPHCNENGIVRCPIC  185



>ref|XP_010937069.1| PREDICTED: uncharacterized protein At3g28850-like [Elaeis guineensis]
Length=440

 Score =   148 bits (374),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 129/371 (35%), Positives = 168/371 (45%), Gaps = 74/371 (20%)
 Frame = +1

Query  232   SPAREKP--PEVINAWELMEGLDETE--MPA-AKKSPKARSFLDHRRSPLKFLNQLASPG  396
             +P+R  P  PE INAWELMEGL++T    PA A  +   RSF  H        + L +P 
Sbjct  105   TPSRTPPNEPETINAWELMEGLEDTSPLRPAYAAAAGVDRSFSFHITR-----DALPAPD  159

Query  397   KLRRSGGKENKPGRAMGRSEFSPKTVPKAYNLQESPWRVSPR----LRSLKKGSPKLSPN  564
              L RS          +    FSPK  P    L      VS      L + +K   +LSP 
Sbjct  160   SLSRS---------KLANGSFSPK--PDWMQLSPGDSIVSDFDPEVLSTFRKALEELSPP  208

Query  565   ELKCDSMRAESMAVCTRRSLNPLFNPeigeklsseeeeqikkMISSTPVSRKSRKSQEAA  744
                                   L+ P    +  +              V  +    QE  
Sbjct  209   H-------------------PALYRPNEPPEKMTGGGYSGDIPNFQGIVRARIDAFQEKI  249

Query  745   DTILEQFN---------QKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTF  897
             D     FN          KC P GE  VV Y T+LRGIRKT+EDC   + IL+ + VR  
Sbjct  250   DEKRASFNSNAAKVAPLDKCLPGGEGKVVFYFTSLRGIRKTYEDCWAVKVILQGYGVRID  309

Query  898   ERDVSMHSGFKEELRGLMGTMV--VKVPLVFVKGRMIGGADEVVkleeegklgil----l  1059
             ERDVSMH GFKEEL  L+GT     ++P VF  G+ +GGADEV ++ E G+LG       
Sbjct  310   ERDVSMHGGFKEELNELLGTGYGCWRLPRVFADGKHLGGADEVRQMHETGELGTALEGCE  369

Query  1060  sgiPQAGAG----CDGCAGVRFVLCLNCNGSCKVL-----------GEDLKNTVKCGECN  1194
                   G G    C+GC  VRF+ C  C+GSCKV             E+++   +C +CN
Sbjct  370   MVAVWKGGGVLDVCEGCGDVRFIPCTTCSGSCKVYVEEEEEEREEGDEEVRGFRRCMDCN  429

Query  1195  ENGLIQCPICC  1227
             ENGL++CP+CC
Sbjct  430   ENGLVRCPLCC  440



>ref|XP_006399120.1| hypothetical protein EUTSA_v10014515mg [Eutrema salsugineum]
 gb|ESQ40573.1| hypothetical protein EUTSA_v10014515mg [Eutrema salsugineum]
Length=245

 Score =   144 bits (362),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 83/165 (50%), Positives = 109/165 (66%), Gaps = 8/165 (5%)
 Frame = +1

Query  751   ILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFK  930
             IL +F + CPP GE+SVV YTT LRG+RKTFE C   R +LE+H V   ERDVSM S F+
Sbjct  81    ILLEFEENCPPGGEDSVVFYTTGLRGVRKTFEACRRVRFLLENHKVMYRERDVSMDSEFR  140

Query  931   EELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQAGAGCDGCAGVR  1110
             EE+  L+G  V   P +F++GR IGGADEVV L E GKL  LL GI    + C+ C   R
Sbjct  141   EEMWRLLGGKVTS-PRLFIRGRYIGGADEVVALNENGKLKKLLEGISLVESPCECCENER  199

Query  1111  FVLCLNCNGSCKVLGE-------DLKNTVKCGECNENGLIQCPIC  1224
             F++C +CNGS +++ +       + K   +C ECNENGL++CP+C
Sbjct  200   FLICSSCNGSSRLIADHRDEESSNDKMWTRCRECNENGLVKCPLC  244



>ref|XP_004300885.1| PREDICTED: uncharacterized protein LOC101315348 [Fragaria vesca 
subsp. vesca]
Length=362

 Score =   147 bits (370),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 79/161 (49%), Positives = 105/161 (65%), Gaps = 7/161 (4%)
 Frame = +1

Query  754   LEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFKE  933
             L  + +KCPP G +SVVIYTT+LRG+R+T+EDC   +S+ + + +   ERDV++H  F  
Sbjct  201   LSDYPEKCPPGGADSVVIYTTSLRGVRRTYEDCQRVKSVFDVNRLVYDERDVALHGEFLT  260

Query  934   ELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleee-gklgillsgiPQAGAG---CDGCA  1101
             EL+GL+G   + VP VFVKGR +GG +EVV+L E      I+     + GAG   C GC 
Sbjct  261   ELKGLVGEG-LGVPRVFVKGRYVGGVEEVVELNESGRLGRIVKWARVERGAGFQACGGCG  319

Query  1102  GVRFVLCLNCNGSCKVLGEDLKNTVKCGECNENGLIQCPIC  1224
             G RFV C+ C GSCKVL  D K   +CG+CNENGL+ C  C
Sbjct  320   GARFVPCMECGGSCKVLVGDKKE--RCGKCNENGLVYCVAC  358



>emb|CDY67834.1| BnaA10g30280D [Brassica napus]
Length=242

 Score =   144 bits (362),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 79/163 (48%), Positives = 111/163 (68%), Gaps = 6/163 (4%)
 Frame = +1

Query  751   ILEQFNQKCPPAGENSVVIYTTTLRGIRKTFEDCNTARSILESHHVRTFERDVSMHSGFK  930
             IL +F + CPP GE+SVV Y T LRG+RKTFE C   R +LE+H V+  ERDVS+ S ++
Sbjct  80    ILSEFEENCPPGGEDSVVFYATGLRGVRKTFEACRRVRFLLENHMVKYKERDVSVDSEYR  139

Query  931   EELRGLMGTMVVKVPLVFVKGRMIGGADEVVkleeegklgillsgiPQAGAGCDGCAGVR  1110
             +E+  L+G  V   P +F++GR IGGADEVV L E GKL  LL GI +A + C+ C   R
Sbjct  140   DEMWRLLGRKVTS-PRLFIRGRYIGGADEVVALNENGKLKKLLQGISRAHSPCECCLNER  198

Query  1111  FVLCLNCNGSCKVLGEDLKNT-----VKCGECNENGLIQCPIC  1224
             F++C +CNGS +++ +D + +      +C ECNE GL++CP+C
Sbjct  199   FLICSSCNGSSRLIADDEETSNGTMWTRCRECNEKGLVRCPLC  241



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3780637393212