BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c10320_g1_i1 len=1375 path=[1:0-1374]

Length=1375
                                                                      Score     E

ref|XP_009592797.1|  PREDICTED: agamous-like MADS-box protein AGL...    306   1e-97   
gb|AAQ72497.1|  MADS-box protein 9                                      301   7e-96   Petunia x hybrida [garden petunia]
ref|XP_009787834.1|  PREDICTED: agamous-like MADS-box protein AGL15     301   1e-95   
gb|ABD77426.1|  MADS-box protein 9                                      297   4e-94   Petunia x hybrida [garden petunia]
ref|XP_006345394.1|  PREDICTED: agamous-like MADS-box protein AGL...    290   2e-91   
ref|XP_004229674.1|  PREDICTED: agamous-like MADS-box protein AGL...    289   7e-91   
gb|KDP43607.1|  hypothetical protein JCGZ_16894                         281   4e-88   
ref|XP_010324817.1|  PREDICTED: agamous-like MADS-box protein AGL...    278   2e-86   
ref|XP_004307242.1|  PREDICTED: agamous-like MADS-box protein AGL...    274   2e-85   
ref|XP_008231548.1|  PREDICTED: agamous-like MADS-box protein AGL15     271   4e-84   
gb|AEL16646.1|  MADS-box protein AGL15                                  270   6e-84   
ref|XP_011091774.1|  PREDICTED: agamous-like MADS-box protein AGL15     268   6e-83   
gb|KDO83296.1|  hypothetical protein CISIN_1g025240mg                   262   1e-80   
ref|XP_006438919.1|  hypothetical protein CICLE_v10032519mg             262   1e-80   
ref|XP_006482951.1|  PREDICTED: agamous-like MADS-box protein AGL...    261   1e-80   
emb|CBI28594.3|  unnamed protein product                                259   6e-80   
ref|XP_011025506.1|  PREDICTED: agamous-like MADS-box protein AGL...    259   1e-79   
ref|XP_010659213.1|  PREDICTED: agamous-like MADS-box protein AGL...    259   1e-79   
ref|XP_009354365.1|  PREDICTED: agamous-like MADS-box protein AGL...    257   7e-79   
ref|XP_004516227.1|  PREDICTED: agamous-like MADS-box protein AGL...    256   2e-78   
ref|XP_008461826.1|  PREDICTED: agamous-like MADS-box protein AGL...    256   3e-78   
ref|XP_009368055.1|  PREDICTED: agamous-like MADS-box protein AGL15     255   4e-78   
ref|XP_010279516.1|  PREDICTED: MADS-box transcription factor 23-...    254   1e-77   
ref|XP_008461827.1|  PREDICTED: agamous-like MADS-box protein AGL...    254   1e-77   
ref|XP_004149728.1|  PREDICTED: agamous-like MADS-box protein AGL...    253   2e-77   
ref|XP_008349472.1|  PREDICTED: agamous-like MADS-box protein AGL15     252   5e-77   
ref|XP_010103280.1|  Agamous-like MADS-box protein AGL15                252   6e-77   
ref|XP_009354366.1|  PREDICTED: agamous-like MADS-box protein AGL...    252   6e-77   
ref|XP_011025507.1|  PREDICTED: agamous-like MADS-box protein AGL...    252   7e-77   
ref|XP_007219474.1|  hypothetical protein PRUPE_ppa021434mg             249   5e-76   
ref|XP_008461828.1|  PREDICTED: agamous-like MADS-box protein AGL...    249   6e-76   
gb|AAU87582.1|  MADS9 protein                                           247   5e-75   Gossypium hirsutum [American cotton]
ref|XP_010067793.1|  PREDICTED: agamous-like MADS-box protein AGL15     246   2e-74   
ref|XP_010694750.1|  PREDICTED: agamous-like MADS-box protein AGL...    244   5e-74   
ref|XP_010269745.1|  PREDICTED: agamous-like MADS-box protein AGL...    242   4e-73   
gb|AGW23369.1|  MADS box protein MADS67                                 239   4e-72   
ref|XP_006590360.1|  PREDICTED: AGL15 protein isoform X2                238   1e-71   
ref|XP_008346945.1|  PREDICTED: agamous-like MADS-box protein AGL15     238   2e-71   
ref|XP_010694755.1|  PREDICTED: agamous-like MADS-box protein AGL...    238   3e-71   
gb|AFX72882.1|  MADS-box protein AGL15                                  237   7e-71   
ref|XP_007149043.1|  hypothetical protein PHAVU_005G035900g             233   7e-70   
ref|XP_008461829.1|  PREDICTED: agamous-like MADS-box protein AGL...    233   2e-69   
gb|AHH28305.1|  MADS-box transcription factor                           229   2e-68   
ref|XP_002314062.1|  hypothetical protein POPTR_0009s06060g             230   3e-68   Populus trichocarpa [western balsam poplar]
ref|XP_010557822.1|  PREDICTED: agamous-like MADS-box protein AGL15     230   4e-68   
ref|XP_008461830.1|  PREDICTED: agamous-like MADS-box protein AGL...    226   5e-67   
gb|KEH17671.1|  MADS-box transcription factor                           226   7e-67   
ref|XP_010279517.1|  PREDICTED: MADS-box transcription factor 23-...    224   3e-66   
ref|NP_001237033.1|  AGL15 protein                                      221   3e-65   
ref|XP_006592528.1|  PREDICTED: agamous-like MADS-box protein AGL...    219   4e-64   
ref|XP_010653762.1|  PREDICTED: MADS-box transcription factor 23-...    218   1e-63   
ref|XP_002278584.1|  PREDICTED: MADS-box transcription factor 23-...    215   1e-62   Vitis vinifera
ref|XP_010547306.1|  PREDICTED: agamous-like MADS-box protein AGL...    213   1e-61   
gb|KHN22068.1|  Agamous-like MADS-box protein AGL15                     209   9e-61   
ref|XP_010492158.1|  PREDICTED: agamous-like MADS-box protein AGL...    210   1e-60   
ref|XP_010492156.1|  PREDICTED: agamous-like MADS-box protein AGL...    210   1e-60   
ref|XP_006575259.1|  PREDICTED: agamous-like MADS-box protein AGL...    208   4e-60   
ref|XP_010659214.1|  PREDICTED: agamous-like MADS-box protein AGL...    206   6e-60   
ref|XP_010547305.1|  PREDICTED: agamous-like MADS-box protein AGL...    208   8e-60   
ref|XP_010419984.1|  PREDICTED: agamous-like MADS-box protein AGL...    207   1e-59   
ref|XP_010419983.1|  PREDICTED: agamous-like MADS-box protein AGL...    207   1e-59   
ref|XP_011048083.1|  PREDICTED: agamous-like MADS-box protein AGL18     206   2e-59   
ref|XP_006289158.1|  hypothetical protein CARUB_v10002596mg             206   3e-59   
ref|XP_010453480.1|  PREDICTED: agamous-like MADS-box protein AGL...    206   3e-59   
ref|XP_010453478.1|  PREDICTED: agamous-like MADS-box protein AGL...    206   3e-59   
ref|XP_002873627.1|  hypothetical protein ARALYDRAFT_488202             206   4e-59   
ref|XP_007145592.1|  hypothetical protein PHAVU_007G251600g             205   5e-59   
ref|XP_010547303.1|  PREDICTED: agamous-like MADS-box protein AGL...    205   1e-58   
emb|CDY65963.1|  BnaA10g29830D                                          204   2e-58   
ref|NP_196883.1|  agamous-like MADS-box protein AGL15                   204   3e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004513865.1|  PREDICTED: agamous-like MADS-box protein AGL...    203   4e-58   
ref|XP_010492157.1|  PREDICTED: agamous-like MADS-box protein AGL...    202   8e-58   
ref|XP_002308020.1|  AGL15 family protein                               200   4e-57   Populus trichocarpa [western balsam poplar]
ref|XP_010547302.1|  PREDICTED: agamous-like MADS-box protein AGL...    201   5e-57   
ref|XP_009121726.1|  PREDICTED: agamous-like MADS-box protein AGL...    199   1e-56   
ref|XP_010453479.1|  PREDICTED: agamous-like MADS-box protein AGL...    199   2e-56   
gb|ADD82424.1|  MADS-box protein AGL15                                  196   4e-56   Dimocarpus longan [longan]
emb|CDX70519.1|  BnaC03g06030D                                          197   1e-55   
ref|XP_007028680.1|  AGAMOUS-like 18, putative                          196   2e-55   
ref|XP_009131360.1|  PREDICTED: agamous-like MADS-box protein AGL...    196   4e-55   
emb|CDY67731.1|  BnaCnng56130D                                          195   5e-55   
sp|Q39295.1|AGL15_BRANA  RecName: Full=Agamous-like MADS-box prot...    195   5e-55   Brassica napus [oilseed rape]
gb|AAB03807.1|  AGL15 type 2                                            195   5e-55   Brassica napus [oilseed rape]
emb|CDP14125.1|  unnamed protein product                                194   6e-55   
ref|XP_006492965.1|  PREDICTED: agamous-like MADS-box protein AGL...    194   7e-55   
ref|XP_010653763.1|  PREDICTED: MADS-box transcription factor 23-...    194   7e-55   
ref|XP_006421311.1|  hypothetical protein CICLE_v10005698mg             194   1e-54   
gb|ABD77425.1|  agamous-like 15                                         193   4e-54   Brassica napus [oilseed rape]
ref|XP_009592798.1|  PREDICTED: agamous-like MADS-box protein AGL...    190   1e-53   
dbj|BAJ53208.1|  JHL06B08.10                                            191   2e-53   
gb|AAC49083.1|  MADS-box protein AGL15                                  191   3e-53   Arabidopsis thaliana [mouse-ear cress]
emb|CBI29819.3|  unnamed protein product                                186   1e-52   
ref|XP_009131359.1|  PREDICTED: agamous-like MADS-box protein AGL...    189   1e-52   
ref|XP_010269746.1|  PREDICTED: agamous-like MADS-box protein AGL...    185   2e-52   
gb|KEH41633.1|  MADS-box transcription factor                           187   3e-52   
gb|KFK25606.1|  hypothetical protein AALP_AA8G136400                    188   5e-52   
ref|XP_009591403.1|  PREDICTED: MADS-box transcription factor 23-...    185   1e-51   
ref|XP_009758657.1|  PREDICTED: MADS-box transcription factor 23-...    185   1e-51   
ref|XP_009612621.1|  PREDICTED: MADS-box transcription factor 23-...    184   5e-51   
ref|XP_008351603.1|  PREDICTED: agamous-like MADS-box protein AGL18     184   1e-50   
ref|XP_009363197.1|  PREDICTED: agamous-like MADS-box protein AGL...    182   3e-50   
ref|XP_009335208.1|  PREDICTED: agamous-like MADS-box protein AGL...    181   9e-50   
ref|XP_009121728.1|  PREDICTED: agamous-like MADS-box protein AGL...    181   1e-49   
ref|XP_009363196.1|  PREDICTED: agamous-like MADS-box protein AGL...    181   1e-49   
ref|XP_008244251.1|  PREDICTED: agamous-like MADS-box protein AGL18     181   2e-49   
ref|XP_009335207.1|  PREDICTED: agamous-like MADS-box protein AGL...    180   3e-49   
ref|XP_006843513.1|  hypothetical protein AMTR_s00053p00228660          176   8e-49   
ref|XP_010504666.1|  PREDICTED: agamous-like MADS-box protein AGL18     177   2e-48   
gb|KFK34974.1|  hypothetical protein AALP_AA5G218000                    171   4e-46   
emb|CDX88943.1|  BnaA04g02430D                                          171   9e-46   
ref|XP_010545211.1|  PREDICTED: agamous-like MADS-box protein AGL...    170   2e-45   
ref|XP_010545163.1|  PREDICTED: agamous-like MADS-box protein AGL...    170   4e-45   
emb|CDP16365.1|  unnamed protein product                                164   2e-44   
ref|XP_011075339.1|  PREDICTED: MADS-box transcription factor 23        166   4e-44   
ref|XP_008455789.1|  PREDICTED: MADS-box transcription factor 23-...    167   4e-44   
gb|AAM51776.1|AF425598_1  MADS-box gene 2 protein                       165   7e-44   Lycopodium annotinum
ref|XP_010516354.1|  PREDICTED: agamous-like MADS-box protein AGL18     165   1e-43   
emb|CDX72042.1|  BnaC08g28320D                                          164   2e-43   
gb|EYU42984.1|  hypothetical protein MIMGU_mgv1a025861mg                160   3e-43   
ref|XP_004249753.1|  PREDICTED: MADS-box transcription factor 23-...    163   3e-43   
ref|XP_004150520.1|  PREDICTED: agamous-like MADS-box protein AGL...    162   6e-43   
emb|CDY30998.1|  BnaC04g24260D                                          163   7e-43   
ref|XP_006291720.1|  hypothetical protein CARUB_v10017886mg             162   9e-43   
ref|NP_191298.1|  Agamous-like MADS-box protein AGL18                   162   1e-42   Arabidopsis thaliana [mouse-ear cress]
gb|AAM65178.1|  MADS transcription factor-like protein                  161   2e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010554819.1|  PREDICTED: agamous-like MADS-box protein AGL...    161   4e-42   
ref|XP_010554818.1|  PREDICTED: agamous-like MADS-box protein AGL...    160   5e-42   
ref|XP_010427610.1|  PREDICTED: agamous-like MADS-box protein AGL18     160   9e-42   
ref|XP_002984921.1|  MADS-domain transcription factor                   159   1e-41   
ref|XP_006351403.1|  PREDICTED: agamous-like MADS-box protein AGL...    158   2e-41   
emb|CDY33827.1|  BnaCnng07450D                                          158   3e-41   
ref|XP_009104054.1|  PREDICTED: agamous-like MADS-box protein AGL18     158   4e-41   
ref|XP_010279518.1|  PREDICTED: agamous-like MADS-box protein AGL...    156   6e-41   
ref|XP_009116442.1|  PREDICTED: agamous-like MADS-box protein AGL18     157   6e-41   
ref|XP_009139036.1|  PREDICTED: agamous-like MADS-box protein AGL18     157   8e-41   
emb|CDY06109.1|  BnaA09g36710D                                          154   7e-40   
dbj|BAC67017.1|  MADS-box transcription factor SrMADS1                  154   1e-39   Selaginella remotifolia
gb|AAM51780.1|AF425602_1  MADS-box gene 6 protein                       152   4e-39   Lycopodium annotinum
gb|KGN58566.1|  hypothetical protein Csa_3G686200                       150   5e-39   
ref|XP_008392265.1|  PREDICTED: agamous-like MADS-box protein AGL18     149   7e-39   
ref|XP_001774085.1|  MIKCC MADS-domain protein PpMADS-S                 153   8e-39   
gb|AAM74074.1|AF492455_1  MADS-box transcription factor                 150   9e-39   Cycas edentata
ref|XP_006647418.1|  PREDICTED: MADS-box transcription factor 27-...    150   3e-38   
ref|XP_006856591.1|  hypothetical protein AMTR_s00046p00208680          149   3e-38   
gb|ADE76318.1|  unknown                                                 149   6e-38   
emb|CAA70822.1|  MADS-box family transcription factor                   149   7e-38   Pinus resinosa [Canadian red pine]
gb|AGR53802.1|  DAL14 protein                                           148   1e-37   
gb|AAM76208.1|  AGAMOUS-like MADS-box transcription factor              147   1e-37   Ginkgo biloba [ginkgo]
gb|AAW78030.1|  AGAMOUS-like protein                                    147   2e-37   Thalictrum dioicum [early meadow-rue]
gb|AAB58907.1|  MADS-box protein                                        148   2e-37   Pinus radiata
emb|CAA56864.1|  dal1                                                   147   3e-37   Picea abies
dbj|BAD18011.1|  MADS-box transcription factor                          146   4e-37   Asparagus virgatus
ref|XP_008376862.1|  PREDICTED: MADS-box protein SOC1-like isofor...    147   4e-37   
gb|KHG12954.1|  MADS-box CMB1                                           147   4e-37   
gb|AAD09207.1|  putative MADS-box family transcription factor           146   4e-37   Pinus radiata
ref|XP_009129078.1|  PREDICTED: agamous-like MADS-box protein AGL3      147   5e-37   
dbj|BAD93166.1|  MADS-box transcription factor GbMADS2                  145   6e-37   Ginkgo biloba [ginkgo]
gb|AFO38187.1|  AGAMOUS1                                                145   6e-37   
ref|NP_001280901.1|  MADS-box protein SOC1-like                         145   8e-37   
gb|ADJ95380.1|  AGAMOUS-like protein                                    145   1e-36   
ref|XP_007045799.1|  MADS-box transcription factor                      145   1e-36   
ref|XP_008376871.1|  PREDICTED: MADS-box protein SOC1-like isofor...    145   1e-36   
dbj|BAC06829.1|  MADS-box protein PpMADS1                               146   2e-36   
ref|XP_001779871.1|  MIKCC MADS-domain protein PpMADS1                  146   2e-36   
ref|NP_001288330.1|  MADS-box transcription factor 27-like              144   2e-36   
gb|AAC97146.1|  AGAMOUS-like MADS-box transcription factor SMADS42B     144   2e-36   Picea mariana [black spruce]
ref|XP_009392819.1|  PREDICTED: MADS-box transcription factor 6-like    144   2e-36   
ref|XP_008459658.1|  PREDICTED: agamous-like MADS-box protein AGL...    144   2e-36   
gb|ACI23561.1|  agamous-like protein 2                                  144   3e-36   Gossypium barbadense [Egyptian cotton]
gb|AGW23350.1|  MADS box protein MADS48                                 144   3e-36   
ref|XP_002874596.1|  hypothetical protein ARALYDRAFT_489841             144   3e-36   
gb|AAS55893.1|  MIKC-type MADS-box protein                              145   3e-36   Physcomitrella patens
gb|ACF93432.1|  MADS10                                                  144   4e-36   Gossypium hirsutum [American cotton]
gb|EEC73475.1|  hypothetical protein OsI_07801                          144   4e-36   Oryza sativa Indica Group [Indian rice]
gb|AIE44767.1|  putative MADS-domain transcription factor AGL6.1        144   4e-36   
gb|AAD09342.1|  MADS box protein                                        143   4e-36   Pinus radiata
gb|AAD01266.1|  MADS box transcription factor                           143   4e-36   Pinus resinosa [Canadian red pine]
gb|AFI23876.1|  AGAMOUS1                                                143   5e-36   
dbj|BAD93174.1|  MADS-box transcription factor GbMADS10                 143   5e-36   Ginkgo biloba [ginkgo]
ref|NP_001267506.1|  agamous-like MADS-box protein AGL11-like           143   5e-36   
sp|Q40885.1|AG_PETHY  RecName: Full=Floral homeotic protein AGAMO...    144   5e-36   Petunia x hybrida [garden petunia]
ref|XP_009347901.1|  PREDICTED: MADS-box protein SOC1-like              143   5e-36   
ref|NP_001047230.1|  Os02g0579600                                       143   5e-36   Oryza sativa Japonica Group [Japonica rice]
gb|AAK21249.1|AF335236_1  MADS-box transcription factor FBP9            144   5e-36   Petunia x hybrida [garden petunia]
ref|NP_192734.1|  agamous-like MADS-box protein AGL11                   143   5e-36   Arabidopsis thaliana [mouse-ear cress]
gb|KHG12869.1|  Floral homeotic AGAMOUS -like protein                   144   6e-36   
gb|AAC97157.1|  AGAMOUS-like MADS-box transcriptional factor SAG1a      143   6e-36   Picea mariana [black spruce]
gb|AAS45683.1|  AGAMOUS-like protein                                    143   7e-36   Thalictrum dioicum [early meadow-rue]
ref|XP_006286826.1|  hypothetical protein CARUB_v10003771mg             143   7e-36   
ref|XP_010437821.1|  PREDICTED: agamous-like MADS-box protein AGL...    143   7e-36   
gb|ACD76823.1|  SEEDSTICK-like protein                                  143   7e-36   Capsella bursa-pastoris
ref|NP_001078364.1|  agamous-like MADS-box protein AGL11                144   7e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009421278.1|  PREDICTED: MADS-box transcription factor 3-like    142   8e-36   
ref|XP_001769862.1|  MIKCC MADS-domain protein PPM1                     144   8e-36   
gb|AHM92097.1|  MADS-box protein 21                                     143   8e-36   
ref|XP_008783531.1|  PREDICTED: MADS-box transcription factor 6-like    143   8e-36   
ref|XP_010421900.1|  PREDICTED: agamous-like MADS-box protein AGL...    142   9e-36   
dbj|BAD93165.1|  MADS-box transcription factor GbMADS1                  143   9e-36   Ginkgo biloba [ginkgo]
ref|XP_010421899.1|  PREDICTED: agamous-like MADS-box protein AGL...    143   9e-36   
ref|XP_009389276.1|  PREDICTED: MADS-box transcription factor 6-like    143   9e-36   
gb|KDP36700.1|  hypothetical protein JCGZ_07991                         142   9e-36   
ref|XP_010437827.1|  PREDICTED: agamous-like MADS-box protein AGL...    142   9e-36   
ref|XP_010108211.1|  Agamous-like MADS-box protein AGL18                142   1e-35   
ref|XP_010925573.1|  PREDICTED: floral homeotic protein AGAMOUS-like    142   1e-35   
ref|XP_010934013.1|  PREDICTED: MADS-box transcription factor 6-like    142   1e-35   
emb|CAA55867.1|  DAL2 protein                                           142   1e-35   Picea abies
gb|ADD25198.1|  AGL6                                                    143   1e-35   Nuphar advena
gb|AAG09919.1|AF112149_1  MADS box protein 2                            142   1e-35   Zea mays [maize]
gb|ABM69042.1|  MADS-box protein MADS4                                  143   1e-35   Gossypium hirsutum [American cotton]
gb|AAL92522.1|  AG-like protein                                         142   1e-35   Gossypium hirsutum [American cotton]
ref|XP_008219059.1|  PREDICTED: agamous-like MADS-box protein AGL...    142   1e-35   
gb|AAG09136.2|AF150932_1  MADS-domain protein PPM1                      144   1e-35   Physcomitrella patens
gb|EPS59667.1|  hypothetical protein M569_15138                         139   1e-35   
ref|XP_009397558.1|  PREDICTED: MADS-box transcription factor 6-like    142   1e-35   
dbj|BAC97837.1|  duplicated                                             142   1e-35   Ipomoea nil [qian niu]
ref|XP_010437812.1|  PREDICTED: agamous-like MADS-box protein AGL...    143   1e-35   
ref|XP_004136416.1|  PREDICTED: MADS-box transcription factor 27-...    142   1e-35   
gb|AAT46096.1|  AGAMOUS-like protein                                    142   1e-35   Akebia trifoliata
ref|XP_010930411.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    142   1e-35   
ref|XP_010421898.1|  PREDICTED: agamous-like MADS-box protein AGL...    143   1e-35   
ref|XP_009404530.1|  PREDICTED: floral homeotic protein AGAMOUS-like    142   1e-35   
ref|NP_001104926.1|  MADS2                                              142   1e-35   Zea mays [maize]
ref|XP_007025251.1|  K-box region and MADS-box transcription fact...    142   1e-35   
ref|XP_002977833.1|  MADS-domain transcription factor                   144   2e-35   
ref|XP_002979492.1|  MADS-domain transcription factor                   144   2e-35   
gb|ADP00515.1|  MADS-box factor MADS1                                   142   2e-35   
gb|ABB87186.1|  MADS-box protein                                        141   2e-35   Picea morrisonicola
gb|AGW23351.1|  MADS box protein MADS49                                 142   2e-35   
gb|AEZ51868.1|  AG MADS-box protein                                     141   2e-35   
ref|XP_009362389.1|  PREDICTED: agamous-like MADS-box protein AGL...    141   2e-35   
gb|ACB70410.1|  agamous MADS-box transcription factor                   141   2e-35   Hosta plantaginea [August lily]
dbj|BAB79434.1|  PMADS3                                                 142   2e-35   Petunia x hybrida [garden petunia]
gb|ADJ67241.1|  MADS box transcription factor 11                        142   2e-35   
ref|XP_008466134.1|  PREDICTED: MADS-box transcription factor 23-...    141   3e-35   
ref|XP_008654205.1|  PREDICTED: AGAMOUS-like protein isoform X1         142   3e-35   
ref|XP_009113582.1|  PREDICTED: agamous-like MADS-box protein AGL...    141   3e-35   
ref|XP_004952891.1|  PREDICTED: MADS-box transcription factor 27-...    141   3e-35   
ref|XP_009113581.1|  PREDICTED: agamous-like MADS-box protein AGL...    141   3e-35   
gb|AAD19360.2|  AGAMOUS homolog transcription factor                    141   3e-35   Hyacinthus orientalis [common hyacinth]
gb|AHM92098.1|  MADS-box protein 22                                     141   3e-35   
gb|AAQ83835.1|  MADS box protein                                        141   3e-35   Asparagus officinalis
gb|ABF50233.1|  AGAMOUS                                                 140   3e-35   Nicotiana langsdorffii x Nicotiana sanderae
ref|XP_006357766.1|  PREDICTED: MADS-box transcription factor 27-...    140   3e-35   
gb|EPS71714.1|  hypothetical protein M569_03044                         139   3e-35   
ref|XP_010518186.1|  PREDICTED: agamous-like MADS-box protein AGL6      141   3e-35   
ref|XP_008378733.1|  PREDICTED: agamous-like MADS-box protein AGL...    140   3e-35   
ref|XP_001776709.1|  MIKCC MADS-domain protein PPMC6                    142   4e-35   
ref|XP_010272608.1|  PREDICTED: MADS-box transcription factor 6-like    141   4e-35   
gb|AGV55405.1|  MADS-box transcription factor AGAMOUSa                  142   4e-35   
ref|XP_001757114.1|  MIKCC MADS-domain protein PPMC5                    142   4e-35   
ref|XP_008466131.1|  PREDICTED: MADS-box transcription factor 23-...    141   4e-35   
ref|XP_008466132.1|  PREDICTED: MADS-box transcription factor 23-...    141   4e-35   
ref|NP_001275579.1|  MADS-box protein CMB1-like                         141   4e-35   
dbj|BAD83772.1|  MADS-box transcription factor                          140   4e-35   Asparagus virgatus
gb|ACD39984.1|  MADS3                                                   141   5e-35   Carica papaya [mamon]
ref|XP_009802761.1|  PREDICTED: floral homeotic protein AGAMOUS i...    141   5e-35   
ref|XP_007025250.1|  K-box region and MADS-box transcription fact...    142   5e-35   
ref|XP_009586722.1|  PREDICTED: floral homeotic protein AGAMOUS i...    141   5e-35   
gb|AAS45686.1|  AGAMOUS-like protein                                    140   5e-35   Meliosma dilleniifolia
gb|ABV60385.1|  floral organ identity protein                           140   5e-35   Carica papaya [mamon]
gb|ABK35281.1|  MADS-box transcription factor AGL6a                     140   5e-35   Crocus sativus [saffron crocus]
gb|AHM92083.1|  MADS-box protein 7                                      141   5e-35   
ref|XP_004309724.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    141   6e-35   
ref|XP_006395681.1|  hypothetical protein EUTSA_v10004767mg             141   6e-35   
gb|AAS01766.1|  MADS-box protein 2                                      140   6e-35   Lilium longiflorum [Easter lily]
gb|AFY98824.1|  AGAMOUS-like protein                                    140   6e-35   
ref|XP_006354102.1|  PREDICTED: MADS-box protein CMB1-like              140   6e-35   
dbj|BAG48168.1|  MADS-box transcription factor                          140   6e-35   Malus domestica [apple tree]
gb|ABQ28694.1|  MADS box transcription factor                           140   7e-35   Narcissus tazetta var. chinensis
emb|CAC80857.1|  C-type MADS box protein                                140   7e-35   Malus domestica [apple tree]
ref|XP_006652364.1|  PREDICTED: MADS-box transcription factor 27-...    140   7e-35   
ref|XP_009586720.1|  PREDICTED: floral homeotic protein AGAMOUS i...    140   7e-35   
dbj|BAG69622.1|  MADS-box transcription factor                          140   7e-35   Lilium formosanum x Lilium longiflorum
ref|XP_009375842.1|  PREDICTED: agamous-like MADS-box protein AGL6      140   7e-35   
gb|AHY82573.1|  MADS-box protein 6                                      140   7e-35   
ref|XP_009802759.1|  PREDICTED: floral homeotic protein AGAMOUS i...    140   7e-35   
ref|XP_010917558.1|  PREDICTED: agamous-like MADS-box protein AGL...    140   7e-35   
gb|AFX82108.1|  MADS-box transcription factor AG1                       140   7e-35   
ref|XP_008376847.1|  PREDICTED: MADS-box protein SOC1-like isofor...    140   7e-35   
gb|AGV28074.1|  Bsister-like protein                                    140   7e-35   
ref|NP_001266181.1|  floral homeotic protein AGAMOUS                    140   8e-35   
dbj|BAM34482.1|  MADS-box transcription factor                          140   8e-35   
gb|ADK35760.1|  agamous-like protein 2                                  140   8e-35   
dbj|BAA90743.1|  MADS-box protein                                       140   8e-35   
gb|ADC79694.1|  SEPALLATA1-like protein                                 140   8e-35   
ref|XP_009347895.1|  PREDICTED: MADS-box protein SOC1-like isofor...    140   8e-35   
gb|AHH41528.1|  MADS-box transcription factor 1a                        140   8e-35   
ref|XP_004485955.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    140   9e-35   
dbj|BAC66963.1|  MADS-box transcription factor AG                       140   9e-35   
gb|AAS67610.1|  agamous MADS-box transcription factor 1a                139   9e-35   
dbj|BAK18784.2|  MADS-box protein                                       140   9e-35   
ref|NP_001266821.1|  uncharacterized protein LOC100832541               140   9e-35   
ref|XP_007020163.1|  K-box region and MADS-box transcription fact...    139   9e-35   
ref|XP_008794140.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    139   9e-35   
ref|XP_010316058.1|  PREDICTED: MADS-box transcription factor 23        139   9e-35   
gb|AFH74370.1|  AGAMOUS-like protein                                    139   9e-35   
gb|AAS67611.1|  agamous MADS-box transcription factor 1b                139   1e-34   
gb|ACV74250.1|  EXTRAPETALS                                             140   1e-34   
gb|ACY26070.1|  MADS-box transcription factor 3                         140   1e-34   
emb|CAB44457.1|  putative MADS domain transcription factor GGM11        140   1e-34   
dbj|BAC66964.1|  MADS-box transcription factor SEP1                     140   1e-34   
gb|AID22158.1|  AGAMOUS-like protein                                    140   1e-34   
ref|NP_001241489.1|  uncharacterized protein LOC100805092               140   1e-34   
emb|CAB44449.1|  putative MADS domain transcription factor GGM3         140   1e-34   
sp|Q38694.1|AGL9_ARADE  RecName: Full=Agamous-like MADS-box prote...    140   1e-34   
ref|XP_011030020.1|  PREDICTED: truncated transcription factor CA...    139   1e-34   
ref|XP_010315871.1|  PREDICTED: floral homeotic protein AGAMOUS i...    140   1e-34   
ref|NP_001190696.1|  agamous-like MADS-box protein AGL11                139   1e-34   
gb|AFH74367.1|  AGAMOUS-like protein                                    139   1e-34   
ref|XP_008225407.1|  PREDICTED: floral homeotic protein AGAMOUS i...    140   1e-34   
ref|NP_001280758.1|  agamous-like MADS-box protein AGL1                 139   1e-34   
ref|XP_006593452.1|  PREDICTED: uncharacterized protein LOC100805...    140   1e-34   
ref|XP_010673137.1|  PREDICTED: agamous-like MADS-box protein AGL15     140   1e-34   
emb|CAD23413.1|  m23                                                    141   1e-34   
ref|XP_010542871.1|  PREDICTED: agamous-like MADS-box protein AGL...    140   1e-34   
ref|XP_002880190.1|  hypothetical protein ARALYDRAFT_483701             140   1e-34   
ref|XP_006358067.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    140   1e-34   
gb|AAT46102.1|  AGAMOUS-like protein                                    139   1e-34   
gb|AFK13159.1|  agamous                                                 139   1e-34   
gb|AEA11211.1|  AGAMOUS-like protein                                    139   2e-34   
ref|XP_008219057.1|  PREDICTED: agamous-like MADS-box protein AGL...    139   2e-34   
gb|AAW66884.1|  MADS box transcription factor                           139   2e-34   
gb|ADB93926.1|  SEEDSTICK-like protein                                  139   2e-34   
gb|AGV40795.1|  MADS-box transcription factor 12                        139   2e-34   
gb|AAD38119.1|  AGAMOUS homolog                                         139   2e-34   
ref|XP_007223946.1|  hypothetical protein PRUPE_ppa011140mg             139   2e-34   
ref|XP_009351902.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    139   2e-34   
ref|XP_009116562.1|  PREDICTED: agamous-like MADS-box protein AGL1      139   2e-34   
ref|XP_009761698.1|  PREDICTED: MADS-box protein CMB1-like              139   2e-34   
ref|XP_006294857.1|  hypothetical protein CARUB_v10023910mg             139   2e-34   
ref|XP_002263410.2|  PREDICTED: MADS-box protein CMB1                   139   2e-34   
gb|AAY30856.1|  MADS-box transcription factor                           139   2e-34   
ref|XP_010917559.1|  PREDICTED: agamous-like MADS-box protein AGL...    139   2e-34   
gb|AIU94283.1|  floral homeotic protein AGAMOUS                         139   2e-34   
ref|XP_010506543.1|  PREDICTED: agamous-like MADS-box protein AGL...    138   2e-34   
gb|AEX58638.1|  AGL6-like protein                                       139   2e-34   
ref|XP_006377087.1|  hypothetical protein POPTR_0012s14020g             139   2e-34   
ref|XP_006358066.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    139   2e-34   
ref|XP_009766321.1|  PREDICTED: MADS-box transcription factor 23-...    139   2e-34   
ref|NP_001280849.1|  MADS-box protein CMB1-like                         139   2e-34   
gb|AGG68164.1|  MADS-box transcription factor                           139   2e-34   
emb|CAA04323.1|  MADS-box protein                                       139   3e-34   
gb|ADP06386.1|  AGAMOUS-LIKE2                                           139   3e-34   
emb|CDY09267.1|  BnaC03g62970D                                          139   3e-34   
gb|AEX92974.1|  MADS box protein 4                                      138   3e-34   
ref|XP_010506542.1|  PREDICTED: agamous-like MADS-box protein AGL...    139   3e-34   
ref|XP_007211925.1|  hypothetical protein PRUPE_ppa010595mg             139   3e-34   
gb|AEO52692.1|  AGAMOUS-like protein                                    138   3e-34   
ref|XP_009356654.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    139   3e-34   
gb|AEK33831.1|  agamous                                                 139   3e-34   
ref|XP_002991417.1|  MADS-domain transcription factor                   138   3e-34   
gb|AFH74399.1|  AGAMOUS-like protein                                    138   3e-34   
gb|ABS82743.1|  MADS-box protein                                        139   3e-34   
emb|CDY04164.1|  BnaA09g19420D                                          139   3e-34   
ref|XP_010911080.1|  PREDICTED: MADS-box transcription factor 6-like    139   3e-34   
gb|AAO20104.1|  mads-box transcription factor                           138   3e-34   
gb|AFH74368.1|  AGAMOUS-like protein                                    138   3e-34   
ref|XP_009421148.1|  PREDICTED: agamous-like MADS-box protein AGL11     138   3e-34   
gb|ABB92624.1|  AGAMOUS-like protein                                    138   3e-34   
ref|NP_001281016.1|  MADS-box protein CMB1-like                         139   3e-34   
gb|AAY25577.1|  AG                                                      138   3e-34   
gb|ADN22973.1|  mads-box transcription factor                           138   3e-34   
gb|ACG32928.1|  MADS-box transcription factor 3                         139   3e-34   
ref|XP_008459656.1|  PREDICTED: agamous-like MADS-box protein AGL...    138   3e-34   
sp|Q9XGJ4.1|GGM13_GNEGN  RecName: Full=MADS-box protein GGM13           138   3e-34   
ref|XP_010934917.1|  PREDICTED: MADS-box transcription factor 6-l...    139   3e-34   
ref|XP_009132380.1|  PREDICTED: floral homeotic protein AGAMOUS i...    139   3e-34   
ref|XP_009766322.1|  PREDICTED: MADS-box transcription factor 23-...    138   3e-34   
gb|EMS56192.1|  MADS-box transcription factor 13                        139   3e-34   
ref|XP_010106750.1|  MADS-box transcription factor 6                    139   4e-34   
dbj|BAD29571.1|  putative transcription factor MADS27                   138   4e-34   
ref|NP_567569.3|  MADS domain transcription factor AGAMOUS              139   4e-34   
gb|AFP23750.1|  AGAMOUS-like protein 6                                  139   4e-34   
gb|ABK28537.1|  unknown                                                 139   4e-34   
ref|NP_182089.1|  agamous-like MADS-box protein AGL6                    139   4e-34   
ref|XP_009595409.1|  PREDICTED: MADS-box transcription factor 23-...    138   4e-34   
ref|NP_001280931.1|  agamous-like MADS-box protein AGL11                138   4e-34   
sp|P17839.2|AG_ARATH  RecName: Full=Floral homeotic protein AGAMOUS     139   4e-34   
gb|AFP23737.1|  AGAMOUS-like protein 6                                  139   4e-34   
gb|AIJ29176.1|  AG-like MADS box protein                                138   4e-34   
gb|AFH74382.1|  AGAMOUS-like protein                                    137   4e-34   
gb|AHX58668.1|  AGAMOUS-like MADS-box transcription factor              138   4e-34   
ref|XP_004970830.1|  PREDICTED: MADS-box transcription factor 21-...    139   4e-34   
ref|XP_009419371.1|  PREDICTED: agamous-like MADS-box protein AGL...    138   4e-34   
ref|XP_009595408.1|  PREDICTED: MADS-box transcription factor 23-...    138   4e-34   
gb|ADP00516.1|  MADS-box factor MADS2                                   138   4e-34   
gb|KHG04329.1|  MADS-box CMB1                                           138   4e-34   
ref|NP_001289798.1|  uncharacterized protein LOC100836399               139   4e-34   
gb|AHM92066.1|  MADS-box protein 6                                      139   4e-34   
dbj|BAD93172.1|  MADS-box transcription factor GbMADS8                  138   4e-34   
gb|ABK35282.1|  MADS-box transcription factor AGL6b                     138   4e-34   
gb|AFH74369.1|  AGAMOUS-like protein                                    137   4e-34   
ref|XP_006449577.1|  hypothetical protein CICLE_v10016427mg             138   4e-34   
ref|XP_003578791.1|  PREDICTED: MADS-box transcription factor 13-...    138   4e-34   
ref|XP_009786109.1|  PREDICTED: MADS-box transcription factor 23-...    137   4e-34   
gb|AFH74389.1|  AGAMOUS-like protein                                    137   4e-34   
gb|AIU94432.1|  MADS-box transcription factor 2 isoform 3               138   4e-34   
gb|AFH74375.1|  AGAMOUS-like protein                                    137   4e-34   
ref|XP_006852690.1|  hypothetical protein AMTR_s00021p00254030          138   4e-34   
ref|XP_002317315.1|  MADS-box family protein                            138   5e-34   
ref|XP_008378732.1|  PREDICTED: agamous-like MADS-box protein AGL...    137   5e-34   
ref|NP_001280892.1|  agamous-like MADS-box protein AGL6                 138   5e-34   
ref|XP_008797646.1|  PREDICTED: MADS-box transcription factor 6         138   5e-34   
gb|AIU94430.1|  MADS-box transcription factor 2 isoform 2               138   5e-34   
ref|XP_007217264.1|  hypothetical protein PRUPE_ppa010578mg             138   5e-34   
gb|AAN15183.1|  MADS box protein GHMADS-2                               137   5e-34   
gb|AFH74386.1|  AGAMOUS-like protein                                    137   5e-34   
gb|AEL13789.1|  AGAMOUS                                                 137   5e-34   
gb|AFD36428.1|  AG-like MADS box transcription factor                   137   5e-34   
gb|AFH74371.1|  AGAMOUS-like protein                                    137   5e-34   
gb|AEJ76844.1|  MADS20                                                  138   5e-34   
ref|XP_009411419.1|  PREDICTED: MADS-box transcription factor 50-...    137   5e-34   
ref|XP_004229868.1|  PREDICTED: MADS-box transcription factor 6 i...    138   5e-34   
gb|AHC54144.1|  sepallata-like MADS box transcription factor 3          136   5e-34   
gb|ACJ26766.1|  MADS-11                                                 138   5e-34   
ref|XP_010508132.1|  PREDICTED: agamous-like MADS-box protein AGL6      138   5e-34   
dbj|BAM71401.1|  transcription factor                                   138   5e-34   
gb|ADP09005.1|  AGAMOUS-like protein                                    138   5e-34   
ref|XP_010542875.1|  PREDICTED: agamous-like MADS-box protein AGL...    137   5e-34   
gb|AGV15453.1|  MADS protein                                            137   5e-34   
ref|XP_002988315.1|  MADS-domain transcription factor                   137   5e-34   
gb|AAL76415.1|AF234617_1  MADS-box transcription factor                 138   5e-34   
ref|XP_007209505.1|  hypothetical protein PRUPE_ppa010391mg             138   5e-34   
ref|XP_010930410.1|  PREDICTED: MADS-box transcription factor 21-...    137   6e-34   
gb|AAZ95251.1|  AGAMOUS-like transcription factor                       137   6e-34   
ref|XP_009399817.1|  PREDICTED: MADS-box transcription factor 3-like    137   6e-34   
dbj|BAD88437.1|  MADS-box transcription factor CsMADS1                  140   6e-34   
gb|ACH72974.1|  AGAMOUS                                                 138   6e-34   
ref|XP_009136976.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    139   6e-34   
ref|XP_003518786.1|  PREDICTED: developmental protein SEPALLATA 1...    138   6e-34   
gb|KHN46234.1|  MADS-box transcription factor 27                        137   6e-34   
ref|XP_009595410.1|  PREDICTED: MADS-box transcription factor 23-...    137   6e-34   
ref|XP_009143157.1|  PREDICTED: agamous-like MADS-box protein AGL6      138   6e-34   
gb|AAC08529.1|  CUM10                                                   137   6e-34   
emb|CAM59043.1|  MIKC-type MADS-box transcription factor WM3B           138   6e-34   
ref|XP_007047796.1|  K-box region and MADS-box transcription fact...    137   6e-34   
ref|XP_004964768.1|  PREDICTED: MADS-box transcription factor 5-like    137   6e-34   
dbj|BAN08522.1|  homeotic AGL6 protein                                  138   6e-34   
ref|XP_006411552.1|  hypothetical protein EUTSA_v10017047mg             138   6e-34   
ref|XP_009786108.1|  PREDICTED: MADS-box transcription factor 23-...    137   6e-34   
ref|XP_004975863.1|  PREDICTED: MADS-box transcription factor 27-...    137   7e-34   
emb|CAE46181.1|  AGAMOUS-like MADS box transcription factor             137   7e-34   
gb|ABK41485.1|  putative MADS box protein                               137   7e-34   
dbj|BAA85630.1|  GpMADS3                                                138   7e-34   
gb|ADK95059.1|  mutant AGAMOUS-like protein                             137   7e-34   
ref|XP_010260833.1|  PREDICTED: MADS-box protein CMB1                   137   7e-34   
dbj|BAK20022.1|  PgMADS protein7                                        137   7e-34   
gb|AEI01160.1|  SHATTERPPOOF-like protein                               137   7e-34   
ref|XP_008786031.1|  PREDICTED: truncated transcription factor CA...    137   7e-34   
gb|ADP02394.1|  AGAMOUS-like protein                                    137   7e-34   
gb|AFH74385.1|  AGAMOUS-like protein                                    137   7e-34   
ref|XP_008444930.1|  PREDICTED: MADS-box protein SVP isoform X1         137   7e-34   
gb|ADD25196.1|  AG                                                      137   7e-34   
ref|XP_004485623.1|  PREDICTED: MADS-box transcription factor 27-...    137   7e-34   
gb|AGU92563.1|  SHATTERPROOF-like protein                               137   8e-34   
emb|CDX99406.1|  BnaC01g11460D                                          139   8e-34   
ref|XP_006467577.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    137   8e-34   
gb|ADD25206.1|  AG3                                                     137   8e-34   
gb|AHY82572.1|  MADS-box protein 5                                      137   8e-34   
ref|XP_009347898.1|  PREDICTED: MADS-box protein SOC1-like isofor...    137   8e-34   
ref|XP_008240082.1|  PREDICTED: MADS-box protein CMB1-like              137   8e-34   
ref|NP_565986.1|  agamous-like MADS-box protein AGL5                    137   8e-34   
gb|AAU82070.1|  SHATTERPROOF2                                           137   8e-34   
gb|KDO77975.1|  hypothetical protein CISIN_1g036452mg                   137   8e-34   
ref|XP_010934918.1|  PREDICTED: MADS-box transcription factor 6-l...    137   8e-34   
ref|NP_001105946.1|  AGAMOUS-like protein                               138   8e-34   
ref|XP_006284388.1|  hypothetical protein CARUB_v10005558mg             138   8e-34   
gb|KGN46222.1|  hypothetical protein Csa_6G076710                       139   8e-34   
gb|AAU82079.1|  SHATTERPROOF2                                           137   8e-34   
ref|XP_004296220.1|  PREDICTED: agamous-like MADS-box protein AGL...    138   9e-34   
emb|CAD40988.2|  OSJNBa0072F16.13                                       137   9e-34   
ref|XP_008801853.1|  PREDICTED: agamous-like MADS-box protein AGL...    137   9e-34   
gb|AFM30905.1|  transcription factor MADS5                              137   9e-34   
ref|XP_011093185.1|  PREDICTED: MADS-box transcription factor 6-like    137   9e-34   
gb|ACD76828.1|  AGAMOUS-like protein                                    137   9e-34   
gb|AGT80613.1|  AGL6-like MADS-box protein                              137   9e-34   
gb|AIU94287.1|  SEPALLATA1-like protein                                 137   9e-34   
gb|ADG45820.1|  mutant SHATTERPROOF-like protein                        137   9e-34   
gb|ADG45819.1|  SHATTERPROOF-like protein                               137   9e-34   
ref|XP_008673573.1|  PREDICTED: MADS-box transcription factor 3 i...    138   9e-34   
ref|XP_006358069.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    137   9e-34   
ref|XP_007220139.1|  hypothetical protein PRUPE_ppa019932mg             135   9e-34   
gb|AFS60086.1|  MADS box transcription factor SEP1                      137   9e-34   
gb|ABS82744.1|  MADS-box protein                                        137   9e-34   
ref|XP_002305048.1|  hypothetical protein POPTR_0004s06300g             137   1e-33   
gb|AFH74390.1|  AGAMOUS-like protein                                    137   1e-33   
gb|AIJ29174.1|  AG-like MADS box protein                                137   1e-33   
ref|XP_011009675.1|  PREDICTED: floral homeotic protein AGAMOUS-like    137   1e-33   
emb|CAB44455.1|  putative MADS domain transcription factor GGM9         137   1e-33   
dbj|BAG06959.1|  MADS-box transcription factor                          137   1e-33   
ref|XP_006467575.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    137   1e-33   
ref|XP_004238023.1|  PREDICTED: MADS-box transcription factor 23-...    137   1e-33   
ref|XP_010506126.1|  PREDICTED: agamous-like MADS-box protein AGL...    137   1e-33   
ref|XP_006467576.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    137   1e-33   
ref|XP_010451378.1|  PREDICTED: floral homeotic protein AGAMOUS         138   1e-33   
ref|XP_009401103.1|  PREDICTED: MADS-box transcription factor 3-like    137   1e-33   
gb|AGB51136.1|  Shatterproof                                            137   1e-33   
ref|XP_010538582.1|  PREDICTED: LOW QUALITY PROTEIN: floral homeo...    137   1e-33   
ref|XP_008794138.1|  PREDICTED: floral homeotic protein AGAMOUS-l...    137   1e-33   
gb|ACD76825.1|  SCHATTERPROOF2-like protein                             137   1e-33   



>ref|XP_009592797.1| PREDICTED: agamous-like MADS-box protein AGL15 isoform X1 [Nicotiana 
tomentosiformis]
Length=272

 Score =   306 bits (784),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 174/272 (64%), Positives = 209/272 (77%), Gaps = 21/272 (8%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKIDIKLIENVN+RQVTFSKRR+GLLKKA ELS+LCDAEVAVIIFSST KLFE++ST
Sbjct  1     MGRGKIDIKLIENVNNRQVTFSKRRAGLLKKANELSVLCDAEVAVIIFSSTGKLFEFAST  60

Query  516   SMKHTLSRYNKCLDSTETPKIvekk----------------pkvehkevevLNNEISELK  647
             SMK TLSRYN+C+ STE   I  K                  K E KEVE L +E+S+LK
Sbjct  61    SMKQTLSRYNRCVASTEISAIERKSEVNQQPQPQAQLQTHVQKQEQKEVESLKDELSKLK  120

Query  648   SKQLQLLGKDLTGMGLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENE  827
              KQL+LLGKDL G+GLNELR LEH+L+  LLAIK RKE+LL++QLENSR+QEERA++E+E
Sbjct  121   IKQLRLLGKDLNGLGLNELRLLEHQLNEGLLAIKDRKEELLIQQLENSRRQEERAVLESE  180

Query  828   NLRRQIEELRGLVPSNVSMPMPTPYLEYYPVLKNCSSGKDGAESL--NTGCDDDLDNEVS  1001
              LRRQ+EELRGL P  +S  +P PYLEY+P+ K     K+G ESL  +T C+D +D+E S
Sbjct  181   TLRRQVEELRGLFP--LSASLPPPYLEYHPLEKKYPIIKEGEESLDSDTACEDGVDDEDS  238

Query  1002  DTTLQLGPPTGSCRKRKTPDQETHSSNSENHL  1097
             +TTLQLG PT   RKRK P+QE+ SSNSEN +
Sbjct  239   NTTLQLGLPTIG-RKRKKPEQESPSSNSENQV  269



>gb|AAQ72497.1| MADS-box protein 9 [Petunia x hybrida]
 gb|ABY56804.1| MADS-box protein 9 [Petunia x hybrida]
Length=269

 Score =   301 bits (772),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 171/269 (64%), Positives = 209/269 (78%), Gaps = 18/269 (7%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKIDIKLIENVN+RQVTFSKRR+GLLKKA ELS+LCDAEVAVIIFSST KLFE+SST
Sbjct  1     MGRGKIDIKLIENVNNRQVTFSKRRAGLLKKANELSVLCDAEVAVIIFSSTGKLFEFSST  60

Query  516   SMKHTLSRYNKCLDSTETPKIvekkp-------------kvehkevevLNNEISELKSKQ  656
             SMK TLSRYN+CL STET  I +K               K E KE+++L +E+S+LK  Q
Sbjct  61    SMKQTLSRYNRCLASTETSAIEKKLEDNEQPQPLQTYVPKQEQKEMDILKDELSKLKMDQ  120

Query  657   LQLLGKDLTGMGLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLR  836
             L+LLGKDL+GMGLNELR LEH+L+  LLAIK RKE+LL++QLE SR+QEERA +E+E LR
Sbjct  121   LRLLGKDLSGMGLNELRLLEHQLNEGLLAIKDRKEELLIQQLEQSRRQEERAALESETLR  180

Query  837   RQIEELRGLVPSNVSMPMPTPYLEYYPVLKNCSSGKDGAESL--NTGCDDDLDNEVSDTT  1010
             RQ+EELRGL P  +S  +P PYLEY+P+ +     K+G ESL  +T C+D +D+E S+TT
Sbjct  181   RQLEELRGLFP--LSTSLPPPYLEYHPLEQKYPILKEGEESLDSDTACEDGVDDEDSNTT  238

Query  1011  LQLGPPTGSCRKRKTPDQETHSSNSENHL  1097
             LQLG P    RKRK P+Q++ SSNSEN +
Sbjct  239   LQLGLPIVG-RKRKKPEQDSPSSNSENQV  266



>ref|XP_009787834.1| PREDICTED: agamous-like MADS-box protein AGL15 [Nicotiana sylvestris]
Length=272

 Score =   301 bits (771),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 171/272 (63%), Positives = 207/272 (76%), Gaps = 21/272 (8%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKIDIKLIENVN+RQVTFSKRR+GLLKKA ELS+LCDAEVAVIIFSST KLFE+SST
Sbjct  1     MGRGKIDIKLIENVNNRQVTFSKRRAGLLKKANELSVLCDAEVAVIIFSSTSKLFEFSST  60

Query  516   SMKHTLSRYNKCLDSTETPKIvekk----------------pkvehkevevLNNEISELK  647
             SM+ TLSRYN+C+ STE   I  K                  K E KEV+ L +E+S+LK
Sbjct  61    SMQQTLSRYNRCVASTEISAIERKSEDNKQPQPQAQLQKHVQKQEQKEVDSLKDELSKLK  120

Query  648   SKQLQLLGKDLTGMGLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENE  827
              KQ++LLGKDL G+GL+ELR LEH+L+  LLAIK RKE+LL++QLENSR QEERA+ E+E
Sbjct  121   IKQMRLLGKDLNGLGLSELRLLEHQLNEGLLAIKDRKEELLIQQLENSRMQEERAVSESE  180

Query  828   NLRRQIEELRGLVPSNVSMPMPTPYLEYYPVLKNCSSGKDGAESL--NTGCDDDLDNEVS  1001
              LRRQ+EELRGL P  +S  +P PYLEY+P+ K     K+G ESL  +T C+D +D+E S
Sbjct  181   TLRRQVEELRGLFP--LSASLPPPYLEYHPLEKKYPIIKEGEESLDSDTACEDGVDDEDS  238

Query  1002  DTTLQLGPPTGSCRKRKTPDQETHSSNSENHL  1097
             +TTLQLG PT   RKRK P+QE+ SSNSEN +
Sbjct  239   NTTLQLGLPTIG-RKRKKPEQESPSSNSENQV  269



>gb|ABD77426.1| MADS-box protein 9 [Petunia x hybrida]
Length=269

 Score =   297 bits (760),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 170/269 (63%), Positives = 209/269 (78%), Gaps = 18/269 (7%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKIDIKLIENVN+RQVTFSKRR+GLLKKA ELS+LCDAEVAVIIFSST KLFE+SST
Sbjct  1     MGRGKIDIKLIENVNNRQVTFSKRRAGLLKKANELSVLCDAEVAVIIFSSTGKLFEFSST  60

Query  516   SMKHTLSRYNKCLDSTET------------PK-IvekkpkvehkevevLNNEISELKSKQ  656
             SMK TLSRYN+CL STET            P+ +    PK E KE+++L +E+S+LK  Q
Sbjct  61    SMKQTLSRYNRCLASTETSAREKKLEDNEQPQPLQTYVPKQEQKEMDILKDELSKLKMDQ  120

Query  657   LQLLGKDLTGMGLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLR  836
             L+LLGKDL+GMGLNELR LEH+L+  LLAIK RKE+LL++QLE SR+QEERA +E+E LR
Sbjct  121   LRLLGKDLSGMGLNELRLLEHQLNEGLLAIKDRKEELLIQQLEQSRRQEERAALESETLR  180

Query  837   RQIEELRGLVPSNVSMPMPTPYLEYYPVLKNCSSGKDGAESL--NTGCDDDLDNEVSDTT  1010
             RQ+EELRGL P  +S  +P  YLEY+P+ +     K+G ESL  +T C+D +D+E S+TT
Sbjct  181   RQLEELRGLFP--LSTSLPPSYLEYHPLEQKYPILKEGEESLDSDTACEDGVDDEDSNTT  238

Query  1011  LQLGPPTGSCRKRKTPDQETHSSNSENHL  1097
             LQLG P    RKRK P+Q++ SSNSEN +
Sbjct  239   LQLGLPIVG-RKRKKPEQDSPSSNSENQV  266



>ref|XP_006345394.1| PREDICTED: agamous-like MADS-box protein AGL15-like [Solanum 
tuberosum]
Length=271

 Score =   290 bits (742),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 169/270 (63%), Positives = 205/270 (76%), Gaps = 20/270 (7%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKIDIKLIENVN+RQVTFSKRR+GLLKKA ELS+LCD+EVAVIIFSST KLFE+SST
Sbjct  1     MGRGKIDIKLIENVNNRQVTFSKRRAGLLKKAGELSVLCDSEVAVIIFSSTGKLFEFSST  60

Query  516   SMKHTLSRYNKCLDSTETPKIvekkp--------------kvehkevevLNNEISELKSK  653
             SMK TLSRYN+C+ ST+   + +K                K E KEV+ L +E+++LK K
Sbjct  61    SMKQTLSRYNRCVASTDNSAVEKKSEDNEQPQSQQQTHVLKQEQKEVDSLKDELAKLKMK  120

Query  654   QLQLLGKDLTGMGLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENL  833
             QL+LLGKDL GMGLNELR LEH+L+  LLAIK RKE+LL++QLE SRKQEER+ +E E L
Sbjct  121   QLRLLGKDLNGMGLNELRLLEHQLNEGLLAIKERKEELLIQQLEYSRKQEERSALECEAL  180

Query  834   RRQIEELRGLVPSNVSMPMPTPYLEY-YPVLKNCSSGKDGAESL--NTGCDDDLDNEVSD  1004
             RRQ+EELRGL P  +S  +P P+LEY  P+ K  S  K+  ESL  +T C+D +D+E S+
Sbjct  181   RRQVEELRGLFP--LSASLPPPFLEYDRPLEKKYSILKESKESLDSDTACEDGVDDEDSN  238

Query  1005  TTLQLGPPTGSCRKRKTPDQETHSSNSENH  1094
             TTLQLG PT  CRKRK  +QE+ SSNSEN 
Sbjct  239   TTLQLGLPT-ICRKRKRTEQESPSSNSENQ  267



>ref|XP_004229674.1| PREDICTED: agamous-like MADS-box protein AGL15 isoform X2 [Solanum 
lycopersicum]
Length=271

 Score =   289 bits (739),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 169/271 (62%), Positives = 207/271 (76%), Gaps = 20/271 (7%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKIDIKLIEN+N+RQVTFSKRR+GLLKKA ELS+LCD+EVAVIIFSST KLFE+SST
Sbjct  1     MGRGKIDIKLIENLNNRQVTFSKRRAGLLKKAGELSVLCDSEVAVIIFSSTGKLFEFSST  60

Query  516   SMKHTLSRYNKCLDST------------ETPKIvekkp--kvehkevevLNNEISELKSK  653
             SMK TLSRYNKC+ ST            E P++ ++    K E KEV+ L +E+++LK K
Sbjct  61    SMKQTLSRYNKCVASTDNSAVEKKSEDNEQPQLQQQTHVLKQEQKEVDSLKDELAKLKMK  120

Query  654   QLQLLGKDLTGMGLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENL  833
             Q +LLGKDL GMGLNELR LEH+L+  LLAIK RKE+LL++QLE SRKQEER+ +E E L
Sbjct  121   QQRLLGKDLNGMGLNELRLLEHQLNEGLLAIKERKEELLIQQLEYSRKQEERSALECETL  180

Query  834   RRQIEELRGLVPSNVSMPMPTPYLEY-YPVLKNCSSGKDGAESL--NTGCDDDLDNEVSD  1004
             RRQ+EELRGL P  +S  +P P+LEY  P+ K  S  K+  ESL  +T C+D +D+E S+
Sbjct  181   RRQVEELRGLFP--LSASLPPPFLEYDRPLEKKYSILKESKESLDSDTACEDGVDDEDSN  238

Query  1005  TTLQLGPPTGSCRKRKTPDQETHSSNSENHL  1097
             TTLQLG PT  CRKRK  +QE+ SSNSEN +
Sbjct  239   TTLQLGLPT-ICRKRKRTEQESPSSNSENQV  268



>gb|KDP43607.1| hypothetical protein JCGZ_16894 [Jatropha curcas]
Length=255

 Score =   281 bits (719),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 155/257 (60%), Positives = 196/257 (76%), Gaps = 4/257 (2%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN NSRQVTFSKRR+GLLKKAQEL+ILCDAEVAVIIFS+T KLFE+SS 
Sbjct  1     MGRGKIEIKRIENANSRQVTFSKRRAGLLKKAQELAILCDAEVAVIIFSNTGKLFEFSSA  60

Query  516   SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMGL  695
              MK TL+RYNKCLDS+E  K+  K  K + KEV+VL  EI++L+ KQL+LLG+DLTG+ L
Sbjct  61    GMKRTLARYNKCLDSSEHIKVEYKAEKQDLKEVDVLKEEIAKLQVKQLRLLGQDLTGLSL  120

Query  696   NELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPS-  872
              EL+ LE +L+  LL +K RKE+LL+EQLE SR QE+RA++ENE LRRQ+EELRG  PS 
Sbjct  121   KELQLLEQQLNEGLLCVKERKEKLLMEQLEQSRVQEQRAMLENETLRRQVEELRGFFPST  180

Query  873   NVSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVSDTTLQLGPPTGSCRKRK  1052
             N S+P    YLEYY + +  S   +G+ S +  C+  ++   SDTTL LG PT + RKRK
Sbjct  181   NHSVP---AYLEYYSIERKHSLTNNGSASPDVACNCSMEKGDSDTTLHLGLPTDAYRKRK  237

Query  1053  TPDQETHSSNSENHLEL  1103
              P+ E+ S++SE+ L L
Sbjct  238   APEGESQSNDSESQLVL  254



>ref|XP_010324817.1| PREDICTED: agamous-like MADS-box protein AGL15 isoform X1 [Solanum 
lycopersicum]
Length=287

 Score =   278 bits (710),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 169/287 (59%), Positives = 207/287 (72%), Gaps = 36/287 (13%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKIDIKLIEN+N+RQVTFSKRR+GLLKKA ELS+LCD+EVAVIIFSST KLFE+SST
Sbjct  1     MGRGKIDIKLIENLNNRQVTFSKRRAGLLKKAGELSVLCDSEVAVIIFSSTGKLFEFSST  60

Query  516   SMKHTLSRYNKCLDST------------ETPKIvekkp--kvehkevevLNNEISELKSK  653
             SMK TLSRYNKC+ ST            E P++ ++    K E KEV+ L +E+++LK K
Sbjct  61    SMKQTLSRYNKCVASTDNSAVEKKSEDNEQPQLQQQTHVLKQEQKEVDSLKDELAKLKMK  120

Query  654   QLQLLGKDLTGMGLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENL  833
             Q +LLGKDL GMGLNELR LEH+L+  LLAIK RKE+LL++QLE SRKQEER+ +E E L
Sbjct  121   QQRLLGKDLNGMGLNELRLLEHQLNEGLLAIKERKEELLIQQLEYSRKQEERSALECETL  180

Query  834   RR----------------QIEELRGLVPSNVSMPMPTPYLEY-YPVLKNCSSGKDGAESL  962
             RR                Q+EELRGL P  +S  +P P+LEY  P+ K  S  K+  ESL
Sbjct  181   RRQGGSFLTQLLLPSHEIQVEELRGLFP--LSASLPPPFLEYDRPLEKKYSILKESKESL  238

Query  963   --NTGCDDDLDNEVSDTTLQLGPPTGSCRKRKTPDQETHSSNSENHL  1097
               +T C+D +D+E S+TTLQLG PT  CRKRK  +QE+ SSNSEN +
Sbjct  239   DSDTACEDGVDDEDSNTTLQLGLPT-ICRKRKRTEQESPSSNSENQV  284



>ref|XP_004307242.1| PREDICTED: agamous-like MADS-box protein AGL15-like [Fragaria 
vesca subsp. vesca]
Length=258

 Score =   274 bits (701),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 149/258 (58%), Positives = 195/258 (76%), Gaps = 2/258 (1%)
 Frame = +3

Query  330   KKMGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYS  509
             K MGRGKI+IK IEN+NSRQVTFSKRR GLLKKAQEL+ILCDAEVAVI+FS+T KLFE+S
Sbjct  3     KTMGRGKIEIKKIENINSRQVTFSKRRGGLLKKAQELAILCDAEVAVIVFSNTGKLFEFS  62

Query  510   STSMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGM  689
             S  MK T++RYNKC +S+ET  +  +  +   KEV+VL +E+ +L+SKQL+LLG DL+ +
Sbjct  63    SAGMKRTIARYNKCYESSETAPVESRAEEEHPKEVDVLKDELEKLQSKQLRLLGNDLSSL  122

Query  690   GLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVP  869
              L EL++LE +L   L ++K +KE+LL+EQLE SR QE+RA+VENE LR+QIEELR L P
Sbjct  123   SLKELQKLEDQLAEGLFSVKEKKEKLLMEQLEQSRVQEQRAIVENETLRKQIEELRRLYP  182

Query  870   SNVSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVSDTTLQLGPPTGSCRKR  1049
                +  +P+ YLEYYPV K  S    GA+S +   +   DN  SDTTLQLG P+ + RKR
Sbjct  183   -QAAHAVPS-YLEYYPVQKQNSPVNHGAKSPDLVSNFAFDNGDSDTTLQLGLPSETYRKR  240

Query  1050  KTPDQETHSSNSENHLEL  1103
             K P++E+HS++S + L L
Sbjct  241   KAPERESHSNDSGSQLGL  258



>ref|XP_008231548.1| PREDICTED: agamous-like MADS-box protein AGL15 [Prunus mume]
Length=254

 Score =   271 bits (692),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 152/256 (59%), Positives = 189/256 (74%), Gaps = 2/256 (1%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN NSRQVTFSKRR+GLLKKAQEL+ILCDAEVAVIIFS+T KLFE+SS 
Sbjct  1     MGRGKIEIKRIENANSRQVTFSKRRAGLLKKAQELAILCDAEVAVIIFSNTGKLFEFSSA  60

Query  516   SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMGL  695
              MK TLSRYNKCLDS+E      K  K + KE++VL +E ++L+ KQ++LLGKDLTG+ L
Sbjct  61    GMKQTLSRYNKCLDSSEDAAEESKAEKQDFKELDVLKDEFAKLQKKQVRLLGKDLTGLSL  120

Query  696   NELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPSN  875
              EL+QLE +L+  LL++K RKEQLL+EQLE SR QE+RA++ENE LRRQ+EELR L P  
Sbjct  121   KELQQLEQQLNEGLLSVKERKEQLLVEQLEQSRVQEQRAILENETLRRQVEELRCLFP-Q  179

Query  876   VSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVSDTTLQLGPPTGSCRKRKT  1055
                 +P+ YLEYYPV K  S    G  S +   +   +N  SD TL LG P+    KRK 
Sbjct  180   TDRAVPS-YLEYYPVEKEKSLVNHGVTSPDLVSNFAFENGDSDITLHLGLPSDVYGKRKA  238

Query  1056  PDQETHSSNSENHLEL  1103
             P++E HS++S + L L
Sbjct  239   PEREAHSNDSGSQLAL  254



>gb|AEL16646.1| MADS-box protein AGL15 [Dimocarpus longan]
Length=254

 Score =   270 bits (691),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 152/256 (59%), Positives = 191/256 (75%), Gaps = 3/256 (1%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN NSRQVTFSKRR+GLLKKAQEL+ILCDAEVAVI+FS+T KLFE+SS+
Sbjct  1     MGRGKIEIKRIENANSRQVTFSKRRAGLLKKAQELAILCDAEVAVIVFSNTGKLFEFSSS  60

Query  516   SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMGL  695
              MK TLSRYNKCL+ TET     K  K   KEV  L +EI++L++KQL+LLGKDL G+ L
Sbjct  61    GMKRTLSRYNKCLNFTETAVAEHKAEKQNTKEVNGLKDEITKLQAKQLRLLGKDLNGLSL  120

Query  696   NELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPSN  875
              EL+ LE +L+  LL +K +KEQLL+EQLE SR QE++A++ENE LRRQ+EELRG  PS 
Sbjct  121   KELQLLEQELNDGLLLVKEKKEQLLMEQLEQSRLQEQQAVLENETLRRQVEELRGFFPS-  179

Query  876   VSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVSDTTLQLGPPTGSCRKRKT  1055
                 +PT +LEY P L+  ++  + + S +   D  +D   SDTTLQLGPPT +  KRK 
Sbjct  180   TDCSVPT-FLEYCP-LQRRNALMNHSASPDIASDSAIDKGDSDTTLQLGPPTDNYHKRKA  237

Query  1056  PDQETHSSNSENHLEL  1103
             P+ ETHS +S + L L
Sbjct  238   PEGETHSHDSRSQLGL  253



>ref|XP_011091774.1| PREDICTED: agamous-like MADS-box protein AGL15 [Sesamum indicum]
Length=249

 Score =   268 bits (684),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 147/252 (58%), Positives = 189/252 (75%), Gaps = 5/252 (2%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN NSRQVTFSKRR+GL KKA ELS+LC+A+VAVIIFS+T K+F++SS+
Sbjct  1     MGRGKIEIKKIENANSRQVTFSKRRAGLFKKAYELSVLCEADVAVIIFSNTGKVFDFSSS  60

Query  516   SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMGL  695
             SMK  L+RY KCL+ T+ P + +K  K + KEV+VL  EI +LK KQL+ LGKD TGM L
Sbjct  61    SMKKILTRYKKCLELTQGPAVEQKPEKQQPKEVDVLKEEIEKLKLKQLRFLGKDFTGMSL  120

Query  696   NELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPS-  872
              +LR LE +L+  LL IK RKEQLL++QL  SR QE+RA++ENE LR+Q+EELR L PS 
Sbjct  121   QDLRALEQQLNEGLLCIKERKEQLLMQQLAQSRVQEQRAVLENETLRKQVEELRTLFPST  180

Query  873   NVSMPMPTPYLEYYPVLKNCSS-GKDGAESLNTGCDDDLDNEVSDTTLQLGPPTGSCRKR  1049
             + + P+    +E++  +K  +   K G+ S  T C+  L++E SDTTL LGPP+G  RKR
Sbjct  181   SYASPL---CIEFHSTVKKSNPVSKAGSRSPETACNGRLEDEDSDTTLHLGPPSGISRKR  237

Query  1050  KTPDQETHSSNS  1085
             KTPD ETHSS S
Sbjct  238   KTPDGETHSSTS  249



>gb|KDO83296.1| hypothetical protein CISIN_1g025240mg [Citrus sinensis]
Length=255

 Score =   262 bits (669),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 146/255 (57%), Positives = 187/255 (73%), Gaps = 4/255 (2%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN NSRQVTFSKRR+GLLKKAQEL+ILCDAEVAVIIFS+T KLFE+SS+
Sbjct  1     MGRGKIEIKRIENANSRQVTFSKRRAGLLKKAQELAILCDAEVAVIIFSNTGKLFEFSSS  60

Query  516   SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMGL  695
              MK TLSRYNKCLD +E      K  K + KEV+ L +EI++L+ KQL+LLGKDL G+ L
Sbjct  61    GMKRTLSRYNKCLDFSEVAVAEYKTEKQDSKEVDGLKDEIAKLQMKQLRLLGKDLNGLSL  120

Query  696   NELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLV-PS  872
              EL+ LE  L+  LL +K +KE+LL+EQLE SR QE+RA++ENE LRRQ+EELRG   P+
Sbjct  121   KELQLLEQDLNEGLLLVKEKKEKLLMEQLEQSRVQEQRAMLENETLRRQVEELRGFFPPT  180

Query  873   NVSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVSDTTLQLGPPTGSCRKRK  1052
               S+P    YLEYYP+ +  S     + + +   D  ++   SDTTL LG P+    KRK
Sbjct  181   ECSVP---AYLEYYPLGRKNSLMNHSSATPDVASDGAVEKGDSDTTLHLGLPSNLYHKRK  237

Query  1053  TPDQETHSSNSENHL  1097
              P++ET+S++S + L
Sbjct  238   APERETNSNDSRSQL  252



>ref|XP_006438919.1| hypothetical protein CICLE_v10032519mg [Citrus clementina]
 gb|ESR52159.1| hypothetical protein CICLE_v10032519mg [Citrus clementina]
Length=255

 Score =   262 bits (669),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 146/255 (57%), Positives = 187/255 (73%), Gaps = 4/255 (2%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN NSRQVTFSKRR+GLLKKAQEL+ILCDAEVAVIIFS+T KLFE+SS+
Sbjct  1     MGRGKIEIKRIENANSRQVTFSKRRAGLLKKAQELAILCDAEVAVIIFSNTGKLFEFSSS  60

Query  516   SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMGL  695
              MK TLSRYNKCLD +E      K  K + KEV+ L +EI++L+ KQL+LLGKDL G+ L
Sbjct  61    GMKRTLSRYNKCLDFSEAAVAEYKTEKQDSKEVDGLKDEIAKLQMKQLRLLGKDLNGLSL  120

Query  696   NELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLV-PS  872
              EL+ LE  L+  LL +K +KE+LL+EQLE SR QE+RA++ENE LRRQ+EELRG   P+
Sbjct  121   KELQLLEQDLNEGLLLVKEKKEKLLMEQLEQSRVQEQRAMLENETLRRQVEELRGFFPPT  180

Query  873   NVSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVSDTTLQLGPPTGSCRKRK  1052
               S+P    YLEYYP+ +  S     + + +   D  ++   SDTTL LG P+    KRK
Sbjct  181   ECSVP---AYLEYYPLGRKNSLMNHSSATPDVASDGAVEKGDSDTTLHLGLPSNLYHKRK  237

Query  1053  TPDQETHSSNSENHL  1097
              P++ET+S++S + L
Sbjct  238   APERETNSNDSRSQL  252



>ref|XP_006482951.1| PREDICTED: agamous-like MADS-box protein AGL15-like [Citrus sinensis]
Length=255

 Score =   261 bits (668),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 146/255 (57%), Positives = 187/255 (73%), Gaps = 4/255 (2%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN NSRQVTFSKRR+GLLKKAQEL+ILCDAEVAVIIFS+T KLFE+SS+
Sbjct  1     MGRGKIEIKRIENANSRQVTFSKRRAGLLKKAQELAILCDAEVAVIIFSNTGKLFEFSSS  60

Query  516   SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMGL  695
              MK TLSRYNKCLD +E      K  K + KEV+ L +EI++L+ KQL+LLGKDL G+ L
Sbjct  61    GMKRTLSRYNKCLDFSEAAVAEYKTEKQDSKEVDGLKDEIAKLQMKQLRLLGKDLNGLSL  120

Query  696   NELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLV-PS  872
              EL+ LE  L+  LL +K +KE+LL+EQLE SR QE+RA++ENE LRRQ+EELRG   P+
Sbjct  121   KELQLLEQDLNEGLLLVKEKKEKLLMEQLEQSRVQEQRAILENETLRRQVEELRGFFPPT  180

Query  873   NVSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVSDTTLQLGPPTGSCRKRK  1052
               S+P    YLEYYP+ +  S     + + +   D  ++   SDTTL LG P+    KRK
Sbjct  181   ECSVP---AYLEYYPLGRKNSLMNHSSATPDVASDGAVEKGDSDTTLHLGLPSNLYHKRK  237

Query  1053  TPDQETHSSNSENHL  1097
              P++ET+S++S + L
Sbjct  238   APERETNSNDSRSQL  252



>emb|CBI28594.3| unnamed protein product [Vitis vinifera]
Length=248

 Score =   259 bits (663),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 154/251 (61%), Positives = 194/251 (77%), Gaps = 6/251 (2%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN NSRQVTFSKRR GLLKKA EL+ILCDA+V VIIFS+T KLFE+SST
Sbjct  1     MGRGKIEIKKIENANSRQVTFSKRRVGLLKKASELAILCDAQVGVIIFSNTGKLFEFSST  60

Query  516   SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMGL  695
             SMK  +SRYNK LDS+E   +VE K + E KEV++L +EI +L+++QLQLLGKDL+G+ L
Sbjct  61    SMKRIISRYNK-LDSSEGA-LVEYKAEQEPKEVDILKDEIRKLQTRQLQLLGKDLSGLSL  118

Query  696   NELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPSN  875
              EL+ LE +L+ +LL++K RKEQ+L+EQLE SR QE+RA++ENE LRRQ+EELRGLVPS 
Sbjct  119   KELQNLEQQLNESLLSVKERKEQVLMEQLEQSRVQEQRAVLENETLRRQVEELRGLVPS-  177

Query  876   VSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVSDTTLQLGPPTGSCRKRKT  1055
              S  +  P+LEY+P+ +  S  K    S +  CD  ++ E SDTTLQLG PT   RKRK 
Sbjct  178   -SDRLVPPFLEYHPLERKDSITKSVVISPDV-CDFAVEREESDTTLQLGLPTEISRKRKA  235

Query  1056  PDQ-ETHSSNS  1085
             P + ET S+NS
Sbjct  236   PAKMETRSNNS  246



>ref|XP_011025506.1| PREDICTED: agamous-like MADS-box protein AGL15 isoform X1 [Populus 
euphratica]
Length=256

 Score =   259 bits (663),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 153/259 (59%), Positives = 189/259 (73%), Gaps = 7/259 (3%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN NSRQVTFSKRR+GLLKKAQEL+ILCDAEVAVI+FS+T KLFE+SS+
Sbjct  1     MGRGKIEIKKIENANSRQVTFSKRRAGLLKKAQELAILCDAEVAVIVFSNTGKLFEFSSS  60

Query  516   SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMGL  695
              MK TLSRYNK LDS E PKI  K  K + KEV+VL  EI++L+ KQ +L G DLTG+ L
Sbjct  61    GMKRTLSRYNKFLDSPEQPKIEYKAEKPDLKEVDVLKEEIAKLQVKQSRLSGMDLTGLSL  120

Query  696   NELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPSN  875
              +L+QLE +L+  LL +K +KE LL+EQLE SR QE+RA++ENE LRRQIEELRG  PS 
Sbjct  121   KDLQQLEKQLNEGLLFVKEKKEHLLMEQLEQSRVQEQRAMLENETLRRQIEELRGFFPS-  179

Query  876   VSMPMPTPYLEYYPVLKNCSSGKDGAESLNTG---CDDDLDNEVSDTTLQLGPPTGSCRK  1046
                P+P PYLE Y   +  S   +GA S       C   ++   SDTTL LG PT + RK
Sbjct  180   TDHPVP-PYLECYATERKNSPIDNGATSPPVAHYIC--SIEKVDSDTTLHLGLPTDTNRK  236

Query  1047  RKTPDQETHSSNSENHLEL  1103
             RK  + E+HS++S++ L L
Sbjct  237   RKALEGESHSNDSDSRLSL  255



>ref|XP_010659213.1| PREDICTED: agamous-like MADS-box protein AGL15 isoform X1 [Vitis 
vinifera]
Length=247

 Score =   259 bits (661),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 151/251 (60%), Positives = 191/251 (76%), Gaps = 7/251 (3%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN NSRQVTFSKRR GLLKKA EL+ILCDA+V VIIFS+T KLFE+SST
Sbjct  1     MGRGKIEIKKIENANSRQVTFSKRRVGLLKKASELAILCDAQVGVIIFSNTGKLFEFSST  60

Query  516   SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMGL  695
             SMK  +SRYNK LDS+E   +  +    E KEV++L +EI +L+++QLQLLGKDL+G+ L
Sbjct  61    SMKRIISRYNK-LDSSEGALV--EYKAEEPKEVDILKDEIRKLQTRQLQLLGKDLSGLSL  117

Query  696   NELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPSN  875
              EL+ LE +L+ +LL++K RKEQ+L+EQLE SR QE+RA++ENE LRRQ+EELRGLVPS 
Sbjct  118   KELQNLEQQLNESLLSVKERKEQVLMEQLEQSRVQEQRAVLENETLRRQVEELRGLVPS-  176

Query  876   VSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVSDTTLQLGPPTGSCRKRKT  1055
              S  +  P+LEY+P+ +  S  K    S +  CD  ++ E SDTTLQLG PT   RKRK 
Sbjct  177   -SDRLVPPFLEYHPLERKDSITKSVVISPDV-CDFAVEREESDTTLQLGLPTEISRKRKA  234

Query  1056  PDQ-ETHSSNS  1085
             P + ET S+NS
Sbjct  235   PAKMETRSNNS  245



>ref|XP_009354365.1| PREDICTED: agamous-like MADS-box protein AGL15 isoform X1 [Pyrus 
x bretschneideri]
Length=257

 Score =   257 bits (657),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 147/259 (57%), Positives = 188/259 (73%), Gaps = 5/259 (2%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN NSRQVTFSKRRSGLLKKAQEL+ILCDAEVAVIIFS+T +LFE+SS 
Sbjct  1     MGRGKIEIKRIENANSRQVTFSKRRSGLLKKAQELAILCDAEVAVIIFSNTGRLFEFSSA  60

Query  516   SMKHTLSRYNKCLDSTETP--KIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGM  689
              M+ TLSRYNKCLDS+E    +   +  K + KE++ L +E + L+ KQL+LLGK+LTG+
Sbjct  61    GMRQTLSRYNKCLDSSEDAPEEGKAEIQKQDSKELDNLKDEYANLQKKQLRLLGKELTGL  120

Query  690   GLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVP  869
              L EL+QLE +L+  LLA+K RKEQLL+EQLE SR QE+RA++ENE LRRQ+EELR L P
Sbjct  121   SLKELQQLEQQLNEGLLAVKERKEQLLMEQLEQSRIQEQRAVLENETLRRQVEELRCLFP  180

Query  870   SNVSMPMPTPYLEYYPVLK-NCSSGKDGAESLNTGCDDDLDNEVSDTTLQLGPPTGSCRK  1046
                +      ++EYYPV K  C   +    S +   +   +N  SDTTLQLG P+ +  K
Sbjct  181   Q--TDRAVRSFIEYYPVEKRKCLVNRGVTSSPDLVSNFAFENGDSDTTLQLGLPSDAYGK  238

Query  1047  RKTPDQETHSSNSENHLEL  1103
             RK P++E  S++S + L L
Sbjct  239   RKAPEREAQSNDSGSQLGL  257



>ref|XP_004516227.1| PREDICTED: agamous-like MADS-box protein AGL15-like [Cicer arietinum]
Length=248

 Score =   256 bits (654),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 144/252 (57%), Positives = 189/252 (75%), Gaps = 6/252 (2%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN NSRQVTFSKRR+GLLKKAQEL+ILCDAEVAVIIFS+T KLFE+SS+
Sbjct  1     MGRGKIEIKRIENANSRQVTFSKRRTGLLKKAQELAILCDAEVAVIIFSNTGKLFEFSSS  60

Query  516   SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMGL  695
              MK TLSRYNKC DS+ET  +  K  K + K VE+L +E+++L++ QL+LLGKDLTG+GL
Sbjct  61    GMKRTLSRYNKCADSSETAVVEYKTEKEDSKMVEILKDEVAKLETNQLRLLGKDLTGLGL  120

Query  696   NELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPSN  875
              EL  LE +++  L ++K RKE+LL+EQLE SR QE++AL+ENE LRRQ+EELR L P  
Sbjct  121   KELHHLEQQINEGLSSVKERKEELLMEQLEQSRIQEQKALLENETLRRQVEELRCLFPMT  180

Query  876   VSMPMPTPYLEYYPVLKNCSSGKDGAE--SLNTGCDDDLDNEVSDTTLQLGPPTGSCRKR  1049
               + +PT YL+Y+ + +  S  ++G +  SL   C +D  +  SDTTL LG P+    KR
Sbjct  181   EHV-IPT-YLQYHHIERKNSFVENGVKCPSLARNCANDKAD--SDTTLHLGLPSDVHHKR  236

Query  1050  KTPDQETHSSNS  1085
               P+++T S +S
Sbjct  237   NAPEKKTFSDDS  248



>ref|XP_008461826.1| PREDICTED: agamous-like MADS-box protein AGL15 isoform X1 [Cucumis 
melo]
Length=251

 Score =   256 bits (653),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 148/252 (59%), Positives = 187/252 (74%), Gaps = 10/252 (4%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN NSRQVTFSKRR+GLLKKAQEL+ILCDAEVAVIIFS+T KLFE+SS+
Sbjct  1     MGRGKIEIKRIENANSRQVTFSKRRAGLLKKAQELAILCDAEVAVIIFSNTGKLFEFSSS  60

Query  516   SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMGL  695
              MKHTL+RYNKC++S++    V K  K EH EV++L  EI+ L+ KQLQLLGKDLTG+G 
Sbjct  61    GMKHTLARYNKCVESSDATVDVHKVEKREHDEVDILREEITTLQMKQLQLLGKDLTGLGF  120

Query  696   NELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPSN  875
              EL+ LE +L+  LL +K +KEQLL+EQLE SR QE+RA++ENE LRRQ+ ELR L P  
Sbjct  121   KELQNLEQQLNEGLLLVKEKKEQLLMEQLEQSRVQEQRAMLENETLRRQVNELRCLFPP-  179

Query  876   VSMPMPTPYLEYYPVLKNCSSGKD--GAESLNTGCDDDLDNEVSDTTLQLGPPTGSCRKR  1049
             V  P+P  YLEY      CS  +   G  S +  C+ +++   SDTTL LG P+    KR
Sbjct  180   VDCPLPA-YLEY------CSLEQKNIGIRSPDMACNSEIERGDSDTTLHLGLPSHVYCKR  232

Query  1050  KTPDQETHSSNS  1085
             K  +++THS++S
Sbjct  233   KESERDTHSNDS  244



>ref|XP_009368055.1| PREDICTED: agamous-like MADS-box protein AGL15 [Pyrus x bretschneideri]
Length=257

 Score =   255 bits (652),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 150/259 (58%), Positives = 187/259 (72%), Gaps = 5/259 (2%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN NSRQVTFSKRRSGLLKKAQEL+ILCDAEVAVIIFS+T KLFE+SS 
Sbjct  1     MGRGKIEIKRIENANSRQVTFSKRRSGLLKKAQELAILCDAEVAVIIFSNTGKLFEFSSA  60

Query  516   SMKHTLSRYNKCLDSTETP--KIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGM  689
              M  TLSRYNKCLDS+E    +   +  K + KE++ L +E ++L+ KQL+LLGK+LT +
Sbjct  61    GMMRTLSRYNKCLDSSEDAPEEGKAEIQKQDCKELDNLKDEYAKLQKKQLRLLGKELTDL  120

Query  690   GLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVP  869
              L EL+QLE +L+  LL +K RKEQLL EQLE SR QE+RA++ENE LRRQ+EELR L P
Sbjct  121   SLKELQQLEQQLNEGLLTVKERKEQLLTEQLEQSRVQEQRAVLENETLRRQVEELRCLFP  180

Query  870   SNVSMPMPTPYLEYYPVLKNCSSGKDGA-ESLNTGCDDDLDNEVSDTTLQLGPPTGSCRK  1046
                +      YLEYYPV K  S    G   S +   +   +N  SDTTLQLG P+ +C K
Sbjct  181   Q--TDRAVQSYLEYYPVEKTKSLVNHGVTSSPDLVSNFAFENGDSDTTLQLGLPSDACGK  238

Query  1047  RKTPDQETHSSNSENHLEL  1103
             RK P++E +S++S + L L
Sbjct  239   RKAPEREANSNDSGSQLGL  257



>ref|XP_010279516.1| PREDICTED: MADS-box transcription factor 23-like isoform X1 [Nelumbo 
nucifera]
Length=255

 Score =   254 bits (649),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 145/250 (58%), Positives = 180/250 (72%), Gaps = 5/250 (2%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN  SRQVTFSKRR+GLLKKAQELSILCDAEVA+IIFSS  KLFE++S+
Sbjct  1     MGRGKIEIKRIENATSRQVTFSKRRAGLLKKAQELSILCDAEVALIIFSSCGKLFEFASS  60

Query  516   SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMGL  695
              MK TLSRYNKCLD +ET  +     K + KEV +L +EI+ L+    +++GK+L G+ L
Sbjct  61    CMKRTLSRYNKCLDCSETALVEYGAKKQQSKEVNILKDEIARLRMANRRMMGKELMGLSL  120

Query  696   NELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPSN  875
              EL+ LEH+L   +L++K RKEQLLLEQLE SR QE+RAL+ENE LR+Q+EELRGL+PS 
Sbjct  121   KELQNLEHQLSEGILSVKDRKEQLLLEQLEKSRLQEQRALLENETLRKQVEELRGLLPSP  180

Query  876   VSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNE-VSDTTLQLGPPTGSCRKRK  1052
               + MP PYL   P+ K     K    S N GC+   + +  SDT+L LG P+ SCRKRK
Sbjct  181   ECL-MP-PYLRLQPMEKKHFQIKQDVISSNMGCNCTFEKQGESDTSLHLGLPSDSCRKRK  238

Query  1053  TPDQETHSSN  1082
               D  T  SN
Sbjct  239   AHD--TSCSN  246



>ref|XP_008461827.1| PREDICTED: agamous-like MADS-box protein AGL15 isoform X2 [Cucumis 
melo]
Length=250

 Score =   254 bits (648),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 146/252 (58%), Positives = 187/252 (74%), Gaps = 11/252 (4%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN NSRQVTFSKRR+GLLKKAQEL+ILCDAEVAVIIFS+T KLFE+SS+
Sbjct  1     MGRGKIEIKRIENANSRQVTFSKRRAGLLKKAQELAILCDAEVAVIIFSNTGKLFEFSSS  60

Query  516   SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMGL  695
              MKHTL+RYNKC++S++   +   K + EH EV++L  EI+ L+ KQLQLLGKDLTG+G 
Sbjct  61    GMKHTLARYNKCVESSDAT-VDVHKVEREHDEVDILREEITTLQMKQLQLLGKDLTGLGF  119

Query  696   NELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPSN  875
              EL+ LE +L+  LL +K +KEQLL+EQLE SR QE+RA++ENE LRRQ+ ELR L P  
Sbjct  120   KELQNLEQQLNEGLLLVKEKKEQLLMEQLEQSRVQEQRAMLENETLRRQVNELRCLFPP-  178

Query  876   VSMPMPTPYLEYYPVLKNCSSGKD--GAESLNTGCDDDLDNEVSDTTLQLGPPTGSCRKR  1049
             V  P+P  YLEY      CS  +   G  S +  C+ +++   SDTTL LG P+    KR
Sbjct  179   VDCPLPA-YLEY------CSLEQKNIGIRSPDMACNSEIERGDSDTTLHLGLPSHVYCKR  231

Query  1050  KTPDQETHSSNS  1085
             K  +++THS++S
Sbjct  232   KESERDTHSNDS  243



>ref|XP_004149728.1| PREDICTED: agamous-like MADS-box protein AGL15-like [Cucumis 
sativus]
Length=246

 Score =   253 bits (646),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 143/252 (57%), Positives = 184/252 (73%), Gaps = 15/252 (6%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN NSRQVTFSKRR+GLLKKAQEL+ILCDAEVAVIIFS+T KLFE+SS+
Sbjct  1     MGRGKIEIKRIENANSRQVTFSKRRAGLLKKAQELAILCDAEVAVIIFSNTGKLFEFSSS  60

Query  516   SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMGL  695
              MKHTL+RYNKC++S++           + +EV++L  EI+ L+ KQLQLLGKDLTG+G 
Sbjct  61    GMKHTLARYNKCVESSDA-----TVDVHKVEEVDILREEITTLQMKQLQLLGKDLTGLGF  115

Query  696   NELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPSN  875
              EL+ LE +L+  LL +K +KEQLL+EQLE SR QE+RA++ENE LRRQ+ ELR L P  
Sbjct  116   KELQNLEQQLNEGLLLVKEKKEQLLMEQLEQSRVQEQRAMLENETLRRQVNELRCLFPP-  174

Query  876   VSMPMPTPYLEYYPVLKNCSSGKD--GAESLNTGCDDDLDNEVSDTTLQLGPPTGSCRKR  1049
             V  P+P  YLEY      CS  +   G  S +  C+ +++   SDTTL LG P+    KR
Sbjct  175   VDCPLPA-YLEY------CSLEQKNIGIRSPDMACNSEIERGDSDTTLHLGLPSHVYCKR  227

Query  1050  KTPDQETHSSNS  1085
             K  +++THS++S
Sbjct  228   KESERDTHSNDS  239



>ref|XP_008349472.1| PREDICTED: agamous-like MADS-box protein AGL15 [Malus domestica]
Length=257

 Score =   252 bits (644),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 146/259 (56%), Positives = 185/259 (71%), Gaps = 5/259 (2%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN NSRQVTFSKRRSGLLKKAQEL+ILCDAEVAVIIFS+T +LFE+SS 
Sbjct  1     MGRGKIEIKRIENANSRQVTFSKRRSGLLKKAQELAILCDAEVAVIIFSNTGRLFEFSSA  60

Query  516   SMKHTLSRYNKCLDSTETP--KIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGM  689
              M+ TLSRYNKCLDS+E    +   +  K + KE++ L +E + L+ KQL LLGK+LTG+
Sbjct  61    GMRQTLSRYNKCLDSSEDAPEEGKAEIQKQDSKELDNLKDEYANLQKKQLXLLGKELTGL  120

Query  690   GLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVP  869
              L EL+QLE +L+  LLA+K RKEQLL EQLE SR QE+RA++ENE LRRQ+EELR L P
Sbjct  121   SLKELQQLEQQLNEGLLAVKERKEQLLTEQLEQSRIQEQRAVLENETLRRQVEELRCLFP  180

Query  870   SNVSMPMPTPYLEYYPVLK-NCSSGKDGAESLNTGCDDDLDNEVSDTTLQLGPPTGSCRK  1046
                +      ++EYYPV K  C   +    S +   +   +N  SDTTLQLG P+ +  K
Sbjct  181   Q--TDXAVRSFIEYYPVEKRKCLVNRGVTSSPDLVSNFAFZNGDSDTTLQLGLPSDAYGK  238

Query  1047  RKTPDQETHSSNSENHLEL  1103
              K P++E  S++S + L L
Sbjct  239   XKAPEREAQSNDSGSQLGL  257



>ref|XP_010103280.1| Agamous-like MADS-box protein AGL15 [Morus notabilis]
 gb|EXB95305.1| Agamous-like MADS-box protein AGL15 [Morus notabilis]
Length=258

 Score =   252 bits (644),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 149/266 (56%), Positives = 186/266 (70%), Gaps = 19/266 (7%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN NSRQVTFSKRRSGLLKKAQEL+ILCDAEVAVIIFS+T KLFE+SS 
Sbjct  1     MGRGKIEIKRIENANSRQVTFSKRRSGLLKKAQELAILCDAEVAVIIFSNTGKLFEFSSC  60

Query  516   SMKHTLSRYNKCLDSTETP---KIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTG  686
              M  TLSRYNKC+D  + P   K      K + KEV+VL +EI++L++KQL+LLGKDL G
Sbjct  61    GMNRTLSRYNKCVDCPDAPIVSKAECTSQKQDSKEVDVLKDEIAKLQTKQLRLLGKDLGG  120

Query  687   MGLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLV  866
             + L EL+ LE +++  L ++K RKEQLL+EQLE SR QE+RA++ENE LRRQIEELR L 
Sbjct  121   LSLKELQHLEQQVNEGLSSVKERKEQLLMEQLEQSRMQEQRAILENETLRRQIEELRCLF  180

Query  867   P-SNVSMPMPTPYLEYYPVLK------NCSSGKDGAESLNTGCDDDLDNEVSDTTLQLGP  1025
             P +  ++P    YLEYYP+ K      +   G+D A +      D      SDTTL LG 
Sbjct  181   PRTECTVP---SYLEYYPIEKKNPIANHSGIGQDVASTFAVEKGD------SDTTLHLGL  231

Query  1026  PTGSCRKRKTPDQETHSSNSENHLEL  1103
                  RK K P+QE  S++S +H+ L
Sbjct  232   SNDVYRKMKAPEQEMQSNDSGSHMSL  257



>ref|XP_009354366.1| PREDICTED: agamous-like MADS-box protein AGL15 isoform X2 [Pyrus 
x bretschneideri]
Length=256

 Score =   252 bits (644),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 147/259 (57%), Positives = 187/259 (72%), Gaps = 6/259 (2%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN NSRQVTFSKRRSGLLKKAQEL+ILCDAEVAVIIFS+T +LFE+SS 
Sbjct  1     MGRGKIEIKRIENANSRQVTFSKRRSGLLKKAQELAILCDAEVAVIIFSNTGRLFEFSSA  60

Query  516   SMKHTLSRYNKCLDSTETP--KIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGM  689
              M+ TLSRYNKCLDS+E    +   +  K + KE++ L +E + L+ KQL LLGK+LTG+
Sbjct  61    GMRQTLSRYNKCLDSSEDAPEEGKAEIQKQDSKELDNLKDEYANLQKKQL-LLGKELTGL  119

Query  690   GLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVP  869
              L EL+QLE +L+  LLA+K RKEQLL+EQLE SR QE+RA++ENE LRRQ+EELR L P
Sbjct  120   SLKELQQLEQQLNEGLLAVKERKEQLLMEQLEQSRIQEQRAVLENETLRRQVEELRCLFP  179

Query  870   SNVSMPMPTPYLEYYPVLK-NCSSGKDGAESLNTGCDDDLDNEVSDTTLQLGPPTGSCRK  1046
                +      ++EYYPV K  C   +    S +   +   +N  SDTTLQLG P+ +  K
Sbjct  180   Q--TDRAVRSFIEYYPVEKRKCLVNRGVTSSPDLVSNFAFENGDSDTTLQLGLPSDAYGK  237

Query  1047  RKTPDQETHSSNSENHLEL  1103
             RK P++E  S++S + L L
Sbjct  238   RKAPEREAQSNDSGSQLGL  256



>ref|XP_011025507.1| PREDICTED: agamous-like MADS-box protein AGL15 isoform X2 [Populus 
euphratica]
Length=254

 Score =   252 bits (643),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 152/259 (59%), Positives = 187/259 (72%), Gaps = 9/259 (3%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN NSRQVTFSKRR+GLLKKAQEL+ILCDAEVAVI+FS+T KLFE+SS+
Sbjct  1     MGRGKIEIKKIENANSRQVTFSKRRAGLLKKAQELAILCDAEVAVIVFSNTGKLFEFSSS  60

Query  516   SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMGL  695
              MK TLSRYNK LDS E PKI  K  K + KEV+VL  EI++L+ KQ +L G DLTG+ L
Sbjct  61    GMKRTLSRYNKFLDSPEQPKIEYKAEKPDLKEVDVLKEEIAKLQVKQSRLSGMDLTGLSL  120

Query  696   NELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPSN  875
              +L+QLE +L+  LL +K +KE LL+EQLE SR Q  RA++ENE LRRQIEELRG  PS 
Sbjct  121   KDLQQLEKQLNEGLLFVKEKKEHLLMEQLEQSRVQ--RAMLENETLRRQIEELRGFFPS-  177

Query  876   VSMPMPTPYLEYYPVLKNCSSGKDGAESLNTG---CDDDLDNEVSDTTLQLGPPTGSCRK  1046
                P+P PYLE Y   +  S   +GA S       C   ++   SDTTL LG PT + RK
Sbjct  178   TDHPVP-PYLECYATERKNSPIDNGATSPPVAHYIC--SIEKVDSDTTLHLGLPTDTNRK  234

Query  1047  RKTPDQETHSSNSENHLEL  1103
             RK  + E+HS++S++ L L
Sbjct  235   RKALEGESHSNDSDSRLSL  253



>ref|XP_007219474.1| hypothetical protein PRUPE_ppa021434mg [Prunus persica]
 gb|EMJ20673.1| hypothetical protein PRUPE_ppa021434mg [Prunus persica]
Length=239

 Score =   249 bits (636),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 141/229 (62%), Positives = 172/229 (75%), Gaps = 2/229 (1%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN NSRQVTFSKRR+GLLKKAQEL+ILCDAEVAVIIFS+T KLFE+SS 
Sbjct  1     MGRGKIEIKRIENANSRQVTFSKRRAGLLKKAQELAILCDAEVAVIIFSNTGKLFEFSSA  60

Query  516   SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMGL  695
              MK TLSRYNKCLDS+E      K  K + KE++VL +E ++L+ KQ++LLGKDLTG+ L
Sbjct  61    GMKRTLSRYNKCLDSSEDAAEECKAEKQDSKELDVLKDEFAKLQKKQVRLLGKDLTGLSL  120

Query  696   NELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPSN  875
              EL+QLE +L+  LL++K RKEQLL+EQLE SR QE+RA++ENE LRRQ+EELR L P  
Sbjct  121   KELQQLEQQLNEGLLSVKERKEQLLVEQLEQSRVQEQRAILENETLRRQVEELRCLFP-Q  179

Query  876   VSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVSDTTLQLG  1022
                 +P+ YLEYYPV K  S    G  S +   +   +N  SD TL LG
Sbjct  180   TDRAVPS-YLEYYPVEKEKSLVHHGVTSPDLVSNFAFENGDSDITLHLG  227



>ref|XP_008461828.1| PREDICTED: agamous-like MADS-box protein AGL15 isoform X3 [Cucumis 
melo]
Length=249

 Score =   249 bits (637),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 147/252 (58%), Positives = 186/252 (74%), Gaps = 12/252 (5%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN NSRQVTFSKRR+GLLKKAQEL+ILCDAEVAVIIFS+T KLFE+SS+
Sbjct  1     MGRGKIEIKRIENANSRQVTFSKRRAGLLKKAQELAILCDAEVAVIIFSNTGKLFEFSSS  60

Query  516   SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMGL  695
              MKHTL+RYNKC++S++    V K  K EH EV++L  EI+ L+ KQLQLLGKDLTG+G 
Sbjct  61    GMKHTLARYNKCVESSDATVDVHKVEKREHDEVDILREEITTLQMKQLQLLGKDLTGLGF  120

Query  696   NELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPSN  875
              EL+ LE +L+  LL +K +KEQLL+EQLE SR  E+RA++ENE LRRQ+ ELR L P  
Sbjct  121   KELQNLEQQLNEGLLLVKEKKEQLLMEQLEQSR--EQRAMLENETLRRQVNELRCLFPP-  177

Query  876   VSMPMPTPYLEYYPVLKNCSSGKD--GAESLNTGCDDDLDNEVSDTTLQLGPPTGSCRKR  1049
             V  P+P  YLEY      CS  +   G  S +  C+ +++   SDTTL LG P+    KR
Sbjct  178   VDCPLPA-YLEY------CSLEQKNIGIRSPDMACNSEIERGDSDTTLHLGLPSHVYCKR  230

Query  1050  KTPDQETHSSNS  1085
             K  +++THS++S
Sbjct  231   KESERDTHSNDS  242



>gb|AAU87582.1| MADS9 protein [Gossypium hirsutum]
Length=254

 Score =   247 bits (631),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 142/256 (55%), Positives = 183/256 (71%), Gaps = 3/256 (1%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN NSRQVTFSKRR+GLLKKA+EL+ILCDAEVAVIIFS+T KLFE+SS+
Sbjct  1     MGRGKIEIKRIENANSRQVTFSKRRAGLLKKAKELAILCDAEVAVIIFSNTGKLFEFSSS  60

Query  516   SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMGL  695
              M  T+SRY     S E  ++  K  K + KE + L +EI++L+ KQLQLLGK+LT M L
Sbjct  61    GMNKTISRYKSAQGSPEIAQVEHKAEKQDSKEADHLKDEIAKLQMKQLQLLGKNLTSMSL  120

Query  696   NELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPSN  875
              EL+ LE +L+  LL++K +KEQLL++QLE SR QE+RA++ENE LRRQ+EELRG  P+ 
Sbjct  121   KELQLLEQQLNEGLLSVKEKKEQLLMQQLEQSRLQEQRAMLENETLRRQVEELRGFFPT-  179

Query  876   VSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVSDTTLQLGPPTGSCRKRKT  1055
                P+  PYLE YPV +  S       S +  C+  ++   SDTTL LG P+    KRK 
Sbjct  180   TDHPI-QPYLECYPVERKNSLMSHSIPSPDLTCNCTVEKGDSDTTLYLGLPS-DYHKRKK  237

Query  1056  PDQETHSSNSENHLEL  1103
             P+ E+HS+ SE+ L L
Sbjct  238   PEIESHSNESESQLGL  253



>ref|XP_010067793.1| PREDICTED: agamous-like MADS-box protein AGL15 [Eucalyptus grandis]
 gb|KCW65994.1| hypothetical protein EUGRSUZ_G03284 [Eucalyptus grandis]
Length=251

 Score =   246 bits (627),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 140/250 (56%), Positives = 177/250 (71%), Gaps = 9/250 (4%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN NSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFS+T KL+E+SS+
Sbjct  1     MGRGKIEIKRIENANSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSNTGKLYEFSSS  60

Query  516   SMKHTLSRYNKCLDSTETPKIvek--kpkvehkevevLNNEISELKSKQLQLLGKDLTGM  689
              MK  LSRYN+C DS E+  +  K    K + K V+ L +EI+EL+ +QL+LLGKDL G+
Sbjct  61    GMKQILSRYNRCQDSPESTVVEYKPESTKEDDKVVDTLKDEIAELQMRQLRLLGKDLNGL  120

Query  690   GLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVP  869
              + EL+ LE +L GAL ++K +KEQ LLEQLE SR QE+RA++ENE LRRQ++ELRG +P
Sbjct  121   SIKELQHLEQQLSGALSSVKEKKEQWLLEQLERSRLQEQRAMLENETLRRQVDELRGFLP  180

Query  870   SNVSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVSDTTLQLGPPTGSCRKR  1049
             S       T  LEY P  +  +    G+ S +  C+   +N  SDTTL LG P     KR
Sbjct  181   S-------THQLEYNPEKRRKALNNSGSGSPDKTCNRTAENGDSDTTLYLGLPFDVYHKR  233

Query  1050  KTPDQETHSS  1079
                D+E ++S
Sbjct  234   SMSDKENYNS  243



>ref|XP_010694750.1| PREDICTED: agamous-like MADS-box protein AGL15 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=251

 Score =   244 bits (624),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 140/254 (55%), Positives = 181/254 (71%), Gaps = 15/254 (6%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN NSRQVTFSKRRSGLLKKA ELS+LCDAEVAVIIFSST +LFE+S++
Sbjct  1     MGRGKIEIKKIENANSRQVTFSKRRSGLLKKAHELSVLCDAEVAVIIFSSTGRLFEFSNS  60

Query  516   SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMGL  695
             SMK TL+RY   L++++      K    + KE++ L +EI++L+ KQ +LLGKDL+G+ +
Sbjct  61    SMKRTLARYKNALETSDVVIGKPKLEIEDFKEIDSLKDEIAKLQVKQTRLLGKDLSGLNM  120

Query  696   NELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLV-PS  872
              +L+QLE +L+ ALL++K +K+QLL+EQLE SR QE+RAL+ENE LRRQI ELRG + PS
Sbjct  121   KDLQQLEKQLNEALLSVKAKKDQLLMEQLEQSRIQEQRALLENETLRRQIAELRGFMTPS  180

Query  873   NVSMPMPTPYLEYYPV------LKNCSSGKDGAESLNTGCDDDLDNEVSDTTLQLGPPTG  1034
                 PM   YLEYYP+       +N +SG D     N+   D  D   SD TL LGPP  
Sbjct  181   ERPEPM---YLEYYPIETKVSFERNATSGSDAV--CNSSGPDKTD---SDITLHLGPPCD  232

Query  1035  SCRKRKTPDQETHS  1076
             + RKRK  + +  S
Sbjct  233   TIRKRKATESDCGS  246



>ref|XP_010269745.1| PREDICTED: agamous-like MADS-box protein AGL15 isoform X1 [Nelumbo 
nucifera]
Length=255

 Score =   242 bits (618),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 144/243 (59%), Positives = 183/243 (75%), Gaps = 3/243 (1%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN  SRQVTFSKRR+GLLKKAQELSILCDAEVA+IIFSS+ KLFE++S+
Sbjct  1     MGRGKIEIKRIENATSRQVTFSKRRAGLLKKAQELSILCDAEVALIIFSSSGKLFEFASS  60

Query  516   SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMGL  695
             SMK TLSRYNKCLD +ET  +  +  K + KEV +L +EI+ L+    +++GK+LTG+ L
Sbjct  61    SMKRTLSRYNKCLDCSETAIVEYEVEKQQSKEVNILKDEIARLRMANRRMMGKELTGLSL  120

Query  696   NELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPSN  875
              EL+ LE++L   +L++K RKEQLLLEQLE SR QE+RAL+ENE LR+Q+EELRGL+PS 
Sbjct  121   KELQHLEYQLSEGILSVKDRKEQLLLEQLEQSRLQEQRALLENETLRKQVEELRGLLPS-  179

Query  876   VSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEV-SDTTLQLGPPTGSCRKRK  1052
                P+P PYLE  P+    S  K    S N GC+   + +  SDT+L LG P+ SCRKRK
Sbjct  180   TERPIP-PYLELQPMENKHSHIKQDIISSNIGCNCLFEKQGDSDTSLHLGLPSDSCRKRK  238

Query  1053  TPD  1061
              P+
Sbjct  239   APE  241



>gb|AGW23369.1| MADS box protein MADS67 [Gossypium hirsutum]
Length=249

 Score =   239 bits (611),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 141/254 (56%), Positives = 178/254 (70%), Gaps = 6/254 (2%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN NSRQVTFSKRR+GLLKKA+EL+ILCDAEVAVIIFS+T KL E+SS+
Sbjct  1     MGRGKIEIKRIENANSRQVTFSKRRAGLLKKAKELAILCDAEVAVIIFSNTGKLSEFSSS  60

Query  516   SMKHTLSRYNKCLDS-TETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMG  692
              MK T SRYNKCL   TE   +  K  K   KE + L +E+++L+ KQLQLLGK+LT + 
Sbjct  61    GMKKTFSRYNKCLQGPTEMALVEHKAEKQVCKEADNLKDEVAKLQMKQLQLLGKNLTSVS  120

Query  693   LNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPS  872
             L EL  LE +L   L ++K +KEQLL+EQLE SR QE+R ++ENE LRRQ+EELRG +PS
Sbjct  121   LKELEVLEQQLSEGLSSVKEKKEQLLMEQLEQSRLQEQRVMLENETLRRQLEELRGFLPS  180

Query  873   NVSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVSDTTLQLGPPTGSCRKRK  1052
               +  +   YLEYYPV +  S         +  C  +L+   SDTTL LG P+    KRK
Sbjct  181   --TDHLVRSYLEYYPVERKNSLMSHNIRGPDVTCACNLEKGDSDTTLYLGLPSDH-HKRK  237

Query  1053  TPDQETHSSNSENH  1094
              P  E+HS++SE+ 
Sbjct  238   KP--ESHSNDSESQ  249



>ref|XP_006590360.1| PREDICTED: AGL15 protein isoform X2 [Glycine max]
Length=242

 Score =   238 bits (607),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 133/233 (57%), Positives = 166/233 (71%), Gaps = 4/233 (2%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK I+N +SRQVTFSKRR+GL KKAQELSILCDAEVAVI+FS+T KLFE+SS+
Sbjct  1     MGRGKIEIKRIDNASSRQVTFSKRRTGLFKKAQELSILCDAEVAVIVFSNTGKLFEFSSS  60

Query  516   SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMGL  695
              MK TLSRYNKCL ST+         K + K VE+L  EI +L++KQLQL+GKDLTG+GL
Sbjct  61    GMKRTLSRYNKCLGSTDAAVAEIMTQKEDSKMVEILREEIEKLETKQLQLVGKDLTGLGL  120

Query  696   NELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPSN  875
              EL+ LE +L+  LL++K RKE+LL+EQLE SR QE+R ++ENE LRRQIEELR L P +
Sbjct  121   KELQNLEQQLNEGLLSVKARKEELLMEQLEQSRVQEQRVMLENETLRRQIEELRCLFPQS  180

Query  876   VSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVSDTTLQLGPPTG  1034
              SM    P+ +Y    +  +    GA  LN   +   +   SDT   LG P G
Sbjct  181   ESM---VPF-QYQHTERKNTFVNTGARCLNLANNCGNEKGSSDTAFHLGLPAG  229



>ref|XP_008346945.1| PREDICTED: agamous-like MADS-box protein AGL15 [Malus domestica]
Length=258

 Score =   238 bits (607),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 144/260 (55%), Positives = 184/260 (71%), Gaps = 6/260 (2%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN NSRQVTFSKRRSGLLKKAQEL+ILCDAEVAVIIFS+T +LFE+S+ 
Sbjct  1     MGRGKIEIKRIENANSRQVTFSKRRSGLLKKAQELAILCDAEVAVIIFSNTGRLFEFSNA  60

Query  516   SMKHTLSRYNKCLDSTETP--KIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGM  689
              M  TLSRYNKCLDS+E    +   +  K + KE++ L +E ++L+ KQL+LLGK+LT +
Sbjct  61    GMIRTLSRYNKCLDSSEDAPEEGKAEIQKQDCKELDNLKDEYAKLQKKQLRLLGKELTDL  120

Query  690   GLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVP  869
              L EL+ LE +L+  LL +K RKEQLL EQL+ SR QE+RA++ENE LRRQ+EELR L P
Sbjct  121   SLKELQHLEQQLNEGLLTVKERKEQLLTEQLZQSRIQEQRAVLENEXLRRQVEELRCLFP  180

Query  870   SNVSMPMPTPYLEYYPVLKNCSSGKDGA-ESLNTGCDDDLDNEVSDTTLQLGPPTGSCR-  1043
                +      YLEYYPV K  S    G   S +   +   +N  SDTTLQLG  + +   
Sbjct  181   Q--TDRAVQSYLEYYPVEKTKSLVNHGVTSSPDLVSNFAFENGDSDTTLQLGLQSNAYSG  238

Query  1044  KRKTPDQETHSSNSENHLEL  1103
             KRK P++E +S++S + L L
Sbjct  239   KRKAPEREANSNDSGSQLGL  258



>ref|XP_010694755.1| PREDICTED: agamous-like MADS-box protein AGL15 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=249

 Score =   238 bits (606),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 139/254 (55%), Positives = 179/254 (70%), Gaps = 17/254 (7%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN NSRQVTFSKRRSGLLKKA ELS+LCDAEVAVIIFSST +LFE+S++
Sbjct  1     MGRGKIEIKKIENANSRQVTFSKRRSGLLKKAHELSVLCDAEVAVIIFSSTGRLFEFSNS  60

Query  516   SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMGL  695
             SMK TL+RY   L++++      K    + KE++ L +EI++L+ KQ +LLGKDL+G+ +
Sbjct  61    SMKRTLARYKNALETSDVVIGKPKLEIEDFKEIDSLKDEIAKLQVKQTRLLGKDLSGLNM  120

Query  696   NELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLV-PS  872
              +L+QLE +L+ ALL++K +K+QLL+EQLE SR Q  RAL+ENE LRRQI ELRG + PS
Sbjct  121   KDLQQLEKQLNEALLSVKAKKDQLLMEQLEQSRIQ--RALLENETLRRQIAELRGFMTPS  178

Query  873   NVSMPMPTPYLEYYPV------LKNCSSGKDGAESLNTGCDDDLDNEVSDTTLQLGPPTG  1034
                 PM   YLEYYP+       +N +SG D     N+   D  D   SD TL LGPP  
Sbjct  179   ERPEPM---YLEYYPIETKVSFERNATSGSDAV--CNSSGPDKTD---SDITLHLGPPCD  230

Query  1035  SCRKRKTPDQETHS  1076
             + RKRK  + +  S
Sbjct  231   TIRKRKATESDCGS  244



>gb|AFX72882.1| MADS-box protein AGL15 [Aquilegia coerulea]
Length=278

 Score =   237 bits (605),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 136/253 (54%), Positives = 182/253 (72%), Gaps = 4/253 (2%)
 Frame = +3

Query  333   KMGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSS  512
             KMGRGKI+IK IEN  SRQVTFSKRR+GL+KKAQELSILCDAEVA+IIFS+T KLFE+SS
Sbjct  21    KMGRGKIEIKKIENATSRQVTFSKRRAGLIKKAQELSILCDAEVALIIFSNTGKLFEFSS  80

Query  513   TSMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMG  692
             + MK TLSRYNK  D ++   +     K   KEV VL  E+S+L+   L+++GK+LTG+ 
Sbjct  81    SGMKRTLSRYNKSQDLSDNSLVQYDTEKQHSKEVTVLKEEVSKLRMAHLRMMGKELTGLS  140

Query  693   LNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPS  872
               EL+ LE++L+  +L++KGRKEQLL+EQLENSR QE RA+VEN +LR+Q+EELR ++P 
Sbjct  141   FKELQHLENQLNEGILSVKGRKEQLLMEQLENSRLQEHRAMVENGSLRQQVEELRSMLPV  200

Query  873   NVSMPMPTPYLEYYPVLKNCSSGK-DGAESLNTGCDDDLDNE-VSDTTLQLGPPTGSCRK  1046
                +P+  PYLE +   +  S  K D   S N GC+  ++    SDT+L LG  +   RK
Sbjct  201   -AELPV-RPYLELHHTERKPSHTKHDVISSSNAGCNCIVEKPGESDTSLHLGLSSEVHRK  258

Query  1047  RKTPDQETHSSNS  1085
             RK P++ + S++S
Sbjct  259   RKAPERASCSNDS  271



>ref|XP_007149043.1| hypothetical protein PHAVU_005G035900g [Phaseolus vulgaris]
 gb|ESW21037.1| hypothetical protein PHAVU_005G035900g [Phaseolus vulgaris]
Length=242

 Score =   233 bits (595),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 129/233 (55%), Positives = 166/233 (71%), Gaps = 4/233 (2%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK I+N +SRQVTFSKRR+GL KKAQELSILCD+EVAVI+FS+T KLFE+SS+
Sbjct  1     MGRGKIEIKRIDNASSRQVTFSKRRTGLFKKAQELSILCDSEVAVIVFSNTGKLFEFSSS  60

Query  516   SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMGL  695
              M  T+SRYNKCL ST+         K + K V++L +EIS++++KQLQLLGKDL+G+G+
Sbjct  61    GMLRTISRYNKCLGSTDVTVAEINSQKEDSKMVDILRDEISKIETKQLQLLGKDLSGLGI  120

Query  696   NELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPSN  875
              EL+ LE +L   LL++K RKE+LL+EQLE SR QE+R ++ENE LRRQIEELR L P  
Sbjct  121   KELQNLEQQLSEGLLSVKARKEELLMEQLEQSRVQEQRVMLENETLRRQIEELRCLFPQT  180

Query  876   VSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVSDTTLQLGPPTG  1034
              SM    P+ +Y P  +  +    GA  LN   +   +   SDT   LG P G
Sbjct  181   ESM---VPF-QYPPSERKNTFVNTGARCLNLANNCGHEKGSSDTVFHLGLPAG  229



>ref|XP_008461829.1| PREDICTED: agamous-like MADS-box protein AGL15 isoform X4 [Cucumis 
melo]
Length=249

 Score =   233 bits (593),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 142/252 (56%), Positives = 184/252 (73%), Gaps = 12/252 (5%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN NSRQVTFSKRR+GLLKKAQEL+ILCDAEVAVIIFS+T KLFE+SS+
Sbjct  1     MGRGKIEIKRIENANSRQVTFSKRRAGLLKKAQELAILCDAEVAVIIFSNTGKLFEFSSS  60

Query  516   SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMGL  695
              MKHTL+RYNKC++S++    V K  K EH EV++L  EI+ L+ KQLQLLGKDLTG+G 
Sbjct  61    GMKHTLARYNKCVESSDATVDVHKVEKREHDEVDILREEITTLQMKQLQLLGKDLTGLGF  120

Query  696   NELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPSN  875
              EL+ LE +L+     +  ++++LL+EQLE SR QE+RA++ENE LRRQ+ ELR L P  
Sbjct  121   KELQNLEQQLNEG--LLLVKEKKLLMEQLEQSRVQEQRAMLENETLRRQVNELRCLFPP-  177

Query  876   VSMPMPTPYLEYYPVLKNCSSGKD--GAESLNTGCDDDLDNEVSDTTLQLGPPTGSCRKR  1049
             V  P+P  YLEY      CS  +   G  S +  C+ +++   SDTTL LG P+    KR
Sbjct  178   VDCPLPA-YLEY------CSLEQKNIGIRSPDMACNSEIERGDSDTTLHLGLPSHVYCKR  230

Query  1050  KTPDQETHSSNS  1085
             K  +++THS++S
Sbjct  231   KESERDTHSNDS  242



>gb|AHH28305.1| MADS-box transcription factor, partial [Pera bumeliifolia]
Length=235

 Score =   229 bits (585),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 130/236 (55%), Positives = 169/236 (72%), Gaps = 2/236 (1%)
 Frame = +3

Query  396   FSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSSTSMKHTLSRYNKCLDSTETPK  575
             FSKRR+GLLKKAQEL+ILCDAEVAVIIFS+T KLFE+SS+ MK  LSRYNKCLDS+E  K
Sbjct  1     FSKRRAGLLKKAQELAILCDAEVAVIIFSNTGKLFEFSSSGMKKILSRYNKCLDSSEPAK  60

Query  576   IvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMGLNELRQLEHKLDGALLAIKGR  755
             +  K  K + KEV+VL  EI++L+ KQL LLGK+L G+ L EL+ LE +L+  L  +K +
Sbjct  61    VEYKAEKQDAKEVDVLKEEIAKLRVKQLHLLGKELIGLSLKELQHLEQQLNEGLFCVKEK  120

Query  756   KEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPSNVSMPMPTPYLEYYPVLKNCS  935
             KEQLL+EQLE SR QE+RA++ENE LRRQ+EELRG   S     +PT Y EYY + +  S
Sbjct  121   KEQLLMEQLEQSRVQEQRAMLENETLRRQVEELRGFFLS-TDHSVPT-YFEYYSMERKHS  178

Query  936   SGKDGAESLNTGCDDDLDNEVSDTTLQLGPPTGSCRKRKTPDQETHSSNSENHLEL  1103
                +G+ S    C+  ++   SDTTL LG P+ +  KRK P+  +HS++S + L L
Sbjct  179   LDNNGSSSPEMACNCSIEKGDSDTTLHLGLPSNAYGKRKAPEGVSHSNDSXSLLVL  234



>ref|XP_002314062.1| hypothetical protein POPTR_0009s06060g [Populus trichocarpa]
 gb|EEE88017.1| hypothetical protein POPTR_0009s06060g [Populus trichocarpa]
Length=271

 Score =   230 bits (586),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 143/248 (58%), Positives = 172/248 (69%), Gaps = 23/248 (9%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN NSRQVTFSKRR+GLLKKAQEL+ILCDAEVAVI+FS+T KLFE+SS+
Sbjct  1     MGRGKIEIKKIENTNSRQVTFSKRRAGLLKKAQELAILCDAEVAVIVFSNTGKLFEFSSS  60

Query  516   SMKHTLSRYNKCLDSTETPKIvekkp-------------kvehkevevLNNEISELKSKQ  656
              MK TLSRYNK LDS E PKI  K               K + KEV+VL  EI++L+ KQ
Sbjct  61    GMKRTLSRYNKFLDSPEQPKIEYKAEDHCPPQPPTQIKDKPDLKEVDVLKEEIAKLQVKQ  120

Query  657   LQLLGKDLTGMGLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLR  836
             L+L G DLTG+ L EL+QLE++L+  LL +K +KE LL+EQLE SR QE+RA++ENE LR
Sbjct  121   LRLSGMDLTGLSLKELQQLENQLNEGLLFVKEKKEHLLMEQLEQSRVQEQRAMLENETLR  180

Query  837   RQ---IEELRGLVPSNVSMPMPTPYLEYYPVLKNCSSGKDGAESLNTG---CDDDLDNEV  998
             RQ   IEELRG  PS    P+PT YLEYY   +      +GA S       C   ++   
Sbjct  181   RQARIIEELRGFFPST-DHPVPT-YLEYYATERKNPPIDNGATSPPVAHYIC--SIEKVD  236

Query  999   SDTTLQLG  1022
             SDTTL LG
Sbjct  237   SDTTLHLG  244



>ref|XP_010557822.1| PREDICTED: agamous-like MADS-box protein AGL15 [Tarenaya hassleriana]
Length=267

 Score =   230 bits (586),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 139/274 (51%), Positives = 184/274 (67%), Gaps = 30/274 (11%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN N+RQVTFSKRR+GLLKKA EL++LCDAEVAVI+FS++ KLFE++S+
Sbjct  1     MGRGKIEIKRIENANNRQVTFSKRRAGLLKKAHELAVLCDAEVAVIVFSNSGKLFEFASS  60

Query  516   SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMGL  695
              MK  LSRY+K  +  + P I E K +    EV+ L +EIS L+ KQ QLLGK L G+ L
Sbjct  61    GMKKILSRYDKSQNPLDPPLI-ECKAEDGSAEVDHLKDEISTLREKQSQLLGKGLNGLSL  119

Query  696   NELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPSN  875
              +L++LE +L+ A L+++GRKEQLL+EQ+E SR +E+RA++ENE LRRQ+EEL+G++PS 
Sbjct  120   KDLQRLEEQLNDAFLSVRGRKEQLLMEQVEESRLKEQRAVLENETLRRQVEELQGILPSA  179

Query  876   VSMPMPTPYLE-YYPV-LKNCS---SGKDGAESLNTGCDDDLDNEVSDTTLQLG-PPTGS  1037
                 MP+ Y+E  +P+ +KN     +G DG + +    D       SDTTLQLG P    
Sbjct  180   NHHYMPSSYIECRHPIEIKNSQIKHTGLDGFDCMALKAD-------SDTTLQLGLPGEAE  232

Query  1038  CRKRKTPDQETHSSNSENHLELK*RGCPSPVGSS  1139
              RKRK P                 RG PSP G S
Sbjct  233   ERKRKEPK----------------RGSPSPSGGS  250



>ref|XP_008461830.1| PREDICTED: agamous-like MADS-box protein AGL15 isoform X5 [Cucumis 
melo]
Length=247

 Score =   226 bits (576),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 141/252 (56%), Positives = 183/252 (73%), Gaps = 14/252 (6%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN NSRQVTFSKRR+GLLKKAQEL+ILCDAEVAVIIFS+T KLFE+SS+
Sbjct  1     MGRGKIEIKRIENANSRQVTFSKRRAGLLKKAQELAILCDAEVAVIIFSNTGKLFEFSSS  60

Query  516   SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMGL  695
              MKHTL+RYNKC++S++    V K  K EH EV++L  EI+ L+ KQLQLLGKDLTG+G 
Sbjct  61    GMKHTLARYNKCVESSDATVDVHKVEKREHDEVDILREEITTLQMKQLQLLGKDLTGLGF  120

Query  696   NELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPSN  875
              EL+ LE +L+     +  ++++LL+EQLE SR  E+RA++ENE LRRQ+ ELR L P  
Sbjct  121   KELQNLEQQLNEG--LLLVKEKKLLMEQLEQSR--EQRAMLENETLRRQVNELRCLFPP-  175

Query  876   VSMPMPTPYLEYYPVLKNCSSGKD--GAESLNTGCDDDLDNEVSDTTLQLGPPTGSCRKR  1049
             V  P+P  YLEY      CS  +   G  S +  C+ +++   SDTTL LG P+    KR
Sbjct  176   VDCPLPA-YLEY------CSLEQKNIGIRSPDMACNSEIERGDSDTTLHLGLPSHVYCKR  228

Query  1050  KTPDQETHSSNS  1085
             K  +++THS++S
Sbjct  229   KESERDTHSNDS  240



>gb|KEH17671.1| MADS-box transcription factor [Medicago truncatula]
Length=256

 Score =   226 bits (576),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 142/255 (56%), Positives = 189/255 (74%), Gaps = 10/255 (4%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN NSRQVTFSKRRSGLLKKAQEL+ILCDAEVAVIIFS+T KLFE+SS+
Sbjct  1     MGRGKIEIKRIENANSRQVTFSKRRSGLLKKAQELAILCDAEVAVIIFSNTGKLFEFSSS  60

Query  516   SMKHTLSRYNKCLDSTETPKIvekkp---kvehkevevLNNEISELKSKQLQLLGKDLTG  686
              MK TLSRYNKC DS+E+  +  K     K + + VE+L +EI++L++ QL+LLGK L G
Sbjct  61    GMKRTLSRYNKCTDSSESASVEYKTEILPKEDSRMVEILKDEIAKLETNQLRLLGKGLAG  120

Query  687   MGLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLV  866
             +G+ EL+ LE +++  L ++K RKE+LL+EQLE SR QE++A++ENE LRRQIEELR L 
Sbjct  121   LGIKELQHLEQQINEGLSSVKERKEELLMEQLEQSRIQEQKAMLENETLRRQIEELRCLF  180

Query  867   PSNVSMPMPTPYLEYYPVLKNCSSGKDGA---ESLNTGCDDDLDNEVSDTTLQLGPPTGS  1037
             P    + MP+ YL+++ V +  S   +G     SL   C D+  +  SDTTLQLG P+  
Sbjct  181   PMTEHV-MPS-YLQFHHVERKNSFVDNGVVKCPSLTRNCSDEKAD--SDTTLQLGLPSDV  236

Query  1038  CRKRKTPDQETHSSN  1082
               K+KTP+++T S++
Sbjct  237   NHKKKTPEKKTFSND  251



>ref|XP_010279517.1| PREDICTED: MADS-box transcription factor 23-like isoform X2 [Nelumbo 
nucifera]
Length=241

 Score =   224 bits (571),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 135/250 (54%), Positives = 167/250 (67%), Gaps = 19/250 (8%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN  SRQVTFSKRR+GLLKKAQELSILCDAEVA+IIFSS  KLFE++S+
Sbjct  1     MGRGKIEIKRIENATSRQVTFSKRRAGLLKKAQELSILCDAEVALIIFSSCGKLFEFASS  60

Query  516   SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMGL  695
              MK TLSRYNKCLD +ET  +     K + KEV +L +EI+ L+    +++GK+L G+ L
Sbjct  61    CMKRTLSRYNKCLDCSETALVEYGAKKQQSKEVNILKDEIARLRMANRRMMGKELMGLSL  120

Query  696   NELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPSN  875
              EL+ LEH+L   +L++K RKEQLLLEQLE S              R Q+EELRGL+PS 
Sbjct  121   KELQNLEHQLSEGILSVKDRKEQLLLEQLEKS--------------RLQVEELRGLLPSP  166

Query  876   VSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNE-VSDTTLQLGPPTGSCRKRK  1052
               + MP PYL   P+ K     K    S N GC+   + +  SDT+L LG P+ SCRKRK
Sbjct  167   ECL-MP-PYLRLQPMEKKHFQIKQDVISSNMGCNCTFEKQGESDTSLHLGLPSDSCRKRK  224

Query  1053  TPDQETHSSN  1082
               D  T  SN
Sbjct  225   AHD--TSCSN  232



>ref|NP_001237033.1| AGL15 protein [Glycine max]
 gb|AAR17483.1| AGL15 [Glycine max]
 gb|AAR17484.1| AGL15 [Glycine max]
Length=235

 Score =   221 bits (563),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 130/233 (56%), Positives = 162/233 (70%), Gaps = 11/233 (5%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK I+N +SRQVTFSKRR+GL KKAQELSILCDAEVAVI+FS+T KLFE+SS+
Sbjct  1     MGRGKIEIKRIDNASSRQVTFSKRRTGLFKKAQELSILCDAEVAVIVFSNTGKLFEFSSS  60

Query  516   SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMGL  695
              MK TLSRYNKCL ST+      K  K + K VE+L  EI++L++KQLQL+GKDLTG+GL
Sbjct  61    GMKRTLSRYNKCLGSTDAAVAEIKTQKEDSKMVEILREEIAKLETKQLQLVGKDLTGLGL  120

Query  696   NELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPSN  875
              EL+ LE +L+  LL++K RK       LE SR QE+R ++ENE LRRQIEELR L P +
Sbjct  121   KELQNLEQQLNEGLLSVKARK-------LEQSRVQEQRVMLENETLRRQIEELRCLFPQS  173

Query  876   VSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVSDTTLQLGPPTG  1034
              SM    P+   +   KN +    GA  LN   +   +   SDT+  LG P G
Sbjct  174   ESM---VPFQYQHTEGKN-TFVDTGARYLNLANNCGNEKGSSDTSFHLGLPAG  222



>ref|XP_006592528.1| PREDICTED: agamous-like MADS-box protein AGL15-like isoform X1 
[Glycine max]
Length=254

 Score =   219 bits (558),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 131/245 (53%), Positives = 165/245 (67%), Gaps = 16/245 (7%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK I+N +SRQVTFSKRR+GL KKAQELSILC+AEVAVI+FS+T KLFE SS+
Sbjct  1     MGRGKIEIKRIDNASSRQVTFSKRRTGLFKKAQELSILCEAEVAVIVFSNTGKLFELSSS  60

Query  516   SMKHTLSRYNKCLDSTETP------------KIvekkpkvehkevevLNNEISELKSKQL  659
              MK TLSRYNKCL ST+                +    K + K VE+L  EI+EL++KQL
Sbjct  61    GMKRTLSRYNKCLGSTDAAVAEIKTGALFYSSFLLTFIKEDSKMVEILREEIAELETKQL  120

Query  660   QLLGKDLTGMGLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRR  839
              L+GKDLTG+GL EL+ LE +L+  LL++K RKE+LL+EQLE SR QE+R ++ENE L R
Sbjct  121   YLVGKDLTGLGLKELQNLEQQLNEGLLSVKARKEELLMEQLEQSRVQEQRVMLENETLCR  180

Query  840   QIEELRGLVPSNVSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVSDTTLQL  1019
             QIEELR L P +  M    P+   +   KN +    GA  LN   +   +   SDT+  L
Sbjct  181   QIEELRCLFPQSERM---VPFQYQHTEGKN-TFVDTGARYLNLANNCGNEKGSSDTSFHL  236

Query  1020  GPPTG  1034
             G P G
Sbjct  237   GLPAG  241



>ref|XP_010653762.1| PREDICTED: MADS-box transcription factor 23-like isoform X2 [Vitis 
vinifera]
Length=248

 Score =   218 bits (554),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 124/254 (49%), Positives = 171/254 (67%), Gaps = 9/254 (4%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN+NSRQVTFSKRR+GLLKKA+ELS+LCDAEV VIIFSST KL+E+SS+
Sbjct  1     MGRGKIEIKKIENINSRQVTFSKRRAGLLKKAKELSVLCDAEVGVIIFSSTGKLYEFSSS  60

Query  516   SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMGL  695
             SM+HTL+RY + LDS E P +  +  +    EV  L  E+++L+   L+++GK+L G+  
Sbjct  61    SMEHTLTRYGRGLDS-ELPSL-HRSAEESQPEVASLKEEVAKLQKGYLRMMGKELDGLSF  118

Query  696   NELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPSN  875
              EL+ LEH L   +L++K +KEQ+LLEQL+ SR  E+RA++ENE LR+Q+EELR      
Sbjct  119   KELQHLEHLLSEGILSVKDKKEQVLLEQLKKSRMHEQRAMMENETLRKQVEELR-----R  173

Query  876   VSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVSDTTLQLGPPTGSCRKRKT  1055
              S P P  ++EY+P  +  S         +    D+     SDT+L LG P+ +  KRK 
Sbjct  174   SSRPQPPSFIEYHPPERRQSLQISSKTPCSCSTVDERGG--SDTSLHLGLPSDAYLKRKG  231

Query  1056  PDQETHSSNSENHL  1097
             P  E    +SE+ +
Sbjct  232   PKIEPIFIDSESQV  245



>ref|XP_002278584.1| PREDICTED: MADS-box transcription factor 23-like isoform X1 [Vitis 
vinifera]
Length=256

 Score =   215 bits (548),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 124/261 (48%), Positives = 170/261 (65%), Gaps = 15/261 (6%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN+NSRQVTFSKRR+GLLKKA+ELS+LCDAEV VIIFSST KL+E+SS+
Sbjct  1     MGRGKIEIKKIENINSRQVTFSKRRAGLLKKAKELSVLCDAEVGVIIFSSTGKLYEFSSS  60

Query  516   SMKHTLSRYNKCLDSTETPKIvekkp-------kvehkevevLNNEISELKSKQLQLLGK  674
             SM+HTL+RY + LDS E P +            +    EV  L  E+++L+   L+++GK
Sbjct  61    SMEHTLTRYGRGLDS-ELPSLHRSAEVRYSIVPQESQPEVASLKEEVAKLQKGYLRMMGK  119

Query  675   DLTGMGLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEEL  854
             +L G+   EL+ LEH L   +L++K +KEQ+LLEQL+ SR  E+RA++ENE LR+Q+EEL
Sbjct  120   ELDGLSFKELQHLEHLLSEGILSVKDKKEQVLLEQLKKSRMHEQRAMMENETLRKQVEEL  179

Query  855   RGLVPSNVSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVSDTTLQLGPPTG  1034
             R       S P P  ++EY+P  +  S         +    D+     SDT+L LG P+ 
Sbjct  180   R-----RSSRPQPPSFIEYHPPERRQSLQISSKTPCSCSTVDERGG--SDTSLHLGLPSD  232

Query  1035  SCRKRKTPDQETHSSNSENHL  1097
             +  KRK P  E    +SE+ +
Sbjct  233   AYLKRKGPKIEPIFIDSESQV  253



>ref|XP_010547306.1| PREDICTED: agamous-like MADS-box protein AGL15 isoform X4 [Tarenaya 
hassleriana]
Length=264

 Score =   213 bits (541),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 142/261 (54%), Positives = 180/261 (69%), Gaps = 4/261 (2%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN N+RQVTFSKRR+GLLKKA+EL++LCDAEVAVI+FS++ KLFE+SS+
Sbjct  1     MGRGKIEIKRIENANNRQVTFSKRRAGLLKKARELAVLCDAEVAVIVFSNSGKLFEFSSS  60

Query  516   SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMGL  695
              MK TLSRYNK   S+  P I  K       EVE+L  EIS+L+ KQ QLLGK L G+ L
Sbjct  61    GMKKTLSRYNKYQKSSGPPPIECKAEVDNCIEVELLKEEISKLREKQSQLLGKGLNGLSL  120

Query  696   NELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPSN  875
              EL+ LE +L+  LL+++ RKEQLLLEQLE SR +E+RA++ENE LRRQ+EELRGL+PS 
Sbjct  121   KELQLLEEQLNETLLSVRERKEQLLLEQLEESRLKEQRAMLENETLRRQVEELRGLLPSA  180

Query  876   VSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVSDTTLQLGPPTGSCRKRKT  1055
                  P+ Y+E YPV       KD A+     C     +  SDTTLQLG P  +  +RK 
Sbjct  181   NLRYFPS-YIECYPVEIKKPPVKD-ADFGGFNCMAQKTD--SDTTLQLGLPGEAEERRKR  236

Query  1056  PDQETHSSNSENHLELK*RGC  1118
              + E  SS+ ++ L    R C
Sbjct  237   KEPEKGSSSGDSVLTNTARAC  257



>gb|KHN22068.1| Agamous-like MADS-box protein AGL15 [Glycine soja]
Length=228

 Score =   209 bits (532),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 124/233 (53%), Positives = 154/233 (66%), Gaps = 18/233 (8%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK I+N +SRQVTFSKRR+GL KKAQELSILCDAEVAVI+FS+T KLFE+SS+
Sbjct  1     MGRGKIEIKRIDNASSRQVTFSKRRTGLFKKAQELSILCDAEVAVIVFSNTGKLFEFSSS  60

Query  516   SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMGL  695
              MK TLSRYNKCL ST+         K + K VE+L  EI +L++KQLQL+GKDLTG+GL
Sbjct  61    GMKRTLSRYNKCLGSTDAAVAEIMTQKEDSKMVEILREEIEKLETKQLQLVGKDLTGLGL  120

Query  696   NELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPSN  875
              EL+ LE +L+  LL++K RKE+LL+EQLE SR               QIEELR L P +
Sbjct  121   KELQNLEQQLNEGLLSVKARKEELLMEQLEQSRV--------------QIEELRCLFPQS  166

Query  876   VSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVSDTTLQLGPPTG  1034
              SM    P+ +Y    +  +    GA  LN   +   +   SDT   LG P G
Sbjct  167   ESM---VPF-QYQHTERKNTFVNTGARCLNLANNCGNEKGSSDTAFHLGLPAG  215



>ref|XP_010492158.1| PREDICTED: agamous-like MADS-box protein AGL15 isoform X3 [Camelina 
sativa]
Length=257

 Score =   210 bits (534),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 129/255 (51%), Positives = 167/255 (65%), Gaps = 19/255 (7%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN NSRQVTFSKRR+GLLKKA ELS+LCDAEVAVI+FS + KLFE+SS+
Sbjct  1     MGRGKIEIKRIENANSRQVTFSKRRAGLLKKAHELSVLCDAEVAVIVFSKSGKLFEFSSS  60

Query  516   SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMGL  695
              MK TLSRY     S+++        + + KEV++L +EIS+L+ K LQL GK L  +  
Sbjct  61    GMKKTLSRYGNYQSSSDSK-----AEEDDCKEVDLLKDEISQLQKKHLQLQGKGLNILSF  115

Query  696   NELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPSN  875
              EL+ LE +L  AL++++ RKE+LL  QLE SR +E+RA +ENE LRRQ++ELR  +PS 
Sbjct  116   KELQNLEQQLYHALISVRERKERLLAIQLEESRLKEQRAELENETLRRQVQELRSFLPS-  174

Query  876   VSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDD----LDNEVSDTTLQLG-PPTGSC  1040
                     +  Y P    C +       LN GC DD    L    SDTTLQLG P     
Sbjct  175   --------FTHYVPSYIKCFAIDPKNAVLNHGCFDDSNCSLQKTNSDTTLQLGLPGEAHD  226

Query  1041  RKRKTPDQETHSSNS  1085
             R++K  D+E+ SS+S
Sbjct  227   RRKKEGDRESPSSDS  241



>ref|XP_010492156.1| PREDICTED: agamous-like MADS-box protein AGL15 isoform X1 [Camelina 
sativa]
Length=260

 Score =   210 bits (534),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 130/255 (51%), Positives = 168/255 (66%), Gaps = 16/255 (6%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN NSRQVTFSKRR+GLLKKA ELS+LCDAEVAVI+FS + KLFE+SS+
Sbjct  1     MGRGKIEIKRIENANSRQVTFSKRRAGLLKKAHELSVLCDAEVAVIVFSKSGKLFEFSSS  60

Query  516   SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMGL  695
              MK TLSRY     S+++    E   + + KEV++L +EIS+L+ K LQL GK L  +  
Sbjct  61    GMKKTLSRYGNYQSSSDSK--AENLQEDDCKEVDLLKDEISQLQKKHLQLQGKGLNILSF  118

Query  696   NELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPSN  875
              EL+ LE +L  AL++++ RKE+LL  QLE SR +E+RA +ENE LRRQ++ELR  +PS 
Sbjct  119   KELQNLEQQLYHALISVRERKERLLAIQLEESRLKEQRAELENETLRRQVQELRSFLPS-  177

Query  876   VSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDD----LDNEVSDTTLQLG-PPTGSC  1040
                     +  Y P    C +       LN GC DD    L    SDTTLQLG P     
Sbjct  178   --------FTHYVPSYIKCFAIDPKNAVLNHGCFDDSNCSLQKTNSDTTLQLGLPGEAHD  229

Query  1041  RKRKTPDQETHSSNS  1085
             R++K  D+E+ SS+S
Sbjct  230   RRKKEGDRESPSSDS  244



>ref|XP_006575259.1| PREDICTED: agamous-like MADS-box protein AGL18-like [Glycine 
max]
Length=247

 Score =   208 bits (529),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 122/243 (50%), Positives = 173/243 (71%), Gaps = 15/243 (6%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN+NSRQVTFSKRR+GLLKKA+ELS+LCDAEVAVIIFSST KL+E+S+T
Sbjct  1     MGRGKIEIKKIENLNSRQVTFSKRRNGLLKKAKELSVLCDAEVAVIIFSSTGKLYEFSNT  60

Query  516   SMKHTLSRYNKCL--DSTETP-KIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTG  686
             SM+HTLSRY+K    DS E P  +          +  +L  EI++L+S  L+++GK+L G
Sbjct  61    SMEHTLSRYSKGAESDSAEQPIDVPPTDVMAVEPDTNLLMEEITKLRSAYLRMMGKELDG  120

Query  687   MGLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLV  866
             + L EL+QLE++L   + ++K +KEQ+L+EQL  SR QE++A++ENE LR+Q+EE++   
Sbjct  121   LSLKELQQLENQLSEGMQSVKDKKEQVLVEQLRKSRIQEQKAMLENEVLRKQLEEIQNKT  180

Query  867   PSNVSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVSDTTLQLGPPTGSCRK  1046
              S         +LE+  + +  S  K+G++SL   C  + +N++SDT+LQLG  T   R+
Sbjct  181   KSQ--------FLEFSSLDRTFS--KNGSKSL-FNCASE-ENDLSDTSLQLGLSTDYGRQ  228

Query  1047  RKT  1055
             RK 
Sbjct  229   RKA  231



>ref|XP_010659214.1| PREDICTED: agamous-like MADS-box protein AGL15 isoform X2 [Vitis 
vinifera]
Length=208

 Score =   206 bits (525),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 131/251 (52%), Positives = 166/251 (66%), Gaps = 46/251 (18%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN NSRQVTFSKRR GLLKKA EL+ILCDA+V VIIFS+T KLFE+SST
Sbjct  1     MGRGKIEIKKIENANSRQVTFSKRRVGLLKKASELAILCDAQVGVIIFSNTGKLFEFSST  60

Query  516   SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMGL  695
             SMK  +SRYNK LDS+E   +  +    E KEV++L +EI +L+++QLQLLGKDL+G+ L
Sbjct  61    SMKRIISRYNK-LDSSEGALV--EYKAEEPKEVDILKDEIRKLQTRQLQLLGKDLSGLSL  117

Query  696   NELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPSN  875
              EL+ LE +L+ +LL++K RKEQ+L+EQLE SR QE+RA++ENE LRRQ+          
Sbjct  118   KELQNLEQQLNESLLSVKERKEQVLMEQLEQSRVQEQRAVLENETLRRQV----------  167

Query  876   VSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVSDTTLQLGPPTGSCRKRKT  1055
                                              +  ++ E SDTTLQLG PT   RKRK 
Sbjct  168   --------------------------------EELRVEREESDTTLQLGLPTEISRKRKA  195

Query  1056  PDQ-ETHSSNS  1085
             P + ET S+NS
Sbjct  196   PAKMETRSNNS  206



>ref|XP_010547305.1| PREDICTED: agamous-like MADS-box protein AGL15 isoform X3 [Tarenaya 
hassleriana]
Length=265

 Score =   208 bits (529),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 142/262 (54%), Positives = 180/262 (69%), Gaps = 5/262 (2%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN N+RQVTFSKRR+GLLKKA+EL++LCDAEVAVI+FS++ KLFE+SS+
Sbjct  1     MGRGKIEIKRIENANNRQVTFSKRRAGLLKKARELAVLCDAEVAVIVFSNSGKLFEFSSS  60

Query  516   SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQ-LQLLGKDLTGMG  692
              MK TLSRYNK   S+  P I  K       EVE+L  EIS+L+ KQ  QLLGK L G+ 
Sbjct  61    GMKKTLSRYNKYQKSSGPPPIECKAEVDNCIEVELLKEEISKLREKQSRQLLGKGLNGLS  120

Query  693   LNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPS  872
             L EL+ LE +L+  LL+++ RKEQLLLEQLE SR +E+RA++ENE LRRQ+EELRGL+PS
Sbjct  121   LKELQLLEEQLNETLLSVRERKEQLLLEQLEESRLKEQRAMLENETLRRQVEELRGLLPS  180

Query  873   NVSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVSDTTLQLGPPTGSCRKRK  1052
                   P+ Y+E YPV       KD A+     C     +  SDTTLQLG P  +  +RK
Sbjct  181   ANLRYFPS-YIECYPVEIKKPPVKD-ADFGGFNCMAQKTD--SDTTLQLGLPGEAEERRK  236

Query  1053  TPDQETHSSNSENHLELK*RGC  1118
               + E  SS+ ++ L    R C
Sbjct  237   RKEPEKGSSSGDSVLTNTARAC  258



>ref|XP_010419984.1| PREDICTED: agamous-like MADS-box protein AGL15 isoform X2 [Camelina 
sativa]
Length=259

 Score =   207 bits (527),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 128/257 (50%), Positives = 166/257 (65%), Gaps = 21/257 (8%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN NSRQVTFSKRR+GLLKKA ELS+LCDAEVAVI+FS + KLFE+SS+
Sbjct  1     MGRGKIEIKRIENANSRQVTFSKRRAGLLKKAHELSVLCDAEVAVIVFSKSGKLFEFSSS  60

Query  516   SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMGL  695
              MK TLSRY     S+++        + +  EV++L +EIS+L+ K LQL GK L  +  
Sbjct  61    GMKKTLSRYGNYQSSSDSK-----VEEEDCAEVDLLKDEISKLQKKHLQLQGKGLNILNF  115

Query  696   NELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPSN  875
              EL+ LE +L  ALL+++ RKE+LL  QLE SR +E+RA +ENE LRRQ++ELR  +PS 
Sbjct  116   KELQNLEQQLHHALLSVRERKERLLAIQLEESRLKEQRAELENETLRRQVQELRSFLPS-  174

Query  876   VSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDD----LDNEVSDTTLQLGPPTGSC-  1040
                     +  Y P    C +       LN GC DD    L    SDTTLQLG P  +  
Sbjct  175   --------FTHYVPSYIKCFAIDPRNAVLNHGCLDDSNCSLQKTNSDTTLQLGLPGDAHA  226

Query  1041  --RKRKTPDQETHSSNS  1085
               R++   D+E+ SS+S
Sbjct  227   HDRRKNEGDRESPSSDS  243



>ref|XP_010419983.1| PREDICTED: agamous-like MADS-box protein AGL15 isoform X1 [Camelina 
sativa]
Length=262

 Score =   207 bits (527),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 130/257 (51%), Positives = 168/257 (65%), Gaps = 18/257 (7%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN NSRQVTFSKRR+GLLKKA ELS+LCDAEVAVI+FS + KLFE+SS+
Sbjct  1     MGRGKIEIKRIENANSRQVTFSKRRAGLLKKAHELSVLCDAEVAVIVFSKSGKLFEFSSS  60

Query  516   SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMGL  695
              MK TLSRY     S+++   VE   + +  EV++L +EIS+L+ K LQL GK L  +  
Sbjct  61    GMKKTLSRYGNYQSSSDSK--VENLQEEDCAEVDLLKDEISKLQKKHLQLQGKGLNILNF  118

Query  696   NELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPSN  875
              EL+ LE +L  ALL+++ RKE+LL  QLE SR +E+RA +ENE LRRQ++ELR  +PS 
Sbjct  119   KELQNLEQQLHHALLSVRERKERLLAIQLEESRLKEQRAELENETLRRQVQELRSFLPS-  177

Query  876   VSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDD----LDNEVSDTTLQLGPPTGSC-  1040
                     +  Y P    C +       LN GC DD    L    SDTTLQLG P  +  
Sbjct  178   --------FTHYVPSYIKCFAIDPRNAVLNHGCLDDSNCSLQKTNSDTTLQLGLPGDAHA  229

Query  1041  --RKRKTPDQETHSSNS  1085
               R++   D+E+ SS+S
Sbjct  230   HDRRKNEGDRESPSSDS  246



>ref|XP_011048083.1| PREDICTED: agamous-like MADS-box protein AGL18 [Populus euphratica]
Length=257

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 117/255 (46%), Positives = 172/255 (67%), Gaps = 13/255 (5%)
 Frame = +3

Query  330   KKMGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYS  509
             K+MGRGKI+I+ IEN+NSRQVTFSKRR+GLLKKA+ELS+LCDAEVAVI+FSST KL+E+S
Sbjct  6     KRMGRGKIEIRRIENLNSRQVTFSKRRNGLLKKARELSVLCDAEVAVIVFSSTGKLYEFS  65

Query  510   STSMKHTLSRYNKC--LDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLT  683
             STSM+HTLSRY     LD  + P            EV  + +E+S+L+   LQ++G+ L 
Sbjct  66    STSMEHTLSRYGSGLDLDYNDHPSDDHGAEHSNSAEVNAVKDELSKLRLTCLQMMGQQLD  125

Query  684   GMGLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEEL-RG  860
             G+   EL+ LEH+L   +L++K +KEQ+L++QL+ S+ QE++A++ENE+LR+QIEEL RG
Sbjct  126   GLSFKELQHLEHQLSAGILSVKDKKEQMLMDQLKKSKMQEQKAILENESLRKQIEELKRG  185

Query  861   LVPSNVSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVSDTTLQLGPPTGSC  1040
               P        + +LE  P+ +  +      +S     +++   ++S T+L LG  +  C
Sbjct  186   SRP-------KSAFLELSPLDRRFAVASSKPDSNRKPQEEE---DLSATSLHLGLSSDVC  235

Query  1041  RKRKTPDQETHSSNS  1085
              +RK    E+ S++S
Sbjct  236   HRRKAAKIESVSNDS  250



>ref|XP_006289158.1| hypothetical protein CARUB_v10002596mg [Capsella rubella]
 gb|EOA22056.1| hypothetical protein CARUB_v10002596mg [Capsella rubella]
Length=256

 Score =   206 bits (525),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 126/255 (49%), Positives = 165/255 (65%), Gaps = 20/255 (8%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN NSRQVTFSKRR+GLLKKA ELS+LCDAEVAVI+FS + KLFE+SS+
Sbjct  1     MGRGKIEIKRIENANSRQVTFSKRRAGLLKKAHELSVLCDAEVAVIVFSKSGKLFEFSSS  60

Query  516   SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMGL  695
              MK TLSRY     S+++        + +  E+++L +EIS+L+ K LQL GK L  +  
Sbjct  61    GMKKTLSRYGNYQSSSDSK------VEEDCTEMDLLKDEISKLQEKHLQLQGKGLNTLSF  114

Query  696   NELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPSN  875
              EL+ LE +L  AL++++ RKEQLL  QLE SR +E+RA +ENE LRRQ++ELR  +P+ 
Sbjct  115   KELQNLEQQLYHALISVRERKEQLLTVQLEESRLKEQRAELENETLRRQVQELRNFLPA-  173

Query  876   VSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDD----LDNEVSDTTLQLGPPTGSCR  1043
                     +  Y P    C +       LN GC +D    L    SDTTLQLG P  +  
Sbjct  174   --------FTHYVPSYIKCFAIDPKNAILNHGCLEDSNCSLQKTDSDTTLQLGLPGEAHD  225

Query  1044  KRKTP-DQETHSSNS  1085
             +RK   D+E+ SS S
Sbjct  226   RRKNEGDRESPSSES  240



>ref|XP_010453480.1| PREDICTED: agamous-like MADS-box protein AGL15 isoform X3 [Camelina 
sativa]
Length=257

 Score =   206 bits (525),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 128/255 (50%), Positives = 166/255 (65%), Gaps = 19/255 (7%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN NSRQVTFSKRR+GLLKKA ELS+LCDAEVAVI+FS + KLFE+SS+
Sbjct  1     MGRGKIEIKRIENANSRQVTFSKRRAGLLKKAHELSVLCDAEVAVIVFSKSGKLFEFSSS  60

Query  516   SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMGL  695
              MK TLSRY     S+++        + + KEV++L +EIS+L+ K LQL GK L  +  
Sbjct  61    GMKKTLSRYGNYQSSSDSK-----AEEEDCKEVDLLKDEISKLQKKHLQLQGKGLNILSF  115

Query  696   NELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPSN  875
              EL+ LE +L  AL++++ RKE+LL  QLE SR +E+RA +ENE LRRQ++ELR  +PS 
Sbjct  116   KELQNLEQQLYHALISVRERKERLLAIQLEESRLKEQRAELENETLRRQVQELRSFLPS-  174

Query  876   VSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDD----LDNEVSDTTLQLG-PPTGSC  1040
                     +  Y P    C +       LN G  DD    L    SDTTLQLG P     
Sbjct  175   --------FTHYVPSYIKCFAIDPKNAVLNHGFFDDSNCSLQKTNSDTTLQLGLPGEAHN  226

Query  1041  RKRKTPDQETHSSNS  1085
             R++K  D+E+ SS+S
Sbjct  227   RRKKEGDRESPSSDS  241



>ref|XP_010453478.1| PREDICTED: agamous-like MADS-box protein AGL15 isoform X1 [Camelina 
sativa]
Length=260

 Score =   206 bits (525),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 129/255 (51%), Positives = 167/255 (65%), Gaps = 16/255 (6%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN NSRQVTFSKRR+GLLKKA ELS+LCDAEVAVI+FS + KLFE+SS+
Sbjct  1     MGRGKIEIKRIENANSRQVTFSKRRAGLLKKAHELSVLCDAEVAVIVFSKSGKLFEFSSS  60

Query  516   SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMGL  695
              MK TLSRY     S+++    E   + + KEV++L +EIS+L+ K LQL GK L  +  
Sbjct  61    GMKKTLSRYGNYQSSSDSK--AENLQEEDCKEVDLLKDEISKLQKKHLQLQGKGLNILSF  118

Query  696   NELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPSN  875
              EL+ LE +L  AL++++ RKE+LL  QLE SR +E+RA +ENE LRRQ++ELR  +PS 
Sbjct  119   KELQNLEQQLYHALISVRERKERLLAIQLEESRLKEQRAELENETLRRQVQELRSFLPS-  177

Query  876   VSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDD----LDNEVSDTTLQLG-PPTGSC  1040
                     +  Y P    C +       LN G  DD    L    SDTTLQLG P     
Sbjct  178   --------FTHYVPSYIKCFAIDPKNAVLNHGFFDDSNCSLQKTNSDTTLQLGLPGEAHN  229

Query  1041  RKRKTPDQETHSSNS  1085
             R++K  D+E+ SS+S
Sbjct  230   RRKKEGDRESPSSDS  244



>ref|XP_002873627.1| hypothetical protein ARALYDRAFT_488202 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49886.1| hypothetical protein ARALYDRAFT_488202 [Arabidopsis lyrata subsp. 
lyrata]
Length=256

 Score =   206 bits (524),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 127/255 (50%), Positives = 162/255 (64%), Gaps = 20/255 (8%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN NSRQVTFSKRRSGLLKKA ELS+LCDAEVAVI+FS + KLFE+SST
Sbjct  1     MGRGKIEIKRIENANSRQVTFSKRRSGLLKKAHELSVLCDAEVAVIVFSKSGKLFEFSST  60

Query  516   SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMGL  695
              MK TLSRY     S+ +        + +  EV++L +E+S+L+ K LQL GK L  +  
Sbjct  61    GMKKTLSRYGNHQSSSASK------AEEDCAEVDLLKDELSKLQEKHLQLQGKGLNILTF  114

Query  696   NELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPSN  875
              EL  LE +L  AL+ ++ RKE+LL  QLE SR +E+RA +ENE LRRQ++ELR  +PS 
Sbjct  115   KELHNLEQQLYHALITVRERKERLLTNQLEESRLKEQRAELENETLRRQVQELRSFLPS-  173

Query  876   VSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDD----LDNEVSDTTLQLG-PPTGSC  1040
                     +  Y P    C +       +N GC DD    L    SDTTLQLG P     
Sbjct  174   --------FTHYVPSYIKCFAIDPKNAVINHGCLDDSECSLQKTNSDTTLQLGLPGEAHD  225

Query  1041  RKRKTPDQETHSSNS  1085
             R++K   +E+ SS+S
Sbjct  226   RRKKEGGRESPSSDS  240



>ref|XP_007145592.1| hypothetical protein PHAVU_007G251600g [Phaseolus vulgaris]
 gb|ESW17586.1| hypothetical protein PHAVU_007G251600g [Phaseolus vulgaris]
Length=247

 Score =   205 bits (522),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 122/242 (50%), Positives = 174/242 (72%), Gaps = 15/242 (6%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN+NSRQVTFSKRR+GLLKKA+ELS+LCDAEVAVIIFSST KL+E+S+T
Sbjct  1     MGRGKIEIKKIENLNSRQVTFSKRRNGLLKKARELSVLCDAEVAVIIFSSTGKLYEFSNT  60

Query  516   SMKHTLSRYNKC--LDSTETP-KIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTG  686
             SM+H++SRY+K   LDS E P  +  K   V   +  +L +EI++L+S  L ++GK+L G
Sbjct  61    SMEHSISRYSKGTELDSAEQPIDVPPKDVMVMEPDTNLLKDEITKLRSAYLNMMGKELDG  120

Query  687   MGLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLV  866
             + L EL+ LE++L   +LA+K +KEQ+L+EQL  SR QE++A++ENE LR+Q+EE++   
Sbjct  121   LSLKELQHLENQLSEGILAVKEKKEQVLVEQLRRSRIQEQKAVLENEVLRKQLEEIQN--  178

Query  867   PSNVSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVSDTTLQLGPPTGSCRK  1046
                      T +LE+  + ++ S  K+ ++SL   C  + +N+ SDT+LQL   T   R+
Sbjct  179   ------KTKTQFLEFSSLDRSFS--KNSSKSL-FNCASE-ENDHSDTSLQLALSTDYGRQ  228

Query  1047  RK  1052
             RK
Sbjct  229   RK  230



>ref|XP_010547303.1| PREDICTED: agamous-like MADS-box protein AGL15 isoform X2 [Tarenaya 
hassleriana]
Length=274

 Score =   205 bits (522),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 140/271 (52%), Positives = 178/271 (66%), Gaps = 14/271 (5%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN N+RQVTFSKRR+GLLKKA+EL++LCDAEVAVI+FS++ KLFE+SS+
Sbjct  1     MGRGKIEIKRIENANNRQVTFSKRRAGLLKKARELAVLCDAEVAVIVFSNSGKLFEFSSS  60

Query  516   SMKHTLSRYNKCLDSTETPKIvekkpkvehkevev----------LNNEISELKSKQLQL  665
              MK TLSRYNK   S+  P I  K      + V            L  EIS+L+ KQ QL
Sbjct  61    GMKKTLSRYNKYQKSSGPPPIECKAEISPIQFVLWKVDNCIEVELLKEEISKLREKQSQL  120

Query  666   LGKDLTGMGLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQI  845
             LGK L G+ L EL+ LE +L+  LL+++ RKEQLLLEQLE SR +E+RA++ENE LRRQ+
Sbjct  121   LGKGLNGLSLKELQLLEEQLNETLLSVRERKEQLLLEQLEESRLKEQRAMLENETLRRQV  180

Query  846   EELRGLVPSNVSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVSDTTLQLGP  1025
             EELRGL+PS      P+ Y+E YPV       KD A+     C     +  SDTTLQLG 
Sbjct  181   EELRGLLPSANLRYFPS-YIECYPVEIKKPPVKD-ADFGGFNCMAQKTD--SDTTLQLGL  236

Query  1026  PTGSCRKRKTPDQETHSSNSENHLELK*RGC  1118
             P  +  +RK  + E  SS+ ++ L    R C
Sbjct  237   PGEAEERRKRKEPEKGSSSGDSVLTNTARAC  267



>emb|CDY65963.1| BnaA10g29830D [Brassica napus]
Length=264

 Score =   204 bits (520),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 127/246 (52%), Positives = 167/246 (68%), Gaps = 15/246 (6%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN NSRQVTFSKRR+GLLKKA ELS+LCD+EVAVI+FS + KLFE+SST
Sbjct  1     MGRGKIEIKRIENANSRQVTFSKRRAGLLKKAHELSVLCDSEVAVIVFSKSGKLFEFSST  60

Query  516   SMKHTLSRYNKCLDSTETPKIvekkpkveh--kevevLNNEISELKSKQLQLLGKDLTGM  689
              MK TL RY+    S++ P I  K  K E    EV++L NEIS+L+ K LQ+ GK L  +
Sbjct  61    RMKRTLLRYDNYQRSSDAPLIKYKPEKQEEDCTEVDLLKNEISKLQEKHLQMQGKGLNAL  120

Query  690   GLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVP  869
             GL EL+ LE +L+ +L++++ RKE LL +QLE SR +E+RA +ENE LRRQ++ELR  +P
Sbjct  121   GLKELQHLEQQLNVSLISVRERKELLLTKQLEESRLKEQRAELENETLRRQVQELRSFLP  180

Query  870   SNVSMPMPTPYLEYYPV-LKNCSSGKDGAESLNTGCDD---DLDNEVSDTTLQLGPPTGS  1037
             S     +P+ Y+  + +  KN           N+G DD    L    SDTTLQLG P G 
Sbjct  181   SFNQQYVPS-YITCFAIDPKNSPVN-------NSGLDDTNYSLQKTNSDTTLQLGLP-GE  231

Query  1038  CRKRKT  1055
              + R++
Sbjct  232   AQARRS  237



>ref|NP_196883.1| agamous-like MADS-box protein AGL15 [Arabidopsis thaliana]
 sp|Q38847.1|AGL15_ARATH RecName: Full=Agamous-like MADS-box protein AGL15 [Arabidopsis 
thaliana]
 gb|AAA65653.1| AGL15 [Arabidopsis thaliana]
 dbj|BAB10600.1| floral homeotic protein AGL15 [Arabidopsis thaliana]
 gb|AED91941.1| agamous-like MADS-box protein AGL15 [Arabidopsis thaliana]
Length=268

 Score =   204 bits (519),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 125/252 (50%), Positives = 162/252 (64%), Gaps = 16/252 (6%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN NSRQVTFSKRRSGLLKKA+ELS+LCDAEVAVI+FS + KLFEYSST
Sbjct  1     MGRGKIEIKRIENANSRQVTFSKRRSGLLKKARELSVLCDAEVAVIVFSKSGKLFEYSST  60

Query  516   SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMGL  695
              MK TLSRY     S+ +      K + +  EV++L +++S+L+ K LQL GK L  +  
Sbjct  61    GMKQTLSRYGNHQSSSAS------KAEEDCAEVDILKDQLSKLQEKHLQLQGKGLNPLTF  114

Query  696   NELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPSN  875
              EL+ LE +L  AL+ ++ RKE+LL  QLE SR +E+RA +ENE LRRQ++ELR  +PS 
Sbjct  115   KELQSLEQQLYHALITVRERKERLLTNQLEESRLKEQRAELENETLRRQVQELRSFLPS-  173

Query  876   VSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVSDTTLQLGPPTGSCRKRKT  1055
                     +  Y P    C +       +N      L N  SDTTLQLG P G    R+T
Sbjct  174   --------FTHYVPSYIKCFAIDPKNALINHDSKCSLQNTDSDTTLQLGLP-GEAHDRRT  224

Query  1056  PDQETHSSNSEN  1091
              + E  S +S++
Sbjct  225   NEGERESPSSDS  236



>ref|XP_004513865.1| PREDICTED: agamous-like MADS-box protein AGL18-like [Cicer arietinum]
Length=249

 Score =   203 bits (516),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 119/244 (49%), Positives = 166/244 (68%), Gaps = 15/244 (6%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN+NSRQVTFSKRR+GLLKKA+ELSILCDAEVAVIIFS T KL+E+SST
Sbjct  1     MGRGKIEIKKIENLNSRQVTFSKRRNGLLKKAKELSILCDAEVAVIIFSGTGKLYEFSST  60

Query  516   SMKHTLSRYNKCLDSTETPKIve----kkpkvehkevevLNNEISELKSKQLQLLGKDLT  683
             SM+H  SRY + L+S    +        +      +  +L  EI++L+S  L++ GK+L 
Sbjct  61    SMEHIFSRYGRGLNSNGAEQQPSDQPPAEVVEHDSDTTLLQEEITKLRSDYLRMTGKELD  120

Query  684   GMGLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGL  863
             G+ L EL+ LE++L   +LA+K +KEQ+LLEQL+ SR QE++A++ENE LR+Q+EE    
Sbjct  121   GLDLKELQYLENQLCEGILAVKNKKEQVLLEQLKRSRLQEQKAMMENEALRKQLEE----  176

Query  864   VPSNVSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVSDTTLQLGPPTGSCR  1043
                 +       +LE++ + +   S  +G++ L+  C +  DNE+SDT LQLG  +   R
Sbjct  177   ----IEKKRKAEFLEFHSLDRTIIS-MNGSKPLSNFCSE--DNEISDTCLQLGLSSDYGR  229

Query  1044  KRKT  1055
             KRK 
Sbjct  230   KRKA  233



>ref|XP_010492157.1| PREDICTED: agamous-like MADS-box protein AGL15 isoform X2 [Camelina 
sativa]
Length=258

 Score =   202 bits (515),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 129/255 (51%), Positives = 166/255 (65%), Gaps = 18/255 (7%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN NSRQVTFSKRR+GLLKKA ELS+LCDAEVAVI+FS + KLFE+SS+
Sbjct  1     MGRGKIEIKRIENANSRQVTFSKRRAGLLKKAHELSVLCDAEVAVIVFSKSGKLFEFSSS  60

Query  516   SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMGL  695
              MK TLSRY     S+++    E   + + KEV++L +EIS+L+ K LQL GK L  +  
Sbjct  61    GMKKTLSRYGNYQSSSDSK--AENLQEDDCKEVDLLKDEISQLQKKHLQLQGKGLNILSF  118

Query  696   NELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPSN  875
              EL+ LE +L  AL++++ RKE+LL  QLE SR +  RA +ENE LRRQ++ELR  +PS 
Sbjct  119   KELQNLEQQLYHALISVRERKERLLAIQLEESRLK--RAELENETLRRQVQELRSFLPS-  175

Query  876   VSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDD----LDNEVSDTTLQLG-PPTGSC  1040
                     +  Y P    C +       LN GC DD    L    SDTTLQLG P     
Sbjct  176   --------FTHYVPSYIKCFAIDPKNAVLNHGCFDDSNCSLQKTNSDTTLQLGLPGEAHD  227

Query  1041  RKRKTPDQETHSSNS  1085
             R++K  D+E+ SS+S
Sbjct  228   RRKKEGDRESPSSDS  242



>ref|XP_002308020.1| AGL15 family protein [Populus trichocarpa]
 gb|EEE91543.1| AGL15 family protein [Populus trichocarpa]
Length=228

 Score =   200 bits (508),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 118/253 (47%), Positives = 161/253 (64%), Gaps = 35/253 (14%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN+NSRQVTFSKRR+GLLKKA+ELS+LCDAEVAVI+FSST KL+E+SST
Sbjct  1     MGRGKIEIKRIENLNSRQVTFSKRRNGLLKKARELSVLCDAEVAVIVFSSTGKLYEFSST  60

Query  516   SMKHTLSRYNKC--LDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGM  689
             SM+HTLSRY     LD  + P            EV  + +E+S+L+   LQ++G+ L G+
Sbjct  61    SMEHTLSRYGSGLDLDYNDHPSDDHGAEHSNSAEVNAVKDELSKLRLTCLQMMGQQLDGL  120

Query  690   GLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEEL-RGLV  866
                EL+ LEH+L   +L++K +KEQ+L++QL+ S+ QE++A +ENE+LR+QIEEL RG  
Sbjct  121   SFKELQHLEHQLSAGILSVKDKKEQMLMDQLKKSKMQEQKATLENESLRKQIEELKRGSR  180

Query  867   PSNVSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVSDTTLQLGPPTGSCRK  1046
             P+N       P  E                            ++SDT+L LG  +  C K
Sbjct  181   PNN-----RKPQEE---------------------------EDLSDTSLHLGLSSDVCHK  208

Query  1047  RKTPDQETHSSNS  1085
             RK    E+ S++S
Sbjct  209   RKADKIESVSNDS  221



>ref|XP_010547302.1| PREDICTED: agamous-like MADS-box protein AGL15 isoform X1 [Tarenaya 
hassleriana]
Length=275

 Score =   201 bits (511),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 140/272 (51%), Positives = 178/272 (65%), Gaps = 15/272 (6%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN N+RQVTFSKRR+GLLKKA+EL++LCDAEVAVI+FS++ KLFE+SS+
Sbjct  1     MGRGKIEIKRIENANNRQVTFSKRRAGLLKKARELAVLCDAEVAVIVFSNSGKLFEFSSS  60

Query  516   SMKHTLSRYNKCLDSTETPKIvekkpkvehkevev----------LNNEISELKSKQ-LQ  662
              MK TLSRYNK   S+  P I  K      + V            L  EIS+L+ KQ  Q
Sbjct  61    GMKKTLSRYNKYQKSSGPPPIECKAEISPIQFVLWKVDNCIEVELLKEEISKLREKQSRQ  120

Query  663   LLGKDLTGMGLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQ  842
             LLGK L G+ L EL+ LE +L+  LL+++ RKEQLLLEQLE SR +E+RA++ENE LRRQ
Sbjct  121   LLGKGLNGLSLKELQLLEEQLNETLLSVRERKEQLLLEQLEESRLKEQRAMLENETLRRQ  180

Query  843   IEELRGLVPSNVSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVSDTTLQLG  1022
             +EELRGL+PS      P+ Y+E YPV       KD A+     C     +  SDTTLQLG
Sbjct  181   VEELRGLLPSANLRYFPS-YIECYPVEIKKPPVKD-ADFGGFNCMAQKTD--SDTTLQLG  236

Query  1023  PPTGSCRKRKTPDQETHSSNSENHLELK*RGC  1118
              P  +  +RK  + E  SS+ ++ L    R C
Sbjct  237   LPGEAEERRKRKEPEKGSSSGDSVLTNTARAC  268



>ref|XP_009121726.1| PREDICTED: agamous-like MADS-box protein AGL15 isoform X1 [Brassica 
rapa]
Length=264

 Score =   199 bits (507),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 124/245 (51%), Positives = 164/245 (67%), Gaps = 15/245 (6%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK I+N NSRQVTFSKRR+GLLKKA ELS+LCD+EVAVI+FS + KLFE+SST
Sbjct  1     MGRGKIEIKRIDNANSRQVTFSKRRAGLLKKAHELSVLCDSEVAVIVFSKSGKLFEFSST  60

Query  516   SMKHTLSRYNKCLDSTETPKIvekkpkveh--kevevLNNEISELKSKQLQLLGKDLTGM  689
              MK TL RY+    S++ P I  K    E    EV++L NEIS+L+ K LQ+ GK L  +
Sbjct  61    RMKRTLLRYDNYQRSSDAPLINYKPENQEEDCTEVDLLKNEISKLQEKHLQMQGKGLNAL  120

Query  690   GLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVP  869
              L EL+ LE +L+ +L++++ RKE LL +QLE SR +E+RA +ENE LRRQ++ELR  +P
Sbjct  121   SLKELQHLEQQLNVSLISVRERKELLLTKQLEESRLKEQRAELENETLRRQVQELRSFLP  180

Query  870   SNVSMPMPTPYLEYYPV-LKNCSSGKDGAESLNTGCDD---DLDNEVSDTTLQLGPPTGS  1037
             S     +P+ Y+  + +  KN           N+G DD    L    SDTTLQLG P G 
Sbjct  181   SFNQQYVPS-YITCFAIDPKNSPVN-------NSGLDDTNYSLQKTNSDTTLQLGLP-GE  231

Query  1038  CRKRK  1052
              + R+
Sbjct  232   AQARR  236



>ref|XP_010453479.1| PREDICTED: agamous-like MADS-box protein AGL15 isoform X2 [Camelina 
sativa]
Length=258

 Score =   199 bits (505),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 128/255 (50%), Positives = 165/255 (65%), Gaps = 18/255 (7%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN NSRQVTFSKRR+GLLKKA ELS+LCDAEVAVI+FS + KLFE+SS+
Sbjct  1     MGRGKIEIKRIENANSRQVTFSKRRAGLLKKAHELSVLCDAEVAVIVFSKSGKLFEFSSS  60

Query  516   SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMGL  695
              MK TLSRY     S+++    E   + + KEV++L +EIS+L+ K LQL GK L  +  
Sbjct  61    GMKKTLSRYGNYQSSSDSK--AENLQEEDCKEVDLLKDEISKLQKKHLQLQGKGLNILSF  118

Query  696   NELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPSN  875
              EL+ LE +L  AL++++ RKE+LL  QLE SR +  RA +ENE LRRQ++ELR  +PS 
Sbjct  119   KELQNLEQQLYHALISVRERKERLLAIQLEESRLK--RAELENETLRRQVQELRSFLPS-  175

Query  876   VSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDD----LDNEVSDTTLQLG-PPTGSC  1040
                     +  Y P    C +       LN G  DD    L    SDTTLQLG P     
Sbjct  176   --------FTHYVPSYIKCFAIDPKNAVLNHGFFDDSNCSLQKTNSDTTLQLGLPGEAHN  227

Query  1041  RKRKTPDQETHSSNS  1085
             R++K  D+E+ SS+S
Sbjct  228   RRKKEGDRESPSSDS  242



>gb|ADD82424.1| MADS-box protein AGL15 [Dimocarpus longan]
Length=213

 Score =   196 bits (499),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 116/215 (54%), Positives = 152/215 (71%), Gaps = 3/215 (1%)
 Frame = +3

Query  459   EVAVIIFSSTDKLFEYSSTSMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEIS  638
             EVAVI+FS+T KLFE+SS+ MK TLSRYNKCL+ TET     K  K   KEV  L +EI+
Sbjct  1     EVAVIVFSNTGKLFEFSSSGMKRTLSRYNKCLNFTETAVAEHKAEKQNTKEVNGLKDEIT  60

Query  639   ELKSKQLQLLGKDLTGMGLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALV  818
             +L++KQL+LLGKDL G+ L EL+ LE +L+  LL +K +KEQLL+EQLE SR QE++A++
Sbjct  61    KLQAKQLRLLGKDLNGLSLKELQLLEQELNDGLLLVKEKKEQLLMEQLEQSRLQEQQAVL  120

Query  819   ENENLRRQIEELRGLVPSNVSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEV  998
             ENE LRRQ+EELRG  PS     +PT +LEY P L+  ++  + + S +   D  +D   
Sbjct  121   ENETLRRQVEELRGFFPS-TDCSVPT-FLEYCP-LQRRNALMNHSASPDIASDSAIDKGD  177

Query  999   SDTTLQLGPPTGSCRKRKTPDQETHSSNSENHLEL  1103
             SDTTLQLGPPT +  KRK P+ ETHS +S + L L
Sbjct  178   SDTTLQLGPPTDNYHKRKAPEGETHSHDSRSQLGL  212



>emb|CDX70519.1| BnaC03g06030D [Brassica napus]
Length=264

 Score =   197 bits (500),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 124/237 (52%), Positives = 160/237 (68%), Gaps = 15/237 (6%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN NSRQVTFSKRR+GLLKKA ELS+LCDAEVAVI+FS + KLFE+SST
Sbjct  1     MGRGKIEIKRIENANSRQVTFSKRRAGLLKKAHELSVLCDAEVAVIVFSKSGKLFEFSST  60

Query  516   -SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMG  692
               MK TL RY     S++ P I  K    E  EV++L +EIS L+ K LQ+ GK L  + 
Sbjct  61    RCMKKTLLRYGNYQISSDVPGINRKAENQECTEVDLLKDEISMLQEKHLQMQGKRLNLLS  120

Query  693   LNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPS  872
             L EL+ LE +L+ +L++++ RKE LL +QLE SR +E+RA +ENE LRRQ++ELR  +PS
Sbjct  121   LKELQHLEKQLNFSLISVRERKELLLTKQLEESRLKEQRAELENETLRRQVQELRSFLPS  180

Query  873   NVSMPMPTPYLEYYPVLKNCSSGKDGAESL--NTGCDD---DLDNEVSDTTLQLGPP  1028
                  +P+ Y++ + +        D  +SL  NT   D    L N  SDTTLQLG P
Sbjct  181   INQHYVPS-YIKCFAI--------DPKKSLLSNTCLGDINCSLQNTNSDTTLQLGLP  228



>ref|XP_007028680.1| AGAMOUS-like 18, putative [Theobroma cacao]
 gb|EOY09182.1| AGAMOUS-like 18, putative [Theobroma cacao]
Length=252

 Score =   196 bits (498),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 119/245 (49%), Positives = 166/245 (68%), Gaps = 15/245 (6%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN+NSRQVTFSKRR+GLLKKA+ELSILCDAEV VI+FSST K++++SST
Sbjct  1     MGRGKIEIKKIENLNSRQVTFSKRRNGLLKKARELSILCDAEVGVIVFSSTGKVYQWSST  60

Query  516   SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNN---EISELKSKQLQLLGKDLTG  686
             SM+H L RY++   +TE P       + ++ +   +N    E   L++  ++L GK+L G
Sbjct  61    SMEHILLRYSRG--TTEDPSQEHPSDEHKNLQPIDVNTLKEEYLRLRAAYMRLNGKELDG  118

Query  687   MGLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLV  866
             +   EL+QLEH+L+  +L++K +KEQ+LLEQL+ SR QE +A++ENE LR+QI EL+   
Sbjct  119   LTFKELQQLEHQLNEGILSVKQQKEQILLEQLKRSRLQERQAILENETLRKQIVELQQNT  178

Query  867   PSNVSMPMPTPYLEYYPVLK-NCSSGKDGAESLNTGCDDDLD-NEVSDTTLQLGPPTGSC  1040
              SN+        LEY P+ + +  S K   +  +   DD  D N+ SDT+L LG P+   
Sbjct  179   SSNL--------LEYNPLQRVSPYSSKAEYDCASEEEDDHADNNDHSDTSLHLGLPSDVG  230

Query  1041  RKRKT  1055
             RKRK 
Sbjct  231   RKRKV  235



>ref|XP_009131360.1| PREDICTED: agamous-like MADS-box protein AGL15 isoform X2 [Brassica 
rapa]
Length=264

 Score =   196 bits (497),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 124/245 (51%), Positives = 162/245 (66%), Gaps = 15/245 (6%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN NSRQVTFSKRR+GLLKKA ELS+LCDAEVAVI+FS + KLFE+SST
Sbjct  1     MGRGKIEIKRIENANSRQVTFSKRRAGLLKKAHELSVLCDAEVAVIVFSKSGKLFEFSST  60

Query  516   SMKHTLSRYNKCLDSTETPKIv-ekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMG  692
             SMK TL RY     S++ P I  + + + E  EV++L +EIS L+ K L + GK L  + 
Sbjct  61    SMKKTLLRYGNYQISSDVPGINCKTENQEECTEVDLLKDEISMLQEKHLHMQGKRLNLLS  120

Query  693   LNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPS  872
             L EL+ LE +L+ +L++++ RKE LL +QLE SR +E+RA +ENE LRRQ++ELR  +PS
Sbjct  121   LKELQHLEKQLNFSLISVRERKELLLTKQLEESRLKEQRAELENETLRRQVQELRSFLPS  180

Query  873   NVSMPMPTPYLEYYPVLKNCSSGKDGAESL--NTGCDD---DLDNEVSDTTLQLGPPTGS  1037
              ++      Y+  + +        D   SL  NT   D    L N  SDTTLQLG P  +
Sbjct  181   -INQHYAPSYIRCFAI--------DPKNSLLSNTCLGDINCSLQNTNSDTTLQLGLPGEA  231

Query  1038  CRKRK  1052
                RK
Sbjct  232   HDTRK  236



>emb|CDY67731.1| BnaCnng56130D [Brassica napus]
Length=265

 Score =   195 bits (496),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 120/246 (49%), Positives = 163/246 (66%), Gaps = 14/246 (6%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             M RGKI+IK IEN NSRQVTFSKRR+GLLKKA ELS+LCD+EVAVI+FS + KLFE+SST
Sbjct  1     MDRGKIEIKRIENANSRQVTFSKRRAGLLKKAHELSVLCDSEVAVIVFSKSGKLFEFSST  60

Query  516   SMKHTLSRYNKCLDSTETP--KIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGM  689
              MK TL RY     S++ P  K   +  + +  EV+ L NEIS+L+ K LQ+ GK L  +
Sbjct  61    GMKRTLLRYENYQRSSDAPLIKYKPENQEEDCTEVDFLKNEISKLQEKHLQMQGKGLNAL  120

Query  690   GLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVP  869
              L EL+ LE +L+ +L++++ RKE LL +Q+E SR +E+RA +ENE LRRQ++ELR  +P
Sbjct  121   CLKELQHLEQQLNVSLISVRERKELLLTKQIEESRIREQRAELENETLRRQVQELRNFLP  180

Query  870   SNVSMPMPTPYLEYYPV-LKNCSSGKDGAESLNTGCDD---DLDNEVSDTTLQLGPPTGS  1037
             S     +P+ Y+  + +  KN           N+G DD    L    SDTTLQLG P  +
Sbjct  181   SINQNYVPS-YITCFAIDPKNSPVN-------NSGLDDTNYSLQKTNSDTTLQLGLPGEA  232

Query  1038  CRKRKT  1055
               +R++
Sbjct  233   QARRRS  238



>sp|Q39295.1|AGL15_BRANA RecName: Full=Agamous-like MADS-box protein AGL15 [Brassica napus]
 gb|AAA65654.1| AGL15 [Brassica napus]
Length=264

 Score =   195 bits (496),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 124/245 (51%), Positives = 162/245 (66%), Gaps = 15/245 (6%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN NSRQVTFSKRR+GLLKKA ELS+LCDAEVAVI+FS + KLFE+SST
Sbjct  1     MGRGKIEIKRIENANSRQVTFSKRRAGLLKKAHELSVLCDAEVAVIVFSKSGKLFEFSST  60

Query  516   SMKHTLSRYNKCLDSTETPKIv-ekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMG  692
             SMK TL RY     S++ P I  + + + E  EV++L +EIS L+ K L + GK L  + 
Sbjct  61    SMKKTLLRYGNYQISSDVPGINCKTENQEECTEVDLLKDEISMLQEKHLHMQGKPLNLLS  120

Query  693   LNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPS  872
             L EL+ LE +L+ +L++++ RKE LL +QLE SR +E+RA +ENE LRRQ++ELR  +PS
Sbjct  121   LKELQHLEKQLNFSLISVRERKELLLTKQLEESRLKEQRAELENETLRRQVQELRSFLPS  180

Query  873   NVSMPMPTPYLEYYPVLKNCSSGKDGAESL--NTGCDD---DLDNEVSDTTLQLGPPTGS  1037
              ++      Y+  + +        D   SL  NT   D    L N  SDTTLQLG P  +
Sbjct  181   -INQHYAPSYIRCFAI--------DPKNSLLSNTCLGDINCSLQNTNSDTTLQLGLPGEA  231

Query  1038  CRKRK  1052
                RK
Sbjct  232   HDTRK  236



>gb|AAB03807.1| AGL15 type 2 [Brassica napus]
Length=265

 Score =   195 bits (496),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 121/251 (48%), Positives = 164/251 (65%), Gaps = 15/251 (6%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             M RGKI+IK IEN NSRQVTFSKRR+GLLKKA ELS+LCD+EVAVI+FS + KLFE+SST
Sbjct  1     MDRGKIEIKRIENANSRQVTFSKRRAGLLKKAHELSVLCDSEVAVIVFSKSGKLFEFSST  60

Query  516   SMKHTLSRYNKCLDSTETP--KIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGM  689
              MK T+ RY     S++ P  K   +  + +  EV+ L NEIS+L+ K LQ+ GK L  +
Sbjct  61    GMKRTVLRYENYQRSSDAPLIKYKPENQEEDCTEVDFLKNEISKLQEKHLQMQGKGLNAL  120

Query  690   GLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVP  869
              L EL+ LE +L+ +L++++ RKE LL +Q+E SR +E+RA +ENE LRRQ++ELR  +P
Sbjct  121   CLKELQHLEQQLNVSLISVRERKELLLTKQIEESRIREQRAELENETLRRQVQELRNFLP  180

Query  870   SNVSMPMPTPYLEYYPV-LKNCSSGKDGAESLNTGCDD---DLDNEVSDTTLQLG-PPTG  1034
             S     +P+ Y+  + +  KN           N+G DD    L    SDTTLQLG P   
Sbjct  181   SINQNYVPS-YITCFAIDPKNSPVN-------NSGLDDTNYSLQKTNSDTTLQLGLPGEA  232

Query  1035  SCRKRKTPDQE  1067
               R+R   ++E
Sbjct  233   QARRRSEANRE  243



>emb|CDP14125.1| unnamed protein product [Coffea canephora]
Length=240

 Score =   194 bits (493),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 119/252 (47%), Positives = 160/252 (63%), Gaps = 19/252 (8%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IENVNSRQVTFSKRR+GLLKKA+EL+ILCDAEV VI+FSST KL+E++ST
Sbjct  1     MGRGKIEIKKIENVNSRQVTFSKRRAGLLKKAKELAILCDAEVGVIVFSSTGKLYEFAST  60

Query  516   SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMGL  695
              M+  L+RYN   +S++   +  K       + + L +EI++L+  Q Q+ GK+L G+  
Sbjct  61    RMEQILARYNTNPESSKLITMENKTENEPQPQADALKSEIAKLQLVQRQMTGKELGGLNF  120

Query  696   NELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELR-GLVPS  872
              EL+ LEH+L   +LA+K RKEQ+LLEQLE S+ Q  + ++ENE LR Q+EE R  L   
Sbjct  121   QELQHLEHQLHEGILAVKDRKEQVLLEQLEKSKLQ--KVVLENEALREQVEEYRLRLYRE  178

Query  873   NVSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVSDTTLQLGPPTGSCRKRK  1052
             N  +      +    V  +C S KDG                SDT+L+LG     C KRK
Sbjct  179   NGQLGRKNSGVCSSTVC-DCRSEKDGN---------------SDTSLRLGLSVDICHKRK  222

Query  1053  TPDQETHSSNSE  1088
              P  E+ S++SE
Sbjct  223   KPKTESTSNDSE  234



>ref|XP_006492965.1| PREDICTED: agamous-like MADS-box protein AGL18-like [Citrus sinensis]
Length=253

 Score =   194 bits (494),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 116/255 (45%), Positives = 172/255 (67%), Gaps = 14/255 (5%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN+NSRQVTFSKRR+GLLKKA+ELS+LCDA+V VI+FSST KL+E+SS+
Sbjct  1     MGRGKIEIKKIENLNSRQVTFSKRRNGLLKKAKELSVLCDADVGVIVFSSTGKLYEFSSS  60

Query  516   SMKHTLSRYNKCLD-STETPKIvekkpkvehkevevLN---NEISELKSKQLQLLGKDLT  683
             SM+H LSRY+K +D   +T +  E        +   LN   +E + L+   +++ G++L 
Sbjct  61    SMEHILSRYSKGIDLECQTNRNEEHGVPELPPKSAELNALKDEYARLRLAYMRMNGQELD  120

Query  684   GMGLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGL  863
             G+   EL+QLEH+L   +L++K  KEQ+LLEQ++ SR  E++A++ENE LR+Q+EELR  
Sbjct  121   GLSFKELQQLEHQLSEGMLSVKDMKEQVLLEQIKRSRLMEQKAMLENETLRKQMEELR--  178

Query  864   VPSNVSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGC-DDDLDNEVSDTTLQLGPPTGSC  1040
                       +P +E+ P+ +  S  K  A+  + GC  ++ +++ SDT+L LG  +   
Sbjct  179   -----RSSSRSPLVEFDPLERRFSFTKLKAD--HCGCTSNENEDDHSDTSLHLGLSSEVR  231

Query  1041  RKRKTPDQETHSSNS  1085
             RKRK P  E+  ++S
Sbjct  232   RKRKAPKIESTGNDS  246



>ref|XP_010653763.1| PREDICTED: MADS-box transcription factor 23-like isoform X3 [Vitis 
vinifera]
Length=244

 Score =   194 bits (493),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 117/261 (45%), Positives = 161/261 (62%), Gaps = 27/261 (10%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN+NSRQVTFSKRR+GLLKKA+ELS+LCDAEV VIIFSST KL+E+SS+
Sbjct  1     MGRGKIEIKKIENINSRQVTFSKRRAGLLKKAKELSVLCDAEVGVIIFSSTGKLYEFSSS  60

Query  516   SMKHTLSRYNKCLDSTETPKIvekkp-------kvehkevevLNNEISELKSKQLQLLGK  674
             SM+HTL+RY + LDS E P +            +    EV  L  E+++L+   L+++GK
Sbjct  61    SMEHTLTRYGRGLDS-ELPSLHRSAEVRYSIVPQESQPEVASLKEEVAKLQKGYLRMMGK  119

Query  675   DLTGMGLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEEL  854
             +L G+   EL+ LEH L   +L++K +KE            QE+RA++ENE LR+Q+EEL
Sbjct  120   ELDGLSFKELQHLEHLLSEGILSVKDKKE------------QEQRAMMENETLRKQVEEL  167

Query  855   RGLVPSNVSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVSDTTLQLGPPTG  1034
             R       S P P  ++EY+P  +  S         +    D+     SDT+L LG P+ 
Sbjct  168   R-----RSSRPQPPSFIEYHPPERRQSLQISSKTPCSCSTVDERGG--SDTSLHLGLPSD  220

Query  1035  SCRKRKTPDQETHSSNSENHL  1097
             +  KRK P  E    +SE+ +
Sbjct  221   AYLKRKGPKIEPIFIDSESQV  241



>ref|XP_006421311.1| hypothetical protein CICLE_v10005698mg [Citrus clementina]
 gb|ESR34551.1| hypothetical protein CICLE_v10005698mg [Citrus clementina]
 gb|KDO45923.1| hypothetical protein CISIN_1g039982mg [Citrus sinensis]
Length=253

 Score =   194 bits (493),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 116/255 (45%), Positives = 171/255 (67%), Gaps = 14/255 (5%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN+NSRQVTFSKRR+GLLKKA+ELS+LCDA+V VI+FSST KL+E+SS+
Sbjct  1     MGRGKIEIKKIENLNSRQVTFSKRRNGLLKKAKELSVLCDADVGVIVFSSTGKLYEFSSS  60

Query  516   SMKHTLSRYNKCLD-STETPKIvekkpkvehkevevLN---NEISELKSKQLQLLGKDLT  683
             SM+H LSRY+K +D   +T +  E        +   LN   +E + L+   +++ G++L 
Sbjct  61    SMEHILSRYSKGIDLECQTNRNEEHGVPELPPKSAELNALKDEYARLRLAYMRMNGQELD  120

Query  684   GMGLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGL  863
             G+   EL+QLEH+L   +L++K  KEQ+LLEQ+  SR  E++A++ENE LR+Q+EELR  
Sbjct  121   GLSFKELQQLEHQLSEGMLSVKDMKEQVLLEQIRRSRLMEQKAMLENETLRKQMEELR--  178

Query  864   VPSNVSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGC-DDDLDNEVSDTTLQLGPPTGSC  1040
                       +P +E+ P+ +  S  K  A+  + GC  ++ +++ SDT+L LG  +   
Sbjct  179   -----RSSSRSPLVEFDPLERRFSFTKLKAD--HCGCTSNENEDDHSDTSLHLGLSSEVR  231

Query  1041  RKRKTPDQETHSSNS  1085
             RKRK P  E+  ++S
Sbjct  232   RKRKAPKIESTGNDS  246



>gb|ABD77425.1| agamous-like 15 [Brassica napus]
Length=264

 Score =   193 bits (490),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 123/245 (50%), Positives = 161/245 (66%), Gaps = 15/245 (6%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN NSRQVTFSKRR+GLLKKA ELS+LCDAEVAVI+FS + KLFE+SST
Sbjct  1     MGRGKIEIKRIENANSRQVTFSKRRAGLLKKAHELSVLCDAEVAVIVFSKSGKLFEFSST  60

Query  516   SMKHTLSRYNKCLDSTETPKIv-ekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMG  692
             SMK TL RY     S++ P I  + + + E  EV++L +EIS L+ K L + GK L  + 
Sbjct  61    SMKKTLLRYGNYQISSDVPGINCKTENQEECTEVDLLKDEISMLQEKHLHMQGKRLNLLS  120

Query  693   LNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPS  872
             L EL+ LE +L+ + ++++ RKE LL +QLE SR +E+RA +ENE LRRQ++ELR  +PS
Sbjct  121   LKELQHLEKQLNFSSISVRERKELLLTKQLEESRLKEQRAELENETLRRQVQELRSFLPS  180

Query  873   NVSMPMPTPYLEYYPVLKNCSSGKDGAESL--NTGCDD---DLDNEVSDTTLQLGPPTGS  1037
              ++      Y+  + +        D   SL  NT   D    L N  SDTTLQLG P  +
Sbjct  181   -INQHYAPSYIRCFAI--------DPKNSLLSNTCLGDINCSLQNTNSDTTLQLGLPGEA  231

Query  1038  CRKRK  1052
                RK
Sbjct  232   HDTRK  236



>ref|XP_009592798.1| PREDICTED: agamous-like MADS-box protein AGL15 isoform X2 [Nicotiana 
tomentosiformis]
Length=221

 Score =   190 bits (483),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 118/208 (57%), Positives = 148/208 (71%), Gaps = 21/208 (10%)
 Frame = +3

Query  528   TLSRYNKCLDSTETPKIvekk----------------pkvehkevevLNNEISELKSKQL  659
             TLSRYN+C+ STE   I  K                  K E KEVE L +E+S+LK KQL
Sbjct  14    TLSRYNRCVASTEISAIERKSEVNQQPQPQAQLQTHVQKQEQKEVESLKDELSKLKIKQL  73

Query  660   QLLGKDLTGMGLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRR  839
             +LLGKDL G+GLNELR LEH+L+  LLAIK RKE+LL++QLENSR+QEERA++E+E LRR
Sbjct  74    RLLGKDLNGLGLNELRLLEHQLNEGLLAIKDRKEELLIQQLENSRRQEERAVLESETLRR  133

Query  840   QIEELRGLVPSNVSMPMPTPYLEYYPVLKNCSSGKDGAESL--NTGCDDDLDNEVSDTTL  1013
             Q+EELRGL P  +S  +P PYLEY+P+ K     K+G ESL  +T C+D +D+E S+TTL
Sbjct  134   QVEELRGLFP--LSASLPPPYLEYHPLEKKYPIIKEGEESLDSDTACEDGVDDEDSNTTL  191

Query  1014  QLGPPTGSCRKRKTPDQETHSSNSENHL  1097
             QLG PT   RKRK P+QE+ SSNSEN +
Sbjct  192   QLGLPTIG-RKRKKPEQESPSSNSENQV  218



>dbj|BAJ53208.1| JHL06B08.10 [Jatropha curcas]
 gb|KDP26077.1| hypothetical protein JCGZ_21110 [Jatropha curcas]
Length=254

 Score =   191 bits (484),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 111/242 (46%), Positives = 162/242 (67%), Gaps = 8/242 (3%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN+NSRQVTFSKRRSGL+KKA+ELS+LCDAEVAVI+FSST KL+E+SS+
Sbjct  1     MGRGKIEIKKIENLNSRQVTFSKRRSGLIKKAKELSVLCDAEVAVIVFSSTGKLYEFSSS  60

Query  516   SMKHTLSRYNKCLD--STETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGM  689
             SM+ TLSRY+K  D    E         + + +EV  L +E+S+L+   LQ++G+ L G+
Sbjct  61    SMEQTLSRYSKGPDLMCPEHASDYPGTEQSQSEEVTALKDEVSKLRLTCLQMMGQQLDGL  120

Query  690   GLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVP  869
                EL+QLEH+L    +++K +KE+++LEQL+ SR QE++A+ ENE LR+Q+EEL+    
Sbjct  121   SFKELQQLEHQLTEGRISVKEKKEKVILEQLKKSRLQEQKAIQENETLRKQVEELK----  176

Query  870   SNVSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVSDTTLQLGPPTGSCRKR  1049
                S    + + E+ P+ +        ++    G ++D   ++S+T+L LG       KR
Sbjct  177   -RSSAMAKSQFQEFNPLERRFPLASFKSDCFPQGEEEDY-GDLSETSLHLGLSYDVHHKR  234

Query  1050  KT  1055
             K 
Sbjct  235   KA  236



>gb|AAC49083.1| MADS-box protein AGL15, partial [Arabidopsis thaliana]
Length=262

 Score =   191 bits (484),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 119/246 (48%), Positives = 156/246 (63%), Gaps = 16/246 (7%)
 Frame = +3

Query  354   DIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSSTSMKHTL  533
             +IK IEN NSRQVTFSKRRSGLLKKA+ELS+LCDAEVAVI+FS + KLFEYSST MK TL
Sbjct  1     EIKRIENANSRQVTFSKRRSGLLKKARELSVLCDAEVAVIVFSKSGKLFEYSSTGMKQTL  60

Query  534   SRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMGLNELRQL  713
             SRY     S+ +      K + +  EV++L +++S+L+ K LQL GK L  +   EL+ L
Sbjct  61    SRYGNHQSSSAS------KAEEDCAEVDILKDQLSKLQEKHLQLQGKGLNPLTFKELQSL  114

Query  714   EHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPSNVSMPMP  893
             E +L  AL+ ++ RKE+LL  QLE SR +E+RA +ENE LRRQ++ELR  +PS       
Sbjct  115   EQQLYHALITVRERKERLLTNQLEESRLKEQRAELENETLRRQVQELRSFLPS-------  167

Query  894   TPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVSDTTLQLGPPTGSCRKRKTPDQETH  1073
               +  Y P    C +       +N      L N  SDTTLQLG P G    R+T + E  
Sbjct  168   --FTHYVPSYIKCFAIDPKNALINHDSKCSLQNTDSDTTLQLGLP-GEAHDRRTNEGERE  224

Query  1074  SSNSEN  1091
             S +S++
Sbjct  225   SPSSDS  230



>emb|CBI29819.3| unnamed protein product [Vitis vinifera]
Length=181

 Score =   186 bits (473),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 99/180 (55%), Positives = 133/180 (74%), Gaps = 11/180 (6%)
 Frame = +3

Query  336  MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
            MGRGKI+IK IEN+NSRQVTFSKRR+GLLKKA+ELS+LCDAEV VIIFSST KL+E+SS+
Sbjct  1    MGRGKIEIKKIENINSRQVTFSKRRAGLLKKAKELSVLCDAEVGVIIFSSTGKLYEFSSS  60

Query  516  SMKHTLSRYNKCLDSTETPK----------IvekkpkvehkevevLNNEISELKSKQLQL  665
            SM+HTL+RY + LDS E P           +V    +    EV  L  E+++L+   L++
Sbjct  61   SMEHTLTRYGRGLDS-ELPSLHRSAEFTIPVVFTFEQESQPEVASLKEEVAKLQKGYLRM  119

Query  666  LGKDLTGMGLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQI  845
            +GK+L G+   EL+ LEH L   +L++K +KEQ+LLEQL+ SR  E+RA++ENE LR+Q+
Sbjct  120  MGKELDGLSFKELQHLEHLLSEGILSVKDKKEQVLLEQLKKSRMHEQRAMMENETLRKQV  179



>ref|XP_009131359.1| PREDICTED: agamous-like MADS-box protein AGL15 isoform X1 [Brassica 
rapa]
 emb|CDX78537.1| BnaA03g04490D [Brassica napus]
Length=265

 Score =   189 bits (480),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 121/238 (51%), Positives = 158/238 (66%), Gaps = 16/238 (7%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN NSRQVTFSKRR+GLLKKA ELS+LCDAEVAVI+FS + KLFE+SST
Sbjct  1     MGRGKIEIKRIENANSRQVTFSKRRAGLLKKAHELSVLCDAEVAVIVFSKSGKLFEFSST  60

Query  516   -SMKHTLSRYNKCLDSTETPKIv-ekkpkvehkevevLNNEISELKSKQLQLLGKDLTGM  689
               MK TL RY     S++ P I  + + + E  EV++L +EIS L+ K L + GK L  +
Sbjct  61    RCMKKTLLRYGNYQISSDVPGINCKTENQEECTEVDLLKDEISMLQEKHLHMQGKRLNLL  120

Query  690   GLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVP  869
              L EL+ LE +L+ +L++++ RKE LL +QLE SR +E+RA +ENE LRRQ++ELR  +P
Sbjct  121   SLKELQHLEKQLNFSLISVRERKELLLTKQLEESRLKEQRAELENETLRRQVQELRSFLP  180

Query  870   SNVSMPMPTPYLEYYPVLKNCSSGKDGAESL--NTGCDD---DLDNEVSDTTLQLGPP  1028
             S ++      Y+  + +        D   SL  NT   D    L N  SDTTLQLG P
Sbjct  181   S-INQHYAPSYIRCFAI--------DPKNSLLSNTCLGDINCSLQNTNSDTTLQLGLP  229



>ref|XP_010269746.1| PREDICTED: agamous-like MADS-box protein AGL15 isoform X2 [Nelumbo 
nucifera]
Length=167

 Score =   185 bits (470),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 108/167 (65%), Positives = 136/167 (81%), Gaps = 0/167 (0%)
 Frame = +3

Query  336  MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
            MGRGKI+IK IEN  SRQVTFSKRR+GLLKKAQELSILCDAEVA+IIFSS+ KLFE++S+
Sbjct  1    MGRGKIEIKRIENATSRQVTFSKRRAGLLKKAQELSILCDAEVALIIFSSSGKLFEFASS  60

Query  516  SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMGL  695
            SMK TLSRYNKCLD +ET  +  +  K + KEV +L +EI+ L+    +++GK+LTG+ L
Sbjct  61   SMKRTLSRYNKCLDCSETAIVEYEVEKQQSKEVNILKDEIARLRMANRRMMGKELTGLSL  120

Query  696  NELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLR  836
             EL+ LE++L   +L++K RKEQLLLEQLE SR QE+RAL+ENE LR
Sbjct  121  KELQHLEYQLSEGILSVKDRKEQLLLEQLEQSRLQEQRALLENETLR  167



>gb|KEH41633.1| MADS-box transcription factor [Medicago truncatula]
Length=249

 Score =   187 bits (476),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 117/246 (48%), Positives = 168/246 (68%), Gaps = 21/246 (9%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN+N+RQVTFSKRR+GLLKKA+ELS+LCDAEVAVII+S T KL+E+SST
Sbjct  1     MGRGKIEIKKIENLNNRQVTFSKRRNGLLKKAKELSVLCDAEVAVIIYSGTGKLYEFSST  60

Query  516   SMKHTLSRY-NKCLD-----STETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKD  677
             SM+HT+SRY N+ L        E P   +  P+V   +  +L  EI++L+S  L++ GK+
Sbjct  61    SMEHTISRYGNRGLGLNNGAEQEQPS-DQPPPQVMELDTTILQEEIAKLRSAYLRMRGKE  119

Query  678   LTGMGLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELR  857
             L G+GL EL+ LEH+L   + A+K +KEQ+L EQL+ SR QE++A++ENE LR+Q+EE  
Sbjct  120   LDGLGLKELQYLEHQLCEGISAVKNKKEQVLAEQLKRSRLQEQKAMMENEALRKQLEE--  177

Query  858   GLVPSNVSMPMPTPYLEYYPVLKNCSSGKDGAE-SLNTGCDDDLDNEVSDTTLQLGPPTG  1034
                   +       ++E++P+ +  S   +G++   N   +    N++SDT+LQLG  + 
Sbjct  178   ------IVNKRKAEFIEFHPLDRTISI--NGSKPPFNYALE---GNKISDTSLQLGLSSD  226

Query  1035  SCRKRK  1052
                KRK
Sbjct  227   YDHKRK  232



>gb|KFK25606.1| hypothetical protein AALP_AA8G136400 [Arabis alpina]
Length=287

 Score =   188 bits (478),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 125/255 (49%), Positives = 159/255 (62%), Gaps = 22/255 (9%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN NSRQVTFSKRR GLLKKA ELS+LCDAEVAVI+FS + KLFEYSST
Sbjct  1     MGRGKIEIKRIENANSRQVTFSKRRGGLLKKANELSVLCDAEVAVIVFSKSGKLFEYSST  60

Query  516   SMKHTLSRYNKC--------LDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLG  671
              MK TL RY            D++      EK  K    EV+ L +E ++L+ K  QL G
Sbjct  61    GMKKTLLRYGNYKSSSSSSSSDASLIDCKAEKNQKGCCTEVDFLKDEYTKLQEKHSQLQG  120

Query  672   KDLTGMGLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEE  851
             K L  + L EL+ LE +L+ +L++++ RKEQLL  QLE SR +E+RA +ENE LRRQ++E
Sbjct  121   KGLNILSLKELQHLEKQLNDSLMSVRERKEQLLTNQLEESRLKEQRAELENETLRRQVQE  180

Query  852   LRGLVPSNVSMPMPTPYLEYYPVLKNCSSGKDGAES-LNTGCDD----DLDNEVSDTTLQ  1016
             LR   PS     +P+ Y++ + V        D   S LN  C +     L+   SDTTLQ
Sbjct  181   LRSFFPSFTQHYVPS-YIKCFAV--------DPKNSLLNHTCLEGNKYSLEKTDSDTTLQ  231

Query  1017  LGPPTGSCRKRKTPD  1061
             LG P  +  KRK  +
Sbjct  232   LGLPGEAQDKRKNEE  246



>ref|XP_009591403.1| PREDICTED: MADS-box transcription factor 23-like [Nicotiana tomentosiformis]
Length=230

 Score =   185 bits (470),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 113/255 (44%), Positives = 161/255 (63%), Gaps = 29/255 (11%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK+IEN NSRQVTFSKRR GL+KKA+EL+ILCDAEV V++FS+T KL++++S+
Sbjct  1     MGRGKIEIKMIENTNSRQVTFSKRRQGLMKKAKELAILCDAEVGVLVFSNTGKLYQFASS  60

Query  516   SMKHTLSRYNKCLDSTETPKIvekkpkvehk-evevLNNEISELKSKQLQLLGKDLTGMG  692
             SM++ LSRYNK  +S+E   I     + E + EV  L  E++ L+  Q +L+GK+L G+ 
Sbjct  61    SMENILSRYNKAPESSELTTIENVAAEHEWQPEVNELRAEVALLRQVQSRLMGKELEGLN  120

Query  693   LNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPS  872
               +L+QLEH+L   +L +K +KEQ+LL ++E S  QEE+  +ENE LR QIEELR     
Sbjct  121   FKDLQQLEHQLTEGILEVKDKKEQVLLGKIEKSLLQEEKVSLENEALREQIEELR-----  175

Query  873   NVSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVSDTTLQLGPPTGSCRKRK  1052
                              ++C       E  NT CD       SDT L+LG P  + +K  
Sbjct  176   --------------RSSRHCQERALALE--NTVCD-------SDTCLRLGLPVDTSQKMI  212

Query  1053  TPDQETHSSNSENHL  1097
              P  E+ S++++N +
Sbjct  213   IPKMESTSNDAQNTM  227



>ref|XP_009758657.1| PREDICTED: MADS-box transcription factor 23-like [Nicotiana sylvestris]
Length=230

 Score =   185 bits (470),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 113/258 (44%), Positives = 163/258 (63%), Gaps = 29/258 (11%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK+IEN NSRQVTFSKRR GL+KKA+EL+ILCDAEV V++FS+T KL+E++S+
Sbjct  1     MGRGKIEIKMIENTNSRQVTFSKRRQGLMKKAKELAILCDAEVGVLVFSNTGKLYEFASS  60

Query  516   SMKHTLSRYNKCLDSTETPKIvekkpkvehk-evevLNNEISELKSKQLQLLGKDLTGMG  692
             SM++ LSRYNK  +S+E   I     + E + +V  L  E++ L+  Q +L+GK+L G+ 
Sbjct  61    SMENILSRYNKAPESSELTTIENVAVEHESQPKVNELRAEVALLRQVQSRLMGKELEGLN  120

Query  693   LNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPS  872
               +L+QLEH+L   +LA+K +KEQ+LL ++E S  QEE+  +ENE LR QIEELR     
Sbjct  121   FKDLQQLEHQLTEGILAVKDKKEQVLLGKIEKSLLQEEKVSLENEALREQIEELR-----  175

Query  873   NVSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVSDTTLQLGPPTGSCRKRK  1052
                              ++C       E  N+ CD       SDT L+LG P  + +   
Sbjct  176   --------------RSSRHCQERALALE--NSVCD-------SDTCLRLGLPVDTSQNMI  212

Query  1053  TPDQETHSSNSENHLELK  1106
              P  E+ S++++N + L+
Sbjct  213   IPKMESTSNDAQNTIVLE  230



>ref|XP_009612621.1| PREDICTED: MADS-box transcription factor 23-like [Nicotiana tomentosiformis]
Length=230

 Score =   184 bits (466),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 112/258 (43%), Positives = 164/258 (64%), Gaps = 29/258 (11%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK+IEN NSRQVTFSKRR GL+KKA+EL+ILCDAEV V++FS+T KL++++S+
Sbjct  1     MGRGKIEIKMIENTNSRQVTFSKRRQGLMKKAKELAILCDAEVGVLVFSNTGKLYQFASS  60

Query  516   SMKHTLSRYNKCLDSTETPKIvekkpkvehk-evevLNNEISELKSKQLQLLGKDLTGMG  692
             SM++ LSRYN+  +S+E   I     + E + EV  L  E++ L+  Q +L+GK+L G+ 
Sbjct  61    SMENILSRYNRVPESSELTTIENGAAEHESQPEVNELRAEVALLRQVQSRLMGKELEGLN  120

Query  693   LNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPS  872
               +L+QLEH+L   +LA+K +KEQ+LL ++E S  QE++  +ENE LR QIEELR     
Sbjct  121   FKDLQQLEHQLSEGILAVKDKKEQVLLGKIEKSLLQEKKVSLENEALREQIEELR-----  175

Query  873   NVSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVSDTTLQLGPPTGSCRKRK  1052
                              ++C     G E  N+ CD       SDT L+LG P  + +   
Sbjct  176   --------------RSSRHCQERALGLE--NSVCD-------SDTCLRLGLPVNTSQNMI  212

Query  1053  TPDQETHSSNSENHLELK  1106
              P  E+ S++++N + L+
Sbjct  213   IPKMESTSNDAQNPMVLE  230



>ref|XP_008351603.1| PREDICTED: agamous-like MADS-box protein AGL18 [Malus domestica]
Length=266

 Score =   184 bits (466),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 118/259 (46%), Positives = 169/259 (65%), Gaps = 17/259 (7%)
 Frame = +3

Query  330   KKMGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYS  509
             K +GRG+I+IK IEN++SRQVTFSKRR+GLLKKA+ELS+LCDAEVAVI+FSST KL+E+S
Sbjct  11    KPLGRGRIEIKKIENLSSRQVTFSKRRNGLLKKAKELSVLCDAEVAVIVFSSTGKLYEFS  70

Query  510   STSMKHTLSRYNKCLDSTETPKIvek-------kpkvehkevevLNNEISELKSKQLQLL  668
             STSM HTLSRYNK     E P+           +    +  V  L NEI+ L+    ++ 
Sbjct  71    STSMDHTLSRYNKG-GLIEHPQKERSGDNEPVMQATNSNCNVNALQNEIATLRLTCTRMT  129

Query  669   GKDLTGMGLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIE  848
             GK+L G+ L +L++LE +L   +L +K +KE++L+E+L+ SR QE++A+ E+ENLR+++E
Sbjct  130   GKELDGVSLKDLQRLEDQLSEGILCVKDKKEEILMEKLKKSRLQEQKAMEESENLRKELE  189

Query  849   ELRGLVPSNVSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVSDTTLQLGPP  1028
             E+R    SN  + + +  LE      +C+S K  A S     + D     SDT+L LG  
Sbjct  190   EMRQNKRSNWPIVVASHPLERRF---SCTSSK--AVSXYEAEESDH----SDTSLHLGLS  240

Query  1029  TGSCRKRKTPDQETHSSNS  1085
             +   RKRK    E +S++S
Sbjct  241   SDVHRKRKAAKIEHNSNDS  259



>ref|XP_009363197.1| PREDICTED: agamous-like MADS-box protein AGL18 isoform X2 [Pyrus 
x bretschneideri]
Length=263

 Score =   182 bits (463),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 114/255 (45%), Positives = 169/255 (66%), Gaps = 12/255 (5%)
 Frame = +3

Query  330   KKMGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYS  509
             K +GRG+I+IK IEN++SRQVTFSKRR+GLLKKA+ELS+LCDAEVAVI+FSST KL+E+S
Sbjct  11    KPLGRGRIEIKKIENLSSRQVTFSKRRNGLLKKAKELSVLCDAEVAVIVFSSTGKLYEFS  70

Query  510   STSMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLN---NEISELKSKQLQLLGKDL  680
             STSM H LSRYNK        K      +        LN   NEI+ L+    ++ GK+L
Sbjct  71    STSMDHPLSRYNKGALIEHPQKERSGDNEPATNSNCNLNALQNEIATLRLTCTRMTGKEL  130

Query  681   TGMGLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRG  860
              G+ L +L++LE +L   +L +K +KE++L+E+L+ SR QE++A+ E+ENLR+++EE+R 
Sbjct  131   DGVSLKDLQRLEDQLSEGILCVKDKKEEILMEKLKKSRLQEQKAMEESENLRKELEEMRQ  190

Query  861   LVPSNVSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVSDTTLQLGPPTGSC  1040
                SN  + + +  LE      +C+S K    ++++   ++ D+  SDT+L LG  +   
Sbjct  191   NKRSNWPIVVASHPLERRF---SCTSSK----AVSSYKAEESDH--SDTSLHLGLSSDVH  241

Query  1041  RKRKTPDQETHSSNS  1085
             RKRK    E +S++S
Sbjct  242   RKRKAAKIEHNSNDS  256



>ref|XP_009335208.1| PREDICTED: agamous-like MADS-box protein AGL18 isoform X2 [Pyrus 
x bretschneideri]
Length=263

 Score =   181 bits (460),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 114/255 (45%), Positives = 169/255 (66%), Gaps = 12/255 (5%)
 Frame = +3

Query  330   KKMGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYS  509
             K +GRG+I+IK IEN++SRQVTFSKRR+GLLKKA+ELS+LCDAEVAVI+FSST KL+E+S
Sbjct  11    KPLGRGRIEIKKIENLSSRQVTFSKRRNGLLKKAKELSVLCDAEVAVIVFSSTGKLYEFS  70

Query  510   STSMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLN---NEISELKSKQLQLLGKDL  680
             STSM  TLSRYNK        K      +        LN   NEI+ L+    ++ GK+L
Sbjct  71    STSMDXTLSRYNKGALIEHPQKERSGDNEPATNSNCNLNALQNEIATLRLTCTRMTGKEL  130

Query  681   TGMGLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRG  860
              G+ L +L++LE +L   +L +K +KE++L+E+L+ SR QE++A+ E+ENLR+++EE+R 
Sbjct  131   DGVSLKDLQRLEDQLSEGILCVKDKKEEILMEKLKKSRLQEQKAMEESENLRKELEEMRQ  190

Query  861   LVPSNVSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVSDTTLQLGPPTGSC  1040
                SN  + + +  LE      +C+S K    ++++   ++ D+  SDT+L LG  +   
Sbjct  191   NKRSNWPIVVASHPLERRF---SCTSSK----AVSSYKAEESDH--SDTSLHLGLSSDVH  241

Query  1041  RKRKTPDQETHSSNS  1085
             RKRK    E +S++S
Sbjct  242   RKRKAAKIEHNSNDS  256



>ref|XP_009121728.1| PREDICTED: agamous-like MADS-box protein AGL15 isoform X2 [Brassica 
rapa]
Length=250

 Score =   181 bits (459),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 117/245 (48%), Positives = 154/245 (63%), Gaps = 29/245 (12%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK I+N NSRQVTFSKRR+GLLKKA ELS+LCD+EVAVI+FS + KLFE+SST
Sbjct  1     MGRGKIEIKRIDNANSRQVTFSKRRAGLLKKAHELSVLCDSEVAVIVFSKSGKLFEFSST  60

Query  516   SMKHTLSRYNKCLDSTETPKIvekkpkveh--kevevLNNEISELKSKQLQLLGKDLTGM  689
              MK TL RY+    S++ P I  K    E    EV++L NEIS+L+ K LQ+ GK L  +
Sbjct  61    RMKRTLLRYDNYQRSSDAPLINYKPENQEEDCTEVDLLKNEISKLQEKHLQMQGKGLNAL  120

Query  690   GLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVP  869
              L EL+ LE +L+ +L++++ RKEQ              RA +ENE LRRQ++ELR  +P
Sbjct  121   SLKELQHLEQQLNVSLISVRERKEQ--------------RAELENETLRRQVQELRSFLP  166

Query  870   SNVSMPMPTPYLEYYPV-LKNCSSGKDGAESLNTGCDD---DLDNEVSDTTLQLGPPTGS  1037
             S     +P+ Y+  + +  KN           N+G DD    L    SDTTLQLG P G 
Sbjct  167   SFNQQYVPS-YITCFAIDPKNSPVN-------NSGLDDTNYSLQKTNSDTTLQLGLP-GE  217

Query  1038  CRKRK  1052
              + R+
Sbjct  218   AQARR  222



>ref|XP_009363196.1| PREDICTED: agamous-like MADS-box protein AGL18 isoform X1 [Pyrus 
x bretschneideri]
Length=266

 Score =   181 bits (459),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 114/259 (44%), Positives = 172/259 (66%), Gaps = 17/259 (7%)
 Frame = +3

Query  330   KKMGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYS  509
             K +GRG+I+IK IEN++SRQVTFSKRR+GLLKKA+ELS+LCDAEVAVI+FSST KL+E+S
Sbjct  11    KPLGRGRIEIKKIENLSSRQVTFSKRRNGLLKKAKELSVLCDAEVAVIVFSSTGKLYEFS  70

Query  510   STSMKHTLSRYNKCLDSTETPKIvek-------kpkvehkevevLNNEISELKSKQLQLL  668
             STSM H LSRYNK     E P+           +    +  +  L NEI+ L+    ++ 
Sbjct  71    STSMDHPLSRYNKGA-LIEHPQKERSGDNEPVMQATNSNCNLNALQNEIATLRLTCTRMT  129

Query  669   GKDLTGMGLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIE  848
             GK+L G+ L +L++LE +L   +L +K +KE++L+E+L+ SR QE++A+ E+ENLR+++E
Sbjct  130   GKELDGVSLKDLQRLEDQLSEGILCVKDKKEEILMEKLKKSRLQEQKAMEESENLRKELE  189

Query  849   ELRGLVPSNVSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVSDTTLQLGPP  1028
             E+R    SN  + + +  LE      +C+S K    ++++   ++ D+  SDT+L LG  
Sbjct  190   EMRQNKRSNWPIVVASHPLERRF---SCTSSK----AVSSYKAEESDH--SDTSLHLGLS  240

Query  1029  TGSCRKRKTPDQETHSSNS  1085
             +   RKRK    E +S++S
Sbjct  241   SDVHRKRKAAKIEHNSNDS  259



>ref|XP_008244251.1| PREDICTED: agamous-like MADS-box protein AGL18 [Prunus mume]
Length=263

 Score =   181 bits (458),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 100/187 (53%), Positives = 141/187 (75%), Gaps = 11/187 (6%)
 Frame = +3

Query  330  KKMGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYS  509
            K MGRG+I+IK IENVNSRQVTF+KRR+GLLKKA+ELS+LCDAEVAVI+F+ST +L+E+S
Sbjct  11   KTMGRGRIEIKKIENVNSRQVTFTKRRNGLLKKAKELSVLCDAEVAVIVFASTGRLYEFS  70

Query  510  STSMKHTLSRYNK--CLD---------STETPKIvekkpkvehkevevLNNEISELKSKQ  656
            STSM HTL RY K   +D         +T+ P  V+K+    +++V  L NEI+ L+   
Sbjct  71   STSMPHTLLRYKKGGVIDYPQERSSEPATKEPNFVQKRKVEPNRDVNGLQNEIATLRLAC  130

Query  657  LQLLGKDLTGMGLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLR  836
            ++++GK+L G+   EL+QLE +L   +L +K +KE++LLE L++SR  E+RA+ ENENLR
Sbjct  131  MRMMGKELHGLSYKELQQLEEQLREGVLFVKQKKEEILLETLKSSRLLEQRAMEENENLR  190

Query  837  RQIEELR  857
            +Q+EE+R
Sbjct  191  KQLEEMR  197



>ref|XP_009335207.1| PREDICTED: agamous-like MADS-box protein AGL18 isoform X1 [Pyrus 
x bretschneideri]
Length=266

 Score =   180 bits (456),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 114/259 (44%), Positives = 172/259 (66%), Gaps = 17/259 (7%)
 Frame = +3

Query  330   KKMGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYS  509
             K +GRG+I+IK IEN++SRQVTFSKRR+GLLKKA+ELS+LCDAEVAVI+FSST KL+E+S
Sbjct  11    KPLGRGRIEIKKIENLSSRQVTFSKRRNGLLKKAKELSVLCDAEVAVIVFSSTGKLYEFS  70

Query  510   STSMKHTLSRYNKCLDSTETPKIvek-------kpkvehkevevLNNEISELKSKQLQLL  668
             STSM  TLSRYNK     E P+           +    +  +  L NEI+ L+    ++ 
Sbjct  71    STSMDXTLSRYNKGA-LIEHPQKERSGDNEPVMQATNSNCNLNALQNEIATLRLTCTRMT  129

Query  669   GKDLTGMGLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIE  848
             GK+L G+ L +L++LE +L   +L +K +KE++L+E+L+ SR QE++A+ E+ENLR+++E
Sbjct  130   GKELDGVSLKDLQRLEDQLSEGILCVKDKKEEILMEKLKKSRLQEQKAMEESENLRKELE  189

Query  849   ELRGLVPSNVSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVSDTTLQLGPP  1028
             E+R    SN  + + +  LE      +C+S K    ++++   ++ D+  SDT+L LG  
Sbjct  190   EMRQNKRSNWPIVVASHPLERRF---SCTSSK----AVSSYKAEESDH--SDTSLHLGLS  240

Query  1029  TGSCRKRKTPDQETHSSNS  1085
             +   RKRK    E +S++S
Sbjct  241   SDVHRKRKAAKIEHNSNDS  259



>ref|XP_006843513.1| hypothetical protein AMTR_s00053p00228660 [Amborella trichopoda]
 gb|ERN05188.1| hypothetical protein AMTR_s00053p00228660 [Amborella trichopoda]
Length=188

 Score =   176 bits (447),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 96/170 (56%), Positives = 127/170 (75%), Gaps = 0/170 (0%)
 Frame = +3

Query  336  MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
            MGRGKI+IK IEN  SRQVTFSKRR+GLLKKAQELSILCDAEVA+IIFSST KLFE+ S+
Sbjct  1    MGRGKIEIKKIENATSRQVTFSKRRAGLLKKAQELSILCDAEVALIIFSSTGKLFEFPSS  60

Query  516  SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMGL  695
             MK TL+RYN+C DS+E+  +       + KEV VL  EI +L+   + ++GK+L  + L
Sbjct  61   GMKKTLARYNQCSDSSESSLVECDFEMQQVKEVAVLREEIGKLQMAHMHMMGKELLNLSL  120

Query  696  NELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQI  845
             EL+ LE+ L+  + ++K RKE+LLLEQLE S+ +E+RA V   NL+ ++
Sbjct  121  KELQHLENMLNEGITSVKDRKEKLLLEQLEQSQLKEKRAAVSLNNLKYEM  170



>ref|XP_010504666.1| PREDICTED: agamous-like MADS-box protein AGL18 [Camelina sativa]
Length=256

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 127/261 (49%), Positives = 163/261 (62%), Gaps = 23/261 (9%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IENVNSRQVTFSKRR+GL KKA+ELSILCDA+VA+IIFSST K++++SST
Sbjct  1     MGRGKIEIKKIENVNSRQVTFSKRRNGLFKKAKELSILCDADVALIIFSSTGKIYDFSST  60

Query  516   SMKHTLSRYNKCLDSTE-TPKIvekkpkvehkevevLNNEIS---ELKSKQL---QLLGK  674
              M+  LSRY     S E   +  +      H    VL N+ S   EL+  QL   +L GK
Sbjct  61    CMEQILSRYGYTTASAEHKQREQQLLLGASHDNEAVLRNDDSMKGELERLQLATERLKGK  120

Query  675   DLTGMGLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEEL  854
             +L GM   +L  LE +L+ +L ++K +K +LLL Q+E SR QE+RAL EN+ LRRQ+E L
Sbjct  121   ELDGMSFPDLISLETQLNESLRSVKDQKTKLLLNQIERSRLQEKRALEENQILRRQVELL  180

Query  855   -RGLVPSNVSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNE--VSDTTLQLG-  1022
              RG  P  +S  +P             SS +D    +++  DD+ DNE   SDT+LQLG 
Sbjct  181   GRGSGPKVLS-EIP-----------QASSPEDADPEISSSDDDENDNEEHHSDTSLQLGL  228

Query  1023  PPTGSCRKRKTPDQETHSSNS  1085
               TG C KRK P  E    NS
Sbjct  229   ASTGYCIKRKKPKMEQVCDNS  249



>gb|KFK34974.1| hypothetical protein AALP_AA5G218000 [Arabis alpina]
Length=256

 Score =   171 bits (434),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 121/262 (46%), Positives = 163/262 (62%), Gaps = 25/262 (10%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRG+I+IK IENVNSRQVTFSKRR+GL+KKA+ELSILCDAEVA+IIFSST K++++SS 
Sbjct  1     MGRGRIEIKKIENVNSRQVTFSKRRNGLMKKAKELSILCDAEVALIIFSSTGKIYDFSSG  60

Query  516   SMKHTLSRYN-KCLDSTETPK-------IvekkpkvehkevevLNNEISELKSKQLQLLG  671
              M+  L+RY      STE  +          ++     ++ + +  E+  L     +L G
Sbjct  61    CMEQILTRYGYSSGSSTEQNQREQQLLLCSSQENGAVLRKEDTMKGELERLHLAIERLKG  120

Query  672   KDLTGMGLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEE  851
             K+L GM  ++L  LE++L+ +L ++K +K Q+LL Q+E SR QE+RAL EN+ LR+QIE 
Sbjct  121   KELDGMSFSDLITLENQLNDSLHSVKDQKTQILLRQVERSRLQEKRALEENQILRKQIEM  180

Query  852   L-RGLVPSNVSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNE--VSDTTLQLG  1022
             L RG VP           L   P     SS +  AES ++  DD+ DNE   SDT+LQLG
Sbjct  181   LGRGSVP---------KVLNEIP---QVSSPQADAES-SSSEDDENDNEDHHSDTSLQLG  227

Query  1023  -PPTGSCRKRKTPDQETHSSNS  1085
                +G C KRK P  E    NS
Sbjct  228   LSSSGYCTKRKKPKIELVCDNS  249



>emb|CDX88943.1| BnaA04g02430D [Brassica napus]
Length=259

 Score =   171 bits (432),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 119/264 (45%), Positives = 158/264 (60%), Gaps = 26/264 (10%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRG+I+IK IENVNSRQVTFSKRR+GL+KKA ELSILCDAEVAVI+FSST K +++SS 
Sbjct  1     MGRGRIEIKKIENVNSRQVTFSKRRNGLMKKANELSILCDAEVAVIVFSSTGKAYDFSSG  60

Query  516   SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEI--------SELKSKQL---Q  662
             SM+H LSRY     +        ++ +         N ++        SEL+  QL   +
Sbjct  61    SMEHILSRYG--YSAVTAGHRQREEQQQLLLCSSQDNGDVLRTDEPLRSELERLQLAIER  118

Query  663   LLGKDLTGMGLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQ  842
             L GK+L GM  ++L  LEH+L  +L ++K RK QLLL Q+E SR QE+RAL EN+ LR+Q
Sbjct  119   LKGKELEGMSFSDLISLEHQLSDSLHSVKDRKTQLLLNQVERSRLQEKRALEENQILRKQ  178

Query  843   IEELRGLVPSNVSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNE--VSDTTLQ  1016
             I+    ++    S P P   +  +      SS +   ES ++  D + DNE   SDT+LQ
Sbjct  179   ID----MLARGSSGPKPLSEIPQF------SSPQAEPESSSSDDDGENDNEEHPSDTSLQ  228

Query  1017  LG-PPTGSCRKRKTPDQETHSSNS  1085
             LG   +    KRK P  E    NS
Sbjct  229   LGLSSSAYFAKRKKPKIEPPCDNS  252



>ref|XP_010545211.1| PREDICTED: agamous-like MADS-box protein AGL18 isoform X2 [Tarenaya 
hassleriana]
Length=270

 Score =   170 bits (431),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 118/267 (44%), Positives = 158/267 (59%), Gaps = 31/267 (12%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRG+I+IK IENVNSRQVTFSKRR+GL+KKA+ELSILCDAEVAVIIFSST K++E+SS+
Sbjct  1     MGRGRIEIKRIENVNSRQVTFSKRRNGLMKKARELSILCDAEVAVIIFSSTGKVYEFSSS  60

Query  516   SMKHTLSRY---NKCLDSTETPKIvekkp----------kvehkevevLNNEISELKSKQ  656
             SM+ TLSRY   +   D     +I++ +               +  + L  E+  L    
Sbjct  61    SMQQTLSRYGYSSSTSDHIHQREILQHQRPHHCPLQDNDDASRQNSDFLKTELERLHLSY  120

Query  657   LQLLGKDLTGMGLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLR  836
              ++ GK+L G+   EL  LE++L+ ALL+IK +K Q+LL+Q+E SR QE+RAL ENE LR
Sbjct  121   ERMKGKELNGLSFPELLSLENQLNEALLSIKDQKTQVLLDQIERSRFQEKRALEENEKLR  180

Query  837   RQIEELRGLVPSNVSMPMP---TPY------LEYYPVLKNCSSGKDGAESLNTGCDDDLD  989
             +Q      LV S  S   P   TP       L  +P +   + G+  +   +     D  
Sbjct  181   QQ------LVKSGRSSSGPSELTPVNAVSRMLAEFPDMTRRTGGESSSSDDDDNDSGDRH  234

Query  990   NEVSDTTLQLGPPTGSCRKRKTPDQET  1070
                SDT L LG  +   RKRKTP  E+
Sbjct  235   ---SDTFLHLGLSSEYNRKRKTPKIES  258



>ref|XP_010545163.1| PREDICTED: agamous-like MADS-box protein AGL18 isoform X1 [Tarenaya 
hassleriana]
Length=288

 Score =   170 bits (430),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 118/268 (44%), Positives = 159/268 (59%), Gaps = 31/268 (12%)
 Frame = +3

Query  333   KMGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSS  512
             +MGRG+I+IK IENVNSRQVTFSKRR+GL+KKA+ELSILCDAEVAVIIFSST K++E+SS
Sbjct  18    EMGRGRIEIKRIENVNSRQVTFSKRRNGLMKKARELSILCDAEVAVIIFSSTGKVYEFSS  77

Query  513   TSMKHTLSRY---NKCLDSTETPKIvekkp----------kvehkevevLNNEISELKSK  653
             +SM+ TLSRY   +   D     +I++ +               +  + L  E+  L   
Sbjct  78    SSMQQTLSRYGYSSSTSDHIHQREILQHQRPHHCPLQDNDDASRQNSDFLKTELERLHLS  137

Query  654   QLQLLGKDLTGMGLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENL  833
               ++ GK+L G+   EL  LE++L+ ALL+IK +K Q+LL+Q+E SR QE+RAL ENE L
Sbjct  138   YERMKGKELNGLSFPELLSLENQLNEALLSIKDQKTQVLLDQIERSRFQEKRALEENEKL  197

Query  834   RRQIEELRGLVPSNVSMPMP---TPY------LEYYPVLKNCSSGKDGAESLNTGCDDDL  986
             R+Q      LV S  S   P   TP       L  +P +   + G+  +   +     D 
Sbjct  198   RQQ------LVKSGRSSSGPSELTPVNAVSRMLAEFPDMTRRTGGESSSSDDDDNDSGDR  251

Query  987   DNEVSDTTLQLGPPTGSCRKRKTPDQET  1070
                 SDT L LG  +   RKRKTP  E+
Sbjct  252   H---SDTFLHLGLSSEYNRKRKTPKIES  276



>emb|CDP16365.1| unnamed protein product [Coffea canephora]
Length=189

 Score =   164 bits (416),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 88/156 (56%), Positives = 118/156 (76%), Gaps = 1/156 (1%)
 Frame = +3

Query  336  MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
            MGRGKI+IK IEN NSRQVTFSKRR+GLLKKA EL +LCDAEVAVIIFS+T KLFE++S+
Sbjct  1    MGRGKIEIKKIENANSRQVTFSKRRNGLLKKAYELGVLCDAEVAVIIFSNTGKLFEFASS  60

Query  516  SMKHTLSRYNKCLDSTETPKIvekkp-kvehkevevLNNEISELKSKQLQLLGKDLTGMG  692
            SM   ++RYNKC + +E   +  ++      KE ++L  EI +LK K  Q+LGKDL G+G
Sbjct  61   SMPQIIARYNKCFEPSECATVEHQREPLQGPKEEDILKEEIEKLKLKHSQMLGKDLDGLG  120

Query  693  LNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQ  800
            L EL+++E +L+  L +IK RKE++L++QLE +  Q
Sbjct  121  LKELQEVEQQLNEGLSSIKARKERMLMDQLEQAMMQ  156



>ref|XP_011075339.1| PREDICTED: MADS-box transcription factor 23 [Sesamum indicum]
Length=248

 Score =   166 bits (420),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 91/175 (52%), Positives = 127/175 (73%), Gaps = 1/175 (1%)
 Frame = +3

Query  336  MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
            MGRGKI+IK IENVNSRQVTFSKRR GL+KKA+EL++LCDA+VAVIIFS T KL+E++S+
Sbjct  1    MGRGKIEIKKIENVNSRQVTFSKRRGGLMKKAKELAVLCDAQVAVIIFSGTGKLYEFASS  60

Query  516  SMKHTLSRYNKCLDSTETPKIvekkpkve-hkevevLNNEISELKSKQLQLLGKDLTGMG  692
             M+  L+RY++  +S E   +     + E   EV  L +EI  L+    +++GK+L G+ 
Sbjct  61   RMEQILARYSRNHESPELATVEHAADQHEPTIEVNTLKDEIERLQLMHRRMMGKELEGLT  120

Query  693  LNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELR  857
             NEL  LE +L   +L++K RKE++LLEQLE S+ QE++ + +NE L  +IEELR
Sbjct  121  YNELHNLEQQLTEGILSVKDRKEKVLLEQLEKSKLQEKKVMQQNEVLLEKIEELR  175



>ref|XP_008455789.1| PREDICTED: MADS-box transcription factor 23-like [Cucumis melo]
Length=286

 Score =   167 bits (422),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 103/244 (42%), Positives = 147/244 (60%), Gaps = 14/244 (6%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRG+++IK IEN+NSRQVTFSKRR+GL+KKA+ELS+LCDAEVA+++FSST +L+E+SST
Sbjct  18    MGRGRVEIKKIENINSRQVTFSKRRNGLMKKAKELSVLCDAEVAIVVFSSTGRLYEFSST  77

Query  516   SMKHTLSRYNKCLDSTETPKIvekkpkv---ehkevevLNNEISELKSKQLQLLGKDLTG  686
             SM+HTLSRY       + PK     P        + +    EI +LK    Q+ G++L  
Sbjct  78    SMEHTLSRYRGQGMELDFPKETLDHPAQLPPSDSDAKSSEEEIEKLKLAYTQMRGQELDS  137

Query  687   MGLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEEL--RG  860
             +   +L+ LE++L   +++IK +KE LLLEQL+  R Q E  + ENE LR+Q+EE   R 
Sbjct  138   LSFIDLQNLENQLREGIISIKDKKETLLLEQLQRCRSQGEVVISENETLRKQLEEFQQRN  197

Query  861   LVPSNVSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVSDTTLQLGPPTGSC  1040
              +P   S P+   Y          S  K  + +      +  +N+ S+ +L LG      
Sbjct  198   NIPRQESSPLQRSYF---------SDSKTASTNETEVKTEAEENDRSEISLHLGLSLDGQ  248

Query  1041  RKRK  1052
             RKRK
Sbjct  249   RKRK  252



>gb|AAM51776.1|AF425598_1 MADS-box gene 2 protein [Lycopodium annotinum]
Length=231

 Score =   165 bits (417),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 97/196 (49%), Positives = 127/196 (65%), Gaps = 13/196 (7%)
 Frame = +3

Query  336  MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
            MGRGKI+IK IEN  SRQVTFSKRR GLLKKA ELS+LCDA+VA+IIFSST KLFEY+S 
Sbjct  1    MGRGKIEIKRIENATSRQVTFSKRRGGLLKKAHELSVLCDAQVALIIFSSTGKLFEYASP  60

Query  516  SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSK-------QLQLLGK  674
            SMK  L RY K  +  +T  +           ++ LN E+  +K +       Q  ++G+
Sbjct  61   SMKEILDRYGKYPEGVQTGTV---TDPNNDVMLQYLNREVIRMKQQIERTHQTQRHMMGE  117

Query  675  DLTGMGLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQI---  845
            DL  + L +L+QLE +LD  L  I+ RK+QLL+EQLE   ++E   L ENE LRR++   
Sbjct  118  DLAILPLKDLQQLEEQLDIGLRRIRARKDQLLVEQLEELHRKERHWLEENEALRRKLAGG  177

Query  846  EELRGLVPSNVSMPMP  893
            + L G VPS +S+  P
Sbjct  178  QALSGPVPSPLSIVNP  193



>ref|XP_010516354.1| PREDICTED: agamous-like MADS-box protein AGL18 [Camelina sativa]
Length=256

 Score =   165 bits (417),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 119/260 (46%), Positives = 158/260 (61%), Gaps = 21/260 (8%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRG+I+IK IENVNSRQVTFSKRR+GL KKA+ELSILCDA+VA+IIFSST K++++SST
Sbjct  1     MGRGRIEIKKIENVNSRQVTFSKRRNGLFKKAKELSILCDADVALIIFSSTGKIYDFSST  60

Query  516   SMKHTLSRYNKCLDSTE-TPKIvekkpkvehkevevLNNEIS---ELKSKQL---QLLGK  674
              M+  LSRY     S E   +  +       +   VL N+ S   EL+  QL   +L GK
Sbjct  61    CMEQILSRYGYTTASAEHKQREQQLLLGASRENEAVLRNDDSMKGELERLQLATERLKGK  120

Query  675   DLTGMGLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEEL  854
             +L GM   +L  LE +L+ +L ++K +K +LLL Q+E SR QE+RAL EN+ LR+Q+E L
Sbjct  121   ELDGMSFPDLISLETQLNESLRSVKDQKTKLLLNQIERSRVQEKRALEENQILRKQVELL  180

Query  855   -RGLVPSNVS-MPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVSDTTLQLG-P  1025
              RG  P  +S +P  +   E  P   +    ++  E  +           SDT+LQLG  
Sbjct  181   GRGSGPKVLSEIPQASSPEEADPESSSSDDDENDNEEHH-----------SDTSLQLGLA  229

Query  1026  PTGSCRKRKTPDQETHSSNS  1085
              TG C KRK P  E    NS
Sbjct  230   STGYCTKRKKPKMEQVCDNS  249



>emb|CDX72042.1| BnaC08g28320D [Brassica napus]
Length=256

 Score =   164 bits (416),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 110/261 (42%), Positives = 160/261 (61%), Gaps = 23/261 (9%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRG+I+IK IENVNSRQVTFSKRR+GL+KKA+ELSILCDAEVA+IIFSST K +++SS 
Sbjct  1     MGRGRIEIKKIENVNSRQVTFSKRRNGLMKKARELSILCDAEVALIIFSSTGKAYDFSSG  60

Query  516   SMKHTLSRYNKCLDSTETPK---------IvekkpkvehkevevLNNEISELKSKQLQLL  668
              M+ TLSRY     S +  +            ++  V   + + + +E+  L+    +L 
Sbjct  61    CMEQTLSRYGYSGASADHKQREGEQQLLLCSSQENGVVLPKEDAMKSEVERLQLAIQRLK  120

Query  669   GKDLTGMGLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIE  848
             GK+L GM  ++L  LE++L+ +L ++K +K Q+LL Q+E SR +E+RAL EN+ LR+Q+E
Sbjct  121   GKELEGMSFSDLISLENQLNDSLHSVKDQKTQILLNQVERSRLKEKRALEENQILRKQVE  180

Query  849   ELRGLVPSNVSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNE-VSDTTLQLG-  1022
                 ++    S P     +  +   +        AE  ++  DDD +N+  SDT+LQLG 
Sbjct  181   ----MLGRGSSGPKGLSEIPQFSSPQ--------AEPESSSSDDDHENDHHSDTSLQLGL  228

Query  1023  PPTGSCRKRKTPDQETHSSNS  1085
               +G   KRK P  E+   NS
Sbjct  229   SSSGYWTKRKKPKIESLCDNS  249



>gb|EYU42984.1| hypothetical protein MIMGU_mgv1a025861mg, partial [Erythranthe 
guttata]
Length=156

 Score =   160 bits (406),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 86/154 (56%), Positives = 114/154 (74%), Gaps = 1/154 (1%)
 Frame = +3

Query  336  MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
            MGRGKI+IK IEN NSRQVTFSKRRSGL KKA EL++LC+AEVAVIIFS+T KLFE+ ++
Sbjct  1    MGRGKIEIKKIENANSRQVTFSKRRSGLFKKAHELAVLCEAEVAVIIFSNTGKLFEFCNS  60

Query  516  SMKHTLSRYNKCLDSTETPKIvekkpkveh-kevevLNNEISELKSKQLQLLGKDLTGMG  692
             MK+ L+RY + L+ T+ P +  +K +     E +    EI +L+ KQLQLLGK+L GM 
Sbjct  61   DMKNILARYKRGLEVTKAPAVKRQKQEQTEPHEADFFRGEIEKLRIKQLQLLGKNLDGMS  120

Query  693  LNELRQLEHKLDGALLAIKGRKEQLLLEQLENSR  794
            L EL  LE +L+  L+ IK +KE++LLEQ+E  +
Sbjct  121  LQELGALEQQLNEGLICIKDKKEKVLLEQVEQYK  154



>ref|XP_004249753.1| PREDICTED: MADS-box transcription factor 23-like [Solanum lycopersicum]
Length=229

 Score =   163 bits (412),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 108/255 (42%), Positives = 153/255 (60%), Gaps = 34/255 (13%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSS-  512
             MGRGKI++K IEN++SRQVTFSKRR+GL KKA+ELS+LCDAE+ VI+FS+TD+L++++S 
Sbjct  1     MGRGKIEMKKIENISSRQVTFSKRRAGLFKKAEELSVLCDAEIGVIVFSNTDRLYKFASS  60

Query  513   -TSMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGM  689
              +SM+  + RYN    S E P I      V   E+  L  E+++L+    +++GK+L G+
Sbjct  61    KSSMEKIVERYNSSSHSFEHPMI----ENVVEPELNSLKAEVAKLRKATGRMMGKELDGL  116

Query  690   GLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVP  869
                EL+QLEH+L   +L++K +KEQ+LLE LE S            NL  QIEEL G   
Sbjct  117   DFKELQQLEHQLTEGILSVKNKKEQVLLELLEKS------------NL--QIEEL-GHKS  161

Query  870   SNVSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCD-DDLDNEVSDTTLQLGPPTGSCRK  1046
              N        Y E Y   +  S G     +    CD   ++ E SDT+L LG    + +K
Sbjct  162   CN-------HYPENYEAARKISGG-----NTTVICDFKSVEEENSDTSLSLGLSVATSQK  209

Query  1047  RKTPDQETHSSNSEN  1091
             +K P  E  S++SEN
Sbjct  210   KKNPQIECTSNDSEN  224



>ref|XP_004150520.1| PREDICTED: agamous-like MADS-box protein AGL18-like [Cucumis 
sativus]
Length=225

 Score =   162 bits (409),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 97/232 (42%), Positives = 145/232 (63%), Gaps = 10/232 (4%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRG+++IK IEN+NSRQVTFSKRR+GL+KKA+ELS+LCDAEVA+++FSST +L+E+SST
Sbjct  1     MGRGRVEIKKIENINSRQVTFSKRRNGLMKKAKELSVLCDAEVAIVVFSSTGRLYEFSST  60

Query  516   SMKHTLSRYNKCLDSTETPKIvekkpkv---ehkevevLNNEISELKSKQLQLLGKDLTG  686
             SM+HTLSRY       + PK     P        + +    EI +LK    Q+ G++L  
Sbjct  61    SMEHTLSRYRGQGMELDFPKETLDHPAQLPPSDSDAKSSEEEIGKLKLAYTQMRGQELDS  120

Query  687   MGLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLV  866
             +   +L+ LE++L   +++IK +KE LLLEQL+  R Q E  + ENE LR+Q+EE +   
Sbjct  121   LSFIDLQNLENQLREGIISIKDKKETLLLEQLQRCRSQGEVVISENETLRKQLEEFQH--  178

Query  867   PSNVSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVSDTTLQLG  1022
              +N+++   +P    Y      S  K  + +      +  +N+ S+ +L LG
Sbjct  179   RNNITLQESSPLQRSY-----FSDSKTASTNETEVKTEVEENDRSEISLHLG  225



>emb|CDY30998.1| BnaC04g24260D [Brassica napus]
Length=259

 Score =   163 bits (412),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 114/260 (44%), Positives = 160/260 (62%), Gaps = 18/260 (7%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRG+I+IK IENVNSRQVTFSKRR+GL+KKA ELSILCDAE+AVI+FSST K++++SS 
Sbjct  1     MGRGRIEIKKIENVNSRQVTFSKRRNGLMKKANELSILCDAEIAVIVFSSTGKVYDFSSG  60

Query  516   SMKHTLSRYNKCLDST------ETPKIvekkpkvehkevevLNNEISELKSKQL---QLL  668
             SM+H LSRY     +       E  +++    +     +    +  SEL+  QL   +L 
Sbjct  61    SMEHILSRYGYSAVTAGHRQREEQQQLLLCSSQENGDVLRTDESLRSELERLQLAIERLK  120

Query  669   GKDLTGMGLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIE  848
             GK+L GMG ++L  LE++L+ +L ++K RK QLLL Q+E SR QE+RAL EN+ LR+QI+
Sbjct  121   GKELEGMGFSDLISLENQLNDSLHSVKDRKTQLLLNQVERSRLQEKRALEENQLLRKQID  180

Query  849   ELRGLVPSNVSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVSDTTLQLG-P  1025
                 ++    S P P   +  +    +    +  + S +   ++D +   SDT+LQLG  
Sbjct  181   ----MLARGSSGPKPLSEIPQF----SSPQAEPESSSSDDDDENDNEELRSDTSLQLGLS  232

Query  1026  PTGSCRKRKTPDQETHSSNS  1085
              TG   KRK P  E    NS
Sbjct  233   STGYFAKRKKPKIEPPCDNS  252



>ref|XP_006291720.1| hypothetical protein CARUB_v10017886mg [Capsella rubella]
 gb|EOA24618.1| hypothetical protein CARUB_v10017886mg [Capsella rubella]
Length=255

 Score =   162 bits (411),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 113/259 (44%), Positives = 156/259 (60%), Gaps = 20/259 (8%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRG+I+IK IENVNSRQVTFSKRR+GL+KKA+ELSILCDAEVA+IIFSST K++++SS 
Sbjct  1     MGRGRIEIKKIENVNSRQVTFSKRRNGLIKKAKELSILCDAEVALIIFSSTGKIYDFSSV  60

Query  516   SMKHTLSRYNKCLDSTETPK-------IvekkpkvehkevevLNNEISELKSKQLQLLGK  674
              M+  LSRY     STE  +           + +   +  + +  E+  L+    +L GK
Sbjct  61    CMEQILSRYGYTAASTEHKQREKQLLLCSSHENEAVLRNDDSMKGELERLQLAIERLKGK  120

Query  675   DLTGMGLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEEL  854
             +L GM   +L  LE++L+ +L ++K +K + LL Q+E SR QE+RAL EN+ LR+Q+E L
Sbjct  121   ELDGMSFPDLITLENQLNESLHSVKDQKTKFLLNQIERSRLQEKRALEENQILRKQVELL  180

Query  855   -RGLVPSNVSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVSDTTLQLG-PP  1028
              R  VP  +S     P +         S   D   S +   ++D +   SDT+LQLG   
Sbjct  181   GRSSVPKVLS---ERPQIS--------SPEADRESSSSDDDENDNEEHHSDTSLQLGLSS  229

Query  1029  TGSCRKRKTPDQETHSSNS  1085
             TG C +RK P  E    NS
Sbjct  230   TGYCTQRKKPKMELVCDNS  248



>ref|NP_191298.1| Agamous-like MADS-box protein AGL18 [Arabidopsis thaliana]
 sp|Q9M2K8.1|AGL18_ARATH RecName: Full=Agamous-like MADS-box protein AGL18 [Arabidopsis 
thaliana]
 gb|AAG37900.1|AF312663_1 MADS-box protein AGL18 [Arabidopsis thaliana]
 emb|CAB68145.1| MADS transcription factor-like protein [Arabidopsis thaliana]
 dbj|BAD95389.1| MADS transcription factor-like protein [Arabidopsis thaliana]
 gb|AEE79650.1| Agamous-like MADS-box protein AGL18 [Arabidopsis thaliana]
Length=256

 Score =   162 bits (410),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 121/260 (47%), Positives = 161/260 (62%), Gaps = 21/260 (8%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRG+I+IK IEN+NSRQVTFSKRR+GL+KKA+ELSILCDAEVA+IIFSST K++++SS 
Sbjct  1     MGRGRIEIKKIENINSRQVTFSKRRNGLIKKAKELSILCDAEVALIIFSSTGKIYDFSSV  60

Query  516   SMKHTLSRYNKCLDSTETPKIvekkpk--vehkevevLNNEIS---ELKSKQL---QLLG  671
              M+  LSRY     STE  +  E +      H    VL N+ S   EL+  QL   +L G
Sbjct  61    CMEQILSRYGYTTASTEHKQQREHQLLICASHGNEAVLRNDDSMKGELERLQLAIERLKG  120

Query  672   KDLTGMGLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEE  851
             K+L GM   +L  LE++L+ +L ++K +K Q+LL Q+E SR QE++AL EN+ LR+Q+E 
Sbjct  121   KELEGMSFPDLISLENQLNESLHSVKDQKTQILLNQIERSRIQEKKALEENQILRKQVEM  180

Query  852   L-RGLVPSNVSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVSDTTLQLG-P  1025
             L RG  P           L   P  ++ S   D   S +   ++D +   SDT+LQLG  
Sbjct  181   LGRGSGP---------KVLNERP--QDSSPEADPESSSSEEDENDNEEHHSDTSLQLGLS  229

Query  1026  PTGSCRKRKTPDQETHSSNS  1085
              TG C KRK P  E    NS
Sbjct  230   STGYCTKRKKPKIELVCDNS  249



>gb|AAM65178.1| MADS transcription factor-like protein [Arabidopsis thaliana]
Length=256

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 120/260 (46%), Positives = 160/260 (62%), Gaps = 21/260 (8%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRG+I+IK IEN+NSRQVTFSKRR+GL+KKA+ELSILCDAEVA+IIFSST K++++SS 
Sbjct  1     MGRGRIEIKKIENINSRQVTFSKRRNGLIKKAKELSILCDAEVALIIFSSTGKIYDFSSV  60

Query  516   SMKHTLSRYNKCLDSTETPKIvekkpk--vehkevevLNNEIS---ELKSKQL---QLLG  671
              M+  LSRY     STE  +  E +      H    VL N+ S   EL+  QL   +L G
Sbjct  61    CMEQILSRYGYTTASTEHKQQREHQLLICASHGNEAVLRNDDSMKVELERLQLAIERLKG  120

Query  672   KDLTGMGLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEE  851
             K+L GM   +L   E++L+ +L ++K +K Q+LL Q+E SR QE++AL EN+ LR+Q+E 
Sbjct  121   KELEGMSFPDLISFENQLNESLHSVKDQKTQILLNQIERSRIQEKKALEENQILRKQVEM  180

Query  852   L-RGLVPSNVSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVSDTTLQLG-P  1025
             L RG  P           L   P  ++ S   D   S +   ++D +   SDT+LQLG  
Sbjct  181   LGRGSGP---------KVLNERP--QDSSPEADPESSSSEEDENDNEEHHSDTSLQLGLS  229

Query  1026  PTGSCRKRKTPDQETHSSNS  1085
              TG C KRK P  E    NS
Sbjct  230   STGYCTKRKKPKIELVCDNS  249



>ref|XP_010554819.1| PREDICTED: agamous-like MADS-box protein AGL18 isoform X2 [Tarenaya 
hassleriana]
Length=265

 Score =   161 bits (407),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 112/261 (43%), Positives = 155/261 (59%), Gaps = 25/261 (10%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGK +IK I+NVNSR V FSKRR+GL+KKA+ELSILCDAEVAVI+FSST K++++SS+
Sbjct  1     MGRGKTEIKRIDNVNSRLVRFSKRRNGLMKKARELSILCDAEVAVIVFSSTGKVYDFSSS  60

Query  516   SMKHTLSRYNKCLDSTETPKIvekkpkv-----------ehkevevLNNEISELKSKQLQ  662
             SM  TLSRY     S++  +  +                  ++ + L +E+  L     +
Sbjct  61    SMHQTLSRYGYSSVSSDHWEQPQLLQHQQPHPSLFQDIDASEDSDSLKSELERLHLSYER  120

Query  663   LLGKDLTGMGLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQ  842
             + G++L G+   EL  LE++L+ ALL IK RK Q+LL Q+E SR QE++AL ENE LR+Q
Sbjct  121   MNGRELDGLSFQELLSLENQLNEALLNIKDRKTQVLLNQIERSRLQEKKALEENERLRKQ  180

Query  843   IEELRG------LVPSNVSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVSD  1004
             +E   G      L   N  + +    L  +P+L     GK  +   +     D D+  SD
Sbjct  181   LEMFEGSSEPLELTAVNTELHI----LASFPLLGRGMEGKSSSLDDDN----DSDDHHSD  232

Query  1005  TTLQLGPPTGSCRKRKTPDQE  1067
             TTLQLG P+   RK+K P  E
Sbjct  233   TTLQLGLPSEYNRKKKIPKIE  253



>ref|XP_010554818.1| PREDICTED: agamous-like MADS-box protein AGL18 isoform X1 [Tarenaya 
hassleriana]
Length=266

 Score =   160 bits (406),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 112/262 (43%), Positives = 155/262 (59%), Gaps = 26/262 (10%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGK +IK I+NVNSR V FSKRR+GL+KKA+ELSILCDAEVAVI+FSST K++++SS+
Sbjct  1     MGRGKTEIKRIDNVNSRLVRFSKRRNGLMKKARELSILCDAEVAVIVFSSTGKVYDFSSS  60

Query  516   SMKHTLSRYNKCLDSTETPKIvekkpk------------vehkevevLNNEISELKSKQL  659
             SM  TLSRY     S++  +  +                   ++ + L +E+  L     
Sbjct  61    SMHQTLSRYGYSSVSSDHWEQPQLLQHQQPHPSLFQDIDASQEDSDSLKSELERLHLSYE  120

Query  660   QLLGKDLTGMGLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRR  839
             ++ G++L G+   EL  LE++L+ ALL IK RK Q+LL Q+E SR QE++AL ENE LR+
Sbjct  121   RMNGRELDGLSFQELLSLENQLNEALLNIKDRKTQVLLNQIERSRLQEKKALEENERLRK  180

Query  840   QIEELRG------LVPSNVSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVS  1001
             Q+E   G      L   N  + +    L  +P+L     GK  +   +     D D+  S
Sbjct  181   QLEMFEGSSEPLELTAVNTELHI----LASFPLLGRGMEGKSSSLDDDN----DSDDHHS  232

Query  1002  DTTLQLGPPTGSCRKRKTPDQE  1067
             DTTLQLG P+   RK+K P  E
Sbjct  233   DTTLQLGLPSEYNRKKKIPKIE  254



>ref|XP_010427610.1| PREDICTED: agamous-like MADS-box protein AGL18 [Camelina sativa]
Length=256

 Score =   160 bits (404),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 117/260 (45%), Positives = 155/260 (60%), Gaps = 21/260 (8%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRG+I+IK IENVNSRQVTFSKRR+GL  KA+ELSILCDA+VA+IIFSST K++++SST
Sbjct  1     MGRGRIEIKKIENVNSRQVTFSKRRNGLFNKAKELSILCDADVALIIFSSTGKIYDFSST  60

Query  516   SMKHTLSRYNKCLDS-TETPKIvekkpkvehkevevLNNEIS---ELKSKQL---QLLGK  674
              M+  LSRY     S     +  +      H    VL N+ S   EL+  QL   +L GK
Sbjct  61    CMEQILSRYGYTTASAVHKQREQQLLLGASHDNEAVLRNDDSMKGELERLQLATERLKGK  120

Query  675   DLTGMGLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEEL  854
             +L GM   +L  LE +L+ +L ++K +K +LLL Q+E SR QE RAL EN+ LR+Q+E L
Sbjct  121   ELDGMSFPDLISLETQLNESLRSVKDQKTKLLLNQIERSRLQERRALEENQILRKQVELL  180

Query  855   -RGLVPSNVS-MPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVSDTTLQLG-P  1025
              RG  P  +S +P  +   +  P   +    ++  E  +           SDT+LQLG  
Sbjct  181   GRGSGPKVLSEIPQASSREDADPESSSSDDDENDNEEHH-----------SDTSLQLGLA  229

Query  1026  PTGSCRKRKTPDQETHSSNS  1085
              TG C KRK P  E    NS
Sbjct  230   STGYCTKRKKPKMEQVCDNS  249



>ref|XP_002984921.1| MADS-domain transcription factor [Selaginella moellendorffii]
 ref|XP_002985974.1| MADS-domain transcription factor [Selaginella moellendorffii]
 gb|EFJ13151.1| MADS-domain transcription factor [Selaginella moellendorffii]
 gb|EFJ14171.1| MADS-domain transcription factor [Selaginella moellendorffii]
Length=235

 Score =   159 bits (401),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 94/231 (41%), Positives = 138/231 (60%), Gaps = 31/231 (13%)
 Frame = +3

Query  336  MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEY--S  509
            MGRGKI+IK IEN  +RQVTFSKRR GLLKKA ELS+LCDA++A+IIFSST KLFEY  S
Sbjct  1    MGRGKIEIKRIENATNRQVTFSKRRGGLLKKAHELSVLCDAQIALIIFSSTGKLFEYSSS  60

Query  510  STSMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGM  689
            STSMK  L RY +  +      IV+   +   +E+  L  +I +L+     ++G+DL  +
Sbjct  61   STSMKEILDRYGRYPEGNHNTSIVDHDNERWGRELIRLKQQIEQLQQTHRHMVGEDLIHL  120

Query  690  GLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLV-  866
            G+ +L+QLEH+L   L  I+ RK+QL+ EQL+  R++E     EN++LRR++  +  ++ 
Sbjct  121  GIKDLQQLEHRLLSGLERIRARKDQLIAEQLDELRRKELHLQRENDHLRRKLNGIHSVID  180

Query  867  --------------------PSNVSMPM-------PTP-YLEYYPVLKNCS  935
                                P +V++P        P P ++E++P +   S
Sbjct  181  SGGKPLATLNVVATPLETREPPSVTLPFSIHGQLAPLPAFVEHHPQMLQTS  231



>ref|XP_006351403.1| PREDICTED: agamous-like MADS-box protein AGL18-like [Solanum 
tuberosum]
Length=229

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 106/255 (42%), Positives = 150/255 (59%), Gaps = 34/255 (13%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSS-  512
             MGRGKI++K IEN++SRQVTFSKRRSGL KKA+ELS+LCDAE+ VI+FS+TD+L+E++S 
Sbjct  1     MGRGKIEMKKIENISSRQVTFSKRRSGLFKKAEELSVLCDAEIGVIVFSNTDRLYEFASS  60

Query  513   -TSMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGM  689
              +SM+  + RYN    S E P +      +   E+  L  E+++L+    +++GK+L  +
Sbjct  61    KSSMEKIVDRYNNSSHSIEHPIV----ENIVEPELNSLKVEVAKLRKATGRMMGKELDDL  116

Query  690   GLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVP  869
                EL+QLEH+L   +L++K +KEQ+LLE LE S            NL  QIEEL G   
Sbjct  117   DFKELQQLEHQLTEGILSVKNKKEQVLLELLEKS------------NL--QIEEL-GHKS  161

Query  870   SNVSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCD-DDLDNEVSDTTLQLGPPTGSCRK  1046
              N        Y E Y   +  S G          CD   +  E SDT+L LG    + +K
Sbjct  162   CN-------HYPENYEAARKISGGNS-----TVICDFKSVGEENSDTSLSLGLSVATSQK  209

Query  1047  RKTPDQETHSSNSEN  1091
             ++ P  E  S++SEN
Sbjct  210   KRNPKIECTSNDSEN  224



>emb|CDY33827.1| BnaCnng07450D [Brassica napus]
Length=258

 Score =   158 bits (400),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 118/264 (45%), Positives = 160/264 (61%), Gaps = 27/264 (10%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRG+I+IK IENVNSRQVTFSKRR+GL+KKA+ELSILCDAEVA+IIFSST K++++SS 
Sbjct  1     MGRGRIEIKKIENVNSRQVTFSKRRNGLMKKAKELSILCDAEVALIIFSSTGKVYDFSSG  60

Query  516   SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEI---------SELKSKQL---  659
              M+ TLSRY    ++ ET    +++ +          N +         SEL   QL   
Sbjct  61    CMEQTLSRYG---NNAETADHKQREQQQLLLCSYSHQNGVVFQKDESTKSELVRLQLAIE  117

Query  660   QLLGKDLTGMGLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRR  839
             +L GK L GM  ++L  LE++L+ +L ++K +K QLLL Q+E SR QE RAL EN+ LR+
Sbjct  118   RLKGKKLEGMSFSDLISLENQLNDSLHSVKNQKTQLLLSQVERSRLQERRALEENQLLRK  177

Query  840   QIEEL-RGLVPSNVSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVSDTTLQ  1016
             Q+E L RG      S P     +  +      S   +   S +   D+D ++  SDT+LQ
Sbjct  178   QVEMLGRG-----SSGPKGLSEIPQFS-----SPQAEHESSSSDDDDNDNEDHHSDTSLQ  227

Query  1017  LG-PPTGSCRKRKTPDQETHSSNS  1085
             LG   +G CRK K P  E+   NS
Sbjct  228   LGLSWSGYCRKIKKPKIESPCDNS  251



>ref|XP_009104054.1| PREDICTED: agamous-like MADS-box protein AGL18 [Brassica rapa]
 emb|CDX67688.1| BnaA07g17280D [Brassica napus]
Length=258

 Score =   158 bits (399),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 115/261 (44%), Positives = 158/261 (61%), Gaps = 21/261 (8%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRG+I+IK IENVNSRQVTFSKRR+GL+KKA+ELSILCDAEVA+IIFSST K++++SS 
Sbjct  1     MGRGRIEIKKIENVNSRQVTFSKRRNGLMKKAKELSILCDAEVALIIFSSTGKVYDFSSG  60

Query  516   SMKHTLSRYNKCLDSTETPK-------IvekkpkvehkevevLNNEISELKSKQL---QL  665
              M+ TLSRY  C   T   K       ++           +   +  SEL+  QL   +L
Sbjct  61    CMEQTLSRYG-CNAETADHKQREEQQLLLCSSSHENGAVFQKDESTKSELERLQLAIERL  119

Query  666   LGKDLTGMGLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQI  845
              GK+L GM  ++L  LE +L+ +L ++K +K QLLL Q+E SR QE+RAL EN+ LR+Q+
Sbjct  120   KGKELEGMSFSDLISLESQLNDSLHSVKNQKTQLLLNQVERSRLQEKRALEENQLLRKQV  179

Query  846   EELRGLVPSNVSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVSDTTLQLG-  1022
             E    ++    S P     +  +      S   +   S +   D+D ++  SDT+LQLG 
Sbjct  180   E----MLGRGSSGPKGLSEIPQFS-----SPQAEHESSSSDDDDNDNEDHHSDTSLQLGL  230

Query  1023  PPTGSCRKRKTPDQETHSSNS  1085
               +G CRK K P  E+   NS
Sbjct  231   SWSGYCRKIKKPKIESPCDNS  251



>ref|XP_010279518.1| PREDICTED: agamous-like MADS-box protein AGL15 isoform X3 [Nelumbo 
nucifera]
Length=209

 Score =   156 bits (394),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 93/187 (50%), Positives = 124/187 (66%), Gaps = 3/187 (2%)
 Frame = +3

Query  504   YSSTSMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLT  683
             +  + MK TLSRYNKCLD +ET  +     K + KEV +L +EI+ L+    +++GK+L 
Sbjct  11    FCHSGMKRTLSRYNKCLDCSETALVEYGAKKQQSKEVNILKDEIARLRMANRRMMGKELM  70

Query  684   GMGLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGL  863
             G+ L EL+ LEH+L   +L++K RKEQLLLEQLE SR QE+RAL+ENE LR+Q+EELRGL
Sbjct  71    GLSLKELQNLEHQLSEGILSVKDRKEQLLLEQLEKSRLQEQRALLENETLRKQVEELRGL  130

Query  864   VPSNVSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNE-VSDTTLQLGPPTGSC  1040
             +PS   + MP PYL   P+ K     K    S N GC+   + +  SDT+L LG P+ SC
Sbjct  131   LPSPECL-MP-PYLRLQPMEKKHFQIKQDVISSNMGCNCTFEKQGESDTSLHLGLPSDSC  188

Query  1041  RKRKTPD  1061
             RKRK  D
Sbjct  189   RKRKAHD  195



>ref|XP_009116442.1| PREDICTED: agamous-like MADS-box protein AGL18 [Brassica rapa]
Length=266

 Score =   157 bits (398),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 115/267 (43%), Positives = 163/267 (61%), Gaps = 24/267 (9%)
 Frame = +3

Query  318   LNKGKKMGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKL  497
               K +KMGRG+I+IK IENVNSRQVTFSKRR+GL+KKA+ELSILCDAEVA+IIFSST K 
Sbjct  6     FEKKEKMGRGRIEIKKIENVNSRQVTFSKRRNGLMKKARELSILCDAEVALIIFSSTGKA  65

Query  498   FEYSSTSMKHTLSRYNKCLDSTETPK--------IvekkpkvehkevevLNNEISELKSK  653
             +++SS  M+ TLSRY     S +  +           ++      + + + +E+  L+  
Sbjct  66    YDFSSGCMEQTLSRYGYSGASHDHKQREEQQLLLCSSQENVAMLPKDDAMKSEVERLQLA  125

Query  654   QLQLLGKDLTGMGLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENL  833
               +L GK+L GM  ++L  LE++L+ +L ++K +K Q+LL Q+E SR +E+RAL EN+ L
Sbjct  126   IQRLKGKELEGMSFSDLISLENQLNDSLHSVKDQKTQILLNQVERSRLKEKRALEENQIL  185

Query  834   RRQIEEL-RGLV-PSNVSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVSDT  1007
             R+Q+E L RG   P  +S             +   SS +   ES ++  DD+ D   SDT
Sbjct  186   RKQVEMLGRGSSGPKGLS------------EIPQFSSPQAEPESSSSDDDDENDPH-SDT  232

Query  1008  TLQLG-PPTGSCRKRKTPDQETHSSNS  1085
             +LQLG   +G   KRK P  E+   NS
Sbjct  233   SLQLGLSSSGYWTKRKKPKIESPYDNS  259



>ref|XP_009139036.1| PREDICTED: agamous-like MADS-box protein AGL18 [Brassica rapa]
Length=264

 Score =   157 bits (398),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 114/261 (44%), Positives = 156/261 (60%), Gaps = 20/261 (8%)
 Frame = +3

Query  333   KMGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSS  512
             +MGRG+I+IK IENVNSRQVTFSKRR+GL+KKA ELSILCDAEVAVI+FSST K +++SS
Sbjct  7     EMGRGRIEIKKIENVNSRQVTFSKRRNGLMKKANELSILCDAEVAVIVFSSTGKAYDFSS  66

Query  513   TSMKHTLSRYNKCLDST------ETPKI---vekkpkvehkevevLNNEISELKSKQLQL  665
              SM+H LSRY     +       E  ++     +      +  E L +E+  L+    +L
Sbjct  67    GSMEHILSRYGYSAVTAGHRQREEQQQLLLCSSQDNGDVLRTDEPLRSELERLQLAIERL  126

Query  666   LGKDLTGMGLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQI  845
              GK+L GM  ++L  LE++L  +L ++K RK QLLL Q+E SR QE+RAL EN+ LR+QI
Sbjct  127   KGKELEGMSFSDLISLENQLSDSLHSVKDRKTQLLLNQVERSRLQEKRALEENQILRKQI  186

Query  846   EELRGLVPSNVSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVSDTTLQLG-  1022
             + L        +M  P P L   P   +    +  + S +   ++D +   SDT+LQLG 
Sbjct  187   DML--------AMSGPKP-LSEIPQF-SSPQAEPESSSSDDDNENDNEEHPSDTSLQLGL  236

Query  1023  PPTGSCRKRKTPDQETHSSNS  1085
               +    KRK P  E    NS
Sbjct  237   SSSAYFAKRKKPKIEPPCDNS  257



>emb|CDY06109.1| BnaA09g36710D [Brassica napus]
Length=255

 Score =   154 bits (390),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 113/260 (43%), Positives = 160/260 (62%), Gaps = 22/260 (8%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRG+I+IK IENVNSRQVTFSKRR+GL+KKA+ELSILCDAEVA+IIFSST K +++SS 
Sbjct  1     MGRGRIEIKKIENVNSRQVTFSKRRNGLMKKARELSILCDAEVALIIFSSTGKAYDFSSG  60

Query  516   SMKHTLSRYNKCLDSTETPK--------IvekkpkvehkevevLNNEISELKSKQLQLLG  671
              M+ TLSRY     S +  +           ++      + + + +E+  L+    +L G
Sbjct  61    CMEQTLSRYGYSGASHDHKQREEQQLLLCSSQENGAVLPKDDAMKSEVERLQLAIQRLKG  120

Query  672   KDLTGMGLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEE  851
             K+L GM  ++L  LE++L+ +L ++K +K Q+LL Q+E SR +E+RAL EN+ LR+Q+E 
Sbjct  121   KELEGMSFSDLISLENQLNDSLHSVKDQKTQILLNQVERSRLKEKRALEENQILRKQVEM  180

Query  852   L-RGLVPSNVSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVSDTTLQLG-P  1025
             L RG      S P     +  +      SS +   ES ++  DD+ D   SDT+LQLG  
Sbjct  181   LGRG-----SSGPKGLSEIPQF------SSPQAEPESSSSDDDDENDPH-SDTSLQLGLS  228

Query  1026  PTGSCRKRKTPDQETHSSNS  1085
              +G   KRK P  E+   NS
Sbjct  229   SSGYWTKRKKPKIESPYDNS  248



>dbj|BAC67017.1| MADS-box transcription factor SrMADS1, partial [Selaginella remotifolia]
Length=256

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 91/204 (45%), Positives = 133/204 (65%), Gaps = 14/204 (7%)
 Frame = +3

Query  318  LNKGKK--MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTD  491
            LNK K+  +GRGKI+IK IEN  SRQVTFSKRR GLLKKA ELS+LCDA+VA+IIFSST 
Sbjct  35   LNKQKEPPVGRGKIEIKRIENATSRQVTFSKRRGGLLKKAHELSVLCDAQVALIIFSSTG  94

Query  492  KLFEYSSTSMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELK-------S  650
            KLFEY+STSMK  L RY K  +S +   +        H+  + +++EI  LK        
Sbjct  95   KLFEYASTSMKEILDRYGKYPESVQGGNM-----ASHHEASDFISHEIRRLKQQLQRSQQ  149

Query  651  KQLQLLGKDLTGMGLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENEN  830
             +  LLG DL+ + + +L+ LE +L+  L  ++ RK+Q+L++Q++  R++E     +NE 
Sbjct  150  SRRHLLGDDLSHLPIKDLQNLEQQLEVGLSRVRSRKDQVLMDQVDELRRRELTLHKDNEM  209

Query  831  LRRQIEELRGLVPSNVSMPMPTPY  902
            LRR++ +++G+  S  S  +  P+
Sbjct  210  LRRRLSDVQGMAESGRSTLIVNPW  233



>gb|AAM51780.1|AF425602_1 MADS-box gene 6 protein [Lycopodium annotinum]
Length=234

 Score =   152 bits (383),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 89/185 (48%), Positives = 121/185 (65%), Gaps = 4/185 (2%)
 Frame = +3

Query  336  MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
            MGRGKI+IK IEN  SRQVTFSKRR GLLKKA EL++LCDA+VA+IIFS+T KLFEY+ST
Sbjct  1    MGRGKIEIKRIENSTSRQVTFSKRRGGLLKKAHELAVLCDAQVALIIFSNTGKLFEYAST  60

Query  516  SMKHTLSRYNKCLDSTETPKIve----kkpkvehkevevLNNEISELKSKQLQLLGKDLT  683
            SMK  L RY K  D  +T +++E       +   +EV  +  +I      Q  ++G+DL 
Sbjct  61   SMKEILDRYRKYPDGIQTGRVMEYDNDVMVQHWSREVMRMKQQIERSYQTQRHMMGEDLG  120

Query  684  GMGLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGL  863
             + L EL+ LE +LD  L  ++ RK+Q+L EQ+++ R +E +   ENE LRR+I    G+
Sbjct  121  LLPLKELQHLEQQLDTGLNRVRARKDQVLREQIDSLRIKELQWHEENEILRRKIAGAHGM  180

Query  864  VPSNV  878
                V
Sbjct  181  TEVAV  185



>gb|KGN58566.1| hypothetical protein Csa_3G686200 [Cucumis sativus]
Length=189

 Score =   150 bits (379),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 95/191 (50%), Positives = 131/191 (69%), Gaps = 11/191 (6%)
 Frame = +3

Query  519   MKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMGLN  698
             MKHTL+RYNKC++S++   +   K + EH+EV++L  EI+ L+ KQLQLLGKDLTG+G  
Sbjct  1     MKHTLARYNKCVESSDAT-VDVHKVEREHEEVDILREEITTLQMKQLQLLGKDLTGLGFK  59

Query  699   ELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPSNV  878
             EL+ LE +L+  LL +K +KEQLL+EQLE SR QE+RA++ENE LRRQ+ ELR L P  V
Sbjct  60    ELQNLEQQLNEGLLLVKEKKEQLLMEQLEQSRVQEQRAMLENETLRRQVNELRCLFPP-V  118

Query  879   SMPMPTPYLEYYPVLKNCSSGKD--GAESLNTGCDDDLDNEVSDTTLQLGPPTGSCRKRK  1052
               P+P  YLEY      CS  +   G  S +  C+ +++   SDTTL LG P+    KRK
Sbjct  119   DCPLPA-YLEY------CSLEQKNIGIRSPDMACNSEIERGDSDTTLHLGLPSHVYCKRK  171

Query  1053  TPDQETHSSNS  1085
               +++THS++S
Sbjct  172   ESERDTHSNDS  182



>ref|XP_008392265.1| PREDICTED: agamous-like MADS-box protein AGL18 [Malus domestica]
Length=175

 Score =   149 bits (377),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 85/164 (52%), Positives = 117/164 (71%), Gaps = 8/164 (5%)
 Frame = +3

Query  330  KKMGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYS  509
            K +GRG+I+IK IEN++SRQVTFSKRR+GLLKKA+ELS+LCDAEVAVI+FSST KL+E+S
Sbjct  11   KPLGRGRIEIKKIENLSSRQVTFSKRRNGLLKKAKELSVLCDAEVAVIVFSSTGKLYEFS  70

Query  510  STSMKHTLSRYNKCLDSTETPKIvek-------kpkvehkevevLNNEISELKSKQLQLL  668
            STSM HTLSRYNK     E P+           +    +  V  L NEI+ L+    ++ 
Sbjct  71   STSMDHTLSRYNKG-GLIEHPQKERSGDNEPVMQATNSNCNVNALQNEIATLRLTCTRMT  129

Query  669  GKDLTGMGLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQ  800
            GK+L G+ L +L++LE +L   +L +K +KE++L+E+L+ SR Q
Sbjct  130  GKELDGVSLKDLQRLEDQLSEGILCVKDKKEEILMEKLKKSRLQ  173



>ref|XP_001774085.1| MIKCC MADS-domain protein PpMADS-S [Physcomitrella patens]
 gb|EDQ61137.1| MIKCC MADS-domain protein PpMADS-S [Physcomitrella patens]
Length=296

 Score =   153 bits (386),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 120/175 (69%), Gaps = 5/175 (3%)
 Frame = +3

Query  336  MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
            MGRGKI+IK IEN  SRQVTFSKRR GLLKKA EL++LCDAEVA+IIFSST KLFE++S+
Sbjct  1    MGRGKIEIKKIENPTSRQVTFSKRRGGLLKKAHELAVLCDAEVALIIFSSTGKLFEFASS  60

Query  516  -SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMG  692
             SM+  L RY+KC D  +T            +EV  L  ++  ++  Q Q+LG+DL  + 
Sbjct  61   GSMRDILERYSKCPDGVQT----TGNVDFMGREVVKLRQQLERMQHSQRQMLGEDLQVLT  116

Query  693  LNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELR  857
            +++L QLE +LD     ++ RK QLLLE++E  R++E     ENE+LR+++  ++
Sbjct  117  VSDLLQLEQQLDVGASRVRARKNQLLLEEIEQLRQKELDLQAENEDLRKKLAHVK  171



>gb|AAM74074.1|AF492455_1 MADS-box transcription factor [Cycas edentata]
 gb|AAP49431.1| MADS-box transcription factor [Cycas edentata]
Length=224

 Score =   150 bits (380),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 84/187 (45%), Positives = 124/187 (66%), Gaps = 1/187 (1%)
 Frame = +3

Query  336  MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
            MGRGKI+IK IEN  +RQVTF KRR+GLLKKA ELS+LCDAEVA+I+FSS  +L+E+++ 
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEFANN  60

Query  516  SMKHTLSRYNK-CLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMG  692
            S+K T+ RY K C D+T+   I E   +   +E   L  +I  L++    L+G  LT + 
Sbjct  61   SVKRTIERYKKTCADNTQGGAISESNSQYWQQEAGKLRQQIDILQNANRHLMGDALTSLS  120

Query  693  LNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPS  872
            + EL+QLE +L+  L  ++ +K ++LLE++E  +++E   L EN+ LR +I E      +
Sbjct  121  VKELKQLEIRLERGLSRVRSKKNEMLLEEIEIMQRREHILLAENQFLRTKIAEYESNQNT  180

Query  873  NVSMPMP  893
            NV +P P
Sbjct  181  NVLIPGP  187



>ref|XP_006647418.1| PREDICTED: MADS-box transcription factor 27-like [Oryza brachyantha]
Length=240

 Score =   150 bits (378),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 98/244 (40%), Positives = 144/244 (59%), Gaps = 18/244 (7%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI I+ I+N  SRQVTFSKRR+G+ KKA+EL+ILCDAEV ++IFSST +L+EYSST
Sbjct  1     MGRGKIVIRRIDNSTSRQVTFSKRRNGIFKKAKELAILCDAEVGLMIFSSTGRLYEYSST  60

Query  516   SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMGL  695
             SMK  + RY K LD  +       + K   +E   L  ++  L+    QL+G+DL+G+ +
Sbjct  61    SMKSVIDRYGKSLDEQQAVANPNSELKFWQREAASLRQQLHNLQENHRQLMGEDLSGLNV  120

Query  696   NELRQLEHKLDGALLAIKGRKEQLLLEQL-ENSRK-----QEERALV--------ENENL  833
              EL+ LE++L+ ++ +++ +K+QLL++++ E +RK     QE   L         EN  L
Sbjct  121   KELQSLENQLEISIRSVRTKKDQLLIDEVHELNRKGSLVHQENMELYKKISLIRRENAEL  180

Query  834   RRQIEELRGLVPSNVSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVSDTTL  1013
              ++I E  G  PS V+   PTPY   +PV++  +       S      D   + V    L
Sbjct  181   YKKIYETEG--PSEVNRDSPTPY--NFPVVEKTNVAVQLGLSTLPQHSDAEQSAVPKLGL  236

Query  1014  QLGP  1025
             QL P
Sbjct  237   QLNP  240



>ref|XP_006856591.1| hypothetical protein AMTR_s00046p00208680 [Amborella trichopoda]
 gb|ERN18058.1| hypothetical protein AMTR_s00046p00208680 [Amborella trichopoda]
Length=222

 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 78/174 (45%), Positives = 120/174 (69%), Gaps = 0/174 (0%)
 Frame = +3

Query  336  MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
            MGRGKI I+ I+N  SRQVTFSKRR+GLLKKA+EL+ILCDA+V ++IFSST KL+E+SS+
Sbjct  1    MGRGKIVIRRIDNSTSRQVTFSKRRNGLLKKAKELAILCDADVGLVIFSSTGKLYEFSSS  60

Query  516  SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMGL  695
            SMK  + RYNKC D          +  +  +E   L  ++  L+    QL+G++L+G+G+
Sbjct  61   SMKSIIERYNKCKDERHQDSSSSSEVTLWQREAATLRQQLKSLQDNHRQLMGEELSGLGV  120

Query  696  NELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELR  857
             EL+ LE++L+ +L  ++ +K+Q+L EQ++  +++ +    EN  L R++ E R
Sbjct  121  GELQNLENQLEMSLRGVRRKKDQILTEQIQELQRKGDLIHQENMELYRKVYEAR  174



>gb|ADE76318.1| unknown [Picea sitchensis]
Length=261

 Score =   149 bits (377),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 93/233 (40%), Positives = 145/233 (62%), Gaps = 24/233 (10%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRG++ ++ IEN  +RQVTFSKRR+GLLKKA ELS+LCDAEVA+IIFS+  KL+E++S+
Sbjct  1     MGRGRVQLRRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLYEFASS  60

Query  516   SMKHTLSRYNKCLDSTE-TPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMG  692
             SM  TL RY KC  + + T  + +++ +  H+EV  L  ++  L+  Q  LLG+DL  + 
Sbjct  61    SMNKTLERYEKCSYAMQDTTGVSDREAQNWHQEVTKLKGKVELLQRSQRHLLGEDLGPLN  120

Query  693   LNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVE-NENLRRQIEELRGLVP  869
             + EL+QLE +L+ AL  ++ RK Q++L+Q+E  R Q ER L E N++L++++ E  G   
Sbjct  121   VKELQQLERQLEVALAHLRSRKTQVMLDQIEELR-QRERLLHEVNKSLQKKLSETEG---  176

Query  870   SNVSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVSDTTLQLGPP  1028
                               ++  +G +   + NTG +   D+ +++TT  L  P
Sbjct  177   ------------------RDVITGIEQTSNTNTGTNGPWDSSITNTTYALSHP  211



>emb|CAA70822.1| MADS-box family transcription factor [Pinus resinosa]
Length=242

 Score =   149 bits (375),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 95/235 (40%), Positives = 144/235 (61%), Gaps = 11/235 (5%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRG++++K IEN  +RQVTFSKRR+GLLKKA ELS+LCDAEVA+IIFSS  KL+E+ S 
Sbjct  1     MGRGRVELKRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFGSA  60

Query  516   SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMGL  695
              M  TL RY KC    +   + +++ +  H+EV  L   +  L+  Q  LLG+DL  + +
Sbjct  61    GMLKTLERYQKCSYVLQDATVSDREAQNWHQEVGKLKARVELLQRSQRHLLGEDLGPLSI  120

Query  696   NELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVE-NENLRRQIEELRGLVPS  872
              EL+QLE +L+ AL  ++ RK Q++LE ++  R++ ER L E N++LR++++E  G    
Sbjct  121   KELQQLERQLEVALTHVRSRKTQVMLEMMDELRRK-ERILQEVNKSLRKKLQEAEGQA-F  178

Query  873   NVSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVSDTTLQLGPPTGS  1037
             N   P P  + + + V  N  + +  + +++  C+  L      T  Q  PP  S
Sbjct  179   NAMQPPPHAW-DSHAVANNAYAMQHPSNAVD--CEPTL-----QTGYQYAPPESS  225



>gb|AGR53802.1| DAL14 protein [Picea abies]
Length=243

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 93/235 (40%), Positives = 144/235 (61%), Gaps = 10/235 (4%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRG++++K IEN  +RQVTFSKRR+GLLKKA ELS+LCDAEVA+IIFSS  KL+E+ S 
Sbjct  1     MGRGRVELKRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFGSA  60

Query  516   SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMGL  695
              M  TL RY KC    +   + ++  +  H+EV  L   +  L+  Q  LLG+DL  + +
Sbjct  61    GMLKTLERYQKCSYVLQDATVSDRDAQNWHQEVGKLKARVELLQRSQRHLLGEDLGPLSI  120

Query  696   NELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVE-NENLRRQIEELRGLVPS  872
              EL+QLE +L+ AL  ++ RK Q++LE ++  R++ ER L E N++LR++++E  G   +
Sbjct  121   KELQQLERQLEVALTHVRTRKTQVMLEMMDELRRK-ERILQEVNKSLRKKLQEAEGQAFN  179

Query  873   NVSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVSDTTLQLGPPTGS  1037
             ++  P P  + + + V  N  + +  + +++  C+  L         Q  PP  S
Sbjct  180   SMQAPPPHAW-DSHAVANNAYAMQHQSNAVD--CEPTL-----QIGYQYAPPETS  226



>gb|AAM76208.1| AGAMOUS-like MADS-box transcription factor [Ginkgo biloba]
 gb|ADD64702.1| MADS5 protein [Ginkgo biloba]
Length=221

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 92/231 (40%), Positives = 137/231 (59%), Gaps = 12/231 (5%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN  +RQVTF KRR+GLLKKA ELS+LCDAEVA+I+FSS  +L+E+++ 
Sbjct  1     MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEFANN  60

Query  516   SMKHTLSRYNK-CLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMG  692
             S+K T+ RY K C D+++   I E   +   +E   L  +I  L++    L+G  LT + 
Sbjct  61    SVKRTIDRYKKTCADNSQGGAISECNSQYWQQEAGKLRQQIDILQNANRHLMGDALTSLS  120

Query  693   LNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPS  872
             + EL+QLE +L+  +  ++ +K ++LLE++E  +++E   L EN+ LR +I E      +
Sbjct  121   VKELKQLEIRLERGISRVRSKKNEMLLEEIEIMQRREHILLAENQFLRTKIAECESSQNA  180

Query  873   NVSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVSD-TTLQLG  1022
             N+   +P P  +  P       G D    L+    D       D T LQLG
Sbjct  181   NM---LPGPEFDALP-------GFDSRHFLHASIMDAHHYAQQDQTALQLG  221



>gb|AAW78030.1| AGAMOUS-like protein [Thalictrum dioicum]
Length=226

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 94/232 (41%), Positives = 140/232 (60%), Gaps = 9/232 (4%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN  +RQVTF KRR+GLLKKA ELS+LC+AEVA+I+FSS  +L+EYS+ 
Sbjct  1     MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCEAEVALIVFSSRGRLYEYSNN  60

Query  516   SMKHTLSRYNKC-LDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMG  692
             S+K T+ RY K   DS  +  + E   +   +E   L+N+I+ L++    LLG+ L+ + 
Sbjct  61    SVKKTIERYKKASTDSPNSGSVSEANVQFYQQEASKLHNQIASLQNHNRNLLGESLSNLN  120

Query  693   LNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPS  872
             + ELRQ+E K++G +  I+ +K +LL  ++E  +K+E     +N+ LR  I       P 
Sbjct  121   IKELRQIEKKIEGGISKIRAKKNELLFAEVEYMQKREIDLQTDNKYLRAMIAANERAPPE  180

Query  873   NVSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDN--EVSDTTLQLG  1022
             ++++ MP    EY+ +    S+  D    L     D  +N      TTLQLG
Sbjct  181   HMNL-MPAN--EYHIM---SSAPFDSRNFLPANLLDHNNNYSRSDQTTLQLG  226



>gb|AAB58907.1| MADS-box protein [Pinus radiata]
Length=261

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 92/233 (39%), Positives = 144/233 (62%), Gaps = 24/233 (10%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRG++ ++ IEN  +RQVTFSKRR+GLLKKA ELS+LCDAEVA+IIFS+  KL+E++S+
Sbjct  1     MGRGRVQLRRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLYEFASS  60

Query  516   SMKHTLSRYNKCLDSTE-TPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMG  692
             SM  TL RY KC  + + T  + +++ +  H+EV  L  ++  L+  Q  LLG+DL  + 
Sbjct  61    SMNKTLERYEKCSYAMQDTTGVSDREAQNWHQEVTKLKGKVELLQRSQRHLLGEDLGPLN  120

Query  693   LNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVE-NENLRRQIEELRGLVP  869
             + EL+QLE +L+ AL  ++ RK Q++L+Q+E  R Q ER L E N++L++++ E  G   
Sbjct  121   VKELQQLERQLEVALTHLRSRKTQVMLDQIEELR-QRERLLHEVNKSLQKKLSETEG---  176

Query  870   SNVSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVSDTTLQLGPP  1028
                               ++  +G +   + NTG +   D+ +++T   L  P
Sbjct  177   ------------------RDVITGIEQTSNTNTGTNGPWDSSITNTAYALSHP  211



>emb|CAA56864.1| dal1 [Picea abies]
Length=261

 Score =   147 bits (372),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 92/233 (39%), Positives = 144/233 (62%), Gaps = 24/233 (10%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRG++ ++ IEN  +RQVTFSKRR+GLLKKA ELS+LCDAEVA+IIFS+  KL+E++S+
Sbjct  1     MGRGRVQLRRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLYEFASS  60

Query  516   SMKHTLSRYNKCLDSTE-TPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMG  692
             SM  TL RY KC  + + T  + +++ +  H+EV  L  ++  L+  Q  LLG+DL  + 
Sbjct  61    SMNKTLERYEKCSYAMQDTTGVSDREAQNWHQEVTKLKGKVELLQRSQRHLLGEDLGPLN  120

Query  693   LNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVE-NENLRRQIEELRGLVP  869
             + EL+QLE +L+ AL  ++ RK Q++L+Q+E  R Q ER L E N++L++++ E  G   
Sbjct  121   VKELQQLERQLEVALAHLRSRKTQVMLDQIEELR-QRERLLHEVNKSLQKKLSETEG---  176

Query  870   SNVSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVSDTTLQLGPP  1028
                               ++  +G +   + NTG +   D+ +++T   L  P
Sbjct  177   ------------------RDVITGIEQTSNTNTGTNGPWDSSITNTAYALSHP  211



>dbj|BAD18011.1| MADS-box transcription factor [Asparagus virgatus]
Length=226

 Score =   146 bits (369),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 80/173 (46%), Positives = 117/173 (68%), Gaps = 1/173 (1%)
 Frame = +3

Query  336  MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
            MGRGKI+IK IEN  +RQVTF KRR+GLLKKA ELS+LCDAEVA+I+FSS  +L+EY++ 
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN  60

Query  516  SMKHTLSRYNK-CLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMG  692
            S+K T+ RY K C D+T T  + E   +   +E   L  +I+ L++    L+G+ L+ MG
Sbjct  61   SVKATIERYKKACTDTTNTGTVSEANSQYYQQEASKLRQQITNLQNSNRNLMGESLSSMG  120

Query  693  LNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEE  851
            L +L+QLE +L+  +  I+ +K +LL  ++E  +K+E     +N  LR +I E
Sbjct  121  LRDLKQLESRLEKGISKIRSKKNELLYAEIEYMQKREMELQNDNMYLRNKIAE  173



>ref|XP_008376862.1| PREDICTED: MADS-box protein SOC1-like isoform X2 [Malus domestica]
Length=254

 Score =   147 bits (371),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 138/232 (59%), Gaps = 9/232 (4%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             M RGKI++K IEN  SRQVTF+KRR+GLLKKA ELS+LCDAEVAVIIFS  DKL+E+ S+
Sbjct  1     MVRGKIEMKRIENATSRQVTFTKRRNGLLKKAYELSVLCDAEVAVIIFSQKDKLYEFCSS  60

Query  516   SMKHTLSRYNKCLDSTETPKIvekkpkve-hkevevLNNEISELKSKQLQLLGKDLTGMG  692
              M+ TL+RY+      +T K+  ++       E  ++  +I  L++ Q +LLG DL    
Sbjct  61    DMQETLTRYHNYAKDEQTNKVEVEQHVQHLKHESAIMTKKIEILEASQRKLLGNDLDSCF  120

Query  693   LNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPS  872
             + EL+++  +L+ +L +I+ RK QL +EQ+EN + +E   L EN  LR +    + L+  
Sbjct  121   VEELQEISSQLERSLRSIRERKAQLFMEQMENLKAKETLLLQENAKLREE-SGAKLLMEH  179

Query  873   NVSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVSDTTLQLGPP  1028
             +      +  + Y        +G   + S+N      + +EV +T L +GPP
Sbjct  180   SAQEKRASASVSYEK------AGASASASVNYWSQSIMSSEV-ETELLIGPP  224



>gb|KHG12954.1| MADS-box CMB1 [Gossypium arboreum]
Length=247

 Score =   147 bits (370),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 91/216 (42%), Positives = 132/216 (61%), Gaps = 15/216 (7%)
 Frame = +3

Query  336  MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEY-SS  512
            MGRG++++K IEN  +RQVTF+KRR+GLLKKA ELS+LCDAEVA+I+FS+  KL+E+ SS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFCSS  60

Query  513  TSMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMG  692
             SM  TL +Y KC  ST        + +  ++E   L   +  L++ Q  LLG+DL  + 
Sbjct  61   PSMTKTLEKYQKCSYSTLDNSRSISETQNSYQEYLKLKARVEVLQTSQRNLLGEDLGPLD  120

Query  693  LNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPS  872
              EL QLEH+L+ +L  I+  K Q +L+QL +   +E+  +  N++LRR++EEL   VP 
Sbjct  121  SKELDQLEHQLEASLKQIRSTKVQAMLDQLNDLHNREKLLMDANKSLRRKLEELSTQVPQ  180

Query  873  -----NVSMPMPTPYLE---------YYPVLKNCSS  938
                 N+  P   PY           ++P+  NCSS
Sbjct  181  GPAWDNIGGPSIPPYNHLTEAQSEAFFHPLGANCSS  216



>gb|AAD09207.1| putative MADS-box family transcription factor [Pinus radiata]
Length=242

 Score =   146 bits (369),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 94/235 (40%), Positives = 143/235 (61%), Gaps = 11/235 (5%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRG++++K IEN  +RQVTFSKRR+GLLKKA ELS+LCDAEVA+IIFSS  KL+E+ S 
Sbjct  1     MGRGRVELKRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFGSA  60

Query  516   SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMGL  695
              M  TL RY KC    +   + +++ +  H+EV  L   +  L+  Q  LLG+DL  + +
Sbjct  61    GMLKTLERYQKCSYVLQDATVSDREAQNWHQEVGKLKARVELLQRSQRHLLGEDLGPLSI  120

Query  696   NELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVE-NENLRRQIEELRGLVPS  872
              EL+QLE +L+ AL  ++ RK Q++LE ++  R++ ER L E N++LR++++E  G    
Sbjct  121   KELQQLERQLEVALTHVRSRKTQVMLEMMDELRRK-ERILQEVNKSLRKKLQEAEGQA-F  178

Query  873   NVSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVSDTTLQLGPPTGS  1037
             N   P P  + + + V  N  + +  + +++  C+  L         Q  PP  S
Sbjct  179   NAMQPPPHAW-DSHAVANNAYAMQHPSNAVD--CEPTL-----QIGYQYAPPESS  225



>ref|XP_009129078.1| PREDICTED: agamous-like MADS-box protein AGL3 [Brassica rapa]
Length=269

 Score =   147 bits (371),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 79/174 (45%), Positives = 122/174 (70%), Gaps = 2/174 (1%)
 Frame = +3

Query  336  MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEY--S  509
            MGRGK+++K IEN  +RQVTF+KRR+GLLKKA ELS+LCDAE+A++IFS+  KL+E+  S
Sbjct  1    MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEIALLIFSNRGKLYEFCSS  60

Query  510  STSMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGM  689
             + M  T+ +Y K   +T  P    K  + ++++  +L +++  L+  Q  LLG+++ GM
Sbjct  61   PSGMTKTVEKYRKHSYATMDPNQSAKDLQEKYQDYLMLKSKVESLQHSQRHLLGEEIAGM  120

Query  690  GLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEE  851
            G+NEL QLEH++D +L  I+ RK   +L+QL + + +EE  L  N +LRR++EE
Sbjct  121  GVNELEQLEHQVDASLKQIRSRKAGAMLDQLSDLKTKEEMLLETNRDLRRKLEE  174



>dbj|BAD93166.1| MADS-box transcription factor GbMADS2 [Ginkgo biloba]
Length=221

 Score =   145 bits (367),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 91/231 (39%), Positives = 136/231 (59%), Gaps = 12/231 (5%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI++K IEN  +RQVTF KRR+GLLKKA ELS+LCDAEVA+I+FSS  +L+E+++ 
Sbjct  1     MGRGKIEMKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEFANN  60

Query  516   SMKHTLSRYNK-CLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMG  692
             S+K T+ RY K C D++    I E   +   +E   L  +I  L++    L+G  LT + 
Sbjct  61    SVKRTIDRYKKTCADNSHGGAISECNSQYWQQEAGKLRQQIDILQNANRHLMGDALTSLS  120

Query  693   LNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPS  872
             + EL+QLE +L+  +  ++ +K ++LLE++E  +++E   L EN+ LR +I E      +
Sbjct  121   VKELKQLEIRLERGISRVRSKKNEMLLEEIEIMQRREHILLAENQFLRTKIAECESSQNA  180

Query  873   NVSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVSD-TTLQLG  1022
             N+   +P P  +  P       G D    L+    D       D T LQLG
Sbjct  181   NM---LPGPEFDALP-------GFDSRHFLHASIMDAHHYAQQDQTALQLG  221



>gb|AFO38187.1| AGAMOUS1 [Thalictrum thalictroides]
Length=222

 Score =   145 bits (367),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 93/238 (39%), Positives = 135/238 (57%), Gaps = 25/238 (11%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN  +RQVTF KRR+GLLKKA ELS+LC+AEVA+I+FSS  +L+EYS+ 
Sbjct  1     MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCEAEVALIVFSSRGRLYEYSNN  60

Query  516   SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMGL  695
             S+K T+ RY K   ST++P           +E   L N+I+ L++    LLG+ L+ + +
Sbjct  61    SVKKTIERYKKA--STDSPNSGSVSEANVQQEASKLRNQIASLQNHNRNLLGESLSNLNI  118

Query  696   NELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIE------ELR  857
              EL+Q+E K++G +  I+ +K +LL  ++E  +K+E     +N+ LR  I       E  
Sbjct  119   RELKQIEKKIEGGISKIRAKKNELLFAEIEYMQKREIDLQTDNKYLRAMIAANERAPEHM  178

Query  858   GLVPSN---VSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVSDTTLQLG  1022
              L+P+N   V    P     + P         +  +  N  C  D       TTLQLG
Sbjct  179   NLMPANEYHVMSSAPFDSRNFMPA--------NLLDHNNNYCRSD------QTTLQLG  222



>ref|NP_001280901.1| MADS-box protein SOC1-like [Malus domestica]
 gb|ADL36744.1| MADS domain class transcription factor [Malus domestica]
Length=238

 Score =   145 bits (367),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 98/237 (41%), Positives = 141/237 (59%), Gaps = 21/237 (9%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             M RGKI++K IEN  SRQVTFSKRR+GLLKKA ELS+LCDAEVAVIIFS  D+L+E+SS+
Sbjct  1     MVRGKIEMKRIENATSRQVTFSKRRNGLLKKAYELSVLCDAEVAVIIFSQKDRLYEFSSS  60

Query  516   SMKHTLSRYNK-CLDSTETPKIvekkpkve-hkevevLNNEISELKSKQLQLLGKDLTGM  689
              M+ TL+RY K   D  +T K+  ++       E  ++  +I  L++ Q +LLG DL   
Sbjct  61    DMRETLTRYRKYAKDHEQTNKVEVEQHVQHLKHESAIMAKKIEILEATQRKLLGNDLDSC  120

Query  690   GLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVP  869
              + EL++L  +L+ +L +I+ RK QL +EQ+E  + +E   L EN  LR Q         
Sbjct  121   YVEELQELSSQLERSLRSIRERKAQLFMEQMEQLKAKETLLLQENAKLREQ---------  171

Query  870   SNVSMPMPTPYLEYYPVLKNCSS---GKDG-AESLNTGCDDDLDNEVSDTTLQLGPP  1028
             S   +     ++E+    K  S+    K G + S+N      + +EV +T L +GPP
Sbjct  172   SGAKL-----WMEHSVQAKRASTLSYEKAGVSASVNYRSQGSMSSEV-ETELFIGPP  222



>gb|ADJ95380.1| AGAMOUS-like protein [Thalictrum clavatum]
Length=222

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 83/196 (42%), Positives = 124/196 (63%), Gaps = 9/196 (5%)
 Frame = +3

Query  336  MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
            MGRGKI+IK IEN  +RQVTF KRR+GLLKKA ELS+LC+AEVA+I+FSS  +L+EYS+ 
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCEAEVALIVFSSRGRLYEYSNN  60

Query  516  SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMGL  695
            S+K T+ RY K   ST++P           +E   L N+I+ L++    LLG+ L+ + +
Sbjct  61   SVKKTIERYKKA--STDSPNSGSVSEANVQQEASKLRNQIASLQNHNRNLLGESLSNLNI  118

Query  696  NELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIE------ELR  857
             EL+Q+E K++G +  I+ +K +LL  ++E  +K+E     +N+ LR  I       E  
Sbjct  119  RELKQIEKKIEGGISKIRAKKNELLFAEIEYMQKREIDLQTDNKYLRAMIAANERAPEHM  178

Query  858  GLVPSNVSMPMPT-PY  902
             L+P+N    M + P+
Sbjct  179  NLMPANEYHVMSSAPF  194



>ref|XP_007045799.1| MADS-box transcription factor [Theobroma cacao]
 gb|EOY01631.1| MADS-box transcription factor [Theobroma cacao]
Length=240

 Score =   145 bits (366),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 84/173 (49%), Positives = 116/173 (67%), Gaps = 1/173 (1%)
 Frame = +3

Query  336  MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
            MGRG++++K IEN  +RQVTF+KRR+GLLKKA ELSILCDAEVA+IIFS+  KL+E+ ST
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCST  60

Query  516  -SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMG  692
             SM  TL RY++C   T  P   E   +  ++E   L  ++  L+  Q   LG+DL  +G
Sbjct  61   SSMAKTLERYHRCTYGTLEPGQTESDTQSSYQEYLKLKAKVEVLQRSQRHFLGEDLGDLG  120

Query  693  LNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEE  851
              EL QLEH+LD +L  ++  K   +L+QL   +++EE  L  N NLRR++EE
Sbjct  121  STELEQLEHQLDFSLKQLRSTKMHSMLDQLAELQRKEEILLETNRNLRRKLEE  173



>ref|XP_008376871.1| PREDICTED: MADS-box protein SOC1-like isoform X3 [Malus domestica]
Length=253

 Score =   145 bits (366),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 84/194 (43%), Positives = 125/194 (64%), Gaps = 6/194 (3%)
 Frame = +3

Query  336  MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
            M RGKI++K IEN  SRQVTF+KRR+GLLKKA ELS+LCDAEVAVIIFS  DKL+E+ S+
Sbjct  1    MVRGKIEMKRIENATSRQVTFTKRRNGLLKKAYELSVLCDAEVAVIIFSQKDKLYEFCSS  60

Query  516  SMKHTLSRYNKCLDSTETPKIvekkpkve-hkevevLNNEISELKSKQLQLLGKDLTGMG  692
             M+ TL+RY+      +T K+  ++       E  ++  +I  L++ Q +LLG DL    
Sbjct  61   DMQETLTRYHNYAKDEQTNKVEVEQHVQHLKHESAIMTKKIEILEASQRKLLGNDLDSCF  120

Query  693  LNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRG----  860
            + EL+++  +L+ +L +I+ RK QL +EQ+EN + +E   L EN  LR +   L+G    
Sbjct  121  VEELQEISSQLERSLRSIRERKAQLFMEQMENLKAKETLLLQENAKLREEWNVLKGRKDG  180

Query  861  -LVPSNVSMPMPTP  899
             +  +N ++ +P P
Sbjct  181  RMSRANETINLPPP  194



>dbj|BAC06829.1| MADS-box protein PpMADS1 [Physcomitrella patens]
Length=281

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 94/234 (40%), Positives = 136/234 (58%), Gaps = 8/234 (3%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN  SRQVTFSKRR GLLKKA EL++LCDAEVA++IFSST K FE++S+
Sbjct  1     MGRGKIEIKKIENTTSRQVTFSKRRGGLLKKAHELAVLCDAEVALVIFSSTGKHFEFASS  60

Query  516   -SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMG  692
              SM+  + RY K  D             +  +EV  L  ++  L+S Q  +LG+DL+ + 
Sbjct  61    GSMRDIIERYRKSSDGAVK---RGTNTDLLGREVIKLKQQVERLESSQRHMLGEDLSALK  117

Query  693   LNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPS  872
             +++L +LE +LD     ++ RK QL+LE++E+ R++E   ++ NE LR++I +  G   +
Sbjct  118   VSDLLELEQQLDQGASRVRARKNQLILEEIEDLRRKEHELMIANEALRKKIADAEGAAEA  177

Query  873   NVSMPMPTPYLEY-YPVLKNCSSGKDGAESLNTGCDDD---LDNEVSDTTLQLG  1022
                   P   LE   P   + S     +  L          L  + S T+LQLG
Sbjct  178   AARANFPDARLESPKPFASDFSRDMSVSSQLAASVYPHPNLLQAQRSQTSLQLG  231



>ref|XP_001779871.1| MIKCC MADS-domain protein PpMADS1 [Physcomitrella patens]
 gb|EDQ55286.1| MIKCC MADS-domain protein PpMADS1 [Physcomitrella patens]
Length=283

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 94/234 (40%), Positives = 137/234 (59%), Gaps = 8/234 (3%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN  SRQVTFSKRR GLLKKA EL++LCDAEVA++IFSST K FE++S+
Sbjct  1     MGRGKIEIKKIENTTSRQVTFSKRRGGLLKKAHELAVLCDAEVALVIFSSTGKHFEFASS  60

Query  516   -SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMG  692
              SM+  + RY K  D             +  +EV  L  ++  L+S Q  +LG+DL+ + 
Sbjct  61    GSMRDIIERYRKSSDGAVK---RGTNTDLLGREVIKLKQQVERLESSQRHMLGEDLSALK  117

Query  693   LNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPS  872
             +++L +LE +LD     ++ RK QL+LE++E+ R++E   ++ NE LR++I +  G   +
Sbjct  118   VSDLLELEQQLDQGASRVRARKNQLILEEIEDLRRKEHELMIANEALRKKIADAEGAAEA  177

Query  873   NVSMPMPTPYLEY-YPVLKNCSSGKDGAESLNTGC---DDDLDNEVSDTTLQLG  1022
                   P   LE   P   + S     +  L        + L  + S T+LQLG
Sbjct  178   AARANFPDARLESPKPFASDFSRDMSVSSQLAASVYPHPNLLQAQRSQTSLQLG  231



>ref|NP_001288330.1| MADS-box transcription factor 27-like [Brachypodium distachyon]
 gb|AIG21836.1| MADS-box transcription factor 27 [Brachypodium distachyon]
Length=240

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 87/203 (43%), Positives = 127/203 (63%), Gaps = 16/203 (8%)
 Frame = +3

Query  336  MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
            MGRGKI I+ I+N  SRQVTFSKRR+G+ KKA+EL+ILCDAEV ++IFSST +L+EYSST
Sbjct  1    MGRGKIVIRRIDNSTSRQVTFSKRRNGIFKKAKELAILCDAEVGLMIFSSTGRLYEYSST  60

Query  516  SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMGL  695
            SMK  + RY K  D  +       + K   +E   L  ++  L+    QL+G+DL+G+ +
Sbjct  61   SMKSVIDRYGKTKDEQQVVANPNSELKFWQREAASLRQQLHNLQENHRQLMGEDLSGLNV  120

Query  696  NELRQLEHKLDGALLAIKGRKEQLLLEQL-ENSRK-----QEERALV--------ENENL  833
             EL+ +E++L+ ++  ++ +K+QLL +++ E +RK     QE   L         EN  L
Sbjct  121  KELQSIENQLEISIRGVRTKKDQLLFDEIHELNRKGSMVHQENMELYKKISLIGQENAEL  180

Query  834  RRQIEELRGLVPSNVSMPMPTPY  902
             ++I E  G  PS V+   PTPY
Sbjct  181  YKKIYEAEG--PSEVNQDSPTPY  201



>gb|AAC97146.1| AGAMOUS-like MADS-box transcription factor SMADS42B [Picea mariana]
 gb|AAC97158.1| AGAMOUS-like MADS-box transcriptional factor SMADS42C [Picea 
mariana]
Length=222

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 136/232 (59%), Gaps = 13/232 (6%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN  +RQVTF KRR+GLLKKA ELS+LCDAEVA+I+FSS  +L+E+++ 
Sbjct  1     MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEFANH  60

Query  516   SMKHTLSRYNK-CLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMG  692
             S+K T+ RY K C+D+     I E   +   +E   L  +I  L++    L+G  LT + 
Sbjct  61    SVKRTIERYKKTCVDNNHGGAISESNSQYWQQEAGKLRQQIEILQNANRHLMGDGLTALN  120

Query  693   LNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPS  872
             + EL+QLE +L+  +  ++ +K ++LLE+++  +++E   + ENE LR +I E +     
Sbjct  121   IKELKQLEVRLEKGIGRVRSKKNEMLLEEIDIMQRREHILIQENEILRSKIAECQN--SH  178

Query  873   NVSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVS--DTTLQLG  1022
             N SM +  P  +  P         D    L+    D   +      TTLQLG
Sbjct  179   NTSM-LSAPEYDALPAF-------DSRNFLHANLIDAAHHYAHQEQTTLQLG  222



>ref|XP_009392819.1| PREDICTED: MADS-box transcription factor 6-like [Musa acuminata 
subsp. malaccensis]
Length=242

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 90/224 (40%), Positives = 130/224 (58%), Gaps = 4/224 (2%)
 Frame = +3

Query  336  MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
            MGRG++++K IEN  +RQVTFSKRR+GLLKKA ELS+LCDAEVA+IIFSS  K++E+ S 
Sbjct  1    MGRGRVELKRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSSRGKVYEFGSV  60

Query  516  SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMGL  695
                TL RY +C  +++   +  ++ +  ++E+  L      L+  Q  LLG+DL  + +
Sbjct  61   GTSKTLERYQRCCYTSQDSNVANREAQNWYQEMAKLKTRFESLQRSQRHLLGEDLGPLSV  120

Query  696  NELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPSN  875
             EL+QLE +L+ AL   + RK QL+L+Q+E  RK+E      N+ L+ QI E  G     
Sbjct  121  KELQQLERQLESALSQARQRKTQLMLDQMEELRKKERHLGEINKQLKEQI-EAEGATFRA  179

Query  876  VSMPM---PTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEV  998
            +  P     T     +P     SSG D   +L  G    +  EV
Sbjct  180  LQGPWCSDATAGGNAFPAQPLQSSGMDREPTLQIGYHQFVPPEV  223



>ref|XP_008459658.1| PREDICTED: agamous-like MADS-box protein AGL11 isoform X3 [Cucumis 
melo]
Length=226

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 82/186 (44%), Positives = 126/186 (68%), Gaps = 5/186 (3%)
 Frame = +3

Query  336  MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
            MGRGKI+IK IEN  +RQVTF KRR+GLLKKA ELS+LCDAEVA+I+FSS  +L+EYS+ 
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSNN  60

Query  516  SMKHTLSRYNK-CLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMG  692
            S+K T+ RY K C DS+ T  + E   +   +E   L  +I  L++    L+G  L+ + 
Sbjct  61   SIKTTIERYKKACSDSSATSSVTELNTQYYQQESAKLRQQIQMLQNSNRHLMGDSLSALT  120

Query  693  LNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENEN--LRRQIEELRGLV  866
            + EL+QLE++L+  +  I+ +K ++LL ++E  +K+E    +ENEN  +R +I E+  + 
Sbjct  121  VKELKQLENRLERGITRIRSKKHEMLLAEIEYLQKRE--IELENENVCIRTKIAEVERVQ  178

Query  867  PSNVSM  884
             +N+++
Sbjct  179  QANMAV  184



>gb|ACI23561.1| agamous-like protein 2 [Gossypium barbadense]
Length=244

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 79/174 (45%), Positives = 117/174 (67%), Gaps = 0/174 (0%)
 Frame = +3

Query  330  KKMGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYS  509
            KKMGRGKI+IK IEN  +RQVTF KRR+GLLKKA ELS+LCDAEVA+I+FSS  +L+EY+
Sbjct  14   KKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYA  73

Query  510  STSMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGM  689
            + S+K T+ RY K  DS+ T  + E   +   +E + L N+I  L++    +LG+ + G+
Sbjct  74   NNSVKATIERYKKASDSSNTGSVAEVNAQFYQQEADKLRNQIRNLQNTNRHMLGESVGGL  133

Query  690  GLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEE  851
             + EL+ LE +L+  +  I+ +K +LL  ++E  +K+E      N+ LR +I E
Sbjct  134  PMKELKSLESRLEKGISRIRSKKNELLFAEIEYMQKKEIDLHNNNQLLRAKIAE  187



>gb|AGW23350.1| MADS box protein MADS48 [Gossypium hirsutum]
Length=247

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 90/216 (42%), Positives = 130/216 (60%), Gaps = 15/216 (7%)
 Frame = +3

Query  336  MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEY-SS  512
            MGRG++++K IEN  +RQVTF+KRR+GLLKKA ELS+LCDAE A+I+FS+  KL+E+ SS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEAALIVFSNRGKLYEFCSS  60

Query  513  TSMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMG  692
             SM  TL +Y KC  ST        + +  ++E   L   +  L++ Q  LLG+DL  + 
Sbjct  61   PSMTKTLEKYQKCSYSTLDNSSSISETQNSYQEYLKLKARVEVLQTSQRNLLGEDLGPLD  120

Query  693  LNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPS  872
              EL QLEH+L+ +L  I+  K Q +L+QL +   +E+     N++LRR++EEL   VP 
Sbjct  121  SKELDQLEHQLEASLKQIRSTKVQAMLDQLNDLHNREKLLTDANKSLRRKLEELSTQVPQ  180

Query  873  -----NVSMPMPTPYLE---------YYPVLKNCSS  938
                 N+  P   PY           ++P+  NCSS
Sbjct  181  GPAWDNIGGPCIPPYNHLTEAQSEAFFHPLGANCSS  216



>ref|XP_002874596.1| hypothetical protein ARALYDRAFT_489841 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50855.1| hypothetical protein ARALYDRAFT_489841 [Arabidopsis lyrata subsp. 
lyrata]
Length=230

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 77/174 (44%), Positives = 120/174 (69%), Gaps = 1/174 (1%)
 Frame = +3

Query  336  MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
            MGRGKI+IK IEN  +RQVTF KRR+GLLKKA ELS+LCDAEVA+I+FS+  +L+EY++ 
Sbjct  1    MGRGKIEIKRIENSTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYANN  60

Query  516  SMKHTLSRYNK-CLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMG  692
            +++ T+ RY K C DST T  + E       +E   L  +I  +++    L+G+ L+ + 
Sbjct  61   NIRSTIERYKKACSDSTNTSTVQEINAAYYQQESAKLRQQIQTIQNSNRNLMGESLSSLS  120

Query  693  LNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEEL  854
            + EL+Q+E++L+ A+  I+ +K +LLL ++EN++K+E     EN  LR ++ E+
Sbjct  121  VKELKQVENRLEKAISRIRSKKHELLLVEIENAQKREIELDNENIYLRTKVAEV  174



>gb|AAS55893.1| MIKC-type MADS-box protein [Physcomitrella patens]
Length=281

 Score =   145 bits (366),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 94/234 (40%), Positives = 137/234 (59%), Gaps = 8/234 (3%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN  SRQVTFSKRR GLLKKA EL++LCDAEVA++IFSST K FE++S+
Sbjct  1     MGRGKIEIKKIENTTSRQVTFSKRRGGLLKKAHELAVLCDAEVALVIFSSTGKHFEFASS  60

Query  516   -SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMG  692
              SM+  + RY K  D             +  +EV  L  ++  L+S Q  +LG+DL+ + 
Sbjct  61    GSMRDIIERYRKNSDGAVK---RGTNTDLLGREVIKLKQQVERLESSQRHMLGEDLSALK  117

Query  693   LNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPS  872
             +++L +LE +LD     ++ RK QL+LE++E+ R++E   ++ NE LR++I +  G   +
Sbjct  118   VSDLLELEQQLDQGASRVRARKNQLILEEIEDLRRKEHELMIANEALRKKIADAEGAAEA  177

Query  873   NVSMPMPTPYLEY-YPVLKNCSSGKDGAESLNTGC---DDDLDNEVSDTTLQLG  1022
                   P   LE   P   + S     +  L        + L  + S T+LQLG
Sbjct  178   AARANFPDARLESPKPFASDFSRDMSVSSQLAASVYPHPNLLQAQRSQTSLQLG  231



>gb|ACF93432.1| MADS10 [Gossypium hirsutum]
Length=246

 Score =   144 bits (363),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 78/174 (45%), Positives = 117/174 (67%), Gaps = 0/174 (0%)
 Frame = +3

Query  330  KKMGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYS  509
            KKMGRGKI+IK IEN  +RQVTF KRR+GLLKKA ELS+LCDAEVA+++FSS  +L+EY+
Sbjct  14   KKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVVFSSRGRLYEYA  73

Query  510  STSMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGM  689
            + S+K T+ RY K  DS+ T  + E   +   +E + L N+I  L++    +LG+ + G+
Sbjct  74   NNSVKATIERYKKASDSSNTGSVAEVNARFYQQEADKLRNQIRNLQNANRHMLGESIGGL  133

Query  690  GLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEE  851
             + EL+ LE +L+  +  I+ +K +LL  ++E  +K+E      N+ LR +I E
Sbjct  134  PMKELKSLESRLEKGISRIRSKKNELLFAEIEYMQKREIDLHNNNQLLRAKIAE  187



>gb|EEC73475.1| hypothetical protein OsI_07801 [Oryza sativa Indica Group]
 gb|EEE57251.1| hypothetical protein OsJ_07263 [Oryza sativa Japonica Group]
Length=235

 Score =   144 bits (362),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 84/203 (41%), Positives = 128/203 (63%), Gaps = 16/203 (8%)
 Frame = +3

Query  336  MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
            MGRGKI I+ I+N  SRQVTFSKRR+G+ KKA+EL+ILCDAEV ++IFSST +L+EYSST
Sbjct  1    MGRGKIVIRRIDNSTSRQVTFSKRRNGIFKKAKELAILCDAEVGLMIFSSTGRLYEYSST  60

Query  516  SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMGL  695
            SMK  + RY K  D  +       + K   +E   L  ++  L+    QL+G+DL+G+ +
Sbjct  61   SMKSVIDRYGKSKDEQQAVANPNSELKFWQREAASLRQQLHNLQENHRQLMGEDLSGLNV  120

Query  696  NELRQLEHKLDGALLAIKGRKEQLLLEQL------------ENSRKQEERALVENEN--L  833
             EL+ LE++L+ +L +++ +K+ +L++++            EN    ++ +L+  EN  L
Sbjct  121  KELQSLENQLEISLRSVRTKKDHVLIDEIHELNRKGSLVHQENMELYKKISLIRQENAEL  180

Query  834  RRQIEELRGLVPSNVSMPMPTPY  902
             ++I E  G  PS V+   PTPY
Sbjct  181  YKKIYETEG--PSEVNRDSPTPY  201



>gb|AIE44767.1| putative MADS-domain transcription factor AGL6.1 [Nuphar advena]
Length=246

 Score =   144 bits (363),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 96/251 (38%), Positives = 145/251 (58%), Gaps = 17/251 (7%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRG++++K IEN  +RQVTFSKRR+GLLKKA ELS+LCDAEVA+I+FSS  KL+E+ S 
Sbjct  1     MGRGRVELKRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIVFSSRGKLYEFGSA  60

Query  516   SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMGL  695
              +  T+ RY +C  +     I  ++ +  ++EV  L      L+  Q  LLG+DL  + +
Sbjct  61    GLSKTIERYQRCNYNPLDNNISVRETQNWYQEVAKLKARYEALQRSQRHLLGEDLGPLSV  120

Query  696   NELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPSN  875
              EL+QLE +L+ AL   + RK Q+++EQ++  RK+E      N+ L+ Q+E  +G V   
Sbjct  121   KELQQLERQLETALSQARQRKTQIMMEQMDELRKKERHLGDVNKQLKNQLES-QGHVFR-  178

Query  876   VSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVSDTTLQLG-----PPTGSC  1040
              SMP  +   E   V+ N S   + A++ +  C         + TLQ+G     PP G+ 
Sbjct  179   -SMPGSSSSWESGVVVGNNSLNMNAAQANHIDC---------EPTLQIGYHQFVPPDGTS  228

Query  1041  RKRKTPDQETH  1073
                +T   E +
Sbjct  229   NIARTVAAENN  239



>gb|AAD09342.1| MADS box protein [Pinus radiata]
Length=222

 Score =   143 bits (361),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 89/232 (38%), Positives = 136/232 (59%), Gaps = 13/232 (6%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN  +RQVTF KRR+GLLKKA ELS+LCDAEVA+I+FSS  +L+E+++ 
Sbjct  1     MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEFANH  60

Query  516   SMKHTLSRYNK-CLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMG  692
             S+K T+ RY K C+D+     I E   +   +E   L  +I  L++    L+G  LT + 
Sbjct  61    SVKRTIERYKKTCVDNNHGGAISESNSQYWQQEAGKLRQQIDILQNANRHLMGDGLTALN  120

Query  693   LNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPS  872
             + EL+QLE +L+  +  ++ +K ++LLE+++  +++E   + ENE LR +I E +    +
Sbjct  121   IKELKQLEVRLEKGISRVRSKKNEMLLEEIDIMQRREHILIQENEILRSKIAECQNSHNT  180

Query  873   NVSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVS--DTTLQLG  1022
             N+   +  P  +  P         D    L+    D   +      TTLQLG
Sbjct  181   NM---LSAPEYDALPAF-------DSRNFLHANLIDAAHHYAHQEQTTLQLG  222



>gb|AAD01266.1| MADS box transcription factor [Pinus resinosa]
Length=222

 Score =   143 bits (361),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 89/232 (38%), Positives = 136/232 (59%), Gaps = 13/232 (6%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN  +RQVTF KRR+GLLKKA ELS+LCDAEVA+I+FSS  +L+E+++ 
Sbjct  1     MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEFANH  60

Query  516   SMKHTLSRYNK-CLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMG  692
             S+K T+ RY K C+D+     I E   +   +E   L  +I  L++    L+G  LT + 
Sbjct  61    SVKRTIERYKKTCVDNNHGGAISESNSQYWQQEAGKLRQQIEILQNANRHLMGDGLTALN  120

Query  693   LNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPS  872
             + EL+QLE +L+  +  ++ +K ++LLE+++  +++E   + ENE LR +I E +    +
Sbjct  121   IKELKQLEVRLEKGISRVRSKKNEMLLEEIDIMQRREHILIQENEILRSKIAECQNSHNT  180

Query  873   NVSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVS--DTTLQLG  1022
             N+   +  P  +  P         D    L+    D   +      TTLQLG
Sbjct  181   NM---LSAPEYDALPAF-------DSRNFLHANLIDAAHHYAHQEQTTLQLG  222



>gb|AFI23876.1| AGAMOUS1 [Thalictrum thalictroides]
 gb|AFO38186.1| AGAMOUS1 [Thalictrum thalictroides]
Length=225

 Score =   143 bits (361),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 93/239 (39%), Positives = 136/239 (57%), Gaps = 24/239 (10%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN  +RQVTF KRR+GLLKKA ELS+LC+AEVA+I+FSS  +L+EYS+ 
Sbjct  1     MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCEAEVALIVFSSRGRLYEYSNN  60

Query  516   SMKHTLSRYNKC-LDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMG  692
             S+K T+ RY K   DS  +  + E   +   +E   L N+I+ L++    LLG+ L+ + 
Sbjct  61    SVKKTIERYKKASTDSPNSGSVSEANVQFYQQEASKLRNQIASLQNHNRNLLGESLSNLN  120

Query  693   LNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIE------EL  854
             + EL+Q+E K++G +  I+ +K +LL  ++E  +K+E     +N+ LR  I       E 
Sbjct  121   IRELKQIEKKIEGGISKIRAKKNELLFAEIEYMQKREIDLQTDNKYLRAMIAANERAPEH  180

Query  855   RGLVPSN---VSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVSDTTLQLG  1022
               L+P+N   V    P     + P         +  +  N  C  D       TTLQLG
Sbjct  181   MNLMPANEYHVMSSAPFDSRNFMPA--------NLLDHNNNYCRSD------QTTLQLG  225



>dbj|BAD93174.1| MADS-box transcription factor GbMADS10 [Ginkgo biloba]
Length=229

 Score =   143 bits (361),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 86/187 (46%), Positives = 120/187 (64%), Gaps = 6/187 (3%)
 Frame = +3

Query  336  MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSS-  512
            MGRGKI+IK IEN  +RQVTFSKRR GLLKKA ELS+LCDAE+ +IIFSST KLFEYSS 
Sbjct  1    MGRGKIEIKRIENTTNRQVTFSKRRGGLLKKAHELSVLCDAELGLIIFSSTGKLFEYSSA  60

Query  513  -TSMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGM  689
             +SM+  + RY K        ++ E   +    E+  + NE  +L++    +LG+DLT +
Sbjct  61   TSSMRKIIERYQK----VSGARLSEFDNQHLFCEMTRIKNENEKLQTSIRHMLGEDLTSL  116

Query  690  GLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVP  869
             + EL  LE +L+ A   ++ RK QL+L+QL+N R++E     +N +L R + E +  V 
Sbjct  117  TMTELHHLEQQLEVAANRVRTRKNQLMLQQLDNLRRKERLLEEQNSHLCRLLAEHQAAVE  176

Query  870  SNVSMPM  890
              V+ PM
Sbjct  177  GVVAEPM  183



>ref|NP_001267506.1| agamous-like MADS-box protein AGL11-like [Cucumis sativus]
 gb|AAD01742.1| agamous-like putative transcription factor [Cucumis sativus]
Length=225

 Score =   143 bits (360),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 82/184 (45%), Positives = 124/184 (67%), Gaps = 5/184 (3%)
 Frame = +3

Query  336  MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
            MGRGKI+IK IEN  +RQVTF KRR+GLLKKA ELS+LCDAEVA+I+FSS  +L+EYS+ 
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSNN  60

Query  516  SMKHTLSRYNK-CLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMG  692
            S+K T+ RY K C DS+ T  + E   +   +E   L  +I  L++    L+G  L+ + 
Sbjct  61   SIKTTIERYKKACSDSSATSSVTELNTQYYQQESAKLRQQIQMLQNSNRHLMGDSLSALT  120

Query  693  LNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENEN--LRRQIEELRGLV  866
            + EL+QLE++L+  +  I+ +K ++LL ++E  +K+E    +ENEN  +R +I E+  + 
Sbjct  121  VKELKQLENRLERGITRIRSKKHEMLLAEIEYLQKRE--IELENENVCIRTKIAEVERVQ  178

Query  867  PSNV  878
             +N+
Sbjct  179  QANM  182



>sp|Q40885.1|AG_PETHY RecName: Full=Floral homeotic protein AGAMOUS; AltName: Full=pMADS3 
[Petunia x hybrida]
 emb|CAA51417.1| pMADS3 [Petunia x hybrida]
Length=242

 Score =   144 bits (362),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 83/196 (42%), Positives = 122/196 (62%), Gaps = 6/196 (3%)
 Frame = +3

Query  330  KKMGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYS  509
            +K+GRGKI+IK IEN  +RQVTF KRR+GLLKKA ELS+LCDAEVA+I+FSS  +L+EY+
Sbjct  15   RKLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYA  74

Query  510  STSMKHTLSRYNK-CLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTG  686
            + S+K T+ RY K C DS+ T  I E   +   +E   L  +I  L+++    LG+ L  
Sbjct  75   NNSVKATIERYKKACSDSSNTGSIAEANAQYYQQEASKLRAQIGNLQNQNRNFLGESLAA  134

Query  687  MGLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELR---  857
            + L +LR LE K++  +  I+ +K +LL  ++E  +K+E      N+ LR +I E     
Sbjct  135  LNLRDLRNLEQKIEKGISKIRAKKNELLFAEIEYMQKREIDLHNNNQYLRAKIAETERSQ  194

Query  858  --GLVPSNVSMPMPTP  899
               L+P + S  +  P
Sbjct  195  QMNLMPGSSSYDLVPP  210



>ref|XP_009347901.1| PREDICTED: MADS-box protein SOC1-like [Pyrus x bretschneideri]
 ref|XP_009347902.1| PREDICTED: MADS-box protein SOC1-like [Pyrus x bretschneideri]
 ref|XP_009347903.1| PREDICTED: MADS-box protein SOC1-like [Pyrus x bretschneideri]
Length=239

 Score =   143 bits (361),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 100/251 (40%), Positives = 146/251 (58%), Gaps = 26/251 (10%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             M RGKI++K IEN  SRQVTFSKRR+GLLKKA ELS+LCDAEVAVIIFS  DKL+E+ S+
Sbjct  1     MVRGKIEMKRIENATSRQVTFSKRRNGLLKKAYELSVLCDAEVAVIIFSQKDKLYEFCSS  60

Query  516   SMKHTLSRYNK-CLDSTETPKIvekkpkve-hkevevLNNEISELKSKQLQLLGKDLTGM  689
              M+ TL+RY K   D  +T K+  ++       E  ++  +I  L++ Q +LLG DL   
Sbjct  61    DMRETLTRYRKYAKDHEQTNKVEVEQHVQHLKYESAIMAKKIEILEATQRKLLGNDLDSC  120

Query  690   GLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVP  869
              + EL+++  +L+ +L +I+ RK QL +EQ+E  + +E   L EN  LR+Q         
Sbjct  121   LVEELQEMSSQLERSLRSIRERKAQLFMEQMEQLKAKETLLLQENAKLRQQ---------  171

Query  870   SNVSMPMPTPYLEYYPVLKNCSSG----KDG-AESLNTGCDDDLDNEVSDTTLQLGPP--  1028
             S   +     ++E+    K  S+     K G + S+N      + +EV +T L +GPP  
Sbjct  172   SGAKL-----WMEHSAQEKGASTSLSYEKAGVSASVNYRSQGSMSSEV-ETELFIGPPIM  225

Query  1029  --TGSCRKRKT  1055
                G+ + R T
Sbjct  226   RAVGASQPRST  236



>ref|NP_001047230.1| Os02g0579600 [Oryza sativa Japonica Group]
 sp|Q6EP49.2|MAD27_ORYSJ RecName: Full=MADS-box transcription factor 27; AltName: Full=OsMADS27; 
AltName: Full=RMADS218 [Oryza sativa Japonica Group]
 gb|AAO47706.1| transcription factor MADS27 [Oryza sativa Japonica Group]
 dbj|BAF09144.1| Os02g0579600 [Oryza sativa Japonica Group]
Length=240

 Score =   143 bits (361),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 84/203 (41%), Positives = 128/203 (63%), Gaps = 16/203 (8%)
 Frame = +3

Query  336  MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
            MGRGKI I+ I+N  SRQVTFSKRR+G+ KKA+EL+ILCDAEV ++IFSST +L+EYSST
Sbjct  1    MGRGKIVIRRIDNSTSRQVTFSKRRNGIFKKAKELAILCDAEVGLMIFSSTGRLYEYSST  60

Query  516  SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMGL  695
            SMK  + RY K  D  +       + K   +E   L  ++  L+    QL+G+DL+G+ +
Sbjct  61   SMKSVIDRYGKSKDEQQAVANPNSELKFWQREAASLRQQLHNLQENHRQLMGEDLSGLNV  120

Query  696  NELRQLEHKLDGALLAIKGRKEQLLLEQL------------ENSRKQEERALVENEN--L  833
             EL+ LE++L+ +L +++ +K+ +L++++            EN    ++ +L+  EN  L
Sbjct  121  KELQSLENQLEISLRSVRTKKDHVLIDEIHELNRKGSLVHQENMELYKKISLIRQENAEL  180

Query  834  RRQIEELRGLVPSNVSMPMPTPY  902
             ++I E  G  PS V+   PTPY
Sbjct  181  YKKIYETEG--PSEVNRDSPTPY  201



>gb|AAK21249.1|AF335236_1 MADS-box transcription factor FBP9 [Petunia x hybrida]
Length=245

 Score =   144 bits (362),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 93/234 (40%), Positives = 138/234 (59%), Gaps = 15/234 (6%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRG++++K IEN  +RQVTF+KRR+GLLKKA ELS+LCDAEVA+IIFSS  KL+E+ ST
Sbjct  1     MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFCST  60

Query  516   -SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMG  692
              SM  TL +Y +C  ++  P       +  + E   L   +  L+  Q  LLG+DL  + 
Sbjct  61    SSMMKTLEKYQQCSYASLDPMQSANDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGSLN  120

Query  693   LNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPS  872
               EL QLEH+LD +L  I+ +K Q +L+QL + +++E+     N+ LRR++EE    +P 
Sbjct  121   SKELEQLEHQLDSSLKQIRSKKTQHMLDQLADLQQKEQMLAEANKQLRRKLEESAARIPL  180

Query  873   NVSM-----PM------PTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVS  1001
              +S      PM      P     + P+  N SS + G   +     ++++N VS
Sbjct  181   RLSWDNGGQPMQHNRLPPQTEGFFQPLGLNSSSPQFGYSPMGA---NEVNNAVS  231



>ref|NP_192734.1| agamous-like MADS-box protein AGL11 [Arabidopsis thaliana]
 sp|Q38836.1|AGL11_ARATH RecName: Full=Agamous-like MADS-box protein AGL11; AltName: Full=Protein 
SEEDSTICK [Arabidopsis thaliana]
 gb|AAC49080.1| MADS-box protein AGL11 [Arabidopsis thaliana]
 emb|CAB39620.1| MADS-box protein AGL11 [Arabidopsis thaliana]
 emb|CAB78119.1| MADS-box protein AGL11 [Arabidopsis thaliana]
 gb|AAM64757.1| MADS-box protein AGL11 [Arabidopsis thaliana]
 gb|AEE82817.1| agamous-like MADS-box protein AGL11 [Arabidopsis thaliana]
Length=230

 Score =   143 bits (360),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 77/174 (44%), Positives = 119/174 (68%), Gaps = 1/174 (1%)
 Frame = +3

Query  336  MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
            MGRGKI+IK IEN  +RQVTF KRR+GLLKKA ELS+LCDAEVA+I+FS+  +L+EY++ 
Sbjct  1    MGRGKIEIKRIENSTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYANN  60

Query  516  SMKHTLSRYNK-CLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMG  692
            +++ T+ RY K C DST T  + E       +E   L  +I  +++    L+G  L+ + 
Sbjct  61   NIRSTIERYKKACSDSTNTSTVQEINAAYYQQESAKLRQQIQTIQNSNRNLMGDSLSSLS  120

Query  693  LNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEEL  854
            + EL+Q+E++L+ A+  I+ +K +LLL ++EN++K+E     EN  LR ++ E+
Sbjct  121  VKELKQVENRLEKAISRIRSKKHELLLVEIENAQKREIELDNENIYLRTKVAEV  174



>gb|KHG12869.1| Floral homeotic AGAMOUS -like protein [Gossypium arboreum]
 gb|KHG29394.1| Floral homeotic AGAMOUS -like protein [Gossypium arboreum]
Length=246

 Score =   144 bits (362),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 78/174 (45%), Positives = 117/174 (67%), Gaps = 0/174 (0%)
 Frame = +3

Query  330  KKMGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYS  509
            KKMGRGKI+IK IEN  +RQVTF KRR+GLLKKA ELS+LCDAEVA+I+FS+  +L+EY+
Sbjct  14   KKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSNRGRLYEYA  73

Query  510  STSMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGM  689
            + S+K T+ RY K  DS+ T  + E   +   +E + L N+I  L++    +LG+ + G+
Sbjct  74   NNSVKATIERYKKASDSSNTGSVAEVNAQFYQQEADKLRNQIRNLQNANRHMLGESIGGL  133

Query  690  GLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEE  851
             + EL+ LE +L+  +  I+ +K +LL  ++E  +K+E      N+ LR +I E
Sbjct  134  PMKELKSLESRLEKGISRIRSKKNELLFAEIEYMQKREIDLHNNNQLLRAKIAE  187



>gb|AAC97157.1| AGAMOUS-like MADS-box transcriptional factor SAG1a [Picea mariana]
Length=222

 Score =   143 bits (360),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 89/232 (38%), Positives = 136/232 (59%), Gaps = 13/232 (6%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN  +RQVTF KRR+GLLKKA ELS+LCDAEVA+I+FSS  +L+E+++ 
Sbjct  1     MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEFANH  60

Query  516   SMKHTLSRYNK-CLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMG  692
             S+K T+ RY K C+D+     I E   +   +E   L  +I  L++    L+G  LT + 
Sbjct  61    SVKRTIERYKKTCVDNNHGGAISESNSQYWQQEAGKLRQQIEILQNANRHLMGDGLTALN  120

Query  693   LNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPS  872
             + EL+QLE +L+  +  ++ +K ++LLE+++  +++E   + ENE LR +I E +    +
Sbjct  121   IKELKQLEVRLEKGIGRVRSKKNEMLLEEIDIMQRREHILIQENEILRSKIAECQNSHNT  180

Query  873   NVSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVS--DTTLQLG  1022
             N+   +  P  +  P         D    L+    D   +      TTLQLG
Sbjct  181   NM---LSAPEYDALPAF-------DSRNFLHANLIDAAHHYAHQEQTTLQLG  222



>gb|AAS45683.1| AGAMOUS-like protein [Thalictrum dioicum]
Length=226

 Score =   143 bits (360),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 139/232 (60%), Gaps = 9/232 (4%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN  +RQVTF KRR+GLLKKA ELS+LC+AEVA+++FSS  +L+EYS+ 
Sbjct  1     MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCEAEVALVVFSSRGRLYEYSNN  60

Query  516   SMKHTLSRYNKC-LDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMG  692
             S+K T+ RY K   DS  +  + E   +   +E   + N+I+ L++    LLG+ L+ + 
Sbjct  61    SVKKTIERYKKASTDSPNSGSVYEANVQFYQQEASKMRNQIASLQNHNRNLLGESLSNLN  120

Query  693   LNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPS  872
             + ELRQ+E K++G +  I+ +K +LL  ++E  +K+E     +N+ L   I     + P 
Sbjct  121   IRELRQIEKKIEGGISKIRAKKNELLFSEIEYMQKREIDLQTDNKYLGAMIAANERVPPE  180

Query  873   NVSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDN--EVSDTTLQLG  1022
             ++++ MP    EY+ +    S+  D    L     D  +N      TTLQLG
Sbjct  181   HMNL-MPAN--EYHIM---SSAPFDSRNFLPANLLDHNNNYSHSDQTTLQLG  226



>ref|XP_006286826.1| hypothetical protein CARUB_v10003771mg [Capsella rubella]
 gb|EOA19724.1| hypothetical protein CARUB_v10003771mg [Capsella rubella]
Length=230

 Score =   143 bits (360),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 77/174 (44%), Positives = 118/174 (68%), Gaps = 1/174 (1%)
 Frame = +3

Query  336  MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
            MGRGKI+IK IEN  +RQVTF KRR+GLLKKA ELS+LCDAEVA+I+FS+  +L+EY++ 
Sbjct  1    MGRGKIEIKRIENSTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYANN  60

Query  516  SMKHTLSRYNK-CLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMG  692
            +++ T+ RY K C DST T  + E       +E   L  +I  +++    L+G  L+ + 
Sbjct  61   NIRSTIERYKKACSDSTNTSTVQEINAAYYQQESAKLRQQIQTIQNSNRNLMGDSLSALS  120

Query  693  LNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEEL  854
            + EL+Q+E++L+ A+  I+ +K +LLL ++EN +K+E     EN  LR ++ E+
Sbjct  121  VKELKQVENRLEKAISRIRSKKHELLLAEIENMQKREIELDNENIYLRTKVAEV  174



>ref|XP_010437821.1| PREDICTED: agamous-like MADS-box protein AGL11 isoform X2 [Camelina 
sativa]
Length=248

 Score =   143 bits (361),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 78/178 (44%), Positives = 119/178 (67%), Gaps = 1/178 (1%)
 Frame = +3

Query  324  KGKKMGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFE  503
            K   MGRGKI+IK IEN  +RQVTF KRR+GLLKKA ELS+LCDAEVA+I+FS+  +L+E
Sbjct  14   KSSVMGRGKIEIKRIENSTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYE  73

Query  504  YSSTSMKHTLSRYNK-CLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDL  680
            Y++ +++ T+ RY K C DST T  + E       +E   L  +I  +++    L+G  L
Sbjct  74   YANNNIRSTIERYKKACSDSTNTSTVQEINAAYYQQESAKLRQQIQTIQNSNRNLMGDSL  133

Query  681  TGMGLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEEL  854
            + + + EL+Q+E++L+ A+  I+ +K +LLL ++EN +K+E     EN  LR ++ E+
Sbjct  134  SSLSVKELKQVENRLEKAISRIRSKKHELLLAEIENMQKREIELDNENIYLRTKVAEV  191



>gb|ACD76823.1| SEEDSTICK-like protein [Capsella bursa-pastoris]
Length=230

 Score =   143 bits (360),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 77/174 (44%), Positives = 118/174 (68%), Gaps = 1/174 (1%)
 Frame = +3

Query  336  MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
            MGRGKI+IK IEN  +RQVTF KRR+GLLKKA ELS+LCDAEVA+I+FS+  +L+EY++ 
Sbjct  1    MGRGKIEIKRIENSTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYANN  60

Query  516  SMKHTLSRYNK-CLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMG  692
            +++ T+ RY K C DST T  + E       +E   L  +I  +++    L+G  L+ + 
Sbjct  61   NIRSTIERYKKACSDSTNTSTVQEINAAYYQQESAKLRQQIQTIQNSNRNLMGDSLSALS  120

Query  693  LNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEEL  854
            + EL+Q+E++L+ A+  I+ +K +LLL ++EN +K+E     EN  LR ++ E+
Sbjct  121  VKELKQVENRLEKAISRIRSKKHELLLAEIENMQKREIELDNENIYLRTKVAEV  174



>ref|NP_001078364.1| agamous-like MADS-box protein AGL11 [Arabidopsis thaliana]
 gb|AEE82818.1| agamous-like MADS-box protein AGL11 [Arabidopsis thaliana]
Length=256

 Score =   144 bits (362),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 77/175 (44%), Positives = 120/175 (69%), Gaps = 1/175 (1%)
 Frame = +3

Query  333  KMGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSS  512
            +MGRGKI+IK IEN  +RQVTF KRR+GLLKKA ELS+LCDAEVA+I+FS+  +L+EY++
Sbjct  26   RMGRGKIEIKRIENSTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYAN  85

Query  513  TSMKHTLSRYNK-CLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGM  689
             +++ T+ RY K C DST T  + E       +E   L  +I  +++    L+G  L+ +
Sbjct  86   NNIRSTIERYKKACSDSTNTSTVQEINAAYYQQESAKLRQQIQTIQNSNRNLMGDSLSSL  145

Query  690  GLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEEL  854
             + EL+Q+E++L+ A+  I+ +K +LLL ++EN++K+E     EN  LR ++ E+
Sbjct  146  SVKELKQVENRLEKAISRIRSKKHELLLVEIENAQKREIELDNENIYLRTKVAEV  200



>ref|XP_009421278.1| PREDICTED: MADS-box transcription factor 3-like [Musa acuminata 
subsp. malaccensis]
Length=222

 Score =   142 bits (359),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 81/200 (41%), Positives = 125/200 (63%), Gaps = 15/200 (8%)
 Frame = +3

Query  336  MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
            MGRGKI+IK IEN  +RQVTF KRR+GLLKKA ELS+LCDAEVA+++FS+  +L+EY+++
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVVFSTRGRLYEYANS  60

Query  516  SMKHTLSRYNK-CLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMG  692
            S+K T+ RY K C D+T T  +     +    E   L  +I+ ++S    L+G+ L+ M 
Sbjct  61   SVKATIERYKKACSDTTGTGSLSVVNAQHYQLESAKLRQQINNIQSTNRNLMGEALSSMS  120

Query  693  LNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQE----------ERALVENENLRRQ  842
            L +L+QLE+KL+  +  I+ +K +LL  ++E  +K+E             + ENE  ++Q
Sbjct  121  LRDLKQLENKLEKGISKIRTKKNELLHAEIEYMQKREMELQNDNMYLRNKITENERAQQQ  180

Query  843  IEELRGLVPSNVSMPMPTPY  902
            I     ++PS     + TP+
Sbjct  181  I----NMLPSTSEYEILTPF  196



>ref|XP_001769862.1| MIKCC MADS-domain protein PPM1 [Physcomitrella patens]
 gb|AAG09135.1|AF150931_1 MADS-domain protein PPM1 [Physcomitrella patens]
 gb|EDQ65424.1| MIKCC MADS-domain protein PPM1 [Physcomitrella patens]
Length=283

 Score =   144 bits (363),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 97/231 (42%), Positives = 144/231 (62%), Gaps = 6/231 (3%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN  SRQVTFSKRR GLLKKA EL++LCDAEVA++IFSST KLFEY+S+
Sbjct  1     MGRGKIEIKKIENTTSRQVTFSKRRGGLLKKAHELAVLCDAEVALVIFSSTGKLFEYASS  60

Query  516   -SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMG  692
              SM+  + RY K  +                +EV  L  ++  LKS Q ++LG+DL+ + 
Sbjct  61    GSMRDIIERYKKSPNGAMK---SGASTDFLGREVVKLQEQVERLKSSQRRMLGEDLSALK  117

Query  693   LNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPS  872
             + +L QLE +LD     ++ RK QL+LE++E  +K+E+  +V NE+LR++I +   +  +
Sbjct  118   VPDLLQLEQQLDLGASRVRARKNQLILEEIEGLQKKEQELMVANEDLRKKIADAEAVARA  177

Query  873   NVSMPMP-TPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVSDTTLQLG  1022
             N+S   P +P      + ++ S+    A ++    +   D + S T+LQLG
Sbjct  178   NLSEARPESPRHLARTLSRDVSASSHPAATVYPHPNLR-DVQRSQTSLQLG  227



>gb|AHM92097.1| MADS-box protein 21 [Erycina pusilla]
Length=233

 Score =   143 bits (360),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 84/200 (42%), Positives = 125/200 (63%), Gaps = 10/200 (5%)
 Frame = +3

Query  333  KMGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSS  512
            KMGRGKI+IK IEN  +RQVTF KRR+GLLKKA ELS+LCDAEVA++IFSS  +L+EY++
Sbjct  6    KMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVIFSSRGRLYEYAN  65

Query  513  TSMKHTLSRYNK-CLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGM  689
             S+K T+ RY K C D++ T  I E   +   +E   L  +I+ L++    LLG  LT M
Sbjct  66   NSVKGTIDRYKKACTDNSSTGSISEANSQYYQQEATKLRQQITNLQNSNRNLLGDALTTM  125

Query  690  GLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQI--------  845
             L +L+QLE +L+  +  I+ +K +LL  +++  +K+E     +N  LR +I        
Sbjct  126  SLRDLKQLETRLEKGINKIRSKKNELLHAEIDYMQKREMELQTDNMYLRNKIADNERVQQ  185

Query  846  -EELRGLVPSNVSMPMPTPY  902
             +++  L  ++    + TPY
Sbjct  186  HQQMSILPSTSTDYEVMTPY  205



>ref|XP_008783531.1| PREDICTED: MADS-box transcription factor 6-like [Phoenix dactylifera]
Length=242

 Score =   143 bits (360),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 78/171 (46%), Positives = 115/171 (67%), Gaps = 0/171 (0%)
 Frame = +3

Query  336  MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
            MGRGK+++K IEN  +RQVTFSKRR+GLLKKA ELS+LCDAEVA+IIFSS  KL+E+ S 
Sbjct  1    MGRGKVELKRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFGSV  60

Query  516  SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMGL  695
                TL RY +C  +++   I   + +  ++E+ +L  ++  L+  Q   LG+DL  + +
Sbjct  61   GTSKTLERYQRCCYASQDSNITNHEAQSWYQEMSMLKAKVESLQRSQRHFLGEDLGPLSV  120

Query  696  NELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIE  848
             EL+QLE +L+ AL   + RK Q++L+Q+E  RK+E      N+ LR ++E
Sbjct  121  KELQQLERQLESALSQARQRKTQIMLDQIEELRKKERHLGEINKQLRNKLE  171



>ref|XP_010421900.1| PREDICTED: agamous-like MADS-box protein AGL11 isoform X3 [Camelina 
sativa]
 ref|XP_010455384.1| PREDICTED: agamous-like MADS-box protein AGL11 isoform X2 [Camelina 
sativa]
 ref|XP_010455385.1| PREDICTED: agamous-like MADS-box protein AGL11 isoform X2 [Camelina 
sativa]
Length=231

 Score =   142 bits (359),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 77/174 (44%), Positives = 118/174 (68%), Gaps = 1/174 (1%)
 Frame = +3

Query  336  MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
            MGRGKI+IK IEN  +RQVTF KRR+GLLKKA ELS+LCDAEVA+I+FS+  +L+EY++ 
Sbjct  1    MGRGKIEIKRIENSTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYANN  60

Query  516  SMKHTLSRYNK-CLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMG  692
            +++ T+ RY K C DST T  + E       +E   L  +I  +++    L+G  L+ + 
Sbjct  61   NIRSTIERYKKACSDSTNTSTVQEINAAYYQQESAKLRQQIQTIQNSNRNLMGDSLSSLS  120

Query  693  LNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEEL  854
            + EL+Q+E++L+ A+  I+ +K +LLL ++EN +K+E     EN  LR ++ E+
Sbjct  121  VKELKQVENRLEKAISRIRSKKHELLLAEIENMQKREIELDNENIYLRTKVAEV  174



>dbj|BAD93165.1| MADS-box transcription factor GbMADS1 [Ginkgo biloba]
 gb|AIC79629.1| MADS1 [Ginkgo biloba]
Length=252

 Score =   143 bits (361),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 92/254 (36%), Positives = 154/254 (61%), Gaps = 8/254 (3%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRG++ ++ IEN  +RQVTFSKRR+GLLKKA ELS+LCDAEVA+I+FS+  KL+E++S+
Sbjct  1     MGRGRVQLRRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIVFSTRGKLYEFASS  60

Query  516   SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMGL  695
             SM  TL RY KC  + +   +  ++ +  H+EV  L +++  L+  Q  LLG+DL  + +
Sbjct  61    SMNKTLERYEKCSYAVQDTNVSNREAQNWHQEVTKLKSKVELLQQSQRHLLGEDLGPLSV  120

Query  696   NELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPSN  875
              EL+QLE +L+ AL  ++ RK Q++++ ++  RK+E      N++L +++ E  G    N
Sbjct  121   KELQQLERQLEIALNHVRSRKSQVMMDLIDELRKKERLLQEVNKSLHKKLSESEG---RN  177

Query  876   VSMPMPTPYLEYYPVLKNCSSGKDGAESL-NTGCDDDLDNEVSDTTLQLGPPTGSCRKRK  1052
              +  M  P  +  P     +   +G  +L +T  + +L     + TLQ+G  +      +
Sbjct  178   ATHDMRHPTDDNGP----WNPSVNGGYALPSTQQNTNLHPVDCEPTLQIGYQSVPRESIE  233

Query  1053  TPDQETHSSNSENH  1094
              P ++TH+   +N+
Sbjct  234   PPQEQTHNQPQDNY  247



>ref|XP_010421899.1| PREDICTED: agamous-like MADS-box protein AGL11 isoform X2 [Camelina 
sativa]
 ref|XP_010455383.1| PREDICTED: agamous-like MADS-box protein AGL11 isoform X1 [Camelina 
sativa]
Length=248

 Score =   143 bits (360),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 78/178 (44%), Positives = 119/178 (67%), Gaps = 1/178 (1%)
 Frame = +3

Query  324  KGKKMGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFE  503
            K   MGRGKI+IK IEN  +RQVTF KRR+GLLKKA ELS+LCDAEVA+I+FS+  +L+E
Sbjct  14   KSSVMGRGKIEIKRIENSTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYE  73

Query  504  YSSTSMKHTLSRYNK-CLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDL  680
            Y++ +++ T+ RY K C DST T  + E       +E   L  +I  +++    L+G  L
Sbjct  74   YANNNIRSTIERYKKACSDSTNTSTVQEINAAYYQQESAKLRQQIQTIQNSNRNLMGDSL  133

Query  681  TGMGLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEEL  854
            + + + EL+Q+E++L+ A+  I+ +K +LLL ++EN +K+E     EN  LR ++ E+
Sbjct  134  SSLSVKELKQVENRLEKAISRIRSKKHELLLAEIENMQKREIELDNENIYLRTKVAEV  191



>ref|XP_009389276.1| PREDICTED: MADS-box transcription factor 6-like [Musa acuminata 
subsp. malaccensis]
 gb|ACJ64680.1| MADS-box protein MADS3 [Musa acuminata AAA Group]
Length=242

 Score =   143 bits (360),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 83/172 (48%), Positives = 113/172 (66%), Gaps = 1/172 (1%)
 Frame = +3

Query  336  MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
            MGRG++++K IEN  +RQVTFSKRR+GLLKKA ELS+LCDAEVA+IIFSS  KL+E+ S 
Sbjct  1    MGRGRVELKRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFGSV  60

Query  516  SMKHTLSRYNKCLDSTETPKIvekkpkveh-kevevLNNEISELKSKQLQLLGKDLTGMG  692
             M  TL RY     +++ P +V +       +E+  L  +   L+  Q  LLG+DL  + 
Sbjct  61   GMSKTLERYQHWCYASQDPNVVNRDNAQNWCQEMSKLKAKFESLQRSQRHLLGEDLGPLS  120

Query  693  LNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIE  848
            + EL+QLE +L+ AL   + RK QL+LEQ+E  RK+E      N+ LR QIE
Sbjct  121  VKELQQLERQLESALSQARQRKSQLILEQMEELRKKERHLGEINKQLRDQIE  172



>gb|KDP36700.1| hypothetical protein JCGZ_07991 [Jatropha curcas]
Length=222

 Score =   142 bits (358),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 84/184 (46%), Positives = 123/184 (67%), Gaps = 5/184 (3%)
 Frame = +3

Query  336  MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
            MGRGKI+IK IEN  +RQVTF KRR+GLLKKA ELS+LCDAEVA+I+FSS  +L+EYS+ 
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSNN  60

Query  516  SMKHTLSRYNK-CLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMG  692
            ++K T+ RY K C DST    I E   +   +E   L  +I  L++    L+G  L+ + 
Sbjct  61   NIKSTIERYKKACSDSTNASSITEINAQYYQQESAKLRQQIQMLQNSNRHLMGDSLSSLT  120

Query  693  LNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENEN--LRRQIEELRGLV  866
            + EL+QLE++L+  +  I+ +K +LLL ++E  +K+E    +ENE+  LR +I E+  L 
Sbjct  121  VKELKQLENRLERGITRIRSKKHELLLAEIEYLQKRE--IELENESVCLRTKIAEIERLQ  178

Query  867  PSNV  878
             +N+
Sbjct  179  QANM  182



>ref|XP_010437827.1| PREDICTED: agamous-like MADS-box protein AGL11 isoform X3 [Camelina 
sativa]
 ref|XP_010437835.1| PREDICTED: agamous-like MADS-box protein AGL11 isoform X3 [Camelina 
sativa]
Length=231

 Score =   142 bits (359),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 77/174 (44%), Positives = 118/174 (68%), Gaps = 1/174 (1%)
 Frame = +3

Query  336  MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
            MGRGKI+IK IEN  +RQVTF KRR+GLLKKA ELS+LCDAEVA+I+FS+  +L+EY++ 
Sbjct  1    MGRGKIEIKRIENSTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYANN  60

Query  516  SMKHTLSRYNK-CLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMG  692
            +++ T+ RY K C DST T  + E       +E   L  +I  +++    L+G  L+ + 
Sbjct  61   NIRSTIERYKKACSDSTNTSTVQEINAAYYQQESAKLRQQIQTIQNSNRNLMGDSLSSLS  120

Query  693  LNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEEL  854
            + EL+Q+E++L+ A+  I+ +K +LLL ++EN +K+E     EN  LR ++ E+
Sbjct  121  VKELKQVENRLEKAISRIRSKKHELLLAEIENMQKREIELDNENIYLRTKVAEV  174



>ref|XP_010108211.1| Agamous-like MADS-box protein AGL18 [Morus notabilis]
 gb|EXC18224.1| Agamous-like MADS-box protein AGL18 [Morus notabilis]
Length=239

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 99/256 (39%), Positives = 143/256 (56%), Gaps = 35/256 (14%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI IK IEN++SRQVTF KRR+GL KKAQELS+LCDA+V VIIFSST +L+E+++T
Sbjct  1     MGRGKIVIKKIENLSSRQVTFCKRRNGLFKKAQELSVLCDAQVGVIIFSSTGRLYEFANT  60

Query  516   SMKHTLSRYNKCLDSTETPK----IvekkpkvehkevevLNNEISE----LKSKQLQLLG  671
              M+  L++YN     +  P+    + E     E  + E   NE+ +    L+   ++++G
Sbjct  61    KMEDILTKYNNKGTESSAPEPSEDLEETDTDTEKSQPEQDANEVMDETEMLRLTLMRMMG  120

Query  672   KDLTGMGLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEE  851
             KDL G+   +L+Q+E KL   +LAIK +KEQ              +AL ENE LR+++ E
Sbjct  121   KDLDGLSFKDLQQMEDKLAEGILAIKSKKEQ--------------KALTENEILRKELNE  166

Query  852   LRGLVPSNVSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVSDTTLQLGPPT  1031
             +R            TP L   P+       +  +    T   D  +   +DT+LQL   +
Sbjct  167   MR--------QNYLTPILTSNPL-----DWRSSSLKSTTKSVDQENEHFADTSLQLRLSS  213

Query  1032  GSCRKRKTPDQETHSS  1079
                RKRK P  E+ +S
Sbjct  214   DFGRKRKAPKIESSTS  229



>ref|XP_010925573.1| PREDICTED: floral homeotic protein AGAMOUS-like [Elaeis guineensis]
 gb|AAW66882.1| MADS box transcription factor [Elaeis guineensis]
Length=224

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 82/190 (43%), Positives = 118/190 (62%), Gaps = 1/190 (1%)
 Frame = +3

Query  336  MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
            MGRGKI+IK IEN  +RQVTF KRR+GLLKKA ELS+LCDAEVA+IIFSS  +L+EY++ 
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIIFSSRGRLYEYANN  60

Query  516  SMKHTLSRYNK-CLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMG  692
            S+K T+ RY K C D++ +  + E   +   +E   L  +I+ L++    L+G  L  M 
Sbjct  61   SVKATIERYKKACTDTSNSGSVSEADSQYYQQESLKLRQQITSLQNSNRNLMGDSLGSMS  120

Query  693  LNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPS  872
            L +L+QLE +L+  +  I+ +K +LL  ++E  +K+E      N  LR +I E  G    
Sbjct  121  LRDLKQLEGRLEKGINKIRTKKNELLFAEIEYMQKRETELQNANMYLRNKIAENEGAQQQ  180

Query  873  NVSMPMPTPY  902
               +P  T Y
Sbjct  181  MNMLPATTEY  190



>ref|XP_010934013.1| PREDICTED: MADS-box transcription factor 6-like [Elaeis guineensis]
Length=241

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 77/171 (45%), Positives = 117/171 (68%), Gaps = 0/171 (0%)
 Frame = +3

Query  336  MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
            MGRGK+++K IEN  +RQVTFSKRR+GLLKKA ELS+LCDAEVA+IIFSS  KL+E+ S 
Sbjct  1    MGRGKVELKRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFGSV  60

Query  516  SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMGL  695
                TL RY +C  +++   +  ++ +  ++E+ +L  ++  L+  Q  LLG+DL  + +
Sbjct  61   GTSKTLERYQRCCYASQESSVTNREAQSWYQEMSMLKAKVESLQRSQRHLLGEDLGPLSV  120

Query  696  NELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIE  848
             EL+QLE +L+ +L   + RK Q++L+Q+E  RK+E      N+ LR ++E
Sbjct  121  KELQQLERQLESSLSQARQRKTQIMLDQMEELRKKERHLGEINKQLRNKLE  171



>emb|CAA55867.1| DAL2 protein [Picea abies]
Length=222

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 89/232 (38%), Positives = 136/232 (59%), Gaps = 13/232 (6%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN  +RQVTF KRR+GLLKKA ELS+LCDAEVA+I+FSS  +L+E+++ 
Sbjct  1     MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEFANH  60

Query  516   SMKHTLSRYNK-CLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMG  692
             S+K T+ RY K C+D+     I E   +   +E   L  +I  L++    L+G  LT + 
Sbjct  61    SVKRTIERYKKTCVDNNHGGVISESNSQYWQQEAGKLRQQIEILQNANRHLMGDGLTALN  120

Query  693   LNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPS  872
             + EL+QLE +L+  +  ++ +K ++LLE+++  +++E   + ENE LR +I E +    +
Sbjct  121   IKELKQLEVRLEKGIGRVRSKKNEMLLEEIDIMQRREHILIQENEILRSKIAECQNSHNT  180

Query  873   NVSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVS--DTTLQLG  1022
             N+   +  P  +  P         D    L+    D   +      TTLQLG
Sbjct  181   NM---LSAPEYDALPAF-------DSRNFLHANLIDAAHHYAHQEQTTLQLG  222



>gb|ADD25198.1| AGL6 [Nuphar advena]
Length=246

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 96/251 (38%), Positives = 144/251 (57%), Gaps = 17/251 (7%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRG++++K IEN  +RQVTFSKRR+GLLKKA ELS+LCDAEVA+I+FSS  KL+E+ S 
Sbjct  1     MGRGRVELKRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIVFSSRGKLYEFGSA  60

Query  516   SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMGL  695
              +  T+ RY +C  +     I  ++ +  ++EV  L      L+  Q  LLG+DL  + +
Sbjct  61    GLSKTIERYQRCNYNPLDNNISVRETQNWYQEVAKLKARYEALQRSQRHLLGEDLGPLSV  120

Query  696   NELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPSN  875
              EL+QLE +L+ AL   + RK Q+++EQ++  RK+E      N+ L+ Q+E  +G V   
Sbjct  121   KELQQLERQLETALSQARQRKTQIMMEQMDELRKKERHLGDVNKQLKNQLES-QGHVFR-  178

Query  876   VSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVSDTTLQLG-----PPTGSC  1040
              SMP  +   E   V+ N S   + A+  +  C         + TLQ+G     PP G+ 
Sbjct  179   -SMPGSSSSWESGVVVGNNSLNMNAAQVDHIDC---------EPTLQIGYHQFVPPDGTS  228

Query  1041  RKRKTPDQETH  1073
                +T   E +
Sbjct  229   NIARTVAAENN  239



>gb|AAG09919.1|AF112149_1 MADS box protein 2 [Zea mays]
Length=240

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 85/203 (42%), Positives = 126/203 (62%), Gaps = 16/203 (8%)
 Frame = +3

Query  336  MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
            MGRGKI I+ I+N  SRQVTFSKRR+G+ KKA+EL+ILCDAEV ++IFSST +L+EYSST
Sbjct  1    MGRGKIVIRRIDNSTSRQVTFSKRRNGIFKKAKELAILCDAEVGLVIFSSTGRLYEYSST  60

Query  516  SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMGL  695
            SMK  + RY K  +  +       + K   +E   L  ++  L+    QL G DL+G+ +
Sbjct  61   SMKSVIDRYGKAKEEQQVVANPNSELKFWQREAASLRQQLHNLQENYRQLTGDDLSGLNV  120

Query  696  NELRQLEHKLDGALLAIKGRKEQLLLEQLEN-SRK-----QEERALV--------ENENL  833
             EL+ LE++L+ +L  ++ +K+ LL++++ + +RK     QE   L         EN+ L
Sbjct  121  KELQSLENQLETSLRGVRAKKDHLLIDEIHDLNRKASLFHQENTDLYNKINLIRQENDEL  180

Query  834  RRQIEELRGLVPSNVSMPMPTPY  902
             ++I E  G  PS V+   PTP+
Sbjct  181  HKKIYETEG--PSGVNRESPTPF  201



>gb|ABM69042.1| MADS-box protein MADS4 [Gossypium hirsutum]
Length=246

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 78/174 (45%), Positives = 117/174 (67%), Gaps = 0/174 (0%)
 Frame = +3

Query  330  KKMGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYS  509
            KKMGRGKI+IK IEN  +RQVTF KRR+GLLKKA ELS+LCDAEVA+I+FS+  +L+EY+
Sbjct  14   KKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSNRGRLYEYA  73

Query  510  STSMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGM  689
            + S+K T+ RY K  DS+ T  + E   +   +E + L N+I  L++    +LG+ + G+
Sbjct  74   NNSVKATIERYKKASDSSNTGSVAEVNAQFYQQEADKLRNQIRNLQNTNRHMLGESVGGL  133

Query  690  GLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEE  851
             + EL+ LE +L+  +  I+ +K +LL  ++E  +K+E      N+ LR +I E
Sbjct  134  PMKELKSLETRLEKGISRIRSKKNELLFAEIEYMQKKEIDLHNNNQLLRAKIAE  187



>gb|AAL92522.1| AG-like protein [Gossypium hirsutum]
Length=244

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 78/174 (45%), Positives = 116/174 (67%), Gaps = 0/174 (0%)
 Frame = +3

Query  330  KKMGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYS  509
            KKMGRGKI+IK IEN  +RQVTF KRR+GLLKKA ELS+LCDAEVA++ FSS  +L+EY+
Sbjct  14   KKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVAFSSRGRLYEYA  73

Query  510  STSMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGM  689
            + S+K T+ RY K  DS+ T  + E   +   +E + L N+I  L++    +LG+ + G+
Sbjct  74   NNSVKATIERYKKASDSSNTGSVAEVNAQFYQQEADKLRNQIRNLQNANRHMLGESIGGL  133

Query  690  GLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEE  851
             + EL+ LE +L+  +  I+ +K +LL  ++E  +K+E      N+ LR +I E
Sbjct  134  PMKELKSLESRLEKGISRIRSKKNELLFAEIEYMQKREIDLHNNNQLLRAKIAE  187



>ref|XP_008219059.1| PREDICTED: agamous-like MADS-box protein AGL11 isoform X2 [Prunus 
mume]
Length=221

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 84/187 (45%), Positives = 126/187 (67%), Gaps = 5/187 (3%)
 Frame = +3

Query  336  MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
            MGRGKI+IK IEN  +RQVTF KRR+GLLKKA ELSILCDAEVA+I+FSS  +L+EYS+ 
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSILCDAEVALIVFSSRGRLYEYSNN  60

Query  516  SMKHTLSRYNK-CLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMG  692
            ++++T+ RY K C DS+ +  I E   +   +E   L  +I  L++    L+G  L+ + 
Sbjct  61   NIRNTIERYKKACSDSSGSTSITEINAQYYQQESAKLRQQIQMLQNSNRHLMGDALSTLS  120

Query  693  LNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENEN--LRRQIEELRGLV  866
            + EL+QLE++L+  +  I+ +K ++LL ++E  +K+E    +ENEN  LR +I E+  L 
Sbjct  121  VKELKQLENRLERGINRIRSKKHEMLLAEIEYLQKKE--IELENENVCLRTKISEVERLQ  178

Query  867  PSNVSMP  887
             +N+  P
Sbjct  179  QANMVGP  185



>gb|AAG09136.2|AF150932_1 MADS-domain protein PPM1 [Physcomitrella patens]
Length=283

 Score =   144 bits (362),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 97/231 (42%), Positives = 144/231 (62%), Gaps = 6/231 (3%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN  SRQVTFSKRR GLLKKA EL++LCDAEVA++IFSST KLFEY+S+
Sbjct  1     MGRGKIEIKKIENTTSRQVTFSKRRGGLLKKAHELAVLCDAEVALVIFSSTGKLFEYASS  60

Query  516   -SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMG  692
              SM+  + RY K  +                +EV  L  ++  LKS Q ++LG+DL+ + 
Sbjct  61    GSMRDIIERYKKSPNGAMK---SGASTDFLGREVLKLQEQVERLKSSQRRMLGEDLSALK  117

Query  693   LNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPS  872
             + +L QLE +LD     ++ RK QL+LE++E  +K+E+  +V NE+LR++I +   +  +
Sbjct  118   VPDLLQLEQQLDLGASRVRARKNQLILEEIEGLQKKEQELMVANEDLRKKIADAEAVARA  177

Query  873   NVSMPMP-TPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVSDTTLQLG  1022
             N+S   P +P      + ++ S+    A ++    +   D + S T+LQLG
Sbjct  178   NLSEARPESPRHLARTLSRDVSASSHPAATVYPHPNLR-DVQRSQTSLQLG  227



>gb|EPS59667.1| hypothetical protein M569_15138, partial [Genlisea aurea]
Length=146

 Score =   139 bits (351),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 104/146 (71%), Gaps = 5/146 (3%)
 Frame = +3

Query  336  MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
            MGRGKI+IK IENVNSRQVTFSKRR GLLKKA+EL++LCDAEVAVIIFSST K+++++S+
Sbjct  1    MGRGKIEIKKIENVNSRQVTFSKRRGGLLKKARELAVLCDAEVAVIIFSSTGKMYDFASS  60

Query  516  SMKHTLSRYNK---CLD--STETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDL  680
             M   L+RYN+   CL+  + E      K       EV+ L NEI  LK +Q Q+ GKDL
Sbjct  61   RMDQILARYNQSNECLEIVTVEHAAEQVKFRHEYSSEVKHLKNEIEALKLRQRQMTGKDL  120

Query  681  TGMGLNELRQLEHKLDGALLAIKGRK  758
             G+  ++L  LE++L   +L++K +K
Sbjct  121  EGLTYSDLHDLENQLMEGILSVKDKK  146



>ref|XP_009397558.1| PREDICTED: MADS-box transcription factor 6-like [Musa acuminata 
subsp. malaccensis]
Length=235

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 77/171 (45%), Positives = 114/171 (67%), Gaps = 0/171 (0%)
 Frame = +3

Query  336  MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
            MGRG++++K IEN  +RQVTFSKRR+GLLKKA ELS+LCDAEVA+IIFSS  KL+E+ S 
Sbjct  1    MGRGRVELKRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFGSA  60

Query  516  SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMGL  695
                TL RY +C  + + P +   + +  ++E+  L  +   L+  Q  LLG+DL  + +
Sbjct  61   GTSKTLERYQRCCYAPQDPNVANGEAQSWYQEMSKLKVKFESLQRSQRHLLGEDLGPLSV  120

Query  696  NELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIE  848
             EL+QLE +L+ AL   + RK QL+++++E  RK+E      N+ L+ Q+E
Sbjct  121  KELQQLERQLESALSQARQRKTQLMMDKMEELRKKERHLGEINKQLKDQLE  171



>dbj|BAC97837.1| duplicated [Ipomoea nil]
 dbj|BAF36711.1| DUPLICATED protein [Ipomoea nil]
Length=247

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 86/201 (43%), Positives = 124/201 (62%), Gaps = 5/201 (2%)
 Frame = +3

Query  330  KKMGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYS  509
            +KMGRGKI+IK IEN  +RQVTF KRR+GLLKKA ELS+LCDAEVA+I+FSS  +L+EY+
Sbjct  15   RKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYA  74

Query  510  STSMKHTLSRYNK-CLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTG  686
            + S+K T+ RY K C DST T  I E   +   +E   L  +IS L+++    +G+ L G
Sbjct  75   NNSVKATIDRYKKACSDSTNTGSISEANTQFYQQEANKLRQQISNLQNQNRNYMGEGLGG  134

Query  687  MGLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALV-ENENLRRQIEELRGL  863
              L +L+ LE K++  +  I+ +K +LL  +++  +K++E  L   N+ LR +I E    
Sbjct  135  FNLRDLKNLESKIEKGISKIRAKKNELLFAEIDYMQKRQEIDLHNNNQYLRAKIIETERA  194

Query  864  VPSNVS---MPMPTPYLEYYP  917
                     MP  + Y E  P
Sbjct  195  QQQQQQMNLMPGSSSYHELAP  215



>ref|XP_010437812.1| PREDICTED: agamous-like MADS-box protein AGL11 isoform X1 [Camelina 
sativa]
Length=266

 Score =   143 bits (361),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 77/175 (44%), Positives = 119/175 (68%), Gaps = 1/175 (1%)
 Frame = +3

Query  333  KMGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSS  512
            +MGRGKI+IK IEN  +RQVTF KRR+GLLKKA ELS+LCDAEVA+I+FS+  +L+EY++
Sbjct  35   RMGRGKIEIKRIENSTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYAN  94

Query  513  TSMKHTLSRYNK-CLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGM  689
             +++ T+ RY K C DST T  + E       +E   L  +I  +++    L+G  L+ +
Sbjct  95   NNIRSTIERYKKACSDSTNTSTVQEINAAYYQQESAKLRQQIQTIQNSNRNLMGDSLSSL  154

Query  690  GLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEEL  854
             + EL+Q+E++L+ A+  I+ +K +LLL ++EN +K+E     EN  LR ++ E+
Sbjct  155  SVKELKQVENRLEKAISRIRSKKHELLLAEIENMQKREIELDNENIYLRTKVAEV  209



>ref|XP_004136416.1| PREDICTED: MADS-box transcription factor 27-like [Cucumis sativus]
 gb|KGN60279.1| hypothetical protein Csa_3G893290 [Cucumis sativus]
Length=234

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/150 (49%), Positives = 107/150 (71%), Gaps = 0/150 (0%)
 Frame = +3

Query  336  MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
            MGRGKI I+ I+N  SRQVTFSKRRSGLLKKA+EL+ILCDA+V VIIFSST KL+EYSST
Sbjct  1    MGRGKIVIRRIDNSTSRQVTFSKRRSGLLKKAKELAILCDADVGVIIFSSTSKLYEYSST  60

Query  516  SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMGL  695
            SMK  + RYNK  +      I   + K   +E   L  ++  L     Q++G++LTG+ +
Sbjct  61   SMKALIERYNKTKEENHQLGIPTSEVKYWQREAATLRQQLQSLHENHRQMMGEELTGLSV  120

Query  696  NELRQLEHKLDGALLAIKGRKEQLLLEQLE  785
             +L+ LE++L+ +L  ++ +K+Q+L+E+++
Sbjct  121  KDLQNLENQLEISLRGVRMKKDQILMEEIQ  150



>gb|AAT46096.1| AGAMOUS-like protein [Akebia trifoliata]
Length=229

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 79/173 (46%), Positives = 115/173 (66%), Gaps = 1/173 (1%)
 Frame = +3

Query  336  MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
            MGRGKI+IK IEN  +RQVTF KRR+GLLKKA ELS+LCDAEVA+I+FSS  +L+E+S++
Sbjct  8    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEFSNS  67

Query  516  SMKHTLSRYNKC-LDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMG  692
            S+K T+ RY K   DS+ T  I+E        E   L  +I  L+    QL+G  L+ + 
Sbjct  68   SIKSTIERYKKASADSSNTTSIIEANAHYYQHEATKLRQQIQNLQIANRQLMGDSLSSLT  127

Query  693  LNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEE  851
            + EL+QLE++L+  L  I+ +K++++  ++E  +K+E     EN  LR +I E
Sbjct  128  VKELKQLENRLERGLTRIRSKKQEIMFAEIEYMQKREVELQKENMYLRAKIAE  180



>ref|XP_010930411.1| PREDICTED: floral homeotic protein AGAMOUS-like isoform X2 [Elaeis 
guineensis]
 ref|XP_010930412.1| PREDICTED: floral homeotic protein AGAMOUS-like isoform X2 [Elaeis 
guineensis]
Length=234

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 80/197 (41%), Positives = 122/197 (62%), Gaps = 2/197 (1%)
 Frame = +3

Query  336  MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
            MGRGKI+IK IEN  +RQVTF KRR+GLLKKA ELS+LCDAE+A+IIFS   +L+EYS+ 
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIIFSGRGRLYEYSNN  60

Query  516  SMKHTLSRY-NKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMG  692
            S+K T+ RY N C DS+ +  I++   +   +E   L ++I  L++    L+G  L+ + 
Sbjct  61   SIKSTIERYKNACADSSNSGAIIDVNSQYYQQESAKLRHQIQTLQNANRHLMGDALSSLS  120

Query  693  LNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPS  872
            + EL+QLE++L+  +  I+ +K +LL  ++E  +++E     +N  LR +I E       
Sbjct  121  VKELKQLENRLERGITRIRSKKHELLFSEIEYMQRREAELQNDNMCLRAKIAE-NEQAAL  179

Query  873  NVSMPMPTPYLEYYPVL  923
             VS+    P  +  P  
Sbjct  180  QVSIAQEGPQFDALPAF  196



>ref|XP_010421898.1| PREDICTED: agamous-like MADS-box protein AGL11 isoform X1 [Camelina 
sativa]
Length=257

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 77/175 (44%), Positives = 119/175 (68%), Gaps = 1/175 (1%)
 Frame = +3

Query  333  KMGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSS  512
            +MGRGKI+IK IEN  +RQVTF KRR+GLLKKA ELS+LCDAEVA+I+FS+  +L+EY++
Sbjct  26   RMGRGKIEIKRIENSTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYAN  85

Query  513  TSMKHTLSRYNK-CLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGM  689
             +++ T+ RY K C DST T  + E       +E   L  +I  +++    L+G  L+ +
Sbjct  86   NNIRSTIERYKKACSDSTNTSTVQEINAAYYQQESAKLRQQIQTIQNSNRNLMGDSLSSL  145

Query  690  GLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEEL  854
             + EL+Q+E++L+ A+  I+ +K +LLL ++EN +K+E     EN  LR ++ E+
Sbjct  146  SVKELKQVENRLEKAISRIRSKKHELLLAEIENMQKREIELDNENIYLRTKVAEV  200



>ref|XP_009404530.1| PREDICTED: floral homeotic protein AGAMOUS-like [Musa acuminata 
subsp. malaccensis]
Length=222

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 81/190 (43%), Positives = 121/190 (64%), Gaps = 1/190 (1%)
 Frame = +3

Query  336  MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
            MGRGKI+IK IEN  SRQVTF KRR+GLLKKA ELS+LCDAEVA+++FSS  +LFEY++ 
Sbjct  1    MGRGKIEIKRIENTTSRQVTFCKRRNGLLKKAYELSVLCDAEVALVVFSSRGRLFEYANN  60

Query  516  SMKHTLSRYNK-CLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMG  692
            S+K T+ RY K C D+  T  + +   +   +E   L  +I+ ++S    L+G+ L+ M 
Sbjct  61   SVKATIERYKKACSDTAGTGSVPQLNAQHYQQESAKLQQQINHIQSTNRSLMGEGLSSMS  120

Query  693  LNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPS  872
            L +++QLE+KL+  +  I+ +K +LL  ++E  +K+E     +N  LR +I E       
Sbjct  121  LRDMKQLENKLEKGISKIRTKKNELLNAEIEYMQKREMELQNDNVFLRNKITENERAQQQ  180

Query  873  NVSMPMPTPY  902
              S+P  + Y
Sbjct  181  MNSLPSASEY  190



>ref|NP_001104926.1| MADS2 [Zea mays]
 gb|AAO85643.1| MADS-box transcription factor MADS2 [Zea mays]
Length=240

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 85/203 (42%), Positives = 126/203 (62%), Gaps = 16/203 (8%)
 Frame = +3

Query  336  MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
            MGRGKI I+ I+N  SRQVTFSKRR+G+ KKA+EL+ILCDAEV ++IFSST +L+EYSST
Sbjct  1    MGRGKIVIRRIDNSTSRQVTFSKRRNGIFKKAKELAILCDAEVGLVIFSSTGRLYEYSST  60

Query  516  SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMGL  695
            SMK  + RY K  +  +       + K   +E   L  ++  L+    QL G DL+G+ +
Sbjct  61   SMKSVIDRYGKAKEEQQDVANPNSELKFWQREAASLRQQLHNLQENYRQLTGDDLSGLNV  120

Query  696  NELRQLEHKLDGALLAIKGRKEQLLLEQLEN-SRK-----QEERALV--------ENENL  833
             EL+ LE++L+ +L  ++ +K+ LL++++ + +RK     QE   L         EN+ L
Sbjct  121  KELQSLENQLETSLRGVRAKKDHLLIDEIHDLNRKASLFHQENTDLYNKINLIRQENDEL  180

Query  834  RRQIEELRGLVPSNVSMPMPTPY  902
             ++I E  G  PS V+   PTP+
Sbjct  181  HKKIYETEG--PSGVNRESPTPF  201



>ref|XP_007025251.1| K-box region and MADS-box transcription factor family protein 
isoform 2 [Theobroma cacao]
 ref|XP_007025252.1| K-box region and MADS-box transcription factor family protein 
isoform 2 [Theobroma cacao]
 ref|XP_007025253.1| K-box region and MADS-box transcription factor family protein 
isoform 2 [Theobroma cacao]
 gb|ABA39727.1| AGAMOUS-like protein [Theobroma cacao]
 gb|EOY27873.1| K-box region and MADS-box transcription factor family protein 
isoform 2 [Theobroma cacao]
 gb|EOY27874.1| K-box region and MADS-box transcription factor family protein 
isoform 2 [Theobroma cacao]
 gb|EOY27875.1| K-box region and MADS-box transcription factor family protein 
isoform 2 [Theobroma cacao]
Length=241

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 79/175 (45%), Positives = 117/175 (67%), Gaps = 1/175 (1%)
 Frame = +3

Query  330  KKMGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYS  509
            KKMGRGKI+IK IEN  +RQVTF KRR+GLLKKA ELS+LCDAEVA+I+FSS  +L+EY+
Sbjct  14   KKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYA  73

Query  510  STSMKHTLSRYNK-CLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTG  686
            + S+K T+ RY K C DS+ T  + E   +   +E   L  +I  L++    +LG+ L+ 
Sbjct  74   NNSVKATIERYKKTCADSSNTGSVSEANAQFYQQEAAKLRVQIGNLQNSNRHMLGESLSA  133

Query  687  MGLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEE  851
            + + +LR LE++L+  +  I+ +K +LL  ++E  +K+E      N+ LR +I E
Sbjct  134  LPMKDLRSLENRLEKGISRIRSKKNELLFAEIEYMQKREIDLHNNNQLLRAKIAE  188



>ref|XP_002977833.1| MADS-domain transcription factor [Selaginella moellendorffii]
 gb|EFJ21171.1| MADS-domain transcription factor [Selaginella moellendorffii]
Length=327

 Score =   144 bits (364),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 86/179 (48%), Positives = 116/179 (65%), Gaps = 9/179 (5%)
 Frame = +3

Query  336  MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
            +GRGKI+IK IEN  SRQVTFSKRR GLLKKA ELS+LCDA+VA+IIFSST KLFEY+ST
Sbjct  44   VGRGKIEIKRIENATSRQVTFSKRRGGLLKKAHELSVLCDAQVALIIFSSTGKLFEYAST  103

Query  516  SMKHTLSRYNKCLDSTETPKIvekkpkvehkeve--vLNNEISELKSKQLQLLGKDLTGM  689
            SMK  L RY K  +S +   I  +    ++   E   L  ++   +  Q  LLG DL  +
Sbjct  104  SMKEILDRYGKYPESVQGGNIASQHHDSDYFSREVIRLKQQLERSQQTQRHLLGDDLAHL  163

Query  690  GLNELRQLEHKLDGALLAIKGRK-------EQLLLEQLENSRKQEERALVENENLRRQI  845
             L +L+ LE +L+  L  I+ RK       EQ+ L+++E+ R++E +   ENE LRR++
Sbjct  164  ALKDLQSLEQQLELGLNRIRSRKCALSMHQEQVFLDEIEDLRRRELQLHKENEMLRRRL  222



>ref|XP_002979492.1| MADS-domain transcription factor [Selaginella moellendorffii]
 gb|EFJ19381.1| MADS-domain transcription factor [Selaginella moellendorffii]
Length=327

 Score =   144 bits (364),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 86/179 (48%), Positives = 116/179 (65%), Gaps = 9/179 (5%)
 Frame = +3

Query  336  MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
            +GRGKI+IK IEN  SRQVTFSKRR GLLKKA ELS+LCDA+VA+IIFSST KLFEY+ST
Sbjct  44   VGRGKIEIKRIENATSRQVTFSKRRGGLLKKAHELSVLCDAQVALIIFSSTGKLFEYAST  103

Query  516  SMKHTLSRYNKCLDSTETPKIvekkpkvehkeve--vLNNEISELKSKQLQLLGKDLTGM  689
            SMK  L RY K  +S +   I  +    ++   E   L  ++   +  Q  LLG DL  +
Sbjct  104  SMKEILDRYGKYPESVQGGNIASQHHDSDYFSREVIRLKQQLERSQQTQRHLLGDDLAHL  163

Query  690  GLNELRQLEHKLDGALLAIKGRK-------EQLLLEQLENSRKQEERALVENENLRRQI  845
             L +L+ LE +L+  L  I+ RK       EQ+ L+++E+ R++E +   ENE LRR++
Sbjct  164  ALKDLQSLEQQLELGLNRIRSRKCALSMHQEQVFLDEIEDLRRRELQLHKENEMLRRRL  222



>gb|ADP00515.1| MADS-box factor MADS1 [Cymbidium ensifolium]
 gb|AFP19447.1| MADS-box protein AG1 [Cymbidium faberi]
Length=233

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 85/196 (43%), Positives = 127/196 (65%), Gaps = 3/196 (2%)
 Frame = +3

Query  330  KKMGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYS  509
            +KMGRGKI+IK IEN  +RQVTF KRR+GLLKKA ELS+LCDAEVA++IFSS  +L+EY+
Sbjct  5    EKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVIFSSRGRLYEYA  64

Query  510  STSMKHTLSRYNK-CLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTG  686
            + S+K T+ RY K C D++ T  I E   +   +E   L  +I+ L++    LLG  LT 
Sbjct  65   NNSVKGTIDRYKKACTDNSSTGSISEANSQYYQQEATKLRQQITNLQNSNRNLLGDALTT  124

Query  687  MGLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQI-EELRGL  863
            M L +L+QLE +L+  +  I+ +K +LL  +++  +K+E     +N  LR +I +  R  
Sbjct  125  MSLRDLKQLETRLEKGISKIRSKKNELLHAEIDYMQKREMDLQTDNMYLRSKIADNERAQ  184

Query  864  VPSNVSMPMPTPYLEY  911
               ++S+ +P+   EY
Sbjct  185  QHQHMSI-LPSTSTEY  199



>gb|ABB87186.1| MADS-box protein [Picea morrisonicola]
Length=222

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 89/232 (38%), Positives = 135/232 (58%), Gaps = 13/232 (6%)
 Frame = +3

Query  336   MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
             MGRGKI+IK IEN  +RQVTF KRR+GLLKKA ELS+LCDAEVA I+FSS  +L+E+++ 
Sbjct  1     MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVAPIVFSSRGRLYEFANH  60

Query  516   SMKHTLSRYNK-CLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMG  692
             S+K T+ RY K C+D+     I E   +   +E   L  +I  L++    L+G  LT + 
Sbjct  61    SVKRTIERYKKTCVDNNHGGAISESNSQYWQQEAGKLRQQIEILQNANRHLMGDGLTALN  120

Query  693   LNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPS  872
             + EL+QLE +L+  +  ++ +K ++LLE+++  +++E   + ENE LR +I E +    +
Sbjct  121   IKELKQLEVRLEKGISRVRSKKNEMLLEEIDIMQRREHILIQENEILRSKIAECQNSHNT  180

Query  873   NVSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDN--EVSDTTLQLG  1022
             N+   +  P  +  P         D    L+    D   +      TTLQLG
Sbjct  181   NM---LSAPEYDALPAF-------DSRNFLHANLIDAAHHFAHQEQTTLQLG  222



>gb|AGW23351.1| MADS box protein MADS49 [Gossypium hirsutum]
Length=239

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 89/203 (44%), Positives = 126/203 (62%), Gaps = 15/203 (7%)
 Frame = +3

Query  336  MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
            MGRGK+++K IEN  +RQVTF+KRR+GLLKKA ELSILCDAEVA+IIFS+  KL+E+SS+
Sbjct  1    MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFSSS  60

Query  516  -SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMG  692
             S+  TL RYN+C      P   E + +  +++   L  ++  L+  Q    G++L  +G
Sbjct  61   NSIADTLERYNRCTYGALEPGQTEIETQRNYQDYLKLKAKVEVLQHSQRHFRGEELGDLG  120

Query  693  LNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEE----LRG  860
              EL QLEH+LD +L  I+  K + ++EQL    ++EE  L  N NLRR+++E    LR 
Sbjct  121  SKELEQLEHQLDFSLKKIRSLKMEHMVEQLSKLERKEEMLLETNRNLRRKLDENASTLRS  180

Query  861  L-------VPSNVSMPMPTPYLE  908
                    VP N+  P   P+ E
Sbjct  181  TWETGEQSVPCNLQRP---PFFE  200



>gb|AEZ51868.1| AG MADS-box protein [Cymbidium ensifolium]
Length=233

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 85/196 (43%), Positives = 126/196 (64%), Gaps = 3/196 (2%)
 Frame = +3

Query  330  KKMGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYS  509
            +KMGRGKI+IK IEN  +RQVTF KRR+GLLKKA ELS+LCDAEVA++IFSS  +L+EY+
Sbjct  5    EKMGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVIFSSRGRLYEYA  64

Query  510  STSMKHTLSRYNK-CLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTG  686
            + S+K T  RY K C D++ T  I E   +   +E   L  +I+ L++    LLG  LT 
Sbjct  65   NNSVKGTTDRYKKACTDNSSTGSISEANSQYYQQEATKLRQQITNLQNSNRNLLGDALTT  124

Query  687  MGLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQI-EELRGL  863
            M L +L+QLE +L+  +  I+ +K +LL  +++  +K+E     +N  LR +I +  R  
Sbjct  125  MSLRDLKQLETRLEKGISKIRSKKNELLHAEIDYMQKREMDLQTDNMYLRSKIADNERAQ  184

Query  864  VPSNVSMPMPTPYLEY  911
               ++S+ +P+   EY
Sbjct  185  QHQHISI-LPSTSTEY  199



>ref|XP_009362389.1| PREDICTED: agamous-like MADS-box protein AGL11 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009362390.1| PREDICTED: agamous-like MADS-box protein AGL11 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009362391.1| PREDICTED: agamous-like MADS-box protein AGL11 isoform X2 [Pyrus 
x bretschneideri]
Length=224

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 85/187 (45%), Positives = 125/187 (67%), Gaps = 3/187 (2%)
 Frame = +3

Query  336  MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYS-S  512
            MGRGKI+IK IEN  +RQVTF KRR+GLLKKA ELSILCDAE+A+I+FSS  +L+EYS +
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSILCDAEIALIVFSSRGRLYEYSNN  60

Query  513  TSMKHTLSRYNK-CLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGM  689
             S+++T+ RY K C DST    I E   +   +E   L  +I  L++    L+G  L+ +
Sbjct  61   NSIRNTIERYKKACSDSTGPSSITEINAQYYQQESAKLRQQIQMLQNSNRHLMGDALSNL  120

Query  690  GLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVP  869
             + EL+QLE+KL+  +  I+ +K+++L+ ++E  +K+E     EN  LR +I E+  L  
Sbjct  121  NVKELKQLENKLERGMTRIRSKKDEMLIAEIEYLQKKEIELENENVYLRTKISEVERLHQ  180

Query  870  SN-VSMP  887
            +N VS+P
Sbjct  181  ANIVSVP  187



>gb|ACB70410.1| agamous MADS-box transcription factor [Hosta plantaginea]
Length=225

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 79/173 (46%), Positives = 116/173 (67%), Gaps = 1/173 (1%)
 Frame = +3

Query  336  MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
            MGRGKI+IK IEN  +RQVTF KRR+GLLKKA ELS+LCDAEVA+I+FS+  +L+EY++ 
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYANN  60

Query  516  SMKHTLSRYNK-CLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMG  692
            S+K T+ RY K C D+T T  + E   +   +E   L  +I+ L++    LLG+ L+ M 
Sbjct  61   SVKATIERYKKACTDTTNTGTVSEANSQYYQQEASKLRQQITNLQNSNRNLLGESLSTMS  120

Query  693  LNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEE  851
            L +L+QLE +L+  +  I+ +K +LL  ++E  +K+E     +N  LR +I E
Sbjct  121  LRDLKQLEGRLEKGINKIRIKKNELLFAEIEYMQKREMELQNDNMYLRNKIAE  173



>dbj|BAB79434.1| PMADS3 [Petunia x hybrida]
Length=242

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 82/196 (42%), Positives = 121/196 (62%), Gaps = 6/196 (3%)
 Frame = +3

Query  330  KKMGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYS  509
            +K+GRGKI+IK IEN  +RQVTF KRR+GLLKKA ELS+LCDAEVA+I+FSS  +L+EY+
Sbjct  15   RKLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYA  74

Query  510  STSMKHTLSRYNK-CLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTG  686
            + S+K T+ RY K C DS+ T  I E   +   +E   L  +I   +++    LG+ L  
Sbjct  75   NNSVKATIERYKKACSDSSNTGSIAEANAQYYQQEASKLRAQIGNXQNQNRNFLGESLAA  134

Query  687  MGLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELR---  857
            + L +LR LE K++  +  I+ +K +LL  ++E  +K+E      N+ LR +I E     
Sbjct  135  LNLRDLRNLEQKIEKGISKIRAKKNELLFAEIEYMQKREIDLHNNNQYLRAKIAETERSQ  194

Query  858  --GLVPSNVSMPMPTP  899
               L+P + S  +  P
Sbjct  195  QMNLMPGSSSYDLVPP  210



>gb|ADJ67241.1| MADS box transcription factor 11 [Oncidium hybrid cultivar]
Length=248

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 81/185 (44%), Positives = 123/185 (66%), Gaps = 1/185 (1%)
 Frame = +3

Query  336  MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEY-SS  512
            MGRG++++K+IEN  +RQVTF+KRR+GLLKKA ELS+LCDAEVA+IIFS+  +LFE+ SS
Sbjct  1    MGRGRVELKMIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGRLFEFCSS  60

Query  513  TSMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMG  692
            +S+  T+ RY KC  ++    I  K+ +  ++E   L   +  L+  Q  LLG+DL  + 
Sbjct  61   SSITKTIERYQKCSYNSSEATIPSKETQNSYQEYLKLKARVEYLQRSQRNLLGEDLGQLS  120

Query  693  LNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPS  872
              EL QLEH+L+ +L  I+  K QL+L+QL + +++E+     N  LR +++E    +P 
Sbjct  121  TKELEQLEHQLETSLKQIRSTKSQLMLDQLCDLKRKEQMLQEANRALRMKLQEEEPEIPL  180

Query  873  NVSMP  887
             +S P
Sbjct  181  QLSWP  185



>ref|XP_008466134.1| PREDICTED: MADS-box transcription factor 23-like isoform X4 [Cucumis 
melo]
Length=225

 Score =   141 bits (355),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 73/150 (49%), Positives = 107/150 (71%), Gaps = 0/150 (0%)
 Frame = +3

Query  336  MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
            MGRGKI I+ I+N  SRQVTFSKRRSGLLKKA+EL+ILCDA+V VIIFSST KL+EYSST
Sbjct  1    MGRGKIVIRRIDNSTSRQVTFSKRRSGLLKKAKELAILCDADVGVIIFSSTSKLYEYSST  60

Query  516  SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMGL  695
            SMK  + RYNK  +      I   + K   +E   L  ++  L     Q++G++LTG+ +
Sbjct  61   SMKALIERYNKTKEENHQLGISTSEVKYWQREAATLRQQLQSLHENHRQMMGEELTGLSV  120

Query  696  NELRQLEHKLDGALLAIKGRKEQLLLEQLE  785
             +L+ LE++L+ +L  ++ +K+Q+L+++++
Sbjct  121  KDLQNLENQLEISLRGVRMKKDQILVDEIQ  150



>ref|XP_008654205.1| PREDICTED: AGAMOUS-like protein isoform X1 [Zea mays]
 ref|XP_008654207.1| PREDICTED: AGAMOUS-like protein isoform X2 [Zea mays]
Length=258

 Score =   142 bits (358),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 87/229 (38%), Positives = 131/229 (57%), Gaps = 5/229 (2%)
 Frame = +3

Query  339   GRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSSTS  518
             GRGKI+IK IEN  +RQVTF KRR+GLLKKA ELS+LCDAEVA+++FSS  +L+EY++ S
Sbjct  34    GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVVFSSRGRLYEYANNS  93

Query  519   MKHTLSRYNKC-LDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMGL  695
             +K T+ RY K   DS+ +  + E   +   +E   L   I  L++    ++G  +  MGL
Sbjct  94    VKSTIERYKKANSDSSNSGTVAEVNAQYYQQESSKLRQMIHSLQNANTNIVGDSIHTMGL  153

Query  696   NELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPSN  875
              +L+Q+E KL+ A++ I+ RK +LL  +++  +K+E     +N  LR +I E        
Sbjct  154   RDLKQMEGKLEKAIIKIRARKNELLYAEVDYMQKREMDLQTDNMYLRSKIAESNETGQPA  213

Query  876   VSMPMPTPYLEYYPVLKNCSSGKDGAESLNTGCDDDLDNEVSDTTLQLG  1022
             + M M  P    Y  +    +  D    L         +++  TTLQLG
Sbjct  214   MHMTMGAPPTSEYDHM----APFDSRNFLQVSMPQHYSHQLQPTTLQLG  258



>ref|XP_009113582.1| PREDICTED: agamous-like MADS-box protein AGL11 isoform X2 [Brassica 
rapa]
 ref|XP_009113583.1| PREDICTED: agamous-like MADS-box protein AGL11 isoform X2 [Brassica 
rapa]
Length=230

 Score =   141 bits (356),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 77/187 (41%), Positives = 120/187 (64%), Gaps = 0/187 (0%)
 Frame = +3

Query  336  MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
            MGRGKI+IK IEN  +RQVTF KRR+GLLKKA ELS+LCDAEVA+I+FS+  +L+EY++ 
Sbjct  1    MGRGKIEIKRIENSTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYANN  60

Query  516  SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMGL  695
            +++ T+ RY K  D+T T  + E       +E   L  +I  +++    L+G  L+ + +
Sbjct  61   NIRSTIERYKKASDNTSTHSVQEINAAYYQQESAKLRQQIQTIQNSNRHLMGDSLSALSV  120

Query  696  NELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPSN  875
             EL+Q+E++L+ A+  I+ +K +LLL ++EN +K+E     E+  LR +I E+      +
Sbjct  121  KELKQVENRLEKAISRIRSKKHELLLAEIENLQKREIELDNESIYLRTKIAEVERFQQHH  180

Query  876  VSMPMPT  896
              M   T
Sbjct  181  HQMVSGT  187



>ref|XP_004952891.1| PREDICTED: MADS-box transcription factor 27-like [Setaria italica]
Length=240

 Score =   141 bits (356),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 82/211 (39%), Positives = 127/211 (60%), Gaps = 14/211 (7%)
 Frame = +3

Query  336  MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
            MGRGKI I+ I+N  SRQVTFSKRR+G+ KKA+EL+ILCDAEV ++IFSST +L+EYSST
Sbjct  1    MGRGKIVIRRIDNSTSRQVTFSKRRNGIFKKAKELAILCDAEVGLMIFSSTGRLYEYSST  60

Query  516  SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMGL  695
            SMK  + RY K  +  +       + K   +E   L  ++  L+    QL G+DL+G+ +
Sbjct  61   SMKSVIDRYGKAKEEQQVAANPNSELKFWQREAASLRQQLHNLQENHRQLTGEDLSGLNV  120

Query  696  NELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLV---  866
             EL+ LE++L+ +L  ++ +K+ LL++++    ++      EN +L  +I ++R      
Sbjct  121  KELQSLENQLETSLRGVRSKKDHLLIDEIHELNRKASLFHQENMDLYNKINQIRQESAEL  180

Query  867  ---------PSNVSMPMPTPYLEYYPVLKNC  932
                     PS V+   PTPY   + V++N 
Sbjct  181  YKKIYQTEGPSEVNRESPTPY--NFAVVENT  209



>ref|XP_009113581.1| PREDICTED: agamous-like MADS-box protein AGL11 isoform X1 [Brassica 
rapa]
Length=231

 Score =   141 bits (355),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 77/187 (41%), Positives = 120/187 (64%), Gaps = 0/187 (0%)
 Frame = +3

Query  336  MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
            MGRGKI+IK IEN  +RQVTF KRR+GLLKKA ELS+LCDAEVA+I+FS+  +L+EY++ 
Sbjct  2    MGRGKIEIKRIENSTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYANN  61

Query  516  SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMGL  695
            +++ T+ RY K  D+T T  + E       +E   L  +I  +++    L+G  L+ + +
Sbjct  62   NIRSTIERYKKASDNTSTHSVQEINAAYYQQESAKLRQQIQTIQNSNRHLMGDSLSALSV  121

Query  696  NELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPSN  875
             EL+Q+E++L+ A+  I+ +K +LLL ++EN +K+E     E+  LR +I E+      +
Sbjct  122  KELKQVENRLEKAISRIRSKKHELLLAEIENLQKREIELDNESIYLRTKIAEVERFQQHH  181

Query  876  VSMPMPT  896
              M   T
Sbjct  182  HQMVSGT  188



>gb|AAD19360.2| AGAMOUS homolog transcription factor [Hyacinthus orientalis]
Length=228

 Score =   141 bits (355),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 116/174 (67%), Gaps = 2/174 (1%)
 Frame = +3

Query  336  MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYS-S  512
            MGRGKI+IK IEN  SRQVTF KRR+GLLKKA ELS+LCDAEVA+I+FS+  +L+EYS S
Sbjct  1    MGRGKIEIKRIENTTSRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYSNS  60

Query  513  TSMKHTLSRYNK-CLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGM  689
             S+K T+ RY K C D+T T  + E   +   +E   L  +I+ L++    L+G+ L+ M
Sbjct  61   NSVKTTIERYKKACTDTTNTGTVSEANSQYYQQEATKLRQQITNLQNTNRTLMGESLSTM  120

Query  690  GLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEE  851
             L EL+QLE +L+  +  I+ +K +LL  ++E  +K+E     +N  LR +I E
Sbjct  121  SLRELKQLEGRLERGINKIRTKKNELLSAEIEYMQKREAEMHNDNMYLRNKIAE  174



>gb|AHM92098.1| MADS-box protein 22 [Erycina pusilla]
Length=234

 Score =   141 bits (356),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 85/196 (43%), Positives = 127/196 (65%), Gaps = 3/196 (2%)
 Frame = +3

Query  330  KKMGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYS  509
            +KMGRGKI+IK IEN+ +RQVTF KRR+GLLKKA ELS+LCDAEVA++IFSS  +L+EY+
Sbjct  6    EKMGRGKIEIKRIENITNRQVTFCKRRNGLLKKAYELSVLCDAEVALVIFSSRGRLYEYA  65

Query  510  STSMKHTLSRYNKC-LDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTG  686
            + S+K T+ RY K   DS+ +  I E   +   +E   L  +I+ L++    L+G+ L+ 
Sbjct  66   NNSVKATIERYKKASSDSSNSGPISETNAQYYMQEASKLRQQITNLQNSNRNLMGEALST  125

Query  687  MGLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEEL-RGL  863
            M L +L+QLE +L+  +  I+ +K +LL  ++E  +K+E     +N  LR QI E  R  
Sbjct  126  MSLRDLKQLETRLEKGINKIRSKKNELLYAEIEYMQKREMELQNDNMYLRNQIAETERSQ  185

Query  864  VPSNVSMPMPTPYLEY  911
                ++M +P+   EY
Sbjct  186  QQQQINM-VPSTSTEY  200



>gb|AAQ83835.1| MADS box protein [Asparagus officinalis]
Length=241

 Score =   141 bits (356),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 78/171 (46%), Positives = 114/171 (67%), Gaps = 0/171 (0%)
 Frame = +3

Query  336  MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
            MGRG++++K IEN  +RQVTFSKRR+GLLKKA ELS+LCDAEVA+IIFSS  KL+E+ S 
Sbjct  1    MGRGRVELKRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFGSA  60

Query  516  SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMGL  695
                TL RY +C  +++   I   + +  ++EV  L  +   L+  Q  LLG+DL  + +
Sbjct  61   GTSKTLERYQRCCYTSQDAAIASHETQSWYQEVSKLKAKFESLQRSQRHLLGEDLGPLSV  120

Query  696  NELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIE  848
             EL+QLE +L+ AL   + RK Q++L+Q+E  RK+E      N+ L+ ++E
Sbjct  121  KELQQLERQLESALSQARQRKTQIMLDQMEELRKKERHLGEINKQLKAKLE  171



>gb|ABF50233.1| AGAMOUS, partial [Nicotiana langsdorffii x Nicotiana sanderae]
Length=206

 Score =   140 bits (353),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 78/175 (45%), Positives = 116/175 (66%), Gaps = 1/175 (1%)
 Frame = +3

Query  330  KKMGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYS  509
            +K+GRGKI+IK IEN  +RQVTF KRR+GLLKKA ELS+LCDAEVA+I+FSS  +L+EY+
Sbjct  15   RKLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYA  74

Query  510  STSMKHTLSRYNK-CLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTG  686
            + S+K T+ RY K C DS+ T  I E   +   +E   L  +I  L+++   +LG+ L  
Sbjct  75   NNSVKATIERYKKACSDSSNTGSISEANAQYYQQEASKLRAQIGNLQNQNRNMLGESLAA  134

Query  687  MGLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEE  851
            + L +L+ LE K++  +  I+ +K +LL  ++E  +K+E      N+ LR +I E
Sbjct  135  LSLRDLKNLEQKIEKGISKIRSKKNELLFAEIEYMQKREIDLHNNNQYLRAKIAE  189



>ref|XP_006357766.1| PREDICTED: MADS-box transcription factor 27-like [Solanum tuberosum]
Length=223

 Score =   140 bits (354),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 83/189 (44%), Positives = 125/189 (66%), Gaps = 0/189 (0%)
 Frame = +3

Query  336  MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
            MGRGKI I+ I+N  SRQVTFSKRR+GLLKKA+EL+ILCDAEV +IIFSST KL+E+S+T
Sbjct  1    MGRGKIVIRRIDNSTSRQVTFSKRRNGLLKKAKELAILCDAEVGLIIFSSTGKLYEFSNT  60

Query  516  SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMGL  695
            SMK  + RY K  D  +       + K+  +E E+L  ++ +L+  Q QLLG++L+G+G+
Sbjct  61   SMKSVIERYTKTKDDCQQLHNPVSELKLWQREAEILGQQLQDLQGNQRQLLGEELSGLGI  120

Query  696  NELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPSN  875
             EL  LE++L+ +L  I+ +KEQ+L ++++   ++      EN  L +++   R     N
Sbjct  121  KELTNLENQLEMSLKGIRMKKEQILKDEIQELTRKGSIIHQENLELYKKVYGTRDAHAVN  180

Query  876  VSMPMPTPY  902
             ++    PY
Sbjct  181  GNINYIYPY  189



>gb|EPS71714.1| hypothetical protein M569_03044, partial [Genlisea aurea]
Length=172

 Score =   139 bits (350),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 114/177 (64%), Gaps = 15/177 (8%)
 Frame = +3

Query  336  MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
            MGRG++++K IEN  +RQVTFSKRR+GLLKKA ELS+LCDAEVA+IIFSS  KL+E+ ST
Sbjct  1    MGRGRVELKKIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFGST  60

Query  516  SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSK-------QLQLLGK  674
            S   TL RY +C  + E             +E      EI++LK+K       Q  LLG+
Sbjct  61   SAASTLERYRRCSYNHEET--------TSERETRSWQQEIAKLKTKYDSLQRAQRHLLGE  112

Query  675  DLTGMGLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQI  845
            DL  + + EL  LE +L+ ALL  + RK Q+L+EQ+E+ R++E      N+NL+ +I
Sbjct  113  DLGPLSVKELHNLEKQLEAALLQARHRKTQMLMEQMEHLRRKERELGDMNKNLKIKI  169



>ref|XP_010518186.1| PREDICTED: agamous-like MADS-box protein AGL6 [Camelina sativa]
Length=252

 Score =   141 bits (356),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 80/182 (44%), Positives = 118/182 (65%), Gaps = 21/182 (12%)
 Frame = +3

Query  336  MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
            MGRG++++K IEN  +RQVTFSKRR+GL+KKA ELS+LCDAEVA+IIFSS  KL+E+ S 
Sbjct  1    MGRGRVEMKRIENTINRQVTFSKRRNGLMKKAYELSVLCDAEVALIIFSSRGKLYEFGSV  60

Query  516  SMKHTLSRYNKC----LDSTETPKIvekkpkvehkevevLNNEISELKSK-------QLQ  662
             +  T+ RYN+C    L +   P+          +  +    E+++LKSK          
Sbjct  61   GIARTIQRYNRCYNCSLGNNNKPE----------ETTQSWTQEVTKLKSKYESLVRTNRN  110

Query  663  LLGKDLTGMGLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQ  842
            LLG+DL  MG+ EL+ LE +L+GAL A + RK Q+++E++E+ RK+E +    N+ L+ +
Sbjct  111  LLGEDLGEMGVKELQALERQLEGALTATRQRKTQVMMEEMEDLRKKERQLGDINKQLKMK  170

Query  843  IE  848
             E
Sbjct  171  FE  172



>ref|XP_008378733.1| PREDICTED: agamous-like MADS-box protein AGL11 isoform X2 [Malus 
domestica]
 ref|XP_008378734.1| PREDICTED: agamous-like MADS-box protein AGL11 isoform X2 [Malus 
domestica]
 ref|XP_008378735.1| PREDICTED: agamous-like MADS-box protein AGL11 isoform X3 [Malus 
domestica]
Length=223

 Score =   140 bits (354),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 79/182 (43%), Positives = 122/182 (67%), Gaps = 1/182 (1%)
 Frame = +3

Query  336  MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
            MGRGKI+IK IEN  +RQVTF KRR+GLLKKA ELSILCDAEVA+I+FS+  +L+EYS+ 
Sbjct  1    MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSILCDAEVALIVFSTRGRLYEYSNN  60

Query  516  SMKHTLSRYNK-CLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMG  692
            ++++T+ RY K C DST +  + E   +   +E   L  +I  L++    L+G  L+ + 
Sbjct  61   NIRNTIERYKKACSDSTGSSSVTEINAQYYQQESAKLRQQIQMLQNSNRHLMGDALSTLT  120

Query  693  LNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPS  872
            + EL+Q+E++L+  +  I+ +K +LLL ++E  +K+E     EN  LR ++ E+  L  +
Sbjct  121  VKELKQVENRLERGITRIRSKKHELLLAEIEYFQKKEIELENENVYLRTKVSEVERLQQA  180

Query  873  NV  878
            N+
Sbjct  181  NM  182



>ref|XP_001776709.1| MIKCC MADS-domain protein PPMC6 [Physcomitrella patens]
 gb|EDQ58545.1| MIKCC MADS-domain protein PPMC6 [Physcomitrella patens]
Length=284

 Score =   142 bits (359),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 86/178 (48%), Positives = 121/178 (68%), Gaps = 5/178 (3%)
 Frame = +3

Query  336  MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
            MGRGKI+IK IEN  SRQVTFSKRR GLLKKA EL++LCDAEVA+IIFSST KLFE++S+
Sbjct  1    MGRGKIEIKKIENPTSRQVTFSKRRGGLLKKAHELAVLCDAEVALIIFSSTGKLFEFASS  60

Query  516  -SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMG  692
             SM+  L RY+KC D  +T    +       +EV  L  ++  L+  Q  +LG+DL  + 
Sbjct  61   GSMRDILERYSKCPDGVQT----DGNSDFMGREVVKLRQQLERLQHSQRHMLGEDLQVLT  116

Query  693  LNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLV  866
            + +L QLE +LD  +  ++ RK QLLLE++E  R++E      NE LR+++ + +G++
Sbjct  117  VPDLLQLEQQLDMGVSRVRARKNQLLLEEVEELRRKEHDLQAANEELRQKLADAKGML  174



>ref|XP_010272608.1| PREDICTED: MADS-box transcription factor 6-like [Nelumbo nucifera]
Length=242

 Score =   141 bits (356),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 77/171 (45%), Positives = 117/171 (68%), Gaps = 0/171 (0%)
 Frame = +3

Query  336  MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
            MGRG++++K IEN  +RQVTFSKRR+GLLKKA ELS+LCDAEVA+IIFSS  KL+E+ S 
Sbjct  1    MGRGRVELKRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFGSA  60

Query  516  SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMGL  695
             M  TL RY +C  + +     +++ +  ++EV  L ++   L+  Q  LLG+DL  + +
Sbjct  61   GMNRTLERYQRCCYTPQDANAADRETQSWYQEVSRLKSKYESLQRAQRHLLGEDLGPLSV  120

Query  696  NELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIE  848
             EL+ LE +L+GAL A + RK Q+++E++E  R++E      N+ L+ ++E
Sbjct  121  KELQNLEKQLEGALSAARQRKTQIMMEEMEELRRKERHLGDINKQLKNKLE  171



>gb|AGV55405.1| MADS-box transcription factor AGAMOUSa [Medicago truncatula]
 gb|KEH36661.1| MADS-box transcription factor [Medicago truncatula]
 gb|AIT11837.1| AGAMOUSa [Medicago truncatula]
Length=260

 Score =   142 bits (357),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 86/200 (43%), Positives = 126/200 (63%), Gaps = 3/200 (2%)
 Frame = +3

Query  330  KKMGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYS  509
            +K+GRGKI+IK IEN  +RQVTF KRR+GLLKKA ELS+LCDAEVA+I+FSS  +L+EY+
Sbjct  14   RKIGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYA  73

Query  510  STSMKHTLSRYNK-CLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTG  686
            + S+K T++RY K C DS+ T    E   +   +E + L  +IS L++   Q++G+ L  
Sbjct  74   NNSVKETIARYKKACSDSSGTGSATEANAQFYQQEADKLRVQISNLQNNNRQMMGESLGS  133

Query  687  MGLNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQI--EELRG  860
            M   EL+ LE KL+  +  I+ +K +LL  ++E  +K+E      N+ LR +I   E   
Sbjct  134  MNAKELKNLESKLEKGISRIRSKKNELLFAEIEYMQKREIDLHNNNQLLRAKIAESERNH  193

Query  861  LVPSNVSMPMPTPYLEYYPV  920
               SN++M M      Y P+
Sbjct  194  SHHSNINMSMLPGGTNYEPM  213



>ref|XP_001757114.1| MIKCC MADS-domain protein PPMC5 [Physcomitrella patens]
 gb|EDQ77973.1| MIKCC MADS-domain protein PPMC5 [Physcomitrella patens]
Length=271

 Score =   142 bits (358),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 92/212 (43%), Positives = 132/212 (62%), Gaps = 17/212 (8%)
 Frame = +3

Query  336  MGRGKIDIKLIENVNSRQVTFSKRRSGLLKKAQELSILCDAEVAVIIFSSTDKLFEYSST  515
            MGRGKI+IK IEN  SRQVTFSKRR GLLKKA EL++LCDA+VA+IIFSST KLFE++S+
Sbjct  1    MGRGKIEIKKIENPTSRQVTFSKRRGGLLKKAHELAVLCDADVALIIFSSTGKLFEFASS  60

Query  516  -SMKHTLSRYNKCLDSTETPKIvekkpkvehkevevLNNEISELKSKQLQLLGKDLTGMG  692
             SM+  L RY+KC D ++T            +EV  L  E+  L+  Q  +LG+DL  + 
Sbjct  61   GSMRDILERYSKCPDGSQT----GVNSDFLGREVVKLRQELERLQHSQRHMLGEDLQVLT  116

Query  693  LNELRQLEHKLDGALLAIKGRKEQLLLEQLENSRKQEERALVENENLRRQIEELRGLVPS  872
            + +L QLE +LD     ++ RK QLLLE++E  R++E      NE LR+++ +++G++  
Sbjct  117  VPDLLQLEQQLDMGASRVRARKNQLLLEEIEELRRKEHDLHAVNEELRQRLADVKGML--  174

Query  873  NVSMPMPTPYLEYYPVLKNCSSGKDGAESLNT  968
                      LE  P  +  +SG  G + ++ 
Sbjct  175  ---------SLEAGPA-RAATSGSPGGQGVSA  196



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3626083034370