BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c1031_g1_i1 len=2405 path=[1171:0-1101 2273:1102-1127 2299:1128-1167
2273:1168-1193 2299:1194-1233 2273:1234-1259 3523:1260-2404]

Length=2405
                                                                      Score     E

ref|XP_009787168.1|  PREDICTED: seed biotin-containing protein SB...    162   5e-39   
ref|XP_009787169.1|  PREDICTED: seed biotin-containing protein SB...    162   7e-39   
ref|XP_009608525.1|  PREDICTED: seed biotin-containing protein SB...    159   8e-38   
ref|XP_009608524.1|  PREDICTED: seed biotin-containing protein SB...    159   8e-38   
ref|XP_011098036.1|  PREDICTED: embryonic protein DC-8-like             150   1e-34   
ref|XP_009591837.1|  PREDICTED: embryonic protein DC-8-like             146   5e-33   
ref|XP_004243405.2|  PREDICTED: seed biotin-containing protein SB...    138   4e-31   
ref|XP_006364103.1|  PREDICTED: seed biotin-containing protein SB...    127   3e-27   
ref|XP_009784311.1|  PREDICTED: seed biotin-containing protein SB...    127   4e-27   
ref|XP_009784310.1|  PREDICTED: seed biotin-containing protein SB...    127   4e-27   
ref|XP_009784313.1|  PREDICTED: embryonic protein DC-8-like isofo...    125   1e-26   
ref|XP_009381763.1|  PREDICTED: embryonic protein DC-8-like             123   2e-26   
ref|XP_010915616.1|  PREDICTED: embryonic protein DC-8                  120   1e-25   
ref|XP_009784312.1|  PREDICTED: embryonic protein DC-8-like isofo...    120   5e-25   
ref|XP_009142073.1|  PREDICTED: embryonic protein DC-8                  121   5e-25   
ref|XP_008783907.1|  PREDICTED: embryonic protein DC-8                  114   8e-24   
ref|XP_009614117.1|  PREDICTED: seed biotin-containing protein SB...    114   2e-23   
ref|XP_006348846.1|  PREDICTED: seed biotin-containing protein SB...    114   3e-23   
ref|XP_009614116.1|  PREDICTED: seed biotin-containing protein SB...    113   3e-23   
ref|XP_009800345.1|  PREDICTED: seed biotin-containing protein SB...    107   4e-21   
ref|XP_009800344.1|  PREDICTED: seed biotin-containing protein SB...    107   4e-21   
ref|XP_009800346.1|  PREDICTED: seed biotin-containing protein SB...    105   9e-21   
ref|XP_009800347.1|  PREDICTED: seed biotin-containing protein SB...    105   1e-20   
ref|XP_010657029.1|  PREDICTED: seed biotin-containing protein SB...    102   9e-20   
ref|XP_010657028.1|  PREDICTED: seed biotin-containing protein SB...    101   1e-19   
ref|XP_004248482.1|  PREDICTED: seed biotin-containing protein SB...    100   1e-18   
gb|KFK37108.1|  hypothetical protein AALP_AA4G213900                    100   2e-18   
ref|XP_006446761.1|  hypothetical protein CICLE_v10014817mg           99.0    4e-18   
ref|XP_008342805.1|  PREDICTED: seed biotin-containing protein SB...  99.4    5e-18   
emb|CDY14845.1|  BnaC04g48420D                                        98.2    9e-18   
gb|KDO63323.1|  hypothetical protein CISIN_1g009018mg                 96.7    2e-17   
ref|XP_006469129.1|  PREDICTED: seed biotin-containing protein SB...  96.7    2e-17   
ref|XP_010038686.1|  PREDICTED: seed biotin-containing protein SB...  96.7    4e-17   
gb|KDP31781.1|  hypothetical protein JCGZ_12242                       94.4    4e-17   
gb|KCW47312.1|  hypothetical protein EUGRSUZ_K01100                   95.5    7e-17   
ref|XP_004303166.1|  PREDICTED: seed biotin-containing protein SB...  94.7    1e-16   
ref|XP_011002541.1|  PREDICTED: LOW QUALITY PROTEIN: seed biotin-...  93.6    2e-16   
ref|XP_010327091.1|  PREDICTED: seed biotin-containing protein SB...  94.0    2e-16   
ref|XP_009354271.1|  PREDICTED: seed biotin-containing protein SBP65  94.4    2e-16   
ref|XP_002325582.2|  late embryogenesis abundant domain-containin...  92.0    4e-16   Populus trichocarpa [western balsam poplar]
ref|XP_006371487.1|  hypothetical protein POPTR_0019s12000g           91.3    5e-16   
ref|XP_010665973.1|  PREDICTED: seed biotin-containing protein SBP65  92.0    6e-16   
ref|XP_002962904.1|  hypothetical protein SELMODRAFT_64748            89.0    7e-16   
gb|KHG20193.1|  Embryonic DC-8                                        91.3    1e-15   
ref|XP_004303167.1|  PREDICTED: seed biotin-containing protein SB...  90.1    3e-15   
ref|XP_002962372.1|  hypothetical protein SELMODRAFT_64743            84.3    3e-14   
ref|XP_006295815.1|  hypothetical protein CARUB_v10024941mg           84.7    2e-13   
emb|CDP15910.1|  unnamed protein product                              83.2    2e-13   
ref|NP_181784.1|  late embryogenesis abundant domain-containing p...  84.3    2e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002525126.1|  conserved hypothetical protein                   84.0    2e-13   Ricinus communis
sp|Q41060.1|SBP65_PEA  RecName: Full=Seed biotin-containing prote...  83.6    2e-13   Pisum sativum [garden pea]
ref|XP_002881860.1|  At2g42560                                        82.8    6e-13   
dbj|BAJ08390.1|  ECP63 protein                                        82.4    6e-13   
ref|XP_010243092.1|  PREDICTED: embryonic protein DC-8-like isofo...  82.0    8e-13   
ref|XP_010506084.1|  PREDICTED: seed biotin-containing protein SB...  82.4    8e-13   
ref|XP_010517781.1|  PREDICTED: seed biotin-containing protein SB...  82.0    1e-12   
ref|XP_006648506.1|  PREDICTED: embryonic protein DC-8-like           81.6    1e-12   
ref|XP_010506086.1|  PREDICTED: seed biotin-containing protein SB...  81.6    1e-12   
gb|KHG00180.1|  Seed biotin-containing SBP65                          81.6    1e-12   
ref|XP_010508555.1|  PREDICTED: seed biotin-containing protein SB...  81.3    2e-12   
ref|XP_010517782.1|  PREDICTED: seed biotin-containing protein SB...  81.3    2e-12   
gb|KEH39260.1|  seed biotin containing protein SBP65, putative        80.9    2e-12   
ref|XP_008381357.1|  PREDICTED: embryonic protein DC-8-like           80.5    2e-12   
ref|XP_010505211.1|  PREDICTED: embryonic protein DC-8-like           80.1    2e-12   
ref|XP_006430349.1|  hypothetical protein CICLE_v10013512mg           80.1    3e-12   
ref|XP_010508556.1|  PREDICTED: seed biotin-containing protein SB...  80.1    3e-12   
ref|XP_010426937.1|  PREDICTED: embryonic protein DC-8-like           79.0    6e-12   
dbj|BAA11017.1|  LEA protein in group 3                               78.2    9e-12   Arabidopsis thaliana [mouse-ear cress]
ref|NP_181202.1|  putative phosphotyrosine                            77.8    1e-11   Arabidopsis thaliana [mouse-ear cress]
gb|KHN03228.1|  Late embryogenesis abundant protein D-29              77.8    1e-11   
ref|NP_001238201.1|  Lea protein precursor                            77.8    1e-11   
ref|XP_006593487.1|  PREDICTED: 51 kDa seed maturation protein is...  77.8    1e-11   
ref|NP_001238138.1|  51 kDa seed maturation protein precursor         77.8    1e-11   
ref|XP_008456425.1|  PREDICTED: seed biotin-containing protein SBP65  77.8    1e-11   
ref|XP_010069075.1|  PREDICTED: embryonic protein DC-8                77.4    2e-11   
ref|XP_010313857.1|  PREDICTED: seed biotin-containing protein SB...  77.0    2e-11   
gb|AAQ65102.1|  At2g42560                                             77.8    2e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004252091.1|  PREDICTED: seed biotin-containing protein SB...  77.0    2e-11   
ref|XP_010243100.1|  PREDICTED: embryonic protein DC-8-like isofo...  77.0    2e-11   
gb|KCW89293.1|  hypothetical protein EUGRSUZ_A01582                   77.0    3e-11   
ref|XP_007211363.1|  hypothetical protein PRUPE_ppa002371mg           77.4    3e-11   
ref|XP_010504059.1|  PREDICTED: embryonic protein DC-8-like           76.6    3e-11   
ref|NP_190872.1|  putative late embryogenesis abundant protein        76.6    3e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006411517.1|  hypothetical protein EUTSA_v10017645mg           76.6    3e-11   
dbj|BAF01507.1|  seed maturation protein                              77.0    3e-11   Arabidopsis thaliana [mouse-ear cress]
sp|P20075.1|LEAD8_DAUCA  RecName: Full=Embryonic protein DC-8         77.0    3e-11   Daucus carota [carrots]
ref|XP_010515787.1|  PREDICTED: embryonic protein DC-8                76.6    4e-11   
ref|XP_009767285.1|  PREDICTED: embryonic protein DC-8-like           75.9    5e-11   
ref|XP_009419789.1|  PREDICTED: LOW QUALITY PROTEIN: seed biotin-...  73.6    5e-11   
ref|XP_006292658.1|  hypothetical protein CARUB_v10018901mg           75.9    5e-11   
ref|XP_006410837.1|  hypothetical protein EUTSA_v10017525mg           75.9    6e-11   
ref|XP_010279088.1|  PREDICTED: seed biotin-containing protein SBP65  76.6    6e-11   
ref|XP_010683930.1|  PREDICTED: embryonic protein DC-8-like           75.9    7e-11   
ref|XP_006592863.1|  PREDICTED: seed biotin-containing protein SB...  75.9    7e-11   
emb|CDY47980.1|  BnaA04g24580D                                        74.3    2e-10   
gb|ACJ39155.1|  LEA protein group 3                                   73.9    2e-10   Brassica napus [oilseed rape]
gb|ACU23559.1|  unknown                                               73.9    2e-10   Glycine max [soybeans]
ref|XP_007154470.1|  hypothetical protein PHAVU_003G121900g           72.8    3e-10   
ref|XP_002881457.1|  hypothetical protein ARALYDRAFT_482642           73.2    3e-10   
ref|XP_010277746.1|  PREDICTED: seed biotin-containing protein SB...  71.2    4e-10   
ref|XP_010277747.1|  PREDICTED: seed biotin-containing protein SB...  70.9    4e-10   
ref|XP_007027566.1|  Embryonic DC-8-like protein                      72.0    6e-10   
ref|XP_001765334.1|  predicted protein                                72.8    7e-10   
ref|XP_006294211.1|  hypothetical protein CARUB_v10023207mg           72.0    8e-10   
gb|KDO37469.1|  hypothetical protein CISIN_1g048372mg                 70.5    8e-10   
gb|ELW68225.1|  Protein ALO17                                         72.0    1e-09   
gb|EYU30783.1|  hypothetical protein MIMGU_mgv1a025154mg              71.6    1e-09   
ref|XP_009141603.1|  PREDICTED: embryonic protein DC-8-like           71.2    1e-09   
dbj|BAN67645.1|  PvLEA5 protein                                       72.0    1e-09   
ref|XP_008348664.1|  PREDICTED: embryonic protein DC-8-like           69.7    2e-09   
gb|KGN47249.1|  hypothetical protein Csa_6G235570                     70.9    2e-09   
ref|NP_001235522.1|  seed biotin-containing protein SBP65             71.2    2e-09   
gb|ACS49840.1|  seed biotinylated protein 68 kDa isoform              70.9    3e-09   Glycine max [soybeans]
ref|XP_004149384.1|  PREDICTED: seed biotin-containing protein SB...  70.5    3e-09   
ref|NP_001189549.1|  late embryogenesis abundant domain-containin...  70.1    3e-09   
dbj|BAH56960.1|  AT3G53040                                            68.6    3e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_005763345.1|  hypothetical protein EMIHUDRAFT_48134            66.6    3e-09   
ref|NP_179425.1|  late embryogenesis abundant domain-containing p...  70.1    4e-09   Arabidopsis thaliana [mouse-ear cress]
gb|KDO60989.1|  hypothetical protein CISIN_1g041124mg                 68.2    4e-09   
ref|XP_004167414.1|  PREDICTED: seed biotin-containing protein SB...  69.7    5e-09   
emb|CDX75026.1|  BnaA05g07720D                                        68.9    5e-09   
ref|XP_006376353.1|  late embryogenesis abundant domain-containin...  70.1    5e-09   
ref|XP_007678355.1|  hypothetical protein BAUCODRAFT_149660           67.4    7e-09   
gb|KHG08157.1|  Embryonic DC-8                                        68.9    7e-09   
dbj|BAE92616.1|  PvLEA1 protein                                       69.3    9e-09   Polypedilum vanderplanki
ref|XP_007886854.1|  PREDICTED: E3 ubiquitin-protein ligase RNF213    69.7    1e-08   
gb|EJY66449.1|  hypothetical protein OXYTRI_13266                     69.3    1e-08   
gb|KFK34557.1|  hypothetical protein AALP_AA5G161400                  68.6    1e-08   
ref|XP_010904970.1|  PREDICTED: embryonic protein DC-8 isoform X1     68.2    2e-08   
ref|XP_010904971.1|  PREDICTED: embryonic protein DC-8 isoform X2     68.2    2e-08   
emb|CDY33171.1|  BnaC04g08680D                                        67.0    2e-08   
ref|XP_004487170.1|  PREDICTED: seed biotin-containing protein SB...  67.8    3e-08   
ref|XP_006285554.1|  hypothetical protein CARUB_v10006996mg           67.4    3e-08   
ref|XP_009143569.1|  PREDICTED: embryonic protein DC-8                67.0    3e-08   
ref|XP_008785503.1|  PREDICTED: embryonic protein DC-8-like isofo...  66.2    3e-08   
ref|XP_011101471.1|  PREDICTED: embryonic protein DC-8                67.0    4e-08   
emb|CAF32327.1|  late embryogenesis abundant protein                  66.2    4e-08   Pisum sativum [garden pea]
ref|XP_009370069.1|  PREDICTED: embryonic protein DC-8-like isofo...  66.6    5e-08   
ref|XP_009370071.1|  PREDICTED: embryonic protein DC-8-like isofo...  66.6    5e-08   
ref|XP_006409163.1|  hypothetical protein EUTSA_v10022656mg           66.6    5e-08   
ref|WP_022921493.1|  hypothetical protein                             65.9    7e-08   
ref|XP_009375647.1|  PREDICTED: embryonic protein DC-8-like           65.9    7e-08   
ref|XP_010667914.1|  PREDICTED: uncharacterized protein LOC104884910  66.2    1e-07   
ref|XP_007804287.1|  hypothetical protein EPUS_00440                  66.2    1e-07   
ref|XP_009148762.1|  PREDICTED: embryonic protein DC-8                65.1    1e-07   
emb|CDX76237.1|  BnaA04g05010D                                        64.3    2e-07   
gb|EMS50716.1|  hypothetical protein TRIUR3_33086                     64.3    2e-07   
ref|XP_008806238.1|  PREDICTED: embryonic protein DC-8-like isofo...  64.3    2e-07   
emb|CDY58291.1|  BnaCnng32920D                                        64.3    2e-07   
ref|XP_003535256.1|  PREDICTED: embryonic protein DC-8-like           63.9    3e-07   
ref|XP_008806239.1|  PREDICTED: embryonic protein DC-8-like isofo...  63.9    3e-07   
ref|XP_009370070.1|  PREDICTED: embryonic protein DC-8-like isofo...  63.9    4e-07   
ref|XP_011038233.1|  PREDICTED: LOW QUALITY PROTEIN: seed biotin-...  64.3    4e-07   
dbj|BAK05046.1|  predicted protein                                    63.2    4e-07   
gb|KFK40226.1|  hypothetical protein AALP_AA3G347000                  63.9    4e-07   
gb|KHN48209.1|  Embryonic protein DC-8                                63.2    6e-07   
ref|XP_002877899.1|  hypothetical protein ARALYDRAFT_485679           62.8    8e-07   
ref|XP_006145969.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...  63.5    8e-07   
ref|XP_010228683.1|  PREDICTED: late embryogenesis abundant prote...  62.0    9e-07   
ref|XP_009617214.1|  PREDICTED: embryonic protein DC-8-like           62.0    1e-06   
gb|AFK36039.1|  unknown                                               60.8    2e-06   
gb|KEH24083.1|  35 kDa seed maturation protein, putative              60.8    2e-06   
ref|XP_829568.1|  hypothetical protein                                62.4    2e-06   Trypanosoma brucei brucei TREU927
ref|XP_011100211.1|  PREDICTED: seed biotin-containing protein SB...  60.8    2e-06   
ref|XP_008785585.1|  PREDICTED: seed biotin-containing protein SB...  59.3    2e-06   
ref|XP_003590405.1|  Late embryongenesis abundant protein             60.1    4e-06   
ref|XP_006838743.1|  hypothetical protein AMTR_s00002p00254930        59.3    5e-06   
emb|CCO06495.1|  late embryogenesis abundant protein                  60.5    5e-06   
ref|XP_011100212.1|  PREDICTED: embryonic protein DC-8-like isofo...  59.7    6e-06   
ref|XP_007201970.1|  hypothetical protein PRUPE_ppa004780mg           60.1    6e-06   
ref|XP_006403734.1|  hypothetical protein EUTSA_v10010945mg           59.7    6e-06   
ref|XP_004508082.1|  PREDICTED: embryonic protein DC-8-like           59.7    6e-06   
ref|XP_010558975.1|  PREDICTED: embryonic protein DC-8-like           58.5    1e-05   
ref|XP_010524054.1|  PREDICTED: seed biotin-containing protein SBP65  58.9    1e-05   
ref|XP_006411984.1|  hypothetical protein EUTSA_v10026959mg           58.5    2e-05   
ref|XP_010432162.1|  PREDICTED: embryonic protein DC-8 isoform X3     58.5    2e-05   
ref|XP_010432161.1|  PREDICTED: embryonic protein DC-8 isoform X2     58.5    2e-05   
ref|XP_011099628.1|  PREDICTED: embryonic protein DC-8 isoform X2     58.5    2e-05   
gb|AJA33578.1|  late embryogenesis abundant protein LEA4-3            57.4    2e-05   
ref|XP_008244486.1|  PREDICTED: seed biotin-containing protein SBP65  58.5    2e-05   
emb|CAA79329.1|  BP8                                                  58.2    2e-05   Betula pendula [white birch]
ref|XP_011099627.1|  PREDICTED: embryonic protein DC-8 isoform X1     58.2    2e-05   
ref|XP_002915863.1|  PREDICTED: hypothetical protein LOC100464398     58.5    3e-05   
gb|KFK30157.1|  hypothetical protein AALP_AA7G224400                  57.0    3e-05   
gb|EYU41141.1|  hypothetical protein MIMGU_mgv1a012420mg              56.2    3e-05   
ref|XP_008358215.1|  PREDICTED: embryonic protein DC-8-like           55.8    3e-05   
ref|XP_008645565.1|  PREDICTED: embryonic protein DC-8-like           57.8    3e-05   
gb|EMT08908.1|  hypothetical protein F775_29269                       57.4    3e-05   
ref|XP_010432160.1|  PREDICTED: embryonic protein DC-8 isoform X1     57.8    3e-05   
ref|XP_010446772.1|  PREDICTED: embryonic protein DC-8-like isofo...  57.4    4e-05   
emb|CBI30214.3|  unnamed protein product                              56.6    4e-05   
ref|XP_007149753.1|  hypothetical protein PHAVU_005G096300g           57.4    4e-05   
ref|XP_002528631.1|  late embryogenesis abundant, putative            56.6    5e-05   Ricinus communis
ref|XP_011016011.1|  PREDICTED: embryonic protein DC-8                56.6    6e-05   
gb|EYU38595.1|  hypothetical protein MIMGU_mgv1a021925mg              56.6    6e-05   
gb|KHJ90756.1|  late embryogeneis abundant protein                    55.1    6e-05   
ref|XP_003593602.1|  Late embryogenesis abundant protein              56.2    6e-05   
ref|XP_006366996.1|  PREDICTED: embryonic protein DC-8-like           56.2    7e-05   
ref|XP_010437329.1|  PREDICTED: embryonic protein DC-8                56.2    7e-05   
ref|XP_006852474.1|  hypothetical protein AMTR_s00021p00128760        55.5    8e-05   
gb|KFK33525.1|  hypothetical protein AALP_AA5G024300                  53.9    8e-05   
ref|XP_010446774.1|  PREDICTED: embryonic protein DC-8-like isofo...  56.2    9e-05   
ref|XP_006374433.1|  embryonic cell protein 63                        55.8    9e-05   
ref|XP_002863597.1|  late embryogenesis abundant domain-containin...  55.5    1e-04   
ref|XP_010446773.1|  PREDICTED: embryonic protein DC-8-like isofo...  55.8    1e-04   
ref|NP_001049970.2|  Os03g0322900                                     54.7    1e-04   Oryza sativa Japonica Group [Japonica rice]
gb|ADR66512.1|  unknown                                               55.1    1e-04   
emb|CDJ80107.1|  Protein LEA-1, isoform k                             55.8    1e-04   
ref|XP_010247790.1|  PREDICTED: embryonic protein DC-8-like           55.1    2e-04   
ref|XP_010465544.1|  PREDICTED: late embryogenesis abundant prote...  53.9    2e-04   
ref|XP_010439531.1|  PREDICTED: uncharacterized protein ECU03_161...  54.3    2e-04   
ref|XP_004303052.1|  PREDICTED: embryonic protein DC-8-like           55.1    2e-04   
ref|NP_001238546.1|  maturation polypeptide                           55.1    2e-04   
ref|XP_001783572.1|  predicted protein                                54.7    3e-04   
sp|A3AHG5.1|LEA1_ORYSJ  RecName: Full=Late embryogenesis abundant...  54.3    3e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010654020.1|  PREDICTED: embryonic protein DC-8-like isofo...  53.9    3e-04   
ref|XP_002884129.1|  hypothetical protein ARALYDRAFT_480743           54.3    3e-04   
gb|AFW88513.1|  hypothetical protein ZEAMMB73_579239                  53.9    3e-04   
emb|CDY25166.1|  BnaC07g03410D                                        54.3    3e-04   
ref|XP_002284002.1|  PREDICTED: embryonic protein DC-8-like isofo...  53.9    3e-04   Vitis vinifera
dbj|BAN67647.1|  PvLEA7 protein                                       52.0    5e-04   
gb|EFA83269.1|  hypothetical protein PPL_04059                        51.2    6e-04   Polysphondylium pallidum PN500
ref|XP_006651332.1|  PREDICTED: late embryogenesis abundant prote...  52.4    7e-04   
ref|XP_008392606.1|  PREDICTED: embryonic protein DC-8-like           52.4    7e-04   
gb|ACU18424.1|  unknown                                               52.4    8e-04   Glycine max [soybeans]
ref|XP_009102270.1|  PREDICTED: embryonic protein DC-8-like           53.1    8e-04   
ref|XP_002869913.1|  late embryogenesis abundant domain-containin...  52.0    8e-04   
gb|AFW88514.1|  hypothetical protein ZEAMMB73_579239                  52.0    8e-04   
ref|XP_010494442.1|  PREDICTED: embryonic protein DC-8-like           52.4    9e-04   
ref|XP_002984024.1|  hypothetical protein SELMODRAFT_119253           50.4    0.001   
gb|ACD14089.1|  group 3 LEA protein                                   52.8    0.001   Medicago sativa [alfalfa]



>ref|XP_009787168.1| PREDICTED: seed biotin-containing protein SBP65-like isoform 
X1 [Nicotiana sylvestris]
Length=568

 Score =   162 bits (411),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 169/530 (32%), Positives = 232/530 (44%), Gaps = 154/530 (29%)
 Frame = +2

Query  188   MASEQLRRDNKTGERAVEVEKDRVPKMASHFESLAEKVADDTAADFHPaavrvtqttvat  367
             MAS+Q RR+N T E  + +EK++VP++ASHFESLAEKV     AD HPA           
Sbjct  1     MASQQERRENVTDEGEINLEKNKVPQIASHFESLAEKV--QGVADVHPA-----------  47

Query  368   tEHEDQGKTAQKGGRAVHDQQT---RGTTAQREHDQAKSWKATEETQAGRHDDIQQNRPV  538
                         G  A+H + T   +G   ++ H   +  +  ++ Q  +  DIQ+ +  
Sbjct  48    ------------GPGAIHVKSTVTDQGAHEKKSHGHEQESQQMQQAQRKKEGDIQREK--  93

Query  539   RVGGIEFYSGQDARSGR--DETTRRQGFEERPGGVKFEVHSGQGGGQST-----------  679
                     S   A+S    +E  ++QGFEERPGGVKFEVH  +  G  T           
Sbjct  94    ------LPSTDQAKSSEIVNEGRKQQGFEERPGGVKFEVHGQEQKGSDTSRETQMQKQEG  147

Query  680   --RLQGLEERPggvkvevhtghgggeeRR----------------DHSGLSLEEIGKYRQ  805
               R QG+        V          + R                +  G SLEEI +YR 
Sbjct  148   ESRGQGISSMQQSRGVATGGQQETETQARGKGESRAGEVTHGTTEETKGPSLEEISQYRG  207

Query  806   TAQQKSIDALQTAQNKYEKAK---------------------------------NTTKEN  886
             TAQQ S++A++ A+ +YEKAK                                 +T  + 
Sbjct  208   TAQQNSMEAIRAAEERYEKAKEKGASSLQNVKESASHGLGAAGTYATEKGAQAKDTVTQG  267

Query  887   VQSGSQYLVEKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSA  1066
             VQ G+QY+ EKAGAAKDTAL+K QQAY A                               
Sbjct  268   VQKGTQYVAEKAGAAKDTALEKGQQAYAA-------------------------------  296

Query  1067  KQTKDTLSSAGQTAKDYTVQSAQQTKDTLS-SAGQTAKDYTVQSAQQTK-------DTLS  1222
               TKDTLS+AGQTA    VQSAQQ KD ++  AG+T K+Y V   ++ K       +++ 
Sbjct  297   --TKDTLSTAGQTA----VQSAQQAKDYVAQKAGET-KEYVVSKTEEAKEIEAPFPESVQ  349

Query  1223  SAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQ-AKD  1399
                ++A  Y  + A + KD     G+ A  Y  + A+  KE    AG  A  +T + A D
Sbjct  350   EKSKSATSYAGEKAAKVKDVTVETGKCAVGYAGKVAETVKEKAVVAGWGAAHFTAEKAAD  409

Query  1400  -------YASQKAGEAGNKASEAKERGTEMSKNAASYAGQKVTEAKDVTV  1528
                     AS  AG AG+KA  AK+   +  K    YA  K+  AKD  V
Sbjct  410   ATKAVAGVASTVAGYAGDKAVAAKDVVADAGKKTVGYAEDKLVAAKDYVV  459



>ref|XP_009787169.1| PREDICTED: seed biotin-containing protein SBP65-like isoform 
X2 [Nicotiana sylvestris]
Length=542

 Score =   162 bits (409),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 169/530 (32%), Positives = 232/530 (44%), Gaps = 154/530 (29%)
 Frame = +2

Query  188   MASEQLRRDNKTGERAVEVEKDRVPKMASHFESLAEKVADDTAADFHPaavrvtqttvat  367
             MAS+Q RR+N T E  + +EK++VP++ASHFESLAEKV     AD HPA           
Sbjct  1     MASQQERRENVTDEGEINLEKNKVPQIASHFESLAEKV--QGVADVHPA-----------  47

Query  368   tEHEDQGKTAQKGGRAVHDQQT---RGTTAQREHDQAKSWKATEETQAGRHDDIQQNRPV  538
                         G  A+H + T   +G   ++ H   +  +  ++ Q  +  DIQ+ +  
Sbjct  48    ------------GPGAIHVKSTVTDQGAHEKKSHGHEQESQQMQQAQRKKEGDIQREK--  93

Query  539   RVGGIEFYSGQDARSGR--DETTRRQGFEERPGGVKFEVHSGQGGGQST-----------  679
                     S   A+S    +E  ++QGFEERPGGVKFEVH  +  G  T           
Sbjct  94    ------LPSTDQAKSSEIVNEGRKQQGFEERPGGVKFEVHGQEQKGSDTSRETQMQKQEG  147

Query  680   --RLQGLEERPggvkvevhtghgggeeRR----------------DHSGLSLEEIGKYRQ  805
               R QG+        V          + R                +  G SLEEI +YR 
Sbjct  148   ESRGQGISSMQQSRGVATGGQQETETQARGKGESRAGEVTHGTTEETKGPSLEEISQYRG  207

Query  806   TAQQKSIDALQTAQNKYEKAK---------------------------------NTTKEN  886
             TAQQ S++A++ A+ +YEKAK                                 +T  + 
Sbjct  208   TAQQNSMEAIRAAEERYEKAKEKGASSLQNVKESASHGLGAAGTYATEKGAQAKDTVTQG  267

Query  887   VQSGSQYLVEKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSA  1066
             VQ G+QY+ EKAGAAKDTAL+K QQAY A                               
Sbjct  268   VQKGTQYVAEKAGAAKDTALEKGQQAYAA-------------------------------  296

Query  1067  KQTKDTLSSAGQTAKDYTVQSAQQTKDTLS-SAGQTAKDYTVQSAQQTK-------DTLS  1222
               TKDTLS+AGQTA    VQSAQQ KD ++  AG+T K+Y V   ++ K       +++ 
Sbjct  297   --TKDTLSTAGQTA----VQSAQQAKDYVAQKAGET-KEYVVSKTEEAKEIEAPFPESVQ  349

Query  1223  SAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQ-AKD  1399
                ++A  Y  + A + KD     G+ A  Y  + A+  KE    AG  A  +T + A D
Sbjct  350   EKSKSATSYAGEKAAKVKDVTVETGKCAVGYAGKVAETVKEKAVVAGWGAAHFTAEKAAD  409

Query  1400  -------YASQKAGEAGNKASEAKERGTEMSKNAASYAGQKVTEAKDVTV  1528
                     AS  AG AG+KA  AK+   +  K    YA  K+  AKD  V
Sbjct  410   ATKAVAGVASTVAGYAGDKAVAAKDVVADAGKKTVGYAEDKLVAAKDYVV  459



>ref|XP_009608525.1| PREDICTED: seed biotin-containing protein SBP65-like isoform 
X2 [Nicotiana tomentosiformis]
Length=538

 Score =   159 bits (401),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 174/511 (34%), Positives = 231/511 (45%), Gaps = 120/511 (23%)
 Frame = +2

Query  188   MASEQLRRDNKTGERAVEVEKDRVPKMASHFESLAEKVADDTAADFHPaavrvtqttvat  367
             MAS+Q +R+N T ER + +EK+RVP+MASHFESLAEKV  + AAD HPA           
Sbjct  1     MASQQEKRENVTDEREINLEKNRVPQMASHFESLAEKV--EGAADVHPAGTGSIHVKSTV  58

Query  368   tEHEDQGKTAQKGGRAVHDQQTRGTTAQREHDQAKSWKATEETQAGRHDDIQQNRPVRVG  547
             T   DQG      G      Q      Q   DQAKS   +E    GR+    + RP   G
Sbjct  59    TTDTDQGDK----GEQSQQMQQAQREKQSSTDQAKS---SEIVNQGRNQQGFEERP---G  108

Query  548   GIEFYS-GQDAR---SGRDETTRRQGFEERPGGVKFEVHS---GQGGGQSTRLQGLEERP  706
             G++F   GQ+ +   +GR+   ++Q  E R  G+     S   G GG Q T  Q      
Sbjct  109   GVKFVVHGQEQKGSDTGRESQMQKQEGESRGQGISSMQQSRGVGTGGQQETETQA-----  163

Query  707   ggvkvevhtghgggeeRRDHSGLSLEEIGKYRQTAQQKSIDALQTAQNKYEKAK------  868
                + E   G        +  G SLEEI +YR TAQQ S++A++ A+ +YEKAK      
Sbjct  164   -SGQDESRAGGVTHGTTEETKGPSLEEISQYRGTAQQNSMEAIRAAEERYEKAKEKGAST  222

Query  869   ---------------------------NTTKENVQSGSQYLVEKAGAAKDTALQKTQQAY  967
                                        +T  + VQ G+QY+ EKAG AKDTAL+K QQAY
Sbjct  223   LQNVKESATHGLSAAGTYATEKGAQAKDTVTQGVQKGTQYVAEKAGVAKDTALEKGQQAY  282

Query  968   NAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKD  1147
              A                                 TKDTLSSAGQTA    VQSAQQ KD
Sbjct  283   AA---------------------------------TKDTLSSAGQTA----VQSAQQAKD  305

Query  1148  TLS-SAGQTAKDYTVQSAQQTKDTLSSAGQ----TAKD-----------YTVQSAQQAKD  1279
              ++  AG+T K+Y +   ++ K+  + + +     AK+           Y  + A + KD
Sbjct  306   YVAQKAGET-KEYVIPKTEEAKEIETPSPEEIASVAKENVQEKSKSETSYVGEKATKVKD  364

Query  1280  TLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQ-AKD-------YASQKAGEAGNK  1435
                  G+ A  Y  + A+  KE    AG  A  +T + A D        AS  AG AG+K
Sbjct  365   VTVETGKGAVGYAGKVAETVKEKAVVAGWGAAHFTAEKAADATKAVAGVASTVAGYAGDK  424

Query  1436  ASEAKERGTEMSKNAASYAGQKVTEAKDVTV  1528
             A  AKE   ++ K    YA  K+  AKD  V
Sbjct  425   AVAAKEVVADVGKKTVGYAEDKLVAAKDYVV  455



>ref|XP_009608524.1| PREDICTED: seed biotin-containing protein SBP65-like isoform 
X1 [Nicotiana tomentosiformis]
Length=564

 Score =   159 bits (402),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 172/511 (34%), Positives = 232/511 (45%), Gaps = 120/511 (23%)
 Frame = +2

Query  188   MASEQLRRDNKTGERAVEVEKDRVPKMASHFESLAEKVADDTAADFHPaavrvtqttvat  367
             MAS+Q +R+N T ER + +EK+RVP+MASHFESLAEKV  + AAD HPA           
Sbjct  1     MASQQEKRENVTDEREINLEKNRVPQMASHFESLAEKV--EGAADVHPAGTGSIHVKSTV  58

Query  368   tEHEDQGKTAQKGGRAVHDQQTRGTTAQREHDQAKSWKATEETQAGRHDDIQQNRPVRVG  547
             T   DQG   ++  +    Q+ +    Q   DQAKS   +E    GR+    + RP   G
Sbjct  59    TTDTDQGDKGEQSQQMQQAQREK----QSSTDQAKS---SEIVNQGRNQQGFEERP---G  108

Query  548   GIEFYS-GQDAR---SGRDETTRRQGFEERPGGVKFEVHS---GQGGGQSTRLQGLEERP  706
             G++F   GQ+ +   +GR+   ++Q  E R  G+     S   G GG Q T  Q      
Sbjct  109   GVKFVVHGQEQKGSDTGRESQMQKQEGESRGQGISSMQQSRGVGTGGQQETETQ------  162

Query  707   ggvkvevhtghgggeeRRDHSGLSLEEIGKYRQTAQQKSIDALQTAQNKYEKAK------  868
                + E   G        +  G SLEEI +YR TAQQ S++A++ A+ +YEKAK      
Sbjct  163   ASGQDESRAGGVTHGTTEETKGPSLEEISQYRGTAQQNSMEAIRAAEERYEKAKEKGAST  222

Query  869   ---------------------------NTTKENVQSGSQYLVEKAGAAKDTALQKTQQAY  967
                                        +T  + VQ G+QY+ EKAG AKDTAL+K QQAY
Sbjct  223   LQNVKESATHGLSAAGTYATEKGAQAKDTVTQGVQKGTQYVAEKAGVAKDTALEKGQQAY  282

Query  968   NAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKD  1147
              A                                 TKDTLSSAGQTA    VQSAQQ KD
Sbjct  283   AA---------------------------------TKDTLSSAGQTA----VQSAQQAKD  305

Query  1148  TLS-SAGQTAKDYTV---------------QSAQQTKDTLSSAGQTAKDYTVQSAQQAKD  1279
              ++  AG+T K+Y +               + A   K+ +    ++   Y  + A + KD
Sbjct  306   YVAQKAGET-KEYVIPKTEEAKEIETPSPEEIASVAKENVQEKSKSETSYVGEKATKVKD  364

Query  1280  TLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQ-AKD-------YASQKAGEAGNK  1435
                  G+ A  Y  + A+  KE    AG  A  +T + A D        AS  AG AG+K
Sbjct  365   VTVETGKGAVGYAGKVAETVKEKAVVAGWGAAHFTAEKAADATKAVAGVASTVAGYAGDK  424

Query  1436  ASEAKERGTEMSKNAASYAGQKVTEAKDVTV  1528
             A  AKE   ++ K    YA  K+  AKD  V
Sbjct  425   AVAAKEVVADVGKKTVGYAEDKLVAAKDYVV  455



>ref|XP_011098036.1| PREDICTED: embryonic protein DC-8-like [Sesamum indicum]
Length=612

 Score =   150 bits (379),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 133/357 (37%), Positives = 175/357 (49%), Gaps = 39/357 (11%)
 Frame = +2

Query  533   PVRVGGIEFYSGQDARSGRDETTRRQGFEERPGGVKFEVHSGQGGGQSTRLQ--GLEERP  706
             PVRVGGIE+ +G +  S R+    ++   E  G +  ++HS    G   + Q  G+E   
Sbjct  61    PVRVGGIEYSAGGEKGSEREVGKEKKA--EEGGKMGSQMHSAAEKGSQVQQQHVGVE---  115

Query  707   ggvkvevhtghgggeeRRDHSGLSLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKEN  886
                       HG         G SLEEI   R TAQQ S++A++ A+ +YEKAK    E 
Sbjct  116   -AGHDRSKEMHGKAGGEEGKGGPSLEEISNLRSTAQQNSMEAIRAAEERYEKAKEMAMEK  174

Query  887   VQSGSQYLVEKAGAAKDTALQKTQQAYNA---AKDTTISKTQQAKDTFSSTGQT------  1039
              Q    Y  EKA  AKD    K Q A      AKD T+ K  +AKD  SS GQ+      
Sbjct  175   GQQAKDYTAEKAAEAKDVISSKGQYAAEKGQQAKDYTVQKAMEAKDVISSKGQSAAEKGQ  234

Query  1040  -AKDYTTQSAKQTKDTLSSAGQT-------AKDYTVQSAQQTKDTLSSAGQTAKDYTVQS  1195
              AKDYT Q A + KD +SS GQ+       AKDYT Q A + KD +SS GQ+A     + 
Sbjct  235   QAKDYTVQKAMEAKDVISSKGQSVAEKGQQAKDYTAQKAMEAKDVISSKGQSAAQLAAEK  294

Query  1196  AQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKET---------  1348
              Q+ KD  +     AKDYT + A  AKD +S  GQ+A  Y  + A+ AK+T         
Sbjct  295   GQKAKDYTAQKAMEAKDYTAEKAIAAKDVISSKGQSAAQYAAEKAKVAKDTAVDTTVTTA  354

Query  1349  --LSKAGQAAKDYTVQAKDYASQKAGEAGNKASEAKERGTEMSKNAASYAGQKVTEA  1513
               L +   AAKD TV++   A   AG AG  A++ K +       AA Y  +KV EA
Sbjct  355   GYLGEKAGAAKDVTVESGKGA---AGYAGKVAADVKGQAVVAGWGAAHYTLEKVAEA  408


 Score = 73.2 bits (178),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 53/131 (40%), Positives = 68/131 (52%), Gaps = 15/131 (11%)
 Frame = +2

Query  1133  QQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKD  1312
             ++ K+     GQ AKDYT + A + KD +SS GQ A +                GQ AKD
Sbjct  165   EKAKEMAMEKGQQAKDYTAEKAAEAKDVISSKGQYAAE---------------KGQQAKD  209

Query  1313  YTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGNKASEAKERGTEMSKNAASYA  1492
             YTVQ A +AK+ +S  GQ+A +   QAKDY  QKA EA +  S   +   E  + A  Y 
Sbjct  210   YTVQKAMEAKDVISSKGQSAAEKGQQAKDYTVQKAMEAKDVISSKGQSVAEKGQQAKDYT  269

Query  1493  GQKVTEAKDVT  1525
              QK  EAKDV 
Sbjct  270   AQKAMEAKDVI  280


 Score = 67.8 bits (164),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 75/225 (33%), Positives = 98/225 (44%), Gaps = 19/225 (8%)
 Frame = +2

Query  839   TAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDT  1018
             TAQ   E AK+      QS +Q   EK   AKD   QK  +A    KD T  K   AKD 
Sbjct  269   TAQKAME-AKDVISSKGQSAAQLAAEKGQKAKDYTAQKAMEA----KDYTAEKAIAAKDV  323

Query  1019  FSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSA  1198
              SS GQ+A  Y  + AK  KDT      T   Y  + A   KD    +G+ A  Y  + A
Sbjct  324   ISSKGQSAAQYAAEKAKVAKDTAVDTTVTTAGYLGEKAGAAKDVTVESGKGAAGYAGKVA  383

Query  1199  QQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKD  1378
                K     AG  A  YT++   +A  T++G   +   YT +    AK+ ++ AGQ    
Sbjct  384   ADVKGQAVVAGWGAAHYTLEKVAEATKTMAGVTSSVAGYTGEKVVAAKDKVASAGQ----  439

Query  1379  YTVQAKDYASQKAGEAGNKASEAKERGTEMSKNAASYAGQKVTEA  1513
              TV         AG AG K + AK+      +  A YA +K  EA
Sbjct  440   -TV---------AGYAGEKLAAAKDAVVATEEQGAEYAARKKAEA  474


 Score = 63.9 bits (154),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 35/49 (71%), Gaps = 2/49 (4%)
 Frame = +2

Query  188  MASEQLRRDNKTGERAVEVEKDRVPKMASHFESLAEKV--ADDTAADFH  328
            MAS+Q RR+N T ER +EVEKDRVPKM +HFESLAEK     D A   H
Sbjct  1    MASQQARRENVTDERNIEVEKDRVPKMTTHFESLAEKARGEQDVAHPLH  49



>ref|XP_009591837.1| PREDICTED: embryonic protein DC-8-like [Nicotiana tomentosiformis]
Length=676

 Score =   146 bits (368),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 153/381 (40%), Positives = 189/381 (50%), Gaps = 94/381 (25%)
 Frame = +2

Query  602   RRQGFEERPGGVKFEVHSGQGGGQSTRLQGLEERPggvkvevhtghgggeeRRDHS----  769
             ++ GFEERPGGVKFEV+S +  G       L+ +          G    EER D +    
Sbjct  71    QQHGFEERPGGVKFEVNSQKQKGS------LDSKHKSQMENSSEGLKVAEERYDKAKELG  124

Query  770   GLSLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQ  949
             G +L  +   +++A          A  K  + K+     VQSG QY+ +  GAAKDTALQ
Sbjct  125   GSALHNV---KESASYGLGSPGAYATPKGAQGKDNVTHGVQSGYQYVAKNTGAAKDTALQ  181

Query  950   KTQQAYNAAKDT-------TISKTQQAKD-TFSSTGQT---AKDYTTQSAKQTKDTLSSA  1096
             K QQ Y A KD            TQQAKD TF   G+T   AKD T +  +Q  DTLSS 
Sbjct  182   KGQQTYAATKDNLSTAGQNVAQSTQQAKDYTFQKAGETKDYAKDTTLEKGQQAYDTLSST  241

Query  1097  GQTA-------KDYTVQSA-----------QQ----TKDTLSSAGQT-------AKDYTV  1189
             GQTA       KDYT+Q A           QQ    TKDTLSSAGQ        AKDYT+
Sbjct  242   GQTAAQYAQQAKDYTLQKAGVAKDTALEKGQQAYNTTKDTLSSAGQNAVQSAQQAKDYTL  301

Query  1190  QSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAG-------QTAKDYTVQTAQQAK--  1342
             Q A +TKDT+   G  A   T       +DTLS AG       Q AKDYT+Q A +AK  
Sbjct  302   QKAGETKDTVRDKGHQAYSTT-------RDTLSSAGTNAAQSAQQAKDYTLQNAGEAKDY  354

Query  1343  -----------------ETLSKAGQAAKDYTVQAKDYASQKAGEAGNKASEAKERGTEMS  1471
                              +TLS AGQ A+    Q+ DY +QK       A EA++    +S
Sbjct  355   AKDRVLDKGRKAYSTTTDTLSSAGQNAQS-AQQSTDY-TQK------NAEEARDNAAGLS  406

Query  1472  KNAASYAGQKVTEAKDVTVES  1534
             KNAASY G+K TEAKDVT+E+
Sbjct  407   KNAASYIGKKATEAKDVTLET  427



>ref|XP_004243405.2| PREDICTED: seed biotin-containing protein SBP65-like [Solanum 
lycopersicum]
Length=532

 Score =   138 bits (348),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 168/477 (35%), Positives = 220/477 (46%), Gaps = 138/477 (29%)
 Frame = +2

Query  188   MASEQLRRDNKTGERAVEVEKDRVPKMASHFESLAEKVADDTAADFHPaavrvtqttvat  367
             MASEQ RR+N T ER +++EKD+V K+ASHF    E +AD                    
Sbjct  1     MASEQARRENVTDERKIQLEKDKVHKIASHF----ESLADKV------------------  38

Query  368   tEHEDQGKTAQKGGRAVHDQQTRGTTAQREHDQAKSWKATEETQAGRHDDIQQNRPVRVG  547
               HE+   T+      VH + T   T     ++ +S    ++TQ                
Sbjct  39    --HEEDTSTSPP--DVVHVKTTVTGTVPHPSEKQRSSDIIDKTQG---------------  79

Query  548   GIEFYSGQDARSGRDETTRRQGFEERPGGVKFEVHSGQGGGQSTRLQGLEERPggvkvev  727
                              +++Q F+E+P GVKF V            QG E     +    
Sbjct  80    -----------------SKQQVFQEKPEGVKFGV------------QGQEHEDSVMNRGK  110

Query  728   htghgggeeRRDHSGLSLEEIGKYRQTAQQKSIDALQTAQNKYEKAKN---TTKENVQSG  898
              +  G  E +   SG SLEEI +YR TAQQKS++A++ A+ +YEKAK    +T +NV+  
Sbjct  111   QSEGGAEETK---SGPSLEEISQYRATAQQKSMNAIRGAEERYEKAKGMGGSTLQNVKES  167

Query  899   SQYLVEKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTK  1078
             + + +  A                        K  QAKDT +   Q    Y  +     K
Sbjct  168   TTHGIAAA---------------------AAEKGAQAKDTITQGLQKGTQYIAEKTGAAK  206

Query  1079  DTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQ  1258
             D     GQ       Q+   TKDTLS AGQTA     +SAQQ           AKDYT+Q
Sbjct  207   DVAVEKGQ-------QAYAATKDTLSGAGQTA----AESAQQ-----------AKDYTMQ  244

Query  1259  SAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQ----AKDYASQKAGEA  1426
                +AKDTLSGAGQTA     ++AQQAK           DYT+Q     KDY  QK GEA
Sbjct  245   KTGEAKDTLSGAGQTA----AESAQQAK-----------DYTMQKTGDTKDYTMQKTGEA  289

Query  1427  GNKASEAKERGTEMSKNAASYAGQKVTEAKDVTVESgkgavgyagkvaETLKDTATV  1597
              +  +E      E SK AASY G+K  + KDVT+E+GKGAVGYAGKVAET+KD   V
Sbjct  290   KDYVAEKTGEIKEQSKGAASYVGEKAAQVKDVTLETGKGAVGYAGKVAETVKDKTVV  346



>ref|XP_006364103.1| PREDICTED: seed biotin-containing protein SBP65-like [Solanum 
tuberosum]
Length=553

 Score =   127 bits (318),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 143/364 (39%), Positives = 180/364 (49%), Gaps = 86/364 (24%)
 Frame = +2

Query  605   RQGFEERPGGVKFEVHSGQGGGQSTRLQGLEERPggvkvevhtghgggeeRRDHSGLSLE  784
             +  FEERPGGVKFEVHS        R +G +                    ++ +   L 
Sbjct  64    KHSFEERPGGVKFEVHS-------QRHKGNDNV------------------KELASHGLG  98

Query  785   EIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKTQQA  964
               G Y              A +K  +AK++    VQSG  Y+ +K GAAK+T L+K+QQ 
Sbjct  99    STGAY--------------ATSKGAQAKDSMTHGVQSGHDYVADKTGAAKNTTLKKSQQG  144

Query  965   YNAAKDT-------TISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTA-----  1108
             Y+  KDT        +   QQAKD   +   TA D   Q+     DTLSSAGQTA     
Sbjct  145   YSPTKDTLTSTGQNVVQSAQQAKDYAKN---TALDKGHQTYAAATDTLSSAGQTAARSAK  201

Query  1109  --KDYTVQSAQQ----TKDTLSSAGQT-------AKDYTVQSAQQ----TKDTLSSAGQT  1237
               KD  +    Q    T DTL + GQT       AKD  +   QQ    T DTLSSAGQT
Sbjct  202   KSKDTVLDKGHQAYAATTDTLLNTGQTAAQSAKKAKDTVLDKGQQAYGATTDTLSSAGQT  261

Query  1238  AKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKA  1417
             A     QSA++AKDT+   GQ A  Y   T     +TLS AGQ A     +AKD    K 
Sbjct  262   A----AQSAKKAKDTVLDKGQQA--YAATT-----DTLSSAGQTAAQSAKKAKDTVLGKG  310

Query  1418  GEA----GNKASEAKERGTEMSKNAASYAGQKVTEAKDVTVESgkgavgyagkvaETLKD  1585
              +A     +  S A +   + +KNAA Y GQK  EAKDVT+E+GKGA+GYAG+V ET+KD
Sbjct  311   QQAYAATTDTLSSAGQTTVQSTKNAAGYVGQKAVEAKDVTLETGKGALGYAGEVTETVKD  370

Query  1586  TATV  1597
              A V
Sbjct  371   KAAV  374


 Score = 68.2 bits (165),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 92/250 (37%), Positives = 114/250 (46%), Gaps = 45/250 (18%)
 Frame = +2

Query  803   QTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKTQQAYNAAKD  982
             QTA Q +  A  T  +K ++A   T + + S  Q   + A  AKDT L K QQAY A   
Sbjct  227   QTAAQSAKKAKDTVLDKGQQAYGATTDTLSSAGQTAAQSAKKAKDTVLDKGQQAYAA---  283

Query  983   TTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSA  1162
             TT        DT SS GQTA     QSAK+ KDT+   GQ       Q+   T DTLSSA
Sbjct  284   TT--------DTLSSAGQTA----AQSAKKAKDTVLGKGQ-------QAYAATTDTLSSA  324

Query  1163  GQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAK  1342
             GQT    TVQS      T ++AG     Y  Q A +AKD     G+ A  Y  +  +  K
Sbjct  325   GQT----TVQS------TKNAAG-----YVGQKAVEAKDVTLETGKGALGYAGEVTETVK  369

Query  1343  ETLSKAGQAAKDYTVQAKD--------YASQKAGEAGNKASEAKERGTEMSKNAASYAGQ  1498
             +  + AG  A  YT +            AS  AG  G KA  AK+       N   YA  
Sbjct  370   DKAAVAGWGAAHYTAEKAAEATKAVVGVASNVAGYTGEKAVAAKDAVAGTGMNVLGYAEN  429

Query  1499  KVTEAKDVTV  1528
             K+ +AKD  V
Sbjct  430   KLADAKDYVV  439



>ref|XP_009784311.1| PREDICTED: seed biotin-containing protein SBP65-like isoform 
X2 [Nicotiana sylvestris]
Length=619

 Score =   127 bits (319),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 147/389 (38%), Positives = 196/389 (50%), Gaps = 69/389 (18%)
 Frame = +2

Query  602   RRQGFEERPGGVKFEVHSGQGGG------QSTRLQGLEERPggvkvevhtghgggeeRRD  763
             ++ GFEERPGGVKFEV+S +  G      +S      EER    K    +     +E   
Sbjct  76    QQHGFEERPGGVKFEVNSQKQKGSLDSKHKSQMENSSEERYDKAKELGGSALHNVKESAS  135

Query  764   HSGLS------LEEI-----GKYRQTAQQKSIDALQTAQNKYEKAKN---TTKENVQSGS  901
             H GL       ++ +       Y   A+     ALQ  Q  Y   K+   T  +NV   +
Sbjct  136   H-GLGSTGAQGIDNVTHGVQSGYHYVAKNAKDTALQKGQQTYAATKDNLSTAGQNVAQSA  194

Query  902   Q----YLVEKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAK  1069
             Q    Y ++KAG AKDTALQK QQA    KDT  S  Q A      + Q AKDY  Q A 
Sbjct  195   QQAKDYTLQKAGEAKDTALQKGQQACYTTKDTLSSVGQNA----VQSAQQAKDYALQKAG  250

Query  1070  QTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTA-------KDYTVQSAQQ--------  1204
             +TKDT+   GQ       Q+   T+DTLS+AG  A       KDYT+Q+A +        
Sbjct  251   ETKDTVRDKGQ-------QAYSTTRDTLSNAGTNAAQSALHAKDYTLQNAGEAKDYAKDT  303

Query  1205  -----------TKDTLSSAGQTA-------KDYTVQSAQQAKDTLSGAGQTAKDYTVQTA  1330
                        T+DTLSSAGQ A       KDYT+++A++AKD  +G  + A  Y  + A
Sbjct  304   VLDKGRKAYSTTRDTLSSAGQNAAQSAQQAKDYTLKNAEEAKDNAAGLSKNAASYIGKRA  363

Query  1331  QQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGNKASEAKERGTEMSKNAASYAGQKVTE  1510
              +AK+   + G+ A  Y  QA  Y  +KA +A +   E  +     +   ASY GQK  +
Sbjct  364   TEAKDVTLETGKGAVGYAGQAASYVGRKAVDAKDATLETGKGAVGYAGKTASYVGQKAVD  423

Query  1511  AKDVTVESgkgavgyagkvaETLKDTATV  1597
             AKDVT+E+GKGAVGYAG+VAET+K+ A V
Sbjct  424   AKDVTLETGKGAVGYAGEVAETVKEKAAV  452


 Score = 58.5 bits (140),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 88/285 (31%), Positives = 125/285 (44%), Gaps = 46/285 (16%)
 Frame = +2

Query  803   QTAQQKSIDALQ-------TAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKTQQ  961
             Q+AQQ    ALQ       T ++K ++A +TT++ + +      + A  AKD  LQ   +
Sbjct  236   QSAQQAKDYALQKAGETKDTVRDKGQQAYSTTRDTLSNAGTNAAQSALHAKDYTLQNAGE  295

Query  962   AYNAAKDTTISKTQQA----KDTFSSTGQTA-------KDYTTQSAKQTKDTLSSAGQTA  1108
             A + AKDT + K ++A    +DT SS GQ A       KDYT ++A++ KD  +   + A
Sbjct  296   AKDYAKDTVLDKGRKAYSTTRDTLSSAGQNAAQSAQQAKDYTLKNAEEAKDNAAGLSKNA  355

Query  1109  KDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQT---------------KDTLSSAGQTAK  1243
               Y  + A + KD     G+ A  Y  Q+A                  K  +  AG+TA 
Sbjct  356   ASYIGKRATEAKDVTLETGKGAVGYAGQAASYVGRKAVDAKDATLETGKGAVGYAGKTA-  414

Query  1244  DYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKD--------  1399
              Y  Q A  AKD     G+ A  Y  + A+  KE  + AG  A  YT +           
Sbjct  415   SYVGQKAVDAKDVTLETGKGAVGYAGEVAETVKEKAAVAGWGAAHYTAEKAAEATKAVVG  474

Query  1400  YASQKAGEAG--NKASEAKERGTEMSKNAASYAGQKVTEAKDVTV  1528
              AS  AG  G    A++    GT MS  A  Y   K+  AKD  V
Sbjct  475   VASNVAGYTGEKAVAAKDAVAGTGMS--AVEYVENKLANAKDYVV  517



>ref|XP_009784310.1| PREDICTED: seed biotin-containing protein SBP65-like isoform 
X1 [Nicotiana sylvestris]
Length=620

 Score =   127 bits (319),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 147/389 (38%), Positives = 196/389 (50%), Gaps = 69/389 (18%)
 Frame = +2

Query  602   RRQGFEERPGGVKFEVHSGQGGG------QSTRLQGLEERPggvkvevhtghgggeeRRD  763
             ++ GFEERPGGVKFEV+S +  G      +S      EER    K    +     +E   
Sbjct  76    QQHGFEERPGGVKFEVNSQKQKGSLDSKHKSQMENSSEERYDKAKELGGSALHNVKESAS  135

Query  764   HSGLS------LEEI-----GKYRQTAQQKSIDALQTAQNKYEKAKN---TTKENVQSGS  901
             H GL       ++ +       Y   A+     ALQ  Q  Y   K+   T  +NV   +
Sbjct  136   H-GLGSTGAQGIDNVTHGVQSGYHYVAKNAKDTALQKGQQTYAATKDNLSTAGQNVAQSA  194

Query  902   Q----YLVEKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAK  1069
             Q    Y ++KAG AKDTALQK QQA    KDT  S  Q A      + Q AKDY  Q A 
Sbjct  195   QQAKDYTLQKAGEAKDTALQKGQQACYTTKDTLSSVGQNA----VQSAQQAKDYALQKAG  250

Query  1070  QTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTA-------KDYTVQSAQQ--------  1204
             +TKDT+   GQ       Q+   T+DTLS+AG  A       KDYT+Q+A +        
Sbjct  251   ETKDTVRDKGQ-------QAYSTTRDTLSNAGTNAAQSALHAKDYTLQNAGEAKDYAKDT  303

Query  1205  -----------TKDTLSSAGQTA-------KDYTVQSAQQAKDTLSGAGQTAKDYTVQTA  1330
                        T+DTLSSAGQ A       KDYT+++A++AKD  +G  + A  Y  + A
Sbjct  304   VLDKGRKAYSTTRDTLSSAGQNAAQSAQQAKDYTLKNAEEAKDNAAGLSKNAASYIGKRA  363

Query  1331  QQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGNKASEAKERGTEMSKNAASYAGQKVTE  1510
              +AK+   + G+ A  Y  QA  Y  +KA +A +   E  +     +   ASY GQK  +
Sbjct  364   TEAKDVTLETGKGAVGYAGQAASYVGRKAVDAKDATLETGKGAVGYAGKTASYVGQKAVD  423

Query  1511  AKDVTVESgkgavgyagkvaETLKDTATV  1597
             AKDVT+E+GKGAVGYAG+VAET+K+ A V
Sbjct  424   AKDVTLETGKGAVGYAGEVAETVKEKAAV  452


 Score = 58.5 bits (140),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 88/285 (31%), Positives = 125/285 (44%), Gaps = 46/285 (16%)
 Frame = +2

Query  803   QTAQQKSIDALQ-------TAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKTQQ  961
             Q+AQQ    ALQ       T ++K ++A +TT++ + +      + A  AKD  LQ   +
Sbjct  236   QSAQQAKDYALQKAGETKDTVRDKGQQAYSTTRDTLSNAGTNAAQSALHAKDYTLQNAGE  295

Query  962   AYNAAKDTTISKTQQA----KDTFSSTGQTA-------KDYTTQSAKQTKDTLSSAGQTA  1108
             A + AKDT + K ++A    +DT SS GQ A       KDYT ++A++ KD  +   + A
Sbjct  296   AKDYAKDTVLDKGRKAYSTTRDTLSSAGQNAAQSAQQAKDYTLKNAEEAKDNAAGLSKNA  355

Query  1109  KDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQT---------------KDTLSSAGQTAK  1243
               Y  + A + KD     G+ A  Y  Q+A                  K  +  AG+TA 
Sbjct  356   ASYIGKRATEAKDVTLETGKGAVGYAGQAASYVGRKAVDAKDATLETGKGAVGYAGKTA-  414

Query  1244  DYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKD--------  1399
              Y  Q A  AKD     G+ A  Y  + A+  KE  + AG  A  YT +           
Sbjct  415   SYVGQKAVDAKDVTLETGKGAVGYAGEVAETVKEKAAVAGWGAAHYTAEKAAEATKAVVG  474

Query  1400  YASQKAGEAG--NKASEAKERGTEMSKNAASYAGQKVTEAKDVTV  1528
              AS  AG  G    A++    GT MS  A  Y   K+  AKD  V
Sbjct  475   VASNVAGYTGEKAVAAKDAVAGTGMS--AVEYVENKLANAKDYVV  517



>ref|XP_009784313.1| PREDICTED: embryonic protein DC-8-like isoform X4 [Nicotiana 
sylvestris]
Length=575

 Score =   125 bits (313),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 137/369 (37%), Positives = 185/369 (50%), Gaps = 74/369 (20%)
 Frame = +2

Query  602   RRQGFEERPGGVKFEVHSGQGGGQSTRLQGLEERPggvkvevhtghgggeeRRDHSGLSL  781
             ++ GFEERPGGVKFEV+S             +++               EER D +    
Sbjct  76    QQHGFEERPGGVKFEVNS------------QKQKGSLDSKHKSQMENSSEERYDKA----  119

Query  782   EEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQ----YLVEKAGAAKDTALQ  949
             +E+G            AL   +        +T +NV   +Q    Y ++KAG AKDTALQ
Sbjct  120   KELGG----------SALHNVKESASHGLGSTGQNVAQSAQQAKDYTLQKAGEAKDTALQ  169

Query  950   KTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQS  1129
             K QQA    KDT  S  Q A      + Q AKDY  Q A +TKDT+   GQ       Q+
Sbjct  170   KGQQACYTTKDTLSSVGQNA----VQSAQQAKDYALQKAGETKDTVRDKGQ-------QA  218

Query  1130  AQQTKDTLSSAGQTA-------KDYTVQSAQQ-------------------TKDTLSSAG  1231
                T+DTLS+AG  A       KDYT+Q+A +                   T+DTLSSAG
Sbjct  219   YSTTRDTLSNAGTNAAQSALHAKDYTLQNAGEAKDYAKDTVLDKGRKAYSTTRDTLSSAG  278

Query  1232  QTA-------KDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQ  1390
             Q A       KDYT+++A++AKD  +G  + A  Y  + A +AK+   + G+ A  Y  Q
Sbjct  279   QNAAQSAQQAKDYTLKNAEEAKDNAAGLSKNAASYIGKRATEAKDVTLETGKGAVGYAGQ  338

Query  1391  AKDYASQKAGEAGNKASEAKERGTEMSKNAASYAGQKVTEAKDVTVESgkgavgyagkva  1570
             A  Y  +KA +A +   E  +     +   ASY GQK  +AKDVT+E+GKGAVGYAG+VA
Sbjct  339   AASYVGRKAVDAKDATLETGKGAVGYAGKTASYVGQKAVDAKDVTLETGKGAVGYAGEVA  398

Query  1571  ETLKDTATV  1597
             ET+K+ A V
Sbjct  399   ETVKEKAAV  407



>ref|XP_009381763.1| PREDICTED: embryonic protein DC-8-like [Musa acuminata subsp. 
malaccensis]
Length=465

 Score =   123 bits (309),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 103/260 (40%), Positives = 140/260 (54%), Gaps = 29/260 (11%)
 Frame = +2

Query  773   LSLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGA--------  928
             +SLEEIG +R TAQQ SI++++ A+ +YEKAK+     V    + +V   GA        
Sbjct  25    MSLEEIGHHRATAQQNSIESIRAAEERYEKAKHAGLATVHHAKETVVHGLGAAGAYAAAK  84

Query  929   ---AKDTALQKTQ-------QAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTK  1078
                AKD A +K +       Q   AAKD TI K +Q         + AKD   Q+A ++K
Sbjct  85    GTEAKDYAGEKARGAAEVAAQKAAAAKDVTIEKGRQGL-------EVAKDTAAQAAAKSK  137

Query  1079  DTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQ  1258
             D   SAG+TA DY  Q+A + KD     G+TA +Y  Q+A +TKD     GQTA DY  Q
Sbjct  138   DVAVSAGETAADYAKQAAVKAKDVTVGTGETAMEYAKQTAAKTKDVTVYTGQTAADYVKQ  197

Query  1259  SAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGNKA  1438
             +A + KD  +GAG+TA DY  Q  ++AK+     GQ A D    A +YA +KA  A + A
Sbjct  198   AAMKTKDVTAGAGETAIDYAKQAVEKAKDVTISTGQTAAD----AAEYAREKAVGAKDTA  253

Query  1439  SEAKERGTEMSKNAASYAGQ  1498
             +E  +R TE  K  A   GQ
Sbjct  254   AETTQRTTEEVKETAKAMGQ  273


 Score = 60.8 bits (146),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 49/137 (36%), Positives = 70/137 (51%), Gaps = 15/137 (11%)
 Frame = +2

Query  929   AKDTALQKTQQAYNAAKDTTISKTQQA-----------KDTFSSTGQTAKDYTTQSAKQT  1075
             A +TA    +QA   AKD T+   + A           KD    TGQTA DY  Q+A +T
Sbjct  143   AGETAADYAKQAAVKAKDVTVGTGETAMEYAKQTAAKTKDVTVYTGQTAADYVKQAAMKT  202

Query  1076  KDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTV  1255
             KD  + AG+TA DY  Q+ ++ KD   S GQTA D    +A+  ++    A  TA + T 
Sbjct  203   KDVTAGAGETAIDYAKQAVEKAKDVTISTGQTAAD----AAEYAREKAVGAKDTAAETTQ  258

Query  1256  QSAQQAKDTLSGAGQTA  1306
             ++ ++ K+T    GQ A
Sbjct  259   RTTEEVKETAKAMGQGA  275



>ref|XP_010915616.1| PREDICTED: embryonic protein DC-8 [Elaeis guineensis]
Length=451

 Score =   120 bits (302),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 115/322 (36%), Positives = 153/322 (48%), Gaps = 74/322 (23%)
 Frame = +2

Query  773   LSLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNT-------TKENVQSGSQ----YLVEK  919
             +S EEIGKYR TAQQ SI+A++ A+ +YEKAK +       TKE +  GS     YL  K
Sbjct  19    MSPEEIGKYRATAQQSSINAIRAAEERYEKAKQSGASALHETKEAMIHGSDATKTYLAAK  78

Query  920   AGAAKDTAL----------------------QKTQQAYNAA-------KDTTISKTQQAK  1012
                AKDTA+                      +K QQ+Y+AA        D T+ K   AK
Sbjct  79    GSEAKDTAVHGARVAAEKAAEKGTAAKDYVAEKGQQSYHAAVQGSRAAADVTVEKASAAK  138

Query  1013  DTFSSTGQ----TAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKD  1180
             D      +     A+D   Q+A + KD   SAG++A DY  Q+A++ +D   S G+TA D
Sbjct  139   DIAMEKSRQGYDAARDTAVQAAAKAKDVTVSAGKSAADYAKQAAEKARDLTMSTGKTAAD  198

Query  1181  YTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTL-----------SGAGQTAKDYTVQT  1327
             Y  ++A + KD     G+ A DY  Q+  +AKD               A   AKD TV T
Sbjct  199   YAQEAAVKAKDVTVETGKRAADYAQQAGVKAKDVTVETRKSAADHAQEAAAKAKDATVST  258

Query  1328  AQQAKETLSKAGQAAKDYTV----QAKDYASQKAGEAGN---------------KASEAK  1450
              + A E+  +    AKD T     +A +Y  QKAG+A                 KA+EAK
Sbjct  259   GKSAAESAREKAVGAKDVTASAGQKATEYVGQKAGDAKEAAEGKGRKTKELAEQKAAEAK  318

Query  1451  ERGTEMSKNAASYAGQKVTEAK  1516
             E   E S+ A  YA QK TEAK
Sbjct  319   ETAKESSQQAKEYAQQKSTEAK  340


 Score = 67.8 bits (164),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 64/213 (30%), Positives = 93/213 (44%), Gaps = 66/213 (31%)
 Frame = +2

Query  911   VEKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLS  1090
             VEKA AAKD A++K++Q Y+AA+DT +    +AKD   S G++A DY  Q+A++ +D   
Sbjct  131   VEKASAAKDIAMEKSRQGYDAARDTAVQAAAKAKDVTVSAGKSAADYAKQAAEKARDLTM  190

Query  1091  SAGQT-----------AKDYTVQS-------AQQT-------------------------  1141
             S G+T           AKD TV++       AQQ                          
Sbjct  191   STGKTAADYAQEAAVKAKDVTVETGKRAADYAQQAGVKAKDVTVETRKSAADHAQEAAAK  250

Query  1142  -----------------------KDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYT  1252
                                    KD  +SAGQ A +Y  Q A   K+     G+  K+  
Sbjct  251   AKDATVSTGKSAAESAREKAVGAKDVTASAGQKATEYVGQKAGDAKEAAEGKGRKTKELA  310

Query  1253  VQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETL  1351
              Q A +AK+T   + Q AK+Y  Q + +AK+ L
Sbjct  311   EQKAAEAKETAKESSQQAKEYAQQKSTEAKQKL  343



>ref|XP_009784312.1| PREDICTED: embryonic protein DC-8-like isoform X3 [Nicotiana 
sylvestris]
Length=588

 Score =   120 bits (301),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 139/371 (37%), Positives = 185/371 (50%), Gaps = 65/371 (18%)
 Frame = +2

Query  602   RRQGFEERPGGVKFEVHSGQGGG------QSTRLQGLEERPggvkvevhtghgggeeRRD  763
             ++ GFEERPGGVKFEV+S +  G      +S      EER    K    +     +E   
Sbjct  76    QQHGFEERPGGVKFEVNSQKQKGSLDSKHKSQMENSSEERYDKAKELGGSALHNVKESAS  135

Query  764   HSGLSLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTA  943
             H GL          T  Q   +     Q      +    ++ Q    Y ++KAG AKDTA
Sbjct  136   H-GLG--------STGAQGIDNVTHGVQ------RQNVAQSAQQAKDYTLQKAGEAKDTA  180

Query  944   LQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTV  1123
             LQK QQA    KDT  S  Q A      + Q AKDY  Q A +TKDT+   GQ       
Sbjct  181   LQKGQQACYTTKDTLSSVGQNA----VQSAQQAKDYALQKAGETKDTVRDKGQ-------  229

Query  1124  QSAQQTKDTLSSAGQTA-------KDYTVQSAQQ-------------------TKDTLSS  1225
             Q+   T+DTLS+AG  A       KDYT+Q+A +                   T+DTLSS
Sbjct  230   QAYSTTRDTLSNAGTNAAQSALHAKDYTLQNAGEAKDYAKDTVLDKGRKAYSTTRDTLSS  289

Query  1226  AGQTA-------KDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYT  1384
             AGQ A       KDYT+++A++AKD  +G  + A  Y  + A +AK+   + G+ A  Y 
Sbjct  290   AGQNAAQSAQQAKDYTLKNAEEAKDNAAGLSKNAASYIGKRATEAKDVTLETGKGAVGYA  349

Query  1385  VQAKDYASQKAGEAGNKASEAKERGTEMSKNAASYAGQKVTEAKDVTVESgkgavgyagk  1564
              QA  Y  +KA +A +   E  +     +   ASY GQK  +AKDVT+E+GKGAVGYAG+
Sbjct  350   GQAASYVGRKAVDAKDATLETGKGAVGYAGKTASYVGQKAVDAKDVTLETGKGAVGYAGE  409

Query  1565  vaETLKDTATV  1597
             VAET+K+ A V
Sbjct  410   VAETVKEKAAV  420



>ref|XP_009142073.1| PREDICTED: embryonic protein DC-8 [Brassica rapa]
Length=679

 Score =   121 bits (303),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 142/467 (30%), Positives = 206/467 (44%), Gaps = 56/467 (12%)
 Frame = +2

Query  188   MASEQLRRDNKTGERAVEVEKDRVPKMASHFESLAEKVADDTAADFHPaavrvtqttvat  367
             MASEQ RR+N   ER V+VEKDRVPKM SHFES+AEK  D   +D           +++ 
Sbjct  1     MASEQARRENVVKEREVQVEKDRVPKMTSHFESIAEKGKD---SDTQRQQETTHFVSLSD  57

Query  368   tEHEDQGKTAQK--------GGRAVHDQQTRGTTAQREHDQAKSWKATEETQAGRHDDIQ  523
               +E +G+T  K        G   VH     GTT ++E ++ +   + E+ Q  R +  Q
Sbjct  58    KGNEGEGETKMKMTKMPHTVGKFVVHSGDKEGTTGKKEEEE-QERASLEDIQGFRANAQQ  116

Query  524   QNR-PVRVGGIEFYSGQDARSGRDETTRRQGFEERPGGVKFEVHSG-QGGGQSTRLQGLE  697
             Q+   +R     +   +++ S   +  ++     R  GV    H G + GG    +QG  
Sbjct  117   QSMDTIRAAEERYNKAEESLSRGGQGGQQAEGRGRESGVHV-THVGTEKGGN---VQGT-  171

Query  698   ERPggvkvevhtghgggeeRRDHSGL-----SLEEIGKYRQTAQQKSIDALQTAQNKYEK  862
                                   H G      + E+  + +    +K+ +A +TA  K ++
Sbjct  172   --ASEKTQRASEYAREKAREAGHVGAQKGQEAKEQAARAKDYTMEKAGEAKETATEKAQR  229

Query  863   AKNTTKENVQSGSQYLVEKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQT-  1039
             A     E  +       E+A  AKD  LQK  +    AKDT   K + A +    TG T 
Sbjct  230   ASQYATEKAKETGNKTAEQAARAKDYTLQKAAE----AKDTAAEKAKYATEKGRETGNTA  285

Query  1040  ------AKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQ  1201
                   AKD   Q A + KD  +   Q    Y  +  ++   T +     AKDYT+Q A 
Sbjct  286   AEQAARAKDIALQKAAEAKDIAAEKAQ----YAAEKGREMGSTAAEKAARAKDYTLQKAV  341

Query  1202  QTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDY  1381
             + KD  +   Q A  Y  +  +   +T +     AKDYT Q A +AK+  ++ GQ AK+ 
Sbjct  342   EAKDIAAEKAQRASQYATEKGRDTGNTAAEQAARAKDYTFQKAGEAKDIAAQKGQEAKEQ  401

Query  1382  TV----QAKDYASQKAGEAGNKASEAKERGTEMSKNAASYAGQKVTE  1510
             TV    +AKDY  QKAGEA            EMSK AA YA + V E
Sbjct  402   TVSVTAKAKDYTVQKAGEA-----------VEMSKEAAEYAKETVVE  437


 Score = 85.9 bits (211),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 88/277 (32%), Positives = 134/277 (48%), Gaps = 55/277 (20%)
 Frame = +2

Query  776   SLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNT--------------TKENVQSGSQYLV  913
             SLE+I  +R  AQQ+S+D ++ A+ +Y KA+ +               +E+    +    
Sbjct  103   SLEDIQGFRANAQQQSMDTIRAAEERYNKAEESLSRGGQGGQQAEGRGRESGVHVTHVGT  162

Query  914   EKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSS  1093
             EK G  + TA +KTQ+A   A++    K ++A    +  GQ AK+   Q+A+        
Sbjct  163   EKGGNVQGTASEKTQRASEYARE----KAREAGHVGAQKGQEAKE---QAAR--------  207

Query  1094  AGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQA  1273
                 AKDYT++ A + K+T +   Q A  Y  + A++T +  +     AKDYT+Q A +A
Sbjct  208   ----AKDYTMEKAGEAKETATEKAQRASQYATEKAKETGNKTAEQAARAKDYTLQKAAEA  263

Query  1274  KDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGNKASE---  1444
             KDT +           + A+ A E   + G  A +   +AKD A QKA EA + A+E   
Sbjct  264   KDTAA-----------EKAKYATEKGRETGNTAAEQAARAKDIALQKAAEAKDIAAEKAQ  312

Query  1445  -AKERGTEMSKNAAS-------YAGQKVTEAKDVTVE  1531
              A E+G EM   AA        Y  QK  EAKD+  E
Sbjct  313   YAAEKGREMGSTAAEKAARAKDYTLQKAVEAKDIAAE  349


 Score = 79.3 bits (194),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 74/236 (31%), Positives = 110/236 (47%), Gaps = 34/236 (14%)
 Frame = +2

Query  773   LSLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQK  952
              ++E+ G+ ++TA +K+  A Q A  K ++  N T E       Y ++KA  AKDTA +K
Sbjct  211   YTMEKAGEAKETATEKAQRASQYATEKAKETGNKTAEQAARAKDYTLQKAAEAKDTAAEK  270

Query  953   TQQAYNA--------------AKDTTISKTQQAKDTFSSTGQ------------------  1036
              + A                 AKD  + K  +AKD  +   Q                  
Sbjct  271   AKYATEKGRETGNTAAEQAARAKDIALQKAAEAKDIAAEKAQYAAEKGREMGSTAAEKAA  330

Query  1037  TAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDT  1216
              AKDYT Q A + KD  +   Q A  Y  +  + T +T +     AKDYT Q A + KD 
Sbjct  331   RAKDYTLQKAVEAKDIAAEKAQRASQYATEKGRDTGNTAAEQAARAKDYTFQKAGEAKDI  390

Query  1217  LSSAGQTAKDYTVQSAQQAKD-TLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDY  1381
              +  GQ AK+ TV    +AKD T+  AG+ A + + + A+ AKET+ + G+ A  Y
Sbjct  391   AAQKGQEAKEQTVSVTAKAKDYTVQKAGE-AVEMSKEAAEYAKETVVEGGKGAAHY  445



>ref|XP_008783907.1| PREDICTED: embryonic protein DC-8 [Phoenix dactylifera]
Length=411

 Score =   114 bits (286),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 102/307 (33%), Positives = 146/307 (48%), Gaps = 70/307 (23%)
 Frame = +2

Query  761   DHSGLSLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNT---------------------T  877
             + + +S EEIGKYR TAQQ SIDA++ A+ +Y+KAK +                      
Sbjct  15    ERTNMSPEEIGKYRATAQQNSIDAIRAAEERYQKAKQSGASTYLAAKGTEAKGTAAKDYV  74

Query  878   KENVQSGSQYLV-----------EKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFS  1024
              E  Q G    V           EKA AAKD A++K ++ Y+AA+DT +    +AKD   
Sbjct  75    AEKGQQGYHAAVQGTRAAADVTAEKASAAKDIAMEKGRRGYDAARDTAVQAAVKAKDVTV  134

Query  1025  STGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQ  1204
             + G++A DY  Q+A++ +D   S G+TA DY  ++A + KD    A + A D+  Q+A +
Sbjct  135   NAGESAADYAKQAAEKARDMTMSTGKTAADYAQEAAVKAKDAAMDARKRAADHAQQAAVK  194

Query  1205  TKD-----------------------TLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDY  1315
             T+D                       T+S+ G++A DY  +    AKD  +GAGQ A  Y
Sbjct  195   TEDETVETGKSAADYAQKAAAKAKDATVST-GKSAADYAREKGMGAKDATAGAGQKAMKY  253

Query  1316  TVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGNKASEAKERGTEMSKNAASYAG  1495
                 A +AKE     GQ  K+   Q              KA E+KE   E ++ A  YA 
Sbjct  254   GGLKAGEAKEAAQGTGQKTKELEEQ--------------KADESKETAKESTQQAKEYAE  299

Query  1496  QKVTEAK  1516
              K TEAK
Sbjct  300   PKSTEAK  306



>ref|XP_009614117.1| PREDICTED: seed biotin-containing protein SBP65-like isoform 
X2 [Nicotiana tomentosiformis]
Length=426

 Score =   114 bits (284),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 134/360 (37%), Positives = 168/360 (47%), Gaps = 75/360 (21%)
 Frame = +2

Query  533   PVRVGGIEFYSGQDARSGRDETTRRQGFEERPGGVKFEVHSGQGGGQSTRLQGLEERPgg  712
             P +VGG+EF SG   +   ++  R +G E R           +GG  S R  G+E R   
Sbjct  42    PAKVGGLEFSSGVMQQEQSEKEQRPEGEERRA----------EGGAHSKR-SGVERRKAP  90

Query  713   vkvevhtghgggeeRRDHSGLSLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQ  892
                                  SLEE  + R TAQQ S+DAL  A+ +YEKAK      + 
Sbjct  91    ---------------------SLEETAQQRATAQQNSMDALTAAEERYEKAKELGASALH  129

Query  893   SGSQYLVEKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQ  1072
                +      GAA           Y  A         QAKDT +   Q    Y    A  
Sbjct  130   DAEESASHGLGAA----------GYYGA---------QAKDTVTHGVQIGSQYVADKAGA  170

Query  1073  TKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQ----TKDTLSSAGQTA  1240
              KDT    G  AKD  V   Q     ++     AKD  ++ +QQ    TKDTLSSAGQTA
Sbjct  171   AKDTTLEKGAQAKDTIVHGVQIGPAYVADKAGAAKDTVLEKSQQAYAATKDTLSSAGQTA  230

Query  1241  KDYTVQSAQQAKD-TLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKA  1417
                 V+SA+QAKD TL  AG+T KDY       A E +S A Q+   Y       A +K 
Sbjct  231   ----VESAKQAKDYTLQKAGET-KDY-------AAEKISTAAQSTTHY-------AGEKT  271

Query  1418  GEAGNKASEAKERGTEMSKNAASYAGQKVTEAKDVTVESgkgavgyagkvaETLKDTATV  1597
              +A   A+E  +   E +KNAASY GQK  +AKD TVE+GK AVGYAG+VAET KD A +
Sbjct  272   TQAKQSAAELTKMAAEKTKNAASYVGQKGVDAKDATVETGKNAVGYAGEVAETAKDKAEI  331



>ref|XP_006348846.1| PREDICTED: seed biotin-containing protein SBP65-like [Solanum 
tuberosum]
Length=527

 Score =   114 bits (286),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 149/497 (30%), Positives = 203/497 (41%), Gaps = 157/497 (32%)
 Frame = +2

Query  188   MASEQLRRDNKTGERAVEVEKDRVPKMASHFESLAEKVADDTAADFHPaavrvtqttvat  367
             MASEQ RR+N T E  +++EKDRV KMASHF    E +AD                    
Sbjct  1     MASEQARRENVTDETKLQLEKDRVNKMASHF----ESLADKV------------------  38

Query  368   tEHEDQGKTAQKGGRAVHDQQTRGTTAQREHDQAKSWKATEETQAGRHDDIQQNRPVRVG  547
               HED     +     VH + T  ++   +  Q         T+  R  DI      R  
Sbjct  39    --HED----TETSPDVVHVKTTVTSSVPYQEHQ---------TEKQRSSDIMDKTQER--  81

Query  548   GIEFYSGQDARSGRDETTRRQGFEERPGGVKFEVHSGQGGGQSTRLQGLEERPggvkvev  727
                               ++Q F+E+PGGVKF V            QG E     +    
Sbjct  82    ------------------KQQVFQEKPGGVKFGV------------QGQEHEDSDINRGK  111

Query  728   htghgggeeRRDHSGLSLEEIGKYRQTAQQKSIDALQTAQNKYEKAK-------------  868
              +  G  E +    G SLEEI +YR TAQ+ S++A++ A+ +YEKAK             
Sbjct  112   QSKGGAEETK---GGPSLEEISQYRATAQENSMNAIRAAEERYEKAKEMGGSTLQNVKES  168

Query  869   --------------------NTTKENVQSGSQYLVEKAGAAKDTALQKTQQAYNAAKDTT  988
                                 +T  + +Q G+QY+ EKAGAAKD AL+K QQAY A     
Sbjct  169   ATHGLGATGTYAAEKGAQAKDTITQGLQKGTQYVAEKAGAAKDVALEKGQQAYAA-----  223

Query  989   ISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLS-------SAGQTAKDYTVQSAQQTKD  1147
                                         TKDTLS        + Q AKDYT++    TKD
Sbjct  224   ----------------------------TKDTLSGAGQTAAQSAQQAKDYTMEKTGDTKD  255

Query  1148  -TLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSA----QQAKDTLSGAGQTA--  1306
              T+   G+ AKD+  Q    TKD  S     AKDY  Q      +Q+K   S  G+ A  
Sbjct  256   YTMQKTGE-AKDFVAQKRGDTKDYTSQRTGEAKDYVAQKTGEIQEQSKGAASYVGEKAAQ  314

Query  1307  -KDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGNKASEAKERGTEMSKNAA  1483
              KD T++T + A     K  +  KD  V A   A+    E   KA++A +    ++   A
Sbjct  315   VKDVTLETGKGAVGYAGKVAETVKDKAVVAGWGAAHFTAE---KAADATKAIAGVTSTVA  371

Query  1484  SYAGQKVTEAKDVTVES  1534
              YAG     AKD+ V++
Sbjct  372   GYAGGTTVAAKDLVVDA  388



>ref|XP_009614116.1| PREDICTED: seed biotin-containing protein SBP65-like isoform 
X1 [Nicotiana tomentosiformis]
Length=434

 Score =   113 bits (283),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 134/360 (37%), Positives = 168/360 (47%), Gaps = 75/360 (21%)
 Frame = +2

Query  533   PVRVGGIEFYSGQDARSGRDETTRRQGFEERPGGVKFEVHSGQGGGQSTRLQGLEERPgg  712
             P +VGG+EF SG   +   ++  R +G E R           +GG  S R  G+E R   
Sbjct  42    PAKVGGLEFSSGVMQQEQSEKEQRPEGEERRA----------EGGAHSKR-SGVERRKAP  90

Query  713   vkvevhtghgggeeRRDHSGLSLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQ  892
                                  SLEE  + R TAQQ S+DAL  A+ +YEKAK      + 
Sbjct  91    ---------------------SLEETAQQRATAQQNSMDALTAAEERYEKAKELGASALH  129

Query  893   SGSQYLVEKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQ  1072
                +      GAA           Y  A         QAKDT +   Q    Y    A  
Sbjct  130   DAEESASHGLGAA----------GYYGA---------QAKDTVTHGVQIGSQYVADKAGA  170

Query  1073  TKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQ----TKDTLSSAGQTA  1240
              KDT    G  AKD  V   Q     ++     AKD  ++ +QQ    TKDTLSSAGQTA
Sbjct  171   AKDTTLEKGAQAKDTIVHGVQIGPAYVADKAGAAKDTVLEKSQQAYAATKDTLSSAGQTA  230

Query  1241  KDYTVQSAQQAKD-TLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKA  1417
                 V+SA+QAKD TL  AG+T KDY       A E +S A Q+   Y       A +K 
Sbjct  231   ----VESAKQAKDYTLQKAGET-KDY-------AAEKISTAAQSTTHY-------AGEKT  271

Query  1418  GEAGNKASEAKERGTEMSKNAASYAGQKVTEAKDVTVESgkgavgyagkvaETLKDTATV  1597
              +A   A+E  +   E +KNAASY GQK  +AKD TVE+GK AVGYAG+VAET KD A +
Sbjct  272   TQAKQSAAELTKMAAEKTKNAASYVGQKGVDAKDATVETGKNAVGYAGEVAETAKDKAEI  331



>ref|XP_009800345.1| PREDICTED: seed biotin-containing protein SBP65-like isoform 
X2 [Nicotiana sylvestris]
Length=465

 Score =   107 bits (266),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 113/275 (41%), Positives = 145/275 (53%), Gaps = 39/275 (14%)
 Frame = +2

Query  776   SLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKT  955
             SLEEI + R TAQQ S+DAL  A+ +Y+KAK               E   +A   A +  
Sbjct  63    SLEEIAQQRATAQQNSMDALTAAEERYQKAK---------------ELGASALHDAKESA  107

Query  956   QQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQ  1135
                  AA     +K  QAKD+ +   Q   +Y    A   KDT    G  AKD  V   Q
Sbjct  108   SHGLGAAGYYATAKGVQAKDSVTHGVQIGPEYVADKAGAAKDTTLDKGAQAKDTIVHGVQ  167

Query  1136  QTKDTLSSAGQTAKDYTVQSAQQ----TKDTLSSAGQTAKDYTVQSAQQAKD-TLSGAGQ  1300
                + ++     AKD  ++ +QQ    T DTL+SAGQTA    V+SAQ+AKD TL  AG+
Sbjct  168   IGSEYVADKAGAAKDTVLEKSQQAYAATADTLTSAGQTA----VESAQKAKDYTLQKAGE  223

Query  1301  TAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGNKASEAKERGTEMSKNA  1480
             T KDY       A E +S A Q+  +Y       A +KA +A   A+E  +   E +KNA
Sbjct  224   T-KDY-------AAEKISTAAQSTTNY-------AGEKATQAKQTAAELSKTAAEKTKNA  268

Query  1481  ASYAGQKVTEAKDVTVESgkgavgyagkvaETLKD  1585
             ASY GQK  EAK+ TVE+GK AVGYAG+VAET KD
Sbjct  269   ASYVGQKGVEAKNATVETGKSAVGYAGEVAETAKD  303


 Score = 85.5 bits (210),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 114/367 (31%), Positives = 165/367 (45%), Gaps = 57/367 (16%)
 Frame = +2

Query  527   NRPVRVGGIEFYSGQDARSGRDETTRRQGFEERPGGVKFEVHSGQGGGQSTRLQGL---E  697
             ++P +VGG+EF SG   +    +  +++G EER      E+   +   Q   +  L   E
Sbjct  30    SQPAKVGGLEFSSGGMQQE---QMQKQEGTEERKAPSLEEIAQQRATAQQNSMDALTAAE  86

Query  698   ERPggvkvevhtghgggeeRRDHSGLSLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTT  877
             ER    K    +     +E   H    L   G Y              A  K  +AK++ 
Sbjct  87    ERYQKAKELGASALHDAKESASH---GLGAAGYY--------------ATAKGVQAKDSV  129

Query  878   KENVQSGSQYLVEKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTT  1057
                VQ G +Y+ +KAGAAKDT L K  Q    AKDT +   Q   +  +     AKD   
Sbjct  130   THGVQIGPEYVADKAGAAKDTTLDKGAQ----AKDTIVHGVQIGSEYVADKAGAAKDTVL  185

Query  1058  QSAKQ----TKDTLSSAGQT-------AKDYTVQSAQQTKD----TLSSAGQTAKDYTVQ  1192
             + ++Q    T DTL+SAGQT       AKDYT+Q A +TKD     +S+A Q+  +Y  +
Sbjct  186   EKSQQAYAATADTLTSAGQTAVESAQKAKDYTLQKAGETKDYAAEKISTAAQSTTNYAGE  245

Query  1193  SAQQTKDTLSSAGQTAKD-------YTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETL  1351
              A Q K T +   +TA +       Y  Q   +AK+     G++A  Y  + A+ AK+  
Sbjct  246   KATQAKQTAAELSKTAAEKTKNAASYVGQKGVEAKNATVETGKSAVGYAGEVAETAKDET  305

Query  1352  SKAG--------QAAKDYTVQAKDYASQKAGEAGNKASEAKERGTEMSKNAASYAGQKVT  1507
               AG        +AA + T       S+ AG AG KA  AK+   +  K+A  YAG K+ 
Sbjct  306   EIAGLGAAHYTAKAAAEATKATAGVVSRAAGYAGEKAVAAKDVVADAGKSAVGYAGDKLA  365

Query  1508  EAKDVTV  1528
              A D  V
Sbjct  366   AAIDYVV  372



>ref|XP_009800344.1| PREDICTED: seed biotin-containing protein SBP65-like isoform 
X1 [Nicotiana sylvestris]
Length=466

 Score =   107 bits (267),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 113/275 (41%), Positives = 145/275 (53%), Gaps = 39/275 (14%)
 Frame = +2

Query  776   SLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKT  955
             SLEEI + R TAQQ S+DAL  A+ +Y+KAK               E   +A   A +  
Sbjct  63    SLEEIAQQRATAQQNSMDALTAAEERYQKAK---------------ELGASALHDAKESA  107

Query  956   QQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQ  1135
                  AA     +K  QAKD+ +   Q   +Y    A   KDT    G  AKD  V   Q
Sbjct  108   SHGLGAAGYYATAKGVQAKDSVTHGVQIGPEYVADKAGAAKDTTLDKGAQAKDTIVHGVQ  167

Query  1136  QTKDTLSSAGQTAKDYTVQSAQQ----TKDTLSSAGQTAKDYTVQSAQQAKD-TLSGAGQ  1300
                + ++     AKD  ++ +QQ    T DTL+SAGQTA    V+SAQ+AKD TL  AG+
Sbjct  168   IGSEYVADKAGAAKDTVLEKSQQAYAATADTLTSAGQTA----VESAQKAKDYTLQKAGE  223

Query  1301  TAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGNKASEAKERGTEMSKNA  1480
             T KDY       A E +S A Q+  +Y       A +KA +A   A+E  +   E +KNA
Sbjct  224   T-KDY-------AAEKISTAAQSTTNY-------AGEKATQAKQTAAELSKTAAEKTKNA  268

Query  1481  ASYAGQKVTEAKDVTVESgkgavgyagkvaETLKD  1585
             ASY GQK  EAK+ TVE+GK AVGYAG+VAET KD
Sbjct  269   ASYVGQKGVEAKNATVETGKSAVGYAGEVAETAKD  303


 Score = 85.1 bits (209),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 114/367 (31%), Positives = 165/367 (45%), Gaps = 57/367 (16%)
 Frame = +2

Query  527   NRPVRVGGIEFYSGQDARSGRDETTRRQGFEERPGGVKFEVHSGQGGGQSTRLQGL---E  697
             ++P +VGG+EF SG   +    +  +++G EER      E+   +   Q   +  L   E
Sbjct  30    SQPAKVGGLEFSSGGMQQE---QMQKQEGTEERKAPSLEEIAQQRATAQQNSMDALTAAE  86

Query  698   ERPggvkvevhtghgggeeRRDHSGLSLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTT  877
             ER    K    +     +E   H    L   G Y              A  K  +AK++ 
Sbjct  87    ERYQKAKELGASALHDAKESASH---GLGAAGYY--------------ATAKGVQAKDSV  129

Query  878   KENVQSGSQYLVEKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTT  1057
                VQ G +Y+ +KAGAAKDT L K  Q    AKDT +   Q   +  +     AKD   
Sbjct  130   THGVQIGPEYVADKAGAAKDTTLDKGAQ----AKDTIVHGVQIGSEYVADKAGAAKDTVL  185

Query  1058  QSAKQ----TKDTLSSAGQT-------AKDYTVQSAQQTKD----TLSSAGQTAKDYTVQ  1192
             + ++Q    T DTL+SAGQT       AKDYT+Q A +TKD     +S+A Q+  +Y  +
Sbjct  186   EKSQQAYAATADTLTSAGQTAVESAQKAKDYTLQKAGETKDYAAEKISTAAQSTTNYAGE  245

Query  1193  SAQQTKDTLSSAGQTAKD-------YTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETL  1351
              A Q K T +   +TA +       Y  Q   +AK+     G++A  Y  + A+ AK+  
Sbjct  246   KATQAKQTAAELSKTAAEKTKNAASYVGQKGVEAKNATVETGKSAVGYAGEVAETAKDET  305

Query  1352  SKAG--------QAAKDYTVQAKDYASQKAGEAGNKASEAKERGTEMSKNAASYAGQKVT  1507
               AG        +AA + T       S+ AG AG KA  AK+   +  K+A  YAG K+ 
Sbjct  306   EIAGLGAAHYTAKAAAEATKATAGVVSRAAGYAGEKAVAAKDVVADAGKSAVGYAGDKLA  365

Query  1508  EAKDVTV  1528
              A D  V
Sbjct  366   AAIDYVV  372



>ref|XP_009800346.1| PREDICTED: seed biotin-containing protein SBP65-like isoform 
X3 [Nicotiana sylvestris]
Length=412

 Score =   105 bits (262),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 113/275 (41%), Positives = 145/275 (53%), Gaps = 39/275 (14%)
 Frame = +2

Query  776   SLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKT  955
             SLEEI + R TAQQ S+DAL  A+ +Y+KAK               E   +A   A +  
Sbjct  63    SLEEIAQQRATAQQNSMDALTAAEERYQKAK---------------ELGASALHDAKESA  107

Query  956   QQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQ  1135
                  AA     +K  QAKD+ +   Q   +Y    A   KDT    G  AKD  V   Q
Sbjct  108   SHGLGAAGYYATAKGVQAKDSVTHGVQIGPEYVADKAGAAKDTTLDKGAQAKDTIVHGVQ  167

Query  1136  QTKDTLSSAGQTAKDYTVQSAQQ----TKDTLSSAGQTAKDYTVQSAQQAKD-TLSGAGQ  1300
                + ++     AKD  ++ +QQ    T DTL+SAGQTA    V+SAQ+AKD TL  AG+
Sbjct  168   IGSEYVADKAGAAKDTVLEKSQQAYAATADTLTSAGQTA----VESAQKAKDYTLQKAGE  223

Query  1301  TAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGNKASEAKERGTEMSKNA  1480
             T KDY       A E +S A Q+  +Y       A +KA +A   A+E  +   E +KNA
Sbjct  224   T-KDY-------AAEKISTAAQSTTNY-------AGEKATQAKQTAAELSKTAAEKTKNA  268

Query  1481  ASYAGQKVTEAKDVTVESgkgavgyagkvaETLKD  1585
             ASY GQK  EAK+ TVE+GK AVGYAG+VAET KD
Sbjct  269   ASYVGQKGVEAKNATVETGKSAVGYAGEVAETAKD  303


 Score = 85.1 bits (209),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 114/368 (31%), Positives = 165/368 (45%), Gaps = 57/368 (15%)
 Frame = +2

Query  524   QNRPVRVGGIEFYSGQDARSGRDETTRRQGFEERPGGVKFEVHSGQGGGQSTRLQGL---  694
              ++P +VGG+EF SG   +    +  +++G EER      E+   +   Q   +  L   
Sbjct  29    HSQPAKVGGLEFSSGGMQQE---QMQKQEGTEERKAPSLEEIAQQRATAQQNSMDALTAA  85

Query  695   EERPggvkvevhtghgggeeRRDHSGLSLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNT  874
             EER    K    +     +E   H    L   G Y              A  K  +AK++
Sbjct  86    EERYQKAKELGASALHDAKESASH---GLGAAGYY--------------ATAKGVQAKDS  128

Query  875   TKENVQSGSQYLVEKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYT  1054
                 VQ G +Y+ +KAGAAKDT L K  Q    AKDT +   Q   +  +     AKD  
Sbjct  129   VTHGVQIGPEYVADKAGAAKDTTLDKGAQ----AKDTIVHGVQIGSEYVADKAGAAKDTV  184

Query  1055  TQSAKQ----TKDTLSSAGQT-------AKDYTVQSAQQTKD----TLSSAGQTAKDYTV  1189
              + ++Q    T DTL+SAGQT       AKDYT+Q A +TKD     +S+A Q+  +Y  
Sbjct  185   LEKSQQAYAATADTLTSAGQTAVESAQKAKDYTLQKAGETKDYAAEKISTAAQSTTNYAG  244

Query  1190  QSAQQTKDTLSSAGQTAKD-------YTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKET  1348
             + A Q K T +   +TA +       Y  Q   +AK+     G++A  Y  + A+ AK+ 
Sbjct  245   EKATQAKQTAAELSKTAAEKTKNAASYVGQKGVEAKNATVETGKSAVGYAGEVAETAKDE  304

Query  1349  LSKAG--------QAAKDYTVQAKDYASQKAGEAGNKASEAKERGTEMSKNAASYAGQKV  1504
                AG        +AA + T       S+ AG AG KA  AK+   +  K+A  YAG K+
Sbjct  305   TEIAGLGAAHYTAKAAAEATKATAGVVSRAAGYAGEKAVAAKDVVADAGKSAVGYAGDKL  364

Query  1505  TEAKDVTV  1528
               A D  V
Sbjct  365   AAAIDYVV  372



>ref|XP_009800347.1| PREDICTED: seed biotin-containing protein SBP65-like isoform 
X4 [Nicotiana sylvestris]
Length=411

 Score =   105 bits (261),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 113/275 (41%), Positives = 145/275 (53%), Gaps = 39/275 (14%)
 Frame = +2

Query  776   SLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKT  955
             SLEEI + R TAQQ S+DAL  A+ +Y+KAK               E   +A   A +  
Sbjct  63    SLEEIAQQRATAQQNSMDALTAAEERYQKAK---------------ELGASALHDAKESA  107

Query  956   QQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQ  1135
                  AA     +K  QAKD+ +   Q   +Y    A   KDT    G  AKD  V   Q
Sbjct  108   SHGLGAAGYYATAKGVQAKDSVTHGVQIGPEYVADKAGAAKDTTLDKGAQAKDTIVHGVQ  167

Query  1136  QTKDTLSSAGQTAKDYTVQSAQQ----TKDTLSSAGQTAKDYTVQSAQQAKD-TLSGAGQ  1300
                + ++     AKD  ++ +QQ    T DTL+SAGQTA    V+SAQ+AKD TL  AG+
Sbjct  168   IGSEYVADKAGAAKDTVLEKSQQAYAATADTLTSAGQTA----VESAQKAKDYTLQKAGE  223

Query  1301  TAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGNKASEAKERGTEMSKNA  1480
             T KDY       A E +S A Q+  +Y       A +KA +A   A+E  +   E +KNA
Sbjct  224   T-KDY-------AAEKISTAAQSTTNY-------AGEKATQAKQTAAELSKTAAEKTKNA  268

Query  1481  ASYAGQKVTEAKDVTVESgkgavgyagkvaETLKD  1585
             ASY GQK  EAK+ TVE+GK AVGYAG+VAET KD
Sbjct  269   ASYVGQKGVEAKNATVETGKSAVGYAGEVAETAKD  303


 Score = 84.7 bits (208),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 114/368 (31%), Positives = 165/368 (45%), Gaps = 57/368 (15%)
 Frame = +2

Query  524   QNRPVRVGGIEFYSGQDARSGRDETTRRQGFEERPGGVKFEVHSGQGGGQSTRLQGL---  694
              ++P +VGG+EF SG   +    +  +++G EER      E+   +   Q   +  L   
Sbjct  29    HSQPAKVGGLEFSSGGMQQE---QMQKQEGTEERKAPSLEEIAQQRATAQQNSMDALTAA  85

Query  695   EERPggvkvevhtghgggeeRRDHSGLSLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNT  874
             EER    K    +     +E   H    L   G Y              A  K  +AK++
Sbjct  86    EERYQKAKELGASALHDAKESASH---GLGAAGYY--------------ATAKGVQAKDS  128

Query  875   TKENVQSGSQYLVEKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYT  1054
                 VQ G +Y+ +KAGAAKDT L K  Q    AKDT +   Q   +  +     AKD  
Sbjct  129   VTHGVQIGPEYVADKAGAAKDTTLDKGAQ----AKDTIVHGVQIGSEYVADKAGAAKDTV  184

Query  1055  TQSAKQ----TKDTLSSAGQT-------AKDYTVQSAQQTKD----TLSSAGQTAKDYTV  1189
              + ++Q    T DTL+SAGQT       AKDYT+Q A +TKD     +S+A Q+  +Y  
Sbjct  185   LEKSQQAYAATADTLTSAGQTAVESAQKAKDYTLQKAGETKDYAAEKISTAAQSTTNYAG  244

Query  1190  QSAQQTKDTLSSAGQTAKD-------YTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKET  1348
             + A Q K T +   +TA +       Y  Q   +AK+     G++A  Y  + A+ AK+ 
Sbjct  245   EKATQAKQTAAELSKTAAEKTKNAASYVGQKGVEAKNATVETGKSAVGYAGEVAETAKDE  304

Query  1349  LSKAG--------QAAKDYTVQAKDYASQKAGEAGNKASEAKERGTEMSKNAASYAGQKV  1504
                AG        +AA + T       S+ AG AG KA  AK+   +  K+A  YAG K+
Sbjct  305   TEIAGLGAAHYTAKAAAEATKATAGVVSRAAGYAGEKAVAAKDVVADAGKSAVGYAGDKL  364

Query  1505  TEAKDVTV  1528
               A D  V
Sbjct  365   AAAIDYVV  372



>ref|XP_010657029.1| PREDICTED: seed biotin-containing protein SBP65 isoform X2 [Vitis 
vinifera]
Length=381

 Score =   102 bits (253),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 78/223 (35%), Positives = 111/223 (50%), Gaps = 47/223 (21%)
 Frame = +2

Query  776   SLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNT-------TKENV----QSGSQYLVEKA  922
             SLEEI K+R+ AQQ SI+A++ A+ +Y+KAK          KE+V    +S + Y  EK 
Sbjct  117   SLEEISKFREKAQQNSIEAIRAAEERYQKAKELGASKLQDVKESVAPRVESATTYATEKG  176

Query  923   GAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQ  1102
                KDTAL+K+QQ Y  AKDT +           + G+TA DYT Q+A+Q          
Sbjct  177   AQVKDTALEKSQQGYTTAKDTLV-----------TAGKTAADYTKQTAEQ----------  215

Query  1103  TAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDT  1282
               KDYT+Q A Q KD      + A +Y  + A + KD   + G  A  YT + A +A   
Sbjct  216   -GKDYTLQKATQAKDVSLETSKGAAEYAGKKAAELKDKALATGWGAAHYTTEKAVEATKA  274

Query  1283  LSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQ  1411
              +GA Q+  +YT              G+   DYT + ++ A Q
Sbjct  275   AAGAIQSTAEYT--------------GEKVVDYTGRKREEAQQ  303


 Score = 58.5 bits (140),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 51/140 (36%), Positives = 67/140 (48%), Gaps = 32/140 (23%)
 Frame = +2

Query  1100  QTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKD  1279
             Q AK+      Q  K++++   ++A  Y  +   Q KDT     Q  + YT      AKD
Sbjct  144   QKAKELGASKLQDVKESVAPRVESATTYATEKGAQVKDTALEKSQ--QGYTT-----AKD  196

Query  1280  TLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGNKASEAKERG  1459
             TL  AG+TA DYT QTA+Q K           DYT+Q              KA++AK+  
Sbjct  197   TLVTAGKTAADYTKQTAEQGK-----------DYTLQ--------------KATQAKDVS  231

Query  1460  TEMSKNAASYAGQKVTEAKD  1519
              E SK AA YAG+K  E KD
Sbjct  232   LETSKGAAEYAGKKAAELKD  251


 Score = 57.4 bits (137),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +2

Query  188  MASEQLRRDNKTGERAVEVEKDRVPKMASHFESLAEKV  301
            MASEQ RRDN T ER   +E +RVPKM SHFESL+E+V
Sbjct  1    MASEQERRDNTTKERETHLEVERVPKMTSHFESLSERV  38



>ref|XP_010657028.1| PREDICTED: seed biotin-containing protein SBP65 isoform X1 [Vitis 
vinifera]
 emb|CAN61650.1| hypothetical protein VITISV_027795 [Vitis vinifera]
Length=396

 Score =   101 bits (252),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 78/223 (35%), Positives = 111/223 (50%), Gaps = 47/223 (21%)
 Frame = +2

Query  776   SLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNT-------TKENV----QSGSQYLVEKA  922
             SLEEI K+R+ AQQ SI+A++ A+ +Y+KAK          KE+V    +S + Y  EK 
Sbjct  117   SLEEISKFREKAQQNSIEAIRAAEERYQKAKELGASKLQDVKESVAPRVESATTYATEKG  176

Query  923   GAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQ  1102
                KDTAL+K+QQ Y  AKDT +           + G+TA DYT Q+A+Q          
Sbjct  177   AQVKDTALEKSQQGYTTAKDTLV-----------TAGKTAADYTKQTAEQ----------  215

Query  1103  TAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDT  1282
               KDYT+Q A Q KD      + A +Y  + A + KD   + G  A  YT + A +A   
Sbjct  216   -GKDYTLQKATQAKDVSLETSKGAAEYAGKKAAELKDKALATGWGAAHYTTEKAVEATKA  274

Query  1283  LSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQ  1411
              +GA Q+  +YT              G+   DYT + ++ A Q
Sbjct  275   AAGAIQSTAEYT--------------GEKVVDYTGRKREEAQQ  303


 Score = 57.4 bits (137),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +2

Query  188  MASEQLRRDNKTGERAVEVEKDRVPKMASHFESLAEKV  301
            MASEQ RRDN T ER   +E +RVPKM SHFESL+E+V
Sbjct  1    MASEQERRDNTTKERETHLEVERVPKMTSHFESLSERV  38



>ref|XP_004248482.1| PREDICTED: seed biotin-containing protein SBP65-like isoform 
X1 [Solanum lycopersicum]
Length=638

 Score =   100 bits (250),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 133/341 (39%), Positives = 167/341 (49%), Gaps = 82/341 (24%)
 Frame = +2

Query  776   SLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKT  955
             +++ +    QTA Q +  A  TA  K ++A + T + + S  +   E A  AKDT L K 
Sbjct  153   TIDALSNTGQTAAQSAKKAKDTAFVKGQQAYDATTDTLSSTGKTAAESAKKAKDTVLYKG  212

Query  956   QQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKD------------------  1081
             QQ Y A           A D  SS GQTA     QSAK+ KD                  
Sbjct  213   QQGYGA-----------ATDNLSSAGQTA----AQSAKKAKDYAKGTVFDKGQQAYGATT  257

Query  1082  -TLSSAGQT-------AKDYTVQSAQQ----TKDTLSSAGQT-------AKDYTVQSAQQ  1204
              TLS+AGQ        AKD  +   QQ    TKDTLSS G+T       AK+ T +  QQ
Sbjct  258   ATLSTAGQNAAQSAKKAKDTVLDKGQQAYAATKDTLSSTGKTAVQSAKNAKETTFEKGQQ  317

Query  1205  ----TKDTLSSAGQ-------TAKDYTVQSAQQA----KDTLSGAGQTA-------KDYT  1318
                 T DTLSSAGQ       TAKD  +   QQA     +TLS AGQTA       KD  
Sbjct  318   AYGATTDTLSSAGQIAAQSAKTAKDTVLDKGQQAYGATTNTLSSAGQTAAQSAKKTKDTV  377

Query  1319  VQTAQQA----KETLSKAGQAAKDYTVQAKDYASQKAGEA----GNKASEAKERGTEMSK  1474
             +   QQA    K+TLS AGQ A     +AKD    K  +A     +  S A +   + +K
Sbjct  378   LDKGQQAYAATKDTLSSAGQNAAQSAKKAKDTVLDKGQQAYAATTDTLSSAGQTTVQSTK  437

Query  1475  NAASYAGQKVTEAKDVTVESgkgavgyagkvaETLKDTATV  1597
             NAA Y GQ+  EAKD+T+E+GKG +GYAG+VAE +KD A V
Sbjct  438   NAAGYVGQRAVEAKDITLETGKGVLGYAGEVAEIVKDKAAV  478


 Score = 63.9 bits (154),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 96/281 (34%), Positives = 124/281 (44%), Gaps = 59/281 (21%)
 Frame = +2

Query  776   SLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKT  955
             +L   GK   TA Q + +A +T   K ++A   T + + S  Q   + A  AKDT L K 
Sbjct  292   TLSSTGK---TAVQSAKNAKETTFEKGQQAYGATTDTLSSAGQIAAQSAKTAKDTVLDKG  348

Query  956   QQAYNAA------------------KDTTISKTQQA----KDTFSSTGQTAKDYTTQSAK  1069
             QQAY A                   KDT + K QQA    KDT SS GQ A     QSAK
Sbjct  349   QQAYGATTNTLSSAGQTAAQSAKKTKDTVLDKGQQAYAATKDTLSSAGQNA----AQSAK  404

Query  1070  QTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDY  1249
             + KDT+   GQ       Q+   T DTLSSAGQT    TVQS      T ++AG     Y
Sbjct  405   KAKDTVLDKGQ-------QAYAATTDTLSSAGQT----TVQS------TKNAAG-----Y  442

Query  1250  TVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKD--------YA  1405
               Q A +AKD     G+    Y  + A+  K+  + +G  A  YT +            A
Sbjct  443   VGQRAVEAKDITLETGKGVLGYAGEVAEIVKDKAAVSGWGAAHYTAEKAAEATKAVVGVA  502

Query  1406  SQKAGEAGNKASEAKERGTEMSKNAASYAGQKVTEAKDVTV  1528
             S  AG    KA  AK+   +   N   YA  ++ +AKD  V
Sbjct  503   SNVAGYTEEKAVAAKDAVADTGMNIVGYAENELADAKDYVV  543


 Score = 57.8 bits (138),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 74/201 (37%), Positives = 93/201 (46%), Gaps = 25/201 (12%)
 Frame = +2

Query  929   AKDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTA  1108
             AK+TA  K  Q Y AA DT     Q A  +   +  T  D   Q+   T D LS+ GQTA
Sbjct  105   AKNTAPDKGDQTYAAATDTLSGAGQTAAQSAKKSKNTVLDKGQQAYAATIDALSNTGQTA  164

Query  1109  KDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLS  1288
                  QSA++ KDT    GQ A D T        DTLSS G+TA     +SA++AKDT+ 
Sbjct  165   ----AQSAKKAKDTAFVKGQQAYDATT-------DTLSSTGKTA----AESAKKAKDTVL  209

Query  1289  GAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGNKASEAKERGTEM  1468
               GQ       Q    A + LS AGQ A     +AKDYA    G   +K  +A    T  
Sbjct  210   YKGQ-------QGYGAATDNLSSAGQTAAQSAKKAKDYAK---GTVFDKGQQAYGATTAT  259

Query  1469  SKNAASYAGQKVTEAKDVTVE  1531
                A   A Q   +AKD  ++
Sbjct  260   LSTAGQNAAQSAKKAKDTVLD  280



>gb|KFK37108.1| hypothetical protein AALP_AA4G213900 [Arabis alpina]
Length=848

 Score =   100 bits (250),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 90/268 (34%), Positives = 137/268 (51%), Gaps = 19/268 (7%)
 Frame = +2

Query  761   DHSGLSLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSG----SQYLVEKAGA  928
             +H+ L  +  G+ ++   QKS+   ++A +   +     KE+V+ G    S Y+ EK   
Sbjct  230   EHAKLLAKGGGEMKEREGQKSVGGGRSATDTVAEKGRQIKESVEQGGKRASDYVTEKGRE  289

Query  929   AKDTALQK---TQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAG  1099
             +   A QK   T++    AKD T+ K  +AKDT +   + A DYTT+ AK+  +    A 
Sbjct  290   SGQVAGQKGQETEEQAGRAKDKTMEKAGEAKDTAAGKARRASDYTTEKAKEAAEQTGRA-  348

Query  1100  QTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKD  1279
                KDYT++ A + KDT +   + A +Y  + A++  +  +     AKDYT++ A QAKD
Sbjct  349   ---KDYTMEKASEAKDTAAEKARRASEYATEKAKEAGNVTAEQTGKAKDYTMEKAGQAKD  405

Query  1280  TLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQ----AKDYASQKAGEAGNKASEA  1447
             T +   Q A +Y  QT   A E  ++    AKDYT+Q    AKD A++KA +A   A E 
Sbjct  406   TAAEKAQRATEYGKQTGNTAAEQAAR----AKDYTLQKAFEAKDIAAEKAQKATEYAKET  461

Query  1448  KERGTEMSKNAASYAGQKVTEAKDVTVE  1531
                  E +  A  Y  QK  EAKD+  E
Sbjct  462   GNTAAEQAARAKDYTLQKAVEAKDIAAE  489


 Score = 93.6 bits (231),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 85/254 (33%), Positives = 117/254 (46%), Gaps = 65/254 (26%)
 Frame = +2

Query  911   VEKAGAAKDTALQKTQQAYN--------------AAKDTTISKTQQAKDTFSSTGQTAKD  1048
             +EKAG AKDTA  K ++A +               AKD T+ K  +AKDT +   + A +
Sbjct  313   MEKAGEAKDTAAGKARRASDYTTEKAKEAAEQTGRAKDYTMEKASEAKDTAAEKARRASE  372

Query  1049  YTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQ------------------TA  1174
             Y T+ AK+  +  +     AKDYT++ A Q KDT +   Q                   A
Sbjct  373   YATEKAKEAGNVTAEQTGKAKDYTMEKAGQAKDTAAEKAQRATEYGKQTGNTAAEQAARA  432

Query  1175  KDYTVQSAQQTKDTLSSAGQT------------------AKDYTVQSAQQAKDTLSGAGQ  1300
             KDYT+Q A + KD  +   Q                   AKDYT+Q A +AKD  +   Q
Sbjct  433   KDYTLQKAFEAKDIAAEKAQKATEYAKETGNTAAEQAARAKDYTLQKAVEAKDIAAEKAQ  492

Query  1301  TAKDYTVQTAQQAKETLSKAGQAAKDYTV----QAKDYASQKAGEAGNKASEAKERGTEM  1468
              A  +  +  ++A    ++ GQ AK+ TV    +AKDY  QKAGEA            E+
Sbjct  493   KASQFVTEKGKEAGNIAAEKGQVAKEQTVSMTGKAKDYTVQKAGEA-----------VEL  541

Query  1469  SKNAASYAGQKVTE  1510
             SK AA YA +KV E
Sbjct  542   SKEAAEYAKEKVVE  555


 Score = 80.9 bits (198),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 72/220 (33%), Positives = 110/220 (50%), Gaps = 29/220 (13%)
 Frame = +2

Query  773   LSLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQK  952
              ++E+  + + TA +K+  A + A  K ++A N T E       Y +EKAG AKDTA +K
Sbjct  351   YTMEKASEAKDTAAEKARRASEYATEKAKEAGNVTAEQTGKAKDYTMEKAGQAKDTAAEK  410

Query  953   TQQA--YNA------------AKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLS  1090
              Q+A  Y              AKD T+ K  +AKD  +   Q A +Y    AK+T +T +
Sbjct  411   AQRATEYGKQTGNTAAEQAARAKDYTLQKAFEAKDIAAEKAQKATEY----AKETGNTAA  466

Query  1091  SAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQ  1270
                  AKDYT+Q A + KD  +   Q A  +  +  ++  +  +  GQ AK+ TV     
Sbjct  467   EQAARAKDYTLQKAVEAKDIAAEKAQKASQFVTEKGKEAGNIAAEKGQVAKEQTV-----  521

Query  1271  AKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQ  1390
                +++G    AKDYTVQ A +A E   +A + AK+  V+
Sbjct  522   ---SMTG---KAKDYTVQKAGEAVELSKEAAEYAKEKVVE  555


 Score = 59.7 bits (143),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +2

Query  188  MASEQLRRDNKTGERAVEVEKDRVPKMASHFESLAEK  298
            M+SEQ RR+N   E+ V+VEKDRVPKM SHFES+AEK
Sbjct  1    MSSEQARRENVVKEKEVDVEKDRVPKMTSHFESMAEK  37



>ref|XP_006446761.1| hypothetical protein CICLE_v10014817mg [Citrus clementina]
 gb|ESR60001.1| hypothetical protein CICLE_v10014817mg [Citrus clementina]
Length=546

 Score = 99.0 bits (245),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 129/450 (29%), Positives = 186/450 (41%), Gaps = 78/450 (17%)
 Frame = +2

Query  188   MASEQLRRDNKTGERAVEVEKDRVPKMASHFESLAEKVADDTAADFHPaavrvtqttvat  367
             MAS+Q RR+  T ++ V +EKDRVPKM +HFESL  +  D   +D         ++  A 
Sbjct  1     MASDQARRETTTTKKEVVIEKDRVPKMTTHFESLTGRAKD---SDTSGGKETSLRSGKAR  57

Query  368   tEHE----------DQGKTAQKGGRAVHDQQTRGTTAQREHDQAKSWKATEETQAGRHDD  517
               HE          DQ K  Q+G     D+  R     RE + A+  +  EE     H++
Sbjct  58    ESHEVGTHEFESLSDQMKDKQRGTGTYADK-ARDANMVREKE-AEGMRGKEE-----HEE  110

Query  518   IQQNRPVRVGGIEFYSGQDARSGRD-ETTRRQGFEERPGGVKFEVHSGQGGGQSTRLQGL  694
              +   P  VG  E             E  R +G  +R      E    + GG+  + QG 
Sbjct  111   KRSTEPYSVGNFEVGGEGRGEMEGRQEKERSRGMHQRE-----EERHVEKGGRRGKQQGK  165

Query  695   EERPggvkvevhtghgggeeRRDHSGLSLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNT  874
             EE             G  +++  HS   LEEI + R  AQQ+S++AL+ A+ +Y +AK  
Sbjct  166   EE------------GGQEQKQEQHS---LEEISQLRGQAQQQSMEALKAAEERYNQAKEE  210

Query  875   TKENVQSGSQYLVEKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYT  1054
                 + S ++Y  EK   AKDT LQ  QQ      +    K  QAKD   S GQTAK+YT
Sbjct  211   AGRRLGSVTEYAAEKGSQAKDTVLQGAQQTSQYISE----KGSQAKDILYSAGQTAKEYT  266

Query  1055  TQSAKQTK-----------------------------DTLSSAGQTAKDYTVQSAQQTKD  1147
                A+Q K                             D    +G+ A +Y  + A   KD
Sbjct  267   VPKAEQAKEYGVEKATEAKEAAADTTKKAGEKAAAAKDVTVQSGKGATEYAGKVAADVKD  326

Query  1148  TLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSG----AGQTAKDY  1315
                 AG +   YT + A      ++ A Q      V+    A   + G    AG  A + 
Sbjct  327   KAVVAGWSTAHYTAEKAVGGTAAVAKAAQYTTGKVVEGTMAAVRAVEGAAEYAGHKAAEI  386

Query  1316  TVQTAQQAKETLSKAGQAAKDYTVQAKDYA  1405
               +    AK+     G+  K+YTV+ K+ A
Sbjct  387   VSKPLVAAKDAAVSTGETMKEYTVRKKEEA  416



>ref|XP_008342805.1| PREDICTED: seed biotin-containing protein SBP65-like [Malus domestica]
Length=755

 Score = 99.4 bits (246),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 81/231 (35%), Positives = 119/231 (52%), Gaps = 24/231 (10%)
 Frame = +2

Query  776   SLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKT  955
             SLEEI + R TAQQ S++A++ A+ +Y KAK + ++ + S ++Y  E AG AKDT LQ  
Sbjct  376   SLEEISQLRGTAQQNSMEAMRAAEERYAKAKESARQGLGSATEYASETAGQAKDTLLQ--  433

Query  956   QQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQ  1135
                            Q AK+T +S G+TA + T   A++ KD   SAGQT   Y  + A 
Sbjct  434   -------------GXQTAKETLTSAGKTAIEKTAPLAERAKDVAVSAGQTTLHYVEEGAV  480

Query  1136  QTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSA----QQAKDTLSG----  1291
             + KD     G+T+  Y    A   KD  + AG TA  YT ++A    ++A   + G    
Sbjct  481   KAKDKTLEGGKTSAAYAGDVAVXLKDKGTVAGWTAAHYTTEAAVEGTKKAAKVVIGAAEY  540

Query  1292  AGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGNKASE  1444
             AG  A D   +     K+  + AG+ A++YT + K+ A Q+  EA   A E
Sbjct  541   AGHKAVDIVSKPLSVVKDAAAVAGEKAEEYTARKKEEA-QRVLEAKRSAEE  590



>emb|CDY14845.1| BnaC04g48420D [Brassica napus]
Length=632

 Score = 98.2 bits (243),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 99/304 (33%), Positives = 140/304 (46%), Gaps = 74/304 (24%)
 Frame = +2

Query  776   SLEEIGKYRQTAQQKSIDALQTAQNKYEKAKN-----------TTKENVQSGSQYLVEKA  922
             +LE+I  +R  AQQKS+D ++ A+ +Y KAK                  +    Y +EK 
Sbjct  103   TLEDIQGFRANAQQKSMDTVRAAEERYNKAKEGLSRGGQGGQQVEGRGRECAKDYTMEKG  162

Query  923   GAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQT--AKDYTTQSAKQTKDTLSSA  1096
             G  KDTA +KTQ+A + A++    K ++A    +  GQ   AKDYT +     KDT S  
Sbjct  163   GDVKDTASEKTQRASDYARE----KAREAGHMGAQKGQAGRAKDYTMEKGGDVKDTASEE  218

Query  1097  GQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAK  1276
                AKDYT++ A + K+T +   + A  Y  + A++T +  +     AKD  +Q A +AK
Sbjct  219   TARAKDYTMEKAGEAKETAAEKARRASQYATEKAKETANMTAEQAARAKDMALQKAAEAK  278

Query  1277  DT----------------LSGAGQT---------------AKDYTVQTAQQA--------  1339
             DT                ++ A Q                AKD   + AQ+A        
Sbjct  279   DTAAEKAKYATEKGRETGITAAEQAARAKDLALQKAKAVEAKDIAAEKAQRASQYVTEKG  338

Query  1340  KET---LSKAGQAAKDYTV----QAKDYASQKAGEAGNKASEAKERGTEMSKNAASYAGQ  1498
             KET    ++ GQ AK+ TV    +AKDY  QKAGEA            EMSK AA YA +
Sbjct  339   KETGNLTAQKGQEAKEQTVSVTAKAKDYTVQKAGEA-----------VEMSKEAAEYAKE  387

Query  1499  KVTE  1510
              V E
Sbjct  388   TVVE  391


 Score = 65.9 bits (159),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 79/266 (30%), Positives = 126/266 (47%), Gaps = 32/266 (12%)
 Frame = +2

Query  773   LSLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQK  952
              ++E+ G+ ++TA +K+  A Q A  K ++  N T E         ++KA  AKDTA +K
Sbjct  225   YTMEKAGEAKETAAEKARRASQYATEKAKETANMTAEQAARAKDMALQKAAEAKDTAAEK  284

Query  953   TQQAYNAAKDTTISKTQQA----------------KDTFSSTGQTAKDYTTQSAKQTKDT  1084
              + A    ++T I+  +QA                KD  +   Q A  Y T+  K+T + 
Sbjct  285   AKYATEKGRETGITAAEQAARAKDLALQKAKAVEAKDIAAEKAQRASQYVTEKGKETGNL  344

Query  1085  LSSAGQTAKDYTVQSAQQTKD-TLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQS  1261
              +  GQ AK+ TV    + KD T+  AG+ A + + ++A+  K+T+   G+ A  YT  +
Sbjct  345   TAQKGQEAKEQTVSVTAKAKDYTVQKAGE-AVEMSKEAAEYAKETVVEGGKGAAHYTGVA  403

Query  1262  AQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQ-AKDYASQKAGEAGNKA  1438
             A++A       G TA  +T +   Q   T + AG      TV+ A  YA  KA E G+KA
Sbjct  404   AEKA----GTVGWTAAHFTTEKVVQG--TKAVAG------TVEGAVGYAGHKAAEVGSKA  451

Query  1439  SE-AKERGTEMSKNAASYAGQKVTEA  1513
              +  KE+    +     Y  +K  EA
Sbjct  452   VDLTKEKAAVAADTVVGYTARKKEEA  477


 Score = 62.4 bits (150),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +2

Query  188  MASEQLRRDNKTGERAVEVEKDRVPKMASHFESLAEKVAD  307
            MASEQ RR+N   ER V+VEKDRVPKM SHFES+AEK  D
Sbjct  1    MASEQARRENVVKEREVQVEKDRVPKMTSHFESIAEKGKD  40



>gb|KDO63323.1| hypothetical protein CISIN_1g009018mg [Citrus sinensis]
Length=546

 Score = 96.7 bits (239),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 133/447 (30%), Positives = 188/447 (42%), Gaps = 72/447 (16%)
 Frame = +2

Query  188   MASEQLRRDNKTGERAVEVEKDRVPKMASHFESLAEKVAD-DTAAD---FHPaavrvtqt  355
             MAS+Q RR+  T ++ V +EKDRVPKM +HFESL  +  D DT+      H +       
Sbjct  1     MASDQARRETTTTKKEVVIEKDRVPKMTTHFESLTGRAKDSDTSGGKETSHRSGKARESH  60

Query  356   tvattEHE---DQGKTAQKGGRAVHDQQTRGTTAQREHDQAKSWKATEETQAGRHDDIQQ  526
              V T E E   DQ K  Q+G     D+  R     RE  +A+  +  EE +A R  +   
Sbjct  61    EVGTHEFESLSDQMKDKQRGTGTYADK-ARDANMVRE-KEAEGMRGKEEHEAKRSTE---  115

Query  527   NRPVRVGGIEFYSGQDARSGRD-ETTRRQGFEERPGGVKFEVHSGQGGGQSTRLQGLEER  703
               P  VG  E             E  R +G  +R      E    + GG+  + QG EE 
Sbjct  116   --PYSVGNFEVGGEGRGEMEGRQEKERSRGMHQRE-----EERHVEKGGRRGKQQGKEE-  167

Query  704   PggvkvevhtghgggeeRRDHSGLSLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKE  883
                         G  +++  HS   LEEI + R  AQQ+S +AL+ A+ +Y +AK     
Sbjct  168   -----------GGQEQKQEQHS---LEEISQLRGQAQQQSKEALKAAEERYNQAKEEAGC  213

Query  884   NVQSGSQYLVEKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQS  1063
              + S ++Y  EK   AKDT LQ  QQ      +    K  QAKDT  S GQTAK+YT   
Sbjct  214   RLGSVTEYAAEKGSQAKDTVLQGAQQTSQYISE----KGSQAKDTLYSAGQTAKEYTVPK  269

Query  1064  AKQTK-----------------------------DTLSSAGQTAKDYTVQSAQQTKDTLS  1156
             A+Q K                             D    +G+ A +Y  + A   KD   
Sbjct  270   AEQAKEYAVEKATEAKEAAADTTKKAGEKAAAAKDVTVQSGKGATEYAGKVAADVKDKAV  329

Query  1157  SAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSG----AGQTAKDYTVQ  1324
              AG +   YT + +      ++ A Q      V+    A   + G    AG  A +   +
Sbjct  330   VAGWSTAHYTTEKSVGGTAAVAKAAQYTTGKVVEGTMAAVRAVEGAAEYAGHKAAEIVSK  389

Query  1325  TAQQAKETLSKAGQAAKDYTVQAKDYA  1405
                 AK+     G+  K+YTV+ K+ A
Sbjct  390   PLVAAKDAAVSTGETMKEYTVRKKEEA  416



>ref|XP_006469129.1| PREDICTED: seed biotin-containing protein SBP65-like [Citrus 
sinensis]
Length=546

 Score = 96.7 bits (239),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 146/474 (31%), Positives = 200/474 (42%), Gaps = 87/474 (18%)
 Frame = +2

Query  188   MASEQLRRDNKTGERAVEVEKDRVPKMASHFESLAEKVAD-DTAAD---FHPaavrvtqt  355
             MAS+Q RR+  T E+ V +EKDRVPKM +HFESL  +  D DT+      H +       
Sbjct  1     MASDQARRETTTTEKEVVIEKDRVPKMTTHFESLTGRAKDSDTSGGKETSHGSGKARESH  60

Query  356   tvattEHE---DQGKTAQKGGRAVHDQQTRGTTAQREHDQAKSWKATEETQAGR--HDDI  520
              V T E E   DQ K  Q+G          GT A +  D     +   E   GR  H++ 
Sbjct  61    EVGTHEFESLTDQMKDKQRG---------IGTYADKARDANMVGEKEAEGMRGREEHEEK  111

Query  521   QQNRPVRVGGIEFYSGQDARSGRD-ETTRRQGFEERPGGVKFEVHSGQGGGQSTRLQGLE  697
             +   P  VG  E             E  R +G  +     + E H  +GG +  + QG E
Sbjct  112   RSTEPYSVGNFEVGGEGRGEMEGRQEKERSRGMHQH----EEERHVEKGGSRGMQ-QGKE  166

Query  698   ERPggvkvevhtghgggeeRRDHSGLSLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTT  877
             E             G  +++  HS   LEEI + R  AQQ+S +AL+ A+ +Y +AK   
Sbjct  167   E------------GGQEQKQEQHS---LEEISQLRGQAQQQSKEALKAAEERYNQAKEEA  211

Query  878   KENVQSGSQYLVEKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTT  1057
                + S ++Y  EK   AKDT LQ  QQ      +    K  QAKDT  S GQTAK+YT 
Sbjct  212   GCRLGSVTEYAAEKGSQAKDTVLQGAQQTSQYISE----KGSQAKDTLYSAGQTAKEYTV  267

Query  1058  QSAKQTK-----------------------------DTLSSAGQTAKDYTVQSAQQTKDT  1150
               A+Q K                             D    +G+ A +Y  + A   KD 
Sbjct  268   PKAEQAKEYAVEKATEAKEAAADTTKKAGEKAAAAKDVTVQSGKGATEYAGKVAADVKDK  327

Query  1151  LSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTA  1330
                AG +   YT + +      ++ A Q      V+    A   + GA + A        
Sbjct  328   AVVAGWSTAHYTTEKSVGGTAAVAKAAQYTTGKVVEGTMAAVRAVEGAAEYA-------G  380

Query  1331  QQAKETLSKAGQAAKDYTVQ----AKDYASQKAGEAGNKASEAK--ER-GTEMS  1471
              +A E +SK   AAKD  V      K+Y ++K  EA  +  EAK  ER GTE S
Sbjct  381   HKAAEIVSKPLVAAKDAAVSTGETMKEYTARKKEEA-QREVEAKRGERQGTERS  433



>ref|XP_010038686.1| PREDICTED: seed biotin-containing protein SBP65-like [Eucalyptus 
grandis]
Length=820

 Score = 96.7 bits (239),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 84/267 (31%), Positives = 127/267 (48%), Gaps = 33/267 (12%)
 Frame = +2

Query  776   SLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNT--------------TKENVQSG----S  901
             +LEE+ + R  AQQ S++ L+ A+ +Y +AK                TK+ V  G    S
Sbjct  293   TLEEVSRLRALAQQNSMEILRAAEERYNQAKELANQGLGTASEKAAQTKDTVLQGARTTS  352

Query  902   QYLVEKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKD  1081
             +Y+ EK    KDTA++K QQ    AK+T +S  + AKD      + AKDYT Q A + KD
Sbjct  353   EYMAEKGARVKDTAVEKGQQGLAVAKETVLSAGKTAKDYTVPKAEQAKDYTMQKAAEAKD  412

Query  1082  TLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQS  1261
                   + AKDY +Q A + KD      +   +YT + A   K+      + A +Y  ++
Sbjct  413   YTLPKAEQAKDYAMQKATEAKDKTVEISKGVANYTGEKAVAAKEAAVETSKGAAEYAGKA  472

Query  1262  AQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGE----AG  1429
             A + KD    AG  A  YT +        ++  G  A    VQ     ++KAGE    AG
Sbjct  473   AVEVKDKTIAAGWGAAHYTAE--------ITVEGTKAAARVVQG---VAEKAGEVALGAG  521

Query  1430  NKASEAKERGTEMSKNAASYAGQKVTE  1510
             +KA+E   +    +K+ A+  G+K  E
Sbjct  522   HKAAEIAAKPLVAAKDVATATGEKAKE  548


 Score = 55.1 bits (131),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 33/46 (72%), Gaps = 3/46 (7%)
 Frame = +2

Query  188  MASEQL--RRDNKTGERAVEVEKDRVPKMASHFESLAEKV-ADDTA  316
            MASEQ+  RR+N T ER + VE D+VPKM  HFESLAEK  A D A
Sbjct  1    MASEQVSRRRENTTNEREIHVETDKVPKMTIHFESLAEKAQASDPA  46


 Score = 53.9 bits (128),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 61/215 (28%), Positives = 97/215 (45%), Gaps = 14/215 (7%)
 Frame = +2

Query  863   AKNTTKENVQSGSQYLVEKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTA  1042
             AK+ T    +    Y ++KA  AKD  L K +Q    AKD  + K  +AKD      +  
Sbjct  388   AKDYTVPKAEQAKDYTMQKAAEAKDYTLPKAEQ----AKDYAMQKATEAKDKTVEISKGV  443

Query  1043  KDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLS  1222
              +YT + A   K+      + A +Y  ++A + KD   +AG  A  YT +        ++
Sbjct  444   ANYTGEKAVAAKEAAVETSKGAAEYAGKAAVEVKDKTIAAGWGAAHYTAE--------IT  495

Query  1223  SAGQTAKDYTVQS-AQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKD  1399
               G  A    VQ  A++A +   GAG  A +   +    AK+  +  G+ AK+YT + K+
Sbjct  496   VEGTKAAARVVQGVAEKAGEVALGAGHKAAEIAAKPLVAAKDVATATGEKAKEYTARKKE  555

Query  1400  YASQKAGEAGNKASEAKERGTEMSKNAASYAGQKV  1504
              A ++  EA   A   +  G E  K+  S A + V
Sbjct  556   EAERQL-EAKKSAENQETEGAERPKDVVSQAKEMV  589



>gb|KDP31781.1| hypothetical protein JCGZ_12242 [Jatropha curcas]
Length=417

 Score = 94.4 bits (233),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 68/198 (34%), Positives = 97/198 (49%), Gaps = 14/198 (7%)
 Frame = +2

Query  773   LSLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQK  952
             LSLEEI K R+TAQ+ S++A++ AQ +YEKAK    + +   ++Y  EK   AKDT + K
Sbjct  75    LSLEEISKLRETAQKNSMEAIKGAQERYEKAKEEMSQGLGVAAEYAKEKGAQAKDTVVDK  134

Query  953   TQQAYNA-------AKDTTIS-------KTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLS  1090
             + QA +        AKD   +       KT QAKDT   + Q A     +   Q KDT+ 
Sbjct  135   SSQATDTVKEKGAEAKDKIAAQGSQAKEKTAQAKDTVLGSAQKASQQIAEKGSQAKDTVI  194

Query  1091  SAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQ  1270
                Q    Y  + + Q KDT+    +   +Y ++ A   KD     G+ A  Y  + A  
Sbjct  195   EGTQKTSQYIAEKSSQAKDTVVGGAKKTSEYALEKAAAAKDKTVETGEGAAHYAGEVAID  254

Query  1271  AKDTLSGAGQTAKDYTVQ  1324
              KD  + AG TA  YT +
Sbjct  255   VKDKATAAGWTAAHYTTE  272



>gb|KCW47312.1| hypothetical protein EUGRSUZ_K01100 [Eucalyptus grandis]
Length=763

 Score = 95.5 bits (236),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 88/268 (33%), Positives = 130/268 (49%), Gaps = 35/268 (13%)
 Frame = +2

Query  776   SLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNT--------------TKENVQSG----S  901
             +LEE+ + R  AQQ S++ L+ A+ +Y +AK                TK+ V  G    S
Sbjct  224   TLEEVSRLRALAQQNSMEILRAAEERYNQAKELANQGLGTASEKAAQTKDTVLQGARTTS  283

Query  902   QYLVEKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKD  1081
             +Y+ EK    KDTA++K QQ    AK+T +S  + AKD      + AKDYT Q A + KD
Sbjct  284   EYMAEKGARVKDTAVEKGQQGLAVAKETVLSAGKTAKDYTVPKAEQAKDYTMQKAAEAKD  343

Query  1082  -TLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQ  1258
              TL  A Q AKDY +Q A + KD      +   +YT + A   K+      + A +Y  +
Sbjct  344   YTLPKAEQ-AKDYAMQKATEAKDKTVEISKGVANYTGEKAVAAKEAAVETSKGAAEYAGK  402

Query  1259  SAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGE----A  1426
             +A + KD    AG  A  YT +        ++  G  A    VQ     ++KAGE    A
Sbjct  403   AAVEVKDKTIAAGWGAAHYTAE--------ITVEGTKAAARVVQG---VAEKAGEVALGA  451

Query  1427  GNKASEAKERGTEMSKNAASYAGQKVTE  1510
             G+KA+E   +    +K+ A+  G+K  E
Sbjct  452   GHKAAEIAAKPLVAAKDVATATGEKAKE  479



>ref|XP_004303166.1| PREDICTED: seed biotin-containing protein SBP65-like isoform 
1 [Fragaria vesca subsp. vesca]
Length=769

 Score = 94.7 bits (234),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 83/249 (33%), Positives = 129/249 (52%), Gaps = 20/249 (8%)
 Frame = +2

Query  776   SLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKT  955
             SL+E+  +RQTAQQ S++A++ A+ +Y+K K +  + + + +Q   E +    +TA Q  
Sbjct  297   SLDEVSAFRQTAQQNSMEAIRAAEERYQKTKESASQTLGTAAQKAKEASERTTETASQTL  356

Query  956   QQAYNAAKDTTISKTQQAKDTFSST-------GQTAKDYTTQSAKQ----TKDTLSSAGQ  1102
               A   AKDT  + TQ+AK+  S T       G   KD   +  +Q     KDTLSSAG 
Sbjct  357   GTAAQRAKDTASTATQKAKEISSQTLGTATEKGAQVKDIALEKGQQGLYTAKDTLSSAGA  416

Query  1103  TAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDT  1282
                +YTV  A++ KD   SAG+T   Y    A   KD ++ AG TA  YT ++A +   T
Sbjct  417   KTAEYTVPLAEKAKDMAVSAGKTTLHYAGDVAVDLKDKVTVAGWTAAQYTTEAAVEGTKT  476

Query  1283  ----LSG----AGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGNKA  1438
                 ++G    AG  A D   +    AK   +  G+ A+++T + K+ A Q+  EA  +A
Sbjct  477   AARVVAGAAEYAGHKAVDIVSKPLSVAKNAAAVTGERAEEFTARKKEEA-QREYEAKKEA  535

Query  1439  SEAKERGTE  1465
                + +G+E
Sbjct  536   EANRPKGSE  544


 Score = 57.8 bits (138),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +2

Query  188  MASEQLRRDNKTGERAVEVEKDRVPKMASHFESL  289
            M+SEQLRR N T ER V +EKDRVPK+ SHFESL
Sbjct  1    MSSEQLRRQNVTPEREVHIEKDRVPKITSHFESL  34



>ref|XP_011002541.1| PREDICTED: LOW QUALITY PROTEIN: seed biotin-containing protein 
SBP65 [Populus euphratica]
Length=536

 Score = 93.6 bits (231),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 81/254 (32%), Positives = 106/254 (42%), Gaps = 51/254 (20%)
 Frame = +2

Query  773   LSLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQK  952
             LSL+EI K R+TAQ+ S +AL+ A+ +YEKAK      V S ++ + EK           
Sbjct  127   LSLDEITKLRETAQKNSFEALKAAEERYEKAKEKASRVVGSATKIVKEK-----------  175

Query  953   TQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSA  1132
                 +  AK+T   K  Q KD  +     A+D   Q A Q KD  +     A+    Q A
Sbjct  176   ----FPQAKNTFAEKAAQPKDIAAEKAAQARDIAAQKAAQPKDIAAEKAAQARGIAAQKA  231

Query  1133  QQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKD  1312
              Q KD  +     A+    Q A  TKD            T Q A QAKDTL    Q    
Sbjct  232   AQPKDIAAEKAAQARGIAAQKATHTKDI-----------TAQKAAQAKDTLVEGAQKTTH  280

Query  1313  YTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGNKASEAKERGTEMSKNAASYA  1492
             Y  +   QAK+T+ +  +   +Y V                         E SK A SY 
Sbjct  281   YIAEKGAQAKDTIVEGAKKTSEYVV-------------------------EKSKGAMSYT  315

Query  1493  GQKVTEAKDVTVES  1534
              +K   AKDVTVES
Sbjct  316   VEKAVAAKDVTVES  329


 Score = 54.3 bits (129),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  188  MASEQLRRDNKTGERAVEVEKDRVPKMASHFESLAEK  298
            MASEQ RR+N T ER   V ++RVPKMASHFESL EK
Sbjct  1    MASEQSRRENATSERENYVVRERVPKMASHFESLIEK  37



>ref|XP_010327091.1| PREDICTED: seed biotin-containing protein SBP65-like isoform 
X2 [Solanum lycopersicum]
Length=605

 Score = 94.0 bits (232),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 119/315 (38%), Positives = 155/315 (49%), Gaps = 63/315 (20%)
 Frame = +2

Query  776   SLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKT  955
             +++ +    QTA Q +  A  TA  K ++A + T + + S  +   E A  AKDT L K 
Sbjct  153   TIDALSNTGQTAAQSAKKAKDTAFVKGQQAYDATTDTLSSTGKTAAESAKKAKDTVLYKG  212

Query  956   QQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKD------------------  1081
             QQ Y A           A D  SS GQTA     QSAK+ KD                  
Sbjct  213   QQGYGA-----------ATDNLSSAGQTA----AQSAKKAKDYAKGTVFDKGQQAYGATT  257

Query  1082  -TLSSAGQT-------AKDYTVQSAQQ----TKDTLSSAGQT-------AKDYTVQSAQQ  1204
              TLS+AGQ        AKD  +   QQ    TKDTLSS G+T       AK+ T +  QQ
Sbjct  258   ATLSTAGQNAAQSAKKAKDTVLDKGQQAYAATKDTLSSTGKTAVQSAKNAKETTFEKGQQ  317

Query  1205  ----TKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAA  1372
                 T DTLSSAGQ A     QSA+ AKDT+   GQ A   T  T   A +T +++ +  
Sbjct  318   AYGATTDTLSSAGQIA----AQSAKTAKDTVLDKGQQAYGATTNTLSSAGQTAAQSAKKT  373

Query  1373  KDYTVQAKDYASQKAGEAGNKASEAKERGTEMSKNAASYAGQKVTEAKDVTVESgkgavg  1552
             KD  +   D   Q      +  S A +   + +KNAA Y GQ+  EAKD+T+E+GKG +G
Sbjct  374   KDTVL---DKGQQAYAATTDTLSSAGQTTVQSTKNAAGYVGQRAVEAKDITLETGKGVLG  430

Query  1553  yagkvaETLKDTATV  1597
             YAG+VAE +KD A V
Sbjct  431   YAGEVAEIVKDKAAV  445


 Score = 62.8 bits (151),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 93/272 (34%), Positives = 123/272 (45%), Gaps = 56/272 (21%)
 Frame = +2

Query  803   QTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKTQQAYNA---  973
             Q A Q +  A  T  +K ++A   TK+ + S  +  V+ A  AK+T  +K QQAY A   
Sbjct  265   QNAAQSAKKAKDTVLDKGQQAYAATKDTLSSTGKTAVQSAKNAKETTFEKGQQAYGATTD  324

Query  974   ---------------AKDTTISKTQQA----KDTFSSTGQTAKDYTTQSAKQTKDTLSSA  1096
                            AKDT + K QQA     +T SS GQTA     QSAK+TKDT+   
Sbjct  325   TLSSAGQIAAQSAKTAKDTVLDKGQQAYGATTNTLSSAGQTA----AQSAKKTKDTVLDK  380

Query  1097  GQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAK  1276
             GQ       Q+   T DTLSSAGQT    TVQS      T ++AG     Y  Q A +AK
Sbjct  381   GQ-------QAYAATTDTLSSAGQT----TVQS------TKNAAG-----YVGQRAVEAK  418

Query  1277  DTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKD--------YASQKAGEAGN  1432
             D     G+    Y  + A+  K+  + +G  A  YT +            AS  AG    
Sbjct  419   DITLETGKGVLGYAGEVAEIVKDKAAVSGWGAAHYTAEKAAEATKAVVGVASNVAGYTEE  478

Query  1433  KASEAKERGTEMSKNAASYAGQKVTEAKDVTV  1528
             KA  AK+   +   N   YA  ++ +AKD  V
Sbjct  479   KAVAAKDAVADTGMNIVGYAENELADAKDYVV  510


 Score = 58.2 bits (139),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 74/201 (37%), Positives = 93/201 (46%), Gaps = 25/201 (12%)
 Frame = +2

Query  929   AKDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTA  1108
             AK+TA  K  Q Y AA DT     Q A  +   +  T  D   Q+   T D LS+ GQTA
Sbjct  105   AKNTAPDKGDQTYAAATDTLSGAGQTAAQSAKKSKNTVLDKGQQAYAATIDALSNTGQTA  164

Query  1109  KDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLS  1288
                  QSA++ KDT    GQ A D T        DTLSS G+TA     +SA++AKDT+ 
Sbjct  165   ----AQSAKKAKDTAFVKGQQAYDATT-------DTLSSTGKTA----AESAKKAKDTVL  209

Query  1289  GAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGNKASEAKERGTEM  1468
               GQ       Q    A + LS AGQ A     +AKDYA    G   +K  +A    T  
Sbjct  210   YKGQ-------QGYGAATDNLSSAGQTAAQSAKKAKDYAK---GTVFDKGQQAYGATTAT  259

Query  1469  SKNAASYAGQKVTEAKDVTVE  1531
                A   A Q   +AKD  ++
Sbjct  260   LSTAGQNAAQSAKKAKDTVLD  280



>ref|XP_009354271.1| PREDICTED: seed biotin-containing protein SBP65 [Pyrus x bretschneideri]
Length=732

 Score = 94.4 bits (233),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 77/218 (35%), Positives = 114/218 (52%), Gaps = 23/218 (11%)
 Frame = +2

Query  776   SLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKT  955
             SLEEI + R TAQQ S++A++ A+ +Y KAK + ++ + S ++Y  EKAG AKDT LQ  
Sbjct  352   SLEEISQLRGTAQQNSMEAIRAAEERYAKAKESARQGLGSATEYASEKAGQAKDTLLQGA  411

Query  956   QQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQ  1135
             Q A               K+  +  G+TA + T   A++TKD   SAGQT   Y  + A 
Sbjct  412   QTA---------------KEALTGAGKTAVEKTAPLAERTKDVAVSAGQTTLHYVEEGAV  456

Query  1136  QTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSA----QQAKDTLSGAGQT  1303
             + KD     G+T   Y    A   KD  + AG TA  YT ++A    ++A   + GA + 
Sbjct  457   KAKDKTLEGGKTTAAYAGDVAVDLKDKATVAGWTAAHYTTEAAVEGTKKAAKAVIGAAEY  516

Query  1304  AKDYTVQTAQQ----AKETLSKAGQAAKDYTVQAKDYA  1405
             A   TV    +    AK+  + AG+ A++YT + K+ A
Sbjct  517   AGHKTVDIVSKPLSAAKDAAAVAGEKAEEYTARKKEEA  554



>ref|XP_002325582.2| late embryogenesis abundant domain-containing family protein 
[Populus trichocarpa]
 gb|EEE99963.2| late embryogenesis abundant domain-containing family protein 
[Populus trichocarpa]
Length=469

 Score = 92.0 bits (227),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 85/246 (35%), Positives = 117/246 (48%), Gaps = 33/246 (13%)
 Frame = +2

Query  773   LSLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQK  952
             LSL+EI K R+TAQ+ S +AL  A+ +YEKAK      V S ++ + EK   AK+T  +K
Sbjct  113   LSLDEITKLRETAQKNSFEALNAAEERYEKAKEKASRVVGSATKTVKEKFPQAKNTFAEK  172

Query  953   TQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSA  1132
               Q     KD    K  Q +D  +      KD T Q A Q KDTL           V+ A
Sbjct  173   AAQP----KDIAAEKAAQVRDIAAQKAAQTKDITAQKAAQAKDTL-----------VEGA  217

Query  1133  QQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKD  1312
             Q+T   ++  G  AKD  V+ A++T + +    + A  YTV+ A  AKD    +G+ A  
Sbjct  218   QKTTHYIAEKGAQAKDTIVEGAKKTSEYVVEKSKGAMGYTVEKAVAAKDVTVESGKEAAC  277

Query  1313  YTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGNKASEAKERGTEMSKNAASYA  1492
             Y  + A   K+  + AG  A  YT +              KA E    GT+ +  A  YA
Sbjct  278   YVEKVAVDVKDKAAAAGWTAAHYTTE--------------KAVE----GTKAAARAVEYA  319

Query  1493  GQKVTE  1510
             GQK TE
Sbjct  320   GQKTTE  325


 Score = 55.5 bits (132),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  188  MASEQLRRDNKTGERAVEVEKDRVPKMASHFESLAEK  298
            MASEQ RR++ T ER   VE++RVPKMASHFESL EK
Sbjct  1    MASEQSRRESATSERENYVERERVPKMASHFESLIEK  37



>ref|XP_006371487.1| hypothetical protein POPTR_0019s12000g [Populus trichocarpa]
 gb|ERP49284.1| hypothetical protein POPTR_0019s12000g [Populus trichocarpa]
Length=426

 Score = 91.3 bits (225),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 85/246 (35%), Positives = 117/246 (48%), Gaps = 33/246 (13%)
 Frame = +2

Query  773   LSLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQK  952
             LSL+EI K R+TAQ+ S +AL  A+ +YEKAK      V S ++ + EK   AK+T  +K
Sbjct  113   LSLDEITKLRETAQKNSFEALNAAEERYEKAKEKASRVVGSATKTVKEKFPQAKNTFAEK  172

Query  953   TQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSA  1132
               Q     KD    K  Q +D  +      KD T Q A Q KDTL           V+ A
Sbjct  173   AAQP----KDIAAEKAAQVRDIAAQKAAQTKDITAQKAAQAKDTL-----------VEGA  217

Query  1133  QQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKD  1312
             Q+T   ++  G  AKD  V+ A++T + +    + A  YTV+ A  AKD    +G+ A  
Sbjct  218   QKTTHYIAEKGAQAKDTIVEGAKKTSEYVVEKSKGAMGYTVEKAVAAKDVTVESGKEAAC  277

Query  1313  YTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGNKASEAKERGTEMSKNAASYA  1492
             Y  + A   K+  + AG  A  YT +              KA E    GT+ +  A  YA
Sbjct  278   YVEKVAVDVKDKAAAAGWTAAHYTTE--------------KAVE----GTKAAARAVEYA  319

Query  1493  GQKVTE  1510
             GQK TE
Sbjct  320   GQKTTE  325


 Score = 55.8 bits (133),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  188  MASEQLRRDNKTGERAVEVEKDRVPKMASHFESLAEK  298
            MASEQ RR++ T ER   VE++RVPKMASHFESL EK
Sbjct  1    MASEQSRRESATSERENYVERERVPKMASHFESLIEK  37



>ref|XP_010665973.1| PREDICTED: seed biotin-containing protein SBP65 [Beta vulgaris 
subsp. vulgaris]
Length=564

 Score = 92.0 bits (227),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 78/239 (33%), Positives = 107/239 (45%), Gaps = 22/239 (9%)
 Frame = +2

Query  776   SLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKT  955
             SLEEI  YRQTAQQ S++ +Q AQ +Y KAK           +      GAA +   +  
Sbjct  207   SLEEISNYRQTAQQNSLETIQAAQERYGKAKEQAANAAWEAKEAAKHGLGAAANKTSELG  266

Query  956   QQAYNAAK------------------DTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKD  1081
              +A   A+                  +T   K QQAK+  S+ GQ + DYT++ A Q KD
Sbjct  267   SKAQEKARAGVGATTQFISEKSRPVAETASEKAQQAKEAISTAGQKSMDYTSEKAAQAKD  326

Query  1082  TLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQS  1261
             T  S+ +T   Y  + A   KD     G+TA  Y  + A++ KD    AG  A  YT + 
Sbjct  327   TTVSSTKTVAGYMGEKAVAAKDVAVQTGKTAAQYAGKVAEEVKDQAVVAGWGAAHYTTEV  386

Query  1262  AQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTV----QAKDYASQKAGEA  1426
             A +A     G    AKD     A +A E   K    A+D  V    +  DY ++K  EA
Sbjct  387   AVEATKKAGGVVGKAKDVMATAAHKATELAEKPVAIARDVAVDTGEKVADYTARKKMEA  445



>ref|XP_002962904.1| hypothetical protein SELMODRAFT_64748, partial [Selaginella moellendorffii]
 gb|EFJ36367.1| hypothetical protein SELMODRAFT_64748, partial [Selaginella moellendorffii]
Length=276

 Score = 89.0 bits (219),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 92/258 (36%), Positives = 122/258 (47%), Gaps = 22/258 (9%)
 Frame = +2

Query  782   EEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKTQQ  961
             E +  YR+  Q+ +  A ++AQ+  E+AK+ T            EKAG  KD+A     +
Sbjct  1     EALSHYREAVQESAYSAFKSAQDTVERAKDVT-----------AEKAGQVKDSAYDSAVR  49

Query  962   AYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQT  1141
             A    KDT   K  QAKDT   T   AKD T + A QTKD++  +   AKD   + A Q 
Sbjct  50    A----KDTAAEKAGQAKDTTYDTAARAKDTTLEKAGQTKDSVYDSSVRAKDVAAEKAAQA  105

Query  1142  KDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTV  1321
             KD+       AKD   + A Q KDT   +   AKD T + A QAKDT   +   AKD T 
Sbjct  106   KDSTYDTAARAKDVAAEKAGQAKDTTYDSAARAKDVTAEKAGQAKDTTYDSAARAKDVTA  165

Query  1322  QTAQQAKETLSKAGQAAKDYTVQ-------AKDYASQKAGEAGNKASEAKERGTEMSKNA  1480
             + A QAK++   +   AKD T +       A    S+K G A  K  E  E   E +++ 
Sbjct  166   EKAGQAKDSTYDSAARAKDVTAEKAARAQDATKAFSEKLGLASEKTKETAESAKESAEST  225

Query  1481  ASYAGQKVTEAKDVTVES  1534
                A QK  E K  T ES
Sbjct  226   VEAAKQKGEELKQRTGES  243


 Score = 69.3 bits (168),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 68/204 (33%), Positives = 100/204 (49%), Gaps = 7/204 (3%)
 Frame = +2

Query  773   LSLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQK  952
             ++ E+ G+ + +A   ++ A  TA  K  +AK+TT +         +EKAG  KD+    
Sbjct  31    VTAEKAGQVKDSAYDSAVRAKDTAAEKAGQAKDTTYDTAARAKDTTLEKAGQTKDSVYDS  90

Query  953   TQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSA  1132
             + +    AKD    K  QAKD+   T   AKD   + A Q KDT   +   AKD T + A
Sbjct  91    SVR----AKDVAAEKAAQAKDSTYDTAARAKDVAAEKAGQAKDTTYDSAARAKDVTAEKA  146

Query  1133  QQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQ---T  1303
              Q KDT   +   AKD T + A Q KD+   +   AKD T + A +A+D      +    
Sbjct  147   GQAKDTTYDSAARAKDVTAEKAGQAKDSTYDSAARAKDVTAEKAARAQDATKAFSEKLGL  206

Query  1304  AKDYTVQTAQQAKETLSKAGQAAK  1375
             A + T +TA+ AKE+     +AAK
Sbjct  207   ASEKTKETAESAKESAESTVEAAK  230



>gb|KHG20193.1| Embryonic DC-8 [Gossypium arboreum]
Length=569

 Score = 91.3 bits (225),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 95/278 (34%), Positives = 139/278 (50%), Gaps = 41/278 (15%)
 Frame = +2

Query  776   SLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKT  955
             ++E+ G+Y+  A +K   A Q+A +K ++ K+TTKE     + Y  +KA   K+TA Q+T
Sbjct  135   TMEKAGEYKDYAAEK---ANQSA-DKAKQMKDTTKEKAAEYTDYAAQKAKETKNTAAQRT  190

Query  956   QQAYNAAKDTTISKT--------QQAKDTFSSTGQTAKDYTTQSAKQTK---DTLSSAGQ  1102
             ++     KDT   K         Q+AKD   +T Q A +YT  +A++TK   D       
Sbjct  191   KET----KDTVTGKASEYTDYAAQKAKDAKDTTAQKASEYTDYAAQKTKGAKDATMGKAT  246

Query  1103  TAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDT  1282
               KDYT + A++ +DT +       DY  Q A+  KDT +        Y  Q  + AKD 
Sbjct  247   EYKDYTAEKAKEARDTTAQKASEYTDYATQKAKDAKDTTAQKASEYTGYAAQKTKDAKDA  306

Query  1283  LSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGN----KASEAK  1450
               G     KDYT Q A++A++T +   Q A +YT    DYA+QKA +A +    KA+E K
Sbjct  307   TMGKAAEYKDYTAQKAKEARDTTA---QKASEYT----DYAAQKAKDAKDAAIGKATEYK  359

Query  1451  ERGTEMSKNA-----------ASYAGQKVTEAKDVTVE  1531
             +   E +K A             YA QK  EAKD T+E
Sbjct  360   DYAAEKAKGAKDTTAQKASEFTDYAAQKAKEAKDTTME  397


 Score = 90.5 bits (223),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 97/279 (35%), Positives = 133/279 (48%), Gaps = 34/279 (12%)
 Frame = +2

Query  782   EEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDT-------  940
             E+  +Y   A QK+ +   TA  + ++ K+T        + Y  +KA  AKDT       
Sbjct  166   EKAAEYTDYAAQKAKETKNTAAQRTKETKDTVTGKASEYTDYAAQKAKDAKDTTAQKASE  225

Query  941   ----ALQKTQQAYNAA-------KDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTL  1087
                 A QKT+ A +A        KD T  K ++A+DT +       DY TQ AK  KDT 
Sbjct  226   YTDYAAQKTKGAKDATMGKATEYKDYTAEKAKEARDTTAQKASEYTDYATQKAKDAKDTT  285

Query  1088  SSAGQTAKDYTVQSAQQTKD----TLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTV  1255
             +   Q A +YT  +AQ+TKD    T+  A +  KDYT Q A++ +DT +       DY  
Sbjct  286   A---QKASEYTGYAAQKTKDAKDATMGKAAEY-KDYTAQKAKEARDTTAQKASEYTDYAA  341

Query  1256  QSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQ----AKDYASQKAGE  1423
             Q A+ AKD   G     KDY  + A+ AK+T ++      DY  Q    AKD   +KA E
Sbjct  342   QKAKDAKDAAIGKATEYKDYAAEKAKGAKDTTAQKASEFTDYAAQKAKEAKDTTMEKATE  401

Query  1424  ----AGNKASEAKERGTEMSKNAASYAGQKVTEAKDVTV  1528
                 A  KA EAK+   E +K    YA +K  E KD TV
Sbjct  402   YKDYAAEKAKEAKDVTAEKTKQGTEYAAEKAKEGKDTTV  440


 Score = 62.8 bits (151),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 59/179 (33%), Positives = 90/179 (50%), Gaps = 5/179 (3%)
 Frame = +2

Query  839   TAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDT  1018
             TAQ K ++A++TT +     + Y  +KA  AKD A+ K  +     KD    K + AKDT
Sbjct  318   TAQ-KAKEARDTTAQKASEYTDYAAQKAKDAKDAAIGKATEY----KDYAAEKAKGAKDT  372

Query  1019  FSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSA  1198
              +       DY  Q AK+ KDT        KDY  + A++ KD  +   +   +Y  + A
Sbjct  373   TAQKASEFTDYAAQKAKEAKDTTMEKATEYKDYAAEKAKEAKDVTAEKTKQGTEYAAEKA  432

Query  1199  QQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAK  1375
             ++ KDT  S     KD    +A++A D L+G  +  K    +TAQ  KETLS+  ++A+
Sbjct  433   KEGKDTTVSKLGELKDSAADAAKRAMDFLTGKTEETKQKASETAQNTKETLSETTESAR  491


 Score = 59.7 bits (143),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 73/238 (31%), Positives = 109/238 (46%), Gaps = 21/238 (9%)
 Frame = +2

Query  863   AKNTTKENVQSGSQYLVEKAGAAKDTALQKTQQ--AYNA-----AKDTTISKTQQAKDTF  1021
             A++TT +     + Y  +KA  AKDT  QK  +   Y A     AKD T+ K  + KD  
Sbjct  259   ARDTTAQKASEYTDYATQKAKDAKDTTAQKASEYTGYAAQKTKDAKDATMGKAAEYKDYT  318

Query  1022  SSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQ  1201
             +   + A+D T Q A +  D  +   + AKD  +  A + KD  +   + AKD T Q A 
Sbjct  319   AQKAKEARDTTAQKASEYTDYAAQKAKDAKDAAIGKATEYKDYAAEKAKGAKDTTAQKAS  378

Query  1202  QTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDY  1381
             +  D  +   + AKD T++ A + KD  +   + AKD T +  +Q  E  ++  +  KD 
Sbjct  379   EFTDYAAQKAKEAKDTTMEKATEYKDYAAEKAKEAKDVTAEKTKQGTEYAAEKAKEGKDT  438

Query  1382  TVQAKDYASQKAGEAGNKASEAKERG-------TEMSKNAASYAGQKVTEAKDVTVES  1534
             TV        K GE  + A++A +R        TE +K  AS   Q   E    T ES
Sbjct  439   TV-------SKLGELKDSAADAAKRAMDFLTGKTEETKQKASETAQNTKETLSETTES  489


 Score = 58.2 bits (139),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 68/197 (35%), Positives = 95/197 (48%), Gaps = 31/197 (16%)
 Frame = +2

Query  974   AKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTL  1153
             AKDTT+ K  + KD  +     + D     AKQ KDT         DY  Q A++TK+T 
Sbjct  131   AKDTTMEKAGEYKDYAAEKANQSAD----KAKQMKDTTKEKAAEYTDYAAQKAKETKNT-  185

Query  1154  SSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQ  1333
                          +AQ+TK+T  +    A +YT  +AQ+AKD      Q A +YT   AQ
Sbjct  186   -------------AAQRTKETKDTVTGKASEYTDYAAQKAKDAKDTTAQKASEYTDYAAQ  232

Query  1334  QAK----ETLSKAGQAAKDYTV----QAKDYASQKAGE----AGNKASEAKERGTEMSKN  1477
             + K     T+ KA +  KDYT     +A+D  +QKA E    A  KA +AK+   + +  
Sbjct  233   KTKGAKDATMGKATE-YKDYTAEKAKEARDTTAQKASEYTDYATQKAKDAKDTTAQKASE  291

Query  1478  AASYAGQKVTEAKDVTV  1528
                YA QK  +AKD T+
Sbjct  292   YTGYAAQKTKDAKDATM  308



>ref|XP_004303167.1| PREDICTED: seed biotin-containing protein SBP65-like isoform 
2 [Fragaria vesca subsp. vesca]
Length=747

 Score = 90.1 bits (222),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 82/242 (34%), Positives = 127/242 (52%), Gaps = 28/242 (12%)
 Frame = +2

Query  776   SLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKT  955
             SL+E+  +RQTAQQ S++A++ A+ +Y+K K       +S SQ L    G A   A + +
Sbjct  297   SLDEVSAFRQTAQQNSMEAIRAAEERYQKTK-------ESASQTL----GTAAQKAKEAS  345

Query  956   QQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQ  1135
             ++    A  T  +  Q+AKDT S+  Q AK+ ++Q    T  T +  G   KD  ++  Q
Sbjct  346   ERTTETASQTLGTAAQRAKDTASTATQKAKEISSQ----TLGTATEKGAQVKDIALEKGQ  401

Query  1136  Q----TKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDT----LSG  1291
             Q     KDTLSSAG    +YTV  A++ KD   SAG TA  YT ++A +   T    ++G
Sbjct  402   QGLYTAKDTLSSAGAKTAEYTVPLAEKAKDMAVSAGWTAAQYTTEAAVEGTKTAARVVAG  461

Query  1292  ----AGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGNKASEAKERG  1459
                 AG  A D   +    AK   +  G+ A+++T + K+ A Q+  EA  +A   + +G
Sbjct  462   AAEYAGHKAVDIVSKPLSVAKNAAAVTGERAEEFTARKKEEA-QREYEAKKEAEANRPKG  520

Query  1460  TE  1465
             +E
Sbjct  521   SE  522


 Score = 57.8 bits (138),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +2

Query  188  MASEQLRRDNKTGERAVEVEKDRVPKMASHFESL  289
            M+SEQLRR N T ER V +EKDRVPK+ SHFESL
Sbjct  1    MSSEQLRRQNVTPEREVHIEKDRVPKITSHFESL  34



>ref|XP_002962372.1| hypothetical protein SELMODRAFT_64743, partial [Selaginella moellendorffii]
 gb|EFJ35835.1| hypothetical protein SELMODRAFT_64743, partial [Selaginella moellendorffii]
Length=276

 Score = 84.3 bits (207),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 89/262 (34%), Positives = 124/262 (47%), Gaps = 14/262 (5%)
 Frame = +2

Query  782   EEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKTQQ  961
             E +  YR+  Q+ +  A ++AQ+  E+AK+ T E          + A  AKDTA +K  Q
Sbjct  1     EALSHYREAVQESAYSAFKSAQDTVERAKDVTAEKTGQVKDSAYDSAVRAKDTAAEKATQ  60

Query  962   A----YNAA---KDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYT  1120
             A    Y+ A   KDTT+ K  Q KD+   +   AKD   + A Q KD+       AKD T
Sbjct  61    AKDTTYDTAARAKDTTLEKAGQTKDSVYDSSVRAKDVAAEKAGQAKDSTYDTAARAKDVT  120

Query  1121  VQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQ  1300
              + A Q KDT   +   AKD T + A Q KD    +   AKD T + A QAKD+   +  
Sbjct  121   AEKAGQAKDTTYDSAARAKDVTAEKAGQAKDATYDSATRAKDVTAEKAGQAKDSTYDSAA  180

Query  1301  TAKDYTVQTAQQAKET-------LSKAGQAAKDYTVQAKDYASQKAGEAGNKASEAKERG  1459
              AKD T + A +A++T       L  A    K+    AK+ A      A  K  E K+R 
Sbjct  181   RAKDVTAEKAARAQDTTKAFSEKLGLASDKTKETAESAKESAESTVEAAKQKGEELKQRT  240

Query  1460  TEMSKNAASYAGQKVTEAKDVT  1525
              E +++     G  V EAK+ T
Sbjct  241   GESTEDFKRRTGMTVEEAKEKT  262



>ref|XP_006295815.1| hypothetical protein CARUB_v10024941mg [Capsella rubella]
 gb|EOA28713.1| hypothetical protein CARUB_v10024941mg [Capsella rubella]
Length=653

 Score = 84.7 bits (208),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 67/201 (33%), Positives = 98/201 (49%), Gaps = 10/201 (5%)
 Frame = +2

Query  914   EKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSS  1093
             E AG    +A     +    AK++     Q+A    S   Q A DY T+  ++T    + 
Sbjct  231   ESAGGGGRSATHTVTEKGRQAKESVGQGAQKAGSAASEKTQRASDYVTEKGRETGQVAAQ  290

Query  1094  AGQTAK-------DYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYT  1252
              GQ AK       DY+++ A + KDT +   + A +Y ++  ++T +T +     AKDYT
Sbjct  291   KGQEAKEQAMRAKDYSMEKAGEAKDTAAEKAKRASEYAMEKGRETGNTAAEQAARAKDYT  350

Query  1253  VQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGN  1432
             +Q A +AK+  +   Q A +Y  +  + A    S+ GQ A   T +AKDY  QKAGEA  
Sbjct  351   LQKALEAKEIAAEKAQRASEYVTEKGKVAGNVASQKGQEAASMTAKAKDYTVQKAGEA--  408

Query  1433  KASEAKERGTEMSKNAASYAG  1495
              A   KE   E  K AA YAG
Sbjct  409   -AGYVKEATVEGGKGAAHYAG  428



>emb|CDP15910.1| unnamed protein product [Coffea canephora]
Length=401

 Score = 83.2 bits (204),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 70/214 (33%), Positives = 98/214 (46%), Gaps = 37/214 (17%)
 Frame = +2

Query  776   SLEEIGKYRQTAQQKSIDALQTAQN----------------------KYEKAKNTTKENV  889
             SLEEI +YRQ AQQ S++A++ A+                       K  +AK T K+ V
Sbjct  66    SLEEITEYRQQAQQNSMEAIRAAEERSRQAKEAACQKPGATSEYAAEKAGQAKETAKQGV  125

Query  890   QSGSQYLVEKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAK  1069
             Q+GSQY  EKAG AK++  Q  ++    A +    K +  KD     GQ A D T + A 
Sbjct  126   QTGSQYAAEKAGQAKESVKQGVERGTQVASE----KAKALKDAAVEKGQEANDVTVEKAV  181

Query  1070  QTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDY  1249
             Q KD    A + A  Y  +     +D    +G+TA  Y  + A +  D  + AG  A  Y
Sbjct  182   QAKDATVDATKKAAGYVGEQTAVVRDITVESGKTAVGYMGKVAGEATDMAAVAGWGAAHY  241

Query  1250  TVQSAQQ-----------AKDTLSGAGQTAKDYT  1318
             T + A             A+D ++GAGQT   YT
Sbjct  242   TAEKAALGTKVMADVAGVARDKVAGAGQTVVGYT  275


 Score = 63.2 bits (152),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +2

Query  188  MASEQLRRDNKTGERAVEVEKDRVPKMASHFESLAEKVADDT  313
            M+SEQ+RR++ T ERAV++EKDRVPKMA+HFESLA K    T
Sbjct  1    MSSEQMRREDVTDERAVDIEKDRVPKMATHFESLAVKAGGGT  42



>ref|NP_181784.1| late embryogenesis abundant domain-containing protein [Arabidopsis 
thaliana]
 gb|AAD22997.1| putative seed maturation protein [Arabidopsis thaliana]
 gb|AEC10139.1| late embryogenesis abundant domain-containing protein [Arabidopsis 
thaliana]
Length=635

 Score = 84.3 bits (207),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 67/186 (36%), Positives = 93/186 (50%), Gaps = 11/186 (6%)
 Frame = +2

Query  932   KDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAK  1111
             KDT  +K QQA    K++     Q+A    S   Q A +Y T+  K+  +  +     AK
Sbjct  228   KDTVAEKGQQA----KESVGEGAQKAGSATSEKAQRASEYATEKGKEAGNMTAEQAARAK  283

Query  1112  DYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSG  1291
             DY +Q A + K+T +   Q A +Y     ++T  T +     AKDYT+Q A +AKD  + 
Sbjct  284   DYALQKAVEAKETAAEKAQRASEYM----KETGSTAAEQAARAKDYTLQKAVEAKDVAAE  339

Query  1292  AGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGNKASEAKERGTEMS  1471
               Q A +Y  +T +QA    ++ GQ A   T +AKDY  QKAGEA   A   KE   E  
Sbjct  340   KAQRASEYMTETGKQAGNVAAQKGQEAASMTAKAKDYTVQKAGEA---AGYIKETTVEGG  396

Query  1472  KNAASY  1489
             K AA Y
Sbjct  397   KGAAHY  402


 Score = 72.8 bits (177),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 75/275 (27%), Positives = 126/275 (46%), Gaps = 34/275 (12%)
 Frame = +2

Query  776   SLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEK-AGAAKDTALQK  952
             SLE+I  YR  AQQKS+D+++ A+ +Y KAK +   + Q       E+  G  +D+ ++ 
Sbjct  111   SLEDIHGYRANAQQKSMDSIKAAEERYNKAKESLSHSGQEARGGRGEEMVGKGRDSGVRV  170

Query  953   TQQAYNAAKDTTIS-----------KTQQAKDTFSSTGQTAKDYTTQ------SAKQTKD  1081
             +                        K + A +  ++ G+  ++   +        +  KD
Sbjct  171   SHVGAVGGGGGGEEKESGVHGFHGEKARHA-ELLAAGGEEMREREGKESAGGVGGRSVKD  229

Query  1082  TLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQS  1261
             T++  GQ AK+   + AQ+     S   Q A +Y  +  ++  +  +     AKDY +Q 
Sbjct  230   TVAEKGQQAKESVGEGAQKAGSATSEKAQRASEYATEKGKEAGNMTAEQAARAKDYALQK  289

Query  1262  AQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGNKAS  1441
             A +AK+T +           + AQ+A E + + G  A +   +AKDY  QKA EA + A+
Sbjct  290   AVEAKETAA-----------EKAQRASEYMKETGSTAAEQAARAKDYTLQKAVEAKDVAA  338

Query  1442  E----AKERGTEMSKNAASYAGQKVTEAKDVTVES  1534
             E    A E  TE  K A + A QK  EA  +T ++
Sbjct  339   EKAQRASEYMTETGKQAGNVAAQKGQEAASMTAKA  373


 Score = 65.1 bits (157),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  188  MASEQLRRDNKTGERAVEVEKDRVPKMASHFESLAEKVAD  307
            MASEQ RR+NK  ER V+VEKDRVPKM SHFES+AEK  D
Sbjct  1    MASEQARRENKVTEREVQVEKDRVPKMTSHFESMAEKGKD  40



>ref|XP_002525126.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF37253.1| conserved hypothetical protein [Ricinus communis]
Length=558

 Score = 84.0 bits (206),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 65/205 (32%), Positives = 95/205 (46%), Gaps = 38/205 (19%)
 Frame = +2

Query  776   SLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKT  955
             SLEEI K RQTAQQ S++A++ AQ +YEKAK    + +   ++Y  EK   +K+ A    
Sbjct  192   SLEEISKLRQTAQQNSMEAIKAAQERYEKAKEKANQGLSVAAEYAKEKGAQSKEGAQN--  249

Query  956   QQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQ  1135
                                               + A QT DT+   G  AKD  ++ AQ
Sbjct  250   --------------------------------IEEKAAQTTDTVKEKGAKAKDTVLEGAQ  277

Query  1136  QTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDY  1315
             +T   ++  G   KD  ++ AQ+T    +  G+ AKD   +  QQ K+ + GA +TAKDY
Sbjct  278   RTTQLVAEGGAKTKDTVLEGAQKTSQYAAEKGKEAKDTAAEMGQQTKEKVVGASKTAKDY  337

Query  1316  TVQ----TAQQAKETLSKAGQAAKD  1378
                    T ++ KE    AG+ A D
Sbjct  338   AATAKDVTMEKTKEAAHYAGEVAAD  362


 Score = 56.6 bits (135),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +2

Query  188  MASEQLRRDNKTGERAVEVEKDRVPKMASHFESL  289
            MASEQ RR+N T ER V +EKDRVPKM  HFESL
Sbjct  63   MASEQSRRENTTSERKVHLEKDRVPKMTLHFESL  96



>sp|Q41060.1|SBP65_PEA RecName: Full=Seed biotin-containing protein SBP65; AltName: 
Full=Seed biotinylated protein of 65 kDa [Pisum sativum]
 emb|CAA53474.1| sbp65a [Pisum sativum]
 gb|AAC49857.1| SBP65 [Pisum sativum]
Length=551

 Score = 83.6 bits (205),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 74/233 (32%), Positives = 115/233 (49%), Gaps = 24/233 (10%)
 Frame = +2

Query  773   LSLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEK--AGAAKDTAL  946
             L++EEI KYR  AQQ +++AL  AQ KYE+AK  T E +++ +Q   EK  A  AKD   
Sbjct  163   LTMEEISKYRNQAQQSALEALSAAQEKYERAKQATNETLRNTTQAAQEKGEAAQAKDATF  222

Query  947   QKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQ  1126
             +KTQQ Y    DT  +  + A +  +    T    T Q  + T+DT+S+A +TA +Y   
Sbjct  223   EKTQQGYEMTGDTVSNSARTASEKAAQAKNTTLGKTQQGYEATRDTVSNAARTAAEYATP  282

Query  1127  SAQ-------QTKDTLSSAGQT-------AKDYTVQSAQQTKDTLSSAGQTAKDY----T  1252
             +A+       Q KD     G+T       A +   + A   K+  + AG TA  Y    T
Sbjct  283   AAEKARCVAVQAKDVTLETGKTAAEKAKCAAEIAAKVAVDLKEKATVAGWTASHYATQLT  342

Query  1253  VQSAQQAKDTLSGA----GQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKD  1399
             V   + A + + GA       A +   ++ +  K   + AG+ AK++T + K+
Sbjct  343   VDGTRAAANAVEGAVGYVAPKASELAAKSVETVKGLAASAGETAKEFTARKKE  395



>ref|XP_002881860.1| At2g42560 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58119.1| At2g42560 [Arabidopsis lyrata subsp. lyrata]
Length=631

 Score = 82.8 bits (203),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 66/186 (35%), Positives = 93/186 (50%), Gaps = 11/186 (6%)
 Frame = +2

Query  932   KDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAK  1111
             KDT  +K +QA    K++     Q+A    S   Q A +Y T+  K+  +  +     AK
Sbjct  224   KDTVAEKGRQA----KESVGQGAQKAGSAASEKAQRASEYATEKGKEAGNVTAEQAARAK  279

Query  1112  DYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSG  1291
             DY +Q A + K+T +   Q A +Y     ++T  T +     AKDYT+Q A +AKD  + 
Sbjct  280   DYALQKAVEAKETAAEKAQRASEYM----KETGSTAAEQAARAKDYTLQKAVEAKDVAAE  335

Query  1292  AGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGNKASEAKERGTEMS  1471
               Q A +Y  +T +QA    ++ GQ A   T +AKDY  QKAGEA   A   KE   E  
Sbjct  336   KAQRASEYMTETGKQAGNVAAQKGQEAASMTAKAKDYTVQKAGEA---AGYIKETTVEGG  392

Query  1472  KNAASY  1489
             K AA Y
Sbjct  393   KGAAHY  398


 Score = 76.3 bits (186),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 78/274 (28%), Positives = 127/274 (46%), Gaps = 35/274 (13%)
 Frame = +2

Query  776   SLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKT  955
             SLE+I  YR  AQQKS+D ++ A+ +Y KAK +     Q G    +E  G  +D+ ++ +
Sbjct  110   SLEDIHGYRANAQQKSMDTIRAAEERYNKAKESLSHGGQEGRGGQME--GKGRDSGVRVS  167

Query  956   QQAYNAAKDTTIS-----------KTQQAKDTFSSTGQTAKDYTTQ------SAKQTKDT  1084
                                     K + A +  ++ G+  ++   +        +  KDT
Sbjct  168   HVGAVGGDGGEEGKESGVHGFHGEKARHA-ELLAAGGEEMREREGKESAGGVGGRSVKDT  226

Query  1085  LSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSA  1264
             ++  G+ AK+   Q AQ+     S   Q A +Y  +  ++  +  +     AKDY +Q A
Sbjct  227   VAEKGRQAKESVGQGAQKAGSAASEKAQRASEYATEKGKEAGNVTAEQAARAKDYALQKA  286

Query  1265  QQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQ----AKDYASQKAGEAGN  1432
              +AK+T +   Q A +Y  +T   A E  ++A    KDYT+Q    AKD A++KA     
Sbjct  287   VEAKETAAEKAQRASEYMKETGSTAAEQAARA----KDYTLQKAVEAKDVAAEKA----Q  338

Query  1433  KASEAKERGTEMSKNAASYAGQKVTEAKDVTVES  1534
             +ASE     TE  K A + A QK  EA  +T ++
Sbjct  339   RASEYM---TETGKQAGNVAAQKGQEAASMTAKA  369



>dbj|BAJ08390.1| ECP63 protein [Daucus carota]
Length=569

 Score = 82.4 bits (202),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 102/269 (38%), Positives = 129/269 (48%), Gaps = 34/269 (13%)
 Frame = +2

Query  857   EKAKNTTKENVQSGSQY---LVEKAGAAKDTALQKT--QQAYNA-----AKDTTISK---  997
             EKA   T+E  Q   +Y     +KAG AKDT L K    + Y A     AKDT   K   
Sbjct  149   EKAAQKTQEAKQKAGEYKNYTAQKAGEAKDTTLGKAGEYKVYAAQKAAEAKDTAAQKAAE  208

Query  998   ----TQQAKDTFSSTGQTAKDYTTQSAKQTKDT-LSSAGQTAKDYTVQSAQQTKD-TLSS  1159
                 T + KD  +     AKD T   A + KDT +  AG+  KDY  Q A +TKD T+  
Sbjct  209   AKEKTGEYKDYAAQKAAEAKDTTAHKAAEAKDTTMGKAGEY-KDYAAQKAAETKDATMQK  267

Query  1160  AGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKD-TLSGAGQTAKDYTVQTAQQ  1336
              G+  KDY  Q A +TKD      +  KDY  Q A +AKD T+   G+  KDY    AQ+
Sbjct  268   TGEY-KDYAAQKAAETKDATMEKAKEYKDYAAQKAAEAKDATMQKTGEY-KDYA---AQK  322

Query  1337  AKETLSKAGQAAKDYTVQAKDYASQKAGEAGN----KASEAKERGTEMSKNAASYAGQKV  1504
             A ET     + AK+Y    KDY +QKA E  +    KA EAK+   + +     YA +K 
Sbjct  323   AAETKDATMEKAKEY----KDYTAQKAAETKDATMEKAKEAKDTTVQKTGEYKDYAAEKA  378

Query  1505  TEAKDVTVESgkgavgyagkvaETLKDTA  1591
              E KDVTVE  K            LKD+A
Sbjct  379   KEGKDVTVEKAKEGKDTTVGKMTELKDSA  407


 Score = 79.3 bits (194),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 79/204 (39%), Positives = 102/204 (50%), Gaps = 20/204 (10%)
 Frame = +2

Query  923   GAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKD-TLSSAG  1099
             G  KD A QK  +A    KDTT  K  +AKDT        KDY  Q A +TKD T+   G
Sbjct  214   GEYKDYAAQKAAEA----KDTTAHKAAEAKDTTMGKAGEYKDYAAQKAAETKDATMQKTG  269

Query  1100  QTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKD-TLSSAGQTAKDYTVQSAQQAK  1276
             +  KDY  Q A +TKD      +  KDY  Q A + KD T+   G+  KDY  Q A + K
Sbjct  270   EY-KDYAAQKAAETKDATMEKAKEYKDYAAQKAAEAKDATMQKTGEY-KDYAAQKAAETK  327

Query  1277  DTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQA----KDYASQKAGEAGN----  1432
             D      +  KDYT Q A + K+   +  + AKD TVQ     KDYA++KA E  +    
Sbjct  328   DATMEKAKEYKDYTAQKAAETKDATMEKAKEAKDTTVQKTGEYKDYAAEKAKEGKDVTVE  387

Query  1433  KASEAKE----RGTEMSKNAASYA  1492
             KA E K+    + TE+  +AA  A
Sbjct  388   KAKEGKDTTVGKMTELKDSAADAA  411


 Score = 69.7 bits (169),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 66/200 (33%), Positives = 94/200 (47%), Gaps = 17/200 (9%)
 Frame = +2

Query  791   GKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKTQQAYN  970
             G+Y+  A QK+ +A  T  +K  +AK+TT         Y  +KA   KD  +QKT +   
Sbjct  214   GEYKDYAAQKAAEAKDTTAHKAAEAKDTTMGKAGEYKDYAAQKAAETKDATMQKTGEY--  271

Query  971   AAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKD-TLSSAGQTAKDYTVQSAQQTKD  1147
               KD    K  + KD      +  KDY  Q A + KD T+   G+  KDY  Q A +TKD
Sbjct  272   --KDYAAQKAAETKDATMEKAKEYKDYAAQKAAEAKDATMQKTGEY-KDYAAQKAAETKD  328

Query  1148  TLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQT  1327
                   +  KDYT Q A +TKD            T++ A++AKDT        KDY  + 
Sbjct  329   ATMEKAKEYKDYTAQKAAETKDA-----------TMEKAKEAKDTTVQKTGEYKDYAAEK  377

Query  1328  AQQAKETLSKAGQAAKDYTV  1387
             A++ K+   +  +  KD TV
Sbjct  378   AKEGKDVTVEKAKEGKDTTV  397


 Score = 65.1 bits (157),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 59/190 (31%), Positives = 88/190 (46%), Gaps = 15/190 (8%)
 Frame = +2

Query  776   SLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKT  955
             ++++ G+Y+  A QK+ +            K+ T E  +    Y  +KA  AKD  +QKT
Sbjct  264   TMQKTGEYKDYAAQKAAET-----------KDATMEKAKEYKDYAAQKAAEAKDATMQKT  312

Query  956   QQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQ  1135
              +     KD    K  + KD      +  KDYT Q A +TKD      + AKD TVQ   
Sbjct  313   GEY----KDYAAQKAAETKDATMEKAKEYKDYTAQKAAETKDATMEKAKEAKDTTVQKTG  368

Query  1136  QTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDY  1315
             + KD  +   +  KD TV+ A++ KDT        KD    +A++A D   G  +  K  
Sbjct  369   EYKDYAAEKAKEGKDVTVEKAKEGKDTTVGKMTELKDSAADAARKAMDMFLGKKEEVKGR  428

Query  1316  TVQTAQQAKE  1345
               +TA+ AKE
Sbjct  429   AGETAEVAKE  438


 Score = 54.3 bits (129),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 71/203 (35%), Positives = 100/203 (49%), Gaps = 27/203 (13%)
 Frame = +2

Query  980   DTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTA-------KDYTVQSAQQ  1138
             DTT+ K  + K+  +   + AK+   Q A++TK+  +   Q A       K+YT Q A +
Sbjct  116   DTTMGKAGEYKEYTAQKAEEAKEKAAQKAEETKEKAAQKTQEAKQKAGEYKNYTAQKAGE  175

Query  1139  TKD-TLSSAGQTAKDYTVQSAQQTKDTLSSAGQTA-------KDYTVQSAQQAKDTLSGA  1294
              KD TL  AG+  K Y  Q A + KDT +     A       KDY  Q A +AKDT +  
Sbjct  176   AKDTTLGKAGEY-KVYAAQKAAEAKDTAAQKAAEAKEKTGEYKDYAAQKAAEAKDTTAHK  234

Query  1295  GQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQA----KDYASQKAGEAGNKASEAKERGT  1462
                AKD T+  A + K+  ++     KD T+Q     KDYA+Q       KA+E K+   
Sbjct  235   AAEAKDTTMGKAGEYKDYAAQKAAETKDATMQKTGEYKDYAAQ-------KAAETKDATM  287

Query  1463  EMSKNAASYAGQKVTEAKDVTVE  1531
             E +K    YA QK  EAKD T++
Sbjct  288   EKAKEYKDYAAQKAAEAKDATMQ  310



>ref|XP_010243092.1| PREDICTED: embryonic protein DC-8-like isoform X1 [Nelumbo nucifera]
Length=544

 Score = 82.0 bits (201),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 89/277 (32%), Positives = 126/277 (45%), Gaps = 21/277 (8%)
 Frame = +2

Query  755   RRDHSGLSLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAK  934
             R  +   +++++G+Y+  A  K+         K  + K+   +  + G    VEK G  +
Sbjct  161   RETNDSAAMKKMGEYKDYAADKARQGKDATIEKMGEYKDYAADKARQGKDVAVEKMGEHR  220

Query  935   DTALQKTQQAYNAA-------KDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSS  1093
             D A  K +Q  + A       KD  + K +Q KD         KDY    AKQ KD    
Sbjct  221   DYAADKAKQGKDVAVEKMGEYKDYAVDKAKQGKDIAVEKMGEYKDYAVDKAKQGKDATMQ  280

Query  1094  AGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKD-TLSSAGQTAKDYTVQSAQQ  1270
                  KDYT   A+Q KD         KDYT   A+Q KD T+  AG+  KDYT +  + 
Sbjct  281   KMGLYKDYTADKAKQGKDATMEKLCEYKDYTADKAKQGKDATMEKAGEY-KDYTAEKTKP  339

Query  1271  AKD-TLSGAGQTAKDYTVQTAQQAKE-TLSKAGQAAKDYTV----QAKDYASQKAGE---  1423
              KD T+   G+  KD+T + A+Q K+ T+ K G+  KDYT     Q KD   +K GE   
Sbjct  340   GKDATMEKMGEY-KDHTAEKAKQGKDATMEKMGE-YKDYTADKAKQGKDATMEKMGEYKD  397

Query  1424  -AGNKASEAKERGTEMSKNAASYAGQKVTEAKDVTVE  1531
                +KA E K+   E +     Y  +K  E KD T E
Sbjct  398   YTADKAKEGKDATMEKTGQYKDYTAEKTKEGKDTTAE  434


 Score = 68.6 bits (166),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 71/205 (35%), Positives = 103/205 (50%), Gaps = 15/205 (7%)
 Frame = +2

Query  773   LSLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQK  952
             +++E++G+Y+  A  K+         K    K+ T +  + G    +EK    KD    K
Sbjct  255   IAVEKMGEYKDYAVDKAKQGKDATMQKMGLYKDYTADKAKQGKDATMEKLCEYKDYTADK  314

Query  953   TQQAYNAA-------KDTTISKTQQAKD-TFSSTGQTAKDYTTQSAKQTKD-TLSSAGQT  1105
              +Q  +A        KD T  KT+  KD T    G+  KD+T + AKQ KD T+   G+ 
Sbjct  315   AKQGKDATMEKAGEYKDYTAEKTKPGKDATMEKMGEY-KDHTAEKAKQGKDATMEKMGEY  373

Query  1106  AKDYTVQSAQQTKD-TLSSAGQTAKDYTVQSAQQTKD-TLSSAGQTAKDYTVQSAQQAKD  1279
              KDYT   A+Q KD T+   G+  KDYT   A++ KD T+   GQ  KDYT +  ++ KD
Sbjct  374   -KDYTADKAKQGKDATMEKMGEY-KDYTADKAKEGKDATMEKTGQY-KDYTAEKTKEGKD  430

Query  1280  TLSGAGQTAKDYTVQTAQQAKETLS  1354
             T +   +  KD T   A QAKE L+
Sbjct  431   TTAERMKGLKDSTADAATQAKEFLT  455


 Score = 60.8 bits (146),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 71/215 (33%), Positives = 91/215 (42%), Gaps = 13/215 (6%)
 Frame = +2

Query  914   EKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKD-TFSSTGQTAKDYTTQSAKQTKDTLS  1090
             EKA    D+A  K    Y   KD    K +Q KD T    G+  KDY    A+Q KD   
Sbjct  158   EKARETNDSAAMKKMGEY---KDYAADKARQGKDATIEKMGEY-KDYAADKARQGKDVAV  213

Query  1091  SAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQ  1270
                   +DY    A+Q KD         KDY V  A+Q KD         KDY V  A+Q
Sbjct  214   EKMGEHRDYAADKAKQGKDVAVEKMGEYKDYAVDKAKQGKDIAVEKMGEYKDYAVDKAKQ  273

Query  1271  AKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTV----QAKDYASQKAGEAGNKA  1438
              KD         KDYT   A+Q K+   +     KDYT     Q KD   +KAGE  +  
Sbjct  274   GKDATMQKMGLYKDYTADKAKQGKDATMEKLCEYKDYTADKAKQGKDATMEKAGEYKDYT  333

Query  1439  SEAKERGTE--MSKNA--ASYAGQKVTEAKDVTVE  1531
             +E  + G +  M K      +  +K  + KD T+E
Sbjct  334   AEKTKPGKDATMEKMGEYKDHTAEKAKQGKDATME  368



>ref|XP_010506084.1| PREDICTED: seed biotin-containing protein SBP65-like isoform 
X1 [Camelina sativa]
Length=657

 Score = 82.4 bits (202),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 63/181 (35%), Positives = 89/181 (49%), Gaps = 10/181 (6%)
 Frame = +2

Query  974   AKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQ-------TAKDYTVQSA  1132
             AK++     Q+A    S   Q A  Y T+  ++T    +  GQ        AKDYT++ A
Sbjct  247   AKESVGQGAQKAGSAASEKTQRASSYVTEKGRETGQVAAQKGQEAKEQAVRAKDYTMEKA  306

Query  1133  QQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKD  1312
              + KDT +   + A +Y  +  ++T +T +     AKDYT+Q A +AKD  +   Q A +
Sbjct  307   GEAKDTAAEKARRASEYATEKGRETGNTAAEQAARAKDYTLQKAVEAKDIAAEKAQKASE  366

Query  1313  YTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGNKASEAKERGTEMSKNAASYA  1492
             Y  +  + A    S+ GQ A   T +AKDY  QKAGEA   A   KE   E  K AA Y 
Sbjct  367   YVTERGKVAGNVASQKGQEAASMTAKAKDYTVQKAGEA---AGYVKEATVEGGKGAAHYV  423

Query  1493  G  1495
             G
Sbjct  424   G  424


 Score = 63.2 bits (152),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  188  MASEQLRRDNKTGERAVEVEKDRVPKMASHFESLAEKVAD  307
            MASEQ RR+NK  ER V+VEKDRVPKM SHFES+AE+  D
Sbjct  1    MASEQARRENKVTEREVKVEKDRVPKMTSHFESMAEQGKD  40



>ref|XP_010517781.1| PREDICTED: seed biotin-containing protein SBP65-like isoform 
X1 [Camelina sativa]
Length=661

 Score = 82.0 bits (201),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 63/181 (35%), Positives = 89/181 (49%), Gaps = 10/181 (6%)
 Frame = +2

Query  974   AKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAK-------DYTVQSA  1132
             AK++     Q+     S   Q A  Y T+  ++T    +  GQ AK       DYT++ A
Sbjct  251   AKESVGQGAQKTGSAASEKTQRASSYVTEKGRETGQVAAQKGQEAKEQAVRAKDYTMEKA  310

Query  1133  QQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKD  1312
              + KDT +   + A +Y  +  ++T +T +     AKDYT+Q A +AKD  +   Q A +
Sbjct  311   GEAKDTAAEKARRASEYATEKGRETGNTAAEQAARAKDYTLQKAVEAKDIAAENAQKASE  370

Query  1313  YTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGNKASEAKERGTEMSKNAASYA  1492
             Y  +  + A    S+ GQ A   T +AKDY  QKAGEA   A   KE   E  K AA YA
Sbjct  371   YVTEKGKVAGNVASQKGQEAASMTAKAKDYTVQKAGEA---AGYVKEATVEGGKGAAHYA  427

Query  1493  G  1495
             G
Sbjct  428   G  428


 Score = 68.9 bits (167),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 63/193 (33%), Positives = 88/193 (46%), Gaps = 31/193 (16%)
 Frame = +2

Query  881   ENVQSGSQYLVEKAGAAKDTALQKTQQAYN---AAKDTTISKTQQAKDTFSSTGQTAKDY  1051
             E  Q  S Y+ EK       A QK Q+A      AKD T+ K  +AKDT +   + A +Y
Sbjct  268   EKTQRASSYVTEKGRETGQVAAQKGQEAKEQAVRAKDYTMEKAGEAKDTAAEKARRASEY  327

Query  1052  TTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAG  1231
              T+  ++T +T +     AKDYT+Q A + KD  +   Q A +Y  +  +   +  S  G
Sbjct  328   ATEKGRETGNTAAEQAARAKDYTLQKAVEAKDIAAENAQKASEYVTEKGKVAGNVASQKG  387

Query  1232  QTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAA---KDYTVQAKDY  1402
             Q A   T +               AKDYTVQ          KAG+AA   K+ TV+    
Sbjct  388   QEAASMTAK---------------AKDYTVQ----------KAGEAAGYVKEATVEGGKG  422

Query  1403  ASQKAGEAGNKAS  1441
             A+  AG A  KA+
Sbjct  423   AAHYAGVAAEKAA  435



>ref|XP_006648506.1| PREDICTED: embryonic protein DC-8-like [Oryza brachyantha]
Length=542

 Score = 81.6 bits (200),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 88/244 (36%), Positives = 120/244 (49%), Gaps = 22/244 (9%)
 Frame = +2

Query  899   SQYLVEKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTK  1078
             ++Y    AG  KD  L   Q A   AK        QA     STG TA +Y   +A +TK
Sbjct  216   AEYAKTAAGKTKDVTLSSGQTAGEYAK--------QAAAGPPSTGGTAAEYAKTAAGKTK  267

Query  1079  DTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQ  1258
             D   S+GQTA +Y  Q+A + KD   S G TA +YT  + ++ KD   S G+TA +Y   
Sbjct  268   DVTLSSGQTAGEYAKQAAVKGKDVTVSTGGTAAEYTKTATEKAKDVALSTGETAAEYAKT  327

Query  1259  SAQQAKDTLSGAGQTAKDYTVQTAQQAKE-TLS-------KAGQAAKDYTVQAKDYASQK  1414
             +A++AKDT   AG+T   YT Q A +AK+ TLS       KA +   D   +  +YA +K
Sbjct  328   AAEKAKDTAVAAGKTTAGYTQQAAVKAKDVTLSTGATVAQKAKEVTADTAHKVAEYAREK  387

Query  1415  AGEAGNKAS-----EAKERGTEMSKNAASYAGQKVTEAKDVTVESgkgavgyagkvaETL  1579
             A E G +A+      A+E G E +  A   A Q    AKD T          A +  +T+
Sbjct  388   A-EQGKEATARAADSAEEPGEETADKARDMAAQTKDTAKDTTGGMAHKVGAMAAQTKDTV  446

Query  1580  KDTA  1591
             KD A
Sbjct  447   KDAA  450


 Score = 64.7 bits (156),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 79/266 (30%), Positives = 119/266 (45%), Gaps = 45/266 (17%)
 Frame = +2

Query  797   YRQTAQQKSIDA-LQTAQNKYEKAKNTTKENVQSG---SQYLVEKAGAAKDTALQKTQQA  964
             Y +TA  K+ D  L + Q   E AK        +G   ++Y    AG  KD  L   Q A
Sbjct  218   YAKTAAGKTKDVTLSSGQTAGEYAKQAAAGPPSTGGTAAEYAKTAAGKTKDVTLSSGQTA  277

Query  965   YNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTK  1144
                AK   +    + KD   STG TA +YT  + ++ KD   S G+TA +Y   +A++ K
Sbjct  278   GEYAKQAAV----KGKDVTVSTGGTAAEYTKTATEKAKDVALSTGETAAEYAKTAAEKAK  333

Query  1145  DTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAK---------------DYTVQSAQQAKD  1279
             DT  +AG+T   YT Q+A + KD   S G T                 +Y  + A+Q K+
Sbjct  334   DTAVAAGKTTAGYTQQAAVKAKDVTLSTGATVAQKAKEVTADTAHKVAEYAREKAEQGKE  393

Query  1280  TLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYT-----------VQAKDYASQKAG--  1420
               + A  +A++   +TA +A++  ++    AKD T            Q KD     AG  
Sbjct  394   ATARAADSAEEPGEETADKARDMAAQTKDTAKDTTGGMAHKVGAMAAQTKDTVKDAAGAM  453

Query  1421  ---------EAGNKASEAKERGTEMS  1471
                      +AG+KA EAK R ++ +
Sbjct  454   AQKTKDTIGQAGHKAGEAKNRASDAA  479



>ref|XP_010506086.1| PREDICTED: seed biotin-containing protein SBP65-like isoform 
X2 [Camelina sativa]
Length=617

 Score = 81.6 bits (200),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 63/181 (35%), Positives = 89/181 (49%), Gaps = 10/181 (6%)
 Frame = +2

Query  974   AKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAK-------DYTVQSA  1132
             AK++     Q+A    S   Q A  Y T+  ++T    +  GQ AK       DYT++ A
Sbjct  247   AKESVGQGAQKAGSAASEKTQRASSYVTEKGRETGQVAAQKGQEAKEQAVRAKDYTMEKA  306

Query  1133  QQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKD  1312
              + KDT +   + A +Y  +  ++T +T +     AKDYT+Q A +AKD  +   Q A +
Sbjct  307   GEAKDTAAEKARRASEYATEKGRETGNTAAEQAARAKDYTLQKAVEAKDIAAEKAQKASE  366

Query  1313  YTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGNKASEAKERGTEMSKNAASYA  1492
             Y  +  + A    S+ GQ A   T +AKDY  QKAGEA   A   KE   E  K AA Y 
Sbjct  367   YVTERGKVAGNVASQKGQEAASMTAKAKDYTVQKAGEA---AGYVKEATVEGGKGAAHYV  423

Query  1493  G  1495
             G
Sbjct  424   G  424


 Score = 63.2 bits (152),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  188  MASEQLRRDNKTGERAVEVEKDRVPKMASHFESLAEKVAD  307
            MASEQ RR+NK  ER V+VEKDRVPKM SHFES+AE+  D
Sbjct  1    MASEQARRENKVTEREVKVEKDRVPKMTSHFESMAEQGKD  40


 Score = 53.1 bits (126),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 70/248 (28%), Positives = 99/248 (40%), Gaps = 51/248 (21%)
 Frame = +2

Query  878   KENVQSGSQYLVEKAGAAKDTALQKTQQAYN------------------AAKDTTISKTQ  1003
             KE       Y +EKAG AKDTA +K ++A                     AKD T+ K  
Sbjct  292   KEQAVRAKDYTMEKAGEAKDTAAEKARRASEYATEKGRETGNTAAEQAARAKDYTLQKAV  351

Query  1004  QAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQ-------TAKDYTVQSAQQ----TKDT  1150
             +AKD  +   Q A +Y T+  K   +  S  GQ        AKDYTVQ A +     K+ 
Sbjct  352   EAKDIAAEKAQKASEYVTERGKVAGNVASQKGQEAASMTAKAKDYTVQKAGEAAGYVKEA  411

Query  1151  LSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTA  1330
                 G+ A  Y   +A++      +A     +  VQ  +    T+ GA   A    V+  
Sbjct  412   TVEGGKGAAHYVGVAAEKAATVGWTAAHLTTEKVVQGTKAVAGTVEGAVGYAGHKAVEVG  471

Query  1331  QQA----KETLSKAGQAAKDYTVQAKDYA------------------SQKAGEAGNKASE  1444
              +A    KE  + A      YT + K+ A                  S+K GEA  K++E
Sbjct  472   SKAVDLTKEKAAVAADTVVGYTAKKKEEAQHRDQEMHQVRKRSDQGLSKKQGEALEKSTE  531

Query  1445  AKERGTEM  1468
              KER  +M
Sbjct  532   KKERVRKM  539



>gb|KHG00180.1| Seed biotin-containing SBP65 [Gossypium arboreum]
Length=634

 Score = 81.6 bits (200),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 68/214 (32%), Positives = 103/214 (48%), Gaps = 19/214 (9%)
 Frame = +2

Query  773   LSLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQK  952
             LS+EEI K R +AQQ S++ L+ A+ +Y +AK +  + + + + Y  EK   AK+TA+Q 
Sbjct  231   LSVEEISKLRASAQQNSMETLRAAEERYNQAKESAAQALNTAADYTKEKGQQAKETAVQS  290

Query  953   TQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDT----LSSAG-------  1099
              Q A          K  QAKDT     +    Y  +   QTKDT    L+SAG       
Sbjct  291   AQYA--------TEKGGQAKDTIIEGAKRTTQYIAEKGTQTKDTAAETLASAGNYTAPRV  342

Query  1100  QTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKD  1279
             + AKDY +Q+A + KD+     +    Y  + A  TKD      + A +   + A   KD
Sbjct  343   EQAKDYALQTAVKAKDSAVDVSKNIASYAGEKAVVTKDVTVEKSKEAAELAGKVAVDVKD  402

Query  1280  TLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDY  1381
                 AG +A  YT + A +  +  +K  + A +Y
Sbjct  403   KAVVAGWSAAHYTTEKAVEGTKVAAKMVEGAAEY  436


 Score = 67.0 bits (162),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 64/158 (41%), Positives = 80/158 (51%), Gaps = 15/158 (9%)
 Frame = +2

Query  1136  QTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDY  1315
             Q K++ + A  TA DYT +  QQ K+T   + Q    Y  +   QAKDT+    +    Y
Sbjct  260   QAKESAAQALNTAADYTKEKGQQAKETAVQSAQ----YATEKGGQAKDTIIEGAKRTTQY  315

Query  1316  TV----QTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGNKASEAKERGTEMSKNAA  1483
                   QT   A ETL+ AG        QAKDYA Q A        +AK+   ++SKN A
Sbjct  316   IAEKGTQTKDTAAETLASAGNYTAPRVEQAKDYALQTA-------VKAKDSAVDVSKNIA  368

Query  1484  SYAGQKVTEAKDVTVESgkgavgyagkvaETLKDTATV  1597
             SYAG+K    KDVTVE  K A   AGKVA  +KD A V
Sbjct  369   SYAGEKAVVTKDVTVEKSKEAAELAGKVAVDVKDKAVV  406


 Score = 58.5 bits (140),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 33/38 (87%), Gaps = 1/38 (3%)
 Frame = +2

Query  188  MASEQL-RRDNKTGERAVEVEKDRVPKMASHFESLAEK  298
            MASEQL RR+N T ER + +E++RVPKMA+HFESLAEK
Sbjct  1    MASEQLSRRENTTSERDIHLEENRVPKMATHFESLAEK  38



>ref|XP_010508555.1| PREDICTED: seed biotin-containing protein SBP65-like isoform 
X1 [Camelina sativa]
Length=648

 Score = 81.3 bits (199),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 69/196 (35%), Positives = 101/196 (52%), Gaps = 11/196 (6%)
 Frame = +2

Query  908   LVEKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTL  1087
             + EK   AK++  Q  Q+A +AA +    KTQ+A    +  G+       Q  ++ K+  
Sbjct  231   VAEKGRQAKESVGQGAQKAGSAASE----KTQRASSYVTEKGRETGQLAAQKGQEAKE--  284

Query  1088  SSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQ  1267
               AG+ AKDYT++ A + KDT +   + A +Y  +  ++T +T +     AKDYT+Q A 
Sbjct  285   -QAGR-AKDYTMEKAGEAKDTAAEKARRASEYATEKGRETGNTAAEQAARAKDYTLQKAV  342

Query  1268  QAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGNKASEA  1447
             +AKD  +   Q A +Y  +  + A    S+ GQ A   T +AKDY  QKA EA   A   
Sbjct  343   EAKDIAAEKAQKASEYVTEKGKVAGNVASQKGQEAASMTAKAKDYTVQKASEA---AGYV  399

Query  1448  KERGTEMSKNAASYAG  1495
             KE   E  K AA YAG
Sbjct  400   KEATVEGGKGAAHYAG  415


 Score = 72.4 bits (176),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 77/257 (30%), Positives = 113/257 (44%), Gaps = 30/257 (12%)
 Frame = +2

Query  806   TAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKTQQA---YNAA  976
             T  +K   A ++     +KA +   E  Q  S Y+ EK       A QK Q+A      A
Sbjct  230   TVAEKGRQAKESVGQGAQKAGSAASEKTQRASSYVTEKGRETGQLAAQKGQEAKEQAGRA  289

Query  977   KDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLS  1156
             KD T+ K  +AKDT +   + A +Y T+  ++T +T +     AKDYT+Q A + KD  +
Sbjct  290   KDYTMEKAGEAKDTAAEKARRASEYATEKGRETGNTAAEQAARAKDYTLQKAVEAKDIAA  349

Query  1157  SAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQ  1336
                Q A +Y  +  +   +  S  GQ A   T +               AKDYTVQ A +
Sbjct  350   EKAQKASEYVTEKGKVAGNVASQKGQEAASMTAK---------------AKDYTVQKASE  394

Query  1337  A----KETLSKAGQAAKDYTVQAKDYASQKAGEAGNKASEAKERGTEM----SKNAASYA  1492
             A    KE   + G+ A  Y   A + A+     A +  +E   +GT+      + A  YA
Sbjct  395   AAGYVKEATVEGGKGAAHYAGVAAEKAATVGWTAAHFTTEKVVQGTKAVAGTVEGAVGYA  454

Query  1493  GQKVTE----AKDVTVE  1531
             G K  E    A D+T E
Sbjct  455   GHKAVEVGSKAVDLTKE  471



>ref|XP_010517782.1| PREDICTED: seed biotin-containing protein SBP65-like isoform 
X2 [Camelina sativa]
Length=621

 Score = 81.3 bits (199),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 59/161 (37%), Positives = 82/161 (51%), Gaps = 10/161 (6%)
 Frame = +2

Query  1034  QTAKDYTTQSAKQTKDTLSSAGQTAK-------DYTVQSAQQTKDTLSSAGQTAKDYTVQ  1192
             Q A  Y T+  ++T    +  GQ AK       DYT++ A + KDT +   + A +Y  +
Sbjct  271   QRASSYVTEKGRETGQVAAQKGQEAKEQAVRAKDYTMEKAGEAKDTAAEKARRASEYATE  330

Query  1193  SAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAA  1372
               ++T +T +     AKDYT+Q A +AKD  +   Q A +Y  +  + A    S+ GQ A
Sbjct  331   KGRETGNTAAEQAARAKDYTLQKAVEAKDIAAENAQKASEYVTEKGKVAGNVASQKGQEA  390

Query  1373  KDYTVQAKDYASQKAGEAGNKASEAKERGTEMSKNAASYAG  1495
                T +AKDY  QKAGEA   A   KE   E  K AA YAG
Sbjct  391   ASMTAKAKDYTVQKAGEA---AGYVKEATVEGGKGAAHYAG  428


 Score = 68.9 bits (167),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 63/193 (33%), Positives = 88/193 (46%), Gaps = 31/193 (16%)
 Frame = +2

Query  881   ENVQSGSQYLVEKAGAAKDTALQKTQQAYN---AAKDTTISKTQQAKDTFSSTGQTAKDY  1051
             E  Q  S Y+ EK       A QK Q+A      AKD T+ K  +AKDT +   + A +Y
Sbjct  268   EKTQRASSYVTEKGRETGQVAAQKGQEAKEQAVRAKDYTMEKAGEAKDTAAEKARRASEY  327

Query  1052  TTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAG  1231
              T+  ++T +T +     AKDYT+Q A + KD  +   Q A +Y  +  +   +  S  G
Sbjct  328   ATEKGRETGNTAAEQAARAKDYTLQKAVEAKDIAAENAQKASEYVTEKGKVAGNVASQKG  387

Query  1232  QTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAA---KDYTVQAKDY  1402
             Q A   T +               AKDYTVQ          KAG+AA   K+ TV+    
Sbjct  388   QEAASMTAK---------------AKDYTVQ----------KAGEAAGYVKEATVEGGKG  422

Query  1403  ASQKAGEAGNKAS  1441
             A+  AG A  KA+
Sbjct  423   AAHYAGVAAEKAA  435


 Score = 54.7 bits (130),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 57/190 (30%), Positives = 88/190 (46%), Gaps = 26/190 (14%)
 Frame = +2

Query  1007  AKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAK---  1177
             A  T +  G+ AK+   Q A++T    S   Q A  Y  +  ++T    +  GQ AK   
Sbjct  240   ATGTVAEKGRQAKESVGQGAQKTGSAASEKTQRASSYVTEKGRETGQVAAQKGQEAKEQA  299

Query  1178  ----DYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKE  1345
                 DYT++ A + KDT +   + A +Y  +  ++  +T +     AKDYT+Q A +AK+
Sbjct  300   VRAKDYTMEKAGEAKDTAAEKARRASEYATEKGRETGNTAAEQAARAKDYTLQKAVEAKD  359

Query  1346  TLSKAGQAAKDYTVQAKDYASQKAGEAGN----KASEAKERGTEMSKNAASYAGQKVTEA  1513
               ++  Q       +A +Y ++K   AGN    K  EA      M+  A  Y  QK  EA
Sbjct  360   IAAENAQ-------KASEYVTEKGKVAGNVASQKGQEA----ASMTAKAKDYTVQKAGEA  408

Query  1514  ----KDVTVE  1531
                 K+ TVE
Sbjct  409   AGYVKEATVE  418



>gb|KEH39260.1| seed biotin containing protein SBP65, putative [Medicago truncatula]
Length=748

 Score = 80.9 bits (198),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 66/192 (34%), Positives = 94/192 (49%), Gaps = 19/192 (10%)
 Frame = +2

Query  788   IGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQY-------LVEKAGAAKDTAL  946
             IGKYR  AQQ  +DA+  AQ +YEKAK  T E + + +Q         +EKA  AKD  +
Sbjct  351   IGKYRNQAQQNEMDAISAAQERYEKAKQATNETLNNTAQTTREKTAQAMEKAAQAKDATV  410

Query  947   QKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQ  1126
             +KTQQ Y A KDT  S  + A +  +   + AK    Q+    KD     G+TA +   +
Sbjct  411   EKTQQGYEATKDTVSSAAKTATEYVTPVAEKAKSAVVQA----KDVTVETGKTAAEVASK  466

Query  1127  SAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQ----QAKDTLSG-  1291
              A   KD  + AG TA  Y+ +         + A + A  Y V  A     ++ D + G 
Sbjct  467   VAVDLKDKATVAGWTAAHYSTKLTVDGTKAAAHAVEGAAGYVVPKAAGLALKSVDVVKGL  526

Query  1292  ---AGQTAKDYT  1318
                AG+TAK++T
Sbjct  527   AASAGETAKEFT  538


 Score = 54.3 bits (129),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 28/35 (80%), Gaps = 1/35 (3%)
 Frame = +2

Query  188  MASEQL-RRDNKTGERAVEVEKDRVPKMASHFESL  289
            MASEQL RR+N T ER + VEKDRVPKM +HFE L
Sbjct  1    MASEQLSRRENTTNERDIHVEKDRVPKMTTHFEQL  35



>ref|XP_008381357.1| PREDICTED: embryonic protein DC-8-like [Malus domestica]
Length=512

 Score = 80.5 bits (197),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 92/294 (31%), Positives = 142/294 (48%), Gaps = 36/294 (12%)
 Frame = +2

Query  761   DHSGLSLEEIGKYRQTAQQKSIDALQTAQN-------KYEKAKNTTKENVQSGSQYLVEK  919
             +++  + E+  + + TA QK+ +A Q A+        K ++AK+ T       + Y  EK
Sbjct  141   EYADYTAEKAKETKDTAAQKANEAAQKAKETKDSAAQKAKEAKDATMGKAGEYTNYAAEK  200

Query  920   AGAAKDTALQKTQQAYN-------AAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTK  1078
             A  AKDT + K  +  N        AKDTT++K ++AKDT  +      +Y  + AKQ K
Sbjct  201   AKEAKDTTVNKAGEYTNYTAEKAKEAKDTTLNKAKEAKDTTMNKAGEYTNYAAEKAKQAK  260

Query  1079  D-TLSSAGQ----------TAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSS  1225
             D T++ AG+           AKD TV++A++TKD  +   +  KD TV    Q KDT + 
Sbjct  261   DTTVNKAGEYTNYAAEKAKEAKDETVKTAKETKDCTAEKAKEGKDTTVSKLGQLKDTAAG  320

Query  1226  AGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYA  1405
             A Q A DY     ++ K   +   +  KD T +TA++AKE LS+  + A+    Q K   
Sbjct  321   AAQKAMDYLSGKKEETKQKAAETAEKTKDTTYETAEKAKEKLSETEEEARRKMEQLKLQG  380

Query  1406  SQKAGEAGNKASEAK----ERGTEMSKNAASYAG-------QKVTEAKDVTVES  1534
              +   E  ++A EA+    E+G    +N  S  G        K+T   DV  ES
Sbjct  381   KEYKDEDADRAREARDIEAEKGQAAKENIFSSIGSIPGAIKSKLTHPTDVVEES  434


 Score = 79.7 bits (195),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 86/244 (35%), Positives = 125/244 (51%), Gaps = 31/244 (13%)
 Frame = +2

Query  782   EEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKTQQ  961
             E+I +Y +TA++K   A QTA+ K  + K   K  V   + Y  EKA   KDTA QK  +
Sbjct  108   EKINEYTETAEEK---AKQTAE-KANETKEAAKGKVGEYADYTAEKAKETKDTAAQKANE  163

Query  962   AYNAAKDTTISKTQQAKDTFSSTGQTAKDYTT---QSAKQTKD-TLSSAGQTAKDYTVQS  1129
             A   AK+T  S  Q+AK+   +T   A +YT    + AK+ KD T++ AG+   +YT + 
Sbjct  164   AAQKAKETKDSAAQKAKEAKDATMGKAGEYTNYAAEKAKEAKDTTVNKAGEYT-NYTAEK  222

Query  1130  AQQTKDTLSSAGQTAKD-----------YTVQSAQQTKD-TLSSAGQ----------TAK  1243
             A++ KDT  +  + AKD           Y  + A+Q KD T++ AG+           AK
Sbjct  223   AKEAKDTTLNKAKEAKDTTMNKAGEYTNYAAEKAKQAKDTTVNKAGEYTNYAAEKAKEAK  282

Query  1244  DYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGE  1423
             D TV++A++ KD  +   +  KD TV    Q K+T + A Q A DY    K+   QKA E
Sbjct  283   DETVKTAKETKDCTAEKAKEGKDTTVSKLGQLKDTAAGAAQKAMDYLSGKKEETKQKAAE  342

Query  1424  AGNK  1435
                K
Sbjct  343   TAEK  346


 Score = 68.2 bits (165),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 71/204 (35%), Positives = 106/204 (52%), Gaps = 39/204 (19%)
 Frame = +2

Query  1031  GQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAK----------D  1180
             G+  KDYTTQ AK+T D   +AG+   +YT  + ++ K T   A +T +          D
Sbjct  88    GKEYKDYTTQKAKETTD---AAGEKINEYTETAEEKAKQTAEKANETKEAAKGKVGEYAD  144

Query  1181  YTVQSAQQTKDTLS----SAGQTA---KDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQA  1339
             YT + A++TKDT +     A Q A   KD   Q A++AKD   G      +Y  + A++A
Sbjct  145   YTAEKAKETKDTAAQKANEAAQKAKETKDSAAQKAKEAKDATMGKAGEYTNYAAEKAKEA  204

Query  1340  KE-TLSKAGQ----------AAKDYTV----QAKDYASQKAGEAGNKASEAKERGTEMSK  1474
             K+ T++KAG+           AKD T+    +AKD    KAGE  N A+E  ++  + + 
Sbjct  205   KDTTVNKAGEYTNYTAEKAKEAKDTTLNKAKEAKDTTMNKAGEYTNYAAEKAKQAKDTTV  264

Query  1475  NAA----SYAGQKVTEAKDVTVES  1534
             N A    +YA +K  EAKD TV++
Sbjct  265   NKAGEYTNYAAEKAKEAKDETVKT  288


 Score = 59.7 bits (143),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 79/232 (34%), Positives = 114/232 (49%), Gaps = 36/232 (16%)
 Frame = +2

Query  914   EKAGAAKDTALQKTQQAYNAA-------KDTTISKTQQAKDTFSSTGQTAK-------DY  1051
             EK    KD   QK ++  +AA        +T   K +Q  +  + T + AK       DY
Sbjct  86    EKGKEYKDYTTQKAKETTDAAGEKINEYTETAEEKAKQTAEKANETKEAAKGKVGEYADY  145

Query  1052  TTQSAKQTKDTLS----SAGQTA---KDYTVQSAQQTKD-TLSSAGQTAKDYTVQSAQQT  1207
             T + AK+TKDT +     A Q A   KD   Q A++ KD T+  AG+   +Y  + A++ 
Sbjct  146   TAEKAKETKDTAAQKANEAAQKAKETKDSAAQKAKEAKDATMGKAGEYT-NYAAEKAKEA  204

Query  1208  KD-TLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYT  1384
             KD T++ AG+   +YT + A++AKDT     + AKD T+    +A E  + A + AK   
Sbjct  205   KDTTVNKAGEYT-NYTAEKAKEAKDTTLNKAKEAKDTTM---NKAGEYTNYAAEKAK---  257

Query  1385  VQAKDYASQKAGE----AGNKASEAKERGTEMSKNAASYAGQKVTEAKDVTV  1528
              QAKD    KAGE    A  KA EAK+   + +K       +K  E KD TV
Sbjct  258   -QAKDTTVNKAGEYTNYAAEKAKEAKDETVKTAKETKDCTAEKAKEGKDTTV  308



>ref|XP_010505211.1| PREDICTED: embryonic protein DC-8-like [Camelina sativa]
Length=448

 Score = 80.1 bits (196),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 79/256 (31%), Positives = 124/256 (48%), Gaps = 26/256 (10%)
 Frame = +2

Query  758   RDHSGLSLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKD  937
             RD +G + E++G+Y+     K+ +A           K+ T E  +  + Y  +KA  AK+
Sbjct  107   RDTAGYTAEKMGEYKDYTVDKAAEA-----------KDKTAEKAKETANYTADKAVEAKN  155

Query  938   TALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDY  1117
                 K  +     KD T+ K  +AKD  +   +   +YT   AK+ KD  +      KDY
Sbjct  156   MTANKMAEY----KDYTVDKAVEAKDKTAEKAKETANYTADKAKEAKDKTAEKIGEYKDY  211

Query  1118  TVQSAQQTKD-----TLSSAGQTA------KDYTVQSAQQTKDTLSSAGQTAKDYTVQSA  1264
             TV+ A + KD      + +  +TA      KDYTV+ A + KD   S     KD  V +A
Sbjct  212   TVEKAVEAKDYTAEKAIEAKDKTAEKTGEYKDYTVEKATEGKDVGVSKLAEFKDSAVDTA  271

Query  1265  QQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGNKASE  1444
             ++A   LSG  + AK+  V+T   AKE + KAG+A +    + +    +   EAG KA E
Sbjct  272   KRAMGFLSGKTEEAKETAVETKDIAKENMEKAGEATRQKMEEMRLEGKELKNEAGAKAHE  331

Query  1445  AKERGTEMSKNAASYA  1492
             A ++  E +++AA  A
Sbjct  332   ASQKTRESTESAAEIA  347


 Score = 68.2 bits (165),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 70/215 (33%), Positives = 100/215 (47%), Gaps = 32/215 (15%)
 Frame = +2

Query  938   TALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTA-------KDYTTQSAKQTKDTLSSA  1096
             +  +  Q  Y  A+D  + KT  A +      Q A       KD T + A+ T      A
Sbjct  57    SVFRAVQGTYEHARDAVVGKTNDAAEATKEGAQIASAKAAETKDATVEKARDT------A  110

Query  1097  GQTA------KDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQ  1258
             G TA      KDYTV  A + KD  +   +   +YT   A + K+  ++     KDYTV 
Sbjct  111   GYTAEKMGEYKDYTVDKAAEAKDKTAEKAKETANYTADKAVEAKNMTANKMAEYKDYTVD  170

Query  1259  SAQQAKDTLSGAGQTAKDYTVQTAQQAKE-TLSKAGQAAKDYT----VQAKDYASQKAGE  1423
              A +AKD  +   +   +YT   A++AK+ T  K G+  KDYT    V+AKDY ++    
Sbjct  171   KAVEAKDKTAEKAKETANYTADKAKEAKDKTAEKIGE-YKDYTVEKAVEAKDYTAE----  225

Query  1424  AGNKASEAKERGTEMSKNAASYAGQKVTEAKDVTV  1528
                KA EAK++  E +     Y  +K TE KDV V
Sbjct  226   ---KAIEAKDKTAEKTGEYKDYTVEKATEGKDVGV  257


 Score = 65.9 bits (159),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 62/197 (31%), Positives = 95/197 (48%), Gaps = 14/197 (7%)
 Frame = +2

Query  977   KDTTISKTQQAKDTFSSTGQTA---KDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKD  1147
             KD T+ K   A+DT   T +     KDYT   A + KD  +   +   +YT   A + K+
Sbjct  99    KDATVEK---ARDTAGYTAEKMGEYKDYTVDKAAEAKDKTAEKAKETANYTADKAVEAKN  155

Query  1148  TLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQT  1327
               ++     KDYTV  A + KD  +   +   +YT   A++AKD  +      KDYTV+ 
Sbjct  156   MTANKMAEYKDYTVDKAVEAKDKTAEKAKETANYTADKAKEAKDKTAEKIGEYKDYTVEK  215

Query  1328  AQQAKETLSKAGQAAKDYTVQA----KDYASQKAGEAGN----KASEAKERGTEMSKNAA  1483
             A +AK+  ++    AKD T +     KDY  +KA E  +    K +E K+   + +K A 
Sbjct  216   AVEAKDYTAEKAIEAKDKTAEKTGEYKDYTVEKATEGKDVGVSKLAEFKDSAVDTAKRAM  275

Query  1484  SYAGQKVTEAKDVTVES  1534
              +   K  EAK+  VE+
Sbjct  276   GFLSGKTEEAKETAVET  292



>ref|XP_006430349.1| hypothetical protein CICLE_v10013512mg [Citrus clementina]
 gb|ESR43589.1| hypothetical protein CICLE_v10013512mg [Citrus clementina]
Length=461

 Score = 80.1 bits (196),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 71/191 (37%), Positives = 103/191 (54%), Gaps = 8/191 (4%)
 Frame = +2

Query  911   VEKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKD-TL  1087
              EKA  AKD  L KT +     KD T  K ++ KD+     +  KDYT + A + KD TL
Sbjct  139   AEKAKEAKDKTLGKTGEY----KDYTAEKARETKDSALQKAKETKDYTAEKAAEAKDKTL  194

Query  1088  SSAGQTAKDYTVQSAQQTKDT-LSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSA  1264
               AG+  KDYT + A++TKD+ +  AG+  KDYT + A Q KDT  S     KD    +A
Sbjct  195   GKAGEY-KDYTAEKARETKDSGMQKAGEY-KDYTAEQAVQGKDTTVSKLGELKDSAADAA  252

Query  1265  QQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGNKASE  1444
             ++A D L+G  +  K  T +T + AKE LS+  +AA+    + K    +   EAG++A E
Sbjct  253   RKAMDFLTGKKEGVKQKTEETGEAAKEKLSETEEAARQKMEEMKLKGEEHKNEAGHRADE  312

Query  1445  AKERGTEMSKN  1477
             ++  G  +  N
Sbjct  313   SEHTGEYVRGN  323


 Score = 59.7 bits (143),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 64/197 (32%), Positives = 105/197 (53%), Gaps = 24/197 (12%)
 Frame = +2

Query  887   VQSGSQYLVEKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSA  1066
             +++  + +V K+  A +TA + T+ A   A++     T++A++     G+ AK+ T +SA
Sbjct  69    LENAKEAVVGKSHEAAETAREGTESAAEKAEEYKDYTTEKARERLDDYGEKAKE-TKESA  127

Query  1067  K----QTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQ  1234
             K    + KD  +   + AKD T+    + KD  +   +  KD  +Q A++T         
Sbjct  128   KGKVGEYKDDAAEKAKEAKDKTLGKTGEYKDYTAEKARETKDSALQKAKET---------  178

Query  1235  TAKDYTVQSAQQAKD-TLSGAGQTAKDYTVQTAQQAKET-LSKAGQAAKDYT----VQAK  1396
               KDYT + A +AKD TL  AG+  KDYT + A++ K++ + KAG+  KDYT    VQ K
Sbjct  179   --KDYTAEKAAEAKDKTLGKAGEY-KDYTAEKARETKDSGMQKAGE-YKDYTAEQAVQGK  234

Query  1397  DYASQKAGEAGNKASEA  1447
             D    K GE  + A++A
Sbjct  235   DTTVSKLGELKDSAADA  251



>ref|XP_010508556.1| PREDICTED: seed biotin-containing protein SBP65-like isoform 
X2 [Camelina sativa]
Length=608

 Score = 80.1 bits (196),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 69/196 (35%), Positives = 101/196 (52%), Gaps = 11/196 (6%)
 Frame = +2

Query  908   LVEKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTL  1087
             + EK   AK++  Q  Q+A +AA +    KTQ+A    +  G+       Q  ++ K+  
Sbjct  231   VAEKGRQAKESVGQGAQKAGSAASE----KTQRASSYVTEKGRETGQLAAQKGQEAKE--  284

Query  1088  SSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQ  1267
               AG+ AKDYT++ A + KDT +   + A +Y  +  ++T +T +     AKDYT+Q A 
Sbjct  285   -QAGR-AKDYTMEKAGEAKDTAAEKARRASEYATEKGRETGNTAAEQAARAKDYTLQKAV  342

Query  1268  QAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGNKASEA  1447
             +AKD  +   Q A +Y  +  + A    S+ GQ A   T +AKDY  QKA EA   A   
Sbjct  343   EAKDIAAEKAQKASEYVTEKGKVAGNVASQKGQEAASMTAKAKDYTVQKASEA---AGYV  399

Query  1448  KERGTEMSKNAASYAG  1495
             KE   E  K AA YAG
Sbjct  400   KEATVEGGKGAAHYAG  415


 Score = 70.5 bits (171),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 74/240 (31%), Positives = 107/240 (45%), Gaps = 30/240 (13%)
 Frame = +2

Query  857   EKAKNTTKENVQSGSQYLVEKAGAAKDTALQKTQQA---YNAAKDTTISKTQQAKDTFSS  1027
             +KA +   E  Q  S Y+ EK       A QK Q+A      AKD T+ K  +AKDT + 
Sbjct  247   QKAGSAASEKTQRASSYVTEKGRETGQLAAQKGQEAKEQAGRAKDYTMEKAGEAKDTAAE  306

Query  1028  TGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQT  1207
               + A +Y T+  ++T +T +     AKDYT+Q A + KD  +   Q A +Y  +  +  
Sbjct  307   KARRASEYATEKGRETGNTAAEQAARAKDYTLQKAVEAKDIAAEKAQKASEYVTEKGKVA  366

Query  1208  KDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQA----KETLSKAGQAAK  1375
              +  S  GQ A   T +               AKDYTVQ A +A    KE   + G+ A 
Sbjct  367   GNVASQKGQEAASMTAK---------------AKDYTVQKASEAAGYVKEATVEGGKGAA  411

Query  1376  DYTVQAKDYASQKAGEAGNKASEAKERGTEM----SKNAASYAGQKVTE----AKDVTVE  1531
              Y   A + A+     A +  +E   +GT+      + A  YAG K  E    A D+T E
Sbjct  412   HYAGVAAEKAATVGWTAAHFTTEKVVQGTKAVAGTVEGAVGYAGHKAVEVGSKAVDLTKE  471



>ref|XP_010426937.1| PREDICTED: embryonic protein DC-8-like [Camelina sativa]
Length=457

 Score = 79.0 bits (193),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 81/248 (33%), Positives = 125/248 (50%), Gaps = 15/248 (6%)
 Frame = +2

Query  758   RDHSGLSLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKD  937
             RD +G   E+ G+ R +  QK+ +      +K  +AK+ T +  +  + Y  EKA  AKD
Sbjct  95    RDATG---EKAGEVRDSTAQKTKETADYTADKAREAKDKTADKTKETADYTAEKAREAKD  151

Query  938   TALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKD-TLSSAGQTAKD  1114
                 +T++  N     T  K ++AKD  +      KDYT + AK+ KD T+ + G+  KD
Sbjct  152   KTADRTKETAN----YTAEKAREAKDKTADKIGEYKDYTAEKAKEAKDKTVETVGEY-KD  206

Query  1115  YTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDT-LSG  1291
             YTV  A + KD  +   +   DYT   A++ KDT +      KDYT + A + KD  +S 
Sbjct  207   YTVDKAIEAKDKTAEKAKETADYTADKAKEAKDTTAQKMGEYKDYTAEKATEGKDAGVSK  266

Query  1292  AGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGNKA----SEAKERG  1459
              G+  KD  V TA++A   LS   +  K   V+ KD A +K  E G +A     E +  G
Sbjct  267   IGEL-KDSAVDTAKRAMGFLSGKTEETKQKAVETKDTAKEKLDETGEEARRKMEEMRLEG  325

Query  1460  TEMSKNAA  1483
              E+ ++A+
Sbjct  326   KELEEDAS  333


 Score = 69.3 bits (168),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 77/217 (35%), Positives = 112/217 (52%), Gaps = 27/217 (12%)
 Frame = +2

Query  914   EKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKD-TFSSTGQTAKDYTTQSAKQTKDTLS  1090
             EKAG  +D+  QKT++      D T  K ++AKD T   T +TA DYT + A++ KD  +
Sbjct  100   EKAGEVRDSTAQKTKETA----DYTADKAREAKDKTADKTKETA-DYTAEKAREAKDKTA  154

Query  1091  SAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKD-TLSSAGQTAKDYTVQSAQ  1267
                +   +YT + A++ KD  +      KDYT + A++ KD T+ + G+  KDYTV  A 
Sbjct  155   DRTKETANYTAEKAREAKDKTADKIGEYKDYTAEKAKEAKDKTVETVGEY-KDYTVDKAI  213

Query  1268  QAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQA----KDYASQKAGE---A  1426
             +AKD  +   +   DYT   A +AKE        AKD T Q     KDY ++KA E   A
Sbjct  214   EAKDKTAEKAKETADYT---ADKAKE--------AKDTTAQKMGEYKDYTAEKATEGKDA  262

Query  1427  G-NKASEAKERGTEMSKNAASYAGQKVTEAKDVTVES  1534
             G +K  E K+   + +K A  +   K  E K   VE+
Sbjct  263   GVSKIGELKDSAVDTAKRAMGFLSGKTEETKQKAVET  299


 Score = 60.5 bits (145),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 51/162 (31%), Positives = 82/162 (51%), Gaps = 16/162 (10%)
 Frame = +2

Query  1043  KDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLS  1222
             +D T + A + +D+ +   +   DYT   A++ KD  +   +   DYT + A++ KD  +
Sbjct  95    RDATGEKAGEVRDSTAQKTKETADYTADKAREAKDKTADKTKETADYTAEKAREAKDKTA  154

Query  1223  SAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKE-TLSKAGQAAKDYTVQAKD  1399
                +   +YT + A++AKD  +      KDYT + A++AK+ T+   G+  KDYTV    
Sbjct  155   DRTKETANYTAEKAREAKDKTADKIGEYKDYTAEKAKEAKDKTVETVGE-YKDYTV----  209

Query  1400  YASQKAGEAGNKASEAKERGTEMSKNAASYAGQKVTEAKDVT  1525
                       +KA EAK++  E +K  A Y   K  EAKD T
Sbjct  210   ----------DKAIEAKDKTAEKAKETADYTADKAKEAKDTT  241



>dbj|BAA11017.1| LEA protein in group 3 [Arabidopsis thaliana]
Length=448

 Score = 78.2 bits (191),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 69/209 (33%), Positives = 102/209 (49%), Gaps = 20/209 (10%)
 Frame = +2

Query  938   TALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTA-------KDYTTQSAKQTKDTLSSA  1096
             +  +  Q  Y  A+D  + KT +A ++     Q A       KD T + AK+T D  +  
Sbjct  57    SVFRAVQGTYEHARDAVVGKTHEAAESTKEGAQIASEKAVGAKDATVEKAKETADYTAEK  116

Query  1097  GQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAK  1276
                 KDYTV  A++ KDT +   +   +YT   A + KD  +      KDY V  A +AK
Sbjct  117   VGEYKDYTVDKAKEAKDTTAEKAKETANYTADKAVEAKDKTAEKIGEYKDYAVDKAVEAK  176

Query  1277  DTLSGAGQTAKDYTVQTAQQAKE-TLSKAGQAAKDYT----VQAKDYASQKAGEAGNKAS  1441
             D  +   +   +YT   A++AK+ T  K G+  KDYT    V+A+DY ++       KA 
Sbjct  177   DKTAEKAKETSNYTADKAKEAKDKTAEKVGE-YKDYTVDKAVEARDYTAE-------KAI  228

Query  1442  EAKERGTEMSKNAASYAGQKVTEAKDVTV  1528
             EAK++  E +     Y  +K TE KDVTV
Sbjct  229   EAKDKTAEKTGEYKDYTVEKATEGKDVTV  257


 Score = 74.7 bits (182),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 78/236 (33%), Positives = 119/236 (50%), Gaps = 21/236 (9%)
 Frame = +2

Query  848   NKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSS  1027
             +K ++AK+TT E  +  + Y  +KA  AKD    KT +     KD  + K  +AKD  + 
Sbjct  126   DKAKEAKDTTAEKAKETANYTADKAVEAKD----KTAEKIGEYKDYAVDKAVEAKDKTAE  181

Query  1028  TGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKD-----TLSSAGQTA------  1174
               +   +YT   AK+ KD  +      KDYTV  A + +D      + +  +TA      
Sbjct  182   KAKETSNYTADKAKEAKDKTAEKVGEYKDYTVDKAVEARDYTAEKAIEAKDKTAEKTGEY  241

Query  1175  KDYTVQSAQQTKD-TLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETL  1351
             KDYTV+ A + KD T+S  G+  KD  V++A++A   LSG  + AK   V+T   AKE +
Sbjct  242   KDYTVEKATEGKDVTVSKLGEL-KDSAVETAKRAMGFLSGKTEEAKGKAVETKDTAKENM  300

Query  1352  SKAGQAAKDYTVQAKDYASQKAGEAGNKASEAKERGTEMSKNAASYAGQKVTEAKD  1519
              KAG+  +    + +    +   EAG KA EA ++  E +++ A    QK  E KD
Sbjct  301   EKAGEVTRQKMEEMRLEGKELKEEAGAKAQEASQKTRESTESGA----QKAEETKD  352


 Score = 74.3 bits (181),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 78/242 (32%), Positives = 115/242 (48%), Gaps = 13/242 (5%)
 Frame = +2

Query  803   QTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKTQQAYN----  970
             Q A +K++ A      K ++  + T E V     Y V+KA  AKDT  +K ++  N    
Sbjct  89    QIASEKAVGAKDATVEKAKETADYTAEKVGEYKDYTVDKAKEAKDTTAEKAKETANYTAD  148

Query  971   ---AAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQT  1141
                 AKD T  K  + KD        AKD T + AK+T +  +   + AKD T +   + 
Sbjct  149   KAVEAKDKTAEKIGEYKDYAVDKAVEAKDKTAEKAKETSNYTADKAKEAKDKTAEKVGEY  208

Query  1142  KDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKD-TLSGAGQTAKDYT  1318
             KD        A+DYT + A + KD  +      KDYTV+ A + KD T+S  G+  KD  
Sbjct  209   KDYTVDKAVEARDYTAEKAIEAKDKTAEKTGEYKDYTVEKATEGKDVTVSKLGEL-KDSA  267

Query  1319  VQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGN----KASEAKERGTEMSKNAAS  1486
             V+TA++A   LS   + AK   V+ KD A +   +AG     K  E +  G E+ + A +
Sbjct  268   VETAKRAMGFLSGKTEEAKGKAVETKDTAKENMEKAGEVTRQKMEEMRLEGKELKEEAGA  327

Query  1487  YA  1492
              A
Sbjct  328   KA  329


 Score = 70.5 bits (171),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 79/258 (31%), Positives = 119/258 (46%), Gaps = 31/258 (12%)
 Frame = +2

Query  833   LQTAQNKYEKAKNTT-------KENVQSGSQYLVEKAGAAKDTALQKTQQA--YNAA---  976
              +  Q  YE A++          E+ + G+Q   EKA  AKD  ++K ++   Y A    
Sbjct  59    FRAVQGTYEHARDAVVGKTHEAAESTKEGAQIASEKAVGAKDATVEKAKETADYTAEKVG  118

Query  977   --KDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDT  1150
               KD T+ K ++AKDT +   +   +YT   A + KD  +      KDY V  A + KD 
Sbjct  119   EYKDYTVDKAKEAKDTTAEKAKETANYTADKAVEAKDKTAEKIGEYKDYAVDKAVEAKDK  178

Query  1151  LSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKD-----TLSGAGQTA---  1306
              +   +   +YT   A++ KD  +      KDYTV  A +A+D      +    +TA   
Sbjct  179   TAEKAKETSNYTADKAKEAKDKTAEKVGEYKDYTVDKAVEARDYTAEKAIEAKDKTAEKT  238

Query  1307  ---KDYTVQTAQQAKE-TLSKAGQAAKDYTVQ----AKDYASQKAGEAGNKASEAKERGT  1462
                KDYTV+ A + K+ T+SK G+  KD  V+    A  + S K  EA  KA E K+   
Sbjct  239   GEYKDYTVEKATEGKDVTVSKLGE-LKDSAVETAKRAMGFLSGKTEEAKGKAVETKDTAK  297

Query  1463  EMSKNAASYAGQKVTEAK  1516
             E  + A     QK+ E +
Sbjct  298   ENMEKAGEVTRQKMEEMR  315



>ref|NP_181202.1| putative phosphotyrosine [Arabidopsis thaliana]
 gb|AAD20140.1| late embryogenesis abundant protein (AtECP63) [Arabidopsis thaliana]
 gb|AEC09277.1| putative phosphotyrosine [Arabidopsis thaliana]
Length=448

 Score = 77.8 bits (190),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 69/209 (33%), Positives = 102/209 (49%), Gaps = 20/209 (10%)
 Frame = +2

Query  938   TALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTA-------KDYTTQSAKQTKDTLSSA  1096
             +  +  Q  Y  A+D  + KT +A ++     Q A       KD T + AK+T D  +  
Sbjct  57    SVFRAVQGTYEHARDAVVGKTHEAAESTKEGAQIASEKAVGAKDATVEKAKETADYTAEK  116

Query  1097  GQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAK  1276
                 KDYTV  A++ KDT +   +   +YT   A + KD  +      KDY V  A +AK
Sbjct  117   VGEYKDYTVDKAKEAKDTTAEKAKETANYTADKAVEAKDKTAEKIGEYKDYAVDKAVEAK  176

Query  1277  DTLSGAGQTAKDYTVQTAQQAKE-TLSKAGQAAKDYT----VQAKDYASQKAGEAGNKAS  1441
             D  +   +   +YT   A++AK+ T  K G+  KDYT    V+A+DY ++       KA 
Sbjct  177   DKTAEKAKETANYTADKAKEAKDKTAEKVGE-YKDYTVDKAVEARDYTAE-------KAI  228

Query  1442  EAKERGTEMSKNAASYAGQKVTEAKDVTV  1528
             EAK++  E +     Y  +K TE KDVTV
Sbjct  229   EAKDKTAEKTGEYKDYTVEKATEGKDVTV  257


 Score = 74.7 bits (182),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 78/236 (33%), Positives = 119/236 (50%), Gaps = 21/236 (9%)
 Frame = +2

Query  848   NKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSS  1027
             +K ++AK+TT E  +  + Y  +KA  AKD    KT +     KD  + K  +AKD  + 
Sbjct  126   DKAKEAKDTTAEKAKETANYTADKAVEAKD----KTAEKIGEYKDYAVDKAVEAKDKTAE  181

Query  1028  TGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKD-----TLSSAGQTA------  1174
               +   +YT   AK+ KD  +      KDYTV  A + +D      + +  +TA      
Sbjct  182   KAKETANYTADKAKEAKDKTAEKVGEYKDYTVDKAVEARDYTAEKAIEAKDKTAEKTGEY  241

Query  1175  KDYTVQSAQQTKD-TLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETL  1351
             KDYTV+ A + KD T+S  G+  KD  V++A++A   LSG  + AK   V+T   AKE +
Sbjct  242   KDYTVEKATEGKDVTVSKLGEL-KDSAVETAKRAMGFLSGKTEEAKGKAVETKDTAKENM  300

Query  1352  SKAGQAAKDYTVQAKDYASQKAGEAGNKASEAKERGTEMSKNAASYAGQKVTEAKD  1519
              KAG+  +    + +    +   EAG KA EA ++  E +++ A    QK  E KD
Sbjct  301   EKAGEVTRQKMEEMRLEGKELKEEAGAKAQEASQKTRESTESGA----QKAEETKD  352


 Score = 73.9 bits (180),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 78/242 (32%), Positives = 115/242 (48%), Gaps = 13/242 (5%)
 Frame = +2

Query  803   QTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKTQQAYN----  970
             Q A +K++ A      K ++  + T E V     Y V+KA  AKDT  +K ++  N    
Sbjct  89    QIASEKAVGAKDATVEKAKETADYTAEKVGEYKDYTVDKAKEAKDTTAEKAKETANYTAD  148

Query  971   ---AAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQT  1141
                 AKD T  K  + KD        AKD T + AK+T +  +   + AKD T +   + 
Sbjct  149   KAVEAKDKTAEKIGEYKDYAVDKAVEAKDKTAEKAKETANYTADKAKEAKDKTAEKVGEY  208

Query  1142  KDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKD-TLSGAGQTAKDYT  1318
             KD        A+DYT + A + KD  +      KDYTV+ A + KD T+S  G+  KD  
Sbjct  209   KDYTVDKAVEARDYTAEKAIEAKDKTAEKTGEYKDYTVEKATEGKDVTVSKLGEL-KDSA  267

Query  1319  VQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGN----KASEAKERGTEMSKNAAS  1486
             V+TA++A   LS   + AK   V+ KD A +   +AG     K  E +  G E+ + A +
Sbjct  268   VETAKRAMGFLSGKTEEAKGKAVETKDTAKENMEKAGEVTRQKMEEMRLEGKELKEEAGA  327

Query  1487  YA  1492
              A
Sbjct  328   KA  329


 Score = 70.1 bits (170),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 79/258 (31%), Positives = 119/258 (46%), Gaps = 31/258 (12%)
 Frame = +2

Query  833   LQTAQNKYEKAKNTT-------KENVQSGSQYLVEKAGAAKDTALQKTQQA--YNAA---  976
              +  Q  YE A++          E+ + G+Q   EKA  AKD  ++K ++   Y A    
Sbjct  59    FRAVQGTYEHARDAVVGKTHEAAESTKEGAQIASEKAVGAKDATVEKAKETADYTAEKVG  118

Query  977   --KDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDT  1150
               KD T+ K ++AKDT +   +   +YT   A + KD  +      KDY V  A + KD 
Sbjct  119   EYKDYTVDKAKEAKDTTAEKAKETANYTADKAVEAKDKTAEKIGEYKDYAVDKAVEAKDK  178

Query  1151  LSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKD-----TLSGAGQTA---  1306
              +   +   +YT   A++ KD  +      KDYTV  A +A+D      +    +TA   
Sbjct  179   TAEKAKETANYTADKAKEAKDKTAEKVGEYKDYTVDKAVEARDYTAEKAIEAKDKTAEKT  238

Query  1307  ---KDYTVQTAQQAKE-TLSKAGQAAKDYTVQ----AKDYASQKAGEAGNKASEAKERGT  1462
                KDYTV+ A + K+ T+SK G+  KD  V+    A  + S K  EA  KA E K+   
Sbjct  239   GEYKDYTVEKATEGKDVTVSKLGE-LKDSAVETAKRAMGFLSGKTEEAKGKAVETKDTAK  297

Query  1463  EMSKNAASYAGQKVTEAK  1516
             E  + A     QK+ E +
Sbjct  298   ENMEKAGEVTRQKMEEMR  315



>gb|KHN03228.1| Late embryogenesis abundant protein D-29 [Glycine soja]
Length=447

 Score = 77.8 bits (190),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 93/271 (34%), Positives = 126/271 (46%), Gaps = 39/271 (14%)
 Frame = +2

Query  758   RDHSGLSLEEIGKYR----QTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQ----YLV  913
             +D++G + ++   Y     QT++  + DA Q ++     A   TKE V   +Q    Y  
Sbjct  103   KDYAGDTAQKTKDYAGDTAQTSKDYAGDAAQKSKGYVGDAAQKTKEYVGDAAQKTMDYAT  162

Query  914   EKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYT---TQSAKQTKDT  1084
             + A   KD A QKT       KD     T  AK T     Q  KDY    T +AK+TKD 
Sbjct  163   DAAQKTKDYATQKT-------KDYASDATDAAKKTKDYAAQKTKDYASDATDAAKKTKDY  215

Query  1085  LSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSA  1264
                A Q  KDY    AQ+TKD  S A Q  KDY   +AQ+TKD  S   Q +K+Y    A
Sbjct  216   ---AAQKTKDYASGGAQKTKDYASGAAQKTKDYASDAAQRTKDHASDGAQKSKEYAGDVA  272

Query  1265  QQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDY-------TVQAKDYASQKA--  1417
             Q AKD      Q +KDY     Q  K+  + A   +KDY       + +A DYAS+ A  
Sbjct  273   QNAKDY----AQKSKDYAGDAVQNIKDYANDAAHKSKDYAGDASHKSKEASDYASETAQK  328

Query  1418  -----GEAGNKASEAKERGTEMSKNAASYAG  1495
                  G+A  K+ EA E  ++ ++    YAG
Sbjct  329   TKDYVGDAAQKSKEASEYASDAAQRTKEYAG  359


 Score = 71.6 bits (174),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 70/197 (36%), Positives = 102/197 (52%), Gaps = 14/197 (7%)
 Frame = +2

Query  932   KDTALQKTQQ----AYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAG  1099
             KD A QKT+     A +AAK T     Q+ KD  S   Q  KDY + +A++TKD  S A 
Sbjct  191   KDYAAQKTKDYASDATDAAKKTKDYAAQKTKDYASGGAQKTKDYASGAAQKTKDYASDAA  250

Query  1100  QTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKD  1279
             Q  KD+    AQ++K+      Q AKDY    AQ++KD    A Q  KDY   +A ++KD
Sbjct  251   QRTKDHASDGAQKSKEYAGDVAQNAKDY----AQKSKDYAGDAVQNIKDYANDAAHKSKD  306

Query  1280  TLSGAGQTAK---DYTVQTAQQAKETLSKAGQAAKDYTVQAKDYA---SQKAGEAGNKAS  1441
                 A   +K   DY  +TAQ+ K+ +  A Q +K+ +  A D A    + AG+A  ++ 
Sbjct  307   YAGDASHKSKEASDYASETAQKTKDYVGDAAQKSKEASEYASDAAQRTKEYAGDATKRSK  366

Query  1442  EAKERGTEMSKNAASYA  1492
             EA +   +M++    YA
Sbjct  367   EASDHANDMARKTKDYA  383


 Score = 65.9 bits (159),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 72/206 (35%), Positives = 99/206 (48%), Gaps = 14/206 (7%)
 Frame = +2

Query  941   ALQKTQQAY-NAAKDTTISKTQQAKDTFSSTGQTAKDYT---TQSAKQTKDTLSSAGQTA  1108
             A QKT++   +AA+ T    T  A+ T     Q  KDY    T +AK+TKD    A Q  
Sbjct  142   AAQKTKEYVGDAAQKTMDYATDAAQKTKDYATQKTKDYASDATDAAKKTKDY---AAQKT  198

Query  1109  KDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLS  1288
             KDY   +    K T   A Q  KDY    AQ+TKD  S A Q  KDY   +AQ+ KD  S
Sbjct  199   KDYASDATDAAKKTKDYAAQKTKDYASGGAQKTKDYASGAAQKTKDYASDAAQRTKDHAS  258

Query  1289  GAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQK-------AGEAGNKASEA  1447
                Q +K+Y    AQ AK+   K+   A D     KDYA+         AG+A +K+ EA
Sbjct  259   DGAQKSKEYAGDVAQNAKDYAQKSKDYAGDAVQNIKDYANDAAHKSKDYAGDASHKSKEA  318

Query  1448  KERGTEMSKNAASYAGQKVTEAKDVT  1525
              +  +E ++    Y G    ++K+ +
Sbjct  319   SDYASETAQKTKDYVGDAAQKSKEAS  344


 Score = 65.1 bits (157),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 67/197 (34%), Positives = 93/197 (47%), Gaps = 16/197 (8%)
 Frame = +2

Query  992   SKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQT  1171
             S T++  D      Q +KDY   +A++TKD      QT+KDY   +AQ++K  +  A Q 
Sbjct  86    STTKKVSDYAGDAAQKSKDYAGDTAQKTKDYAGDTAQTSKDYAGDAAQKSKGYVGDAAQK  145

Query  1172  AKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQ--------AKDTLSGAGQTAKDYTVQT  1327
              K+Y   +AQ+T D  + A Q  KDY  Q  +         AK T   A Q  KDY    
Sbjct  146   TKEYVGDAAQKTMDYATDAAQKTKDYATQKTKDYASDATDAAKKTKDYAAQKTKDYASDA  205

Query  1328  AQQAKETLSKAGQAAKDYTV----QAKDYASQKAGEAGNKASEAKERGTEMSKNAA----  1483
                AK+T   A Q  KDY      + KDYAS  A +  + AS+A +R  + + + A    
Sbjct  206   TDAAKKTKDYAAQKTKDYASGGAQKTKDYASGAAQKTKDYASDAAQRTKDHASDGAQKSK  265

Query  1484  SYAGQKVTEAKDVTVES  1534
              YAG     AKD   +S
Sbjct  266   EYAGDVAQNAKDYAQKS  282


 Score = 63.5 bits (153),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 64/197 (32%), Positives = 93/197 (47%), Gaps = 23/197 (12%)
 Frame = +2

Query  1001  QQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKD  1180
             Q+ KD    T QT+KDY   +A+++K  +  A Q  K+Y   +AQ+T D  + A Q  KD
Sbjct  111   QKTKDYAGDTAQTSKDYAGDAAQKSKGYVGDAAQKTKEYVGDAAQKTMDYATDAAQKTKD  170

Query  1181  YTVQ-------------------SAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQT  1303
             Y  Q                   +AQ+TKD  S A   AK     +AQ+ KD  SG  Q 
Sbjct  171   YATQKTKDYASDATDAAKKTKDYAAQKTKDYASDATDAAKKTKDYAAQKTKDYASGGAQK  230

Query  1304  AKDYTVQTAQQAKETLSKAGQAAKDYTV----QAKDYASQKAGEAGNKASEAKERGTEMS  1471
              KDY    AQ+ K+  S A Q  KD+      ++K+YA   A  A + A ++K+   +  
Sbjct  231   TKDYASGAAQKTKDYASDAAQRTKDHASDGAQKSKEYAGDVAQNAKDYAQKSKDYAGDAV  290

Query  1472  KNAASYAGQKVTEAKDV  1522
             +N   YA     ++KD 
Sbjct  291   QNIKDYANDAAHKSKDY  307



>ref|NP_001238201.1| Lea protein precursor [Glycine max]
 emb|CAA80491.1| Lea protein [Glycine max]
Length=458

 Score = 77.8 bits (190),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 93/271 (34%), Positives = 126/271 (46%), Gaps = 39/271 (14%)
 Frame = +2

Query  758   RDHSGLSLEEIGKYR----QTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQ----YLV  913
             +D++G + ++   Y     QT++  + DA Q ++     A   TKE V   +Q    Y  
Sbjct  114   KDYAGDTAQKTKDYAGDTAQTSKDYAGDAAQKSKGYVGDAAQKTKEYVGDAAQKTMDYAT  173

Query  914   EKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYT---TQSAKQTKDT  1084
             + A   KD A QKT       KD     T  AK T     Q  KDY    T +AK+TKD 
Sbjct  174   DAAQKTKDYATQKT-------KDYASDATDAAKKTKDYAAQKTKDYASDATDAAKKTKDY  226

Query  1085  LSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSA  1264
                A Q  KDY    AQ+TKD  S A Q  KDY   +AQ+TKD  S   Q +K+Y    A
Sbjct  227   ---AAQKTKDYASGGAQKTKDYASGAAQKTKDYASDAAQRTKDHASDGAQKSKEYAGDVA  283

Query  1265  QQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDY-------TVQAKDYASQKA--  1417
             Q AKD      Q +KDY     Q  K+  + A   +KDY       + +A DYAS+ A  
Sbjct  284   QNAKDY----AQKSKDYAGDAVQNIKDYANDAAHKSKDYAGDASHKSKEASDYASETAQK  339

Query  1418  -----GEAGNKASEAKERGTEMSKNAASYAG  1495
                  G+A  K+ EA E  ++ ++    YAG
Sbjct  340   TKDYVGDAAQKSKEASEYASDAAQRTKEYAG  370


 Score = 72.0 bits (175),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 70/197 (36%), Positives = 102/197 (52%), Gaps = 14/197 (7%)
 Frame = +2

Query  932   KDTALQKTQQ----AYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAG  1099
             KD A QKT+     A +AAK T     Q+ KD  S   Q  KDY + +A++TKD  S A 
Sbjct  202   KDYAAQKTKDYASDATDAAKKTKDYAAQKTKDYASGGAQKTKDYASGAAQKTKDYASDAA  261

Query  1100  QTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKD  1279
             Q  KD+    AQ++K+      Q AKDY    AQ++KD    A Q  KDY   +A ++KD
Sbjct  262   QRTKDHASDGAQKSKEYAGDVAQNAKDY----AQKSKDYAGDAVQNIKDYANDAAHKSKD  317

Query  1280  TLSGAGQTAK---DYTVQTAQQAKETLSKAGQAAKDYTVQAKDYA---SQKAGEAGNKAS  1441
                 A   +K   DY  +TAQ+ K+ +  A Q +K+ +  A D A    + AG+A  ++ 
Sbjct  318   YAGDASHKSKEASDYASETAQKTKDYVGDAAQKSKEASEYASDAAQRTKEYAGDATKRSK  377

Query  1442  EAKERGTEMSKNAASYA  1492
             EA +   +M++    YA
Sbjct  378   EASDHANDMARKTKDYA  394


 Score = 68.6 bits (166),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 80/249 (32%), Positives = 109/249 (44%), Gaps = 41/249 (16%)
 Frame = +2

Query  899   SQYLVEKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTK  1078
             S Y  + A  +KD A    Q+  + A DT     Q+ KD    T QT+KDY   +A+++K
Sbjct  92    SDYAGDAAQKSKDYAGDTAQKTKDYAGDTA----QKTKDYAGDTAQTSKDYAGDAAQKSK  147

Query  1079  DTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQ-------------------SAQ  1201
               +  A Q  K+Y   +AQ+T D  + A Q  KDY  Q                   +AQ
Sbjct  148   GYVGDAAQKTKEYVGDAAQKTMDYATDAAQKTKDYATQKTKDYASDATDAAKKTKDYAAQ  207

Query  1202  QTKDTLSSA-----------GQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKET  1348
             +TKD  S A            Q  KDY    AQ+ KD  SGA Q  KDY    AQ+ K+ 
Sbjct  208   KTKDYASDATDAAKKTKDYAAQKTKDYASGGAQKTKDYASGAAQKTKDYASDAAQRTKDH  267

Query  1349  LSKAGQAAKDY----TVQAKDYASQKAGEAGNKASEAKERGTEMSKNAASYAG---QKVT  1507
              S   Q +K+Y       AKDYA +    AG+     K+   + +  +  YAG    K  
Sbjct  268   ASDGAQKSKEYAGDVAQNAKDYAQKSKDYAGDAVQNIKDYANDAAHKSKDYAGDASHKSK  327

Query  1508  EAKDVTVES  1534
             EA D   E+
Sbjct  328   EASDYASET  336


 Score = 65.5 bits (158),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 72/206 (35%), Positives = 99/206 (48%), Gaps = 14/206 (7%)
 Frame = +2

Query  941   ALQKTQQAY-NAAKDTTISKTQQAKDTFSSTGQTAKDYT---TQSAKQTKDTLSSAGQTA  1108
             A QKT++   +AA+ T    T  A+ T     Q  KDY    T +AK+TKD    A Q  
Sbjct  153   AAQKTKEYVGDAAQKTMDYATDAAQKTKDYATQKTKDYASDATDAAKKTKDY---AAQKT  209

Query  1109  KDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLS  1288
             KDY   +    K T   A Q  KDY    AQ+TKD  S A Q  KDY   +AQ+ KD  S
Sbjct  210   KDYASDATDAAKKTKDYAAQKTKDYASGGAQKTKDYASGAAQKTKDYASDAAQRTKDHAS  269

Query  1289  GAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQK-------AGEAGNKASEA  1447
                Q +K+Y    AQ AK+   K+   A D     KDYA+         AG+A +K+ EA
Sbjct  270   DGAQKSKEYAGDVAQNAKDYAQKSKDYAGDAVQNIKDYANDAAHKSKDYAGDASHKSKEA  329

Query  1448  KERGTEMSKNAASYAGQKVTEAKDVT  1525
              +  +E ++    Y G    ++K+ +
Sbjct  330   SDYASETAQKTKDYVGDAAQKSKEAS  355


 Score = 61.6 bits (148),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 55/161 (34%), Positives = 81/161 (50%), Gaps = 5/161 (3%)
 Frame = +2

Query  1025  STGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQ  1204
             ST +   DY   +A+++KD      Q  KDY   +AQ+TKD      QT+KDY   +AQ+
Sbjct  86    STTKKVSDYAGDAAQKSKDYAGDTAQKTKDYAGDTAQKTKDYAGDTAQTSKDYAGDAAQK  145

Query  1205  TKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYT  1384
             +K  +  A Q  K+Y   +AQ+  D  + A Q  KDY  Q  +      + A +  KDY 
Sbjct  146   SKGYVGDAAQKTKEYVGDAAQKTMDYATDAAQKTKDYATQKTKDYASDATDAAKKTKDYA  205

Query  1385  VQ-AKDYASQKAGEAGNKASEAKERGTEMSKNAASYAGQKV  1504
              Q  KDYAS    +A + A + K+   + +K+ AS   QK 
Sbjct  206   AQKTKDYAS----DATDAAKKTKDYAAQKTKDYASGGAQKT  242



>ref|XP_006593487.1| PREDICTED: 51 kDa seed maturation protein isoform X1 [Glycine 
max]
Length=437

 Score = 77.8 bits (190),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 91/172 (53%), Gaps = 5/172 (3%)
 Frame = +2

Query  992   SKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQT  1171
             S T +  D  + T Q +KDY T +A+++KD    A Q +KDY   +AQ+TKD  S   QT
Sbjct  89    STTNKVSDYATDTAQKSKDYATDTAQKSKDYAGDAAQKSKDYAGDAAQKTKDYASDTAQT  148

Query  1172  AKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETL  1351
             +KDY   +AQ++K  +  A Q  K+Y   +AQ+ KD  + A Q  KDY  Q  +      
Sbjct  149   SKDYAGDAAQKSKGYVGDAAQKTKEYVGDAAQKTKDYATDAAQKTKDYATQKTKDYASDA  208

Query  1352  SKAGQAAKDYTVQ-AKDYASQKAGEAGNKASEAKERGTEMSKNAASYAGQKV  1504
             + A +  KDY  Q  KDYAS    EA + A   K+   + +K+ AS   QK 
Sbjct  209   TDAAKKTKDYAAQKTKDYAS----EASDVAQNTKDYAAQKTKDYASGGAQKT  256


 Score = 71.6 bits (174),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 73/223 (33%), Positives = 100/223 (45%), Gaps = 37/223 (17%)
 Frame = +2

Query  977   KDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLS  1156
             KD      Q+ KD  S T QT+KDY   +A+++K  +  A Q  K+Y   +AQ+TKD  +
Sbjct  128   KDYAGDAAQKTKDYASDTAQTSKDYAGDAAQKSKGYVGDAAQKTKEYVGDAAQKTKDYAT  187

Query  1157  SAGQTAKDYTVQ-------------------SAQQTKDTLSSAGQTA-----------KD  1246
              A Q  KDY  Q                   +AQ+TKD  S A   A           KD
Sbjct  188   DAAQKTKDYATQKTKDYASDATDAAKKTKDYAAQKTKDYASEASDVAQNTKDYAAQKTKD  247

Query  1247  YTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDY----TVQAKDYASQK  1414
             Y    AQ+ KD  SG  Q  KDY    AQ+ K+  S   Q +K+Y     + AKDYA + 
Sbjct  248   YASGGAQKTKDYASGGAQKTKDYASDAAQKTKDYASDGAQKSKEYAGDVALNAKDYAQKS  307

Query  1415  AGEAGNKASEAKERGTEMSKNAASYAG---QKVTEAKDVTVES  1534
                AG+ A   K+  ++  +    Y+G    K  EA D   E+
Sbjct  308   KDYAGDAAQNVKDYASDAVQKRKEYSGDASHKSKEASDYASET  350


 Score = 65.5 bits (158),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 63/183 (34%), Positives = 87/183 (48%), Gaps = 21/183 (11%)
 Frame = +2

Query  1001  QQAKDTFSSTGQTAKDYTTQ-----------SAKQTKDTLSSAGQTAKDYTVQSAQQTKD  1147
             Q+ KD  +   Q  KDY TQ           +AK+TKD    A Q  KDY  +++   ++
Sbjct  180   QKTKDYATDAAQKTKDYATQKTKDYASDATDAAKKTKDY---AAQKTKDYASEASDVAQN  236

Query  1148  TLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQT  1327
             T   A Q  KDY    AQ+TKD  S   Q  KDY   +AQ+ KD  S   Q +K+Y    
Sbjct  237   TKDYAAQKTKDYASGGAQKTKDYASGGAQKTKDYASDAAQKTKDYASDGAQKSKEYAGDV  296

Query  1328  AQQAKETLSKAGQAAKDYTVQAKDYAS-------QKAGEAGNKASEAKERGTEMSKNAAS  1486
             A  AK+   K+   A D     KDYAS       + +G+A +K+ EA +  +E +K    
Sbjct  297   ALNAKDYAQKSKDYAGDAAQNVKDYASDAVQKRKEYSGDASHKSKEASDYASETAKKTKD  356

Query  1487  YAG  1495
             Y G
Sbjct  357   YVG  359


 Score = 63.5 bits (153),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 90/266 (34%), Positives = 129/266 (48%), Gaps = 32/266 (12%)
 Frame = +2

Query  758   RDHSGLSLEEIGKYR----QTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQ----YLV  913
             +D++G + ++   Y     QT++  + DA Q ++     A   TKE V   +Q    Y  
Sbjct  128   KDYAGDAAQKTKDYASDTAQTSKDYAGDAAQKSKGYVGDAAQKTKEYVGDAAQKTKDYAT  187

Query  914   EKAGAAKDTALQKTQQ----AYNAAKDTTISKTQQAKDTFS---STGQTAKDYTTQSAKQ  1072
             + A   KD A QKT+     A +AAK T     Q+ KD  S      Q  KDY   +A++
Sbjct  188   DAAQKTKDYATQKTKDYASDATDAAKKTKDYAAQKTKDYASEASDVAQNTKDY---AAQK  244

Query  1073  TKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTK----DTLSSA---G  1231
             TKD  S   Q  KDY    AQ+TKD  S A Q  KDY    AQ++K    D   +A    
Sbjct  245   TKDYASGGAQKTKDYASGGAQKTKDYASDAAQKTKDYASDGAQKSKEYAGDVALNAKDYA  304

Query  1232  QTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDY---  1402
             Q +KDY   +AQ  KD  S A Q  K+Y+   + ++KE    A + AK    + KDY   
Sbjct  305   QKSKDYAGDAAQNVKDYASDAVQKRKEYSGDASHKSKEASDYASETAK----KTKDYVGD  360

Query  1403  ASQKAGEAGNKASEAKERGTEMSKNA  1480
             A+Q++  A   AS+A +R  E + +A
Sbjct  361   AAQRSKGAAEYASDAAQRTKEYAGDA  386



>ref|NP_001238138.1| 51 kDa seed maturation protein precursor [Glycine max]
 gb|AAA91965.1| 51 kDa seed maturation protein [Glycine max]
 gb|KHN45001.1| Late embryogenesis abundant protein D-29 [Glycine soja]
Length=473

 Score = 77.8 bits (190),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 91/172 (53%), Gaps = 5/172 (3%)
 Frame = +2

Query  992   SKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQT  1171
             S T +  D  + T Q +KDY T +A+++KD    A Q +KDY   +AQ+TKD  S   QT
Sbjct  89    STTNKVSDYATDTAQKSKDYATDTAQKSKDYAGDAAQKSKDYAGDAAQKTKDYASDTAQT  148

Query  1172  AKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETL  1351
             +KDY   +AQ++K  +  A Q  K+Y   +AQ+ KD  + A Q  KDY  Q  +      
Sbjct  149   SKDYAGDAAQKSKGYVGDAAQKTKEYVGDAAQKTKDYATDAAQKTKDYATQKTKDYASDA  208

Query  1352  SKAGQAAKDYTVQ-AKDYASQKAGEAGNKASEAKERGTEMSKNAASYAGQKV  1504
             + A +  KDY  Q  KDYAS    EA + A   K+   + +K+ AS   QK 
Sbjct  209   TDAAKKTKDYAAQKTKDYAS----EASDVAQNTKDYAAQKTKDYASGGAQKT  256


 Score = 72.4 bits (176),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 74/223 (33%), Positives = 101/223 (45%), Gaps = 37/223 (17%)
 Frame = +2

Query  977   KDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLS  1156
             KD      Q+ KD  S T QT+KDY   +A+++K  +  A Q  K+Y   +AQ+TKD  +
Sbjct  128   KDYAGDAAQKTKDYASDTAQTSKDYAGDAAQKSKGYVGDAAQKTKEYVGDAAQKTKDYAT  187

Query  1157  SAGQTAKDYTVQ-------------------SAQQTKDTLSSA---GQTAKDYTVQS---  1261
              A Q  KDY  Q                   +AQ+TKD  S A    Q  KDY  Q    
Sbjct  188   DAAQKTKDYATQKTKDYASDATDAAKKTKDYAAQKTKDYASEASDVAQNTKDYAAQKTKD  247

Query  1262  -----AQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDY----TVQAKDYASQK  1414
                  AQ+ KD  SG  Q  KDY    AQ+ K+  S   Q +K+Y     + AKDYA + 
Sbjct  248   YASGGAQKTKDYASGGAQKTKDYASDAAQKTKDYASDGAQKSKEYAGDVALNAKDYAQKS  307

Query  1415  AGEAGNKASEAKERGTEMSKNAASYAG---QKVTEAKDVTVES  1534
                AG+ A   K+  ++  +    Y+G    K  EA D   E+
Sbjct  308   KDYAGDAAQNVKDYASDAVQKRKEYSGDASHKSKEASDYASET  350


 Score = 65.9 bits (159),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 63/183 (34%), Positives = 87/183 (48%), Gaps = 21/183 (11%)
 Frame = +2

Query  1001  QQAKDTFSSTGQTAKDYTTQ-----------SAKQTKDTLSSAGQTAKDYTVQSAQQTKD  1147
             Q+ KD  +   Q  KDY TQ           +AK+TKD    A Q  KDY  +++   ++
Sbjct  180   QKTKDYATDAAQKTKDYATQKTKDYASDATDAAKKTKDY---AAQKTKDYASEASDVAQN  236

Query  1148  TLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQT  1327
             T   A Q  KDY    AQ+TKD  S   Q  KDY   +AQ+ KD  S   Q +K+Y    
Sbjct  237   TKDYAAQKTKDYASGGAQKTKDYASGGAQKTKDYASDAAQKTKDYASDGAQKSKEYAGDV  296

Query  1328  AQQAKETLSKAGQAAKDYTVQAKDYAS-------QKAGEAGNKASEAKERGTEMSKNAAS  1486
             A  AK+   K+   A D     KDYAS       + +G+A +K+ EA +  +E +K    
Sbjct  297   ALNAKDYAQKSKDYAGDAAQNVKDYASDAVQKRKEYSGDASHKSKEASDYASETAKKTKD  356

Query  1487  YAG  1495
             Y G
Sbjct  357   YVG  359


 Score = 56.2 bits (134),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 74/236 (31%), Positives = 103/236 (44%), Gaps = 43/236 (18%)
 Frame = +2

Query  932   KDTALQKTQ----QAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAG  1099
             KD A QKT+    +A + A++T     Q+ KD  S   Q  KDY +  A++TKD  S A 
Sbjct  216   KDYAAQKTKDYASEASDVAQNTKDYAAQKTKDYASGGAQKTKDYASGGAQKTKDYASDAA  275

Query  1100  QTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQS-------AQQTKDTLSSAGQT-------  1237
             Q  KDY    AQ++K+        AKDY  +S       AQ  KD  S A Q        
Sbjct  276   QKTKDYASDGAQKSKEYAGDVALNAKDYAQKSKDYAGDAAQNVKDYASDAVQKRKEYSGD  335

Query  1238  -------AKDYTVQSAQQAKDTLSGAGQTAK---DYTVQTAQQAKETLSKA--------G  1363
                    A DY  ++A++ KD +  A Q +K   +Y    AQ+ KE    A         
Sbjct  336   ASHKSKEASDYASETAKKTKDYVGDAAQRSKGAAEYASDAAQRTKEYAGDATKRSKEASN  395

Query  1364  QAAKDYTVQAKDYASQKAGEAGNKASEAKERGTEMSKNAASYAGQKVTEAKDVTVE  1531
               A D   + KDYAS       + A   KE+  +++  A  Y+ +K  E KD   E
Sbjct  396   DHANDMAQKTKDYAS-------DTAQRTKEKLQDIASEAGQYSAEKAREMKDAAAE  444



>ref|XP_008456425.1| PREDICTED: seed biotin-containing protein SBP65 [Cucumis melo]
Length=467

 Score = 77.8 bits (190),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 62/202 (31%), Positives = 98/202 (49%), Gaps = 18/202 (9%)
 Frame = +2

Query  776   SLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKT  955
             SL+EI  YR  AQ++S +A++ A+ +YEKA    KE++  G    VE      +    + 
Sbjct  153   SLDEISNYRAIAQERSNEAIRAAKERYEKA---NKESLHQG----VEGKTEESEQRETEE  205

Query  956   QQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQ  1135
              +          +  +  K+T +S  +TAKDYT   A++           AKDYTVQ A 
Sbjct  206   GEENTVEVGGERTGLETVKETLTSAAKTAKDYTVPIAEK-----------AKDYTVQKAI  254

Query  1136  QTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDY  1315
             + KD   SAGQT   Y  + A   KD    +G+ A +Y  ++A+  KD    AG +   Y
Sbjct  255   EAKDITVSAGQTTAHYLGEKAVAAKDVAVESGKVAAEYAGKAAEDLKDKAVVAGWSTAHY  314

Query  1316  TVQTAQQAKETLSKAGQAAKDY  1381
             +  TA +  +  ++  + A +Y
Sbjct  315   SCDTAMEGTKAAARLVKGAAEY  336


 Score = 54.7 bits (130),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 31/36 (86%), Gaps = 1/36 (3%)
 Frame = +2

Query  188  MASEQL-RRDNKTGERAVEVEKDRVPKMASHFESLA  292
            MASEQL RRDN T ER ++VEK+RVP++ SHFE++A
Sbjct  1    MASEQLSRRDNTTNEREIQVEKERVPQLTSHFEAIA  36



>ref|XP_010069075.1| PREDICTED: embryonic protein DC-8 [Eucalyptus grandis]
Length=468

 Score = 77.4 bits (189),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 68/185 (37%), Positives = 99/185 (54%), Gaps = 13/185 (7%)
 Frame = +2

Query  986   TISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSA-  1162
             T  ++++  D  +   +  KDYTT+ AK+T D   SA Q  ++ T ++A++ K+T  SA 
Sbjct  95    TADRSREGYDATTGKAKEYKDYTTEKAKETTD---SAAQKVQEKTGEAAEKAKETKESAK  151

Query  1163  GQTA--KDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQ  1336
             G+    KDY  + A++TKD+        KDYT Q A++AK+         KDYT Q A++
Sbjct  152   GKLGEYKDYAAEKARETKDSTLGKAAEYKDYTAQKAEEAKEKTKQKAGEYKDYTAQKAEE  211

Query  1337  AKETLSKAGQAAKDYTVQAKDYASQKAGEAGNKASEAKERGTEMSKNAASYAGQKVTEAK  1516
             AKE   K  Q A +Y    KDYA+QKA EA  K  E K+     +     YA +K  + K
Sbjct  212   AKE---KTKQKAGEY----KDYAAQKAEEAKEKTRETKDAALGKAGEYKDYAAEKAKQTK  264

Query  1517  DVTVE  1531
             D T E
Sbjct  265   DYTAE  269


 Score = 68.2 bits (165),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 61/177 (34%), Positives = 93/177 (53%), Gaps = 20/177 (11%)
 Frame = +2

Query  950   KTQQAYNA----AKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSA-GQTA--  1108
             ++++ Y+A    AK+     T++AK+T  S  Q  ++ T ++A++ K+T  SA G+    
Sbjct  98    RSREGYDATTGKAKEYKDYTTEKAKETTDSAAQKVQEKTGEAAEKAKETKESAKGKLGEY  157

Query  1109  KDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLS  1288
             KDY  + A++TKD+        KDYT Q A++ K+         KDYT Q A++AK+   
Sbjct  158   KDYAAEKARETKDSTLGKAAEYKDYTAQKAEEAKEKTKQKAGEYKDYTAQKAEEAKEKTK  217

Query  1289  GAGQTAKDYTVQTAQQAKE--------TLSKAGQAAKDYTV----QAKDYASQKAGE  1423
                   KDY  Q A++AKE         L KAG+  KDY      Q KDY ++KA E
Sbjct  218   QKAGEYKDYAAQKAEEAKEKTRETKDAALGKAGE-YKDYAAEKAKQTKDYTAEKAKE  273


 Score = 59.7 bits (143),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 52/169 (31%), Positives = 76/169 (45%), Gaps = 13/169 (8%)
 Frame = +2

Query  905   YLVEKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDT  1084
             Y  EKA    D+A QK Q+    A +      + AK          KDY  + A++TKD+
Sbjct  116   YTTEKAKETTDSAAQKVQEKTGEAAEKAKETKESAKGKLGEY----KDYAAEKARETKDS  171

Query  1085  LSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSA  1264
                     KDYT Q A++ K+         KDYT Q A++ K+         KDY  Q A
Sbjct  172   TLGKAAEYKDYTAQKAEEAKEKTKQKAGEYKDYTAQKAEEAKEKTKQKAGEYKDYAAQKA  231

Query  1265  QQAKD--------TLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTV  1387
             ++AK+         L  AG+  KDY  + A+Q K+  ++  +  KD T 
Sbjct  232   EEAKEKTRETKDAALGKAGEY-KDYAAEKAKQTKDYTAEKAKEGKDTTA  279


 Score = 55.5 bits (132),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 57/158 (36%), Positives = 86/158 (54%), Gaps = 16/158 (10%)
 Frame = +2

Query  1097  GQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAK  1276
             G+   +YT   +++  D  +   +  KDYT + A++T D   SA Q  ++ T ++A++AK
Sbjct  88    GREGAEYTADRSREGYDATTGKAKEYKDYTTEKAKETTD---SAAQKVQEKTGEAAEKAK  144

Query  1277  DTLSGA-GQTA--KDYTVQTAQQAKE-TLSKAGQAAKDYTVQ----AKDYASQKAGE---  1423
             +T   A G+    KDY  + A++ K+ TL KA +  KDYT Q    AK+   QKAGE   
Sbjct  145   ETKESAKGKLGEYKDYAAEKARETKDSTLGKAAE-YKDYTAQKAEEAKEKTKQKAGEYKD  203

Query  1424  -AGNKASEAKERGTEMSKNAASYAGQKVTEAKDVTVES  1534
                 KA EAKE+  + +     YA QK  EAK+ T E+
Sbjct  204   YTAQKAEEAKEKTKQKAGEYKDYAAQKAEEAKEKTRET  241


 Score = 52.8 bits (125),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 54/171 (32%), Positives = 77/171 (45%), Gaps = 28/171 (16%)
 Frame = +2

Query  803   QTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKTQQAYNAAKD  982
             Q  Q+K+ +A + A+   E AK    E       Y  EKA   KD+ L K  +     KD
Sbjct  130   QKVQEKTGEAAEKAKETKESAKGKLGEY----KDYAAEKARETKDSTLGKAAEY----KD  181

Query  983   TTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKD-----  1147
              T  K ++AK+         KDYT Q A++ K+         KDY  Q A++ K+     
Sbjct  182   YTAQKAEEAKEKTKQKAGEYKDYTAQKAEEAKEKTKQKAGEYKDYAAQKAEEAKEKTRET  241

Query  1148  ---TLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSG  1291
                 L  AG+  KDY  + A+QTKD           YT + A++ KDT +G
Sbjct  242   KDAALGKAGEY-KDYAAEKAKQTKD-----------YTAEKAKEGKDTTAG  280



>ref|XP_010313857.1| PREDICTED: seed biotin-containing protein SBP65-like isoform 
X2 [Solanum lycopersicum]
Length=417

 Score = 77.0 bits (188),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 114/399 (29%), Positives = 162/399 (41%), Gaps = 101/399 (25%)
 Frame = +2

Query  524   QNRP-VRVGGIEFYSG-----QDARSGRDETTRRQGFEERPGGVKFEVHSGQGGGQSTRL  685
             +++P V+VGG+EF SG     +D  +  D+ +  QG     GG K E H         R 
Sbjct  26    EHQPAVKVGGLEFSSGMQQQQKDTDTESDKHSSHQGL----GGFKIESH---------RK  72

Query  686   QGLEERPggvkvevhtghgggeeRRDHSGLSLEEIGKYRQTAQQKSIDALQTA--QNKYE  859
             +G E R                    H G+  +E G  +++ ++    A      +N  E
Sbjct  73    EGEEGRV-------------------HGGIHPQETGNKKKSERKAPALAPAAVLAENSDE  113

Query  860   KAKNT-------------------------TKENVQSGSQYL-----------VEKAGAA  931
             KAK+                          T ++V+SGSQY+           +EK   A
Sbjct  114   KAKDFGASALHNANEKESASHGHDAATYSQTAQDVRSGSQYVADKAAAAKDTAIEKGAQA  173

Query  932   KDTALQKTQQA--YNA-----AKDTTISKTQQAK----DTFSSTGQTAKDYTTQSAKQTK  1078
             KD  +   Q    Y A     AKDT + K QQ      DT S  GQT    T QSA+Q K
Sbjct  174   KDAVIHGPQIGSEYVADKSRVAKDTILEKGQQVCGETVDTLSRAGQT----TMQSAQQAK  229

Query  1079  D-TLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTV  1255
             D TL  AG+  KDY  + ++     +   G  AKD TV++ +        A +T  + + 
Sbjct  230   DGTLQKAGEM-KDYAAEKSKNAAGYIKQKGVDAKDATVETGKSAVGYAGEAAKTVAEKSR  288

Query  1256  QSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDY--------TVQAKDYASQ  1411
              +A  AKD     G++A  Y  + A+ AK+        A  Y        T    D  S 
Sbjct  289   DAAVYAKDATVETGKSAVGYAGEAAKTAKDMAEAGAFGAAHYTAKGAAAATKATADVVSS  348

Query  1412  KAGEAGNKASEAKERGTEMSKNAASYAGQKVTEAKDVTV  1528
              AG AG KA  A++      K+ A YAG K+  AKD  V
Sbjct  349   VAGYAGEKAVAARDAVAGAGKSVAEYAGDKLAAAKDYVV  387


 Score = 62.0 bits (149),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 72/175 (41%), Positives = 92/175 (53%), Gaps = 27/175 (15%)
 Frame = +2

Query  1070  QTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDY  1249
             Q KD +    Q   +Y    ++  KDT+   GQ       Q   +T DTLS AGQT    
Sbjct  172   QAKDAVIHGPQIGSEYVADKSRVAKDTILEKGQ-------QVCGETVDTLSRAGQT----  220

Query  1250  TVQSAQQAKD-TLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGEA  1426
             T+QSAQQAKD TL  AG+  KDY  + ++ A   + + G  AKD TV+    A   AGEA
Sbjct  221   TMQSAQQAKDGTLQKAGEM-KDYAAEKSKNAAGYIKQKGVDAKDATVETGKSAVGYAGEA  279

Query  1427  GNKASEAKERGTEMSKNAASYAGQKVTEAKDVTVESgkgavgyagkvaETLKDTA  1591
                 +E        S++AA YA       KD TVE+GK AVGYAG+ A+T KD A
Sbjct  280   AKTVAE-------KSRDAAVYA-------KDATVETGKSAVGYAGEAAKTAKDMA  320



>gb|AAQ65102.1| At2g42560 [Arabidopsis thaliana]
Length=635

 Score = 77.8 bits (190),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 62/180 (34%), Positives = 87/180 (48%), Gaps = 21/180 (12%)
 Frame = +2

Query  1010  KDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTV  1189
             KDT +  GQ AK+   + A++     S   Q A +Y  +  ++  +  +     AKDY +
Sbjct  228   KDTVAEKGQQAKESVGEGAQKAGSATSEKAQRASEYATEKGKEAGNMTAEQAARAKDYAL  287

Query  1190  QSAQQTKDT-----------LSSAGQT-------AKDYTVQSAQQAKDTLSGAGQTAKDY  1315
             Q+A + K+T           +   G T       AKDYT+Q A +AKD  +   Q A +Y
Sbjct  288   QTAVEAKETAAEKAQRASEYMKETGSTAAEQAARAKDYTLQKAVEAKDVAAEKAQRASEY  347

Query  1316  TVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGNKASEAKERGTEMSKNAASYAG  1495
               +T +QA    ++ GQ A   T +AKDY  QKAGEA   A   KE   E  K AA YAG
Sbjct  348   MTETGKQAGNVAAQKGQEAASMTAKAKDYTVQKAGEA---AGYIKETTVEGGKGAAHYAG  404


 Score = 73.6 bits (179),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 77/275 (28%), Positives = 129/275 (47%), Gaps = 34/275 (12%)
 Frame = +2

Query  776   SLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEK-AGAAKDTALQK  952
             SLE+I  YR  AQQKS+D+++ A+ +Y KAK +   + Q       E+  G  +D+ ++ 
Sbjct  111   SLEDIHGYRANAQQKSMDSIKAAEERYNKAKESLSHSGQEARGGRGEEMVGKGRDSGVRV  170

Query  953   TQQAYNAAKDTTIS-----------KTQQAKDTFSSTGQTAKDYTTQ------SAKQTKD  1081
             +                        K + A +  ++ G+  ++   +        +  KD
Sbjct  171   SHVGAVGGGGGGEEKESGVHGFHGEKARHA-ELLAAGGEEMREREGKESAGGVGGRSVKD  229

Query  1082  TLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQS  1261
             T++  GQ AK+   + AQ+     S   Q A +Y  +  ++  +  +     AKDY +Q+
Sbjct  230   TVAEKGQQAKESVGEGAQKAGSATSEKAQRASEYATEKGKEAGNMTAEQAARAKDYALQT  289

Query  1262  AQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQ----AKDYASQKAGEAG  1429
             A +AK+T +   Q A +Y  +T   A E  ++A    KDYT+Q    AKD A++KA    
Sbjct  290   AVEAKETAAEKAQRASEYMKETGSTAAEQAARA----KDYTLQKAVEAKDVAAEKA----  341

Query  1430  NKASEAKERGTEMSKNAASYAGQKVTEAKDVTVES  1534
              +ASE     TE  K A + A QK  EA  +T ++
Sbjct  342   QRASEYM---TETGKQAGNVAAQKGQEAASMTAKA  373


 Score = 65.1 bits (157),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  188  MASEQLRRDNKTGERAVEVEKDRVPKMASHFESLAEKVAD  307
            MASEQ RR+NK  ER V+VEKDRVPKM SHFES+AEK  D
Sbjct  1    MASEQARRENKVTEREVQVEKDRVPKMTSHFESMAEKGKD  40



>ref|XP_004252091.1| PREDICTED: seed biotin-containing protein SBP65-like isoform 
X1 [Solanum lycopersicum]
Length=428

 Score = 77.0 bits (188),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 114/399 (29%), Positives = 162/399 (41%), Gaps = 101/399 (25%)
 Frame = +2

Query  524   QNRP-VRVGGIEFYSG-----QDARSGRDETTRRQGFEERPGGVKFEVHSGQGGGQSTRL  685
             +++P V+VGG+EF SG     +D  +  D+ +  QG     GG K E H         R 
Sbjct  26    EHQPAVKVGGLEFSSGMQQQQKDTDTESDKHSSHQGL----GGFKIESH---------RK  72

Query  686   QGLEERPggvkvevhtghgggeeRRDHSGLSLEEIGKYRQTAQQKSIDALQTA--QNKYE  859
             +G E R                    H G+  +E G  +++ ++    A      +N  E
Sbjct  73    EGEEGRV-------------------HGGIHPQETGNKKKSERKAPALAPAAVLAENSDE  113

Query  860   KAKNT-------------------------TKENVQSGSQYL-----------VEKAGAA  931
             KAK+                          T ++V+SGSQY+           +EK   A
Sbjct  114   KAKDFGASALHNANEKESASHGHDAATYSQTAQDVRSGSQYVADKAAAAKDTAIEKGAQA  173

Query  932   KDTALQKTQQA--YNA-----AKDTTISKTQQAK----DTFSSTGQTAKDYTTQSAKQTK  1078
             KD  +   Q    Y A     AKDT + K QQ      DT S  GQT    T QSA+Q K
Sbjct  174   KDAVIHGPQIGSEYVADKSRVAKDTILEKGQQVCGETVDTLSRAGQT----TMQSAQQAK  229

Query  1079  D-TLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTV  1255
             D TL  AG+  KDY  + ++     +   G  AKD TV++ +        A +T  + + 
Sbjct  230   DGTLQKAGEM-KDYAAEKSKNAAGYIKQKGVDAKDATVETGKSAVGYAGEAAKTVAEKSR  288

Query  1256  QSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDY--------TVQAKDYASQ  1411
              +A  AKD     G++A  Y  + A+ AK+        A  Y        T    D  S 
Sbjct  289   DAAVYAKDATVETGKSAVGYAGEAAKTAKDMAEAGAFGAAHYTAKGAAAATKATADVVSS  348

Query  1412  KAGEAGNKASEAKERGTEMSKNAASYAGQKVTEAKDVTV  1528
              AG AG KA  A++      K+ A YAG K+  AKD  V
Sbjct  349   VAGYAGEKAVAARDAVAGAGKSVAEYAGDKLAAAKDYVV  387


 Score = 62.0 bits (149),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 72/175 (41%), Positives = 92/175 (53%), Gaps = 27/175 (15%)
 Frame = +2

Query  1070  QTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDY  1249
             Q KD +    Q   +Y    ++  KDT+   GQ       Q   +T DTLS AGQT    
Sbjct  172   QAKDAVIHGPQIGSEYVADKSRVAKDTILEKGQ-------QVCGETVDTLSRAGQT----  220

Query  1250  TVQSAQQAKD-TLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGEA  1426
             T+QSAQQAKD TL  AG+  KDY  + ++ A   + + G  AKD TV+    A   AGEA
Sbjct  221   TMQSAQQAKDGTLQKAGEM-KDYAAEKSKNAAGYIKQKGVDAKDATVETGKSAVGYAGEA  279

Query  1427  GNKASEAKERGTEMSKNAASYAGQKVTEAKDVTVESgkgavgyagkvaETLKDTA  1591
                 +E        S++AA YA       KD TVE+GK AVGYAG+ A+T KD A
Sbjct  280   AKTVAE-------KSRDAAVYA-------KDATVETGKSAVGYAGEAAKTAKDMA  320



>ref|XP_010243100.1| PREDICTED: embryonic protein DC-8-like isoform X2 [Nelumbo nucifera]
Length=500

 Score = 77.0 bits (188),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 73/204 (36%), Positives = 103/204 (50%), Gaps = 13/204 (6%)
 Frame = +2

Query  773   LSLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQK  952
             +++E++G++R  A  K+      A  K  + K+   +  + G    VEK G  KD A+ K
Sbjct  211   VAVEKMGEHRDYAADKAKQGKDVAVEKMGEYKDYAVDKAKQGKDIAVEKMGEYKDYAVDK  270

Query  953   TQQAYNAA-------KDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKD-TLSSAGQTA  1108
              +Q  +A        KD T  K +Q KD         KDYT   AKQ KD T+   G+  
Sbjct  271   AKQGKDATMQKMGLYKDYTADKAKQGKDATMEKLCEYKDYTADKAKQGKDATMEKMGEY-  329

Query  1109  KDYTVQSAQQTKD-TLSSAGQTAKDYTVQSAQQTKD-TLSSAGQTAKDYTVQSAQQAKDT  1282
             KDYT   A+Q KD T+   G+  KDYT   A++ KD T+   GQ  KDYT +  ++ KDT
Sbjct  330   KDYTADKAKQGKDATMEKMGEY-KDYTADKAKEGKDATMEKTGQY-KDYTAEKTKEGKDT  387

Query  1283  LSGAGQTAKDYTVQTAQQAKETLS  1354
              +   +  KD T   A QAKE L+
Sbjct  388   TAERMKGLKDSTADAATQAKEFLT  411


 Score = 65.1 bits (157),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 72/215 (33%), Positives = 88/215 (41%), Gaps = 13/215 (6%)
 Frame = +2

Query  914   EKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKD-TFSSTGQTAKDYTTQSAKQTKDTLS  1090
             EKA    D+A  K    Y   KD    K +Q KD T    G+  KDY    A+Q KD   
Sbjct  158   EKARETNDSAAMKKMGEY---KDYAADKARQGKDATIEKMGEY-KDYAADKARQGKDVAV  213

Query  1091  SAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQ  1270
                   +DY    A+Q KD         KDY V  A+Q KD         KDY V  A+Q
Sbjct  214   EKMGEHRDYAADKAKQGKDVAVEKMGEYKDYAVDKAKQGKDIAVEKMGEYKDYAVDKAKQ  273

Query  1271  AKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTV----QAKDYASQKAGE----A  1426
              KD         KDYT   A+Q K+   +     KDYT     Q KD   +K GE     
Sbjct  274   GKDATMQKMGLYKDYTADKAKQGKDATMEKLCEYKDYTADKAKQGKDATMEKMGEYKDYT  333

Query  1427  GNKASEAKERGTEMSKNAASYAGQKVTEAKDVTVE  1531
              +KA + K+   E       Y   K  E KD T+E
Sbjct  334   ADKAKQGKDATMEKMGEYKDYTADKAKEGKDATME  368



>gb|KCW89293.1| hypothetical protein EUGRSUZ_A01582, partial [Eucalyptus grandis]
Length=458

 Score = 77.0 bits (188),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 68/185 (37%), Positives = 99/185 (54%), Gaps = 13/185 (7%)
 Frame = +2

Query  986   TISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSA-  1162
             T  ++++  D  +   +  KDYTT+ AK+T D   SA Q  ++ T ++A++ K+T  SA 
Sbjct  95    TADRSREGYDATTGKAKEYKDYTTEKAKETTD---SAAQKVQEKTGEAAEKAKETKESAK  151

Query  1163  GQTA--KDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQ  1336
             G+    KDY  + A++TKD+        KDYT Q A++AK+         KDYT Q A++
Sbjct  152   GKLGEYKDYAAEKARETKDSTLGKAAEYKDYTAQKAEEAKEKTKQKAGEYKDYTAQKAEE  211

Query  1337  AKETLSKAGQAAKDYTVQAKDYASQKAGEAGNKASEAKERGTEMSKNAASYAGQKVTEAK  1516
             AKE   K  Q A +Y    KDYA+QKA EA  K  E K+     +     YA +K  + K
Sbjct  212   AKE---KTKQKAGEY----KDYAAQKAEEAKEKTRETKDAALGKAGEYKDYAAEKAKQTK  264

Query  1517  DVTVE  1531
             D T E
Sbjct  265   DYTAE  269


 Score = 67.8 bits (164),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 61/177 (34%), Positives = 93/177 (53%), Gaps = 20/177 (11%)
 Frame = +2

Query  950   KTQQAYNA----AKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSA-GQTA--  1108
             ++++ Y+A    AK+     T++AK+T  S  Q  ++ T ++A++ K+T  SA G+    
Sbjct  98    RSREGYDATTGKAKEYKDYTTEKAKETTDSAAQKVQEKTGEAAEKAKETKESAKGKLGEY  157

Query  1109  KDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLS  1288
             KDY  + A++TKD+        KDYT Q A++ K+         KDYT Q A++AK+   
Sbjct  158   KDYAAEKARETKDSTLGKAAEYKDYTAQKAEEAKEKTKQKAGEYKDYTAQKAEEAKEKTK  217

Query  1289  GAGQTAKDYTVQTAQQAKE--------TLSKAGQAAKDYTV----QAKDYASQKAGE  1423
                   KDY  Q A++AKE         L KAG+  KDY      Q KDY ++KA E
Sbjct  218   QKAGEYKDYAAQKAEEAKEKTRETKDAALGKAGE-YKDYAAEKAKQTKDYTAEKAKE  273


 Score = 58.9 bits (141),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 52/169 (31%), Positives = 76/169 (45%), Gaps = 13/169 (8%)
 Frame = +2

Query  905   YLVEKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDT  1084
             Y  EKA    D+A QK Q+    A +      + AK          KDY  + A++TKD+
Sbjct  116   YTTEKAKETTDSAAQKVQEKTGEAAEKAKETKESAKGKLGEY----KDYAAEKARETKDS  171

Query  1085  LSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSA  1264
                     KDYT Q A++ K+         KDYT Q A++ K+         KDY  Q A
Sbjct  172   TLGKAAEYKDYTAQKAEEAKEKTKQKAGEYKDYTAQKAEEAKEKTKQKAGEYKDYAAQKA  231

Query  1265  QQAKD--------TLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTV  1387
             ++AK+         L  AG+  KDY  + A+Q K+  ++  +  KD T 
Sbjct  232   EEAKEKTRETKDAALGKAGEY-KDYAAEKAKQTKDYTAEKAKEGKDTTA  279


 Score = 54.7 bits (130),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 57/158 (36%), Positives = 86/158 (54%), Gaps = 16/158 (10%)
 Frame = +2

Query  1097  GQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAK  1276
             G+   +YT   +++  D  +   +  KDYT + A++T D   SA Q  ++ T ++A++AK
Sbjct  88    GREGAEYTADRSREGYDATTGKAKEYKDYTTEKAKETTD---SAAQKVQEKTGEAAEKAK  144

Query  1277  DTLSGA-GQTA--KDYTVQTAQQAKE-TLSKAGQAAKDYTVQ----AKDYASQKAGE---  1423
             +T   A G+    KDY  + A++ K+ TL KA +  KDYT Q    AK+   QKAGE   
Sbjct  145   ETKESAKGKLGEYKDYAAEKARETKDSTLGKAAE-YKDYTAQKAEEAKEKTKQKAGEYKD  203

Query  1424  -AGNKASEAKERGTEMSKNAASYAGQKVTEAKDVTVES  1534
                 KA EAKE+  + +     YA QK  EAK+ T E+
Sbjct  204   YTAQKAEEAKEKTKQKAGEYKDYAAQKAEEAKEKTRET  241



>ref|XP_007211363.1| hypothetical protein PRUPE_ppa002371mg [Prunus persica]
 gb|EMJ12562.1| hypothetical protein PRUPE_ppa002371mg [Prunus persica]
Length=680

 Score = 77.4 bits (189),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 61/204 (30%), Positives = 98/204 (48%), Gaps = 31/204 (15%)
 Frame = +2

Query  776   SLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKT  955
             SLEEI K+R  AQQ S++A++ A+ +Y +AK + ++ + S ++++ EK            
Sbjct  331   SLEEISKFRAAAQQNSMEAIRAAEERYAQAKESARQGIGSATEFVSEKG-----------  379

Query  956   QQAYNAAKDTTISKTQQAKDTFSSTGQTAKD--------YTTQSAKQTKDTLSSAGQTAK  1111
                    K+T +   Q AK+T SS G+T  +        Y  + A + KD     G+TA 
Sbjct  380   ----EQTKETLVQGAQTAKETLSSAGKTVVEKTAPTTLHYVGEGAAKAKDVTLEGGKTAG  435

Query  1112  DYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQ--------TKDTLSSAGQTAKDYTVQSAQ  1267
              Y    A   KD  + AG +A  YT ++A +         K     AG TA D   +   
Sbjct  436   AYAGDVAVGLKDKATVAGWSAAHYTTEAAVEGTKLAARTVKGAAEYAGHTAVDIVSKPLI  495

Query  1268  QAKDTLSGAGQTAKDYTVQTAQQA  1339
              AKD  + AG+ A++YT +  ++A
Sbjct  496   MAKDAAAVAGEKAEEYTARKREEA  519


 Score = 55.5 bits (132),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 34/46 (74%), Gaps = 1/46 (2%)
 Frame = +2

Query  188  MASEQ-LRRDNKTGERAVEVEKDRVPKMASHFESLAEKVADDTAAD  322
            MASEQ +RR+N T ER VE+EKD+VPK+ +HFE+L      DT+ D
Sbjct  1    MASEQQMRRENTTSEREVEIEKDKVPKITTHFEALRGAEGKDTSLD  46



>ref|XP_010504059.1| PREDICTED: embryonic protein DC-8-like [Camelina sativa]
Length=457

 Score = 76.6 bits (187),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 79/247 (32%), Positives = 120/247 (49%), Gaps = 13/247 (5%)
 Frame = +2

Query  758   RDHSGLSLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKD  937
             RD +G   E+ G+ R T  QK+ +      ++  +AK+ T +  +  + Y  EKA  AKD
Sbjct  95    RDATG---EKAGEVRDTTAQKTKETADYTADEAREAKDKTADKTKETADYTAEKAREAKD  151

Query  938   TALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDY  1117
                 KT++  N     T  K ++AKD  +      KDYT + AK+ KD  +      KDY
Sbjct  152   KTADKTKETAN----YTAEKAKEAKDKTAEKMGEYKDYTAEKAKEAKDKTAETVGEYKDY  207

Query  1118  TVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDT-LSGA  1294
             TV  A + KD  +   +   DYT   A++ KD  +      KDYT + A + KD  +S  
Sbjct  208   TVDKAIEAKDKTAEKAKETADYTADKAKEAKDKTAEKMGEYKDYTAEKATEGKDVGVSKI  267

Query  1295  GQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGNKA----SEAKERGT  1462
             G+  KD  V TA++A   LS   +  K   V+ KD A +K  E G +A     E +  G 
Sbjct  268   GEL-KDSAVDTAKRAMGFLSGKTEETKQKAVETKDTAKEKLDETGEEARRKMEEMRLEGK  326

Query  1463  EMSKNAA  1483
             E+ ++A+
Sbjct  327   ELEEDAS  333


 Score = 69.7 bits (169),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 71/212 (33%), Positives = 103/212 (49%), Gaps = 12/212 (6%)
 Frame = +2

Query  914   EKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKD-TFSSTGQTAKDYTTQSAKQTKDTLS  1090
             EKAG  +DT  QKT++      D T  + ++AKD T   T +TA DYT + A++ KD  +
Sbjct  100   EKAGEVRDTTAQKTKETA----DYTADEAREAKDKTADKTKETA-DYTAEKAREAKDKTA  154

Query  1091  SAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQ  1270
                +   +YT + A++ KD  +      KDYT + A++ KD  +      KDYTV  A +
Sbjct  155   DKTKETANYTAEKAKEAKDKTAEKMGEYKDYTAEKAKEAKDKTAETVGEYKDYTVDKAIE  214

Query  1271  AKDTLSGAGQTAKDYTVQTAQQAKE-TLSKAGQAAKDYTV----QAKDYASQKAGEAGNK  1435
             AKD  +   +   DYT   A++AK+ T  K G+  KDYT     + KD    K GE  + 
Sbjct  215   AKDKTAEKAKETADYTADKAKEAKDKTAEKMGE-YKDYTAEKATEGKDVGVSKIGELKDS  273

Query  1436  ASEAKERGTEMSKNAASYAGQKVTEAKDVTVE  1531
             A +  +R             QK  E KD   E
Sbjct  274   AVDTAKRAMGFLSGKTEETKQKAVETKDTAKE  305


 Score = 65.9 bits (159),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 55/170 (32%), Positives = 88/170 (52%), Gaps = 8/170 (5%)
 Frame = +2

Query  1043  KDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLS  1222
             +D T + A + +DT +   +   DYT   A++ KD  +   +   DYT + A++ KD  +
Sbjct  95    RDATGEKAGEVRDTTAQKTKETADYTADEAREAKDKTADKTKETADYTAEKAREAKDKTA  154

Query  1223  SAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTV----Q  1390
                +   +YT + A++AKD  +      KDYT + A++AK+  ++     KDYTV    +
Sbjct  155   DKTKETANYTAEKAKEAKDKTAEKMGEYKDYTAEKAKEAKDKTAETVGEYKDYTVDKAIE  214

Query  1391  AKDYASQKAGE----AGNKASEAKERGTEMSKNAASYAGQKVTEAKDVTV  1528
             AKD  ++KA E      +KA EAK++  E       Y  +K TE KDV V
Sbjct  215   AKDKTAEKAKETADYTADKAKEAKDKTAEKMGEYKDYTAEKATEGKDVGV  264



>ref|NP_190872.1| putative late embryogenesis abundant protein [Arabidopsis thaliana]
 emb|CAB86908.1| late embryogenesis abundant protein-like [Arabidopsis thaliana]
 gb|AAL59922.1| putative late embryogenesis abundant protein [Arabidopsis thaliana]
 gb|AAM20111.1| putative late embryogenesis abundant protein [Arabidopsis thaliana]
 gb|AEE79028.1| putative late embryogenesis abundant protein [Arabidopsis thaliana]
Length=479

 Score = 76.6 bits (187),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 75/226 (33%), Positives = 115/226 (51%), Gaps = 20/226 (9%)
 Frame = +2

Query  875   TKENVQSGSQYLVEKA-------GAAKDTALQKTQQAYNAAKDTTISKTQQAKD-TFSST  1030
             T E+ + G+    EKA       G  +D+  QKT++      D T  K ++AKD T   T
Sbjct  76    TAESTREGADIASEKAAGMRDTTGEVRDSTAQKTKETA----DYTADKAREAKDKTADKT  131

Query  1031  GQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTK  1210
              +TA DY  + A++ KD  +   +   +YT + A++ KD  +      KDYT + A++ K
Sbjct  132   KETA-DYAAEKAREAKDRTADKTKETAEYTAEKAREAKDKTADKLGEYKDYTAEKAKEAK  190

Query  1211  DTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQ  1390
             DT +      KDYTV  A++AKD  +   + AK+    T+ +A+ET  K  +   +Y   
Sbjct  191   DTTAEKLGEYKDYTVDKAKEAKDKTA---EKAKETAEYTSDKARETKDKTAEKVGEY---  244

Query  1391  AKDYASQKAGEAGNKASEAKERGTEMSKNAASYAGQKVTEAKDVTV  1528
              KDY ++KA E  +KA EAK++  E       Y  +K TE KD  V
Sbjct  245   -KDYTAEKAKETADKAREAKDKTAEKVGEYRDYTAEKATETKDAGV  289


 Score = 65.1 bits (157),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 79/246 (32%), Positives = 116/246 (47%), Gaps = 35/246 (14%)
 Frame = +2

Query  791   GKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKTQQAYN  970
             G+ R +  QK+ +      +K  +AK+ T +  +  + Y  EKA  AKD    KT++   
Sbjct  99    GEVRDSTAQKTKETADYTADKAREAKDKTADKTKETADYAAEKAREAKDRTADKTKETA-  157

Query  971   AAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKD-  1147
                + T  K ++AKD  +      KDYT + AK+ KDT +      KDYTV  A++ KD 
Sbjct  158   ---EYTAEKAREAKDKTADKLGEYKDYTAEKAKEAKDTTAEKLGEYKDYTVDKAKEAKDK  214

Query  1148  TLSSAGQTA---------------------KDYTVQSAQQTKDTLSSA-GQTA------K  1243
             T   A +TA                     KDYT + A++T D    A  +TA      +
Sbjct  215   TAEKAKETAEYTSDKARETKDKTAEKVGEYKDYTAEKAKETADKAREAKDKTAEKVGEYR  274

Query  1244  DYTVQSAQQAKDT-LSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAG  1420
             DYT + A + KD  +S  G+  KD  V TA++A   LS   +  K   V+ KD A +K  
Sbjct  275   DYTAEKATETKDAGVSKIGEL-KDSAVDTAKRAMGFLSGKTEETKQKAVETKDTAKEKMD  333

Query  1421  EAGNKA  1438
             EAG +A
Sbjct  334   EAGEEA  339


 Score = 64.7 bits (156),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 62/179 (35%), Positives = 95/179 (53%), Gaps = 13/179 (7%)
 Frame = +2

Query  863   AKNTTKENVQSGSQYLVEKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTA  1042
             AK+ T + +     Y  EKA  AKDT  +K  + Y   KD T+ K ++AKD  +   +  
Sbjct  167   AKDKTADKLGEYKDYTAEKAKEAKDTTAEKLGE-Y---KDYTVDKAKEAKDKTAEKAKET  222

Query  1043  KDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSA-GQTA------KDYTVQSAQ  1201
              +YT+  A++TKD  +      KDYT + A++T D    A  +TA      +DYT + A 
Sbjct  223   AEYTSDKARETKDKTAEKVGEYKDYTAEKAKETADKAREAKDKTAEKVGEYRDYTAEKAT  282

Query  1202  QTKDT-LSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAK  1375
             +TKD  +S  G+  KD  V +A++A   LSG  +  K   V+T   AKE + +AG+ A+
Sbjct  283   ETKDAGVSKIGEL-KDSAVDTAKRAMGFLSGKTEETKQKAVETKDTAKEKMDEAGEEAR  340


 Score = 62.4 bits (150),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 77/238 (32%), Positives = 118/238 (50%), Gaps = 30/238 (13%)
 Frame = +2

Query  866   KNTTKENVQSGSQYLVEKAGAAKDTALQKTQQA--YNA-----AKDTTISKTQQAKDTFS  1024
             +++T +  +  + Y  +KA  AKD    KT++   Y A     AKD T  KT+       
Sbjct  102   RDSTAQKTKETADYTADKAREAKDKTADKTKETADYAAEKAREAKDRTADKTK-------  154

Query  1025  STGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQ  1204
                +TA +YT + A++ KD  +      KDYT + A++ KDT +      KDYTV  A++
Sbjct  155   ---ETA-EYTAEKAREAKDKTADKLGEYKDYTAEKAKEAKDTTAEKLGEYKDYTVDKAKE  210

Query  1205  TKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYT  1384
              KD  +   +   +YT   A++ KD  +      KDY   TA++AKET  KA + AKD T
Sbjct  211   AKDKTAEKAKETAEYTSDKARETKDKTAEKVGEYKDY---TAEKAKETADKA-REAKDKT  266

Query  1385  VQA----KDYASQKAGE---AG-NKASEAKERGTEMSKNAASYAGQKVTEAKDVTVES  1534
              +     +DY ++KA E   AG +K  E K+   + +K A  +   K  E K   VE+
Sbjct  267   AEKVGEYRDYTAEKATETKDAGVSKIGELKDSAVDTAKRAMGFLSGKTEETKQKAVET  324



>ref|XP_006411517.1| hypothetical protein EUTSA_v10017645mg [Eutrema salsugineum]
 gb|ESQ52970.1| hypothetical protein EUTSA_v10017645mg [Eutrema salsugineum]
Length=487

 Score = 76.6 bits (187),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 61/191 (32%), Positives = 97/191 (51%), Gaps = 6/191 (3%)
 Frame = +2

Query  812   QQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKTQQAYNAAKDTTI  991
             ++K  ++ +  + K   AK+T  E  Q  S+Y  EK   A +     T +    AKD T+
Sbjct  68    ERKGQESAEMGREKGAAAKDTAAEKAQRASEYATEKGKEAGNV----TAEQAGRAKDYTL  123

Query  992   SKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQT  1171
              K  +AKD  +   + A  Y T+  ++T +T +     AKDYT+Q A + KD  +   Q 
Sbjct  124   QKAVEAKDIAAEKARRATQYVTEKGRETGNTAAEQAARAKDYTLQKAVEAKDIAAEKAQR  183

Query  1172  AKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKD-TLSGAGQTAKDYTVQTAQQAKET  1348
             A +Y  +  ++T +  +  GQ AKD TV    +AKD T+  AG+ A + +   A  AKET
Sbjct  184   ASEYVTEKGKETGNIATQKGQEAKDQTVSMTGKAKDYTVQKAGE-AVEMSKDMAGYAKET  242

Query  1349  LSKAGQAAKDY  1381
             + + G+ A  Y
Sbjct  243   VVEGGKGAAHY  253


 Score = 56.2 bits (134),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 78/259 (30%), Positives = 117/259 (45%), Gaps = 34/259 (13%)
 Frame = +2

Query  800   RQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKTQQAYN---  970
             + TA +K+  A + A  K ++A N T E       Y ++KA  AKD A +K ++A     
Sbjct  86    KDTAAEKAQRASEYATEKGKEAGNVTAEQAGRAKDYTLQKAVEAKDIAAEKARRATQYVT  145

Query  971   ---------------AAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQT  1105
                             AKD T+ K  +AKD  +   Q A +Y T+  K+T +  +  GQ 
Sbjct  146   EKGRETGNTAAEQAARAKDYTLQKAVEAKDIAAEKAQRASEYVTEKGKETGNIATQKGQE  205

Query  1106  AKDYTVQSAQQTKD-TLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDT  1282
             AKD TV    + KD T+  AG+ A + +   A   K+T+   G+ A  Y   +A++A   
Sbjct  206   AKDQTVSMTGKAKDYTVQKAGE-AVEMSKDMAGYAKETVVEGGKGAAHYAGVAAEKAAAV  264

Query  1283  LSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQ-AKDYASQKAGEAGNKASEA-KER  1456
                   TA  +T +   Q   T + AG      TV+ A  YA  KA E G+KA +  KE+
Sbjct  265   G----WTAAHFTTEKVVQG--TKAVAG------TVEGAVGYAGHKAAEVGSKAVDLTKEK  312

Query  1457  GTEMSKNAASYAGQKVTEA  1513
                 +     Y  +K  EA
Sbjct  313   AAVAADTVVGYTARKKDEA  331



>dbj|BAF01507.1| seed maturation protein [Arabidopsis thaliana]
Length=635

 Score = 77.0 bits (188),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 62/180 (34%), Positives = 86/180 (48%), Gaps = 21/180 (12%)
 Frame = +2

Query  1010  KDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTV  1189
             KDT +  GQ AK+   + A++     S   Q A +Y  +  ++  +  +     AKDY +
Sbjct  228   KDTVAEKGQQAKESVGEGAQKAGSATSEKAQRASEYATEKGKEAGNMTAEQAARAKDYAL  287

Query  1190  QSAQQTKDT-----------LSSAGQT-------AKDYTVQSAQQAKDTLSGAGQTAKDY  1315
             Q A + K+T           +   G T       AKDYT+Q A +AKD  +   Q A +Y
Sbjct  288   QKAVEAKETAAEKAQRASEYMKETGSTAAEQAARAKDYTLQKAVEAKDVAAEKAQRASEY  347

Query  1316  TVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGNKASEAKERGTEMSKNAASYAG  1495
               +T +QA    ++ GQ A   T +AKDY  QKAGEA   A   KE   E  K AA YAG
Sbjct  348   MTETGKQAGNVAAQKGQEAASMTAKAKDYTVQKAGEA---AGYIKETTVEGGKGAAHYAG  404


 Score = 72.0 bits (175),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 75/275 (27%), Positives = 126/275 (46%), Gaps = 34/275 (12%)
 Frame = +2

Query  776   SLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEK-AGAAKDTALQK  952
             SLE+I  YR  AQQKS+D+++ A+ +Y KAK +   + Q       E+  G  +D+ ++ 
Sbjct  111   SLEDIHGYRANAQQKSMDSIKAAEERYNKAKESLSHSGQEARGGRGEEMVGKGRDSGVRV  170

Query  953   TQQAYNAAKDTTIS-----------KTQQAKDTFSSTGQTAKDYTTQ------SAKQTKD  1081
             +                        K + A +  ++ G+  ++   +        +  KD
Sbjct  171   SHVGAVGGGGGGEEKESGVHGFHGEKARHA-ELLAAGGEEMREREGKESAGGVGGRSVKD  229

Query  1082  TLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQS  1261
             T++  GQ AK+   + AQ+     S   Q A +Y  +  ++  +  +     AKDY +Q 
Sbjct  230   TVAEKGQQAKESVGEGAQKAGSATSEKAQRASEYATEKGKEAGNMTAEQAARAKDYALQK  289

Query  1262  AQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGNKAS  1441
             A +AK+T +           + AQ+A E + + G  A +   +AKDY  QKA EA + A+
Sbjct  290   AVEAKETAA-----------EKAQRASEYMKETGSTAAEQAARAKDYTLQKAVEAKDVAA  338

Query  1442  E----AKERGTEMSKNAASYAGQKVTEAKDVTVES  1534
             E    A E  TE  K A + A QK  EA  +T ++
Sbjct  339   EKAQRASEYMTETGKQAGNVAAQKGQEAASMTAKA  373


 Score = 65.1 bits (157),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  188  MASEQLRRDNKTGERAVEVEKDRVPKMASHFESLAEKVAD  307
            MASEQ RR+NK  ER V+VEKDRVPKM SHFES+AEK  D
Sbjct  1    MASEQARRENKVTEREVQVEKDRVPKMTSHFESMAEKGKD  40



>sp|P20075.1|LEAD8_DAUCA RecName: Full=Embryonic protein DC-8 [Daucus carota]
 emb|CAA34258.2| embryo-specific protein 66kDa [Daucus carota]
Length=555

 Score = 77.0 bits (188),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 68/190 (36%), Positives = 99/190 (52%), Gaps = 7/190 (4%)
 Frame = +2

Query  782   EEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKTQQ  961
             E+ G+Y+  A QK+ +A   A  K  +AK+TT ++ +    Y  +KA  AKD  +QKT +
Sbjct  200   EKTGEYKDYAAQKAAEAKVLAAQKAAEAKDTTGKDGEY-KDYAAQKAAEAKDATMQKTGE  258

Query  962   AYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKD-TLSSAGQTAKDYTVQSAQQ  1138
                  KD    KT + KD      +  K+Y  Q A + KD T+   G+  KDY+ Q A +
Sbjct  259   Y----KDYAAQKTAETKDATMEKAKEYKEYAAQKAAEAKDATMQKTGEY-KDYSAQKAAE  313

Query  1139  TKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYT  1318
             TKD      +  KDYT Q A +TKD      + AKD TVQ   + KD  +   +  KD T
Sbjct  314   TKDATMEKTKEYKDYTAQKAAETKDATMEKAKEAKDTTVQKTGEYKDYAAEKAKEGKDVT  373

Query  1319  VQTAQQAKET  1348
             V+ A++ K+T
Sbjct  374   VEKAKEGKDT  383


 Score = 76.3 bits (186),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 93/260 (36%), Positives = 120/260 (46%), Gaps = 32/260 (12%)
 Frame = +2

Query  875   TKENVQSGSQYLVEKAGAAKDTALQKTQQA--YNA-----AKDTTISKTQQAK-------  1012
             TKE       Y  +KAG AKDT L K  +   Y A     AKDTT  K  +AK       
Sbjct  147   TKEKAGEYKNYTAQKAGEAKDTTLGKAGEYKDYAAQKAAEAKDTTAQKAAEAKEKTGEYK  206

Query  1013  DTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKD-TLSSAGQTAKDYTV  1189
             D  +     AK    Q A + KDT    G+  KDY  Q A + KD T+   G+  KDY  
Sbjct  207   DYAAQKAAEAKVLAAQKAAEAKDTTGKDGEY-KDYAAQKAAEAKDATMQKTGEY-KDYAA  264

Query  1190  QSAQQTKDTLSSAGQTAKDYTVQSAQQAKD-TLSGAGQTAKDYTVQTAQQAKE-TLSKAG  1363
             Q   +TKD      +  K+Y  Q A +AKD T+   G+  KDY+ Q A + K+ T+ K  
Sbjct  265   QKTAETKDATMEKAKEYKEYAAQKAAEAKDATMQKTGEY-KDYSAQKAAETKDATMEK--  321

Query  1364  QAAKDYTVQAKDYASQKAGEAGN----KASEAKERGTEMSKNAASYAGQKVTEAKDVTVE  1531
                   T + KDY +QKA E  +    KA EAK+   + +     YA +K  E KDVTVE
Sbjct  322   ------TKEYKDYTAQKAAETKDATMEKAKEAKDTTVQKTGEYKDYAAEKAKEGKDVTVE  375

Query  1532  SgkgavgyagkvaETLKDTA  1591
               K            LKD+A
Sbjct  376   KAKEGKDTTVGKMTELKDSA  395


 Score = 65.5 bits (158),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 59/190 (31%), Positives = 90/190 (47%), Gaps = 15/190 (8%)
 Frame = +2

Query  776   SLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKT  955
             ++++ G+Y+  A QK+ +            K+ T E  +   +Y  +KA  AKD  +QKT
Sbjct  252   TMQKTGEYKDYAAQKTAET-----------KDATMEKAKEYKEYAAQKAAEAKDATMQKT  300

Query  956   QQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQ  1135
              +     KD +  K  + KD      +  KDYT Q A +TKD      + AKD TVQ   
Sbjct  301   GEY----KDYSAQKAAETKDATMEKTKEYKDYTAQKAAETKDATMEKAKEAKDTTVQKTG  356

Query  1136  QTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDY  1315
             + KD  +   +  KD TV+ A++ KDT        KD    +A++A D   G  +  K  
Sbjct  357   EYKDYAAEKAKEGKDVTVEKAKEGKDTTVGKMTELKDSAADAARKAMDMFLGKKEEVKGK  416

Query  1316  TVQTAQQAKE  1345
               +TA+ AKE
Sbjct  417   AGETAEAAKE  426



>ref|XP_010515787.1| PREDICTED: embryonic protein DC-8 [Camelina sativa]
Length=457

 Score = 76.6 bits (187),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 78/247 (32%), Positives = 119/247 (48%), Gaps = 13/247 (5%)
 Frame = +2

Query  758   RDHSGLSLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKD  937
             RD +G   E+ G+ R +  QK+ +      +K  +AK+   +  +  + Y  EKA  AKD
Sbjct  95    RDATG---EKAGEVRDSTAQKTKETADYTAHKAREAKDKMADKTKETADYTAEKAREAKD  151

Query  938   TALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDY  1117
                 KT++  N     T  K ++AKD  +      KDYT + AK+ KD  +      KDY
Sbjct  152   KTADKTKETAN----YTAEKAKEAKDRTAEKMGEYKDYTAEKAKEAKDKTAETVGEYKDY  207

Query  1118  TVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDT-LSGA  1294
             TV  A + KD  +   +   DYT   A++ KD  +      KDYT + A + KD  +S  
Sbjct  208   TVDKAIEAKDKTAEKAKETADYTADKAKEAKDKTAEKMGEYKDYTAEKATEGKDVGVSKI  267

Query  1295  GQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGNKA----SEAKERGT  1462
             G+  KD  V TA++A   LS   +  K   V+ KD A +K  E G +A     E +  G 
Sbjct  268   GEL-KDSAVDTAKRAMGFLSGKTEETKQKAVETKDTAKEKLDETGEEARRKMEEMRLEGK  326

Query  1463  EMSKNAA  1483
             E+ ++A+
Sbjct  327   ELEEDAS  333


 Score = 71.2 bits (173),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 66/211 (31%), Positives = 102/211 (48%), Gaps = 15/211 (7%)
 Frame = +2

Query  914   EKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSS  1093
             EKAG  +D+  QKT++      D T  K ++AKD  +   +   DYT + A++ KD  + 
Sbjct  100   EKAGEVRDSTAQKTKETA----DYTAHKAREAKDKMADKTKETADYTAEKAREAKDKTAD  155

Query  1094  AGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQA  1273
               +   +YT + A++ KD  +      KDYT + A++ KD  +      KDYTV  A +A
Sbjct  156   KTKETANYTAEKAKEAKDRTAEKMGEYKDYTAEKAKEAKDKTAETVGEYKDYTVDKAIEA  215

Query  1274  KDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGN----KAS  1441
             KD  +   +   DYT   A +AKE   K  +   +Y    KDY ++KA E  +    K  
Sbjct  216   KDKTAEKAKETADYT---ADKAKEAKDKTAEKMGEY----KDYTAEKATEGKDVGVSKIG  268

Query  1442  EAKERGTEMSKNAASYAGQKVTEAKDVTVES  1534
             E K+   + +K A  +   K  E K   VE+
Sbjct  269   ELKDSAVDTAKRAMGFLSGKTEETKQKAVET  299


 Score = 68.2 bits (165),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 54/170 (32%), Positives = 89/170 (52%), Gaps = 8/170 (5%)
 Frame = +2

Query  1043  KDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLS  1222
             +D T + A + +D+ +   +   DYT   A++ KD ++   +   DYT + A++ KD  +
Sbjct  95    RDATGEKAGEVRDSTAQKTKETADYTAHKAREAKDKMADKTKETADYTAEKAREAKDKTA  154

Query  1223  SAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTV----Q  1390
                +   +YT + A++AKD  +      KDYT + A++AK+  ++     KDYTV    +
Sbjct  155   DKTKETANYTAEKAKEAKDRTAEKMGEYKDYTAEKAKEAKDKTAETVGEYKDYTVDKAIE  214

Query  1391  AKDYASQKAGE----AGNKASEAKERGTEMSKNAASYAGQKVTEAKDVTV  1528
             AKD  ++KA E      +KA EAK++  E       Y  +K TE KDV V
Sbjct  215   AKDKTAEKAKETADYTADKAKEAKDKTAEKMGEYKDYTAEKATEGKDVGV  264



>ref|XP_009767285.1| PREDICTED: embryonic protein DC-8-like [Nicotiana sylvestris]
Length=460

 Score = 75.9 bits (185),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 55/163 (34%), Positives = 87/163 (53%), Gaps = 7/163 (4%)
 Frame = +2

Query  881   ENVQSGSQYLVEKAGAAKDTALQKTQQAYNAA-------KDTTISKTQQAKDTFSSTGQT  1039
             EN +       EKA +   +A +KTQQA ++        KD+   K ++AKD      + 
Sbjct  87    ENARHSKDVAAEKAKSTATSAAEKTQQAKDSTTGKAVEYKDSAADKAKEAKDATVGKMEE  146

Query  1040  AKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTL  1219
              KDY    AK+ KD+ ++     KDY  + A+Q KDT     + AKD T++ A++ KD+ 
Sbjct  147   CKDYAADKAKEAKDSTTAKAVEYKDYAAEKAKQAKDTTMEKAKQAKDTTMEKAREAKDST  206

Query  1220  SSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKET  1348
             ++     KDYT + A++AKDT     +  KDYT + A++ K+T
Sbjct  207   TAKAGEYKDYTAEKAKEAKDTTMQKTEEYKDYTAEKAKEGKDT  249


 Score = 67.4 bits (163),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 55/177 (31%), Positives = 90/177 (51%), Gaps = 4/177 (2%)
 Frame = +2

Query  761   DHSGLSLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDT  940
             D +G+  E     +  A +K+     +A  K ++AK++T            +KA  AKD 
Sbjct  80    DTAGVVAENARHSKDVAAEKAKSTATSAAEKTQQAKDSTTGKAVEYKDSAADKAKEAKDA  139

Query  941   ALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYT  1120
              + K ++     KD    K ++AKD+ ++     KDY  + AKQ KDT     + AKD T
Sbjct  140   TVGKMEEC----KDYAADKAKEAKDSTTAKAVEYKDYAAEKAKQAKDTTMEKAKQAKDTT  195

Query  1121  VQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSG  1291
             ++ A++ KD+ ++     KDYT + A++ KDT     +  KDYT + A++ KDT  G
Sbjct  196   MEKAREAKDSTTAKAGEYKDYTAEKAKEAKDTTMQKTEEYKDYTAEKAKEGKDTTVG  252


 Score = 57.4 bits (137),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 55/167 (33%), Positives = 84/167 (50%), Gaps = 11/167 (7%)
 Frame = +2

Query  1040  AKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTL  1219
             +KD   + AK T  + +   Q AKD T   A + KD+ +   + AKD TV   ++ KD  
Sbjct  92    SKDVAAEKAKSTATSAAEKTQQAKDSTTGKAVEYKDSAADKAKEAKDATVGKMEECKDYA  151

Query  1220  SSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTV----  1387
             +   + AKD T   A + KD  +   + AKD T++ A+QAK+T  +  + AKD T     
Sbjct  152   ADKAKEAKDSTTAKAVEYKDYAAEKAKQAKDTTMEKAKQAKDTTMEKAREAKDSTTAKAG  211

Query  1388  QAKDYASQKAGEAGNKASEAKERGTEMSKNAASYAGQKVTEAKDVTV  1528
             + KDY ++       KA EAK+   + ++    Y  +K  E KD TV
Sbjct  212   EYKDYTAE-------KAKEAKDTTMQKTEEYKDYTAEKAKEGKDTTV  251



>ref|XP_009419789.1| PREDICTED: LOW QUALITY PROTEIN: seed biotin-containing protein 
SBP65-like [Musa acuminata subsp. malaccensis]
Length=249

 Score = 73.6 bits (179),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 78/245 (32%), Positives = 118/245 (48%), Gaps = 59/245 (24%)
 Frame = +2

Query  773   LSLEEIGKYRQTAQQKSIDALQTAQNKYEKAK-------NTTKENV--------------  889
             +S EEIG+YR  AQQ S+++++ A+ +YEKAK       + T++ V              
Sbjct  1     MSPEEIGRYRAVAQQNSVESIRAAEERYEKAKQAGAGVLHGTRDTVAHGLGAAGLWAAAM  60

Query  890   ------------QSGSQYLVEKAGAAKDTALQKTQQAY-------NAAKDTTISKTQQ--  1006
                         ++ ++Y  EK   AKD A +K            ++ KDTT+ K++Q  
Sbjct  61    GTEAKDRAAHGARAAAEYTTEKGSLAKDYAAEKAHAVAEVAAXQASSVKDTTVEKSRQGL  120

Query  1007  --AKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKD  1180
               AKD   S G++A DY  Q+A + KD   S G+TA+    ++A +TKD  +SAG T   
Sbjct  121   EVAKDAAVSAGESAMDYAEQAALKAKDVAVSTGETAR----EAATKTKDATASAGDTEGR  176

Query  1181  YTVQSAQQTK-DTLSSAGQ----------TAKDYTVQSAQQAKDTLSGAGQTAKDYTVQT  1327
                +S+Q++   T S  G+           A +   Q A QAKDT    G+ AKDY   T
Sbjct  177   GGNRSSQESPAGTESKRGERLVSKTEETKEAMEELNQQAGQAKDTAMQTGERAKDYAGGT  236

Query  1328  AQQAK  1342
             A + K
Sbjct  237   AAEFK  241



>ref|XP_006292658.1| hypothetical protein CARUB_v10018901mg [Capsella rubella]
 gb|EOA25556.1| hypothetical protein CARUB_v10018901mg [Capsella rubella]
Length=453

 Score = 75.9 bits (185),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 79/247 (32%), Positives = 120/247 (49%), Gaps = 13/247 (5%)
 Frame = +2

Query  758   RDHSGLSLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKD  937
             RD +G   E+ G+ R +  QK+ +       K  +AK+ T +  +  + Y  EKA  AKD
Sbjct  95    RDATG---EKAGQVRDSTAQKTKETADYTAEKAREAKDKTADKAKETADYTAEKAREAKD  151

Query  938   TALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDY  1117
                 KT++      D T  K ++AKD  +      KDYT + A + KD  +      KDY
Sbjct  152   KTADKTKETA----DYTAEKAREAKDKTAEKVGEYKDYTVEKATEAKDKTAEKMGEYKDY  207

Query  1118  TVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDT-LSGA  1294
             TV  A++ KD  +   +   DYT   A++ KD  +      KDYT + A + KD  +S  
Sbjct  208   TVDKAKEAKDKTAEKAKETADYTADKAREAKDKTAEKMGEYKDYTAEKATEGKDAGVSKI  267

Query  1295  GQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGNKA----SEAKERGT  1462
             G+  KD  V TA++A   LS   +  K   V+ KD A +K  +AG +A     E K  G 
Sbjct  268   GEL-KDSAVDTAKRAMGFLSGKTEETKQKAVETKDTAKEKMEDAGEEARRKMEEMKLEGK  326

Query  1463  EMSKNAA  1483
             E+ ++A+
Sbjct  327   ELEEDAS  333


 Score = 70.5 bits (171),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 73/222 (33%), Positives = 111/222 (50%), Gaps = 10/222 (5%)
 Frame = +2

Query  866   KNTTKENVQSGSQYLVEKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKD-TFSSTGQTA  1042
             +++T +  +  + Y  EKA  AKD    K ++      D T  K ++AKD T   T +TA
Sbjct  106   RDSTAQKTKETADYTAEKAREAKDKTADKAKETA----DYTAEKAREAKDKTADKTKETA  161

Query  1043  KDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLS  1222
              DYT + A++ KD  +      KDYTV+ A + KD  +      KDYTV  A++ KD  +
Sbjct  162   -DYTAEKAREAKDKTAEKVGEYKDYTVEKATEAKDKTAEKMGEYKDYTVDKAKEAKDKTA  220

Query  1223  SAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKET-LSKAGQ---AAKDYTVQ  1390
                +   DYT   A++AKD  +      KDYT + A + K+  +SK G+   +A D   +
Sbjct  221   EKAKETADYTADKAREAKDKTAEKMGEYKDYTAEKATEGKDAGVSKIGELKDSAVDTAKR  280

Query  1391  AKDYASQKAGEAGNKASEAKERGTEMSKNAASYAGQKVTEAK  1516
             A  + S K  E   KA E K+   E  ++A   A +K+ E K
Sbjct  281   AMGFLSGKTEETKQKAVETKDTAKEKMEDAGEEARRKMEEMK  322


 Score = 68.9 bits (167),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 59/171 (35%), Positives = 90/171 (53%), Gaps = 10/171 (6%)
 Frame = +2

Query  1043  KDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLS  1222
             +D T + A Q +D+ +   +   DYT + A++ KD  +   +   DYT + A++ KD  +
Sbjct  95    RDATGEKAGQVRDSTAQKTKETADYTAEKAREAKDKTADKAKETADYTAEKAREAKDKTA  154

Query  1223  SAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKE-TLSKAGQAAKDYTV----  1387
                +   DYT + A++AKD  +      KDYTV+ A +AK+ T  K G+  KDYTV    
Sbjct  155   DKTKETADYTAEKAREAKDKTAEKVGEYKDYTVEKATEAKDKTAEKMGE-YKDYTVDKAK  213

Query  1388  QAKDYASQKAGE----AGNKASEAKERGTEMSKNAASYAGQKVTEAKDVTV  1528
             +AKD  ++KA E      +KA EAK++  E       Y  +K TE KD  V
Sbjct  214   EAKDKTAEKAKETADYTADKAREAKDKTAEKMGEYKDYTAEKATEGKDAGV  264



>ref|XP_006410837.1| hypothetical protein EUTSA_v10017525mg [Eutrema salsugineum]
 gb|ESQ52290.1| hypothetical protein EUTSA_v10017525mg [Eutrema salsugineum]
Length=446

 Score = 75.9 bits (185),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 84/242 (35%), Positives = 114/242 (47%), Gaps = 22/242 (9%)
 Frame = +2

Query  857   EKAKNT---TKENVQSGSQYLVEKAGAAKDT-------ALQKTQQAYNAAKDTTISKTQQ  1006
             EKAK T   T E +     Y ++KA  AKD        A  KT +     KD  + KT +
Sbjct  102   EKAKETADYTAEKIGEYEDYTIDKAKEAKDKTAEKAVEAKDKTAEKMGEYKDYAVDKTVE  161

Query  1007  AKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYT  1186
             AKD  +   +   +YT   AK+ KD  +      KDYT   A + KD  ++    AKDYT
Sbjct  162   AKDKTAEKAKETANYTADKAKEAKDKTAEKMGEYKDYTANKAVEAKDYTANKAVEAKDYT  221

Query  1187  VQSAQQTKD-TLSSAGQTAKDYTVQSAQQAKDT-LSGAGQTAKDYTVQTAQQAKETLSKA  1360
              + A + KD T+   G+  KDYTV+ A + KD  +S  G+  KD  + TA++A   LS  
Sbjct  222   AEKAAEAKDKTVEKTGEY-KDYTVEKATEGKDVGVSKLGEL-KDSALDTAKRAMGFLSGK  279

Query  1361  GQAAKDYTVQAKDYASQKAGEAGN----KASEAKERGTEMSKNAASYAGQKVTEAKDVTV  1528
                 K   V+ KD A +K  EAG     K  E +  G E+       AG+K  EA   T 
Sbjct  280   ADETKQKAVETKDSAKEKMEEAGEETRRKMEEMRLEGKELKDE----AGEKAREASQKTK  335

Query  1529  ES  1534
             ES
Sbjct  336   ES  337


 Score = 73.9 bits (180),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 76/238 (32%), Positives = 115/238 (48%), Gaps = 6/238 (3%)
 Frame = +2

Query  782   EEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKTQQ  961
             E+IG+Y      K+ +A      K  +AK+ T E +     Y V+K   AKD   +K ++
Sbjct  113   EKIGEYEDYTIDKAKEAKDKTAEKAVEAKDKTAEKMGEYKDYAVDKTVEAKDKTAEKAKE  172

Query  962   AYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQT  1141
               N     T  K ++AKD  +      KDYT   A + KD  ++    AKDYT + A + 
Sbjct  173   TAN----YTADKAKEAKDKTAEKMGEYKDYTANKAVEAKDYTANKAVEAKDYTAEKAAEA  228

Query  1142  KD-TLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYT  1318
             KD T+   G+  KDYTV+ A + KD   S     KD  + +A++A   LSG     K   
Sbjct  229   KDKTVEKTGEY-KDYTVEKATEGKDVGVSKLGELKDSALDTAKRAMGFLSGKADETKQKA  287

Query  1319  VQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGNKASEAKERGTEMSKNAASYA  1492
             V+T   AKE + +AG+  +    + +    +   EAG KA EA ++  E + +AA  A
Sbjct  288   VETKDSAKEKMEEAGEETRRKMEEMRLEGKELKDEAGEKAREASQKTKESTDSAAEKA  345


 Score = 63.5 bits (153),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 63/198 (32%), Positives = 90/198 (45%), Gaps = 17/198 (9%)
 Frame = +2

Query  974   AKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKD-----TLSSAGQTA------KDYT  1120
             AKD T+ K ++  D  +      +DYT   AK+ KD      + +  +TA      KDY 
Sbjct  96    AKDATVEKAKETADYTAEKIGEYEDYTIDKAKEAKDKTAEKAVEAKDKTAEKMGEYKDYA  155

Query  1121  VQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQ  1300
             V    + KD  +   +   +YT   A++ KD  +      KDYT   A +AKD  +    
Sbjct  156   VDKTVEAKDKTAEKAKETANYTADKAKEAKDKTAEKMGEYKDYTANKAVEAKDYTANKAV  215

Query  1301  TAKDYTVQTAQQAKE-TLSKAGQAAKDYTV----QAKDYASQKAGEAGNKASEAKERGTE  1465
              AKDYT + A +AK+ T+ K G+  KDYTV    + KD    K GE  + A +  +R   
Sbjct  216   EAKDYTAEKAAEAKDKTVEKTGE-YKDYTVEKATEGKDVGVSKLGELKDSALDTAKRAMG  274

Query  1466  MSKNAASYAGQKVTEAKD  1519
                  A    QK  E KD
Sbjct  275   FLSGKADETKQKAVETKD  292


 Score = 60.5 bits (145),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 72/232 (31%), Positives = 102/232 (44%), Gaps = 39/232 (17%)
 Frame = +2

Query  944   LQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTA-------KDYTTQSAKQTKDTLSSAGQ  1102
              +  Q  Y  A+D  + K+Q A ++     Q A       KD T + AK+T D  +    
Sbjct  57    FRAVQGTYEHARDAVVGKSQDAAESTREGAQVASEKAAGAKDATVEKAKETADYTAEKIG  116

Query  1103  TAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDT  1282
               +DYT+  A++           AKD T + A + KD  +      KDY V    +AKD 
Sbjct  117   EYEDYTIDKAKE-----------AKDKTAEKAVEAKDKTAEKMGEYKDYAVDKTVEAKDK  165

Query  1283  LSGAGQTAKDYTVQTAQQAKE-TLSKAGQAAKDYT----VQAKDYASQKAGEA----GNK  1435
              +   +   +YT   A++AK+ T  K G+  KDYT    V+AKDY + KA EA      K
Sbjct  166   TAEKAKETANYTADKAKEAKDKTAEKMGEY-KDYTANKAVEAKDYTANKAVEAKDYTAEK  224

Query  1436  ASEAKERGTEMSKNAASYAGQKVTEAKDVTVESgkgavgyagkvaETLKDTA  1591
             A+EAK++  E           K  E KD TVE               LKD+A
Sbjct  225   AAEAKDKTVE-----------KTGEYKDYTVEKATEGKDVGVSKLGELKDSA  265



>ref|XP_010279088.1| PREDICTED: seed biotin-containing protein SBP65 [Nelumbo nucifera]
Length=863

 Score = 76.6 bits (187),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 88/268 (33%), Positives = 123/268 (46%), Gaps = 48/268 (18%)
 Frame = +2

Query  860   KAKNTTKENVQSGSQYLVEKAGAAKDTALQKTQQAYNAAK-----DTTISKTQQ----AK  1012
             KAK+T   N ++ + Y+ EK    KD + Q+ Q+   + +     D    K+QQ    AK
Sbjct  479   KAKDTAVSNGKNIANYVGEKNAENKDASAQRVQRGAQSGEGQQDHDNNEEKSQQGSVAAK  538

Query  1013  DTFSSTGQTAKDYTTQSAKQTKDTL--------SSAGQTA---KDYTVQSAQQTKDTLSS  1159
             D  +   +TA D+T Q+A   KDT         S  GQ     +D T Q+ Q+  ++   
Sbjct  539   DIIAGASKTAMDHTQQAAAIAKDTAVGVSNNIASYVGQMNTGNEDTTTQNVQREDESRPE  598

Query  1160  AGQTA----------------KDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSG  1291
              G T+                KD + QS    K+T+++AG+TA DYT+Q+A +AKDT   
Sbjct  599   KGPTSEVTGPEEEGQQGNDNIKDKSQQSYVGAKNTVAAAGKTAMDYTLQAAVKAKDTALI  658

Query  1292  AGQTAKDYTVQTAQQAK----ETLSKAGQAAKDYTVQAKDYASQKAGEA--------GNK  1435
                +   Y  + A  AK    E   K G  A   TV+AKD A   AG          G K
Sbjct  659   ISNSIASYAGEKAAVAKDVTLENSKKVGGLAGQKTVEAKDTAVDTAGRVSKSIASYTGEK  718

Query  1436  ASEAKERGTEMSKNAASYAGQKVTEAKD  1519
             A+ AK+   E SK     AGQK  EAKD
Sbjct  719   AAVAKDVTLESSKKVGGLAGQKAVEAKD  746


 Score = 72.0 bits (175),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 78/250 (31%), Positives = 123/250 (49%), Gaps = 39/250 (16%)
 Frame = +2

Query  782   EEIGKYRQTAQQKSIDALQT-AQNKYEKAKN----TTKENVQSGSQYLVEKAGAAKDTAL  946
             +++G Y+  AQQ S +A++  A+   EKAK     T ++ VQ  +++  EK      T  
Sbjct  191   QDMGNYQTIAQQASAEAIRRRAEKLNEKAKELVAMTRQQGVQREAEHGTEKGSITGVTRP  250

Query  947   QKTQQAYNAAKDTTISKTQQ-----AKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAK  1111
             ++ Q+ Y    +   S+ QQ     AKDT +  G+TA DYT Q+A Q KDT  + G++  
Sbjct  251   EEDQRGYYDDNNKEKSQAQQQGYVGAKDTIAGIGKTAMDYTLQAAAQAKDTTVNVGKSIA  310

Query  1112  DYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDT--LSSA-----GQTAKDYTVQSAQQ  1270
                 +   + KDT   A Q  +  T    ++++ T  L+       G    D   + +QQ
Sbjct  311   SSVGEKNAENKDT---ATQRVQRETTSGPEKSRTTNELTGPEGGQQGHEVHDNNKEKSQQ  367

Query  1271  -----AKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGNK  1435
                  AKDT++GAG+TA DY++Q A +AK+T +  G++   Y               G K
Sbjct  368   QGYVAAKDTIAGAGKTAMDYSLQVATRAKDTAANVGKSVASYM--------------GEK  413

Query  1436  ASEAKERGTE  1465
              +E KER TE
Sbjct  414   NAENKERKTE  423


 Score = 69.7 bits (169),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 80/259 (31%), Positives = 105/259 (41%), Gaps = 74/259 (29%)
 Frame = +2

Query  980   DTTISKTQQ----AKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKD  1147
             D T  K+QQ    AKDT +   + A DYT Q A + KDT  S G+   +Y  +   + KD
Sbjct  445   DNTTEKSQQVYAAAKDTIAGASKNAMDYTLQGAAKAKDTAVSNGKNIANYVGEKNAENKD  504

Query  1148  TL---------SSAGQTAKDYTVQSAQQ----TKDTLSSAGQTAKDYTVQSAQQAKDTLS  1288
                        S  GQ   D   + +QQ     KD ++ A +TA D+T Q+A  AKDT  
Sbjct  505   ASAQRVQRGAQSGEGQQDHDNNEEKSQQGSVAAKDIIAGASKTAMDHTQQAAAIAKDTAV  564

Query  1289  GAGQTAKDY-----------TVQTAQQ---------------------------------  1336
             G       Y           T Q  Q+                                 
Sbjct  565   GVSNNIASYVGQMNTGNEDTTTQNVQREDESRPEKGPTSEVTGPEEEGQQGNDNIKDKSQ  624

Query  1337  -----AKETLSKAGQAAKDYTVQA----KDYA----SQKAGEAGNKASEAKERGTEMSKN  1477
                  AK T++ AG+ A DYT+QA    KD A    +  A  AG KA+ AK+   E SK 
Sbjct  625   QSYVGAKNTVAAAGKTAMDYTLQAAVKAKDTALIISNSIASYAGEKAAVAKDVTLENSKK  684

Query  1478  AASYAGQKVTEAKDVTVES  1534
                 AGQK  EAKD  V++
Sbjct  685   VGGLAGQKTVEAKDTAVDT  703



>ref|XP_010683930.1| PREDICTED: embryonic protein DC-8-like [Beta vulgaris subsp. 
vulgaris]
Length=562

 Score = 75.9 bits (185),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 80/231 (35%), Positives = 107/231 (46%), Gaps = 26/231 (11%)
 Frame = +2

Query  932   KDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAK  1111
             KD+A+ K + A    KD T  K  QAKDT     + A  Y    A   KD  +     AK
Sbjct  137   KDSAVGKAKDA----KDYTGEKAVQAKDTAVGKTKDATGYVADKANAAKDYAAEKAVGAK  192

Query  1112  DYTVQSAQQTKDT-----------LSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQ  1258
             DYT + A Q KDT           ++   + AKDYT   A   KD  +     AKDYT +
Sbjct  193   DYTAEKAVQAKDTAVGKTKDATGYVADKAKAAKDYTADKAVGAKDYTAEKAVGAKDYTAE  252

Query  1259  SAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGNKA  1438
              A+QA +    AG+  KDYT + A++AK+       A+ +  V AKDY ++KA +A +K 
Sbjct  253   KARQAAEK---AGEY-KDYTAEKAKEAKD-------ASVEKAVGAKDYTAEKARQAADKT  301

Query  1439  SEAKERGTEMSKNAASYAGQKVTEAKDVTVESgkgavgyagkvaETLKDTA  1591
              E K+R  E +      A  K  E KD T E        A      LKD+A
Sbjct  302   GEMKDRTVEYTAEKGRQAADKAGEYKDYTAEKAVEGKDTAVGKLSELKDSA  352


 Score = 75.5 bits (184),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 91/266 (34%), Positives = 127/266 (48%), Gaps = 31/266 (12%)
 Frame = +2

Query  758   RDHSGLSLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKD  937
             RD++  SL +    + +A  K+ DA      K  +AK+T     +  + Y+ +KA AAKD
Sbjct  126   RDNTAESLRQT---KDSAVGKAKDAKDYTGEKAVQAKDTAVGKTKDATGYVADKANAAKD  182

Query  938   TALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDY  1117
              A +K       AKD T  K  QAKDT     + A  Y    AK  KD  +     AKDY
Sbjct  183   YAAEKAV----GAKDYTAEKAVQAKDTAVGKTKDATGYVADKAKAAKDYTADKAVGAKDY  238

Query  1118  TVQSAQQTKD-TLSSAGQTA------KDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAK  1276
             T + A   KD T   A Q A      KDYT + A++ KD        AKDYT + A+QA 
Sbjct  239   TAEKAVGAKDYTAEKARQAAEKAGEYKDYTAEKAKEAKDASVEKAVGAKDYTAEKARQAA  298

Query  1277  DTLSGAGQTAKDYTVQ-TAQQAKETLSKAGQAAKDYTVQAKDYASQKAGE----AGNKAS  1441
             D     G+  KD TV+ TA++ ++   KAG        + KDY ++KA E    A  K S
Sbjct  299   DKT---GEM-KDRTVEYTAEKGRQAADKAG--------EYKDYTAEKAVEGKDTAVGKLS  346

Query  1442  EAKERGTEMSKNAASYAGQKVTEAKD  1519
             E K+   +++K A  +   K  E K+
Sbjct  347   ELKDSAADVAKRAMGFLSMKKDETKE  372


 Score = 70.1 bits (170),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 82/243 (34%), Positives = 114/243 (47%), Gaps = 22/243 (9%)
 Frame = +2

Query  758   RDHSGLSLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKD  937
             +D++G   E+  + + TA  K+ DA     +K   AK+   E       Y  EKA  AKD
Sbjct  148   KDYTG---EKAVQAKDTAVGKTKDATGYVADKANAAKDYAAEKAVGAKDYTAEKAVQAKD  204

Query  938   TALQKTQQA-------YNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSA  1096
             TA+ KT+ A         AAKD T  K   AKD  +     AKDYT + A+Q  +    A
Sbjct  205   TAVGKTKDATGYVADKAKAAKDYTADKAVGAKDYTAEKAVGAKDYTAEKARQAAE---KA  261

Query  1097  GQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAK  1276
             G+  KDYT + A++ KD        AKDYT + A+Q  D          +YT +  +QA 
Sbjct  262   GEY-KDYTAEKAKEAKDASVEKAVGAKDYTAEKARQAADKTGEMKDRTVEYTAEKGRQAA  320

Query  1277  DTLSGAGQTAKDYTVQTAQQAKET----LSKAGQAAKDYTVQAKDYASQKAGEAGNKASE  1444
             D    AG+  KDYT + A + K+T    LS+   +A D   +A  + S K  E   K  E
Sbjct  321   DK---AGEY-KDYTAEKAVEGKDTAVGKLSELKDSAADVAKRAMGFLSMKKDETKEKVGE  376

Query  1445  AKE  1453
               E
Sbjct  377   TAE  379


 Score = 60.5 bits (145),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 73/228 (32%), Positives = 105/228 (46%), Gaps = 7/228 (3%)
 Frame = +2

Query  800   RQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKTQQAYNAA-  976
             + TA  K+ DA     +K + AK+ T +       Y  EKA  AKD   +K +QA   A 
Sbjct  203   KDTAVGKTKDATGYVADKAKAAKDYTADKAVGAKDYTAEKAVGAKDYTAEKARQAAEKAG  262

Query  977   --KDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDT  1150
               KD T  K ++AKD        AKDYT + A+Q  D          +YT +  +Q  D 
Sbjct  263   EYKDYTAEKAKEAKDASVEKAVGAKDYTAEKARQAADKTGEMKDRTVEYTAEKGRQAAD-  321

Query  1151  LSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTA  1330
                AG+  KDYT + A + KDT        KD     A++A   LS      K+   +TA
Sbjct  322   --KAGEY-KDYTAEKAVEGKDTAVGKLSELKDSAADVAKRAMGFLSMKKDETKEKVGETA  378

Query  1331  QQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGNKASEAKERGTEMSK  1474
             + AK+   +  +AAK+   +A + A Q A  A +K  E KE   ++ K
Sbjct  379   EAAKDKTWETAEAAKEKGREAMESAKQTAEAAKDKTWEKKEEAKDVFK  426



>ref|XP_006592863.1| PREDICTED: seed biotin-containing protein SBP65-like [Glycine 
max]
Length=540

 Score = 75.9 bits (185),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 78/242 (32%), Positives = 114/242 (47%), Gaps = 22/242 (9%)
 Frame = +2

Query  830   ALQTAQNKYEKAK-------NTTKENVQSGSQYLVEKAGAAKDTALQKTQQAYNAAKDTT  988
             A Q  + +Y++AK       NTT E  Q  S    + A  AKD  L+K QQ Y A KDT 
Sbjct  159   ATQGVKERYDRAKQAASETLNTTAETAQEKSAQAKDLATQAKDATLEKGQQGYVATKDTI  218

Query  989   ISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQ  1168
              S  + A +  +   + AK+YT Q+A++TK    S G T   Y  + A Q KD    +G+
Sbjct  219   SSAAKTASEKTAPVAEKAKEYTLQAAEKTK----SVGGTTASYVGEKAVQAKDVTVESGK  274

Query  1169  TAKDYTVQSAQQTKDTLSSAGQTAKDY----TVQSAQQAKDTLSG----AGQTAKDYTVQ  1324
              A  Y  + A   KD  +S G  A  +    TV+  + A   + G    AG  A +    
Sbjct  275   NAAGYAAKVAVDLKDKAASVGWAAAHFSAEKTVEGTKAAAHVVEGAAGYAGHKAAELASM  334

Query  1325  TAQQAKETLSKAGQAAKDYTVQAKDYASQKAGEA--GNKASEAKERGTEMSKNAASYAGQ  1498
             +    K   + AG+ AK+YT + K+ A Q+  EA    +  EA+ER ++      S  G+
Sbjct  335   STGAVKGLAASAGETAKEYTTRKKEEA-QRELEAKKAFQPQEAEERPSQGIGETVSSVGE  393

Query  1499  KV  1504
             KV
Sbjct  394   KV  395



>emb|CDY47980.1| BnaA04g24580D [Brassica napus]
Length=467

 Score = 74.3 bits (181),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 88/307 (29%), Positives = 135/307 (44%), Gaps = 60/307 (20%)
 Frame = +2

Query  776   SLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTT--------------KENVQSGSQYLV  913
             SLE+I  +R  AQQ+S+D ++ A+ +Y KAK +               +E+    +    
Sbjct  102   SLEDIQGFRANAQQQSMDTIRAAEERYNKAKESLSRGGQGGQQAEGRGRESGVHVTHVGT  161

Query  914   EKAGAAKDTALQKTQQAYNA--------------------------------AKDTTISK  997
             EK G  + TA +KTQ+A  A                                AKD  + K
Sbjct  162   EKGGNVQGTASEKTQRASEASDYAREKAREAGHYATEKGRETGNTAAEQAARAKDIALQK  221

Query  998   TQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAK  1177
               +AKD  +   Q    Y  +  ++   T +     AKDYT+Q A + KD  +   Q A 
Sbjct  222   AAEAKDIAAEKAQ----YAAEKGREMGSTAAEKAARAKDYTLQKAVEAKDIAAEKAQRAS  277

Query  1178  DYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKD-TLSGAGQTAKDYTVQTAQQAKETLS  1354
              Y  + A + KD  +  GQ AK+ TV    +AKD T+  AG+ A + + + A+ AKET+ 
Sbjct  278   QYATEKAGEAKDIAAQKGQEAKEQTVSVTAKAKDYTVQKAGE-AVEMSKEAAEYAKETVV  336

Query  1355  KAGQAAKDYTVQAKDYASQKAGEAGNKASEAKERGTEM----SKNAASYAGQKVTE----  1510
             + G+ A  Y   A + A+     A +  +E   +GT+      + A  YAG K  E    
Sbjct  337   EGGKGAAHYAGVAAEKAAAVGWTAAHFTTEKVVQGTKAVTGTVEGAVGYAGHKAAEVGSK  396

Query  1511  AKDVTVE  1531
             A D+T E
Sbjct  397   AVDLTKE  403



>gb|ACJ39155.1| LEA protein group 3 [Brassica napus]
Length=398

 Score = 73.9 bits (180),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 77/225 (34%), Positives = 107/225 (48%), Gaps = 17/225 (8%)
 Frame = +2

Query  896   GSQYLVEKAGAAKDTALQKTQQA--YNA-----AKDTTISKTQQAKDTFSSTGQTAKDYT  1054
             G++   EKA  AKD  L+K ++   Y A     AKD T  K  + KD        AKD T
Sbjct  88    GAKMASEKAAGAKDATLEKAKETADYTADEAKEAKDKTAEKMGEYKDYTVDKAVEAKDKT  147

Query  1055  TQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQ  1234
              + AK+T +  +   + AKD T Q   + KD      + AKDYT + A + KD  +    
Sbjct  148   AEKAKETANYTADKAKEAKDKTAQKVGEYKDYTVDKAKEAKDYTAEKAIEAKDKTAEKAG  207

Query  1235  TAKDYTVQSAQQAKDT-LSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQ  1411
               KDYTV+ A + KD  +S  G+  KD  + TA++A   LS   +  K   ++ KD A +
Sbjct  208   EYKDYTVEKAAEGKDVGVSKLGEL-KDSAIDTAKRAMGFLSGKTEETKQKAIETKDSAKE  266

Query  1412  KAGEAGN----KASEAKERGTEMSKNAASYAGQKVTEAKDVTVES  1534
             K  EAG     K  E +  G E+       AG+K  EA   T ES
Sbjct  267   KMEEAGEETRRKMEEKRLEGKELKYQ----AGEKAREASQKTRES  307


 Score = 56.2 bits (134),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 96/202 (48%), Gaps = 17/202 (8%)
 Frame = +2

Query  863   AKNTTKENVQSGSQYLVEKAGAAKDTALQKTQQAYN-------AAKDTTISKTQQAKDTF  1021
             AK+ T E +     Y V+KA  AKD   +K ++  N        AKD T  K  + KD  
Sbjct  121   AKDKTAEKMGEYKDYTVDKAVEAKDKTAEKAKETANYTADKAKEAKDKTAQKVGEYKDYT  180

Query  1022  SSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDT-LSSAGQTAKDYTVQSA  1198
                 + AKDYT + A + KD  +      KDYTV+ A + KD  +S  G+  KD  + +A
Sbjct  181   VDKAKEAKDYTAEKAIEAKDKTAEKAGEYKDYTVEKAAEGKDVGVSKLGEL-KDSAIDTA  239

Query  1199  QQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKD  1378
             ++    LS   +  K   +++   AK+ +  AG+  +    +   + KE   +AG+ A++
Sbjct  240   KRAMGFLSGKTEETKQKAIETKDSAKEKMEEAGEETRRKMEEKRLEGKELKYQAGEKARE  299

Query  1379  YTVQAKDYASQKAGEAGNKASE  1444
                     ASQK  E+ + A+E
Sbjct  300   --------ASQKTRESTDSAAE  313



>gb|ACU23559.1| unknown [Glycine max]
Length=458

 Score = 73.9 bits (180),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 92/271 (34%), Positives = 125/271 (46%), Gaps = 39/271 (14%)
 Frame = +2

Query  758   RDHSGLSLEEIGKYR----QTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQ----YLV  913
             +D++G + ++   Y     QT++  + DA Q ++     A   TKE V   +Q    Y  
Sbjct  114   KDYAGDTAQKTKDYAGDTAQTSKDYAGDAAQKSKGYVGDAAQKTKEYVGDAAQKTMDYAT  173

Query  914   EKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYT---TQSAKQTKDT  1084
             + A   KD A QKT       KD     T  AK T     Q  KDY    T +AK+TKD 
Sbjct  174   DAAQKTKDYATQKT-------KDYASDATDAAKRTKDYAAQKTKDYASDATDAAKKTKDY  226

Query  1085  LSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSA  1264
                A Q  KDY    AQ+TKD  S A Q  KDY   +AQ+TKD  S   Q +K+Y    A
Sbjct  227   ---AAQKTKDYASGGAQKTKDYASGAAQKTKDYASDAAQRTKDHASDGAQKSKEYAGDVA  283

Query  1265  QQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDY-------TVQAKDYASQKA--  1417
             Q AKD      Q +KD      Q  K+  + A   +KDY       + +A DYAS+ A  
Sbjct  284   QNAKDY----AQKSKDCAGDAVQNIKDYANDAAHKSKDYAGDASHKSKEASDYASETAQK  339

Query  1418  -----GEAGNKASEAKERGTEMSKNAASYAG  1495
                  G+A  K+ EA E  ++ ++    YAG
Sbjct  340   TKDYVGDAAQKSKEASEYASDAAQRTKEYAG  370


 Score = 73.2 bits (178),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 70/197 (36%), Positives = 102/197 (52%), Gaps = 14/197 (7%)
 Frame = +2

Query  932   KDTALQKTQQ----AYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAG  1099
             KD A QKT+     A +AAK T     Q+ KD  S   Q  KDY + +A++TKD  S A 
Sbjct  202   KDYAAQKTKDYASDATDAAKKTKDYAAQKTKDYASGGAQKTKDYASGAAQKTKDYASDAA  261

Query  1100  QTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKD  1279
             Q  KD+    AQ++K+      Q AKDY    AQ++KD    A Q  KDY   +A ++KD
Sbjct  262   QRTKDHASDGAQKSKEYAGDVAQNAKDY----AQKSKDCAGDAVQNIKDYANDAAHKSKD  317

Query  1280  TLSGAGQTAK---DYTVQTAQQAKETLSKAGQAAKDYTVQAKDYA---SQKAGEAGNKAS  1441
                 A   +K   DY  +TAQ+ K+ +  A Q +K+ +  A D A    + AG+A  ++ 
Sbjct  318   YAGDASHKSKEASDYASETAQKTKDYVGDAAQKSKEASEYASDAAQRTKEYAGDATKRSK  377

Query  1442  EAKERGTEMSKNAASYA  1492
             EA +   +M++    YA
Sbjct  378   EASDHANDMARKTKDYA  394


 Score = 68.6 bits (166),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 80/249 (32%), Positives = 109/249 (44%), Gaps = 41/249 (16%)
 Frame = +2

Query  899   SQYLVEKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTK  1078
             S Y  + A  +KD A    Q+  + A DT     Q+ KD    T QT+KDY   +A+++K
Sbjct  92    SDYAGDAAQKSKDYAGDTAQKTKDYAGDTA----QKTKDYAGDTAQTSKDYAGDAAQKSK  147

Query  1079  DTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQ-------------------SAQ  1201
               +  A Q  K+Y   +AQ+T D  + A Q  KDY  Q                   +AQ
Sbjct  148   GYVGDAAQKTKEYVGDAAQKTMDYATDAAQKTKDYATQKTKDYASDATDAAKRTKDYAAQ  207

Query  1202  QTKDTLSSA-----------GQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKET  1348
             +TKD  S A            Q  KDY    AQ+ KD  SGA Q  KDY    AQ+ K+ 
Sbjct  208   KTKDYASDATDAAKKTKDYAAQKTKDYASGGAQKTKDYASGAAQKTKDYASDAAQRTKDH  267

Query  1349  LSKAGQAAKDY----TVQAKDYASQKAGEAGNKASEAKERGTEMSKNAASYAG---QKVT  1507
              S   Q +K+Y       AKDYA +    AG+     K+   + +  +  YAG    K  
Sbjct  268   ASDGAQKSKEYAGDVAQNAKDYAQKSKDCAGDAVQNIKDYANDAAHKSKDYAGDASHKSK  327

Query  1508  EAKDVTVES  1534
             EA D   E+
Sbjct  328   EASDYASET  336


 Score = 66.6 bits (161),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 72/206 (35%), Positives = 99/206 (48%), Gaps = 14/206 (7%)
 Frame = +2

Query  941   ALQKTQQAY-NAAKDTTISKTQQAKDTFSSTGQTAKDYT---TQSAKQTKDTLSSAGQTA  1108
             A QKT++   +AA+ T    T  A+ T     Q  KDY    T +AK+TKD    A Q  
Sbjct  153   AAQKTKEYVGDAAQKTMDYATDAAQKTKDYATQKTKDYASDATDAAKRTKDY---AAQKT  209

Query  1109  KDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLS  1288
             KDY   +    K T   A Q  KDY    AQ+TKD  S A Q  KDY   +AQ+ KD  S
Sbjct  210   KDYASDATDAAKKTKDYAAQKTKDYASGGAQKTKDYASGAAQKTKDYASDAAQRTKDHAS  269

Query  1289  GAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQK-------AGEAGNKASEA  1447
                Q +K+Y    AQ AK+   K+   A D     KDYA+         AG+A +K+ EA
Sbjct  270   DGAQKSKEYAGDVAQNAKDYAQKSKDCAGDAVQNIKDYANDAAHKSKDYAGDASHKSKEA  329

Query  1448  KERGTEMSKNAASYAGQKVTEAKDVT  1525
              +  +E ++    Y G    ++K+ +
Sbjct  330   SDYASETAQKTKDYVGDAAQKSKEAS  355


 Score = 61.6 bits (148),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 55/161 (34%), Positives = 81/161 (50%), Gaps = 5/161 (3%)
 Frame = +2

Query  1025  STGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQ  1204
             ST +   DY   +A+++KD      Q  KDY   +AQ+TKD      QT+KDY   +AQ+
Sbjct  86    STTKKVSDYAGDAAQKSKDYAGDTAQKTKDYAGDTAQKTKDYAGDTAQTSKDYAGDAAQK  145

Query  1205  TKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYT  1384
             +K  +  A Q  K+Y   +AQ+  D  + A Q  KDY  Q  +      + A +  KDY 
Sbjct  146   SKGYVGDAAQKTKEYVGDAAQKTMDYATDAAQKTKDYATQKTKDYASDATDAAKRTKDYA  205

Query  1385  VQ-AKDYASQKAGEAGNKASEAKERGTEMSKNAASYAGQKV  1504
              Q  KDYAS    +A + A + K+   + +K+ AS   QK 
Sbjct  206   AQKTKDYAS----DATDAAKKTKDYAAQKTKDYASGGAQKT  242



>ref|XP_007154470.1| hypothetical protein PHAVU_003G121900g [Phaseolus vulgaris]
 gb|ESW26464.1| hypothetical protein PHAVU_003G121900g [Phaseolus vulgaris]
Length=357

 Score = 72.8 bits (177),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 73/199 (37%), Positives = 98/199 (49%), Gaps = 28/199 (14%)
 Frame = +2

Query  1001  QQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKD  1180
             Q++KD  S T Q  KDYT  +A++TKD +  A Q  KDY   +AQ+TKD  S A   AK 
Sbjct  103   QKSKDYASGTAQKTKDYTGDAAQKTKDYVGDAAQKTKDYVGDAAQKTKDYASDASDAAKK  162

Query  1181  YTVQSAQQTKDTLSSAGQTA---KDYTVQS----AQQAKDTLSGAGQTAKDYTVQTAQQA  1339
                 +A++ K+  S AG  A   KDY+ Q     A++ KD  S A +  KDY   TAQ  
Sbjct  163   TKDYAAEKAKEYASDAGDAAKKTKDYSAQKTSDGAKKTKDYASDAAKKTKDYVSDTAQN-  221

Query  1340  KETLSKAGQAAKDYTVQA----KDY---ASQKAGEAGNKASEAKER-------GTEMSKN  1477
                   AGQ  KDY   A    +DY   A+ K+ EA + AS+A E+           SK 
Sbjct  222   ------AGQNVKDYASDAAQKTRDYSGDAAHKSKEASDYASDAAEKTKHYVDDAVRRSKE  275

Query  1478  AASYAGQKVTEAKDVTVES  1534
              + YA       KD + E+
Sbjct  276   GSEYANDAAQRTKDYSSEA  294


 Score = 53.1 bits (126),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 55/98 (56%), Gaps = 4/98 (4%)
 Frame = +2

Query  1178  DYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSK  1357
             DY   +AQ++KD  S   Q  KDYT  +AQ+ KD +  A Q  KDY    AQ+ K+  S 
Sbjct  96    DYADDAAQKSKDYASGTAQKTKDYTGDAAQKTKDYVGDAAQKTKDYVGDAAQKTKDYASD  155

Query  1358  AGQAAKDYTVQAKDYASQKAGEAGNKASEAKERGTEMS  1471
             A  AAK    + KDYA++KA E  + A +A ++  + S
Sbjct  156   ASDAAK----KTKDYAAEKAKEYASDAGDAAKKTKDYS  189



>ref|XP_002881457.1| hypothetical protein ARALYDRAFT_482642 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57716.1| hypothetical protein ARALYDRAFT_482642 [Arabidopsis lyrata subsp. 
lyrata]
Length=444

 Score = 73.2 bits (178),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 78/252 (31%), Positives = 122/252 (48%), Gaps = 22/252 (9%)
 Frame = +2

Query  758   RDHSGLSLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKD  937
             RD +  + +++G+Y+      ++D       K ++AK+ T E  +  + Y  +KA  AKD
Sbjct  107   RDTADYTADKMGEYKDY----TVD-------KAKEAKDKTAEKAKETASYTADKAVEAKD  155

Query  938   TALQKTQQAYNAAKDTTISKTQQAKDTFSSTG-------QTAKDYTTQSAKQTKDTLSSA  1096
                 KT +     KD  + K  +AKD  + T        + AKD TT+   + KD     
Sbjct  156   ----KTAEKMGEYKDYAVDKAVEAKDKTAETANYTADKAKEAKDKTTEKMGEYKDYTVDK  211

Query  1097  GQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAK  1276
                AKDYT   A + KD  +      KDYTV+ A + KD   S     KD  V++A++A 
Sbjct  212   AVEAKDYTAAKAIEAKDKTAEKTGEYKDYTVEKATEGKDVGVSKLGELKDSAVETAKRAM  271

Query  1277  DTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGNKASEAKER  1456
               LSG  + AK+  V+T   AKE + KAG+  +    + +    +   EAG KA EA ++
Sbjct  272   GFLSGKTEEAKEKAVETKDTAKENIEKAGEVTRQKMEEMRLEGKELKDEAGAKAHEASQK  331

Query  1457  GTEMSKNAASYA  1492
               E +++AA  A
Sbjct  332   TRESTESAAEKA  343


 Score = 66.6 bits (161),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 69/209 (33%), Positives = 98/209 (47%), Gaps = 24/209 (11%)
 Frame = +2

Query  938   TALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTA-------KDYTTQSAKQTKDTLSSA  1096
             +  +  Q  Y  A+D  + KT  A ++     Q A       KD T + A+ T D  +  
Sbjct  57    SVFRAVQGTYEHARDAVVGKTHDAAESTKEGAQIASEKAVGAKDATVEKARDTADYTADK  116

Query  1097  GQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAK  1276
                 KDYTV  A++ KD  +   +    YT   A + KD  +      KDY V  A +AK
Sbjct  117   MGEYKDYTVDKAKEAKDKTAEKAKETASYTADKAVEAKDKTAEKMGEYKDYAVDKAVEAK  176

Query  1277  DTLSGAGQTAKDYTVQTAQQAKE-TLSKAGQAAKDYTV----QAKDYASQKAGEAGNKAS  1441
             D  +   +TA +YT   A++AK+ T  K G+  KDYTV    +AKDY +        KA 
Sbjct  177   DKTA---ETA-NYTADKAKEAKDKTTEKMGEY-KDYTVDKAVEAKDYTAA-------KAI  224

Query  1442  EAKERGTEMSKNAASYAGQKVTEAKDVTV  1528
             EAK++  E +     Y  +K TE KDV V
Sbjct  225   EAKDKTAEKTGEYKDYTVEKATEGKDVGV  253


 Score = 57.8 bits (138),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 77/256 (30%), Positives = 114/256 (45%), Gaps = 48/256 (19%)
 Frame = +2

Query  833   LQTAQNKYEKAKNTT-------KENVQSGSQYLVEKAGAAKDTALQKTQQA--YNA----  973
              +  Q  YE A++          E+ + G+Q   EKA  AKD  ++K +    Y A    
Sbjct  59    FRAVQGTYEHARDAVVGKTHDAAESTKEGAQIASEKAVGAKDATVEKARDTADYTADKMG  118

Query  974   -AKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDT  1150
               KD T+ K ++AKD              ++A++ K+T S        YT   A + KD 
Sbjct  119   EYKDYTVDKAKEAKD--------------KTAEKAKETAS--------YTADKAVEAKDK  156

Query  1151  LSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTA  1330
              +      KDY V  A + KD  +   +TA +YT   A++AKD  +      KDYTV  A
Sbjct  157   TAEKMGEYKDYAVDKAVEAKDKTA---ETA-NYTADKAKEAKDKTTEKMGEYKDYTVDKA  212

Query  1331  QQAKETLSKAGQAAKDYTVQA----KDYASQKAGEAGN----KASEAKERGTEMSKNAAS  1486
              +AK+  +     AKD T +     KDY  +KA E  +    K  E K+   E +K A  
Sbjct  213   VEAKDYTAAKAIEAKDKTAEKTGEYKDYTVEKATEGKDVGVSKLGELKDSAVETAKRAMG  272

Query  1487  YAGQKVTEAKDVTVES  1534
             +   K  EAK+  VE+
Sbjct  273   FLSGKTEEAKEKAVET  288



>ref|XP_010277746.1| PREDICTED: seed biotin-containing protein SBP65-like isoform 
X1 [Nelumbo nucifera]
Length=284

 Score = 71.2 bits (173),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 58/172 (34%), Positives = 77/172 (45%), Gaps = 46/172 (27%)
 Frame = +2

Query  776   SLEEIGKYRQTAQQKSIDALQTAQNKYE--------------------------------  859
             +LEE+GKYR  AQQ SIDA++ A+ +YE                                
Sbjct  65    TLEEMGKYRAIAQQSSIDAIRRAEERYEKAKASAAPAAGLEAEGTKESSSTGDATSYVAE  124

Query  860   ---KAKNTTKENVQSGSQYLVEKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSST  1030
                KA +T K+ VQS ++Y   K GAA+DT L+K QQ Y  A+D    K QQA   + +T
Sbjct  125   KGAKAMDTVKQGVQSAAKYASSKGGAARDTILEKNQQGYGYARD----KAQQA---YVAT  177

Query  1031  GQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYT  1186
                 +D   + A Q KD      + A  Y  Q A + KD     G  A  YT
Sbjct  178   ----RDTMARGAGQAKDATVEGSKKAAGYAGQKAVEAKDAAVRTGWAAAHYT  225



>ref|XP_010277747.1| PREDICTED: seed biotin-containing protein SBP65-like isoform 
X2 [Nelumbo nucifera]
Length=258

 Score = 70.9 bits (172),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 58/172 (34%), Positives = 77/172 (45%), Gaps = 46/172 (27%)
 Frame = +2

Query  776   SLEEIGKYRQTAQQKSIDALQTAQNKYE--------------------------------  859
             +LEE+GKYR  AQQ SIDA++ A+ +YE                                
Sbjct  65    TLEEMGKYRAIAQQSSIDAIRRAEERYEKAKASAAPAAGLEAEGTKESSSTGDATSYVAE  124

Query  860   ---KAKNTTKENVQSGSQYLVEKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSST  1030
                KA +T K+ VQS ++Y   K GAA+DT L+K QQ Y  A+D    K QQA   + +T
Sbjct  125   KGAKAMDTVKQGVQSAAKYASSKGGAARDTILEKNQQGYGYARD----KAQQA---YVAT  177

Query  1031  GQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYT  1186
                 +D   + A Q KD      + A  Y  Q A + KD     G  A  YT
Sbjct  178   ----RDTMARGAGQAKDATVEGSKKAAGYAGQKAVEAKDAAVRTGWAAAHYT  225



>ref|XP_007027566.1| Embryonic DC-8-like protein [Theobroma cacao]
 gb|EOY08068.1| Embryonic DC-8-like protein [Theobroma cacao]
Length=389

 Score = 72.0 bits (175),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 82/248 (33%), Positives = 127/248 (51%), Gaps = 14/248 (6%)
 Frame = +2

Query  869   NTTKENVQSGSQYLVEKAGAAKDTALQKTQQAYNAA---KDTTISKTQQAKDTFSSTGQT  1039
             +TTKE      +YL +K+  A + A Q +++A   A   KDT   K  + KD  +   + 
Sbjct  147   DTTKEKTCEYKEYLEQKSREASEQASQASEKAEELAQRAKDTARGKAAEYKDYAAEKAKE  206

Query  1040  AKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAK--DYTVQSAQQTKD  1213
             +     + AK+TKD+ +   +  KD   Q A++TKDT+  AG+TA+   Y  Q+A++  D
Sbjct  207   SAQKANEKAKETKDSAAQKAKETKDSAAQKAKETKDTV--AGKTAEYTGYAAQTAKEATD  264

Query  1214  TLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQA  1393
             T +      KDY  + A++AK T +   Q A +YT   AQ+A+E    A   A +Y    
Sbjct  265   TTTGKAAEYKDYAAEKAKEAKGTTA---QMASEYTGYAAQKAREAKDTAMGKASEY----  317

Query  1394  KDYASQKAGEAGNKASEAKERGTEMSKNAASYAGQKVTEAKDVTVESgkgavgyagkvaE  1573
             KDYA++KA EA +  S+  +   E +K  + YA +K  + KD T E       Y  + A+
Sbjct  318   KDYAAEKAKEAKDATSKKAKEAAEKAKQGSEYAAEKAKDGKDTTAEKMNEYKDYTAEKAK  377

Query  1574  TLKDTATV  1597
               KDT  V
Sbjct  378   ESKDTTVV  385


 Score = 65.1 bits (157),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 87/260 (33%), Positives = 128/260 (49%), Gaps = 33/260 (13%)
 Frame = +2

Query  782   EEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKT--  955
             E+  +Y++  +QKS +A + A    EKA+    E  Q        KA   KD A +K   
Sbjct  151   EKTCEYKEYLEQKSREASEQASQASEKAE----ELAQRAKDTARGKAAEYKDYAAEKAKE  206

Query  956   --QQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAK--DYTV  1123
               Q+A   AK+T  S  Q+AK+T        KD   Q AK+TKDT+  AG+TA+   Y  
Sbjct  207   SAQKANEKAKETKDSAAQKAKET--------KDSAAQKAKETKDTV--AGKTAEYTGYAA  256

Query  1124  QSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQ---QAKDTLSGA  1294
             Q+A++  DT +      KDY  + A++ K T +   Q A +YT  +AQ   +AKDT  G 
Sbjct  257   QTAKEATDTTTGKAAEYKDYAAEKAKEAKGTTA---QMASEYTGYAAQKAREAKDTAMGK  313

Query  1295  GQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGNKASEAKERGTEMSK  1474
                 KDY  + A++AK+  SK  + A +   Q  +YA++       KA + K+   E   
Sbjct  314   ASEYKDYAAEKAKEAKDATSKKAKEAAEKAKQGSEYAAE-------KAKDGKDTTAEKMN  366

Query  1475  NAASYAGQKVTEAKDVTVES  1534
                 Y  +K  E+KD TV S
Sbjct  367   EYKDYTAEKAKESKDTTVVS  386



>ref|XP_001765334.1| predicted protein [Physcomitrella patens]
 gb|EDQ69797.1| predicted protein [Physcomitrella patens]
Length=558

 Score = 72.8 bits (177),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 81/243 (33%), Positives = 120/243 (49%), Gaps = 16/243 (7%)
 Frame = +2

Query  776   SLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKT  955
             +LE IG+YR  AQ++ + AL+ AQ++YE AKNT  +     +    +K     +T  Q T
Sbjct  23    ALESIGQYRGAAQEQGMAALRGAQDRYEAAKNTASQKADETANVAGQKKNTVAETLSQYT  82

Query  956   QQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQT---AKDYTVQ  1126
             Q A        + K QQ K     T Q ++    ++A+QT++T ++A  T   A D T Q
Sbjct  83    QAA--------LDKLQQMK---IGTQQYSEQALNKAAEQTENTKAAAAGTYNKAADTTSQ  131

Query  1127  SAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTA  1306
             +AQ  K T      +AKD  VQ   Q  D  +SA Q+AKD  VQ   QA D  +   Q  
Sbjct  132   TAQSAKGTSMDTAASAKDTAVQKKDQAYDATASAAQSAKDTAVQKKDQAYDAAASTAQNT  191

Query  1307  KDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGEA--GNKASEAKERGTEMSKNA  1480
             KD   +   QA +   +  QAAKD  +   + A+++ G+A  G K + A   GT   K  
Sbjct  192   KDMLAEKTNQASDYAGQTYQAAKDTVMDYTNAAAEQTGQAWEGTKQTSADYAGTAQDKAM  251

Query  1481  ASY  1489
              ++
Sbjct  252   GTW  254


 Score = 62.8 bits (151),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 70/199 (35%), Positives = 94/199 (47%), Gaps = 15/199 (8%)
 Frame = +2

Query  854   YEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTG  1033
             Y KA +TT +  QS     ++ A +AKDTA+QK  QAY    D T S  Q AKDT     
Sbjct  122   YNKAADTTSQTAQSAKGTSMDTAASAKDTAVQKKDQAY----DATASAAQSAKDTAVQKK  177

Query  1034  QTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKD  1213
               A D    +A+ TKD L+     A DY  Q+ Q  KDT+        DYT  +A+QT  
Sbjct  178   DQAYDAAASTAQNTKDMLAEKTNQASDYAGQTYQAAKDTV-------MDYTNAAAEQTGQ  230

Query  1214  TLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQA  1393
                   QT+ DY    A  A+D   G     K    +    A++   +A Q+A D    A
Sbjct  231   AWEGTKQTSADY----AGTAQDKAMGTWDATKQKKAEATGMAQDKAGEAKQSAADTATAA  286

Query  1394  KDYASQKAGEAGNKASEAK  1450
             ++ AS+  G A  KA +AK
Sbjct  287   QEKASEATGAAQEKAGQAK  305



>ref|XP_006294211.1| hypothetical protein CARUB_v10023207mg, partial [Capsella rubella]
 gb|EOA27109.1| hypothetical protein CARUB_v10023207mg, partial [Capsella rubella]
Length=449

 Score = 72.0 bits (175),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 74/226 (33%), Positives = 110/226 (49%), Gaps = 18/226 (8%)
 Frame = +2

Query  857   EKAKNT---TKENVQSGSQYLVEKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSS  1027
             EKAK+T   T E  +  + Y  +KA  AK+    KT       KD T+ K  +AKD  + 
Sbjct  126   EKAKDTADYTAEKAKETANYTADKAVEAKN----KTADKIGEYKDYTVDKAVEAKDKTAE  181

Query  1028  TGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKD-----TLSSAGQTA------  1174
               +   +YT + AK+ KD  +      KDYTV  A + KD      + +  +TA      
Sbjct  182   KAKETANYTAEKAKEAKDKTAGKIGEYKDYTVDKAVEAKDYTAEKAIEAKDKTAEKTGEY  241

Query  1175  KDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLS  1354
             KDYTV+ A + KD   S     KD  V +A++A   LSG  + AK+  V+T   AKE + 
Sbjct  242   KDYTVEKATEGKDVGVSKLSELKDSAVDTAKRAMGFLSGKTEEAKETAVETKDIAKENME  301

Query  1355  KAGQAAKDYTVQAKDYASQKAGEAGNKASEAKERGTEMSKNAASYA  1492
             KAG+A +      +    +   E G+KA E  ++  E +++AA  A
Sbjct  302   KAGEATRQKMEDMRLKGKELKDETGSKAHEVSQKAKENTESAAEKA  347


 Score = 69.3 bits (168),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 64/214 (30%), Positives = 99/214 (46%), Gaps = 15/214 (7%)
 Frame = +2

Query  938   TALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQT-------AKDYTTQSAKQTKDTLSSA  1096
             +  +  Q  Y  A+D  + K+  A ++     Q        AKD T + AK T D  +  
Sbjct  79    SVFRAVQGTYEHARDAVVGKSHDAAESTKEGAQIVSEKAVGAKDATVEKAKDTADYTAEK  138

Query  1097  GQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAK  1276
              +   +YT   A + K+  +      KDYTV  A + KD  +   +   +YT + A++AK
Sbjct  139   AKETANYTADKAVEAKNKTADKIGEYKDYTVDKAVEAKDKTAEKAKETANYTAEKAKEAK  198

Query  1277  DTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQA----KDYASQKAGEAGN----  1432
             D  +G     KDYTV  A +AK+  ++    AKD T +     KDY  +KA E  +    
Sbjct  199   DKTAGKIGEYKDYTVDKAVEAKDYTAEKAIEAKDKTAEKTGEYKDYTVEKATEGKDVGVS  258

Query  1433  KASEAKERGTEMSKNAASYAGQKVTEAKDVTVES  1534
             K SE K+   + +K A  +   K  EAK+  VE+
Sbjct  259   KLSELKDSAVDTAKRAMGFLSGKTEEAKETAVET  292


 Score = 65.1 bits (157),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 72/233 (31%), Positives = 105/233 (45%), Gaps = 42/233 (18%)
 Frame = +2

Query  833   LQTAQNKYEKAKNTT-------KENVQSGSQYLVEKAGAAKDTALQKTQQAYNAAKDTTI  991
              +  Q  YE A++          E+ + G+Q + EKA  AKD  ++K       AKDT  
Sbjct  81    FRAVQGTYEHARDAVVGKSHDAAESTKEGAQIVSEKAVGAKDATVEK-------AKDTAD  133

Query  992   SKTQQAKDTFSSTGQTA--------------KDYTTQSAKQTKDTLSSAGQTAKDYTVQS  1129
                ++AK+T + T   A              KDYT   A + KD  +   +   +YT + 
Sbjct  134   YTAEKAKETANYTADKAVEAKNKTADKIGEYKDYTVDKAVEAKDKTAEKAKETANYTAEK  193

Query  1130  AQQTKDTLSSAGQTAKDYTVQSAQQTKD-----TLSSAGQTA------KDYTVQSAQQAK  1276
             A++ KD  +      KDYTV  A + KD      + +  +TA      KDYTV+ A + K
Sbjct  194   AKEAKDKTAGKIGEYKDYTVDKAVEAKDYTAEKAIEAKDKTAEKTGEYKDYTVEKATEGK  253

Query  1277  DTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYAS---QKAGEA  1426
             D         KD  V TA++A   LS   + AK+  V+ KD A    +KAGEA
Sbjct  254   DVGVSKLSELKDSAVDTAKRAMGFLSGKTEEAKETAVETKDIAKENMEKAGEA  306



>gb|KDO37469.1| hypothetical protein CISIN_1g048372mg, partial [Citrus sinensis]
Length=278

 Score = 70.5 bits (171),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 60/157 (38%), Positives = 86/157 (55%), Gaps = 17/157 (11%)
 Frame = +2

Query  977   KDTTISKTQQAKD-TFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKD-T  1150
             KD    K ++AKD T   TG+  KDYT + A++TKD+     + AKDYT + AQ+ KD T
Sbjct  135   KDDAADKAKEAKDKTLGKTGEY-KDYTAEKARETKDSALQKAKGAKDYTAEKAQEAKDKT  193

Query  1151  LSSAGQTAKDYTVQSAQQTKDT-LSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQT  1327
             L  AG+  KDY+ + A++TKD+ +  AG+  KDYT + A Q KDT           TV  
Sbjct  194   LGKAGEY-KDYSAEKARETKDSGMQKAGEY-KDYTAEQAVQGKDT-----------TVSK  240

Query  1328  AQQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGNKA  1438
               + K++ + A + A D+    K+   QK  E G  A
Sbjct  241   LGELKDSAADAARKAMDFLTGKKEEVKQKTEETGEAA  277


 Score = 64.7 bits (156),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 82/145 (57%), Gaps = 8/145 (6%)
 Frame = +2

Query  914   EKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKD-TLS  1090
             +KA  AKD  L KT +     KD T  K ++ KD+     + AKDYT + A++ KD TL 
Sbjct  140   DKAKEAKDKTLGKTGEY----KDYTAEKARETKDSALQKAKGAKDYTAEKAQEAKDKTLG  195

Query  1091  SAGQTAKDYTVQSAQQTKDT-LSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQ  1267
              AG+  KDY+ + A++TKD+ +  AG+  KDYT + A Q KDT  S     KD    +A+
Sbjct  196   KAGEY-KDYSAEKARETKDSGMQKAGEY-KDYTAEQAVQGKDTTVSKLGELKDSAADAAR  253

Query  1268  QAKDTLSGAGQTAKDYTVQTAQQAK  1342
             +A D L+G  +  K  T +T + AK
Sbjct  254   KAMDFLTGKKEEVKQKTEETGEAAK  278


 Score = 63.9 bits (154),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 65/182 (36%), Positives = 98/182 (54%), Gaps = 28/182 (15%)
 Frame = +2

Query  977   KDTTISKTQQAKDTFSSTGQTA-------KDYTTQ-----------SAKQTKDTLSSAGQ  1102
             K+  + K+ +A +T     ++A       KDYTT+            AK+TK++      
Sbjct  73    KEAVVGKSHEAAETAREGTESAAEKAEEYKDYTTEKAREKLDDNGEKAKETKESAKGKVG  132

Query  1103  TAKDYTVQSAQQTKD-TLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKD  1279
               KD     A++ KD TL   G+  KDYT + A++TKD+     + AKDYT + AQ+AKD
Sbjct  133   EYKDDAADKAKEAKDKTLGKTGEY-KDYTAEKARETKDSALQKAKGAKDYTAEKAQEAKD  191

Query  1280  -TLSGAGQTAKDYTVQTAQQAKET-LSKAGQAAKDYT----VQAKDYASQKAGEAGNKAS  1441
              TL  AG+  KDY+ + A++ K++ + KAG+  KDYT    VQ KD    K GE  + A+
Sbjct  192   KTLGKAGEY-KDYSAEKARETKDSGMQKAGE-YKDYTAEQAVQGKDTTVSKLGELKDSAA  249

Query  1442  EA  1447
             +A
Sbjct  250   DA  251



>gb|ELW68225.1| Protein ALO17 [Tupaia chinensis]
Length=538

 Score = 72.0 bits (175),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 59/194 (30%), Positives = 99/194 (51%), Gaps = 19/194 (10%)
 Frame = +2

Query  977   KDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLS  1156
             KD   S  ++AKDT + T + AKD    S ++ KD  +++G+ AKD    S ++ KDTL+
Sbjct  197   KDVPASTREKAKDTLADTREKAKDVPATSRERAKDAPATSGEKAKDTPATSGEKAKDTLA  256

Query  1157  SAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTL--------SGAGQTAKD  1312
               G+ AKD    +  + KD  +   + AKD    S ++AK+ L        + +G+ AKD
Sbjct  257   GTGEKAKDAPALTKGKAKDVPAGTREKAKDVPATSEEKAKEVLTEKAKEVPATSGEKAKD  316

Query  1313  YTVQTAQQAKETLSKAGQAAKDYTV----QAKDYASQKAGEA-------GNKASEAKERG  1459
                 + ++AK+  +  G+ AKD       +AKD ++   G+A       G K  +A    
Sbjct  317   MPATSEEKAKDVPADTGEKAKDVPATSGEKAKDVSASTKGKAKDTPATSGEKDKDAPATS  376

Query  1460  TEMSKNAASYAGQK  1501
              E +K+A + +G+K
Sbjct  377   GEKAKDAPATSGEK  390


 Score = 63.5 bits (153),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 54/180 (30%), Positives = 88/180 (49%), Gaps = 21/180 (12%)
 Frame = +2

Query  998   TQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAK  1177
             T++AK+  +++G+ AKD    S ++ KD  +  G+ AKD    S ++ KD  +S    AK
Sbjct  300   TEKAKEVPATSGEKAKDMPATSEEKAKDVPADTGEKAKDVPATSGEKAKDVSASTKGKAK  359

Query  1178  DYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSK  1357
             D    S ++ KD  +++G+ AKD    S ++ KD  +G    AKD    + ++ K+  + 
Sbjct  360   DTPATSGEKDKDAPATSGEKAKDAPATSGEKDKDASAGIKGKAKDTPATSGEKDKDAPAT  419

Query  1358  AGQAAKDYTV---------------QAKDYASQKAGEAGNKASEAKERGTEMSKNAASYA  1492
             +G+ AKD +                +AKD  +   GEA  K  +AK  G     N  SYA
Sbjct  420   SGEKAKDASAGIKGKAKDTLALSGGKAKDLPAG-IGEAAGKTEKAKPEG-----NKGSYA  473


 Score = 63.5 bits (153),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 86/170 (51%), Gaps = 22/170 (13%)
 Frame = +2

Query  1043  KDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLS  1222
             KD    + ++ KDTL+   + AKD    S ++ KD  +++G+ AKD    S ++ KDTL+
Sbjct  197   KDVPASTREKAKDTLADTREKAKDVPATSRERAKDAPATSGEKAKDTPATSGEKAKDTLA  256

Query  1223  SAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSK--------AGQAAKD  1378
               G+ AKD    +  +AKD  +G  + AKD    + ++AKE L++        +G+ AKD
Sbjct  257   GTGEKAKDAPALTKGKAKDVPAGTREKAKDVPATSEEKAKEVLTEKAKEVPATSGEKAKD  316

Query  1379  YTVQAKDYASQKAGEAGNKASEAKERGTEMSKNAASYAGQKVTEAKDVTV  1528
                 +++ A     + G KA           K+  + +G+K   AKDV+ 
Sbjct  317   MPATSEEKAKDVPADTGEKA-----------KDVPATSGEK---AKDVSA  352


 Score = 59.3 bits (142),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 60/232 (26%), Positives = 113/232 (49%), Gaps = 13/232 (6%)
 Frame = +2

Query  812   QQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKTQQAYNA------  973
             ++K+ D L   + K +    T++E  +       EKA   KDT     ++A +       
Sbjct  204   REKAKDTLADTREKAKDVPATSRERAKDAPATSGEKA---KDTPATSGEKAKDTLAGTGE  260

Query  974   -AKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDT  1150
              AKD       +AKD  + T + AKD    S ++ K+ L+   + AK+    S ++ KD 
Sbjct  261   KAKDAPALTKGKAKDVPAGTREKAKDVPATSEEKAKEVLT---EKAKEVPATSGEKAKDM  317

Query  1151  LSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTA  1330
              +++ + AKD    + ++ KD  +++G+ AKD +  +  +AKDT + +G+  KD    + 
Sbjct  318   PATSEEKAKDVPADTGEKAKDVPATSGEKAKDVSASTKGKAKDTPATSGEKDKDAPATSG  377

Query  1331  QQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGNKASEAKERGTEMSKNAAS  1486
             ++AK+  + +G+  KD +   K  A      +G K  +A     E +K+A++
Sbjct  378   EKAKDAPATSGEKDKDASAGIKGKAKDTPATSGEKDKDAPATSGEKAKDASA  429



>gb|EYU30783.1| hypothetical protein MIMGU_mgv1a025154mg, partial [Erythranthe 
guttata]
Length=512

 Score = 71.6 bits (174),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 87/284 (31%), Positives = 118/284 (42%), Gaps = 35/284 (12%)
 Frame = +2

Query  776   SLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTT---------KENVQSGSQYLVEKAGA  928
             SLEEI K R  AQQ S++A++ A+++Y KAK+ T            +Q+ +Q    K G 
Sbjct  95    SLEEISKMRGAAQQNSLEAIRAAEDRYNKAKDQTTTGHGQAQGGGGIQTRTQTQTNKGGG  154

Query  929   AKDTALQKTQQAYNAAKDTTISKTQQAKDT---------FSSTGQTAKDYTTQSAKQTKD  1081
                  ++KTQQ    AKD   S+  Q KD               Q AK+Y    A + KD
Sbjct  155   G--AFMEKTQQQPQEAKDVISSQGHQPKDVTAPKAAAAALMEKTQQAKEYAAHKATEAKD  212

Query  1082  TLSSA-------GQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTA  1240
              +SS         Q AK      A   KD     GQTA  Y  + A+  KDT       A
Sbjct  213   VISSKSGTAMEKAQQAKGVIAPKAAALKDIALEKGQTAAQYAAEKAKAAKDTAVDTSMVA  272

Query  1241  KDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQ--------AK  1396
               Y  + A  AKD    +G+ A  Y  + A   K+    AG  A  YT++          
Sbjct  273   AQYAGEKAVAAKDVTVESGKGAAGYAGKVAVGVKDQAVVAGWGAAHYTLEKVAEATKTVA  332

Query  1397  DYASQKAGEAGNKASEAKERGTEMSKNAASYAGQKVTEAKDVTV  1528
                S  AG  G KA  AK++   + +    YAG  +   KD  V
Sbjct  333   GVTSSVAGYTGEKAVVAKDKVAGVGQTVVGYAGDTIAAVKDAVV  376



>ref|XP_009141603.1| PREDICTED: embryonic protein DC-8-like [Brassica rapa]
Length=398

 Score = 71.2 bits (173),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 76/225 (34%), Positives = 107/225 (48%), Gaps = 17/225 (8%)
 Frame = +2

Query  896   GSQYLVEKAGAAKDTALQKTQQA--YNA-----AKDTTISKTQQAKDTFSSTGQTAKDYT  1054
             G++   EKA  AKD  L+K ++   Y A     AKD T  K  + KD        AKD T
Sbjct  88    GAKMASEKAAGAKDATLEKAKETADYTADKAKEAKDKTAEKMGEYKDYTVDKAVEAKDKT  147

Query  1055  TQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQ  1234
              + AK+T +  +   + AKD T Q   + KD      + AKDYT + A + KD  +    
Sbjct  148   AEKAKETANYTADKAKEAKDKTAQKVGEYKDYTVDKAKEAKDYTAEKAIEAKDKTAEKAG  207

Query  1235  TAKDYTVQSAQQAKDT-LSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQ  1411
               KDYTV+ A + K+  +S  G+  KD  + TA++A   LS   +  K   ++ KD A +
Sbjct  208   EYKDYTVEKAAEGKEAGVSKLGEL-KDSAIDTAKRAMGFLSGKTEETKQKAIETKDSAKE  266

Query  1412  KAGEAGN----KASEAKERGTEMSKNAASYAGQKVTEAKDVTVES  1534
             K  EAG     K  E +  G E+       AG+K  EA   T ES
Sbjct  267   KMEEAGEETRRKMEEMRIEGKELKDQ----AGEKAREAAQKTRES  307


 Score = 54.3 bits (129),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 66/226 (29%), Positives = 104/226 (46%), Gaps = 37/226 (16%)
 Frame = +2

Query  848   NKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKTQQAYN-------AAKDTTISKTQQ  1006
             +K ++AK+ T E +     Y V+KA  AKD   +K ++  N        AKD T  K  +
Sbjct  116   DKAKEAKDKTAEKMGEYKDYTVDKAVEAKDKTAEKAKETANYTADKAKEAKDKTAQKVGE  175

Query  1007  AKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYT  1186
              KD      + AKDYT + A + KD  +      KDYTV+ A + K+    AG       
Sbjct  176   YKDYTVDKAKEAKDYTAEKAIEAKDKTAEKAGEYKDYTVEKAAEGKE----AG-------  224

Query  1187  VQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQ  1366
                       +S  G+  KD  + +A++A   LSG  +  K   ++T   AKE + +AG+
Sbjct  225   ----------VSKLGEL-KDSAIDTAKRAMGFLSGKTEETKQKAIETKDSAKEKMEEAGE  273

Query  1367  AAK----DYTVQAKDYASQKAGEAGNKASEAKERGTEMSKNAASYA  1492
               +    +  ++ K+   Q    AG KA EA ++  E + +AA  A
Sbjct  274   ETRRKMEEMRIEGKELKDQ----AGEKAREAAQKTRESTDSAAERA  315



>dbj|BAN67645.1| PvLEA5 protein [Polypedilum vanderplanki]
Length=709

 Score = 72.0 bits (175),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 96/326 (29%), Positives = 135/326 (41%), Gaps = 76/326 (23%)
 Frame = +2

Query  776   SLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTT-------KENVQSGSQYLVEKAGAAK  934
             ++E +   + T  +K  DA      K + AK+ T       KE +       VEK G AK
Sbjct  177   TVETLANAKDTTVEKVTDAKDATVEKLKDAKDATAEFLGEKKEQLVGAKDATVEKLGEAK  236

Query  935   DTALQKTQQAYNA--------------AKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQ  1072
             DT ++K + A +A               KD TI K  +AKD      + AKD T +  K 
Sbjct  237   DTTVEKLKDAKDATAEYLGEKKEQIKGVKDGTIEKLGEAKDVTVDKLKDAKDTTVEKLKD  296

Query  1073  TKDTLSSAGQTAKDYTVQSAQQTKD-------------------TLSSAGQTAKDYTVQS  1195
              KDT     + AKD TV+  +  KD                   T+   G+ AKD TV  
Sbjct  297   AKDTTVEKLKDAKDTTVEKLKDAKDSTAEYLGEKKEQIRGVKDGTVEKMGE-AKDVTVDK  355

Query  1196  AQQTKDTLSSAGQTAKDYTVQSAQQAKD-------------------TLSGAGQTAKDYT  1318
              +  KDT     + AKD TV+  + AKD                   T+   G+ AKD T
Sbjct  356   LKDAKDTTVEKLKDAKDTTVEKLKDAKDSTAEYLGEKKEQIRGVKDGTVEKMGE-AKDVT  414

Query  1319  VQTAQQAKETLSKAGQAAKDYTVQ----AKDYASQKAGEAGN-----------KASEAKE  1453
             V   + AK+T  +  + AKD TV+    AKD  ++  GE              K  EAK+
Sbjct  415   VDKLKDAKDTTVEKLKDAKDTTVEKLKDAKDSTAEYLGEKKEQIRGVKDGTVEKMGEAKD  474

Query  1454  RGTEMSKNAASYAGQKVTEAKDVTVE  1531
                +  K+A     +K+ +AKD TVE
Sbjct  475   VTVDKLKDAKDTTVEKLKDAKDTTVE  500


 Score = 70.1 bits (170),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 96/310 (31%), Positives = 134/310 (43%), Gaps = 54/310 (17%)
 Frame = +2

Query  758   RDHSGLSLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTT-------KENVQSGSQYLVE  916
             +D    ++E++   + T  +K  DA  T   K + AK++T       KE ++      VE
Sbjct  284   KDAKDTTVEKLKDAKDTTVEKLKDAKDTTVEKLKDAKDSTAEYLGEKKEQIRGVKDGTVE  343

Query  917   KAGAAKDTALQKTQQAYNA-------AKDTTISKTQQAKD-------------------T  1018
             K G AKD  + K + A +        AKDTT+ K + AKD                   T
Sbjct  344   KMGEAKDVTVDKLKDAKDTTVEKLKDAKDTTVEKLKDAKDSTAEYLGEKKEQIRGVKDGT  403

Query  1019  FSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKD-TLSSAGQT------AK  1177
                 G+ AKD T    K  KDT     + AKD TV+  +  KD T    G+        K
Sbjct  404   VEKMGE-AKDVTVDKLKDAKDTTVEKLKDAKDTTVEKLKDAKDSTAEYLGEKKEQIRGVK  462

Query  1178  DYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKE----  1345
             D TV+   + KD      + AKD TV+  + AKDT     + AKD T +   + KE    
Sbjct  463   DGTVEKMGEAKDVTVDKLKDAKDTTVEKLKDAKDTTVEKLKDAKDSTAEYLGEKKEQIRG  522

Query  1346  ----TLSKAGQAAKDYTV----QAKDYASQKAGEAGNKASEAKERGTEMSKNAASYAGQK  1501
                 T+ K G+ AKD TV     AKD  ++K   A N  +E      E  K       +K
Sbjct  523   VKDGTVEKMGE-AKDVTVDKLKDAKDTTAEKLKNAKNTTAEYLGEKKEQMKGIKDGTMEK  581

Query  1502  VTEAKDVTVE  1531
             + EAKDVTV+
Sbjct  582   MGEAKDVTVD  591


 Score = 69.3 bits (168),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 85/274 (31%), Positives = 127/274 (46%), Gaps = 23/274 (8%)
 Frame = +2

Query  776   SLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTA---L  946
             ++E++G+ +     K  DA  T   K + AK+TT E ++      VEK   AKD+    L
Sbjct  268   TIEKLGEAKDVTVDKLKDAKDTTVEKLKDAKDTTVEKLKDAKDTTVEKLKDAKDSTAEYL  327

Query  947   QKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQ  1126
              + ++     KD T+ K  +AKD      + AKD T +  K  KDT     + AKD T +
Sbjct  328   GEKKEQIRGVKDGTVEKMGEAKDVTVDKLKDAKDTTVEKLKDAKDTTVEKLKDAKDSTAE  387

Query  1127  SAQQTKD--------TLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKD-  1279
                + K+        T+   G+ AKD TV   +  KDT     + AKD TV+  + AKD 
Sbjct  388   YLGEKKEQIRGVKDGTVEKMGE-AKDVTVDKLKDAKDTTVEKLKDAKDTTVEKLKDAKDS  446

Query  1280  TLSGAGQT------AKDYTVQTAQQAKETLSKAGQAAKDYTVQ----AKDYASQKAGEAG  1429
             T    G+        KD TV+   +AK+      + AKD TV+    AKD   +K  +A 
Sbjct  447   TAEYLGEKKEQIRGVKDGTVEKMGEAKDVTVDKLKDAKDTTVEKLKDAKDTTVEKLKDAK  506

Query  1430  NKASEAKERGTEMSKNAASYAGQKVTEAKDVTVE  1531
             +  +E      E  +       +K+ EAKDVTV+
Sbjct  507   DSTAEYLGEKKEQIRGVKDGTVEKMGEAKDVTVD  540


 Score = 67.0 bits (162),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 89/289 (31%), Positives = 128/289 (44%), Gaps = 49/289 (17%)
 Frame = +2

Query  809   AQQKSIDALQTAQN----KYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKTQQAYNA-  973
             A+   +D L  A++    K   AK+ T E + +     VEK   AKD  ++K + A +A 
Sbjct  151   AKDTVVDTLAAAKDTVVEKLVGAKDATVETLANAKDTTVEKVTDAKDATVEKLKDAKDAT  210

Query  974   -------------AKDTTISKTQQAKDTFSSTGQTAKDYTT-------QSAKQTKD-TLS  1090
                          AKD T+ K  +AKDT     + AKD T        +  K  KD T+ 
Sbjct  211   AEFLGEKKEQLVGAKDATVEKLGEAKDTTVEKLKDAKDATAEYLGEKKEQIKGVKDGTIE  270

Query  1091  SAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQ  1270
               G+ AKD TV   +  KDT     + AKD TV+  +  KDT     + AKD T +   +
Sbjct  271   KLGE-AKDVTVDKLKDAKDTTVEKLKDAKDTTVEKLKDAKDTTVEKLKDAKDSTAEYLGE  329

Query  1271  AKDTLSGAGQ-------TAKDYTVQTAQQAKETLSKAGQAAKDYTVQ----AKDYASQKA  1417
              K+ + G           AKD TV   + AK+T  +  + AKD TV+    AKD  ++  
Sbjct  330   KKEQIRGVKDGTVEKMGEAKDVTVDKLKDAKDTTVEKLKDAKDTTVEKLKDAKDSTAEYL  389

Query  1418  GE-----------AGNKASEAKERGTEMSKNAASYAGQKVTEAKDVTVE  1531
             GE              K  EAK+   +  K+A     +K+ +AKD TVE
Sbjct  390   GEKKEQIRGVKDGTVEKMGEAKDVTVDKLKDAKDTTVEKLKDAKDTTVE  438


 Score = 67.0 bits (162),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 88/280 (31%), Positives = 129/280 (46%), Gaps = 39/280 (14%)
 Frame = +2

Query  761   DHSGLSLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDT  940
             D++G  +EE+ +     + K I  L  A  K   AK+T  + + +    +VEK   AKD 
Sbjct  124   DNTGDKIEEVKE-----EGKGI--LSAAAEKLVAAKDTVVDTLAAAKDTVVEKLVGAKDA  176

Query  941   ALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYT  1120
                 T +    AKDTT+ K   AKD      + AKD T +   + K+ L      AKD T
Sbjct  177   ----TVETLANAKDTTVEKVTDAKDATVEKLKDAKDATAEFLGEKKEQLVG----AKDAT  228

Query  1121  VQSAQQTKDTLSSAGQTAKDYTVQSAQQTKD--------TLSSAGQTAKDYTVQSAQQAK  1276
             V+   + KDT     + AKD T +   + K+        T+   G+ AKD TV   + AK
Sbjct  229   VEKLGEAKDTTVEKLKDAKDATAEYLGEKKEQIKGVKDGTIEKLGE-AKDVTVDKLKDAK  287

Query  1277  DTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQ-----------AKDYASQKAGE  1423
             DT     + AKD TV+  + AK+T  +  + AKD T +            KD   +K GE
Sbjct  288   DTTVEKLKDAKDTTVEKLKDAKDTTVEKLKDAKDSTAEYLGEKKEQIRGVKDGTVEKMGE  347

Query  1424  AG----NKASEAKERGTEMSKNAASYAGQKVTEAKDVTVE  1531
             A     +K  +AK+   E  K+A     +K+ +AKD T E
Sbjct  348   AKDVTVDKLKDAKDTTVEKLKDAKDTTVEKLKDAKDSTAE  387


 Score = 60.5 bits (145),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 83/284 (29%), Positives = 119/284 (42%), Gaps = 77/284 (27%)
 Frame = +2

Query  776   SLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQ----SGSQYL-----------  910
             ++E++G+ +     K  DA  T   K + AK+TT E ++    S ++YL           
Sbjct  341   TVEKMGEAKDVTVDKLKDAKDTTVEKLKDAKDTTVEKLKDAKDSTAEYLGEKKEQIRGVK  400

Query  911   ---VEKAGAAKDTALQKTQQAYNA-------AKDTTISKTQQAKD---------------  1015
                VEK G AKD  + K + A +        AKDTT+ K + AKD               
Sbjct  401   DGTVEKMGEAKDVTVDKLKDAKDTTVEKLKDAKDTTVEKLKDAKDSTAEYLGEKKEQIRG  460

Query  1016  ----TFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKD------------  1147
                 T    G+ AKD T    K  KDT     + AKD TV+  +  KD            
Sbjct  461   VKDGTVEKMGE-AKDVTVDKLKDAKDTTVEKLKDAKDTTVEKLKDAKDSTAEYLGEKKEQ  519

Query  1148  -------TLSSAGQTAKDYTVQSAQQTKDT----LSSAGQTAKDYTVQSAQQAK----DT  1282
                    T+   G+ AKD TV   +  KDT    L +A  T  +Y  +  +Q K     T
Sbjct  520   IRGVKDGTVEKMGE-AKDVTVDKLKDAKDTTAEKLKNAKNTTAEYLGEKKEQMKGIKDGT  578

Query  1283  LSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQK  1414
             +   G+ AKD TV   + AK+T ++    AKD T+   DY  +K
Sbjct  579   MEKMGE-AKDVTVDKLKDAKDTTAEKWNNAKDATI---DYFGEK  618


 Score = 57.4 bits (137),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 74/247 (30%), Positives = 109/247 (44%), Gaps = 40/247 (16%)
 Frame = +2

Query  776   SLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQ----SGSQYLVEK---AGAAK  934
             ++E++G+ +     K  DA  T   K + AK+TT E ++    S ++YL EK       K
Sbjct  403   TVEKMGEAKDVTVDKLKDAKDTTVEKLKDAKDTTVEKLKDAKDSTAEYLGEKKEQIRGVK  462

Query  935   DTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKD-----------  1081
             D  ++K  +A    KD T+ K + AKDT     + AKD T +  K  KD           
Sbjct  463   DGTVEKMGEA----KDVTVDKLKDAKDTTVEKLKDAKDTTVEKLKDAKDSTAEYLGEKKE  518

Query  1082  --------TLSSAGQTAKDYTVQSAQQTKDT----LSSAGQTAKDYTVQSAQQTK----D  1213
                     T+   G+ AKD TV   +  KDT    L +A  T  +Y  +  +Q K     
Sbjct  519   QIRGVKDGTVEKMGE-AKDVTVDKLKDAKDTTAEKLKNAKNTTAEYLGEKKEQMKGIKDG  577

Query  1214  TLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQA  1393
             T+   G+ AKD TV   + AKDT +     AKD T+    + KE +      A D     
Sbjct  578   TMEKMGE-AKDVTVDKLKDAKDTTAEKWNNAKDATIDYFGEKKEQMKGVKDGAMDKMGNT  636

Query  1394  KDYASQK  1414
             KD  ++K
Sbjct  637   KDAIAEK  643



>ref|XP_008348664.1| PREDICTED: embryonic protein DC-8-like [Malus domestica]
Length=307

 Score = 69.7 bits (169),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 71/192 (37%), Positives = 101/192 (53%), Gaps = 30/192 (16%)
 Frame = +2

Query  1031  GQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAK----------D  1180
             G+  KDYTTQ AK+T D   +AG+   +YT  + ++ K T   A +T +          D
Sbjct  88    GKEYKDYTTQKAKETTD---AAGEKINEYTETAEEKAKQTAEKANETKESAKGKVGEYAD  144

Query  1181  YTVQSAQQTKDTLS----SAGQTA---KDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQA  1339
             YT + A++TKDT +     A Q A   KD   Q A++AKD   G      +Y  + A++A
Sbjct  145   YTAEKAKETKDTAAQKANEAAQKAKETKDSAAQKAKEAKDATMGKAGEYTNYAAEKAKEA  204

Query  1340  KE-TLSKAGQAAKDYTV----QAKDYASQKAGE----AGNKASEAKERGTEMSKNAASYA  1492
             K+ T++KAG+   +YT     +AKD    KAGE    A  KA EAK+  T  +    +YA
Sbjct  205   KDTTVNKAGEYT-NYTAEKAKEAKDTTMNKAGEYTNYAAEKAKEAKDTTTNKAGEYTNYA  263

Query  1493  GQKVTEAKDVTV  1528
              +K  EAKD TV
Sbjct  264   AEKAKEAKDTTV  275


 Score = 68.2 bits (165),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 75/209 (36%), Positives = 118/209 (56%), Gaps = 24/209 (11%)
 Frame = +2

Query  782   EEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKTQQ  961
             E+I +Y +TA++K   A QTA+ K  + K + K  V   + Y  EKA   KDTA QK  +
Sbjct  108   EKINEYTETAEEK---AKQTAE-KANETKESAKGKVGEYADYTAEKAKETKDTAAQKANE  163

Query  962   AYNAAKDTTISKTQQAKDTFSSTGQTAKDYTT---QSAKQTKD-TLSSAGQTAKDYTVQS  1129
             A   AK+T  S  Q+AK+   +T   A +YT    + AK+ KD T++ AG+   +YT + 
Sbjct  164   AAQKAKETKDSAAQKAKEAKDATMGKAGEYTNYAAEKAKEAKDTTVNKAGEYT-NYTAEK  222

Query  1130  AQQTKD-TLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKD-TLSGAGQT  1303
             A++ KD T++ AG+   +Y  + A++ KDT ++      +Y  + A++AKD T++ AG+ 
Sbjct  223   AKEAKDTTMNKAGEYT-NYAAEKAKEAKDTTTNKAGEYTNYAAEKAKEAKDTTVNKAGE-  280

Query  1304  AKDYTVQTAQQAKETLSKAGQAAKDYTVQ  1390
                YT   A++AKE        AKD TV+
Sbjct  281   ---YTNYAAEKAKE--------AKDETVK  298


 Score = 67.4 bits (163),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 76/207 (37%), Positives = 113/207 (55%), Gaps = 35/207 (17%)
 Frame = +2

Query  998   TQQAKDTFSSTGQTAKDYTT---QSAKQTKDTLSSAGQTAK-------DYTVQSAQQTKD  1147
             TQ+AK+T  + G+   +YT    + AKQT +  +   ++AK       DYT + A++TKD
Sbjct  96    TQKAKETTDAAGEKINEYTETAEEKAKQTAEKANETKESAKGKVGEYADYTAEKAKETKD  155

Query  1148  TLS----SAGQTAK---DYTVQSAQQTKD-TLSSAGQTAKDYTVQSAQQAKDT-LSGAGQ  1300
             T +     A Q AK   D   Q A++ KD T+  AG+   +Y  + A++AKDT ++ AG+
Sbjct  156   TAAQKANEAAQKAKETKDSAAQKAKEAKDATMGKAGEYT-NYAAEKAKEAKDTTVNKAGE  214

Query  1301  TAKDYTVQTAQQAKE----TLSKAGQA---AKDYTVQAKDYASQKAGE----AGNKASEA  1447
                 YT  TA++AKE    T++KAG+    A +   +AKD  + KAGE    A  KA EA
Sbjct  215   ----YTNYTAEKAKEAKDTTMNKAGEYTNYAAEKAKEAKDTTTNKAGEYTNYAAEKAKEA  270

Query  1448  KERGTEMSKNAASYAGQKVTEAKDVTV  1528
             K+     +    +YA +K  EAKD TV
Sbjct  271   KDTTVNKAGEYTNYAAEKAKEAKDETV  297



>gb|KGN47249.1| hypothetical protein Csa_6G235570 [Cucumis sativus]
Length=465

 Score = 70.9 bits (172),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 66/220 (30%), Positives = 102/220 (46%), Gaps = 35/220 (16%)
 Frame = +2

Query  776   SLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKT  955
             SLEEI  YR  +Q++S +A++ A+ +YEKA      N +S +Q      G    T   + 
Sbjct  153   SLEEISNYRAISQERSNEAIRAAKERYEKA------NRESLNQ------GVRGKTEELEQ  200

Query  956   QQAYNAAKDTT-----ISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYT  1120
             ++     ++T       +  +  K+T +S  +TAKDYT   A++           AK YT
Sbjct  201   RETEEGEENTVEGGGEWTGLETVKETLTSATKTAKDYTVPIAEK-----------AKGYT  249

Query  1121  VQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQ  1300
             VQ A + KD   SAGQ    Y  + A   KD    +G+ A +Y  ++A+  KD    AG 
Sbjct  250   VQKAIEAKDVAVSAGQKTAHYLEEKAVAAKDVAVESGKVAAEYAGKAAEDLKDKAVVAGW  309

Query  1301  TAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAG  1420
             +   Y+  TA +         +AA     +A +YA   AG
Sbjct  310   STAHYSCDTAVEGT-------KAAARLVKEAAEYAGAIAG  342



>ref|NP_001235522.1| seed biotin-containing protein SBP65 [Glycine max]
 sp|Q39846.1|SBP65_SOYBN RecName: Full=Seed biotin-containing protein SBP65; AltName: 
Full=BP75; AltName: Full=Seed biotinylated protein of 65 kDa 
[Glycine max]
 gb|AAC61783.1| LEA protein [Glycine max]
 gb|KHN36687.1| Seed biotin-containing protein SBP65 [Glycine soja]
Length=643

 Score = 71.2 bits (173),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 66/207 (32%), Positives = 98/207 (47%), Gaps = 19/207 (9%)
 Frame = +2

Query  830   ALQTAQNKYEKAKNTTKENVQSGSQYLVEK-------AGAAKDTALQKTQQAYNAAKDTT  988
             A Q  + KYE+AK    E + + +Q   EK       A  AKD  L+K QQ Y   KDT 
Sbjct  232   ATQGVKEKYERAKQAASETLNTTTQTAQEKSAQAKNLAAQAKDATLEKGQQGYAVTKDTI  291

Query  989   ISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQ  1168
              S  + A +  +   + AKDYT Q+A++ K    SAG T   Y  + A Q KD    +G+
Sbjct  292   SSAAKTASEKTAPVAEKAKDYTLQAAEKAK----SAGGTTASYVGEKAVQAKDVAVESGK  347

Query  1169  TAKDYTVQSAQQTKDTLSSAGQTAKDY----TVQSAQQAKDTLSG----AGQTAKDYTVQ  1324
             +A  Y  + A   +D  ++ G  A  +    TV+  + A   + G    AG  A +    
Sbjct  348   SAAGYAAKVAADLRDKATAVGWAAAHFSAEKTVEGTKAAAHVVEGAAGYAGHKAAELASM  407

Query  1325  TAQQAKETLSKAGQAAKDYTVQAKDYA  1405
             +A   K   + AG+ AK+YT + K+ A
Sbjct  408   SAGAVKGLAASAGETAKEYTAKKKEEA  434



>gb|ACS49840.1| seed biotinylated protein 68 kDa isoform [Glycine max]
Length=643

 Score = 70.9 bits (172),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 66/207 (32%), Positives = 98/207 (47%), Gaps = 19/207 (9%)
 Frame = +2

Query  830   ALQTAQNKYEKAKNTTKENVQSGSQYLVEK-------AGAAKDTALQKTQQAYNAAKDTT  988
             A Q  + KYE+AK    E + + +Q   EK       A  AKD  L+K QQ Y   KDT 
Sbjct  232   ATQGVKEKYERAKQAASETLNTTTQTAQEKSAQAKNLAAQAKDATLEKGQQGYAVTKDTI  291

Query  989   ISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQ  1168
              S  + A +  +   + AKDYT Q+A++ K    SAG T   Y  + A Q KD    +G+
Sbjct  292   SSAAKTASEKTAPVAEKAKDYTLQAAEKAK----SAGGTTASYVGEKAVQAKDVAVESGK  347

Query  1169  TAKDYTVQSAQQTKDTLSSAGQTAKDY----TVQSAQQAKDTLSG----AGQTAKDYTVQ  1324
             +A  Y  + A   +D  ++ G  A  +    TV+  + A   + G    AG  A +    
Sbjct  348   SAAGYAAKVAADLRDKATAVGWAAAHFSAEKTVEGTKAAAHVVEGAAGYAGHKAAELASM  407

Query  1325  TAQQAKETLSKAGQAAKDYTVQAKDYA  1405
             +A   K   + AG+ AK+YT + K+ A
Sbjct  408   SAGAVKGLAASAGETAKEYTAKKKEEA  434



>ref|XP_004149384.1| PREDICTED: seed biotin-containing protein SBP65-like [Cucumis 
sativus]
Length=450

 Score = 70.5 bits (171),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 61/207 (29%), Positives = 99/207 (48%), Gaps = 28/207 (14%)
 Frame = +2

Query  776   SLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKT  955
             SLEEI  YR  +Q++S +A++ A+ +YEKA      N +S +Q      G    T   + 
Sbjct  153   SLEEISNYRAISQERSNEAIRAAKERYEKA------NRESLNQ------GVRGKTEELEQ  200

Query  956   QQAYNAAKDTT-----ISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYT  1120
             ++     ++T       +  +  K+T +S  +TAKDYT   A++           AK YT
Sbjct  201   RETEEGEENTVEGGGEWTGLETVKETLTSATKTAKDYTVPIAEK-----------AKGYT  249

Query  1121  VQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQ  1300
             VQ A + KD   SAGQ    Y  + A   KD    +G+ A +Y  ++A+  KD    AG 
Sbjct  250   VQKAIEAKDVAVSAGQKTAHYLEEKAVAAKDVAVESGKVAAEYAGKAAEDLKDKAVVAGW  309

Query  1301  TAKDYTVQTAQQAKETLSKAGQAAKDY  1381
             +   Y+  TA +  +  ++  + A +Y
Sbjct  310   STAHYSCDTAVEGTKAAARLVKEAAEY  336



>ref|NP_001189549.1| late embryogenesis abundant domain-containing protein [Arabidopsis 
thaliana]
 gb|AEC06759.1| late embryogenesis abundant domain-containing protein [Arabidopsis 
thaliana]
Length=417

 Score = 70.1 bits (170),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 80/260 (31%), Positives = 102/260 (39%), Gaps = 20/260 (8%)
 Frame = +2

Query  776   SLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKT  955
             + +  G  +  A+ K+  A   A +K   AKN   EN      +  +KAG AKD A +K 
Sbjct  52    AYDNAGYAKDFAENKAEYAKDFAYDKAGDAKNMAYENAGYAKDFAYDKAGDAKDMAYEKA  111

Query  956   QQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQ  1135
               A    KD    K   AKD    T   AKD+        KD        AKD   + A 
Sbjct  112   GHA----KDFAYDKAGNAKDMAYETAGYAKDFAYDKGGYAKDVAYDKAGNAKDMAYEKAG  167

Query  1136  QTKDTLSSAGQTAKDYTVQ-------SAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGA  1294
               KD      +  KD+T         SAQ   D+       AKD   + A   KD     
Sbjct  168   NAKDMAYEKAEHIKDFTYDKVGSAYGSAQSMMDSGYDKAGDAKDMAYEKAGIVKDMAYDK  227

Query  1295  GQTAKDYTVQTAQQAKET-LSKAGQAAKDYTVQAKDYASQKAGEAGNKASEAKERGTEMS  1471
                AKD   + A  AK+    KAG A        KD A  K G A   A +AK+ G E +
Sbjct  228   AGDAKDVAYEKAGIAKDMAYDKAGNA--------KDMAYDKVGSAYGSAQKAKDSGYEKA  279

Query  1472  KNAASYAGQKVTEAKDVTVE  1531
               A  YA +K   AKD+  E
Sbjct  280   GEAKDYAYKKAGNAKDIAYE  299


 Score = 54.7 bits (130),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 71/241 (29%), Positives = 97/241 (40%), Gaps = 19/241 (8%)
 Frame = +2

Query  854   YEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTG  1033
             Y+K+K+  ++  Q+   Y  +KA   KD+A      A    KD   +K + AKD      
Sbjct  23    YQKSKDEARKAAQAAENYAYDKANYVKDSAYDNAGYA----KDFAENKAEYAKDFAYDKA  78

Query  1034  QTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKD  1213
               AK+   ++A   KD        AKD   + A   KD        AKD   ++A   KD
Sbjct  79    GDAKNMAYENAGYAKDFAYDKAGDAKDMAYEKAGHAKDFAYDKAGNAKDMAYETAGYAKD  138

Query  1214  TLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKE-TLSKAGQA-------  1369
                  G  AKD     A  AKD        AKD   + A+  K+ T  K G A       
Sbjct  139   FAYDKGGYAKDVAYDKAGNAKDMAYEKAGNAKDMAYEKAEHIKDFTYDKVGSAYGSAQSM  198

Query  1370  ---AKDYTVQAKDYASQKAG----EAGNKASEAKERGTEMSKNAASYAGQKVTEAKDVTV  1528
                  D    AKD A +KAG     A +KA +AK+   E +  A   A  K   AKD+  
Sbjct  199   MDSGYDKAGDAKDMAYEKAGIVKDMAYDKAGDAKDVAYEKAGIAKDMAYDKAGNAKDMAY  258

Query  1529  E  1531
             +
Sbjct  259   D  259



>dbj|BAH56960.1| AT3G53040 [Arabidopsis thaliana]
Length=275

 Score = 68.6 bits (166),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 68/205 (33%), Positives = 107/205 (52%), Gaps = 20/205 (10%)
 Frame = +2

Query  875   TKENVQSGSQYLVEKA-------GAAKDTALQKTQQAYNAAKDTTISKTQQAKD-TFSST  1030
             T E+ + G+    EKA       G  +D+  QKT++      D T  K ++AKD T   T
Sbjct  76    TAESTREGADIASEKAAGMRDTTGEVRDSTAQKTKET----ADYTADKAREAKDKTADKT  131

Query  1031  GQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTK  1210
              +TA DY  + A++ KD  +   +   +YT + A++ KD  +      KDYT + A++ K
Sbjct  132   KETA-DYAAEKAREAKDRTADKTKETAEYTAEKAREAKDKTADKLGEYKDYTAEKAKEAK  190

Query  1211  DTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQ  1390
             DT +      KDYTV  A++AKD  +   + AK+    T+ +A+ET  K  +   +Y   
Sbjct  191   DTTAEKLGEYKDYTVDKAKEAKDKTA---EKAKETAEYTSDKARETKDKTAEKVGEY---  244

Query  1391  AKDYASQKAGEAGNKASEAKERGTE  1465
              KDY ++KA E  +KA EAK++  E
Sbjct  245   -KDYTAEKAKETADKAREAKDKTAE  268


 Score = 55.5 bits (132),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 62/193 (32%), Positives = 95/193 (49%), Gaps = 29/193 (15%)
 Frame = +2

Query  866   KNTTKENVQSGSQYLVEKAGAAKDTALQKTQQA--YNA-----AKDTTISKTQQAKDTFS  1024
             +++T +  +  + Y  +KA  AKD    KT++   Y A     AKD T  KT+       
Sbjct  102   RDSTAQKTKETADYTADKAREAKDKTADKTKETADYAAEKAREAKDRTADKTK-------  154

Query  1025  STGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQ  1204
                +TA +YT + A++ KD  +      KDYT + A++ KDT +      KDYTV  A++
Sbjct  155   ---ETA-EYTAEKAREAKDKTADKLGEYKDYTAEKAKEAKDTTAEKLGEYKDYTVDKAKE  210

Query  1205  TKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYT  1384
              KD  +   +   +YT   A++ KD  +      KDY   TA++AKET  KA        
Sbjct  211   AKDKTAEKAKETAEYTSDKARETKDKTAEKVGEYKDY---TAEKAKETADKA--------  259

Query  1385  VQAKDYASQKAGE  1423
              +AKD  ++K GE
Sbjct  260   REAKDKTAEKVGE  272



>ref|XP_005763345.1| hypothetical protein EMIHUDRAFT_48134, partial [Emiliania huxleyi 
CCMP1516]
 ref|XP_005763641.1| hypothetical protein EMIHUDRAFT_48184, partial [Emiliania huxleyi 
CCMP1516]
 gb|EOD10916.1| hypothetical protein EMIHUDRAFT_48134, partial [Emiliania huxleyi 
CCMP1516]
 gb|EOD11212.1| hypothetical protein EMIHUDRAFT_48184, partial [Emiliania huxleyi 
CCMP1516]
Length=126

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/126 (25%), Positives = 72/126 (57%), Gaps = 0/126 (0%)
 Frame = +2

Query  1001  QQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKD  1180
             ++ +DT +S  +  +D    +A++ +DT +SA +  +D    +A++ +DT +SA +  +D
Sbjct  1     ERVRDTRASAAERVRDTRASAAERVRDTRASAAERVRDTRASAAERVRDTRASAAERVRD  60

Query  1181  YTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKA  1360
                 +A++ +DT +SA +  +D    +A++ +DT + A +  +D     A++ ++T + A
Sbjct  61    TRASAAERVRDTRASAAERVRDTRASAAERVRDTRASAAERVRDTRASAAERVRDTRASA  120

Query  1361  GQAAKD  1378
              +  +D
Sbjct  121   AERVRD  126


 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 70/123 (57%), Gaps = 0/123 (0%)
 Frame = +2

Query  977   KDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLS  1156
             +DT  S  ++ +DT +S  +  +D    +A++ +DT +SA +  +D    +A++ +DT +
Sbjct  4     RDTRASAAERVRDTRASAAERVRDTRASAAERVRDTRASAAERVRDTRASAAERVRDTRA  63

Query  1157  SAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQ  1336
             SA +  +D    +A++ +DT +SA +  +D    +A++ +DT + A +  +D     A++
Sbjct  64    SAAERVRDTRASAAERVRDTRASAAERVRDTRASAAERVRDTRASAAERVRDTRASAAER  123

Query  1337  AKE  1345
              ++
Sbjct  124   VRD  126



>ref|NP_179425.1| late embryogenesis abundant domain-containing protein [Arabidopsis 
thaliana]
 gb|AAD15503.1| similar to late embryogenesis abundant proteins [Arabidopsis 
thaliana]
 dbj|BAE98422.1| similar to late embryogenesis abundant proteins [Arabidopsis 
thaliana]
 gb|AEC06758.1| late embryogenesis abundant domain-containing protein [Arabidopsis 
thaliana]
Length=456

 Score = 70.1 bits (170),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 80/260 (31%), Positives = 102/260 (39%), Gaps = 20/260 (8%)
 Frame = +2

Query  776   SLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKT  955
             + +  G  +  A+ K+  A   A +K   AKN   EN      +  +KAG AKD A +K 
Sbjct  91    AYDNAGYAKDFAENKAEYAKDFAYDKAGDAKNMAYENAGYAKDFAYDKAGDAKDMAYEKA  150

Query  956   QQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQ  1135
               A    KD    K   AKD    T   AKD+        KD        AKD   + A 
Sbjct  151   GHA----KDFAYDKAGNAKDMAYETAGYAKDFAYDKGGYAKDVAYDKAGNAKDMAYEKAG  206

Query  1136  QTKDTLSSAGQTAKDYTVQ-------SAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGA  1294
               KD      +  KD+T         SAQ   D+       AKD   + A   KD     
Sbjct  207   NAKDMAYEKAEHIKDFTYDKVGSAYGSAQSMMDSGYDKAGDAKDMAYEKAGIVKDMAYDK  266

Query  1295  GQTAKDYTVQTAQQAKET-LSKAGQAAKDYTVQAKDYASQKAGEAGNKASEAKERGTEMS  1471
                AKD   + A  AK+    KAG A        KD A  K G A   A +AK+ G E +
Sbjct  267   AGDAKDVAYEKAGIAKDMAYDKAGNA--------KDMAYDKVGSAYGSAQKAKDSGYEKA  318

Query  1472  KNAASYAGQKVTEAKDVTVE  1531
               A  YA +K   AKD+  E
Sbjct  319   GEAKDYAYKKAGNAKDIAYE  338


 Score = 54.7 bits (130),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 71/241 (29%), Positives = 97/241 (40%), Gaps = 19/241 (8%)
 Frame = +2

Query  854   YEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTG  1033
             Y+K+K+  ++  Q+   Y  +KA   KD+A      A    KD   +K + AKD      
Sbjct  62    YQKSKDEARKAAQAAENYAYDKANYVKDSAYDNAGYA----KDFAENKAEYAKDFAYDKA  117

Query  1034  QTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKD  1213
               AK+   ++A   KD        AKD   + A   KD        AKD   ++A   KD
Sbjct  118   GDAKNMAYENAGYAKDFAYDKAGDAKDMAYEKAGHAKDFAYDKAGNAKDMAYETAGYAKD  177

Query  1214  TLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKE-TLSKAGQA-------  1369
                  G  AKD     A  AKD        AKD   + A+  K+ T  K G A       
Sbjct  178   FAYDKGGYAKDVAYDKAGNAKDMAYEKAGNAKDMAYEKAEHIKDFTYDKVGSAYGSAQSM  237

Query  1370  ---AKDYTVQAKDYASQKAG----EAGNKASEAKERGTEMSKNAASYAGQKVTEAKDVTV  1528
                  D    AKD A +KAG     A +KA +AK+   E +  A   A  K   AKD+  
Sbjct  238   MDSGYDKAGDAKDMAYEKAGIVKDMAYDKAGDAKDVAYEKAGIAKDMAYDKAGNAKDMAY  297

Query  1529  E  1531
             +
Sbjct  298   D  298



>gb|KDO60989.1| hypothetical protein CISIN_1g041124mg, partial [Citrus sinensis]
Length=276

 Score = 68.2 bits (165),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 59/157 (38%), Positives = 85/157 (54%), Gaps = 17/157 (11%)
 Frame = +2

Query  977   KDTTISKTQQAKD-TFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKD-T  1150
             KD    K ++AKD T   TG+  KDYT + A++TKD+     +  KDYT + A + KD T
Sbjct  133   KDDAAEKAKEAKDKTLGKTGEY-KDYTAEKARETKDSALQKAKETKDYTAEKAAEAKDKT  191

Query  1151  LSSAGQTAKDYTVQSAQQTKDT-LSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQT  1327
             L  AG+  KDYT + A++TKD+ +  AG+  KDYT + A Q KDT           TV  
Sbjct  192   LGKAGEY-KDYTAEKARETKDSAMQKAGEY-KDYTAEQAVQGKDT-----------TVSK  238

Query  1328  AQQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGNKA  1438
               + K++ ++A + A D+    K+   QK  E G  A
Sbjct  239   LGELKDSAAEAARKAMDFLTGKKEEVKQKTEETGEAA  275


 Score = 66.6 bits (161),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 58/146 (40%), Positives = 81/146 (55%), Gaps = 8/146 (5%)
 Frame = +2

Query  911   VEKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKD-TL  1087
              EKA  AKD  L KT +     KD T  K ++ KD+     +  KDYT + A + KD TL
Sbjct  137   AEKAKEAKDKTLGKTGEY----KDYTAEKARETKDSALQKAKETKDYTAEKAAEAKDKTL  192

Query  1088  SSAGQTAKDYTVQSAQQTKDT-LSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSA  1264
               AG+  KDYT + A++TKD+ +  AG+  KDYT + A Q KDT  S     KD   ++A
Sbjct  193   GKAGEY-KDYTAEKARETKDSAMQKAGEY-KDYTAEQAVQGKDTTVSKLGELKDSAAEAA  250

Query  1265  QQAKDTLSGAGQTAKDYTVQTAQQAK  1342
             ++A D L+G  +  K  T +T + AK
Sbjct  251   RKAMDFLTGKKEEVKQKTEETGEAAK  276


 Score = 65.5 bits (158),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 66/183 (36%), Positives = 98/183 (54%), Gaps = 28/183 (15%)
 Frame = +2

Query  974   AKDTTISKTQQAKDTFSSTGQTA-------KDYTTQ-----------SAKQTKDTLSSAG  1099
             AK+  + K+ +A +T     ++A       KDYTT+            AK+TK++     
Sbjct  70    AKEAVVGKSHEAAETAREGTESAAEKAEEYKDYTTEKARERLDDYGEKAKETKESAKGKV  129

Query  1100  QTAKDYTVQSAQQTKD-TLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAK  1276
                KD   + A++ KD TL   G+  KDYT + A++TKD+     +  KDYT + A +AK
Sbjct  130   GEYKDDAAEKAKEAKDKTLGKTGEY-KDYTAEKARETKDSALQKAKETKDYTAEKAAEAK  188

Query  1277  D-TLSGAGQTAKDYTVQTAQQAKET-LSKAGQAAKDYT----VQAKDYASQKAGEAGNKA  1438
             D TL  AG+  KDYT + A++ K++ + KAG+  KDYT    VQ KD    K GE  + A
Sbjct  189   DKTLGKAGEY-KDYTAEKARETKDSAMQKAGE-YKDYTAEQAVQGKDTTVSKLGELKDSA  246

Query  1439  SEA  1447
             +EA
Sbjct  247   AEA  249


 Score = 61.6 bits (148),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 60/178 (34%), Positives = 97/178 (54%), Gaps = 21/178 (12%)
 Frame = +2

Query  887   VQSGSQYLVEKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAK-------  1045
             +++  + +V K+  A +TA + T+ A   A++     T++A++     G+ AK       
Sbjct  67    LENAKEAVVGKSHEAAETAREGTESAAEKAEEYKDYTTEKARERLDDYGEKAKETKESAK  126

Query  1046  -------DYTTQSAKQTKD-TLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQ  1201
                    D   + AK+ KD TL   G+  KDYT + A++TKD+     +  KDYT + A 
Sbjct  127   GKVGEYKDDAAEKAKEAKDKTLGKTGEY-KDYTAEKARETKDSALQKAKETKDYTAEKAA  185

Query  1202  QTKD-TLSSAGQTAKDYTVQSAQQAKDT-LSGAGQTAKDYTVQTAQQAKET-LSKAGQ  1366
             + KD TL  AG+  KDYT + A++ KD+ +  AG+  KDYT + A Q K+T +SK G+
Sbjct  186   EAKDKTLGKAGEY-KDYTAEKARETKDSAMQKAGEY-KDYTAEQAVQGKDTTVSKLGE  241



>ref|XP_004167414.1| PREDICTED: seed biotin-containing protein SBP65-like [Cucumis 
sativus]
Length=474

 Score = 69.7 bits (169),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 66/220 (30%), Positives = 101/220 (46%), Gaps = 35/220 (16%)
 Frame = +2

Query  776   SLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKT  955
             SLEEI  YR   Q++S +A++ A+ +YEKA      N +S +Q      G    T   + 
Sbjct  153   SLEEISNYRAITQERSNEAIRAAKERYEKA------NRESLNQ------GVRGKTEELEQ  200

Query  956   QQAYNAAKDTT-----ISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYT  1120
             ++     ++T       +  +  K+T +S  +TAKDYT   A++           AK YT
Sbjct  201   RETEEGEENTVEGGGEWTGLETVKETLTSATKTAKDYTVPIAEK-----------AKGYT  249

Query  1121  VQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQ  1300
             VQ A + KD   SAGQ    Y  + A   KD    +G+ A +Y  ++A+  KD    AG 
Sbjct  250   VQKAIEAKDVAVSAGQKTAHYLEEKAVAAKDVAVESGKVAAEYAGKAAEDLKDKAVVAGW  309

Query  1301  TAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAG  1420
             +   Y+  TA +         +AA     +A +YA   AG
Sbjct  310   STAHYSCDTAVEGT-------KAAARLVKEAAEYAGAIAG  342



>emb|CDX75026.1| BnaA05g07720D [Brassica napus]
Length=371

 Score = 68.9 bits (167),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 77/231 (33%), Positives = 111/231 (48%), Gaps = 35/231 (15%)
 Frame = +2

Query  830   ALQTAQNKYEKAKNTT-------KENVQSGSQYLVEKAGAAKDTALQKTQQAYNAAKDT-  985
               +  Q  YE A++          E+ + G+Q   EKA  AKD  L+K       AKDT 
Sbjct  59    VFRAVQGTYEHARDAVVGKSHDVAESTREGAQIASEKAAGAKDATLEK-------AKDTA  111

Query  986   --TISKTQQAKDTFSSTGQTAKDYTTQSAKQTKD-TLSSAGQTAKDYTVQSAQQTKD-TL  1153
               T  K ++ KD  +      KDYT   AK+ KD T+   G+  KDYTV  A + +D T 
Sbjct  112   DYTAEKAREVKDKTAEKMGEYKDYTVDKAKEAKDKTVDKMGEY-KDYTVDKAVEARDKTA  170

Query  1154  SSAGQTA----------KDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQT  1303
               A +TA          KDYTV+ A + KD   S     KD  V +A++A   LSG  + 
Sbjct  171   EKAKETANYTADKAGEYKDYTVEKAAEGKDAGVSKLGEFKDSAVDTAKRAMGFLSGKTEE  230

Query  1304  AKDYTVQTAQQAKETLSKAGQAAK----DYTVQAKDYASQKAGEAGNKASE  1444
              K   V+T   AKE + +AG+ A+    +  ++A++  SQK  E  + A+E
Sbjct  231   PKQKAVETKDSAKEKMVEAGEEARRKMEEMRLEARE-GSQKTKETADSAAE  280



>ref|XP_006376353.1| late embryogenesis abundant domain-containing family protein 
[Populus trichocarpa]
 gb|ERP54150.1| late embryogenesis abundant domain-containing family protein 
[Populus trichocarpa]
Length=627

 Score = 70.1 bits (170),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 82/257 (32%), Positives = 116/257 (45%), Gaps = 24/257 (9%)
 Frame = +2

Query  773   LSLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQK  952
             LSL+EI K R TAQQ S++AL        KA     E  +  +  +V      K+ A Q 
Sbjct  126   LSLDEITKLRGTAQQNSLEAL--------KAAEERNEKEKEKASLVV----GCKEKAPQ-  172

Query  953   TQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSA  1132
                    AK T + K  QAKDT +     AK+ +   A Q KD +S     AKD   +  
Sbjct  173   -------AKHTVVEKAMQAKDTAAEKAARAKETSGDKAGQAKDIISEKAAQAKDIVAERT  225

Query  1133  QQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKD  1312
              + KD  +   + AKD  +  AQ+T   L+  G  AKD   +   QAKDT+    Q +  
Sbjct  226   ARAKDAAADKAEQAKDTVLGGAQKTSRNLAEKGSRAKDTAAEKTSQAKDTIWEGAQKSCQ  285

Query  1313  YTVQTAQQAKETLSKAGQAAKDYTVQAKDYA---SQKAGE-AGNKASEAKERGTEMSKNA  1480
                + A QAK T+ +  Q   +   QAKD     SQK+ + A  K ++ K    E  +  
Sbjct  286   QIEEKASQAKSTVLEGAQKVAEKGAQAKDTVAEGSQKSTQYAAEKGAQVKYTAVEGGRKT  345

Query  1481  ASYAGQKVTEAKDVTVE  1531
               +  +K  +AKD  VE
Sbjct  346   TQFIAEKGVQAKDTVVE  362


 Score = 67.8 bits (164),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 66/228 (29%), Positives = 96/228 (42%), Gaps = 12/228 (5%)
 Frame = +2

Query  839   TAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDT  1018
             TA  K  +AK+T  E  Q   Q + EKA  AK T L+  Q+           K  QAKDT
Sbjct  264   TAAEKTSQAKDTIWEGAQKSCQQIEEKASQAKSTVLEGAQK--------VAEKGAQAKDT  315

Query  1019  FSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSA  1198
              +   Q +  Y  +   Q K T    G+    +  +   Q KDT+    Q    Y  +  
Sbjct  316   VAEGSQKSTQYAAEKGAQVKYTAVEGGRKTTQFIAEKGVQAKDTVVEETQKTTHYLAEKG  375

Query  1199  QQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKD  1378
              Q KDTL    +    Y  +   QAKDT+    +   +Y  +   +AK+   ++G+ A  
Sbjct  376   AQVKDTLVEGAKKFTQYVTEKGAQAKDTIFEGAKKTSEYVAEKEVRAKDVTVESGKEAVH  435

Query  1379  YT----VQAKDYASQKAGEAGNKASEAKERGTEMSKNAASYAGQKVTE  1510
             Y     V  KD A+     A +  +E    G++ +  A  YAGQK  E
Sbjct  436   YVEKVAVDVKDKAAAAGWTAAHYTTEKAVEGSKAAARAVEYAGQKTAE  483



>ref|XP_007678355.1| hypothetical protein BAUCODRAFT_149660 [Baudoinia compniacensis 
UAMH 10762]
 gb|EMC94521.1| hypothetical protein BAUCODRAFT_149660 [Baudoinia compniacensis 
UAMH 10762]
Length=258

 Score = 67.4 bits (163),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 67/172 (39%), Positives = 92/172 (53%), Gaps = 18/172 (10%)
 Frame = +2

Query  1028  TGQ---TAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSA  1198
             TGQ   TA DY+ Q+  Q   T   A +TA+DYT             A  TA DY+ Q+ 
Sbjct  92    TGQAQDTASDYSKQAQHQAGQTYDQASKTAQDYT-----------GKAQDTASDYSKQAQ  140

Query  1199  QQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKD  1378
              Q   T   A +TA+DYT Q+  QAK T   AG+TA++YT Q   QAK+T  +A + A D
Sbjct  141   HQAGQTYDQASKTAQDYTGQAQDQAKQTYDQAGKTAQEYTDQAQDQAKQTYDQAAKTASD  200

Query  1379  YTVQAKDYAS---QKAGEAGNK-ASEAKERGTEMSKNAASYAGQKVTEAKDV  1522
             YT QA++ AS   ++A E GN    +A+E  T+    A  YA   + +A+D 
Sbjct  201   YTGQAQNTASDYTKQAQEQGNDLLKQAQETATQAYNTAGEYAQSGLKQAQDA  252



>gb|KHG08157.1| Embryonic DC-8 [Gossypium arboreum]
Length=405

 Score = 68.9 bits (167),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 67/211 (32%), Positives = 98/211 (46%), Gaps = 43/211 (20%)
 Frame = +2

Query  908   LVEKAGAAKDTALQKTQQAYNAAK---DTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTK  1078
             + +KAG  KD A  KT+ A   AK   D T  K  +  D  +   +  +D T Q AK++K
Sbjct  95    MKDKAGEYKDYATDKTKDATRRAKEATDATKEKACEYTDYAAHKAKETRDSTAQKAKESK  154

Query  1079  DTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQ  1258
             D+++       DY  Q A+++KD ++       DY  Q A++T+D+ S           Q
Sbjct  155   DSVTGKASEYGDYVAQKAKESKDAVTGKAADYADYASQKAKETRDSAS-----------Q  203

Query  1259  SAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGNKA  1438
              A++AKD ++G     KDY    A++AKE               AKD  ++KA EA  KA
Sbjct  204   KAKEAKDNITGKASEYKDY---AAEKAKE---------------AKDMTAEKAKEAAGKA  245

Query  1439  SEAKERGTEMSKNAASYAGQKVTEAKDVTVE  1531
              E  E           YA +K  E +D TVE
Sbjct  246   RERTE-----------YAAEKAKEGRDATVE  265


 Score = 59.3 bits (142),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 61/223 (27%), Positives = 105/223 (47%), Gaps = 27/223 (12%)
 Frame = +2

Query  791   GKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKTQQAYN  970
             G+Y+  A  K+ DA + A+     A + TKE     + Y   KA   K+T          
Sbjct  100   GEYKDYATDKTKDATRRAKE----ATDATKEKACEYTDYAAHKA---KET----------  142

Query  971   AAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDT  1150
               +D+T  K +++KD+ +       DY  Q AK++KD ++       DY  Q A++T+D+
Sbjct  143   --RDSTAQKAKESKDSVTGKASEYGDYVAQKAKESKDAVTGKAADYADYASQKAKETRDS  200

Query  1151  LSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTA  1330
              S   + AKD     A + KD  +   + AKD T + A++A    +G  +   +Y  + A
Sbjct  201   ASQKAKEAKDNITGKASEYKDYAAEKAKEAKDMTAEKAKEA----AGKARERTEYAAEKA  256

Query  1331  QQAKETLSKAGQAAKDYTV----QAKDYASQKAGEAGNKASEA  1447
             ++ ++   +  +   DYTV    + KD    K GE  + A++A
Sbjct  257   KEGRDATVEKTKEYSDYTVDKAKEGKDTGVSKLGELKDSAADA  299



>dbj|BAE92616.1| PvLEA1 protein [Polypedilum vanderplanki]
Length=742

 Score = 69.3 bits (168),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 77/248 (31%), Positives = 107/248 (43%), Gaps = 11/248 (4%)
 Frame = +2

Query  782   EEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKTQQ  961
             E+I + ++ A+ K   A+    +K  +AK+ T E +        EK G AKD   +K   
Sbjct  246   EKIIQVKEAAKDKIGHAVDVTTDKLGQAKDATAEKLVQAKDATAEKLGYAKDVTAEKLGL  305

Query  962   AYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQT  1141
             A    K+T +     AKDT      T K+    +A  T D L  A     D   Q+A++T
Sbjct  306   AAEKTKETLVD----AKDTIVEAKDTTKEKLGHAADVTADKLGHAKDVTADKLGQAAEKT  361

Query  1142  KDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTV  1321
             K+TL  A    KD  VQ+   T D L  A    KD   Q+A + K+TL        D   
Sbjct  362   KETLVDAKDATKDKLVQAKDVTADKLGHAKDVTKDKLAQAADKTKETLVETKDKTADKLG  421

Query  1322  QTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGNKASEAKERGTEMSKNAASYAGQK  1501
             Q A + KE L +A     D    AKD  + K G A  K  E      + +K+  +Y    
Sbjct  422   QAADKTKEKLVEAKDVTADKLGHAKDVTADKLGRAAEKTKETLVDAKDTTKDKLAY----  477

Query  1502  VTEAKDVT  1525
                AKDVT
Sbjct  478   ---AKDVT  482


 Score = 63.2 bits (152),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 82/259 (32%), Positives = 118/259 (46%), Gaps = 35/259 (14%)
 Frame = +2

Query  791   GKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDT---ALQKTQQ  961
             G YR+  +    D     ++K+++ K+   E +++  + +++   AAKD    A+  T  
Sbjct  212   GNYREEDECNYCDE---TKSKFKEVKDAAGEKMENAKEKIIQVKEAAKDKIGHAVDVTTD  268

Query  962   AYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQ----SAKQTKDTLSSAGQT---AKDYT  1120
                 AKD T  K  QAKD  +     AKD T +    +A++TK+TL  A  T   AKD T
Sbjct  269   KLGQAKDATAEKLVQAKDATAEKLGYAKDVTAEKLGLAAEKTKETLVDAKDTIVEAKDTT  328

Query  1121  VQ----SAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLS  1288
              +    +A  T D L  A     D   Q+A++TK+TL  A    KD  VQ+     D L 
Sbjct  329   KEKLGHAADVTADKLGHAKDVTADKLGQAAEKTKETLVDAKDATKDKLVQAKDVTADKLG  388

Query  1289  GAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGNKASEAKERGTEM  1468
              A    KD   Q A + KETL           V+ KD  + K G+A +K    KE+  E 
Sbjct  389   HAKDVTKDKLAQAADKTKETL-----------VETKDKTADKLGQAADK---TKEKLVE-  433

Query  1469  SKNAASYAGQKVTEAKDVT  1525
                A      K+  AKDVT
Sbjct  434   ---AKDVTADKLGHAKDVT  449


 Score = 62.0 bits (149),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 68/219 (31%), Positives = 99/219 (45%), Gaps = 14/219 (6%)
 Frame = +2

Query  809   AQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDT-------ALQKTQQAY  967
             A +K+ + L  A++   +AK+TTKE +   +    +K G AKD        A +KT++  
Sbjct  306   AAEKTKETLVDAKDTIVEAKDTTKEKLGHAADVTADKLGHAKDVTADKLGQAAEKTKETL  365

Query  968   NAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKD  1147
               AKD T  K  QAKD  +     AKD        TKD L+ A    K+  V++  +T D
Sbjct  366   VDAKDATKDKLVQAKDVTADKLGHAKDV-------TKDKLAQAADKTKETLVETKDKTAD  418

Query  1148  TLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQT  1327
              L  A    K+  V++   T D L  A     D   ++A++ K+TL  A  T KD     
Sbjct  419   KLGQAADKTKEKLVEAKDVTADKLGHAKDVTADKLGRAAEKTKETLVDAKDTTKDKLAYA  478

Query  1328  AQQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGNKASE  1444
                  + L+ A    K+  V AKD    K G A +K  E
Sbjct  479   KDVTADKLNYAADKTKEKLVDAKDTTKDKLGYAADKTKE  517


 Score = 56.6 bits (135),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 71/229 (31%), Positives = 101/229 (44%), Gaps = 12/229 (5%)
 Frame = +2

Query  845   QNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKD-TF  1021
             ++K  +A + TKE +        +K G A D    KT++    AKD T  K   AKD T 
Sbjct  395   KDKLAQAADKTKETLVETKDKTADKLGQAAD----KTKEKLVEAKDVTADKLGHAKDVTA  450

Query  1022  SSTGQTA---KDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQ  1192
                G+ A   K+    +   TKD L+ A     D    +A +TK+ L  A  T KD    
Sbjct  451   DKLGRAAEKTKETLVDAKDTTKDKLAYAKDVTADKLNYAADKTKEKLVDAKDTTKDKLGY  510

Query  1193  SAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAA  1372
             +A +TK+ L+ A  T KD    + +  KD    A Q       +T  +AKE   +A  A 
Sbjct  511   AADKTKEKLADAKDTTKDKFGDAKEATKDKYEDAKQK----MAETKDKAKEKFFEAKDAT  566

Query  1373  KDYTVQAKDYASQKAGEAGNKASEAKERGTEMSKNAASYAGQKVTEAKD  1519
              D    AKD    K G A +K  E  +   + +K+   YA  K+ E KD
Sbjct  567   ADKLGNAKDATKDKLGYAADKTKEKYDEAKDATKDKLGYAKDKLVETKD  615



>ref|XP_007886854.1| PREDICTED: E3 ubiquitin-protein ligase RNF213 [Callorhinchus 
milii]
Length=5344

 Score = 69.7 bits (169),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 38/160 (24%), Positives = 87/160 (54%), Gaps = 0/160 (0%)
 Frame = +2

Query  998   TQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAK  1177
             T  + DT   +G+T+ D T +S   ++D  + +G  ++D T +S+  ++D  + +G T++
Sbjct  68    TDYSMDTTDESGETSWDPTNESGDPSRDPTNESGDLSRDLTNESSDTSQDLTNESGDTSQ  127

Query  1178  DYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSK  1357
             D T +S   ++D  + +G T++D T +    + D+ + +G+T+ D T ++   + E  ++
Sbjct  128   DPTNESGDTSQDLTNESGDTSRDPTNEIRDASLDSTNESGETSMDSTNESGLNSPEPTNE  187

Query  1358  AGQAAKDYTVQAKDYASQKAGEAGNKASEAKERGTEMSKN  1477
             + +++ D T  +KD +     E+G  + + +    E+  N
Sbjct  188   SEESSLDPTNGSKDVSMDTTIESGEASLDPELSDVEIESN  227



>gb|EJY66449.1| hypothetical protein OXYTRI_13266 [Oxytricha trifallax]
Length=1350

 Score = 69.3 bits (168),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 64/179 (36%), Positives = 82/179 (46%), Gaps = 12/179 (7%)
 Frame = +2

Query  839   TAQNKYEKAKNTTK---ENVQSGSQYLVEKAGAAKDTALQKTQQAYNAAKDTTISK--TQ  1003
             T QN  EKA++  +   EN++     +V+KA  AKD    K+Q      KD       TQ
Sbjct  369   TIQNVKEKAQDVYERPTENLRQAKDVVVDKAYQAKDYIEDKSQDI----KDQYAPNLDTQ  424

Query  1004  QAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSA--QQTKDTLSSAGQTAK  1177
             Q K+    TG+ AKD     A Q KD ++   Q  KD    +   QQ KD     G+ AK
Sbjct  425   QVKNKALETGRQAKDVVVDKAYQAKDYIADKSQELKDQYAPNIDTQQVKDKALETGKQAK  484

Query  1178  DYTVQSAQQTKDTLSSAGQTAKD-YTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETL  1351
             D  V  A Q KD +       KD Y      Q KD  +  G+ AKD  VQ  QQAKE +
Sbjct  485   DLAVDKAYQAKDYIQDKSSQLKDQYKNMDYDQMKDKAADLGKQAKDNVVQKGQQAKEMV  543



>gb|KFK34557.1| hypothetical protein AALP_AA5G161400 [Arabis alpina]
Length=489

 Score = 68.6 bits (166),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 78/235 (33%), Positives = 106/235 (45%), Gaps = 27/235 (11%)
 Frame = +2

Query  905   YLVEKAGAAKDTALQKTQQA--YNA-----AKDTTISKTQQAKDTFSSTGQTA-------  1042
             Y  EKAG AKD    KT+Q   Y A     AKD T  K  + KD  +   + A       
Sbjct  163   YAAEKAGEAKDKTADKTKQTADYTADRAREAKDKTADKMGEYKDYTAEKAEEAKEKMGEY  222

Query  1043  KDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLS  1222
             KDYT   A + KD  +      KDYTV  A++ KD  +   +   DYT   A++ KD  +
Sbjct  223   KDYTVDKATEAKDKTAEKLGEYKDYTVDKAKEGKDKTAEKAKETADYTADKAKEAKDKTA  282

Query  1223  SAGQTAKDYTVQSAQQAKDT-LSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKD  1399
                   KDYT + A + KD  +S  G+  KD  V TA++A   LS   +  K+  ++ KD
Sbjct  283   ETVGEYKDYTAEKATEGKDAGVSKIGEL-KDSAVDTAKRAMGFLSGKTEETKEKALETKD  341

Query  1400  YASQKAGEAGNKA-----------SEAKERGTEMSKNAASYAGQKVTEAKDVTVE  1531
              A +K  EAG +A            E K+    M+ +    A  K  E KD T E
Sbjct  342   SAKEKMDEAGEEARRKMEEMRLEGEELKDDADRMAHDKTESAAGKAREVKDSTTE  396


 Score = 57.4 bits (137),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 71/225 (32%), Positives = 103/225 (46%), Gaps = 31/225 (14%)
 Frame = +2

Query  977   KDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLS  1156
             KD T  K ++A+D  +   + + DYT   A++ KD      +TA DYT   A++ KD + 
Sbjct  103   KDATAEKAEEARDRTADKTKESADYTADKAREAKDKTK---ETA-DYTADKAREAKDKMG  158

Query  1157  SAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQ  1336
                   KDY  + A + KD  +   +   DYT   A++AKD  +      KDYT + A++
Sbjct  159   EY----KDYAAEKAGEAKDKTADKTKQTADYTADRAREAKDKTADKMGEYKDYTAEKAEE  214

Query  1337  AKETLSKAGQAAKDYTV----QAKDYASQKAGE----AGNKASEAKERGTEMSKNAASYA  1492
             AKE + +     KDYTV    +AKD  ++K GE      +KA E K++  E +K  A Y 
Sbjct  215   AKEKMGEY----KDYTVDKATEAKDKTAEKLGEYKDYTVDKAKEGKDKTAEKAKETADYT  270

Query  1493  GQKVTEAKD-----------VTVESgkgavgyagkvaETLKDTAT  1594
               K  EAKD            T E               LKD+A 
Sbjct  271   ADKAKEAKDKTAETVGEYKDYTAEKATEGKDAGVSKIGELKDSAV  315


 Score = 56.6 bits (135),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 77/261 (30%), Positives = 112/261 (43%), Gaps = 52/261 (20%)
 Frame = +2

Query  884   NVQSGSQYLV-------EKAGAAKDT----ALQKTQQAYNAAKDTTISKTQQA-------  1009
             N + G +Y V       E   A ++T     L    +A    KD  I K+  A       
Sbjct  32    NKEGGVKYKVTEKTTTMEHPLAEEETERPGLLGSVMKAVQGTKDAVIGKSHDAAESTRNE  91

Query  1010  KDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTV  1189
              D  S      KD T + A++ +D  +   + + DYT   A++ KD      +TA DYT 
Sbjct  92    ADIASEKAAGVKDATAEKAEEARDRTADKTKESADYTADKAREAKDKTK---ETA-DYTA  147

Query  1190  QSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKE-TLSKAGQ  1366
               A++ KD +       KDY  + A +AKD  +   +   DYT   A++AK+ T  K G+
Sbjct  148   DKAREAKDKMGE----YKDYAAEKAGEAKDKTADKTKQTADYTADRAREAKDKTADKMGE  203

Query  1367  AA-----------------KDYTV----QAKDYASQKAGE----AGNKASEAKERGTEMS  1471
                                KDYTV    +AKD  ++K GE      +KA E K++  E +
Sbjct  204   YKDYTAEKAEEAKEKMGEYKDYTVDKATEAKDKTAEKLGEYKDYTVDKAKEGKDKTAEKA  263

Query  1472  KNAASYAGQKVTEAKDVTVES  1534
             K  A Y   K  EAKD T E+
Sbjct  264   KETADYTADKAKEAKDKTAET  284



>ref|XP_010904970.1| PREDICTED: embryonic protein DC-8 isoform X1 [Elaeis guineensis]
Length=499

 Score = 68.2 bits (165),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 73/246 (30%), Positives = 115/246 (47%), Gaps = 25/246 (10%)
 Frame = +2

Query  869   NTTKENVQSGSQYLVEKAGAAKDTALQK-------TQQAYNAAKDTTISKTQQAKDTFSS  1027
              T KE     +  + EKAG  KD A +K       T Q     KD+   K ++ +D  + 
Sbjct  64    RTVKEVATGKAHDVSEKAGETKDAAAEKAKETKDVTMQKMGEYKDSAAEKAKEYRDWAAE  123

Query  1028  TGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQT  1207
               +  KD T Q A++ KDT +   + A+D ++Q A + KD+ +     AKD T++ A++ 
Sbjct  124   KAKEGKDTTMQKAEEYKDTAAEKARVARDTSMQKAGEYKDSTAQKLGEAKDTTMEKAREY  183

Query  1208  KDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQA------  1369
             KD      +  KD ++    + K++ S   + AKD +++     KE   +  +A      
Sbjct  184   KDAAVEKAKEMKDASMHKTGETKESASEKARGAKDVSMEKTGDYKELAGEKARAEAEKAR  243

Query  1370  -AKDYTVQA----KDYASQKAGEAGNKASEAKERGT-------EMSKNAASYAGQKVTEA  1513
              AK+ ++Q     K+ AS+KA EA  KA EAKE          E +   A  A +K  EA
Sbjct  244   EAKEGSIQKTGEYKELASEKAREAAEKAREAKEASMQKTGEYKEFASEKAREAAEKAREA  303

Query  1514  KDVTVE  1531
             KD   E
Sbjct  304   KDTAAE  309


 Score = 66.2 bits (160),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 70/229 (31%), Positives = 117/229 (51%), Gaps = 31/229 (14%)
 Frame = +2

Query  857   EKAKNTTKENVQSGSQY---LVEKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSS  1027
             EKAK T    +Q   +Y     EKA   +D A +K ++     KDTT+ K ++ KDT + 
Sbjct  90    EKAKETKDVTMQKMGEYKDSAAEKAKEYRDWAAEKAKEG----KDTTMQKAEEYKDTAAE  145

Query  1028  TGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQT  1207
               + A+D + Q A + KD+ +     AKD T++ A++ KD      +  KD ++    +T
Sbjct  146   KARVARDTSMQKAGEYKDSTAQKLGEAKDTTMEKAREYKDAAVEKAKEMKDASMHKTGET  205

Query  1208  KDTLSSAGQTAKDYTVQ---------------SAQQAKDTLSGAGQTAKDYTVQTAQQAK  1342
             K++ S   + AKD +++                A++A++   G+ Q   +Y    +++A+
Sbjct  206   KESASEKARGAKDVSMEKTGDYKELAGEKARAEAEKAREAKEGSIQKTGEYKELASEKAR  265

Query  1343  ETLSKAGQAAKDYTVQA----KDYASQKAGEAGNKASEAK----ERGTE  1465
             E   KA + AK+ ++Q     K++AS+KA EA  KA EAK    ER TE
Sbjct  266   EAAEKA-REAKEASMQKTGEYKEFASEKAREAAEKAREAKDTAAERTTE  313



>ref|XP_010904971.1| PREDICTED: embryonic protein DC-8 isoform X2 [Elaeis guineensis]
Length=497

 Score = 68.2 bits (165),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 73/246 (30%), Positives = 115/246 (47%), Gaps = 25/246 (10%)
 Frame = +2

Query  869   NTTKENVQSGSQYLVEKAGAAKDTALQK-------TQQAYNAAKDTTISKTQQAKDTFSS  1027
              T KE     +  + EKAG  KD A +K       T Q     KD+   K ++ +D  + 
Sbjct  64    RTVKEVATGKAHDVSEKAGETKDAAAEKAKETKDVTMQKMGEYKDSAAEKAKEYRDWAAE  123

Query  1028  TGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQT  1207
               +  KD T Q A++ KDT +   + A+D ++Q A + KD+ +     AKD T++ A++ 
Sbjct  124   KAKEGKDTTMQKAEEYKDTAAEKARVARDTSMQKAGEYKDSTAQKLGEAKDTTMEKAREY  183

Query  1208  KDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQA------  1369
             KD      +  KD ++    + K++ S   + AKD +++     KE   +  +A      
Sbjct  184   KDAAVEKAKEMKDASMHKTGETKESASEKARGAKDVSMEKTGDYKELAGEKARAEAEKAR  243

Query  1370  -AKDYTVQA----KDYASQKAGEAGNKASEAKERGT-------EMSKNAASYAGQKVTEA  1513
              AK+ ++Q     K+ AS+KA EA  KA EAKE          E +   A  A +K  EA
Sbjct  244   EAKEGSIQKTGEYKELASEKAREAAEKAREAKEASMQKTGEYKEFASEKAREAAEKAREA  303

Query  1514  KDVTVE  1531
             KD   E
Sbjct  304   KDTAAE  309


 Score = 65.9 bits (159),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 70/229 (31%), Positives = 117/229 (51%), Gaps = 31/229 (14%)
 Frame = +2

Query  857   EKAKNTTKENVQSGSQY---LVEKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSS  1027
             EKAK T    +Q   +Y     EKA   +D A +K ++     KDTT+ K ++ KDT + 
Sbjct  90    EKAKETKDVTMQKMGEYKDSAAEKAKEYRDWAAEKAKEG----KDTTMQKAEEYKDTAAE  145

Query  1028  TGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQT  1207
               + A+D + Q A + KD+ +     AKD T++ A++ KD      +  KD ++    +T
Sbjct  146   KARVARDTSMQKAGEYKDSTAQKLGEAKDTTMEKAREYKDAAVEKAKEMKDASMHKTGET  205

Query  1208  KDTLSSAGQTAKDYTVQ---------------SAQQAKDTLSGAGQTAKDYTVQTAQQAK  1342
             K++ S   + AKD +++                A++A++   G+ Q   +Y    +++A+
Sbjct  206   KESASEKARGAKDVSMEKTGDYKELAGEKARAEAEKAREAKEGSIQKTGEYKELASEKAR  265

Query  1343  ETLSKAGQAAKDYTVQA----KDYASQKAGEAGNKASEAK----ERGTE  1465
             E   KA + AK+ ++Q     K++AS+KA EA  KA EAK    ER TE
Sbjct  266   EAAEKA-REAKEASMQKTGEYKEFASEKAREAAEKAREAKDTAAERTTE  313



>emb|CDY33171.1| BnaC04g08680D [Brassica napus]
Length=359

 Score = 67.0 bits (162),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 70/220 (32%), Positives = 106/220 (48%), Gaps = 23/220 (10%)
 Frame = +2

Query  881   ENVQSGSQYLVEKAGAAKDTALQKTQQAYNAAKDT---TISKTQQAKDTFSSTGQTAKDY  1051
             E+ + G+Q   EKA  AKD  L+K       AKDT   T  K ++AKD  +      K+Y
Sbjct  83    ESTREGAQIASEKAAGAKDATLEK-------AKDTADYTAEKAREAKDKTAEKIGEYKNY  135

Query  1052  TTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAG  1231
             T   A + KD  +   +   +YT   A++ KD  +      KDYTV+ A + KD  +   
Sbjct  136   TVDKAVEAKDKTAEKAKETANYTADKAKEAKDKTAEKMGEYKDYTVEKAIEAKDKTAEKA  195

Query  1232  QTAKDYTVQSAQQAKDT-LSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYAS  1408
                KDYTV+ A + KD  +S  G+  KD        AKE + +AG+ A+    + +    
Sbjct  196   GEYKDYTVEKAAEGKDAGVSKLGEL-KD-------SAKEKMEEAGEEARRKMEEMRLEGK  247

Query  1409  QKAGEAGNKASEAKERGTEMSKNAASYAGQKVTEAKDVTV  1528
             +   EA +KA E    G++ +K +A  A ++  E KD  V
Sbjct  248   ELKDEARDKARE----GSQKTKESAELAAERAHETKDSAV  283


 Score = 57.0 bits (136),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 71/229 (31%), Positives = 105/229 (46%), Gaps = 26/229 (11%)
 Frame = +2

Query  836   QTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKD  1015
             Q A  K   AK+ T E  +  + Y  EKA  AKD    KT +     K+ T+ K  +AKD
Sbjct  90    QIASEKAAGAKDATLEKAKDTADYTAEKAREAKD----KTAEKIGEYKNYTVDKAVEAKD  145

Query  1016  TFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQS  1195
               +   +   +YT   AK+ KD  +      KDYTV+ A + KD  +      KDYTV+ 
Sbjct  146   KTAEKAKETANYTADKAKEAKDKTAEKMGEYKDYTVEKAIEAKDKTAEKAGEYKDYTVEK  205

Query  1196  AQQTKDT-LSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAA  1372
             A + KD  +S  G+  KD        AK+ +  AG+ A+        +  E +   G+  
Sbjct  206   AAEGKDAGVSKLGEL-KD-------SAKEKMEEAGEEAR--------RKMEEMRLEGKEL  249

Query  1373  KDYTVQAKDYASQKAGEAGNKASEAKERGTEMSKNAASYAG--QKVTEA  1513
             KD   +A+D A + + +    A  A ER  E   +A +  G  + VTEA
Sbjct  250   KD---EARDKAREGSQKTKESAELAAERAHETKDSAVTIFGTLENVTEA  295



>ref|XP_004487170.1| PREDICTED: seed biotin-containing protein SBP65-like [Cicer arietinum]
Length=667

 Score = 67.8 bits (164),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 67/215 (31%), Positives = 104/215 (48%), Gaps = 34/215 (16%)
 Frame = +2

Query  773   LSLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTA---  943
             L+LEEI KYR  AQ+ +++A+  AQ +YE+AK  T E + + +Q    K  A KDT    
Sbjct  212   LTLEEISKYRNQAQENAMEAISGAQERYEEAKKPTNETLTNTTQTAQGKE-ATKDTVSCA  270

Query  944   ---------------LQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTK  1078
                            ++K+QQ Y A KDT  S  + A +  +    T  +   Q    TK
Sbjct  271   AKTAAEKAAQAKNATIEKSQQGYEATKDTVSSAAKTAAEKAAQAKNTTIEKGQQGYVATK  330

Query  1079  DTLSSAGQTAKDYTVQSAQQT-------KDTLSSAGQTAKDY----TVQSAQQTKDTLSS  1225
             DT+SS  +TA +Y    A++T       KD  ++AG TA  Y    TV   +   + +  
Sbjct  331   DTVSSVAKTAAEYVSPVAEKTKTVVVDLKDKATAAGWTAAHYSTQLTVDGTKAAANVVEG  390

Query  1226  AGQTAKDYTVQSAQQAKDTLSG----AGQTAKDYT  1318
             A + A     + A ++ D + G    AG++AK++T
Sbjct  391   AARYAAPKAAELAAKSVDVVKGLAASAGESAKEFT  425



>ref|XP_006285554.1| hypothetical protein CARUB_v10006996mg [Capsella rubella]
 gb|EOA18452.1| hypothetical protein CARUB_v10006996mg [Capsella rubella]
Length=465

 Score = 67.4 bits (163),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 83/238 (35%), Positives = 100/238 (42%), Gaps = 33/238 (14%)
 Frame = +2

Query  881   ENVQSGSQYLVEKAGAAKDTALQKTQQAYNA------AKDTTISKTQQAKDTFSSTGQTA  1042
             ++ Q+  +Y  +KAG AKD A  KT Q   A      AKD    K  Q KD         
Sbjct  115   DSAQNAKKYAYDKAGDAKDMAYNKTDQVNEAFEKAGQAKDMAYDKAGQGKDIAYDKADQT  174

Query  1043  KDYTTQSAKQTKDT--------LSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSA  1198
             KD   + A Q KD          + AGQ AKD     A Q KD        AKD     A
Sbjct  175   KDMVYEKAGQAKDMAYDKMGSAYNKAGQ-AKDVVYDKAGQAKDVAYDKAGQAKDIAYDKA  233

Query  1199  QQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKD  1378
              Q KDT       AKD        A D    AGQ AKD     A QAK+        A D
Sbjct  234   GQVKDTAYDKAGQAKDKAYDKTGSAYDL---AGQ-AKDIAYDKASQAKDM-------AYD  282

Query  1379  YTVQAKDYASQKAGEAGNKASEAKE-------RGTEMSKNAASYAGQKVTEAKDVTVE  1531
                QAKD A  KAG A +KA EAK+         +EM+ +A  +A +K  +AKD   +
Sbjct  283   KVGQAKDMAYDKAGSAYDKAEEAKDLAYDKAGSASEMAGHAKDFAYEKARDAKDAAYD  340



>ref|XP_009143569.1| PREDICTED: embryonic protein DC-8 [Brassica rapa]
Length=410

 Score = 67.0 bits (162),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 81/252 (32%), Positives = 118/252 (47%), Gaps = 34/252 (13%)
 Frame = +2

Query  830   ALQTAQNKYEKAKNTT-------KENVQSGSQYLVEKAGAAKDTALQKTQQAYNAAKDT-  985
               +  Q  YE A++          E+ + G+Q   EKA  AKD  L+K       AKDT 
Sbjct  59    VFRAVQGTYEHARDAVVGKSHDVAESTREGAQIASEKAAGAKDATLEK-------AKDTA  111

Query  986   --TISKTQQAKDTFSSTGQTAKDYTTQSAKQTKD-TLSSAGQTAKDYTVQSAQQTKD-TL  1153
               T  K ++AKD  +      K+YT   AK+ KD T+   G+  K YTV  A + +D T 
Sbjct  112   DHTAEKAREAKDKTAEKMGEYKNYTVDKAKEAKDKTVGKMGEY-KVYTVDKAVEARDKTA  170

Query  1154  SSAGQTA----------KDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQT  1303
               A +TA          KDYTV+ A + KD   S     KD  V +A++A   LSG  + 
Sbjct  171   EKAKETANYTADKAGEYKDYTVEKAAEGKDAGVSKLGEFKDSAVDTAKRAMGFLSGKTEE  230

Query  1304  AKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGNKASEAKERGTEMSKNAA  1483
              K   V+T   AKE + +AG+ A+    + +    +   EA +KA E    G++ +K  A
Sbjct  231   TKQKAVETKDSAKEKMVEAGEEARRKMEEMRLEGKELKEEAKDKARE----GSQKTKETA  286

Query  1484  SYAGQKVTEAKD  1519
               A ++  E KD
Sbjct  287   DSAAERAHETKD  298



>ref|XP_008785503.1| PREDICTED: embryonic protein DC-8-like isoform X1 [Phoenix dactylifera]
Length=318

 Score = 66.2 bits (160),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 76/246 (31%), Positives = 111/246 (45%), Gaps = 66/246 (27%)
 Frame = +2

Query  767   SGLSLEEIGKYRQTAQQKSIDALQTAQNKYEK----------------------------  862
             +G+S EEIG+YR TAQQ S+D ++ A+ +YEK                            
Sbjct  22    TGMSPEEIGRYRATAQQNSVDVMRAAEERYEKAKHAGASTIHDAKETATHGLAATTTYLA  81

Query  863   -----AKNTTKENVQSGSQYLVEKA---------------------------------GA  928
                  AK T     +  ++Y  EK                                   A
Sbjct  82    AKGTEAKGTVAHGARVAAEYAAEKGTAAKDHAAEKAQQGYHAAVRGARAAADVAAEKASA  141

Query  929   AKDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTA  1108
             AKDTA++K  Q  + AKDT +    +AKD  +S G +A DY  Q+A++ +D   S G++A
Sbjct  142   AKDTAMEKGGQGCDTAKDTAVQAAVKAKDVAASAGGSAADYGKQAAEKARDVTVSTGKSA  201

Query  1109  KDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLS  1288
              D+  Q+A + KD     G++A DY  Q+A + +D   S G++A DY  + A  AKD   
Sbjct  202   ADHAQQAAAKAKDVAIETGKSAVDYAQQAAAKARDAAVSTGKSAADYAQKKAGGAKDAAV  261

Query  1289  GAGQTA  1306
             GAGQ A
Sbjct  262   GAGQKA  267



>ref|XP_011101471.1| PREDICTED: embryonic protein DC-8 [Sesamum indicum]
Length=521

 Score = 67.0 bits (162),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 72/220 (33%), Positives = 112/220 (51%), Gaps = 24/220 (11%)
 Frame = +2

Query  929   AKDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTA---KDYTTQSAKQTKDTLSSAG  1099
             AKD  + K+ +A +  + TT    ++ ++   S  Q A   KDYT + AK+T D   SA 
Sbjct  60    AKDAVMGKSHEAADRTRGTTEEAAERTREGLESAAQKAAEYKDYTAEKAKETTD---SAA  116

Query  1100  QTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKD  1279
             Q A +   + A++ KD+ +   + AKD T+++  + KD  +   + A +   Q A+QAKD
Sbjct  117   QKAAE-AGEKAREKKDSAAEKAKQAKDATMETMGEYKDYAAEKTKEAANSAAQKAKQAKD  175

Query  1280  TLSGAGQTAKDYTVQTAQQAKE-TLSKAGQAAKDYTV-----------QAKDYASQKAGE  1423
             T +G     KDY  + A + K+  + KAG+  KDY             + KD A +KAGE
Sbjct  176   TTAGKMGEYKDYAAEKAGETKDAAMGKAGE-YKDYAAEKAQAAAEKARETKDSAMEKAGE  234

Query  1424  ----AGNKASEAKERGTEMSKNAASYAGQKVTEAKDVTVE  1531
                 A  KA E K+   + +     YA +KV +AKD T+E
Sbjct  235   YKDYAAQKAKETKDSTVQKTGEYKDYAAEKVGQAKDTTLE  274


 Score = 64.3 bits (155),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 70/213 (33%), Positives = 114/213 (54%), Gaps = 16/213 (8%)
 Frame = +2

Query  776   SLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKT  955
             ++E +G+Y+  A +K+ +A  +A  K ++AK+TT   +     Y  EKAG  KD A+ K 
Sbjct  144   TMETMGEYKDYAAEKTKEAANSAAQKAKQAKDTTAGKMGEYKDYAAEKAGETKDAAMGKA  203

Query  956   QQAYNAAKDTTISKTQQAKDTFSSTGQTA---KDYTTQSAKQTKD-TLSSAGQT------  1105
              +  + A +   +  ++A++T  S  + A   KDY  Q AK+TKD T+   G+       
Sbjct  204   GEYKDYAAEKAQAAAEKARETKDSAMEKAGEYKDYAAQKAKETKDSTVQKTGEYKDYAAE  263

Query  1106  ----AKDYTVQSAQQTKD-TLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQ  1270
                 AKD T++ A+Q KD T+  AGQ AKD TV+ A + KD  +   +  KD TV    +
Sbjct  264   KVGQAKDTTLEKARQAKDTTMEKAGQ-AKDTTVEKAGEYKDYTAEKAKEGKDTTVGKITE  322

Query  1271  AKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQA  1369
              KD+ + A + A DY     ++ K+ + + G+A
Sbjct  323   LKDSAADAARRAMDYLTGKKEETKQKVQETGEA  355


 Score = 64.3 bits (155),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 76/215 (35%), Positives = 115/215 (53%), Gaps = 32/215 (15%)
 Frame = +2

Query  806   TAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKTQQAYNAAKDT  985
             +A QK+ +A + A+ K    K++  E  +      +E  G  KD A +KT++A N+A   
Sbjct  114   SAAQKAAEAGEKAREK----KDSAAEKAKQAKDATMETMGEYKDYAAEKTKEAANSA---  166

Query  986   TISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDT-LSSAGQTAKDYTVQSA-------QQT  1141
                K +QAKDT +      KDY  + A +TKD  +  AG+  KDY  + A       ++T
Sbjct  167   -AQKAKQAKDTTAGKMGEYKDYAAEKAGETKDAAMGKAGEY-KDYAAEKAQAAAEKARET  224

Query  1142  KDT-LSSAGQTAKDYTVQSAQQTKD-TLSSAGQT----------AKDYTVQSAQQAKD-T  1282
             KD+ +  AG+  KDY  Q A++TKD T+   G+           AKD T++ A+QAKD T
Sbjct  225   KDSAMEKAGEY-KDYAAQKAKETKDSTVQKTGEYKDYAAEKVGQAKDTTLEKARQAKDTT  283

Query  1283  LSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTV  1387
             +  AGQ AKD TV+ A + K+  ++  +  KD TV
Sbjct  284   MEKAGQ-AKDTTVEKAGEYKDYTAEKAKEGKDTTV  317


 Score = 64.3 bits (155),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 100/308 (32%), Positives = 136/308 (44%), Gaps = 70/308 (23%)
 Frame = +2

Query  755   RRDHSGLSLEE-----IGKYRQTAQQKSIDALQTAQNKY-----------EKAKNTTKEN  886
             RRD  G+  EE     IG   +T Q   + A      K            E+A   T+E 
Sbjct  30    RRDVEGVRQEERGPGVIGSLIRTVQGTVVHAKDAVMGKSHEAADRTRGTTEEAAERTREG  89

Query  887   VQSGSQ-------YLVEKAGAAKDTALQKTQQAYNAA---KDTTISKTQQAKDTFSSTGQ  1036
             ++S +Q       Y  EKA    D+A QK  +A   A   KD+   K +QAKD    T  
Sbjct  90    LESAAQKAAEYKDYTAEKAKETTDSAAQKAAEAGEKAREKKDSAAEKAKQAKDATMETMG  149

Query  1037  TAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDT  1216
               KDY   +A++TK+  +SA Q AK        Q KDT +      KDY  + A +TKD 
Sbjct  150   EYKDY---AAEKTKEAANSAAQKAK--------QAKDTTAGKMGEYKDYAAEKAGETKDA  198

Query  1217  -LSSAGQTAKDYTVQSAQQA----KDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDY  1381
              +  AG+  KDY  + AQ A    ++T   A + A +Y    AQ+AKET        KD 
Sbjct  199   AMGKAGEY-KDYAAEKAQAAAEKARETKDSAMEKAGEYKDYAAQKAKET--------KDS  249

Query  1382  TVQA----KDYASQKAGEAGN---------------KASEAKERGTEMSKNAASYAGQKV  1504
             TVQ     KDYA++K G+A +               KA +AK+   E +     Y  +K 
Sbjct  250   TVQKTGEYKDYAAEKVGQAKDTTLEKARQAKDTTMEKAGQAKDTTVEKAGEYKDYTAEKA  309

Query  1505  TEAKDVTV  1528
              E KD TV
Sbjct  310   KEGKDTTV  317



>emb|CAF32327.1| late embryogenesis abundant protein [Pisum sativum]
Length=358

 Score = 66.2 bits (160),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 47/145 (32%), Positives = 73/145 (50%), Gaps = 14/145 (10%)
 Frame = +2

Query  1091  SAGQTAKDYTVQSAQQTKD-------TLSSAGQTAKDYTVQSAQQTKDTLS-------SA  1228
             SAG  ++DY   + ++TKD        + SAG+ AKDY   + ++TKD  +       S 
Sbjct  113   SAGVKSRDYAYDAKEKTKDAANRAAENVESAGEKAKDYAYDAKERTKDAANRAAENAESV  172

Query  1229  GQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYAS  1408
             G+ A+DY   + ++ K+    AG+TAKDY     ++ KE    AG  A+DY   A D   
Sbjct  173   GEKARDYAYDAKERTKEAAQNAGETAKDYAYGAKERTKEAAESAGGTARDYAYDATDKTK  232

Query  1409  QKAGEAGNKASEAKERGTEMSKNAA  1483
             +  G   +K  E  ++  EM+K  A
Sbjct  233   EAVGTVADKTKEGAKKTAEMTKEGA  257


 Score = 62.0 bits (149),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 55/174 (32%), Positives = 86/174 (49%), Gaps = 21/174 (12%)
 Frame = +2

Query  1025  STGQTAKDYTTQSAKQTKD-------TLSSAGQTAKDYTVQSAQQTKD-------TLSSA  1162
             S G  ++DY   + ++TKD        + SAG+ AKDY   + ++TKD          S 
Sbjct  113   SAGVKSRDYAYDAKEKTKDAANRAAENVESAGEKAKDYAYDAKERTKDAANRAAENAESV  172

Query  1163  GQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAK  1342
             G+ A+DY   + ++TK+   +AG+TAKDY   + ++ K+    AG TA+DY      + K
Sbjct  173   GEKARDYAYDAKERTKEAAQNAGETAKDYAYGAKERTKEAAESAGGTARDYAYDATDKTK  232

Query  1343  ETL----SKAGQAAKDYTVQAKDYASQKA---GEAGNKASEAKERGTEMSKNAA  1483
             E +     K  + AK      K+ A + A   GE    A+EA +   EM+K  A
Sbjct  233   EAVGTVADKTKEGAKKTAEMTKEGAEKTAETTGEVAGAATEALKSAGEMAKRTA  286


 Score = 58.9 bits (141),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 61/190 (32%), Positives = 96/190 (51%), Gaps = 19/190 (10%)
 Frame = +2

Query  806   TAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKTQQAYNAAKDT  985
             +A  KS D    A+ K + A N   ENV+S  +        AKD A          AK+ 
Sbjct  113   SAGVKSRDYAYDAKEKTKDAANRAAENVESAGE-------KAKDYAYD--------AKER  157

Query  986   TISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAG  1165
             T     +A +   S G+ A+DY   + ++TK+   +AG+TAKDY   + ++TK+   SAG
Sbjct  158   TKDAANRAAENAESVGEKARDYAYDAKERTKEAAQNAGETAKDYAYGAKERTKEAAESAG  217

Query  1166  QTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKE  1345
              TA+DY   +  +TK+ + +     K+   ++A+  K+   GA +TA+  T + A  A E
Sbjct  218   GTARDYAYDATDKTKEAVGTVADKTKEGAKKTAEMTKE---GAEKTAET-TGEVAGAATE  273

Query  1346  TLSKAGQAAK  1375
              L  AG+ AK
Sbjct  274   ALKSAGEMAK  283



>ref|XP_009370069.1| PREDICTED: embryonic protein DC-8-like isoform X1 [Pyrus x bretschneideri]
Length=512

 Score = 66.6 bits (161),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 76/238 (32%), Positives = 118/238 (50%), Gaps = 29/238 (12%)
 Frame = +2

Query  800   RQTAQQKSIDALQTAQN-------KYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKTQ  958
             + TA QK+ +A Q A+        K ++AK+ T       + Y   KA  AKDT + K  
Sbjct  154   KDTAAQKANEAAQKAKETKDSAAQKAKEAKDATMGKAGEYTNYAAGKAKEAKDTTVNKVG  213

Query  959   QAYN-------AAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKD-TLSSAGQ----  1102
             +  N        AKDTT++K ++AKDT  +      +Y  + AK+ KD T++ AG+    
Sbjct  214   ENTNYATEKAKEAKDTTLNKAKEAKDTTMNKAGEYTNYADEKAKEAKDTTVNKAGEYTNY  273

Query  1103  ------TAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSA  1264
                    AKD TV++A++TKD  +      KD TV    Q KDT + A Q A +Y     
Sbjct  274   AAEKAKEAKDATVETAKETKDYTAEKANEGKDTTVSKLGQLKDTAAGAAQKAMEYLSGKK  333

Query  1265  QQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAK----DYTVQAKDYASQKAGEA  1426
             ++ K   +   +  KD T +TA++AKE LS+  + A+    +  +Q K+Y  + A  A
Sbjct  334   EETKQKAAETTEKTKDTTSETAEKAKEKLSETEEEARRKMEELKLQGKEYKDEDADRA  391


 Score = 63.9 bits (154),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 67/196 (34%), Positives = 97/196 (49%), Gaps = 25/196 (13%)
 Frame = +2

Query  905   YLVEKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQS---AKQT  1075
             Y  EKA   KDTA QK  +A   AK+T  S  Q+AK+   +T   A +YT  +   AK+ 
Sbjct  145   YTAEKAKETKDTAAQKANEAAQKAKETKDSAAQKAKEAKDATMGKAGEYTNYAAGKAKEA  204

Query  1076  KD-TLSSAGQT----------AKDYTVQSAQQTKD-TLSSAGQ----------TAKDYTV  1189
             KD T++  G+           AKD T+  A++ KD T++ AG+           AKD TV
Sbjct  205   KDTTVNKVGENTNYATEKAKEAKDTTLNKAKEAKDTTMNKAGEYTNYADEKAKEAKDTTV  264

Query  1190  QSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQA  1369
               A +  +  +   + AKD TV++A++ KD  +      KD TV    Q K+T + A Q 
Sbjct  265   NKAGEYTNYAAEKAKEAKDATVETAKETKDYTAEKANEGKDTTVSKLGQLKDTAAGAAQK  324

Query  1370  AKDYTVQAKDYASQKA  1417
             A +Y    K+   QKA
Sbjct  325   AMEYLSGKKEETKQKA  340


 Score = 60.5 bits (145),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 63/172 (37%), Positives = 90/172 (52%), Gaps = 18/172 (10%)
 Frame = +2

Query  1046  DYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQT---AKDYTVQSAQQTKDT  1216
             DYT + AK+TKDT   A Q A     ++AQ+ K+T  SA Q    AKD T+  A +  + 
Sbjct  144   DYTAEKAKETKDT---AAQKAN----EAAQKAKETKDSAAQKAKEAKDATMGKAGEYTNY  196

Query  1217  LSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKE-TLSKAGQ---AAKDYT  1384
              +   + AKD TV    +  +  +   + AKD T+  A++AK+ T++KAG+    A +  
Sbjct  197   AAGKAKEAKDTTVNKVGENTNYATEKAKEAKDTTLNKAKEAKDTTMNKAGEYTNYADEKA  256

Query  1385  VQAKDYASQKAGE----AGNKASEAKERGTEMSKNAASYAGQKVTEAKDVTV  1528
              +AKD    KAGE    A  KA EAK+   E +K    Y  +K  E KD TV
Sbjct  257   KEAKDTTVNKAGEYTNYAAEKAKEAKDATVETAKETKDYTAEKANEGKDTTV  308


 Score = 60.1 bits (144),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 71/204 (35%), Positives = 100/204 (49%), Gaps = 39/204 (19%)
 Frame = +2

Query  1031  GQTAKDYTTQSAKQTKDTLSSAGQTAKDYT----------VQSAQQTKDTLSSAGQTAKD  1180
             G+  KDYTTQ AK+T D   +AG+   +YT           + A++TK+          D
Sbjct  88    GKEYKDYTTQKAKETTD---AAGKKINEYTETAEEKAKQAAEKAKETKEAAKGKVGEYAD  144

Query  1181  YTVQSAQQTKDTLS----SAGQTAK---DYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQA  1339
             YT + A++TKDT +     A Q AK   D   Q A++AKD   G      +Y    A++A
Sbjct  145   YTAEKAKETKDTAAQKANEAAQKAKETKDSAAQKAKEAKDATMGKAGEYTNYAAGKAKEA  204

Query  1340  KET-LSKAGQ----------AAKDYTV----QAKDYASQKAGEAGN----KASEAKERGT  1462
             K+T ++K G+           AKD T+    +AKD    KAGE  N    KA EAK+   
Sbjct  205   KDTTVNKVGENTNYATEKAKEAKDTTLNKAKEAKDTTMNKAGEYTNYADEKAKEAKDTTV  264

Query  1463  EMSKNAASYAGQKVTEAKDVTVES  1534
               +    +YA +K  EAKD TVE+
Sbjct  265   NKAGEYTNYAAEKAKEAKDATVET  288



>ref|XP_009370071.1| PREDICTED: embryonic protein DC-8-like isoform X3 [Pyrus x bretschneideri]
Length=479

 Score = 66.6 bits (161),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 79/228 (35%), Positives = 113/228 (50%), Gaps = 24/228 (11%)
 Frame = +2

Query  905   YLVEKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSA---KQT  1075
             Y  EKA   KDTA QK  +A   AK+T  S  Q+AK+   +T   A +YT  +A   K+ 
Sbjct  145   YTAEKAKETKDTAAQKANEAAQKAKETKDSAAQKAKEAKDATMGKAGEYTNYAAGKAKEA  204

Query  1076  KDT-LSSAGQTAKDYTVQSAQQTKDT-LSSAGQ----------TAKDYTVQSAQQTKDTL  1219
             KDT ++  G+   +Y  + A++ KDT ++ AG+           AKD TV++A++TKD  
Sbjct  205   KDTTVNKVGENT-NYATEKAKEAKDTTVNKAGEYTNYAAEKAKEAKDATVETAKETKDYT  263

Query  1220  SSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTV----QTAQQAKETLSKAGQAAKDYTV  1387
             +      KD TV    Q KDT +GA Q A +Y      +T Q+A ET  K      +   
Sbjct  264   AEKANEGKDTTVSKLGQLKDTAAGAAQKAMEYLSGKKEETKQKAAETTEKTKDTTSETAE  323

Query  1388  QAKDYASQKAGEAGNKASEAKERGTEMSKNAASYAGQKVTEAKDVTVE  1531
             +AK+  S+   EA  K  E K +G E     A  A     EA+D+  E
Sbjct  324   KAKEKLSETEEEARRKMEELKLQGKEYKDEDADRA----REARDIKAE  367


 Score = 60.1 bits (144),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 67/191 (35%), Positives = 94/191 (49%), Gaps = 28/191 (15%)
 Frame = +2

Query  1031  GQTAKDYTTQSAKQTKDTLSSAGQTAKDYT----------VQSAQQTKDTLSSAGQTAKD  1180
             G+  KDYTTQ AK+T D   +AG+   +YT           + A++TK+          D
Sbjct  88    GKEYKDYTTQKAKETTD---AAGKKINEYTETAEEKAKQAAEKAKETKEAAKGKVGEYAD  144

Query  1181  YTVQSAQQTKDTLS----SAGQTA---KDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQA  1339
             YT + A++TKDT +     A Q A   KD   Q A++AKD   G      +Y    A++A
Sbjct  145   YTAEKAKETKDTAAQKANEAAQKAKETKDSAAQKAKEAKDATMGKAGEYTNYAAGKAKEA  204

Query  1340  KE-TLSKAGQA---AKDYTVQAKDYASQKAGE----AGNKASEAKERGTEMSKNAASYAG  1495
             K+ T++K G+    A +   +AKD    KAGE    A  KA EAK+   E +K    Y  
Sbjct  205   KDTTVNKVGENTNYATEKAKEAKDTTVNKAGEYTNYAAEKAKEAKDATVETAKETKDYTA  264

Query  1496  QKVTEAKDVTV  1528
             +K  E KD TV
Sbjct  265   EKANEGKDTTV  275


 Score = 53.5 bits (127),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 64/210 (30%), Positives = 100/210 (48%), Gaps = 19/210 (9%)
 Frame = +2

Query  809   AQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKTQQAYNAAKDTT  988
             A QK+ +   +A  K ++AK+ T       + Y   KA  AKDT + K  +  N A    
Sbjct  164   AAQKAKETKDSAAQKAKEAKDATMGKAGEYTNYAAGKAKEAKDTTVNKVGENTNYA----  219

Query  989   ISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQ  1168
               K ++AKDT  +      +Y  + AK+           AKD TV++A++TKD  +    
Sbjct  220   TEKAKEAKDTTVNKAGEYTNYAAEKAKE-----------AKDATVETAKETKDYTAEKAN  268

Query  1169  TAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKET  1348
               KD TV    Q KDT + A Q A +Y     ++ K   +   +  KD T +TA++AKE 
Sbjct  269   EGKDTTVSKLGQLKDTAAGAAQKAMEYLSGKKEETKQKAAETTEKTKDTTSETAEKAKEK  328

Query  1349  LSKAGQAAK----DYTVQAKDYASQKAGEA  1426
             LS+  + A+    +  +Q K+Y  + A  A
Sbjct  329   LSETEEEARRKMEELKLQGKEYKDEDADRA  358



>ref|XP_006409163.1| hypothetical protein EUTSA_v10022656mg [Eutrema salsugineum]
 gb|ESQ50616.1| hypothetical protein EUTSA_v10022656mg [Eutrema salsugineum]
Length=498

 Score = 66.6 bits (161),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 82/269 (30%), Positives = 105/269 (39%), Gaps = 31/269 (12%)
 Frame = +2

Query  761   DHSGLSLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDT  940
             D  G++ E+ G  +  A +K+  A   A   YEKA NT          +  +KAG AKD 
Sbjct  130   DAKGMAYEKAGNAKDIAYEKAGYAKDFA---YEKAGNT--------KDFAYDKAGNAKDI  178

Query  941   ALQK----TQQAY---NAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAG  1099
             A +K       AY     AKD    K   AKD        AKDY    A    D      
Sbjct  179   AYEKGGIAKDMAYEKAGYAKDFAYDKAGNAKDMAYEKAGHAKDYAYDKAGNANDLAYEKA  238

Query  1100  QTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKD  1279
             + AK Y    A   KD        AK Y  + A   KD        AKD+       A  
Sbjct  239   EHAKAYAYDKAGDAKDMAYETAGHAKHYAYEKAGNVKDVAYEKSGHAKDFAYDKVGSAYG  298

Query  1280  TLSGAGQ----TAKDYTVQTAQQAKE-TLSKAGQAAKDYTVQAKDYASQKAGEAGNKASE  1444
             ++   G      AKD   + A  AK+    KAG         AKD A +K G A   A +
Sbjct  299   SMKDVGYDKAGDAKDMAYEMAGNAKDLAYEKAG--------NAKDMAYEKVGSAYGSAHK  350

Query  1445  AKERGTEMSKNAASYAGQKVTEAKDVTVE  1531
             AK+ G E +  A  +A +K   AKD+  E
Sbjct  351   AKDFGYEKAGEAKDFAYKKAGNAKDIAYE  379


 Score = 60.8 bits (146),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 77/269 (29%), Positives = 113/269 (42%), Gaps = 16/269 (6%)
 Frame = +2

Query  788   IGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKTQQAY  967
              GK+  T  + + +A +TA+    +     KE   S + ++ +K      +  ++ ++A 
Sbjct  25    FGKWADTTAKDARNAAETAKKMATETAQEAKEKTGSWAGWVSDKITTGFGSTKEEAEKAA  84

Query  968   NAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKD  1147
               A++    K Q  KD+       AKD+    A++ KD     G  AK    + A   KD
Sbjct  85    RVAENYAYDKAQHVKDSAYDNAGYAKDFAENKAQKAKDFAYDKGGDAKGMAYEKAGNAKD  144

Query  1148  TLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQT  1327
                     AKD+  + A  TKD        AKD   +    AKD        AKD+    
Sbjct  145   IAYEKAGYAKDFAYEKAGNTKDFAYDKAGNAKDIAYEKGGIAKDMAYEKAGYAKDFAYDK  204

Query  1328  AQQAKET-LSKAGQAAKDYTVQAKDYASQKAGEAGNKASEAKERGTEMSKNAASYAGQKV  1504
             A  AK+    KAG         AKDYA  KAG A + A E  E       +A +YA  K 
Sbjct  205   AGNAKDMAYEKAG--------HAKDYAYDKAGNANDLAYEKAE-------HAKAYAYDKA  249

Query  1505  TEAKDVTVESgkgavgyagkvaETLKDTA  1591
              +AKD+  E+   A  YA + A  +KD A
Sbjct  250   GDAKDMAYETAGHAKHYAYEKAGNVKDVA  278


 Score = 56.6 bits (135),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 75/242 (31%), Positives = 91/242 (38%), Gaps = 40/242 (17%)
 Frame = +2

Query  911   VEKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKD-TL  1087
              + AG AKD A  K Q+A    KD    K   AK         AKD   + A   KD   
Sbjct  103   YDNAGYAKDFAENKAQKA----KDFAYDKGGDAKGMAYEKAGNAKDIAYEKAGYAKDFAY  158

Query  1088  SSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQ  1267
               AG T KD+    A   KD     G  AKD   + A   KD        AKD   + A 
Sbjct  159   EKAGNT-KDFAYDKAGNAKDIAYEKGGIAKDMAYEKAGYAKDFAYDKAGNAKDMAYEKAG  217

Query  1268  QAKDTLSGAGQTAKDYTVQTAQQAKE-TLSKAGQA----------AKDYTVQ--------  1390
              AKD        A D   + A+ AK     KAG A          AK Y  +        
Sbjct  218   HAKDYAYDKAGNANDLAYEKAEHAKAYAYDKAGDAKDMAYETAGHAKHYAYEKAGNVKDV  277

Query  1391  -------AKDYASQKAGEA--------GNKASEAKERGTEMSKNAASYAGQKVTEAKDVT  1525
                    AKD+A  K G A         +KA +AK+   EM+ NA   A +K   AKD+ 
Sbjct  278   AYEKSGHAKDFAYDKVGSAYGSMKDVGYDKAGDAKDMAYEMAGNAKDLAYEKAGNAKDMA  337

Query  1526  VE  1531
              E
Sbjct  338   YE  339



>ref|WP_022921493.1| hypothetical protein [Ornithinimicrobium pekingense]
Length=446

 Score = 65.9 bits (159),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 46/146 (32%), Positives = 65/146 (45%), Gaps = 11/146 (8%)
 Frame = +2

Query  983   TTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSA  1162
             T IS  Q+  D   + G+T K    + A+  +D + +     +D  +   Q+T D L + 
Sbjct  246   TIISLAQRLHDQHVAEGETTKARLVEEAETYRDRVVTEADQKRDELITDGQETHDRLVTE  305

Query  1163  GQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAK-----------  1309
             GQT  D  VQ+ Q+T D L   G    D  VQ+ QQ  D L   GQ  +           
Sbjct  306   GQTRHDELVQTGQETHDRLVQEGHAKHDELVQTGQQTHDNLVQEGQQERHRLVTEGQAKH  365

Query  1310  DYTVQTAQQAKETLSKAGQAAKDYTV  1387
             D  V T QQ  +TL   GQ ++D  V
Sbjct  366   DELVTTGQQTHDTLVTEGQTSRDQMV  391


 Score = 65.5 bits (158),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 48/145 (33%), Positives = 67/145 (46%), Gaps = 15/145 (10%)
 Frame = +2

Query  908   LVEKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTL  1087
             LVE+A   +D  + +  Q     +D  I+  Q+  D   + GQT  D   Q+ ++T D L
Sbjct  269   LVEEAETYRDRVVTEADQK----RDELITDGQETHDRLVTEGQTRHDELVQTGQETHDRL  324

Query  1088  SSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQ  1267
                G    D  VQ+ QQT D L           VQ  QQ +  L + GQ   D  V + Q
Sbjct  325   VQEGHAKHDELVQTGQQTHDNL-----------VQEGQQERHRLVTEGQAKHDELVTTGQ  373

Query  1268  QAKDTLSGAGQTAKDYTVQTAQQAK  1342
             Q  DTL   GQT++D  V  A+Q +
Sbjct  374   QTHDTLVTEGQTSRDQMVGEAEQQR  398



>ref|XP_009375647.1| PREDICTED: embryonic protein DC-8-like [Pyrus x bretschneideri]
Length=452

 Score = 65.9 bits (159),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 77/238 (32%), Positives = 118/238 (50%), Gaps = 27/238 (11%)
 Frame = +2

Query  809   AQQKSIDALQTAQNKYEKAKNTTKENV-QSGSQYLVEKAGAAKDTALQKTQQAYN-----  970
             A QK+ +   TA  K ++ K+TT        + Y  EKA   +DT + K  +  N     
Sbjct  169   AAQKAKETKDTAAQKAKEVKDTTMGKAGDEYTNYAAEKAKEVQDTTVNKAGEYTNYGTEK  228

Query  971   --AAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKD-TLSSAGQ----------TAK  1111
                AKDTT++K ++AKDT  +      +Y  + AK+ KD T++ AG+           AK
Sbjct  229   AREAKDTTLNKAKEAKDTTVNKAGEYTNYAAEKAKEAKDTTINKAGEYTNYAAEKAKEAK  288

Query  1112  DYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDT-LS  1288
             D TV++A++TKD  +   +  KD TV    Q KDT + A Q A +Y     ++ K   + 
Sbjct  289   DATVETAKETKDYTAEKAKEGKDTTVSKLGQLKDTAAGAAQKAVEYLSGKKEETKQKGVE  348

Query  1289  GAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGNKASEAKERGT  1462
              AG+T K  T +TA++ KE LS+  + A+      +        E  N+A EA E+GT
Sbjct  349   TAGKT-KYMTYETAEKTKEKLSETEEKAR------RKMEELNKDEDANRAREACEQGT  399


 Score = 63.5 bits (153),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 65/174 (37%), Positives = 90/174 (52%), Gaps = 21/174 (12%)
 Frame = +2

Query  1046  DYTTQSAKQTKDTLS----SAGQTAK---DYTVQSAQQTKDT-LSSAGQTAKDYTVQSAQ  1201
             DYT   AK+TKDT +     A Q AK   D   Q A++ KDT +  AG    +Y  + A+
Sbjct  149   DYTAPKAKETKDTAAQKANEAAQKAKETKDTAAQKAKEVKDTTMGKAGDEYTNYAAEKAK  208

Query  1202  QTKDT-LSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKD  1378
             + +DT ++ AG+   +Y  + A++AKDT     + AKD TV    +A E  + A + AK 
Sbjct  209   EVQDTTVNKAGEYT-NYGTEKAREAKDTTLNKAKEAKDTTV---NKAGEYTNYAAEKAK-  263

Query  1379  YTVQAKDYASQKAGE----AGNKASEAKERGTEMSKNAASYAGQKVTEAKDVTV  1528
                +AKD    KAGE    A  KA EAK+   E +K    Y  +K  E KD TV
Sbjct  264   ---EAKDTTINKAGEYTNYAAEKAKEAKDATVETAKETKDYTAEKAKEGKDTTV  314


 Score = 62.0 bits (149),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 66/202 (33%), Positives = 104/202 (51%), Gaps = 14/202 (7%)
 Frame = +2

Query  905   YLVEKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKD----TFSSTGQTAKDYTTQSAKQ  1072
             Y   KA   KDTA QK  +A   AK+T  +  Q+AK+    T    G    +Y  + AK+
Sbjct  150   YTAPKAKETKDTAAQKANEAAQKAKETKDTAAQKAKEVKDTTMGKAGDEYTNYAAEKAKE  209

Query  1073  TKDT-LSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDY  1249
              +DT ++ AG+   +Y  + A++ KDT  +  + AKD TV  A +  +  +   + AKD 
Sbjct  210   VQDTTVNKAGEYT-NYGTEKAREAKDTTLNKAKEAKDTTVNKAGEYTNYAAEKAKEAKDT  268

Query  1250  TVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTV----QAKDY---AS  1408
             T+  A +  +  +   + AKD TV+TA++ K+  ++  +  KD TV    Q KD    A+
Sbjct  269   TINKAGEYTNYAAEKAKEAKDATVETAKETKDYTAEKAKEGKDTTVSKLGQLKDTAAGAA  328

Query  1409  QKAGE-AGNKASEAKERGTEMS  1471
             QKA E    K  E K++G E +
Sbjct  329   QKAVEYLSGKKEETKQKGVETA  350


 Score = 59.7 bits (143),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 57/172 (33%), Positives = 88/172 (51%), Gaps = 17/172 (10%)
 Frame = +2

Query  776   SLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKT  955
             ++ + G+Y     +K+ +A  T  NK ++AK+TT       + Y  EKA  AKDT + K 
Sbjct  214   TVNKAGEYTNYGTEKAREAKDTTLNKAKEAKDTTVNKAGEYTNYAAEKAKEAKDTTINKA  273

Query  956   QQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQ  1135
              +  N A +    K ++AKD    T +  KDYT + AK+ KDT           TV    
Sbjct  274   GEYTNYAAE----KAKEAKDATVETAKETKDYTAEKAKEGKDT-----------TVSKLG  318

Query  1136  QTKDTLSSAGQTAKDYTVQSAQQTKDT-LSSAGQTAKDYTVQSAQQAKDTLS  1288
             Q KDT + A Q A +Y     ++TK   + +AG+T K  T ++A++ K+ LS
Sbjct  319   QLKDTAAGAAQKAVEYLSGKKEETKQKGVETAGKT-KYMTYETAEKTKEKLS  369



>ref|XP_010667914.1| PREDICTED: uncharacterized protein LOC104884910 [Beta vulgaris 
subsp. vulgaris]
Length=1351

 Score = 66.2 bits (160),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 58/175 (33%), Positives = 78/175 (45%), Gaps = 4/175 (2%)
 Frame = +2

Query  914   EKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSS  1093
             EKA A      Q   +      +TT  K QQAK+  SS GQ + +YT++ A Q KDT  S
Sbjct  1163  EKARAGVGATTQFISKKSRPVAETTSEKAQQAKEDISSAGQKSMEYTSEKAAQAKDTTVS  1222

Query  1094  AGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQA  1273
             + +T   Y  + A   KD     G+ A  Y  + A++ KD    AG  A  YT + A  A
Sbjct  1223  STKTVAGYMGEKAVAAKDVAVQTGKPAAQYAGKVAEEVKDQAVVAGWGAAHYTTEVAVDA  1282

Query  1274  KDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTV----QAKDYASQKAGEA  1426
                  G    AKD     A +A E   K    A+D  V    +  DY ++K  EA
Sbjct  1283  TKKAGGVVGKAKDVMATAAHKATELAEKPVAVARDVAVDTEEKVADYTARKKREA  1337


 Score = 60.1 bits (144),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 73/143 (51%), Gaps = 11/143 (8%)
 Frame = +2

Query  1118  TVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAG  1297
             T + AQQ K+ +SSAGQ + +YT + A Q KDT  S+ +T   Y  + A  AKD     G
Sbjct  1187  TSEKAQQAKEDISSAGQKSMEYTSEKAAQAKDTTVSSTKTVAGYMGEKAVAAKDVAVQTG  1246

Query  1298  QTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGNKASE----AKERGTE  1465
             + A  Y  + A++ K+    AG  A  YT +    A++KAG    KA +    A  + TE
Sbjct  1247  KPAAQYAGKVAEEVKDQAVVAGWGAAHYTTEVAVDATKKAGGVVGKAKDVMATAAHKATE  1306

Query  1466  MSKNAASYAGQKVTEAKDVTVES  1534
             +       A + V  A+DV V++
Sbjct  1307  L-------AEKPVAVARDVAVDT  1322


 Score = 55.8 bits (133),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 49/153 (32%), Positives = 77/153 (50%), Gaps = 11/153 (7%)
 Frame = +2

Query  1052  TTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAG  1231
             T++ A+Q K+ +SSAGQ + +YT + A Q KDT  S+ +T   Y  + A   KD     G
Sbjct  1187  TSEKAQQAKEDISSAGQKSMEYTSEKAAQAKDTTVSSTKTVAGYMGEKAVAAKDVAVQTG  1246

Query  1232  QTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQ  1411
             + A  Y  + A++ KD    AG  A  YT + A  A +   KAG        +AKD  + 
Sbjct  1247  KPAAQYAGKVAEEVKDQAVVAGWGAAHYTTEVAVDATK---KAGGVVG----KAKDVMAT  1299

Query  1412  KAGEAGNKASEAKERGTEMSKNAASYAGQKVTE  1510
                 A +KA+E  E+   ++++ A    +KV +
Sbjct  1300  ----AAHKATELAEKPVAVARDVAVDTEEKVAD  1328



>ref|XP_007804287.1| hypothetical protein EPUS_00440 [Endocarpon pusillum Z07020]
 gb|ERF70252.1| hypothetical protein EPUS_00440 [Endocarpon pusillum Z07020]
Length=1874

 Score = 66.2 bits (160),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 62/205 (30%), Positives = 93/205 (45%), Gaps = 0/205 (0%)
 Frame = +2

Query  803   QTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKTQQAYNAAKD  982
             + A  K  DA+ TA++  E   +T ++  +  +    + A  A DTA    + A + A+D
Sbjct  277   EDAADKPEDAVDTAEDTAEDVADTAEDTAKDAADTAEDTAEDAADTAEDTAKDAADTAED  336

Query  983   TTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSA  1162
             T       A+DT      TA+D    +A   +DT   A  TA+D    +A   +DT   A
Sbjct  337   TAEGAADTAEDTAKDAADTAEDTAKDAADTAEDTAKDAADTAEDTAKDAADTAEDTAKDA  396

Query  1163  GQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAK  1342
               TA+D    +A   +DT   A  TA+D    +A  A+DT   A  TA+D     A  A+
Sbjct  397   ADTAEDTAKDAADTAEDTAKDAADTAEDTAKDAADTAEDTAKDAADTAEDTAKDAADTAE  456

Query  1343  ETLSKAGQAAKDYTVQAKDYASQKA  1417
             +T   A   A+D    A D A  +A
Sbjct  457   DTAKDAADTAEDTAEGAADTAEDEA  481


 Score = 61.6 bits (148),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 65/221 (29%), Positives = 100/221 (45%), Gaps = 4/221 (2%)
 Frame = +2

Query  830   ALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKTQQAYNAAKDTTISKTQQA  1009
             A  TA++  E A +  ++ V +      + A  A+DTA    + A + A+DT       A
Sbjct  268   AADTAEDTAEDAADKPEDAVDTAEDTAEDVADTAEDTA----KDAADTAEDTAEDAADTA  323

Query  1010  KDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTV  1189
             +DT      TA+D    +A   +DT   A  TA+D    +A   +DT   A  TA+D   
Sbjct  324   EDTAKDAADTAEDTAEGAADTAEDTAKDAADTAEDTAKDAADTAEDTAKDAADTAEDTAK  383

Query  1190  QSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQA  1369
              +A   +DT   A  TA+D    +A  A+DT   A  TA+D     A  A++T   A   
Sbjct  384   DAADTAEDTAKDAADTAEDTAKDAADTAEDTAKDAADTAEDTAKDAADTAEDTAKDAADT  443

Query  1370  AKDYTVQAKDYASQKAGEAGNKASEAKERGTEMSKNAASYA  1492
             A+D    A D A   A +A + A +  E   + +++ A  A
Sbjct  444   AEDTAKDAADTAEDTAKDAADTAEDTAEGAADTAEDEAEGA  484



>ref|XP_009148762.1| PREDICTED: embryonic protein DC-8 [Brassica rapa]
Length=451

 Score = 65.1 bits (157),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 66/207 (32%), Positives = 103/207 (50%), Gaps = 20/207 (10%)
 Frame = +2

Query  932   KDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAK  1111
             KD  + K+  A  + K+     + +A +   +TG+ A + T ++A +TK+T         
Sbjct  73    KDAVIGKSHDAVESTKEGAEVASGKAGEVKDATGEKAAEVTDRTANKTKETA--------  124

Query  1112  DYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSG  1291
             DYT + A++ KD  +      KDYT + A++ KD  +   + + DYT   A++AKD  + 
Sbjct  125   DYTAEKAKEAKDKTAEQVGEYKDYTAEKAKEAKDRTAEKTKESADYTADKAKEAKDKTAE  184

Query  1292  AGQTAKDYTVQTAQQAKETLSKAGQAAKDYTV----QAKDYASQK----AGEAGNKASEA  1447
                  KDY   TA +A+E   K G+  KDYT     +AKD  ++K    AG   +KA EA
Sbjct  185   KVGEYKDY---TADKAREAAEKVGE-YKDYTAEKAKEAKDKTAEKTKETAGYTADKAKEA  240

Query  1448  KERGTEMSKNAASYAGQKVTEAKDVTV  1528
             K++  E       Y  +K TE KD  V
Sbjct  241   KDKTAEKLGEYKDYTAEKATEGKDAGV  267


 Score = 64.3 bits (155),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 65/190 (34%), Positives = 97/190 (51%), Gaps = 16/190 (8%)
 Frame = +2

Query  851   KYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKTQQA--YNA-----AKDTTISKTQQA  1009
             K ++AK+ T E V     Y  EKA  AKD   +KT+++  Y A     AKD T  K  + 
Sbjct  130   KAKEAKDKTAEQVGEYKDYTAEKAKEAKDRTAEKTKESADYTADKAKEAKDKTAEKVGEY  189

Query  1010  KDTFSSTGQTA-------KDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQ  1168
             KD  +   + A       KDYT + AK+ KD  +   +    YT   A++ KD  +    
Sbjct  190   KDYTADKAREAAEKVGEYKDYTAEKAKEAKDKTAEKTKETAGYTADKAKEAKDKTAEKLG  249

Query  1169  TAKDYTVQSAQQTKDT-LSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKE  1345
               KDYT + A + KD  +S  G+  KD  V +A++A   LSG  +  K  TV+T + AKE
Sbjct  250   EYKDYTAEKATEGKDAGVSKIGEL-KDSAVDTAKRAMGFLSGKTEETKQKTVETKETAKE  308

Query  1346  TLSKAGQAAK  1375
              +++AG+ A+
Sbjct  309   KMNEAGEEAR  318


 Score = 58.9 bits (141),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 71/229 (31%), Positives = 110/229 (48%), Gaps = 22/229 (10%)
 Frame = +2

Query  881   ENVQSGSQYLVEKAGAAKDT----ALQKTQQAYNAAKDT---TISKTQQAKDTFSSTGQT  1039
             E+ + G++    KAG  KD     A + T +  N  K+T   T  K ++AKD  +     
Sbjct  85    ESTKEGAEVASGKAGEVKDATGEKAAEVTDRTANKTKETADYTAEKAKEAKDKTAEQVGE  144

Query  1040  AKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTL  1219
              KDYT + AK+ KD  +   + + DYT   A++ KD  +      KDYT   A++  + +
Sbjct  145   YKDYTAEKAKEAKDRTAEKTKESADYTADKAKEAKDKTAEKVGEYKDYTADKAREAAEKV  204

Query  1220  SSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKD  1399
                    KDYT + A++AKD  +   +  K+    TA +AKE   K  +   +Y    KD
Sbjct  205   GE----YKDYTAEKAKEAKDKTA---EKTKETAGYTADKAKEAKDKTAEKLGEY----KD  253

Query  1400  YASQKAGE---AG-NKASEAKERGTEMSKNAASYAGQKVTEAKDVTVES  1534
             Y ++KA E   AG +K  E K+   + +K A  +   K  E K  TVE+
Sbjct  254   YTAEKATEGKDAGVSKIGELKDSAVDTAKRAMGFLSGKTEETKQKTVET  302



>emb|CDX76237.1| BnaA04g05010D [Brassica napus]
Length=451

 Score = 64.3 bits (155),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 65/190 (34%), Positives = 97/190 (51%), Gaps = 16/190 (8%)
 Frame = +2

Query  851   KYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKTQQA--YNA-----AKDTTISKTQQA  1009
             K ++AK+ T E V     Y  EKA  AKD   +KT+++  Y A     AKD T  K  + 
Sbjct  130   KAKEAKDKTAEQVGEYKDYTAEKAKEAKDRTAEKTKESADYTADKAKEAKDKTAEKVGEY  189

Query  1010  KDTFSSTGQTA-------KDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQ  1168
             KD  +   + A       KDYT + AK+ KD  +   +    YT   A++ KD  +    
Sbjct  190   KDYTADKAREAAEKVGEYKDYTAEKAKEAKDKTAEKTKETAGYTADKAKEAKDKTAEKLG  249

Query  1169  TAKDYTVQSAQQTKDT-LSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKE  1345
               KDYT + A + KD  +S  G+  KD  V +A++A   LSG  +  K  TV+T + AKE
Sbjct  250   EYKDYTAEKATEGKDAGVSKIGEL-KDSAVDTAKRAMGFLSGKTEETKQKTVETKETAKE  308

Query  1346  TLSKAGQAAK  1375
              +++AG+ A+
Sbjct  309   KMNEAGEEAR  318


 Score = 64.3 bits (155),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 66/207 (32%), Positives = 103/207 (50%), Gaps = 20/207 (10%)
 Frame = +2

Query  932   KDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAK  1111
             KD  + K+  A  + K+     + +A +   +TG+ A + T ++A +TK+T         
Sbjct  73    KDAVIGKSHDAAESTKEGAEVASGKAGEVKDATGEKAGEVTDRTANKTKETA--------  124

Query  1112  DYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSG  1291
             DYT + A++ KD  +      KDYT + A++ KD  +   + + DYT   A++AKD  + 
Sbjct  125   DYTAEKAKEAKDKTAEQVGEYKDYTAEKAKEAKDRTAEKTKESADYTADKAKEAKDKTAE  184

Query  1292  AGQTAKDYTVQTAQQAKETLSKAGQAAKDYTV----QAKDYASQK----AGEAGNKASEA  1447
                  KDY   TA +A+E   K G+  KDYT     +AKD  ++K    AG   +KA EA
Sbjct  185   KVGEYKDY---TADKAREAAEKVGE-YKDYTAEKAKEAKDKTAEKTKETAGYTADKAKEA  240

Query  1448  KERGTEMSKNAASYAGQKVTEAKDVTV  1528
             K++  E       Y  +K TE KD  V
Sbjct  241   KDKTAEKLGEYKDYTAEKATEGKDAGV  267


 Score = 58.9 bits (141),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 71/229 (31%), Positives = 110/229 (48%), Gaps = 22/229 (10%)
 Frame = +2

Query  881   ENVQSGSQYLVEKAGAAKDTALQK----TQQAYNAAKDT---TISKTQQAKDTFSSTGQT  1039
             E+ + G++    KAG  KD   +K    T +  N  K+T   T  K ++AKD  +     
Sbjct  85    ESTKEGAEVASGKAGEVKDATGEKAGEVTDRTANKTKETADYTAEKAKEAKDKTAEQVGE  144

Query  1040  AKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTL  1219
              KDYT + AK+ KD  +   + + DYT   A++ KD  +      KDYT   A++  + +
Sbjct  145   YKDYTAEKAKEAKDRTAEKTKESADYTADKAKEAKDKTAEKVGEYKDYTADKAREAAEKV  204

Query  1220  SSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKD  1399
                    KDYT + A++AKD  +   +  K+    TA +AKE   K  +   +Y    KD
Sbjct  205   GE----YKDYTAEKAKEAKDKTA---EKTKETAGYTADKAKEAKDKTAEKLGEY----KD  253

Query  1400  YASQKAGE---AG-NKASEAKERGTEMSKNAASYAGQKVTEAKDVTVES  1534
             Y ++KA E   AG +K  E K+   + +K A  +   K  E K  TVE+
Sbjct  254   YTAEKATEGKDAGVSKIGELKDSAVDTAKRAMGFLSGKTEETKQKTVET  302



>gb|EMS50716.1| hypothetical protein TRIUR3_33086 [Triticum urartu]
Length=432

 Score = 64.3 bits (155),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 57/156 (37%), Positives = 77/156 (49%), Gaps = 33/156 (21%)
 Frame = +2

Query  965   YNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLS-----SAGQT------AK  1111
             +  AKDT   KT QA D   +T    KDYT + AK+T D+++     +A  T      AK
Sbjct  172   FGGAKDTAADKTYQAADATGNTMGEYKDYTAEKAKETNDSVAHKTSETAEATRNKLGEAK  231

Query  1112  DYTVQSAQQTKDTLSS--------------------AGQT--AKDYTVQSAQQTKDTLSS  1225
             DYTV+ A + KDT++                     AG+T  AKD T+Q AQQTKD  + 
Sbjct  232   DYTVEKATEAKDTVAQKTNETAEATKNKLGEYKDALAGKTQEAKDTTMQKAQQTKDAAAE  291

Query  1226  AGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQ  1333
               + AKD T Q A +  D   G  Q A+D ++ T Q
Sbjct  292   KARQAKDVTQQKAGEYTDATKGTAQEARDRSMATTQ  327



>ref|XP_008806238.1| PREDICTED: embryonic protein DC-8-like isoform X1 [Phoenix dactylifera]
Length=473

 Score = 64.3 bits (155),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 72/224 (32%), Positives = 104/224 (46%), Gaps = 33/224 (15%)
 Frame = +2

Query  914   EKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSS  1093
             EKAG  KD A +K ++     KD +  K ++ KD         KD T + AK+ KD  + 
Sbjct  79    EKAGETKDAAAEKAKET----KDASAEKAKETKDAAMQKMGEYKDTTAEKAKEYKDWAAE  134

Query  1094  AGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQA  1273
               +  KD T+Q A + KD         KD   + A + KDT   + Q A +YT  + ++A
Sbjct  135   KAREGKDTTMQKAGEYKDVAMEKAGVHKDTAAEKATEAKDT---SKQKAGEYTDSAVEKA  191

Query  1274  KDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDY-----------ASQKAG  1420
             ++         KD ++Q   +AKE+LS+    A D   +AKD             S+KA 
Sbjct  192   REM--------KDASMQKTGEAKESLSEKASKAADKAREAKDAGMEKTEEYKESGSEKAR  243

Query  1421  EAGNKASEAKERGTE-------MSKNAASYAGQKVTEAKDVTVE  1531
             EA  KA EAKE   +       ++   AS A +K  EAKDV  E
Sbjct  244   EAAEKAREAKEASMQKTEEYKGLASEKASEAAEKAREAKDVAAE  287



>emb|CDY58291.1| BnaCnng32920D [Brassica napus]
Length=452

 Score = 64.3 bits (155),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 65/207 (31%), Positives = 97/207 (47%), Gaps = 19/207 (9%)
 Frame = +2

Query  953   TQQAYNAAKDTTISKTQQAKDTFSSTGQTA-------KDYTTQSAKQTKDTLSSAGQTAK  1111
               +A    KD  I K+  A ++     + A       KD T + A + KD  ++  +   
Sbjct  66    VMKAVQGTKDAVIGKSHDAAESTKEGSEVASGKAGEVKDATAEKAGEVKDRTANKTKETA  125

Query  1112  DYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSG  1291
             DYT + A++ KD  +      KDYT + A++ KD  +   +   DYT   A++AKD  + 
Sbjct  126   DYTAEKAKEAKDKTAEKVGEYKDYTAEKAKEAKDRTAEKTKETADYTADKAKEAKDKTAE  185

Query  1292  AGQTAKDYTVQTAQQAKETLSKAGQAAKDYTV----QAKDYASQK----AGEAGNKASEA  1447
                  KDY   TA +A+E   K G+  KDYT     +AKD  ++K    AG   +KA EA
Sbjct  186   KVGEYKDY---TADKAREAAEKVGE-YKDYTAEKAKEAKDKTAEKTKETAGYTADKAKEA  241

Query  1448  KERGTEMSKNAASYAGQKVTEAKDVTV  1528
             K++  E       Y  +K TE KD  V
Sbjct  242   KDKTPEKLGEYKDYTAEKATEGKDAGV  268


 Score = 64.3 bits (155),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 65/190 (34%), Positives = 95/190 (50%), Gaps = 16/190 (8%)
 Frame = +2

Query  851   KYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKTQQA--YNA-----AKDTTISKTQQA  1009
             K ++AK+ T E V     Y  EKA  AKD   +KT++   Y A     AKD T  K  + 
Sbjct  131   KAKEAKDKTAEKVGEYKDYTAEKAKEAKDRTAEKTKETADYTADKAKEAKDKTAEKVGEY  190

Query  1010  KDTFSSTGQTA-------KDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQ  1168
             KD  +   + A       KDYT + AK+ KD  +   +    YT   A++ KD       
Sbjct  191   KDYTADKAREAAEKVGEYKDYTAEKAKEAKDKTAEKTKETAGYTADKAKEAKDKTPEKLG  250

Query  1169  TAKDYTVQSAQQTKDT-LSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKE  1345
               KDYT + A + KD  +S  G+  KD  V +A++A   LSG  +  K  TV+T + AKE
Sbjct  251   EYKDYTAEKATEGKDAGVSKIGEL-KDSAVDTAKRAMGFLSGKTEETKQKTVETKETAKE  309

Query  1346  TLSKAGQAAK  1375
              +++AG+ A+
Sbjct  310   KMNEAGEEAR  319


 Score = 60.8 bits (146),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 69/212 (33%), Positives = 102/212 (48%), Gaps = 21/212 (10%)
 Frame = +2

Query  914   EKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSS  1093
             EKAG  KD    KT++      D T  K ++AKD  +      KDYT + AK+ KD  + 
Sbjct  108   EKAGEVKDRTANKTKETA----DYTAEKAKEAKDKTAEKVGEYKDYTAEKAKEAKDRTAE  163

Query  1094  AGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQA  1273
               +   DYT   A++ KD  +      KDYT   A++  + +       KDYT + A++A
Sbjct  164   KTKETADYTADKAKEAKDKTAEKVGEYKDYTADKAREAAEKVGE----YKDYTAEKAKEA  219

Query  1274  KDTLSGAGQTAKDYTVQTAQQAKE-TLSKAGQAAKDYTVQAKDYASQKAGE---AG-NKA  1438
             KD  +   +    YT   A++AK+ T  K G+    Y    KDY ++KA E   AG +K 
Sbjct  220   KDKTAEKTKETAGYTADKAKEAKDKTPEKLGE----Y----KDYTAEKATEGKDAGVSKI  271

Query  1439  SEAKERGTEMSKNAASYAGQKVTEAKDVTVES  1534
              E K+   + +K A  +   K  E K  TVE+
Sbjct  272   GELKDSAVDTAKRAMGFLSGKTEETKQKTVET  303



>ref|XP_003535256.1| PREDICTED: embryonic protein DC-8-like [Glycine max]
 gb|KHN45703.1| Embryonic protein DC-8 [Glycine soja]
Length=449

 Score = 63.9 bits (154),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 64/180 (36%), Positives = 92/180 (51%), Gaps = 18/180 (10%)
 Frame = +2

Query  1016  TFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKD-TLSSAGQTAKDYTVQ  1192
             T S  G+ A DY +Q AK+TKD          DY  Q A++TKD T+  AG+   DY  Q
Sbjct  130   TGSKVGEYA-DYGSQKAKETKDATKEKAGEYTDYASQKAKETKDKTMEKAGEYT-DYASQ  187

Query  1193  SAQQTKD-TLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKE-TLSKAGQ  1366
              A++TKD T+  AG+   DY  Q A++AKD     G   KDY  + A++ K+ T++K G 
Sbjct  188   KAKETKDKTMEKAGEYT-DYASQKAKEAKDKTMEKGGEYKDYAAEKAKEGKDATVNKMG-  245

Query  1367  AAKDYTVQAKDYASQKAGEAGN----KASEAKERGTEMSKNAASYAGQKVTEAKDVTVES  1534
                    + KDY ++KA E  +    K  E K+   + +K A  Y   K  E K+   E+
Sbjct  246   -------EYKDYTAEKAKEGKDTTLGKLGELKDSAADAAKRAVGYLSGKTEETKEKVSET  298


 Score = 63.5 bits (153),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 69/185 (37%), Positives = 102/185 (55%), Gaps = 18/185 (10%)
 Frame = +2

Query  998   TQQAKDTFSSTGQTA---KDYTTQSAKQTKD-TLSSAGQTAKDYTVQSAQQTKD-TLSSA  1162
             +Q+AK+T  +T + A    DY +Q AK+TKD T+  AG+   DY  Q A++TKD T+  A
Sbjct  142   SQKAKETKDATKEKAGEYTDYASQKAKETKDKTMEKAGEYT-DYASQKAKETKDKTMEKA  200

Query  1163  GQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKD-TLSGAGQTAKDYTVQTAQQA  1339
             G+   DY  Q A++ KD     G   KDY  + A++ KD T++  G+  KDYT + A++ 
Sbjct  201   GEYT-DYASQKAKEAKDKTMEKGGEYKDYAAEKAKEGKDATVNKMGEY-KDYTAEKAKEG  258

Query  1340  KE-TLSKAGQAAKDYTVQAKDYASQKAGEAGNKASEAKERGTEMSKNAASYAGQKVTEAK  1516
             K+ TL K G+  KD    A D A +  G    K  E KE+ +E ++  A+    K  E K
Sbjct  259   KDTTLGKLGE-LKD---SAADAAKRAVGYLSGKTEETKEKVSETAEATAN----KAAEMK  310

Query  1517  DVTVE  1531
             + T E
Sbjct  311   EATRE  315


 Score = 54.3 bits (129),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 70/202 (35%), Positives = 96/202 (48%), Gaps = 27/202 (13%)
 Frame = +2

Query  944   LQKTQQAYNAAKDTTISKTQQAKDTFS-STGQTAKDYTTQ-----SAKQTKDTLSSAGQT  1105
              +  Q  Y  AK+  + K + +  T S ST +   D   Q     +A++ +D   SA ++
Sbjct  60    FKAVQDTYENAKEAVVGKKEPSTTTNSYSTREVIHDVDIQPDDAAAAREVRD--KSASKS  117

Query  1106  AKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKD-T  1282
                Y   SA     T S  G+ A DY  Q A++TKD          DY  Q A++ KD T
Sbjct  118   PGIYN--SATADNKTGSKVGEYA-DYGSQKAKETKDATKEKAGEYTDYASQKAKETKDKT  174

Query  1283  LSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGNKASEAKERGT  1462
             +  AG+    YT   +Q+AKET  K  + A +YT    DYASQKA EA +K     E+G 
Sbjct  175   MEKAGE----YTDYASQKAKETKDKTMEKAGEYT----DYASQKAKEAKDKTM---EKGG  223

Query  1463  EMSKNAASYAGQKVTEAKDVTV  1528
             E       YA +K  E KD TV
Sbjct  224   EYK----DYAAEKAKEGKDATV  241



>ref|XP_008806239.1| PREDICTED: embryonic protein DC-8-like isoform X2 [Phoenix dactylifera]
Length=471

 Score = 63.9 bits (154),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 72/224 (32%), Positives = 104/224 (46%), Gaps = 33/224 (15%)
 Frame = +2

Query  914   EKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSS  1093
             EKAG  KD A +K ++     KD +  K ++ KD         KD T + AK+ KD  + 
Sbjct  79    EKAGETKDAAAEKAKET----KDASAEKAKETKDAAMQKMGEYKDTTAEKAKEYKDWAAE  134

Query  1094  AGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQA  1273
               +  KD T+Q A + KD         KD   + A + KDT   + Q A +YT  + ++A
Sbjct  135   KAREGKDTTMQKAGEYKDVAMEKAGVHKDTAAEKATEAKDT---SKQKAGEYTDSAVEKA  191

Query  1274  KDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDY-----------ASQKAG  1420
             ++         KD ++Q   +AKE+LS+    A D   +AKD             S+KA 
Sbjct  192   REM--------KDASMQKTGEAKESLSEKASKAADKAREAKDAGMEKTEEYKESGSEKAR  243

Query  1421  EAGNKASEAKERGTE-------MSKNAASYAGQKVTEAKDVTVE  1531
             EA  KA EAKE   +       ++   AS A +K  EAKDV  E
Sbjct  244   EAAEKAREAKEASMQKTEEYKGLASEKASEAAEKAREAKDVAAE  287



>ref|XP_009370070.1| PREDICTED: embryonic protein DC-8-like isoform X2 [Pyrus x bretschneideri]
Length=501

 Score = 63.9 bits (154),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 64/186 (34%), Positives = 95/186 (51%), Gaps = 16/186 (9%)
 Frame = +2

Query  905   YLVEKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQS---AKQT  1075
             Y  EKA   KDTA QK  +A   AK+T  S  Q+AK+   +T   A +YT  +   AK+ 
Sbjct  145   YTAEKAKETKDTAAQKANEAAQKAKETKDSAAQKAKEAKDATMGKAGEYTNYAAGKAKEA  204

Query  1076  KD-TLSSAGQTAKDYTVQSAQQTKD-TLSSAGQ----------TAKDYTVQSAQQTKDTL  1219
             KD T++  G+   +Y  + A++ KD T++ AG+           AKD TV  A +  +  
Sbjct  205   KDTTVNKVGENT-NYATEKAKEAKDTTMNKAGEYTNYADEKAKEAKDTTVNKAGEYTNYA  263

Query  1220  SSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKD  1399
             +   + AKD TV++A++ KD  +      KD TV    Q K+T + A Q A +Y    K+
Sbjct  264   AEKAKEAKDATVETAKETKDYTAEKANEGKDTTVSKLGQLKDTAAGAAQKAMEYLSGKKE  323

Query  1400  YASQKA  1417
                QKA
Sbjct  324   ETKQKA  329


 Score = 60.1 bits (144),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 68/193 (35%), Positives = 97/193 (50%), Gaps = 28/193 (15%)
 Frame = +2

Query  1031  GQTAKDYTTQSAKQTKDTLSSAGQTAKDYT----------VQSAQQTKDTLSSAGQTAKD  1180
             G+  KDYTTQ AK+T D   +AG+   +YT           + A++TK+          D
Sbjct  88    GKEYKDYTTQKAKETTD---AAGKKINEYTETAEEKAKQAAEKAKETKEAAKGKVGEYAD  144

Query  1181  YTVQSAQQTKDTLS----SAGQTA---KDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQA  1339
             YT + A++TKDT +     A Q A   KD   Q A++AKD   G      +Y    A++A
Sbjct  145   YTAEKAKETKDTAAQKANEAAQKAKETKDSAAQKAKEAKDATMGKAGEYTNYAAGKAKEA  204

Query  1340  KE-TLSKAGQA---AKDYTVQAKDYASQKAGEAGN----KASEAKERGTEMSKNAASYAG  1495
             K+ T++K G+    A +   +AKD    KAGE  N    KA EAK+     +    +YA 
Sbjct  205   KDTTVNKVGENTNYATEKAKEAKDTTMNKAGEYTNYADEKAKEAKDTTVNKAGEYTNYAA  264

Query  1496  QKVTEAKDVTVES  1534
             +K  EAKD TVE+
Sbjct  265   EKAKEAKDATVET  277


 Score = 56.2 bits (134),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 71/233 (30%), Positives = 112/233 (48%), Gaps = 30/233 (13%)
 Frame = +2

Query  800   RQTAQQKSIDALQTAQN-------KYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKTQ  958
             + TA QK+ +A Q A+        K ++AK+ T       + Y   KA  AKDT + K  
Sbjct  154   KDTAAQKANEAAQKAKETKDSAAQKAKEAKDATMGKAGEYTNYAAGKAKEAKDTTVNKVG  213

Query  959   QAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDT-LSSAGQTAKDYTVQSAQ  1135
             +  N A      K ++AKDT  +      +Y  + AK+ KDT ++ AG+   +Y  + A+
Sbjct  214   ENTNYA----TEKAKEAKDTTMNKAGEYTNYADEKAKEAKDTTVNKAGEYT-NYAAEKAK  268

Query  1136  QTKDTLSSAGQTAKDYTVQSAQQTKD-TLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKD  1312
             + KD      +  KDYT + A + KD T+S  GQ  KD    +AQ+A + LSG  +  K 
Sbjct  269   EAKDATVETAKETKDYTAEKANEGKDTTVSKLGQL-KDTAAGAAQKAMEYLSGKKEETKQ  327

Query  1313  YTV-----------QTAQQAKETLSKAGQAAK----DYTVQAKDYASQKAGEA  1426
                           +TA++AKE LS+  + A+    +  +Q K+Y  + A  A
Sbjct  328   KAAETTEKTKDTTSETAEKAKEKLSETEEEARRKMEELKLQGKEYKDEDADRA  380



>ref|XP_011038233.1| PREDICTED: LOW QUALITY PROTEIN: seed biotin-containing protein 
SBP65-like [Populus euphratica]
Length=778

 Score = 64.3 bits (155),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 76/257 (30%), Positives = 108/257 (42%), Gaps = 43/257 (17%)
 Frame = +2

Query  848   NKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKTQQAYNA------------------  973
             +K E+AK+T     Q  S+ L EK   AKDTA +KT Q  ++                  
Sbjct  234   DKVEQAKDTVLGGAQKTSRNLAEKGSRAKDTAAEKTSQTKDSIWEGAKKSCQQIEEKASQ  293

Query  974   AKDTTISKTQ-------QAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSA  1132
             AK T +   Q       QAKDT     Q +  Y  +   Q KDT +  G+    +  ++ 
Sbjct  294   AKSTVLEGAQKFAEKGAQAKDTVVEGSQKSTQYAAEKGAQAKDTAAEGGRKTTQFIAETG  353

Query  1133  QQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTL-SGAGQT--  1303
              Q KDT+    Q    +  +   Q KDTL    +    Y  +   QAKDT+  GA QT  
Sbjct  354   VQAKDTVVEETQKTTHFLAEKGAQMKDTLVEGAKKFTQYVTEKGAQAKDTIFEGAKQTSE  413

Query  1304  --------AKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGNKASEAKERG  1459
                     AKD TV++ ++A   + K         V  KD A+     A +  +E    G
Sbjct  414   YVAEKEVRAKDVTVESGKEAVNYVDKV-------AVDVKDKATAAGWTAAHYTAEKAVEG  466

Query  1460  TEMSKNAASYAGQKVTE  1510
             ++ +  AA YAGQK  E
Sbjct  467   SKAAARAAEYAGQKTAE  483


 Score = 62.8 bits (151),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 52/170 (31%), Positives = 75/170 (44%), Gaps = 7/170 (4%)
 Frame = +2

Query  830   ALQTAQNKYEK---AKNTTKENVQSGSQYLVEKAGAAKDTALQKTQQAYNAAKDTTISKT  1000
              L+ AQ   EK   AK+T  E  Q  +QY  EK   AKDTA +  ++      +T +   
Sbjct  298   VLEGAQKFAEKGAQAKDTVVEGSQKSTQYAAEKGAQAKDTAAEGGRKTTQFIAETGV---  354

Query  1001  QQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKD  1180
              QAKDT     Q    +  +   Q KDTL    +    Y  +   Q KDT+    +   +
Sbjct  355   -QAKDTVVEETQKTTHFLAEKGAQMKDTLVEGAKKFTQYVTEKGAQAKDTIFEGAKQTSE  413

Query  1181  YTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTA  1330
             Y  +   + KD    +G+ A +Y  + A   KD  + AG TA  YT + A
Sbjct  414   YVAEKEVRAKDVTVESGKEAVNYVDKVAVDVKDKATAAGWTAAHYTAEKA  463



>dbj|BAK05046.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=362

 Score = 63.2 bits (152),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 62/186 (33%), Positives = 86/186 (46%), Gaps = 44/186 (24%)
 Frame = +2

Query  881   ENVQSGSQYLVEKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQ  1060
             E+VQ G++ L    G           + +  AKDT   KT QA D   +     KDYT +
Sbjct  74    ESVQEGAKSLASAVG-----------RTFGGAKDTAADKTYQAADATGNKLGEYKDYTAE  122

Query  1061  SAKQTKDTLS-----SAGQT------AKDYTVQSAQQTKDTLSS----------------  1159
              AK+T D+L+     +A  T      AKDYTV+ A + KDT++                 
Sbjct  123   KAKETNDSLAHKTSETAEATRNKLGEAKDYTVEKATEAKDTVAQKTSQTAEATKNKLGEY  182

Query  1160  ----AGQT--AKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTV  1321
                 AG+T  AK+ TV  AQ+T+D  +   + AKD T Q A +  D   G  Q A+D T+
Sbjct  183   KDALAGKTQEAKETTVHKAQETRDAAAEKARQAKDVTQQKAGEYTDATKGTAQEARDRTM  242

Query  1322  QTAQQA  1339
              T Q A
Sbjct  243   ATTQTA  248



>gb|KFK40226.1| hypothetical protein AALP_AA3G347000 [Arabis alpina]
Length=565

 Score = 63.9 bits (154),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 73/239 (31%), Positives = 87/239 (36%), Gaps = 17/239 (7%)
 Frame = +2

Query  830   ALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKTQQAYNAAKDTTISKTQQA  1009
             A+  A +K +  K++  +N      +   KA  AKD A  K   A    KD    K   A
Sbjct  67    AVNYAYDKAQHVKDSAYDNAGYAKDFAERKAQHAKDFAYHKAGDA----KDMAYEKAGNA  122

Query  1010  KDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTV  1189
             KD         KD+    A   KD        AKD     A   KD        AKDY  
Sbjct  123   KDMAYEKAGNVKDFAYDKAGDAKDIAYEKAGYAKDIAYDKAGNAKDMAYDKAGHAKDYAY  182

Query  1190  QSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKET-LSKAGQ  1366
               A   KD        AKDY    A  AKD        AKDY    A  AK+    KAG 
Sbjct  183   DKASNAKDMAYDKAGHAKDYAYDKASNAKDMAYDKAGHAKDYGYDKAGNAKDMAYEKAG-  241

Query  1367  AAKDYTVQAKDYASQKAGE----AGNKASEAKERGTEMSKNAASYAGQKVTEAKDVTVE  1531
                    Q KDYA  KA      A  KA   K+   +M+ NA   A +K   AK    +
Sbjct  242   -------QGKDYAYDKASNVKHMAHEKAGHVKDYAYDMAGNAKDMAYEKAGYAKGFAYD  293


 Score = 62.4 bits (150),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 82/280 (29%), Positives = 108/280 (39%), Gaps = 32/280 (11%)
 Frame = +2

Query  773   LSLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQK  952
             ++ E+ G  +  A +K+ +    A +K   AK+   E          +KAG AKD A  K
Sbjct  114   MAYEKAGNAKDMAYEKAGNVKDFAYDKAGDAKDIAYEKAGYAKDIAYDKAGNAKDMAYDK  173

Query  953   TQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSA  1132
                    AKD    K   AKD        AKDY    A   KD        AKDY    A
Sbjct  174   AGH----AKDYAYDKASNAKDMAYDKAGHAKDYAYDKASNAKDMAYDKAGHAKDYGYDKA  229

Query  1133  QQTKDT-LSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDT-LSGAG---  1297
                KD     AGQ  KDY    A   K          KDY    A  AKD     AG   
Sbjct  230   GNAKDMAYEKAGQ-GKDYAYDKASNVKHMAHEKAGHVKDYAYDMAGNAKDMAYEKAGYAK  288

Query  1298  --------------QTAKDYTVQTAQQAKETLSKAGQAAKDYTVQ----AKDYASQKAGE  1423
                           Q+  D+    A  AK+  ++    AKD   Q    AKD A +KAG 
Sbjct  289   GFAYDKVGSAYKSAQSMMDFGYDKAGDAKDMANEKASIAKDMAYQKAGNAKDMAYEKAGI  348

Query  1424  AGN----KASEAKERGTEMSKNAASYAGQKVTEAKDVTVE  1531
             A +    KA  A++   + + +A ++A  K  +AKD+  E
Sbjct  349   AKDMAYEKAGHAEDFAYDKAGHAKNFAYDKAGDAKDMAYE  388


 Score = 60.1 bits (144),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 81/267 (30%), Positives = 96/267 (36%), Gaps = 35/267 (13%)
 Frame = +2

Query  800   RQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKTQQAYNAAK  979
             +  A  K+ DA   A  K   AK+   E   +   +  +KAG AKD A +K   A    K
Sbjct  101   KDFAYHKAGDAKDMAYEKAGNAKDMAYEKAGNVKDFAYDKAGDAKDIAYEKAGYA----K  156

Query  980   DTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSS  1159
             D    K   AKD        AKDY    A   KD        AKDY    A   KD    
Sbjct  157   DIAYDKAGNAKDMAYDKAGHAKDYAYDKASNAKDMAYDKAGHAKDYAYDKASNAKDMAYD  216

Query  1160  AGQTAKDYTVQSAQQTKDT-LSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQ  1336
                 AKDY    A   KD     AGQ  KDY    A   K          KDY    A  
Sbjct  217   KAGHAKDYGYDKAGNAKDMAYEKAGQ-GKDYAYDKASNVKHMAHEKAGHVKDYAYDMAGN  275

Query  1337  AKET------------LSKAGQAAK----------DYTVQAKDYASQKAGEAGNKASEAK  1450
             AK+               K G A K          D    AKD A++       KAS AK
Sbjct  276   AKDMAYEKAGYAKGFAYDKVGSAYKSAQSMMDFGYDKAGDAKDMANE-------KASIAK  328

Query  1451  ERGTEMSKNAASYAGQKVTEAKDVTVE  1531
             +   + + NA   A +K   AKD+  E
Sbjct  329   DMAYQKAGNAKDMAYEKAGIAKDMAYE  355


 Score = 58.2 bits (139),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 76/259 (29%), Positives = 103/259 (40%), Gaps = 19/259 (7%)
 Frame = +2

Query  773   LSLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQK  952
             ++ E+ G  +  A  K+ +A   A +K   AK+   +   +      +KAG AKD A  K
Sbjct  147   IAYEKAGYAKDIAYDKAGNAKDMAYDKAGHAKDYAYDKASNAKDMAYDKAGHAKDYAYDK  206

Query  953   TQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSA  1132
                    AKD    K   AKD        AKD   + A Q KD         K    + A
Sbjct  207   ASN----AKDMAYDKAGHAKDYGYDKAGNAKDMAYEKAGQGKDYAYDKASNVKHMAHEKA  262

Query  1133  QQTKDTLSSAGQTAKDYTVQSAQQTK----DTLSSA---GQTAKDYTVQSAQQAKDTLSG  1291
                KD        AKD   + A   K    D + SA    Q+  D+    A  AKD  + 
Sbjct  263   GHVKDYAYDMAGNAKDMAYEKAGYAKGFAYDKVGSAYKSAQSMMDFGYDKAGDAKDMANE  322

Query  1292  AGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQ----AKDYASQKAGEAGN----KASEA  1447
                 AKD   Q A  AK+   +    AKD   +    A+D+A  KAG A N    KA +A
Sbjct  323   KASIAKDMAYQKAGNAKDMAYEKAGIAKDMAYEKAGHAEDFAYDKAGHAKNFAYDKAGDA  382

Query  1448  KERGTEMSKNAASYAGQKV  1504
             K+   E + +A   A  KV
Sbjct  383   KDMAYEKAGDAKDMAFDKV  401


 Score = 57.0 bits (136),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 63/194 (32%), Positives = 78/194 (40%), Gaps = 9/194 (5%)
 Frame = +2

Query  953   TQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSA  1132
              Q+A N A D    K Q  KD+       AKD+  + A+  KD        AKD   + A
Sbjct  64    VQRAVNYAYD----KAQHVKDSAYDNAGYAKDFAERKAQHAKDFAYHKAGDAKDMAYEKA  119

Query  1133  QQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKD  1312
                KD         KD+    A   KD        AKD     A  AKD        AKD
Sbjct  120   GNAKDMAYEKAGNVKDFAYDKAGDAKDIAYEKAGYAKDIAYDKAGNAKDMAYDKAGHAKD  179

Query  1313  YTVQTAQQAKET-LSKAGQAAKDYTVQAKDYASQKAGEAGNKASEAKERGTEMSKNAASY  1489
             Y    A  AK+    KAG  AKDY   A D AS     A +KA  AK+ G + + NA   
Sbjct  180   YAYDKASNAKDMAYDKAGH-AKDY---AYDKASNAKDMAYDKAGHAKDYGYDKAGNAKDM  235

Query  1490  AGQKVTEAKDVTVE  1531
             A +K  + KD   +
Sbjct  236   AYEKAGQGKDYAYD  249



>gb|KHN48209.1| Embryonic protein DC-8 [Glycine soja]
Length=464

 Score = 63.2 bits (152),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 70/211 (33%), Positives = 111/211 (53%), Gaps = 26/211 (12%)
 Frame = +2

Query  923   GAAKDTALQKTQQAYNAAKDTTISKT------------QQAKDTFSSTGQTA---KDYTT  1057
             G  +D +  KT   Y++A D   +KT            Q+AK+T  +T + A    DY +
Sbjct  104   GEVRDISATKTHDIYDSATDNNNNKTGSKVGEYADYASQKAKETKDATMEKAGEYTDYAS  163

Query  1058  QSAKQTKDTLSSAGQTAKDYTVQSAQQTKD-TLSSAGQTAKDYTVQSAQQTKD-TLSSAG  1231
             Q AK+ K T    G   KDY+ + A++ KD T++  G+  KDY  + A++ KD T++  G
Sbjct  164   QKAKEAKKTTMEKGGEYKDYSAEEAKERKDATVNKMGEY-KDYAAEKAKEGKDATVNKMG  222

Query  1232  QTAKDYTVQSAQQAKD-TLSGAGQTAKDYTVQTAQQAKE-TLSKAGQAAKDYTVQAKDYA  1405
             +  KDY  +  ++ KD T++  G+  KDYT + A++ K+ TL K G+  KD    A D A
Sbjct  223   EY-KDYAAEKTKEGKDATVNKMGEY-KDYTAEKAKEGKDTTLGKLGE-LKD---TASDAA  276

Query  1406  SQKAGEAGNKASEAKERGTEMSKNAASYAGQ  1498
              +  G    K  E KE  +E ++  A+ AG+
Sbjct  277   KRAVGYLSGKKEETKEMASETAEATANKAGE  307


 Score = 54.3 bits (129),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 73/221 (33%), Positives = 110/221 (50%), Gaps = 29/221 (13%)
 Frame = +2

Query  911   VEKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKD------------TFSSTGQTAKDYT  1054
             +EKAG   D A QK ++A    K TT+ K  + KD            T +  G+  KDY 
Sbjct  152   MEKAGEYTDYASQKAKEA----KKTTMEKGGEYKDYSAEEAKERKDATVNKMGEY-KDYA  206

Query  1055  TQSAKQTKD-TLSSAGQTAKDYTVQSAQQTKD-TLSSAGQTAKDYTVQSAQQTKD-TLSS  1225
              + AK+ KD T++  G+  KDY  +  ++ KD T++  G+  KDYT + A++ KD TL  
Sbjct  207   AEKAKEGKDATVNKMGEY-KDYAAEKTKEGKDATVNKMGEY-KDYTAEKAKEGKDTTLGK  264

Query  1226  AGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAG---QAAKDYTVQAK  1396
              G+  KD    +A++A   LSG  +  K+   +TA+    T +KAG   +A K  T +  
Sbjct  265   LGEL-KDTASDAAKRAVGYLSGKKEETKEMASETAEA---TANKAGEMKEATKKKTAETV  320

Query  1397  DYASQKAGEAGNKASEAKERGTEMSKNAASYAGQKVTEAKD  1519
             + A  KAGE  ++A+E  E     +   A     K  E KD
Sbjct  321   EAAKNKAGEIKDRAAETAEAAKNKTAETAEVTKNKALEMKD  361



>ref|XP_002877899.1| hypothetical protein ARALYDRAFT_485679 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54158.1| hypothetical protein ARALYDRAFT_485679 [Arabidopsis lyrata subsp. 
lyrata]
Length=469

 Score = 62.8 bits (151),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 68/227 (30%), Positives = 109/227 (48%), Gaps = 26/227 (11%)
 Frame = +2

Query  881   ENVQSGSQYLVEKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQ  1060
             E+ + GS+   EKA   +D        A    +D+T  KT++  D  +   + AKD T +
Sbjct  78    ESTREGSEIASEKAAGMRD--------ATGEVRDSTAQKTKETADYTADKAREAKDKTAE  129

Query  1061  SAKQTKDTLSSAGQTAKD-----------YTVQSAQQTKDTLSSAGQTAKDYTVQSAQQT  1207
               K+T + ++   + A+D           YT + A++ KD  +   +   +YT + A++ 
Sbjct  130   KTKETAEYMAEKAREAQDKTADKTKETAGYTAEKAREAKDKTADKTKETAEYTAEKAKEA  189

Query  1208  KDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTV  1387
             KDT +      KDYTV  A++AKD  +   +   +YT   A++AK+T ++     KDYTV
Sbjct  190   KDTTAEKLGEYKDYTVDKAKEAKDKAAEKAKETAEYTADKAREAKDTTAEKLGEYKDYTV  249

Query  1388  QAKDYASQKAGEAGNKASEAKERGTEMSKNAASYAGQKVTEAKDVTV  1528
                    +KA E   KA EAK++  E       Y  +K TE KD  V
Sbjct  250   -------EKANETAEKAREAKDKTAEKVGEYKDYTAEKATEGKDAGV  289


 Score = 62.0 bits (149),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 83/261 (32%), Positives = 125/261 (48%), Gaps = 31/261 (12%)
 Frame = +2

Query  791   GKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKTQQ--A  964
             G+ R +  QK+ +      +K  +AK+ T E  +  ++Y+ EKA  A+D    KT++   
Sbjct  99    GEVRDSTAQKTKETADYTADKAREAKDKTAEKTKETAEYMAEKAREAQDKTADKTKETAG  158

Query  965   YNA-----AKDTTISKT-----------QQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSA  1096
             Y A     AKD T  KT           ++AKDT +      KDYT   AK+ KD  +  
Sbjct  159   YTAEKAREAKDKTADKTKETAEYTAEKAKEAKDTTAEKLGEYKDYTVDKAKEAKDKAAEK  218

Query  1097  GQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQT-------KDTLSSAGQTAKDYTV  1255
              +   +YT   A++ KDT +      KDYTV+ A +T       KD  +      KDYT 
Sbjct  219   AKETAEYTADKAREAKDTTAEKLGEYKDYTVEKANETAEKAREAKDKTAEKVGEYKDYTA  278

Query  1256  QSAQQAKDT-LSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGN  1432
             + A + KD  +S  G+  KD  V TA++A   LS   +  K   V+ KD A +K  EAG 
Sbjct  279   EKATEGKDAGVSRLGEL-KDSAVDTAKRAMGFLSGKTEETKQKAVETKDTAKEKMDEAGE  337

Query  1433  KA----SEAKERGTEMSKNAA  1483
             +A     E +  G E+ ++A+
Sbjct  338   EARRKMEEMRLEGKELEEDAS  358


 Score = 55.5 bits (132),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 72/234 (31%), Positives = 119/234 (51%), Gaps = 22/234 (9%)
 Frame = +2

Query  866   KNTTKENVQSGSQYLVEKAGAAKDTALQKTQQA--YNAAKDTTISKTQQAKD-TFSSTGQ  1036
             +++T +  +  + Y  +KA  AKD   +KT++   Y A       K ++A+D T   T +
Sbjct  102   RDSTAQKTKETADYTADKAREAKDKTAEKTKETAEYMA------EKAREAQDKTADKTKE  155

Query  1037  TAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDT  1216
             TA  YT + A++ KD  +   +   +YT + A++ KDT +      KDYTV  A++ KD 
Sbjct  156   TA-GYTAEKAREAKDKTADKTKETAEYTAEKAKEAKDTTAEKLGEYKDYTVDKAKEAKDK  214

Query  1217  LSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTV----QTAQQAKETLSKAGQAAKDYT  1384
              +   +   +YT   A++AKDT +      KDYTV    +TA++A+E   K  +   +Y 
Sbjct  215   AAEKAKETAEYTADKAREAKDTTAEKLGEYKDYTVEKANETAEKAREAKDKTAEKVGEY-  273

Query  1385  VQAKDYASQKAGE---AG-NKASEAKERGTEMSKNAASYAGQKVTEAKDVTVES  1534
                KDY ++KA E   AG ++  E K+   + +K A  +   K  E K   VE+
Sbjct  274   ---KDYTAEKATEGKDAGVSRLGELKDSAVDTAKRAMGFLSGKTEETKQKAVET  324



>ref|XP_006145969.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase RNF213 
[Tupaia chinensis]
Length=5531

 Score = 63.5 bits (153),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 56/200 (28%), Positives = 96/200 (48%), Gaps = 25/200 (13%)
 Frame = +2

Query  977   KDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLS  1156
             KD   S  ++AKDT + T + AKD    S ++ KD  +++G+ AKD    S ++ KDTL+
Sbjct  199   KDVPASTREKAKDTLADTREKAKDVPATSRERAKDAPATSGEKAKDTPATSGEKAKDTLA  258

Query  1157  SAGQTAKDYTV-------------------------QSAQQTKDTLSSAGQTAKDYTVQS  1261
               G+ AKD                            + A++ +D  +  G+ AK+    S
Sbjct  259   GTGEKAKDAPALTKGKAKDVPAGTREKAKDVPATSEEKAKEQRDCPAITGEKAKEVPATS  318

Query  1262  AQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGNKAS  1441
              ++AKD  + + + AKD    T ++AK+  + +G+ AKD +   K  A      +G K  
Sbjct  319   GEKAKDMPATSEEKAKDVPADTGEKAKDVPATSGEKAKDVSASTKGKAKDTPATSGEKDK  378

Query  1442  EAKERGTEMSKNAASYAGQK  1501
             +A     E +K+A + +G+K
Sbjct  379   DAPATSGEKAKDAPATSGEK  398


 Score = 62.0 bits (149),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 57/174 (33%), Positives = 85/174 (49%), Gaps = 13/174 (7%)
 Frame = +2

Query  974   AKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTL  1153
             AKD   +  ++AKD  + TG+ AKD    S ++ KD  +S    AKD    S ++ KD  
Sbjct  322   AKDMPATSEEKAKDVPADTGEKAKDVPATSGEKAKDVSASTKGKAKDTPATSGEKDKDAP  381

Query  1154  SSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQ  1333
             +++G+ AKD    S ++ KD  +     AKD    S ++ KD  + +G+ AKD +     
Sbjct  382   ATSGEKAKDAPATSGEKDKDASAGIKGKAKDTPATSGEKDKDAPATSGEKAKDASAGIKG  441

Query  1334  QAKETLSKAGQAAKDYTVQAKDYASQKAGEAGNKASEAKERGTEMSKNAASYAG  1495
             +AK+TL+ +G  AKD             GEA  K  +AK  G     N  SYA 
Sbjct  442   KAKDTLALSGGKAKDL--------PAGIGEAAGKTEKAKPEG-----NKGSYAA  482



>ref|XP_010228683.1| PREDICTED: late embryogenesis abundant protein 1-like [Brachypodium 
distachyon]
Length=357

 Score = 62.0 bits (149),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 65/204 (32%), Positives = 99/204 (49%), Gaps = 25/204 (12%)
 Frame = +2

Query  881   ENVQSGSQYLVEKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQ  1060
             E+VQ G++ L    G           + + +AKDTT  KT QA D   +     KDYT +
Sbjct  73    ESVQEGAKSLASAVG-----------RTFGSAKDTTAEKTSQAADATGNKLGEYKDYTAE  121

Query  1061  SAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTA  1240
              A++T ++LS         T ++A+ TK+ L       KDYT + A + KDT++      
Sbjct  122   KARETNESLSQ-------KTSETAEATKNKLGEY----KDYTAEKATEAKDTVAQKASET  170

Query  1241  KDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAG  1420
              + T     + KD L+G  + AKD T Q AQ+ K+  ++  + AKD T   K   S+ A 
Sbjct  171   TEATKNKLGEYKDALAGKAREAKDTTAQKAQETKDATAETARQAKDAT---KQKTSEYAD  227

Query  1421  EAGNKASEAKERGTEMSKNAASYA  1492
              A   A EA++R    ++ AA  A
Sbjct  228   AAKGTAQEARDRSMATTQTAADKA  251



>ref|XP_009617214.1| PREDICTED: embryonic protein DC-8-like [Nicotiana tomentosiformis]
Length=430

 Score = 62.0 bits (149),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 51/163 (31%), Positives = 81/163 (50%), Gaps = 18/163 (11%)
 Frame = +2

Query  881   ENVQSGSQYLVEKAGAAKDTALQKTQQAYNAA-------KDTTISKTQQAKDTFSSTGQT  1039
             +N +       EK    + +A +KTQQA ++        KD+   K +QAKD      + 
Sbjct  80    DNARHSKDVAAEKVKGTETSAAEKTQQAKDSTTGKAVEYKDSAAEKAKQAKDATVGKTEE  139

Query  1040  AKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTL  1219
              KDY    AK+ KD+ +S     KDY  + A+Q           AKD T++ A++ KD+ 
Sbjct  140   YKDYAADKAKEAKDSTTSKAVEYKDYAAEKAKQ-----------AKDSTMEKAKEAKDSA  188

Query  1220  SSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKET  1348
             ++     KDY  + A++AKDT     +  KDYT + A++ K+T
Sbjct  189   AAKAGEYKDYAAEKAKEAKDTTMQKSEEYKDYTAEKAKEGKDT  231



>gb|AFK36039.1| unknown [Lotus japonicus]
Length=302

 Score = 60.8 bits (146),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 60/172 (35%), Positives = 95/172 (55%), Gaps = 18/172 (10%)
 Frame = +2

Query  1022  SSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQ  1201
             S T Q  KDY T SA++TKD    A Q  KDY   +AQ+  D    A +  K+Y   + +
Sbjct  115   SDTAQKIKDYATGSAEKTKDYAGDAAQKTKDYAGDAAQKPTDY---ATEKTKEYAGGATE  171

Query  1202  QTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDY  1381
             +TK+    A Q +K+Y   +AQ+A+DT + A Q +K+Y    AQ++K+T  ++ + A D 
Sbjct  172   KTKEYAGDAAQKSKEYAGDAAQKARDTANDAAQKSKEYAGDAAQKSKDTAQESKEYAGD-  230

Query  1382  TVQAKDYASQKAGEAGNKASE----AKERGTEMSKNAASYAGQKVTEAKDVT  1525
                    A+QK  EA + AS+     KE+  E++  A+ Y+ +K   A+D+T
Sbjct  231   -------AAQKIKEASSYASDTSQKTKEKLQEVAFGASEYSAEK---ARDMT  272



>gb|KEH24083.1| 35 kDa seed maturation protein, putative [Medicago truncatula]
Length=344

 Score = 60.8 bits (146),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 58/180 (32%), Positives = 98/180 (54%), Gaps = 32/180 (18%)
 Frame = +2

Query  965   YNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTK  1144
             + AAK+  + K+ +A       G+ A+D T  +A++T++          DY  + A++TK
Sbjct  90    FKAAKEAVVGKSYEA-------GEKARDTTDYAAQKTRENA--------DYAAEKARETK  134

Query  1145  DTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKD-TLSGAGQT------  1303
             DT ++      +Y  + A++ KDT ++      +Y  + A++AKD T++ AG+       
Sbjct  135   DTTANKAGEYTNYAAEKAREAKDTTANKAGEYTNYAAEKAKEAKDATVNKAGEYTNYAAD  194

Query  1304  ----AKDYTVQTAQQAKE-TLSKAGQAAKDYT----VQAKDYASQKAGEAGNKASEAKER  1456
                 AKD TVQ A +AK+ T++KAG+  KDYT    V+AKD    K GE  + A++A +R
Sbjct  195   KAKQAKDATVQKAGEAKDATVNKAGE-YKDYTAEKAVEAKDTTVGKLGELKDSAADAAKR  253


 Score = 59.3 bits (142),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 80/153 (52%), Gaps = 27/153 (18%)
 Frame = +2

Query  1094  AGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQA  1273
             AG+ A+D T  +AQ+T++          DY  + A++TKDT ++      +Y  + A++A
Sbjct  104   AGEKARDTTDYAAQKTRENA--------DYAAEKARETKDTTANKAGEYTNYAAEKAREA  155

Query  1274  KDTLSGAGQTAKDYTVQTAQQAKE-TLSKAGQA---AKDYTVQAKDYASQKAGEAG----  1429
             KDT +       +Y  + A++AK+ T++KAG+    A D   QAKD   QKAGEA     
Sbjct  156   KDTTANKAGEYTNYAAEKAKEAKDATVNKAGEYTNYAADKAKQAKDATVQKAGEAKDATV  215

Query  1430  NKASEAKERGTEMSKNAASYAGQKVTEAKDVTV  1528
             NKA E K+           Y  +K  EAKD TV
Sbjct  216   NKAGEYKD-----------YTAEKAVEAKDTTV  237



>ref|XP_829568.1| hypothetical protein [Trypanosoma brucei brucei TREU927]
 gb|EAN80456.1| hypothetical protein, conserved [Trypanosoma brucei brucei TREU927]
Length=1172

 Score = 62.4 bits (150),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 63/229 (28%), Positives = 101/229 (44%), Gaps = 49/229 (21%)
 Frame = +2

Query  953   TQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSA  1132
             T+Q+   A+DTT    +QA+DT     + A+D T Q A++ +DT     + A+D T Q A
Sbjct  715   TEQSAEQAEDTTEQPGEQAEDTTEQPAEQAEDTTEQPAEEAEDTTEQPTEQAEDATEQPA  774

Query  1133  QQTKDT---------LSSA------------------------------------GQTAK  1177
             +Q +D          L  A                                     + A+
Sbjct  775   EQAEDATEQPDEHEELDEADIPKEASTGSSPKKPASEDAGEQVAAEGVEDATEQPAEQAE  834

Query  1178  DYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSK  1357
             D T QSA+Q +DT    G+ A+D T Q A+QA+DT     + A+D T Q  +QA++   +
Sbjct  835   DATEQSAEQAEDTTEQPGEQAEDTTEQPAEQAEDTTEQPAEEAEDTTEQPTEQAEDATEQ  894

Query  1358  AGQAAKDYTVQAKDYASQKAGEAGNKASEAKERGTEMSKNAASYAGQKV  1504
               + A+D T Q  ++      +   +AS     G+   K A+  AG++V
Sbjct  895   PAEQAEDATEQPDEHEELDEADIPKEAS----TGSSPKKPASEDAGEQV  939


 Score = 61.6 bits (148),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 65/227 (29%), Positives = 104/227 (46%), Gaps = 43/227 (19%)
 Frame = +2

Query  953   TQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSA  1132
             T+Q+   A+DTT    +QA+DT     + A+D T Q A++ +DT     + A+D T Q A
Sbjct  837   TEQSAEQAEDTTEQPGEQAEDTTEQPAEQAEDTTEQPAEEAEDTTEQPTEQAEDATEQPA  896

Query  1133  QQTKDTL-----------------SSAGQTAK-----------------DYTVQSAQQTK  1210
             +Q +D                   +S G + K                 D T Q A+Q +
Sbjct  897   EQAEDATEQPDEHEELDEADIPKEASTGSSPKKPASEDAGEQVAAEGVEDTTEQPAEQAE  956

Query  1211  DTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQ  1390
             DT     + A+D T Q  +QA+DT     + A+D T Q  +QA++T  +  + A+D T Q
Sbjct  957   DTTEQPAEEAEDTTEQPTEQAEDTTEQPAEEAEDATEQPGEQAEDTTEQPAEQAEDATEQ  1016

Query  1391  -AKDYASQKAGEAGNKASEAKER--------GTEMSKNAASYAGQKV  1504
              A++ A + A E  ++  E  E         G+   K A+  AG++V
Sbjct  1017  PAEEVAQETAAEQTDEHEELDEADIPKEASTGSSPKKPASEDAGEQV  1063


 Score = 54.7 bits (130),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 55/204 (27%), Positives = 89/204 (44%), Gaps = 34/204 (17%)
 Frame = +2

Query  956   QQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQ  1135
             Q A    +D T    +QA+D    + + A+D T Q  +Q +DT     + A+D T Q A+
Sbjct  816   QVAAEGVEDATEQPAEQAEDATEQSAEQAEDTTEQPGEQAEDTTEQPAEQAEDTTEQPAE  875

Query  1136  QTKDTLSSAGQTAKDYTVQSAQQTKDTL-----------------SSAGQTAK-------  1243
             + +DT     + A+D T Q A+Q +D                   +S G + K       
Sbjct  876   EAEDTTEQPTEQAEDATEQPAEQAEDATEQPDEHEELDEADIPKEASTGSSPKKPASEDA  935

Query  1244  ----------DYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQA  1393
                       D T Q A+QA+DT     + A+D T Q  +QA++T  +  + A+D T Q 
Sbjct  936   GEQVAAEGVEDTTEQPAEQAEDTTEQPAEEAEDTTEQPTEQAEDTTEQPAEEAEDATEQP  995

Query  1394  KDYASQKAGEAGNKASEAKERGTE  1465
              + A     +   +A +A E+  E
Sbjct  996   GEQAEDTTEQPAEQAEDATEQPAE  1019



>ref|XP_011100211.1| PREDICTED: seed biotin-containing protein SBP65-like isoform 
X1 [Sesamum indicum]
Length=402

 Score = 60.8 bits (146),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 47/170 (28%), Positives = 74/170 (44%), Gaps = 26/170 (15%)
 Frame = +2

Query  776   SLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKT  955
             SLEEI   R  AQQ S +A++ A+ +YEK+K                          +K 
Sbjct  126   SLEEISNLRAKAQQNSTEAIRAAEERYEKSK--------------------------EKG  159

Query  956   QQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQ  1135
               A + AKD T  K   AK+    +G+   +YT + A + KD    AG  A  YT++ A 
Sbjct  160   ASALHKAKDYTAKKAVAAKEVAVESGKGVAEYTGKVAAEVKDHAIVAGWGATHYTLEKAA  219

Query  1136  QTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTL  1285
             +    ++    +   YT +     KD ++ AG++   Y  +    AKD +
Sbjct  220   EATKAVAGITSSVAGYTGEKVVVAKDKVAGAGKSLAGYAGEKIAAAKDAV  269


 Score = 56.6 bits (135),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 33/42 (79%), Gaps = 1/42 (2%)
 Frame = +2

Query  188  MASEQLRRDNK-TGERAVEVEKDRVPKMASHFESLAEKVADD  310
            MAS+QLRR+N  T ER   V+KDRVPKM +HFESLAEK  D+
Sbjct  1    MASKQLRRENHVTDERETVVKKDRVPKMTTHFESLAEKARDE  42



>ref|XP_008785585.1| PREDICTED: seed biotin-containing protein SBP65-like isoform 
X2 [Phoenix dactylifera]
Length=238

 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 73/216 (34%), Positives = 106/216 (49%), Gaps = 44/216 (20%)
 Frame = +2

Query  767   SGLSLEEIGKYRQTAQQKSIDALQTAQNKYEKAKN-------------------------  871
             +G+S EEIG+YR TAQQ S+D ++ A+ +YEKAK+                         
Sbjct  22    TGMSPEEIGRYRATAQQNSVDVMRAAEERYEKAKHAGASTIHDAKETATHGLAATTTYLA  81

Query  872   --------TTKENVQSGSQYLVEKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSS  1027
                     T     +  ++Y  EK  AAKD A +K QQ Y+AA     +    A +  S+
Sbjct  82    AKGTEAKGTVAHGARVAAEYAAEKGTAAKDHAAEKAQQGYHAAVRGARAAADVAAEKASA  141

Query  1028  TGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQT  1207
                 AKD   +   Q  DT       AKD  VQ+A + KD  +SAG +A DY  Q+A++ 
Sbjct  142   ----AKDTAMEKGGQGCDT-------AKDTAVQAAVKAKDVAASAGGSAADYGKQAAEKA  190

Query  1208  KDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDY  1315
             +D   S G++A D+  Q+A +AKD     G++A DY
Sbjct  191   RDVTVSTGKSAADHAQQAAAKAKDVAIETGKSAVDY  226



>ref|XP_003590405.1| Late embryongenesis abundant protein [Medicago truncatula]
 gb|AES60656.1| late embryogenesis abundant protein, putative [Medicago truncatula]
Length=348

 Score = 60.1 bits (144),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 66/198 (33%), Positives = 102/198 (52%), Gaps = 19/198 (10%)
 Frame = +2

Query  917   KAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKD-TLSS  1093
             KA   KD  +QKT +    A +    K ++AKD         KDY  + AK+ KD T++ 
Sbjct  98    KAKETKDATMQKTNEYAGYAGE----KAREAKDKAGEY----KDYAAEKAKEGKDATMNK  149

Query  1094  AGQTAKDYTVQSAQQTKD-TLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQ  1270
              G+  KDYT + A++ KD T++  G+  KDYT + A++ KD  +      KD  V +A++
Sbjct  150   MGEY-KDYTAEKAKEGKDATMNKMGEY-KDYTAEKAKEGKDNTAWKIGEMKDSAVDAAKR  207

Query  1271  AKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGNKASEAK  1450
             A   L    + AK  T +TA+ AK+  ++  +AAK  T +  + A Q       K  EAK
Sbjct  208   AMGYLGDKKEEAKQKTAETAEAAKQKTAETAEAAKQKTAETAEAAKQ-------KTVEAK  260

Query  1451  ERGTEMSKNAASYAGQKV  1504
             ++  EM   A   AG+K+
Sbjct  261   DKTKEMLSEADKEAGRKM  278


 Score = 58.5 bits (140),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 66/209 (32%), Positives = 108/209 (52%), Gaps = 16/209 (8%)
 Frame = +2

Query  923   GAAKDTALQKTQQAYNAA----KDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLS  1090
             G  +D +  +++  Y++A    K+T  +  Q+AK+T  +T Q   +Y   + ++ ++   
Sbjct  67    GEVRDISANQSRGVYDSAAQKAKETKDATAQKAKETKDATMQKTNEYAGYAGEKAREAKD  126

Query  1091  SAGQTAKDYTVQSAQQTKD-TLSSAGQTAKDYTVQSAQQTKD-TLSSAGQTAKDYTVQSA  1264
              AG+  KDY  + A++ KD T++  G+  KDYT + A++ KD T++  G+  KDYT + A
Sbjct  127   KAGEY-KDYAAEKAKEGKDATMNKMGEY-KDYTAEKAKEGKDATMNKMGEY-KDYTAEKA  183

Query  1265  QQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGNKASE  1444
             ++ KD  +      KD  V  A++A   L    + AK  T +  + A QK  E    A  
Sbjct  184   KEGKDNTAWKIGEMKDSAVDAAKRAMGYLGDKKEEAKQKTAETAEAAKQKTAET---AEA  240

Query  1445  AKERGTEMSKNAASYAGQKVTEAKDVTVE  1531
             AK++  E     A  A QK  EAKD T E
Sbjct  241   AKQKTAE----TAEAAKQKTVEAKDKTKE  265



>ref|XP_006838743.1| hypothetical protein AMTR_s00002p00254930 [Amborella trichopoda]
 gb|ERN01312.1| hypothetical protein AMTR_s00002p00254930 [Amborella trichopoda]
Length=315

 Score = 59.3 bits (142),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 65/215 (30%), Positives = 107/215 (50%), Gaps = 23/215 (11%)
 Frame = +2

Query  887   VQSGSQYLVEKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSA  1066
             V   +Q   EKA   KD+A QKT +     KD+ + K Q AKDT +      KD+    A
Sbjct  72    VTGKAQEASEKARETKDSAAQKTMET----KDSAVEKAQGAKDTAAQKAGETKDWAMDKA  127

Query  1067  KQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKD  1246
             +  K+++    +  KD    S ++TKD+    G+  KD T++ A++TKD   SA + A++
Sbjct  128   RGAKESVGEKAEGIKD----SVKETKDSAMEKGRETKDSTLERARETKD---SAIEKARE  180

Query  1247  YTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQ----AKDYASQK  1414
              T  +A++A++         K+   + A++ K++     + AKD T +     KD A  +
Sbjct  181   LTEWAAEKAREY--------KELAAEKARETKDSAMDKSRGAKDTTAEKAKETKDSAVTR  232

Query  1415  AGEAGNKASEAKERGTEMSKNAASYAGQKVTEAKD  1519
             AGEA + A++A     +        A QK  E+KD
Sbjct  233   AGEANDSAADATRGAMDTLSGKKEEAKQKSNESKD  267


 Score = 56.6 bits (135),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 67/209 (32%), Positives = 104/209 (50%), Gaps = 24/209 (11%)
 Frame = +2

Query  842   AQNKYEKAKNTTKENVQSGSQ---YLVEKAGAAKDTALQKTQQAYNAAKDTTISKTQQAK  1012
             AQ   EKA+ T     Q   +     VEKA  AKDTA QK  +     KD  + K + AK
Sbjct  76    AQEASEKARETKDSAAQKTMETKDSAVEKAQGAKDTAAQKAGET----KDWAMDKARGAK  131

Query  1013  DTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTL--------SSAGQ  1168
             ++     +  KD    S K+TKD+    G+  KD T++ A++TKD+           A +
Sbjct  132   ESVGEKAEGIKD----SVKETKDSAMEKGRETKDSTLERARETKDSAIEKARELTEWAAE  187

Query  1169  TAKDY---TVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDT-LSGAGQTAKDYTVQTAQQ  1336
              A++Y     + A++TKD+     + AKD T + A++ KD+ ++ AG+ A D      + 
Sbjct  188   KAREYKELAAEKARETKDSAMDKSRGAKDTTAEKAKETKDSAVTRAGE-ANDSAADATRG  246

Query  1337  AKETLSKAGQAAKDYTVQAKDYASQKAGE  1423
             A +TLS   + AK  + ++KD A    GE
Sbjct  247   AMDTLSGKKEEAKQKSNESKDPAKDVFGE  275


 Score = 55.1 bits (131),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 69/243 (28%), Positives = 119/243 (49%), Gaps = 32/243 (13%)
 Frame = +2

Query  794   KYRQT---AQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKTQQA  964
             K R+T   A QK+++   +A  K + AK+T  +       + ++KA  AK++  +K +  
Sbjct  82    KARETKDSAAQKTMETKDSAVEKAQGAKDTAAQKAGETKDWAMDKARGAKESVGEKAEGI  141

Query  965   YNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTL--------SSAGQTAKDY-  1117
              ++ K+T        KD+    G+  KD T + A++TKD+           A + A++Y 
Sbjct  142   KDSVKET--------KDSAMEKGRETKDSTLERARETKDSAIEKARELTEWAAEKAREYK  193

Query  1118  --TVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSG  1291
                 + A++TKD+     + AKD T + A++TKD+  +    A D    + + A DTLSG
Sbjct  194   ELAAEKARETKDSAMDKSRGAKDTTAEKAKETKDSAVTRAGEANDSAADATRGAMDTLSG  253

Query  1292  AGQTAKDYTVQTAQQAKETLSKAGQAAK----DYTVQAKDYASQKAGEAGNKASEA-KER  1456
               + AK  + ++   AK+   +  +A +    D  V A+D     AGE   + +EA KE 
Sbjct  254   KKEEAKQKSNESKDPAKDVFGETEEATRQRLEDMKVTAED-----AGERAKQKAEANKEA  308

Query  1457  GTE  1465
             G E
Sbjct  309   GAE  311



>emb|CCO06495.1| late embryogenesis abundant protein [Arabis alpina]
Length=542

 Score = 60.5 bits (145),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 73/261 (28%), Positives = 104/261 (40%), Gaps = 11/261 (4%)
 Frame = +2

Query  770   GLSLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQ  949
             G++ E+ G+ +  A  K+ +       K    K+   +   +      EKAG AK  A  
Sbjct  211   GMAYEKAGQGKDYAYDKASNVKHMGHEKAGHVKDYAYDMAGNAKDMAYEKAGYAKGFAYD  270

Query  950   KTQQAYNAAK---DTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYT  1120
             K   AY +A+   D    K   AKD  +     AKD   Q A   KD        AKD  
Sbjct  271   KVGSAYKSAQSMMDFGYDKAGDAKDMANEKASIAKDMAYQKAGNAKDMAYEKAGIAKDMA  330

Query  1121  VQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQ  1300
              + A   +D        AK++T   A   KD        AKD        A     G+ Q
Sbjct  331   YEKAGHAEDFAYDKAGHAKNFTYDKAGDAKDMAYEKAGDAKDMAFDKVGCA----YGSAQ  386

Query  1301  TAKDYTVQTAQQAKETLSKAGQAAKDYTVQ----AKDYASQKAGEAGNKASEAKERGTEM  1468
              AKD+  + A +AK+   K    AKD   +    AKD+A  KAG A +K+ +     T+ 
Sbjct  387   KAKDFGYEKAGEAKDFAYKKASNAKDIAYENAQDAKDFAYDKAGYAYDKSGDVIRMATDK  446

Query  1469  SKNAASYAGQKVTEAKDVTVE  1531
             S  A     +K   AKD+  +
Sbjct  447   SGEAYEGVKEKSENAKDIAAD  467


 Score = 60.5 bits (145),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 66/202 (33%), Positives = 80/202 (40%), Gaps = 14/202 (7%)
 Frame = +2

Query  953   TQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSA  1132
              Q+A N A D    K Q  KD+       AKD+  + A+  KD        AKD   + A
Sbjct  63    VQRAVNYAYD----KAQHVKDSAYDNAGYAKDFAERKAQHAKDFAYHMAGDAKDMAYEKA  118

Query  1133  QQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKD  1312
                KD         KD+    A   KD        AKD     A  AKD        AKD
Sbjct  119   GNAKDMAYEKAGNVKDFAYDKAGDAKDIAYEKAGCAKDIAYDKAGNAKDMAYDKAGHAKD  178

Query  1313  YTVQTAQQAKET-LSKAGQAAKDYTV----QAKDYASQKAGE----AGNKASEAKERGTE  1465
             Y    A  AK+    KAG  AKDY       AK  A +KAG+    A +KAS  K  G E
Sbjct  179   YAYDKASNAKDMAYDKAGH-AKDYGYDKAGNAKGMAYEKAGQGKDYAYDKASNVKHMGHE  237

Query  1466  MSKNAASYAGQKVTEAKDVTVE  1531
              + +   YA      AKD+  E
Sbjct  238   KAGHVKDYAYDMAGNAKDMAYE  259


 Score = 55.8 bits (133),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 85/307 (28%), Positives = 117/307 (38%), Gaps = 55/307 (18%)
 Frame = +2

Query  773   LSLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQK  952
             ++ E+ G  +  A +K+ +    A +K   AK+   E          +KAG AKD A  K
Sbjct  113   MAYEKAGNAKDMAYEKAGNVKDFAYDKAGDAKDIAYEKAGCAKDIAYDKAGNAKDMAYDK  172

Query  953   T----QQAYNA---AKDTTISKTQQAKD------------TFSSTGQTAKDYTTQSAKQT  1075
                    AY+    AKD    K   AKD             +   GQ  KDY    A   
Sbjct  173   AGHAKDYAYDKASNAKDMAYDKAGHAKDYGYDKAGNAKGMAYEKAGQ-GKDYAYDKASNV  231

Query  1076  KDTLSSAGQTAKDYTVQSAQQTKDT---------------LSSA---GQTAKDYTVQSAQ  1201
             K          KDY    A   KD                + SA    Q+  D+    A 
Sbjct  232   KHMGHEKAGHVKDYAYDMAGNAKDMAYEKAGYAKGFAYDKVGSAYKSAQSMMDFGYDKAG  291

Query  1202  QTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKE-TLSKAGQAAKD  1378
               KD  +     AKD   Q A  AKD        AKD   + A  A++    KAG  AK+
Sbjct  292   DAKDMANEKASIAKDMAYQKAGNAKDMAYEKAGIAKDMAYEKAGHAEDFAYDKAGH-AKN  350

Query  1379  YTV----QAKDYASQKAGEAGNKASE-----------AKERGTEMSKNAASYAGQKVTEA  1513
             +T      AKD A +KAG+A + A +           AK+ G E +  A  +A +K + A
Sbjct  351   FTYDKAGDAKDMAYEKAGDAKDMAFDKVGCAYGSAQKAKDFGYEKAGEAKDFAYKKASNA  410

Query  1514  KDVTVES  1534
             KD+  E+
Sbjct  411   KDIAYEN  417


 Score = 55.1 bits (131),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 77/242 (32%), Positives = 87/242 (36%), Gaps = 37/242 (15%)
 Frame = +2

Query  911   VEKAGAAKDTALQKTQQA----YNAA---KDTTISKTQQAKDTFSSTGQTAKDYTTQSAK  1069
              + AG AKD A +K Q A    Y+ A   KD    K   AKD         KD+    A 
Sbjct  82    YDNAGYAKDFAERKAQHAKDFAYHMAGDAKDMAYEKAGNAKDMAYEKAGNVKDFAYDKAG  141

Query  1070  QTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDY  1249
               KD        AKD     A   KD        AKDY    A   KD        AKDY
Sbjct  142   DAKDIAYEKAGCAKDIAYDKAGNAKDMAYDKAGHAKDYAYDKASNAKDMAYDKAGHAKDY  201

Query  1250  TVQSAQQAKDT-LSGAGQTAKDYTVQTAQQAKET-LSKAGQAAKDYTV----QAKDYASQ  1411
                 A  AK      AGQ  KDY    A   K     KAG   KDY       AKD A +
Sbjct  202   GYDKAGNAKGMAYEKAGQ-GKDYAYDKASNVKHMGHEKAGH-VKDYAYDMAGNAKDMAYE  259

Query  1412  KAGEA----------------------GNKASEAKERGTEMSKNAASYAGQKVTEAKDVT  1525
             KAG A                       +KA +AK+   E +  A   A QK   AKD+ 
Sbjct  260   KAGYAKGFAYDKVGSAYKSAQSMMDFGYDKAGDAKDMANEKASIAKDMAYQKAGNAKDMA  319

Query  1526  VE  1531
              E
Sbjct  320   YE  321


 Score = 53.1 bits (126),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 74/248 (30%), Positives = 95/248 (38%), Gaps = 19/248 (8%)
 Frame = +2

Query  800   RQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKTQQAYNAAK  979
             +  A   + DA   A  K   AK+   E   +   +  +KAG AKD A +K       AK
Sbjct  100   KDFAYHMAGDAKDMAYEKAGNAKDMAYEKAGNVKDFAYDKAGDAKDIAYEKA----GCAK  155

Query  980   DTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDT-LS  1156
             D    K   AKD        AKDY    A   KD        AKDY    A   K     
Sbjct  156   DIAYDKAGNAKDMAYDKAGHAKDYAYDKASNAKDMAYDKAGHAKDYGYDKAGNAKGMAYE  215

Query  1157  SAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYT---VQT  1327
              AGQ  KDY    A   K          KDY    A  AKD        AK +    V +
Sbjct  216   KAGQ-GKDYAYDKASNVKHMGHEKAGHVKDYAYDMAGNAKDMAYEKAGYAKGFAYDKVGS  274

Query  1328  AQQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGNKASEAKERGTEMSKNAASYAGQKVT  1507
             A ++ +++   G    D    AKD A++       KAS AK+   + + NA   A +K  
Sbjct  275   AYKSAQSMMDFGY---DKAGDAKDMANE-------KASIAKDMAYQKAGNAKDMAYEKAG  324

Query  1508  EAKDVTVE  1531
              AKD+  E
Sbjct  325   IAKDMAYE  332



>ref|XP_011100212.1| PREDICTED: embryonic protein DC-8-like isoform X2 [Sesamum indicum]
Length=355

 Score = 59.7 bits (143),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 47/170 (28%), Positives = 74/170 (44%), Gaps = 26/170 (15%)
 Frame = +2

Query  776   SLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKT  955
             SLEEI   R  AQQ S +A++ A+ +YEK+K                          +K 
Sbjct  126   SLEEISNLRAKAQQNSTEAIRAAEERYEKSK--------------------------EKG  159

Query  956   QQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQ  1135
               A + AKD T  K   AK+    +G+   +YT + A + KD    AG  A  YT++ A 
Sbjct  160   ASALHKAKDYTAKKAVAAKEVAVESGKGVAEYTGKVAAEVKDHAIVAGWGATHYTLEKAA  219

Query  1136  QTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTL  1285
             +    ++    +   YT +     KD ++ AG++   Y  +    AKD +
Sbjct  220   EATKAVAGITSSVAGYTGEKVVVAKDKVAGAGKSLAGYAGEKIAAAKDAV  269


 Score = 57.0 bits (136),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 33/42 (79%), Gaps = 1/42 (2%)
 Frame = +2

Query  188  MASEQLRRDNK-TGERAVEVEKDRVPKMASHFESLAEKVADD  310
            MAS+QLRR+N  T ER   V+KDRVPKM +HFESLAEK  D+
Sbjct  1    MASKQLRRENHVTDERETVVKKDRVPKMTTHFESLAEKARDE  42



>ref|XP_007201970.1| hypothetical protein PRUPE_ppa004780mg [Prunus persica]
 gb|EMJ03169.1| hypothetical protein PRUPE_ppa004780mg [Prunus persica]
Length=491

 Score = 60.1 bits (144),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 61/198 (31%), Positives = 95/198 (48%), Gaps = 23/198 (12%)
 Frame = +2

Query  899   SQYLVEKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTK  1078
             + Y  EKA  AKD  +QK + A    KDTT+ K  +  +  +   + AKD T + A +TK
Sbjct  226   TNYATEKAKEAKDATMQKAKDA----KDTTVGKASEYTNYAAEKAKEAKDTTAEKANETK  281

Query  1079  DTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQ  1258
             D      +  KD TV    + KDT + A + A DY           LS   +  K    +
Sbjct  282   DYTDEKAKEGKDTTVSKLGELKDTAAGAARKAMDY-----------LSGKKEETKQKAAE  330

Query  1259  SAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAK----DYTVQAKDYASQKAGEA  1426
             +A+Q KD  +   +  K+ T +TA++ KE LS+  + A+    +  V+ K+Y      EA
Sbjct  331   TAEQTKDKAADTTEKTKEKTYETAEKTKEKLSETEEEARRKMEELKVEGKEYKD----EA  386

Query  1427  GNKASEAKERGTEMSKNA  1480
             G ++ EA++   E  K A
Sbjct  387   GGRSREARDIEAEKGKAA  404


 Score = 55.8 bits (133),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 85/297 (29%), Positives = 130/297 (44%), Gaps = 44/297 (15%)
 Frame = +2

Query  761   DHSGLSLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAK--  934
             +++G + E+  + + TA QK+ DA  TA  K + AK+TT       + Y  +KA   K  
Sbjct  107   EYTGTAAEKAKQSKDTAAQKAKDAKDTAAQKAKDAKDTTMGKTSEYTGYAAQKAKETKDA  166

Query  935   ---------DTALQKTQQAYNAAKDTTISKTQQAKDTF----------------SSTGQT  1039
                      DT + KT      A D    KT++ KD                  S+ G+ 
Sbjct  167   AAQEAKEAKDTTMGKTSDYTGYAAD----KTKETKDYAAEKAKEAAEKAKETEDSAMGKA  222

Query  1040  AK--DYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKD  1213
              +  +Y T+ AK+ KD      + AKD TV  A +  +  +   + AKD T + A +TKD
Sbjct  223   GEYTNYATEKAKEAKDATMQKAKDAKDTTVGKASEYTNYAAEKAKEAKDTTAEKANETKD  282

Query  1214  TLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTV----QTAQQAKETLSKAGQAAKDY  1381
                   +  KD TV    + KDT +GA + A DY      +T Q+A ET  +    A D 
Sbjct  283   YTDEKAKEGKDTTVSKLGELKDTAAGAARKAMDYLSGKKEETKQKAAETAEQTKDKAADT  342

Query  1382  TVQAKDYASQKAGEAGNKAS----EAKERGTEMSKNAASY---AGQKVTEAKDVTVE  1531
             T + K+   + A +   K S    EA+ +  E+      Y   AG +  EA+D+  E
Sbjct  343   TEKTKEKTYETAEKTKEKLSETEEEARRKMEELKVEGKEYKDEAGGRSREARDIEAE  399



>ref|XP_006403734.1| hypothetical protein EUTSA_v10010945mg [Eutrema salsugineum]
 gb|ESQ45187.1| hypothetical protein EUTSA_v10010945mg [Eutrema salsugineum]
Length=420

 Score = 59.7 bits (143),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 65/199 (33%), Positives = 102/199 (51%), Gaps = 15/199 (8%)
 Frame = +2

Query  866   KNTTKENVQSGSQYLVEKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAK  1045
             K+TT +  +  + Y  +KA  AKD    KT +     KD T  K ++AKDT   T + AK
Sbjct  117   KDTTADKTKETTDYTADKAREAKD----KTAEKMGEYKDYTAEKAKEAKDT---TAEKAK  169

Query  1046  DYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDT-LS  1222
             +   + AK  KDT +   +   DYT   A++ KD  +      KDYT + A + KD  +S
Sbjct  170   EMADK-AKGAKDTTAEKAKETADYTADKAREAKDKTAEKMGEYKDYTAEKATEGKDVGVS  228

Query  1223  SAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAK----DYTVQ  1390
               G+  KD  V +A++A   LSG  +  K   V+T   AKE + +AG+ A+    D  ++
Sbjct  229   KIGEL-KDSAVDTAKRAMGFLSGKTEETKQKAVETKDTAKEKMDEAGEEARRKMEDMRLE  287

Query  1391  AKDYASQKAGEAGNKASEA  1447
              K+     AG+ G++ +E+
Sbjct  288   GKELKDD-AGQTGHEKTES  305


 Score = 58.5 bits (140),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 63/205 (31%), Positives = 96/205 (47%), Gaps = 35/205 (17%)
 Frame = +2

Query  881   ENVQSGSQYLVEKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQ  1060
             E+ ++G++   EKA   KD   +K  +     KDTT  KT++  D           YT  
Sbjct  89    ESTRNGAEVASEKAAGVKDATAEKAVEV----KDTTADKTKETTD-----------YTAD  133

Query  1061  SAKQTKDTLSSAGQTAKDYTVQSAQQTKDT-------LSSAGQTAKDYTVQSAQQTKDTL  1219
              A++ KD  +      KDYT + A++ KDT       ++   + AKD T + A++T D  
Sbjct  134   KAREAKDKTAEKMGEYKDYTAEKAKEAKDTTAEKAKEMADKAKGAKDTTAEKAKETADYT  193

Query  1220  SSAGQTA-----------KDYTVQSAQQAKDT-LSGAGQTAKDYTVQTAQQAKETLSKAG  1363
             +   + A           KDYT + A + KD  +S  G+  KD  V TA++A   LS   
Sbjct  194   ADKAREAKDKTAEKMGEYKDYTAEKATEGKDVGVSKIGEL-KDSAVDTAKRAMGFLSGKT  252

Query  1364  QAAKDYTVQAKDYASQKAGEAGNKA  1438
             +  K   V+ KD A +K  EAG +A
Sbjct  253   EETKQKAVETKDTAKEKMDEAGEEA  277



>ref|XP_004508082.1| PREDICTED: embryonic protein DC-8-like [Cicer arietinum]
Length=424

 Score = 59.7 bits (143),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 78/253 (31%), Positives = 121/253 (48%), Gaps = 15/253 (6%)
 Frame = +2

Query  761   DHSGLSLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDT  940
             DH+  + E+   Y + A QK  D    A    EK K+   +  +   QY  + A   +D 
Sbjct  135   DHAHDTAEKTKDYARDASQKIRDYATDAA---EKTKHHAGDASERTGQYADDAAEDTRDF  191

Query  941   ALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYT  1120
             A     +A + A++ T S  Q+AKD  +   Q AK+Y T +A ++KD    A +  K+Y 
Sbjct  192   A----GEAIHKAREYTGSAAQKAKDLAADAAQKAKEYATGAAYKSKDYAGDAAEKTKEYA  247

Query  1121  VQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQ  1300
               +A+++KDT        KDY   +A +TKD    A   AKDY   +A +AKD    A +
Sbjct  248   GDAAEKSKDT----AYKTKDYAGDAAYKTKDYAGDAAYKAKDYAGDAAYKAKDYAGDAAE  303

Query  1301  TAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGNKASEAKERGTEMSKNA  1480
               KD   +T   A +   K+ + A D   ++KDY    AG+A  K  EA +  ++ +K  
Sbjct  304   KTKDAAYKTKDYAGDAAEKSKEYATDAAYKSKDY----AGDAAQKTKEASDYASDTTKKT  359

Query  1481  ASYAGQKVTEAKD  1519
              +YA     + KD
Sbjct  360   TNYATDTAKKTKD  372


 Score = 55.8 bits (133),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 75/230 (33%), Positives = 109/230 (47%), Gaps = 18/230 (8%)
 Frame = +2

Query  875   TKENVQSGSQYLVEKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYT  1054
             +KE  Q  + +  + A   KD A   +Q+  + A D        A D    TGQ A D  
Sbjct  126   SKETAQRANDHAHDTAEKTKDYARDASQKIRDYATDAAEKTKHHAGDASERTGQYADD--  183

Query  1055  TQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQ  1234
               +A+ T+D    A   A++YT  +AQ+ KD  + A Q AK+Y   +A ++KD    A +
Sbjct  184   --AAEDTRDFAGEAIHKAREYTGSAAQKAKDLAADAAQKAKEYATGAAYKSKDYAGDAAE  241

Query  1235  TAKDYTVQSAQQAKDTL----SGAGQTA---KDYTVQTAQQAKETLSKAGQAAKDYTVQA  1393
               K+Y   +A+++KDT       AG  A   KDY    A +AK+    A   AKDY   A
Sbjct  242   KTKEYAGDAAEKSKDTAYKTKDYAGDAAYKTKDYAGDAAYKAKDYAGDAAYKAKDYAGDA  301

Query  1394  ----KDYASQKAGEAGNKASEAKERGTEMSKNAASYAG---QKVTEAKDV  1522
                 KD A +    AG+ A ++KE  T+ +  +  YAG   QK  EA D 
Sbjct  302   AEKTKDAAYKTKDYAGDAAEKSKEYATDAAYKSKDYAGDAAQKTKEASDY  351


 Score = 55.1 bits (131),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 72/236 (31%), Positives = 115/236 (49%), Gaps = 19/236 (8%)
 Frame = +2

Query  860   KAKNTTKENVQSGSQYLVEKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQT  1039
             K K+   +  Q    Y  E A  +K+TA    Q+A + A DT     ++ KD      Q 
Sbjct  103   KTKDCASDAAQKTKDYASETAKKSKETA----QRANDHAHDTA----EKTKDYARDASQK  154

Query  1040  AKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTL  1219
              +DY T +A++TK     A +    Y   +A+ T+D    A   A++YT  +AQ+ KD  
Sbjct  155   IRDYATDAAEKTKHHAGDASERTGQYADDAAEDTRDFAGEAIHKAREYTGSAAQKAKDLA  214

Query  1220  SSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSK----AGQAA---KD  1378
             + A Q AK+Y   +A ++KD    A +  K+Y    A+++K+T  K    AG AA   KD
Sbjct  215   ADAAQKAKEYATGAAYKSKDYAGDAAEKTKEYAGDAAEKSKDTAYKTKDYAGDAAYKTKD  274

Query  1379  Y----TVQAKDYASQKAGEAGNKASEAKERGTEMSKNAASYAGQKVTEAKDVTVES  1534
             Y      +AKDYA   A +A + A +A E+  + +     YAG    ++K+   ++
Sbjct  275   YAGDAAYKAKDYAGDAAYKAKDYAGDAAEKTKDAAYKTKDYAGDAAEKSKEYATDA  330



>ref|XP_010558975.1| PREDICTED: embryonic protein DC-8-like [Tarenaya hassleriana]
Length=367

 Score = 58.5 bits (140),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 66/225 (29%), Positives = 98/225 (44%), Gaps = 18/225 (8%)
 Frame = +2

Query  833   LQTAQNKYEKAKNTTK-------ENVQSGSQYLVEKAGAAKDTALQKTQQAYNAAKDTTI  991
             L+  Q  YE AK+          E  +       EKAG  KD  +QK+++      D T 
Sbjct  66    LKAVQGTYEHAKDAVSGKGHEAAEKAEEVKDATAEKAGEVKDRTVQKSKETA----DYTA  121

Query  992   SKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKD-TLSSAGQ  1168
              K ++ KD  +      +DYT   A++ KD  +      KDYT   A++ KD T    G+
Sbjct  122   EKAREGKDKTADKMGEYRDYTADKAREAKDKTAEKMGEYKDYTADKAREAKDKTAEKTGE  181

Query  1169  TA------KDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTA  1330
              A      KDYT + A + KD         KD  V +A++A   LSG  +  K   V+  
Sbjct  182   AAEKAGEYKDYTAEKATEGKDAGVGKLGELKDSAVDTAKRAMGFLSGKKEETKQTAVEAK  241

Query  1331  QQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGNKASEAKERGTE  1465
                KE LS+ G+ A+    + +    ++AG+A      A ER  E
Sbjct  242   DTTKEKLSETGEEARRKMEEMRLEGKEEAGKAYETKDSATERANE  286


 Score = 52.4 bits (124),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 58/183 (32%), Positives = 87/183 (48%), Gaps = 21/183 (11%)
 Frame = +2

Query  1001  QQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKD  1180
             + AKD  S  G  A     + A++ KD  +      KD TVQ +++T            D
Sbjct  74    EHAKDAVSGKGHEA----AEKAEEVKDATAEKAGEVKDRTVQKSKET-----------AD  118

Query  1181  YTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKE-TLSK  1357
             YT + A++ KD  +      +DYT   A++AKD  +      KDYT   A++AK+ T  K
Sbjct  119   YTAEKAREGKDKTADKMGEYRDYTADKAREAKDKTAEKMGEYKDYTADKAREAKDKTAEK  178

Query  1358  AGQAAKDYTVQAKDYASQKAGE---AG-NKASEAKERGTEMSKNAASYAGQKVTEAKDVT  1525
              G+AA +   + KDY ++KA E   AG  K  E K+   + +K A  +   K  E K   
Sbjct  179   TGEAA-EKAGEYKDYTAEKATEGKDAGVGKLGELKDSAVDTAKRAMGFLSGKKEETKQTA  237

Query  1526  VES  1534
             VE+
Sbjct  238   VEA  240



>ref|XP_010524054.1| PREDICTED: seed biotin-containing protein SBP65 [Tarenaya hassleriana]
Length=475

 Score = 58.9 bits (141),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 55/202 (27%), Positives = 97/202 (48%), Gaps = 10/202 (5%)
 Frame = +2

Query  776   SLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKT  955
             +LE+I + R  AQQ S+DA++ A+ +Y+ AK ++    ++       K+  A++T+ +  
Sbjct  112   TLEDIHEARAKAQQMSMDAIRAAEERYKNAKESSSHGDEA-------KSTKARETSDETG  164

Query  956   QQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQ  1135
             QQ      +T +   ++AK T     +  ++   ++A+  K T    GQ AK+  V SAQ
Sbjct  165   QQGRE---ETGVQGAEKAKGTAMEKIRHVQESAAETAQSAKATAVEKGQRAKESVVGSAQ  221

Query  1136  QTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDY  1315
             + KD  +   Q   +Y  +   +  D  +  GQ  K+     A +AKDT     +   +Y
Sbjct  222   KAKDFAADKAQRTSEYVTEKGAEAGDIAARKGQETKEQAASMAGKAKDTAVDVTKKVAEY  281

Query  1316  TVQTAQQAKETLSKAGQAAKDY  1381
               + A  AKE   + G+ A  Y
Sbjct  282   AGEKAAVAKEATVEGGKEAAHY  303



>ref|XP_006411984.1| hypothetical protein EUTSA_v10026959mg [Eutrema salsugineum]
 gb|ESQ53437.1| hypothetical protein EUTSA_v10026959mg [Eutrema salsugineum]
Length=395

 Score = 58.5 bits (140),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 70/198 (35%), Positives = 80/198 (40%), Gaps = 23/198 (12%)
 Frame = +2

Query  866   KNTTKENVQSGSQYLVEKAGAA-------KDTALQKTQQAY---NAAKDTTISKTQQAKD  1015
             K+  +E V+S   Y  +KAG+A       KD A  K   AY   N AK     KT  AKD
Sbjct  79    KDEAEEAVESAKNYAYDKAGSAYDNAGYAKDFASDKAGSAYDGANNAKHYAYDKTGDAKD  138

Query  1016  T-FSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQ  1192
               +   GQ AKD     A Q KD        AKD     A Q KD       +AKD    
Sbjct  139   MAYEKAGQ-AKDVAYDKASQAKDIAYDKADQAKDMAYDKAGQVKDMAYDKAGSAKDMAYD  197

Query  1193  SAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAA  1372
                Q KD       +AKD     A QAKD       +AKD        A E   KAG   
Sbjct  198   KVGQAKDMAYDKAGSAKDMAYDKAGQAKDMAYDKVGSAKDMAYGKVGSASE---KAG---  251

Query  1373  KDYTVQAKDYASQKAGEA  1426
                  QAKD+A  KAG A
Sbjct  252   -----QAKDFAYDKAGHA  264



>ref|XP_010432162.1| PREDICTED: embryonic protein DC-8 isoform X3 [Camelina sativa]
Length=466

 Score = 58.5 bits (140),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 77/239 (32%), Positives = 95/239 (40%), Gaps = 23/239 (10%)
 Frame = +2

Query  881   ENVQSGSQYLVEKAGAAKDTALQKT----QQAYNAA---KDTTISKTQQAKDTFSSTGQT  1039
             ++ Q+   Y  +KAG AKD A  KT      AYN A   KD    K  QAKD        
Sbjct  115   DSAQNAKHYAYDKAGDAKDMAYNKTGEANDMAYNKAGQAKDMAFDKAGQAKDMAYDKAGK  174

Query  1040  AKDYTTQSAKQTKDT-LSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDT  1216
             AKD     A Q KD     AGQ AKD   + A    D    A   A D T  +  +  DT
Sbjct  175   AKDIAYDKAGQAKDMAYDKAGQ-AKDKVYEKAGSAYDIAGQAKDRAYDKTGHAKDKAYDT  233

Query  1217  LSSAGQTA--------------KDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLS  1354
               SA + A              KD     A QAKD        AKD    TA  A E   
Sbjct  234   AGSAYEMAGQVKDMAYDKAGQVKDMAYDKAGQAKDMAYDKASEAKDKIYDTAGSAYEMAG  293

Query  1355  KAGQAAKDYTVQAKDYASQKAGEAGNKASEAKERGTEMSKNAASYAGQKVTEAKDVTVE  1531
             +A   A D   +AKD    KA +A + A +     +E +  A  +A  K +  KDV  +
Sbjct  294   QAKDMAYDKASKAKDMTYDKAAQAKDMAYDKARLASEKAGQAKDFAYDKASHVKDVAYD  352


 Score = 57.0 bits (136),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 86/274 (31%), Positives = 113/274 (41%), Gaps = 34/274 (12%)
 Frame = +2

Query  773   LSLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQK  952
             ++  + G+ +  A  K+  A   A +K  KAK+   +          +KAG AKD   +K
Sbjct  145   MAYNKAGQAKDMAFDKAGQAKDMAYDKAGKAKDIAYDKAGQAKDMAYDKAGQAKDKVYEK  204

Query  953   TQQAYNAA---KDTTISKTQQAKD--------TFSSTGQTAKDYTTQSAKQTKDT-LSSA  1096
                AY+ A   KD    KT  AKD         +   GQ  KD     A Q KD     A
Sbjct  205   AGSAYDIAGQAKDRAYDKTGHAKDKAYDTAGSAYEMAGQV-KDMAYDKAGQVKDMAYDKA  263

Query  1097  GQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAK  1276
             GQ AKD     A + KD +     +A     + A Q KD        AKD T   A QAK
Sbjct  264   GQ-AKDMAYDKASEAKDKIYDTAGSA----YEMAGQAKDMAYDKASKAKDMTYDKAAQAK  318

Query  1277  DTLSG--------AGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGN  1432
             D            AGQ AKD+    A   K+    A   A+D    A D    K+ EA +
Sbjct  319   DMAYDKARLASEKAGQ-AKDFAYDKASHVKDV---AYDKAEDVIRMATD----KSNEAKD  370

Query  1433  KASEAKERGTEMSKNAASYAGQKVTEAKDVTVES  1534
              A E+ ER  E SKNA   A  K  + +D T ++
Sbjct  371   NADESYERFKEGSKNAKDMASDKAQDVRDKTADA  404


 Score = 55.5 bits (132),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 92/276 (33%), Positives = 118/276 (43%), Gaps = 26/276 (9%)
 Frame = +2

Query  761   DHSGLSLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDT  940
             D +G + +     +  A  K+ DA   A NK  +A +              +KAG AKD 
Sbjct  108   DRAGSAYDSAQNAKHYAYDKAGDAKDMAYNKTGEANDMAYNKAGQAKDMAFDKAGQAKDM  167

Query  941   ALQKTQQAYNAAKDTTISKTQQAKDT-FSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDY  1117
             A  K  +A    KD    K  QAKD  +   GQ AKD   + A    D    A   A D 
Sbjct  168   AYDKAGKA----KDIAYDKAGQAKDMAYDKAGQ-AKDKVYEKAGSAYDIAGQAKDRAYDK  222

Query  1118  TVQSAQQTKDTLSSAGQTA---KDYTVQSAQQTKDT-LSSAGQTAKDYTVQSAQQAKDTL  1285
             T  +  +  DT  SA + A   KD     A Q KD     AGQ AKD     A +AKD +
Sbjct  223   TGHAKDKAYDTAGSAYEMAGQVKDMAYDKAGQVKDMAYDKAGQ-AKDMAYDKASEAKDKI  281

Query  1286  SG--------AGQTAKDYTVQTAQQAKE-TLSKAGQAAKDYTVQAKDYASQKAGEAG---  1429
                       AGQ AKD     A +AK+ T  KA QA KD        AS+KAG+A    
Sbjct  282   YDTAGSAYEMAGQ-AKDMAYDKASKAKDMTYDKAAQA-KDMAYDKARLASEKAGQAKDFA  339

Query  1430  -NKASEAKERGTEMSKNAASYAGQKVTEAKDVTVES  1534
              +KAS  K+   + +++    A  K  EAKD   ES
Sbjct  340   YDKASHVKDVAYDKAEDVIRMATDKSNEAKDNADES  375



>ref|XP_010432161.1| PREDICTED: embryonic protein DC-8 isoform X2 [Camelina sativa]
Length=473

 Score = 58.5 bits (140),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 79/239 (33%), Positives = 98/239 (41%), Gaps = 27/239 (11%)
 Frame = +2

Query  881   ENVQSGSQYLVEKAGAAKDTALQKT----QQAYNAA---KDTTISKTQQAKDTFSSTGQT  1039
             ++ Q+   Y  +KAG AKD A  KT      AYN A   KD    K  QAKD        
Sbjct  115   DSAQNAKHYAYDKAGDAKDMAYNKTGEANDMAYNKAGQAKDMAFDKAGQAKDMAYDKAGK  174

Query  1040  AKDYTTQSAKQTKDT-LSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDT  1216
             AKD     A Q KD     AGQ AKD   + A    D    A   A D T  +  +  DT
Sbjct  175   AKDIAYDKAGQAKDMAYDKAGQ-AKDKVYEKAGSAYDIAGQAKDRAYDKTGHAKDKAYDT  233

Query  1217  LSSAGQTA--------------KDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLS  1354
               SA + A              KD     A QAKD        AKD    TA  A E   
Sbjct  234   AGSAYEMAGQVKDMAYDKAGQVKDMAYDKAGQAKDMAYDKASEAKDKIYDTAGSAYEMAG  293

Query  1355  KAGQAAKDYTVQAKDYASQKAGEAGNKASEAKERGTEMSKNAASYAGQKVTEAKDVTVE  1531
             +A   A D   +AKD  + KA    +KA +AK    +M+ + A  A +K  +AKD   +
Sbjct  294   QAKDMAYDKASKAKDMTTDKARSTYDKAEQAK----DMAYDKARLASEKAGQAKDFAYD  348


 Score = 53.5 bits (127),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 89/299 (30%), Positives = 120/299 (40%), Gaps = 55/299 (18%)
 Frame = +2

Query  773   LSLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQK  952
              + ++ G  +  A  K+ +A   A NK  +AK+   +          +KAG AKD A  K
Sbjct  123   YAYDKAGDAKDMAYNKTGEANDMAYNKAGQAKDMAFDKAGQAKDMAYDKAGKAKDIAYDK  182

Query  953   TQQAYNAAKDTTISKTQQAKD--------TFSSTGQT---AKDYTTQSAKQTKDTLSSAG  1099
               QA    KD    K  QAKD         +   GQ    A D T  +  +  DT  SA 
Sbjct  183   AGQA----KDMAYDKAGQAKDKVYEKAGSAYDIAGQAKDRAYDKTGHAKDKAYDTAGSAY  238

Query  1100  QTA---KDYTVQSAQQTKDT-LSSAGQTAKDYTVQSAQQTKDTLSS--------AGQTAK  1243
             + A   KD     A Q KD     AGQ AKD     A + KD +          AGQ AK
Sbjct  239   EMAGQVKDMAYDKAGQVKDMAYDKAGQ-AKDMAYDKASEAKDKIYDTAGSAYEMAGQ-AK  296

Query  1244  DYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKA--  1417
             D     A +AKD  +   ++    T   A+QAK+      + A +   QAKD+A  KA  
Sbjct  297   DMAYDKASKAKDMTTDKARS----TYDKAEQAKDMAYDKARLASEKAGQAKDFAYDKASH  352

Query  1418  --------------------GEAGNKASEAKERGTEMSKNAASYAGQKVTEAKDVTVES  1534
                                  EA + A E+ ER  E SKNA   A  K  + +D T ++
Sbjct  353   VKDVAYDKAEDVIRMATDKSNEAKDNADESYERFKEGSKNAKDMASDKAQDVRDKTADA  411


 Score = 53.1 bits (126),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 90/282 (32%), Positives = 119/282 (42%), Gaps = 31/282 (11%)
 Frame = +2

Query  761   DHSGLSLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDT  940
             D +G + +     +  A  K+ DA   A NK  +A +              +KAG AKD 
Sbjct  108   DRAGSAYDSAQNAKHYAYDKAGDAKDMAYNKTGEANDMAYNKAGQAKDMAFDKAGQAKDM  167

Query  941   ALQKTQQAYNAAKDTTISKTQQAKDT-FSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDY  1117
             A  K  +A    KD    K  QAKD  +   GQ AKD   + A    D    A   A D 
Sbjct  168   AYDKAGKA----KDIAYDKAGQAKDMAYDKAGQ-AKDKVYEKAGSAYDIAGQAKDRAYDK  222

Query  1118  TVQSAQQTKDTLSSAGQTA---KDYTVQSAQQTKDT-LSSAGQTAKDYTVQSAQQAKDTL  1285
             T  +  +  DT  SA + A   KD     A Q KD     AGQ AKD     A +AKD +
Sbjct  223   TGHAKDKAYDTAGSAYEMAGQVKDMAYDKAGQVKDMAYDKAGQ-AKDMAYDKASEAKDKI  281

Query  1286  SG--------AGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKD-------YASQKAG  1420
                       AGQ AKD     A +AK+  +   ++  D   QAKD        AS+KAG
Sbjct  282   YDTAGSAYEMAGQ-AKDMAYDKASKAKDMTTDKARSTYDKAEQAKDMAYDKARLASEKAG  340

Query  1421  EAGN----KASEAKERGTEMSKNAASYAGQKVTEAKDVTVES  1534
             +A +    KAS  K+   + +++    A  K  EAKD   ES
Sbjct  341   QAKDFAYDKASHVKDVAYDKAEDVIRMATDKSNEAKDNADES  382



>ref|XP_011099628.1| PREDICTED: embryonic protein DC-8 isoform X2 [Sesamum indicum]
Length=533

 Score = 58.5 bits (140),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 80/245 (33%), Positives = 110/245 (45%), Gaps = 44/245 (18%)
 Frame = +2

Query  809   AQQKSIDALQTAQ---NKY--EKAK---NTTKENVQSGSQYLVEKAG-----------AA  931
             A  KS DAL +A    +KY  EKAK   +TT E +     Y  EK G           AA
Sbjct  92    AASKSTDALSSAAYDTSKYASEKAKEMADTTSEKLDDAKNYASEKGGEAVKVASDRASAA  151

Query  932   KDTALQKTQQAYNAAKDT-------TISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLS  1090
             K+T   K   AY +A +T       T  K  +AKD  S       +   ++ K   D  S
Sbjct  152   KETGKHKAGNAYESASETASDVAGGTAEKLGRAKDCAS-------EKAGEAMKMASDMAS  204

Query  1091  SAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQ  1270
                +TAKD       + K+   S+ +TA D     A++    L  A   A +   ++ + 
Sbjct  205   GVKETAKD-------KVKNAYESSSETASDVARGPAEK----LGRAKDCASEKAGEAMKM  253

Query  1271  AKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGNKASEAK  1450
             A D  SGA +TAKD      + A ET S       +    AK+YAS+KAGEA +KA +A 
Sbjct  254   ASDMASGAKETAKDKVKNAYESASETASDVAGRTSEKLGNAKNYASEKAGEAKDKAYDAY  313

Query  1451  ERGTE  1465
             E GT+
Sbjct  314   EVGTD  318



>gb|AJA33578.1| late embryogenesis abundant protein LEA4-3 [Pinus tabuliformis]
Length=314

 Score = 57.4 bits (137),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 70/246 (28%), Positives = 115/246 (47%), Gaps = 22/246 (9%)
 Frame = +2

Query  827   DALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKTQQAYNAAKDTTISKTQQ  1006
             D L++A+     AK+ + E+  S    + E       +A +  Q+ +  AKD+   KTQ+
Sbjct  25    DNLESAKTMAHVAKDASTESASSALGSIKE----GTMSAFKGLQEKFENAKDSVTGKTQE  80

Query  1007  AKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYT  1186
              KDT     +  KD      K+T DT  +  +  KD   Q A++TKD      + AKD  
Sbjct  81    VKDTTVDKTRETKDSVADKTKETTDTAVNKAREYKDSAAQKAEETKDAAMEKARAAKDTA  140

Query  1187  VQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQ  1366
              + A+  KD+++   Q AKD +++ A++ KD     GQ A+    +T++  K  L +  +
Sbjct  141   AEKARAAKDSVAGKTQEAKDSSIEKAEETKDRT---GQKAQ----ETSEGTKGKLGETTE  193

Query  1367  AAKDYTVQAK-------DYASQKAGE----AGNKASEAKERGTEMSKNAASYAGQKVTEA  1513
             + ++   Q K       D A QK GE    A  KA E+K+   + ++ A +     VT  
Sbjct  194   SMREKMEQLKVGGEETVDSAKQKTGETAHQAQEKAQESKDTAMDKTEQAKNSIWSSVTGL  253

Query  1514  KDVTVE  1531
             KD   E
Sbjct  254   KDTIQE  259


 Score = 57.4 bits (137),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 72/240 (30%), Positives = 115/240 (48%), Gaps = 39/240 (16%)
 Frame = +2

Query  755   RRDHSGLSLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAK  934
             RR+++  +LE        A+  S ++  +A         + KE   S  + L EK   AK
Sbjct  19    RRENASDNLESAKTMAHVAKDASTESASSALG-------SIKEGTMSAFKGLQEKFENAK  71

Query  935   DTALQKTQQAYNAAKDTTISKTQQAKDTFS----STGQTA-------KDYTTQSAKQTKD  1081
             D+   KTQ+     KDTT+ KT++ KD+ +     T  TA       KD   Q A++TKD
Sbjct  72    DSVTGKTQEV----KDTTVDKTRETKDSVADKTKETTDTAVNKAREYKDSAAQKAEETKD  127

Query  1082  TLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDY----  1249
                   + AKD   + A+  KD+++   Q AKD +++ A++TKD     GQ A++     
Sbjct  128   AAMEKARAAKDTAAEKARAAKDSVAGKTQEAKDSSIEKAEETKDRT---GQKAQETSEGT  184

Query  1250  ------TVQSAQQAKDTLSGAGQ----TAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKD  1399
                   T +S ++  + L   G+    +AK  T +TA QA+E   ++   A D T QAK+
Sbjct  185   KGKLGETTESMREKMEQLKVGGEETVDSAKQKTGETAHQAQEKAQESKDTAMDKTEQAKN  244



>ref|XP_008244486.1| PREDICTED: seed biotin-containing protein SBP65 [Prunus mume]
Length=668

 Score = 58.5 bits (140),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 65/252 (26%), Positives = 108/252 (43%), Gaps = 74/252 (29%)
 Frame = +2

Query  776   SLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKT  955
             SLEEI K+R  AQQ S++A++ A+ +Y +AK + ++ + S ++++ EK    K+T +Q  
Sbjct  314   SLEEISKFRAAAQQNSMEAIRAAEERYAQAKESARQGIGSATEFVSEKGEQTKETLVQGV  373

Query  956   QQA---YNAAKDTTISKT----QQAKDTFSSTGQT-----------AKDYTTQSAKQT--  1075
             Q A    ++A  T + KT    + AKD   S GQT           AKD T +  K    
Sbjct  374   QTAKETLSSAGKTVVEKTAPVAENAKDVAVSAGQTTLHYVGEGAAKAKDVTLEGGKTAGA  433

Query  1076  ---------KDTLSSAGQTAKDYTVQSAQQ------------------------------  1138
                      KD  + AG +A  YT ++A +                              
Sbjct  434   YAGDVAVGLKDKATVAGWSAAHYTTEAAVEGTKLAARTVKGAAEYAGHTAVDIVSKPLIM  493

Query  1139  TKDTLSSAGQTAKDYTVQSAQQTKDTL---------SSAGQTAKDYTVQSAQQAKDTLSG  1291
              KD  + AG+ A +YT +  ++ +  L         S  GQT      Q  ++ + +  G
Sbjct  494   AKDAAAVAGEKAGEYTARKREEAQRELEARSAEQNKSQGGQT------QQGREKEGSKGG  547

Query  1292  AGQTAKDYTVQT  1327
              G+T +++  Q 
Sbjct  548   QGETGQEWQSQV  559


 Score = 55.5 bits (132),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 34/46 (74%), Gaps = 1/46 (2%)
 Frame = +2

Query  188  MASEQ-LRRDNKTGERAVEVEKDRVPKMASHFESLAEKVADDTAAD  322
            MASEQ +RR+N T ER VE+EKD+VPK+ +HFE+L      DT+ D
Sbjct  1    MASEQQMRRENTTSEREVEIEKDKVPKITTHFEALRGAEGKDTSLD  46



>emb|CAA79329.1| BP8 [Betula pendula]
Length=474

 Score = 58.2 bits (139),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 76/243 (31%), Positives = 111/243 (46%), Gaps = 40/243 (16%)
 Frame = +2

Query  857   EKAKNTTKENVQSGSQYLVEKAGAAKDTALQKTQQAYNAAKDTTISKTQQA---------  1009
             EKA+ TT E  +       EKA   KD+A +K ++     KD T  KT++          
Sbjct  127   EKARETT-EKARETKDSAAEKARETKDSAAEKAKEY----KDYTAEKTRETRESAKEKAK  181

Query  1010  ---------KDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSA  1162
                      KD+     +  KDY  + AK+ KD         KDY  + A++TKD+    
Sbjct  182   EAAEKAKETKDSALGKAEEYKDYAAEKAKEAKDKTVGKASEYKDYAAEKAKETKDSALGK  241

Query  1163  GQTAKDYTVQSAQQTKD-TLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQA  1339
              +  KDYT +  ++ KD T+  AG+  KDY   +A++AK+T        KDYT +   + 
Sbjct  242   AEEYKDYTAEKEKEVKDKTVGKAGEY-KDY---AAEKAKET--------KDYTAEKTIEG  289

Query  1340  KE-TLSKAG---QAAKDYTVQAKDYASQKAGEAGNKASEAKERGTEMSKNAASYAGQKVT  1507
             K+ TLSK G   ++A D   +A  + S K  E   K  E KE   E    A   A +K+ 
Sbjct  290   KDTTLSKLGELKESAADAARRAMGFLSGKKDEVTQKTEETKEATKEKLSEAEEEARRKME  349

Query  1508  EAK  1516
             E K
Sbjct  350   ELK  352


 Score = 57.4 bits (137),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 68/205 (33%), Positives = 101/205 (49%), Gaps = 28/205 (14%)
 Frame = +2

Query  932   KDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAK  1111
             KD+AL K ++     KD    K ++AKD         KDY  + AK+TKD+     +  K
Sbjct  191   KDSALGKAEEY----KDYAAEKAKEAKDKTVGKASEYKDYAAEKAKETKDSALGKAEEYK  246

Query  1112  DYTVQSAQQTKD-TLSSAGQTAKDYTVQSAQQTKD------------TLSSAGQTAKDYT  1252
             DYT +  ++ KD T+  AG+  KDY  + A++TKD            TLS  G+  K+  
Sbjct  247   DYTAEKEKEVKDKTVGKAGEY-KDYAAEKAKETKDYTAEKTIEGKDTTLSKLGEL-KESA  304

Query  1253  VQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAK----DYTVQA---KDYASQ  1411
               +A++A   LSG        T +T +  KE LS+A + A+    +  V+    KD A +
Sbjct  305   ADAARRAMGFLSGKKDEVTQKTEETKEATKEKLSEAEEEARRKMEELKVRGEENKDDADR  364

Query  1412  KAGEAGNKASEAKERGTEMSKNAAS  1486
             K  E  NK +EA +RGT  + N  S
Sbjct  365   KDRE-DNKVNEA-DRGTAATANIFS  387


 Score = 53.1 bits (126),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 60/239 (25%), Positives = 112/239 (47%), Gaps = 44/239 (18%)
 Frame = +2

Query  938   TALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQ----SAKQTKDTLSSAGQT  1105
             + L+   + Y  AK+  + KT++  ++   +G+ A +   +    +A++T++T   A + 
Sbjct  58    SVLKAVHETYEHAKEAVVGKTEETAESTRESGENAAEKARKTKDSAAEKTRETKKCAAEK  117

Query  1106  AKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKD--  1279
             AK+Y   +A++ ++T   A +T KD   + A++TKD+ +   +  KDYT +  ++ ++  
Sbjct  118   AKEYKDYTAEKARETTEKARET-KDSAAEKARETKDSAAEKAKEYKDYTAEKTRETRESA  176

Query  1280  -------------TLS---GAGQTAKDYTVQTAQQAKE-TLSKAGQAAKDYTVQA-----  1393
                          T     G  +  KDY  + A++AK+ T+ KA +  KDY  +      
Sbjct  177   KEKAKEAAEKAKETKDSALGKAEEYKDYAAEKAKEAKDKTVGKASE-YKDYAAEKAKETK  235

Query  1394  ----------KDYASQKAGEAGN----KASEAKERGTEMSKNAASYAGQKVTEAKDVTV  1528
                       KDY ++K  E  +    KA E K+   E +K    Y  +K  E KD T+
Sbjct  236   DSALGKAEEYKDYTAEKEKEVKDKTVGKAGEYKDYAAEKAKETKDYTAEKTIEGKDTTL  294



>ref|XP_011099627.1| PREDICTED: embryonic protein DC-8 isoform X1 [Sesamum indicum]
Length=536

 Score = 58.2 bits (139),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 80/245 (33%), Positives = 110/245 (45%), Gaps = 44/245 (18%)
 Frame = +2

Query  809   AQQKSIDALQTAQ---NKY--EKAK---NTTKENVQSGSQYLVEKAG-----------AA  931
             A  KS DAL +A    +KY  EKAK   +TT E +     Y  EK G           AA
Sbjct  95    AASKSTDALSSAAYDTSKYASEKAKEMADTTSEKLDDAKNYASEKGGEAVKVASDRASAA  154

Query  932   KDTALQKTQQAYNAAKDT-------TISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLS  1090
             K+T   K   AY +A +T       T  K  +AKD  S       +   ++ K   D  S
Sbjct  155   KETGKHKAGNAYESASETASDVAGGTAEKLGRAKDCAS-------EKAGEAMKMASDMAS  207

Query  1091  SAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQ  1270
                +TAKD       + K+   S+ +TA D     A++    L  A   A +   ++ + 
Sbjct  208   GVKETAKD-------KVKNAYESSSETASDVARGPAEK----LGRAKDCASEKAGEAMKM  256

Query  1271  AKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGNKASEAK  1450
             A D  SGA +TAKD      + A ET S       +    AK+YAS+KAGEA +KA +A 
Sbjct  257   ASDMASGAKETAKDKVKNAYESASETASDVAGRTSEKLGNAKNYASEKAGEAKDKAYDAY  316

Query  1451  ERGTE  1465
             E GT+
Sbjct  317   EVGTD  321



>ref|XP_002915863.1| PREDICTED: hypothetical protein LOC100464398 [Ailuropoda melanoleuca]
Length=1000

 Score = 58.5 bits (140),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 51/220 (23%), Positives = 104/220 (47%), Gaps = 20/220 (9%)
 Frame = +2

Query  755   RRDHSGLSLEEIGKYRQTAQQKSIDALQTAQNKYEK----AKNTTKENVQSGSQYLVEKA  922
             RR  S +++E   KY         D L+T +++  K    +++   E + +   Y    +
Sbjct  565   RRPVSSIAMETREKYTS-------DDLRTTEDQVTKDLGSSEDPITEPLVTSEDYTSVDS  617

Query  923   GAAKDTA---LQKTQQAYNA----AKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKD  1081
             G  +D      + T+ ++ A     +D T +  +  +D+F+    T +DYTT   + TKD
Sbjct  618   GTIEDYTNADPETTKDSFTAEPGTTEDYTTADPETTEDSFTEEPGTTEDYTTADPETTKD  677

Query  1082  TLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQS  1261
             + +    T +DY     + T+D+ ++  +T++DYT      T+D+ ++  +T +DYT   
Sbjct  678   SFTVEPGTTEDYITADPETTEDSFTA--ETSEDYTTADPDTTEDSFTAQPETTEDYTTAD  735

Query  1262  AQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDY  1381
              +  +D+ +    T +DYT    +  K++ +      +DY
Sbjct  736   PETTEDSFTAEPGTTEDYTTADPETTKDSFTVEPGTTEDY  775



>gb|KFK30157.1| hypothetical protein AALP_AA7G224400 [Arabis alpina]
Length=312

 Score = 57.0 bits (136),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 47/131 (36%), Positives = 64/131 (49%), Gaps = 4/131 (3%)
 Frame = +2

Query  1076  KDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTV  1255
             KD  +     A D   ++ +Q KDT   A + AKDY    AQ  KD  +     A D   
Sbjct  84    KDKANEGANKAADKAYETKEQAKDTAYEAKEKAKDY----AQSAKDKANEGANKAADKAY  139

Query  1256  QSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGNK  1435
             ++ +QAKDT   A + AKDY  +T  +  E   KA   A+D   +AKDYA     +A  K
Sbjct  140   ETKEQAKDTAYNAKEKAKDYAERTKDKVNEGAYKAADKAEDTKERAKDYAEDTMDDAKAK  199

Query  1436  ASEAKERGTEM  1468
             A +AKE+  E 
Sbjct  200   ARDAKEKVKEY  210


 Score = 55.1 bits (131),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 52/153 (34%), Positives = 76/153 (50%), Gaps = 4/153 (3%)
 Frame = +2

Query  1133  QQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKD  1312
             Q  KD  +     A D   ++ +Q KDT   A + AKDY    AQ AKD  +     A D
Sbjct  81    QGAKDKANEGANKAADKAYETKEQAKDTAYEAKEKAKDY----AQSAKDKANEGANKAAD  136

Query  1313  YTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGNKASEAKERGTEMSKNAASYA  1492
                +T +QAK+T   A + AKDY  + KD  ++ A +A +KA + KER  + +++    A
Sbjct  137   KAYETKEQAKDTAYNAKEKAKDYAERTKDKVNEGAYKAADKAEDTKERAKDYAEDTMDDA  196

Query  1493  GQKVTEAKDVTVESgkgavgyagkvaETLKDTA  1591
               K  +AK+   E G+     A    ET+KD A
Sbjct  197   KAKARDAKEKVKEYGEDTKEKAEGFKETVKDKA  229



>gb|EYU41141.1| hypothetical protein MIMGU_mgv1a012420mg [Erythranthe guttata]
Length=251

 Score = 56.2 bits (134),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 43/140 (31%), Positives = 73/140 (52%), Gaps = 14/140 (10%)
 Frame = +2

Query  1028  TGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQT  1207
             T + AK YT ++  +TKD +++ GQ+A  Y  + A   +D +   G+ A +Y  + A + 
Sbjct  94    TAKEAKSYTEENLIETKDIVAAKGQSAAAYVGEKATAARDAVVQGGKVAAEYVAKVAVEV  153

Query  1208  KDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQ-------  1366
             K+    AG  A +YTV+        ++GA +    YT + A  A ET++ AG+       
Sbjct  154   KEQAVVAGWVATNYTVEK-------VAGATKAVAGYTGEKAVAAGETIAGAGKVVGEKMA  206

Query  1367  AAKDYTVQAKDYASQKAGEA  1426
             AAKD  V +++  ++K  EA
Sbjct  207   AAKDAVVVSQENVARKKEEA  226



>ref|XP_008358215.1| PREDICTED: embryonic protein DC-8-like, partial [Malus domestica]
Length=229

 Score = 55.8 bits (133),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 51/154 (33%), Positives = 75/154 (49%), Gaps = 11/154 (7%)
 Frame = +2

Query  1106  AKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTL  1285
             AKD TV++A++TKD  +   +  KD TV    Q KDT + A Q A DY     ++ K   
Sbjct  1     AKDETVKTAKETKDCTAEKAKEGKDTTVSKLGQLKDTAAGAAQKAMDYLSGKKEETKQKA  60

Query  1286  SGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGNKASEAK----E  1453
             +   +  KD T +TA++AKE LS+  + A+    Q K    +   E  ++A EA+    E
Sbjct  61    AETAEKTKDTTYETAEKAKEKLSETEEEARRKMEQLKLQGKEYKDEDADRAREARDIEAE  120

Query  1454  RGTEMSKNAASYAG-------QKVTEAKDVTVES  1534
             +G    +N  S  G        K+T   DV  ES
Sbjct  121   KGQAAKENIFSSIGSIPGAIKSKLTHPTDVVEES  154



>ref|XP_008645565.1| PREDICTED: embryonic protein DC-8-like [Zea mays]
 gb|AFW71082.1| hypothetical protein ZEAMMB73_726804 [Zea mays]
Length=604

 Score = 57.8 bits (138),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 63/163 (39%), Positives = 91/163 (56%), Gaps = 3/163 (2%)
 Frame = +2

Query  974   AKDTTISKTQQAKD-TFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDT  1150
             AKDT  S  Q A++ T  +TG+ A DYT Q+A + KD  + A  T  +Y  Q+A + KD 
Sbjct  249   AKDTGASGAQAAEEKTQEATGKAA-DYTKQAAAKVKDLTAGAAGTTMEYAKQAAVKAKDV  307

Query  1151  LSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTA  1330
               + G+TA +Y  Q+A + KD   S G+TA +Y   +A++AK+     G+T   YT Q A
Sbjct  308   TLATGETAAEYAKQAAVKGKDVTLSTGETAAEYAKAAAEKAKEAAVATGKTTAGYTQQAA  367

Query  1331  QQAKE-TLSKAGQAAKDYTVQAKDYASQKAGEAGNKASEAKER  1456
              +AK+ T+S   Q A+  T    D A + A  A  KA + KER
Sbjct  368   VKAKDATVSTGAQVAQKATEVTADTARKVAEYAKEKAEQGKER  410



>gb|EMT08908.1| hypothetical protein F775_29269 [Aegilops tauschii]
Length=396

 Score = 57.4 bits (137),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 52/147 (35%), Positives = 75/147 (51%), Gaps = 18/147 (12%)
 Frame = +2

Query  980   DTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSS  1159
             DT   K+ QA D   +     KDYT + AK++ D+++         T ++A+ T++ L  
Sbjct  141   DTAADKSYQAADATGNKLGEFKDYTAEKAKESNDSVAHK-------TSETAEATRNKLGE  193

Query  1160  AGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQA  1339
             A    KDYTV+ A + KDT++       + T     + KD L+G  Q AKD T+Q AQQ 
Sbjct  194   A----KDYTVEKATEAKDTVAQKTSETAEATKNKLGEYKDALAGKTQEAKDTTMQKAQQT  249

Query  1340  KETLSKAGQAAKDYTVQAKDYASQKAG  1420
             K+       AA +   QAKD   QKAG
Sbjct  250   KD-------AAAEKARQAKDVTQQKAG  269


 Score = 55.1 bits (131),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 53/151 (35%), Positives = 73/151 (48%), Gaps = 18/151 (12%)
 Frame = +2

Query  935   DTALQKTQQAYNAA-------KDTTISKTQQAKDTFSS-TGQTA----------KDYTTQ  1060
             DTA  K+ QA +A        KD T  K +++ D+ +  T +TA          KDYT +
Sbjct  141   DTAADKSYQAADATGNKLGEFKDYTAEKAKESNDSVAHKTSETAEATRNKLGEAKDYTVE  200

Query  1061  SAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTA  1240
              A + KDT++       + T     + KD L+   Q AKD T+Q AQQTKD  +   + A
Sbjct  201   KATEAKDTVAQKTSETAEATKNKLGEYKDALAGKTQEAKDTTMQKAQQTKDAAAEKARQA  260

Query  1241  KDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQ  1333
             KD T Q A    D   G  Q A+D T+ T Q
Sbjct  261   KDVTQQKAGVYTDATKGTAQEARDRTMATTQ  291



>ref|XP_010432160.1| PREDICTED: embryonic protein DC-8 isoform X1 [Camelina sativa]
Length=484

 Score = 57.8 bits (138),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 85/288 (30%), Positives = 116/288 (40%), Gaps = 44/288 (15%)
 Frame = +2

Query  773   LSLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQK  952
             ++  + G+ +  A  K+  A   A +K  KAK+   +          +KAG AKD   +K
Sbjct  145   MAYNKAGQAKDMAFDKAGQAKDMAYDKAGKAKDIAYDKAGQAKDMAYDKAGQAKDKVYEK  204

Query  953   TQQAYNAA---KDTTISKTQQAKD--------TFSSTGQTAKDYTTQSAKQTKDT-LSSA  1096
                AY+ A   KD    KT  AKD         +   GQ  KD     A Q KD     A
Sbjct  205   AGSAYDIAGQAKDRAYDKTGHAKDKAYDTAGSAYEMAGQV-KDMAYDKAGQVKDMAYDKA  263

Query  1097  GQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAK  1276
             GQ AKD     A + KD +     +A     + A Q KD        AKD T   A QAK
Sbjct  264   GQ-AKDMAYDKASEAKDKIYDTAGSA----YEMAGQAKDMAYDKASKAKDMTYDKAAQAK  318

Query  1277  DTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKA-------------  1417
             D  +   ++    T   A+QAK+      + A +   QAKD+A  KA             
Sbjct  319   DMTTDKARS----TYDKAEQAKDMAYDKARLASEKAGQAKDFAYDKASHVKDVAYDKAED  374

Query  1418  ---------GEAGNKASEAKERGTEMSKNAASYAGQKVTEAKDVTVES  1534
                       EA + A E+ ER  E SKNA   A  K  + +D T ++
Sbjct  375   VIRMATDKSNEAKDNADESYERFKEGSKNAKDMASDKAQDVRDKTADA  422


 Score = 57.0 bits (136),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 79/246 (32%), Positives = 103/246 (42%), Gaps = 30/246 (12%)
 Frame = +2

Query  881   ENVQSGSQYLVEKAGAAKDTALQKT----QQAYNA---AKDTTISKTQQAKDTFSSTGQT  1039
             ++ Q+   Y  +KAG AKD A  KT      AYN    AKD    K  QAKD        
Sbjct  115   DSAQNAKHYAYDKAGDAKDMAYNKTGEANDMAYNKAGQAKDMAFDKAGQAKDMAYDKAGK  174

Query  1040  AKDYTTQSAKQTKDT-LSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDT  1216
             AKD     A Q KD     AGQ AKD   + A    D    A   A D T  +  +  DT
Sbjct  175   AKDIAYDKAGQAKDMAYDKAGQ-AKDKVYEKAGSAYDIAGQAKDRAYDKTGHAKDKAYDT  233

Query  1217  LSSAGQTA---KDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTV  1387
               SA + A   KD     A Q KD        AKD     A +AK+ +     +A +   
Sbjct  234   AGSAYEMAGQVKDMAYDKAGQVKDMAYDKAGQAKDMAYDKASEAKDKIYDTAGSAYEMAG  293

Query  1388  QAKDYASQKAGEAG----NKASEAK--------------ERGTEMSKNAASYAGQKVTEA  1513
             QAKD A  KA +A     +KA++AK              E+  +M+ + A  A +K  +A
Sbjct  294   QAKDMAYDKASKAKDMTYDKAAQAKDMTTDKARSTYDKAEQAKDMAYDKARLASEKAGQA  353

Query  1514  KDVTVE  1531
             KD   +
Sbjct  354   KDFAYD  359


 Score = 55.5 bits (132),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 88/280 (31%), Positives = 118/280 (42%), Gaps = 35/280 (13%)
 Frame = +2

Query  773   LSLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQK  952
              + ++ G  +  A  K+ +A   A NK  +AK+   +          +KAG AKD A  K
Sbjct  123   YAYDKAGDAKDMAYNKTGEANDMAYNKAGQAKDMAFDKAGQAKDMAYDKAGKAKDIAYDK  182

Query  953   TQQAYNAAKDTTISKTQQAKD--------TFSSTGQT---AKDYTTQSAKQTKDTLSSAG  1099
               QA    KD    K  QAKD         +   GQ    A D T  +  +  DT  SA 
Sbjct  183   AGQA----KDMAYDKAGQAKDKVYEKAGSAYDIAGQAKDRAYDKTGHAKDKAYDTAGSAY  238

Query  1100  QTA---KDYTVQSAQQTKDT-LSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQ  1267
             + A   KD     A Q KD     AGQ AKD     A + KD +     +A     + A 
Sbjct  239   EMAGQVKDMAYDKAGQVKDMAYDKAGQ-AKDMAYDKASEAKDKIYDTAGSA----YEMAG  293

Query  1268  QAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKD-------YASQKAGEA  1426
             QAKD        AKD T   A QAK+  +   ++  D   QAKD        AS+KAG+A
Sbjct  294   QAKDMAYDKASKAKDMTYDKAAQAKDMTTDKARSTYDKAEQAKDMAYDKARLASEKAGQA  353

Query  1427  GN----KASEAKERGTEMSKNAASYAGQKVTEAKDVTVES  1534
              +    KAS  K+   + +++    A  K  EAKD   ES
Sbjct  354   KDFAYDKASHVKDVAYDKAEDVIRMATDKSNEAKDNADES  393



>ref|XP_010446772.1| PREDICTED: embryonic protein DC-8-like isoform X1 [Camelina sativa]
Length=491

 Score = 57.4 bits (137),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 89/283 (31%), Positives = 121/283 (43%), Gaps = 34/283 (12%)
 Frame = +2

Query  773   LSLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQK  952
              + ++ G  +  A  K+ +A   A NK  +AK+   +          +KAG AKD A  K
Sbjct  123   YAYDKAGDAKDMAYNKTGEANDMAYNKAGQAKDMAFDKAGQAKDMAYDKAGQAKDIAYDK  182

Query  953   TQQAYNAA---KDTTISKTQQAKD--------TFSSTGQT---AKDYTTQSAKQTKDTLS  1090
                AY+ A   KD    K  QAKD         +  +GQ    A D T  +  +  DT  
Sbjct  183   VGSAYDKAGQAKDMAYDKAGQAKDKVYEKAGSAYDISGQAKDRAYDKTGHAKDKAYDTAG  242

Query  1091  SAGQTA---KDYTVQSAQQTKDT-LSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQ  1258
             SA + A   KD     A Q KD     AGQ AKD     A + KD +     +A     +
Sbjct  243   SAYEMAGQAKDMAYDKAGQVKDMAYDKAGQ-AKDMAYDKASEAKDKIYDTAGSA----YE  297

Query  1259  SAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKD-------YASQKA  1417
              A QAKD        AKD T   A QAK+  +   ++  D   QAKD        AS+KA
Sbjct  298   MAGQAKDMAYDKASKAKDMTYDKAAQAKDMTTDKARSTYDKAEQAKDMAYDKARLASEKA  357

Query  1418  GEAGN----KASEAKERGTEMSKNAASYAGQKVTEAKDVTVES  1534
             G+A +    KAS  K+   + +++    A  K  EAKD   ES
Sbjct  358   GQAKDFAYDKASHVKDVAYDKAEDVIRMATDKSNEAKDNADES  400



>emb|CBI30214.3| unnamed protein product [Vitis vinifera]
Length=341

 Score = 56.6 bits (135),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 65/211 (31%), Positives = 96/211 (45%), Gaps = 35/211 (17%)
 Frame = +2

Query  833   LQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKTQQA--YNA-----AKDTTI  991
             L+  Q  YE AK    E     SQ  VEK     + A +K +++  Y A     AKD+  
Sbjct  55    LRAVQETYEHAK----EAATGKSQEAVEKTRETAEEAKEKMRESKDYTADKSKEAKDSAA  110

Query  992   SKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDT-LSSAGQ  1168
              K ++ KDT +      K+   + AK+TKD ++      KDY  + A+  KDT L   G+
Sbjct  111   EKARETKDTGAEKTVEHKNSAAEKAKETKDAVAGQAGEYKDYAAEKARGVKDTTLGKTGE  170

Query  1169  TAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDT----------------------  1282
               KDY  + A++TKD         KDYT   A++ KDT                      
Sbjct  171   Y-KDYAAEKAKETKDATVQKAAEYKDYTAGKAEEGKDTSVGKITELKDSAADAARRAMEY  229

Query  1283  LSGAGQTAKDYTVQTAQQAKETLSKAGQAAK  1375
             L+G  +  K  T +TA+ AKE L++  +AA+
Sbjct  230   LTGKKEETKHKTSETAEAAKERLTETEEAAR  260



>ref|XP_007149753.1| hypothetical protein PHAVU_005G096300g [Phaseolus vulgaris]
 gb|ESW21747.1| hypothetical protein PHAVU_005G096300g [Phaseolus vulgaris]
Length=528

 Score = 57.4 bits (137),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 61/202 (30%), Positives = 88/202 (44%), Gaps = 36/202 (18%)
 Frame = +2

Query  944   LQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTA---KDYTTQSAKQ----TKDTLSSAGQ  1102
             L  T  A N  K       Q A +T +ST Q A   KD   +  +Q    TKDT+SSA +
Sbjct  212   LTNTDNACNDLKKRYERTKQAASETLNSTAQIATQAKDAAVERGQQGYAVTKDTISSAAK  271

Query  1103  TAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDT  1282
             TA + T   A++TK            YT+Q A++ K    SAG T   Y  + A QAKD 
Sbjct  272   TASEKTAPVAEKTKG-----------YTLQVAEKAK----SAGGTTASYVGEKAGQAKDV  316

Query  1283  LSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGNKASEAKERGT  1462
                 G++A  Y  + A   K+  +  G  A +++ +              K  E  +   
Sbjct  317   AVEGGKSAAGYASKVAADLKDRATVVGWTAANFSTE--------------KTVEGTKIAA  362

Query  1463  EMSKNAASYAGQKVTEAKDVTV  1528
              + + AA YAGQK  E   ++V
Sbjct  363   HLVEGAAGYAGQKAAELASMSV  384



>ref|XP_002528631.1| late embryogenesis abundant, putative [Ricinus communis]
 gb|EEF33734.1| late embryogenesis abundant, putative [Ricinus communis]
Length=406

 Score = 56.6 bits (135),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 67/230 (29%), Positives = 105/230 (46%), Gaps = 38/230 (17%)
 Frame = +2

Query  938   TALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTA-------KDYTTQSAKQTKD-----  1081
             + L+K    Y  AK+  + K+Q++ +    +  TA       KDYT++ AK+TKD     
Sbjct  56    SVLKKVADTYEHAKEAVVGKSQESAEKTKESAYTAAEQAGENKDYTSEKAKETKDAAARK  115

Query  1082  ---TLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYT  1252
                T  SA Q A +Y  ++ ++TKD         KD T + AQ T ++    G+  K+Y 
Sbjct  116   LDETKESAKQKAGEYADKT-KETKDATKEKLGEYKDRTAEKAQNTTESAKEKGEEYKNYA  174

Query  1253  VQSAQQAKDTLSGAGQTAKDYTVQ---------------TAQQAKE-------TLSKAGQ  1366
              + A++ KD  +   +  KDY+ +               TA++AKE        L +  +
Sbjct  175   AEKAKEMKDKTAEKAKETKDYSAEKANEAAEKAKEAKDYTAEKAKEGKDTATSRLGELTE  234

Query  1367  AAKDYTVQAKDYASQKAGEAGNKASEAKERGTEMSKNAASYAGQKVTEAK  1516
             +AK    +A D  S K  EA +K  E KE G E    A   A +K+ E K
Sbjct  235   SAKGAARRAMDLFSTKKEEAKDKTVETKEAGKEKLSEAEEEARRKMEELK  284



>ref|XP_011016011.1| PREDICTED: embryonic protein DC-8 [Populus euphratica]
Length=419

 Score = 56.6 bits (135),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 71/244 (29%), Positives = 114/244 (47%), Gaps = 23/244 (9%)
 Frame = +2

Query  788   IGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKTQQAY  967
             +GK  + A+Q + +    A+ K  + K++  E  +    Y  +KA    D+A  K  +  
Sbjct  71    VGKSFEAAEQ-TRETADAAEEKARENKDSVAEKAKGYKYYTTQKAKETTDSAASKINETK  129

Query  968   NAAKDTTISKTQQAKDT---FSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQ  1138
              +AK+      + AK     +    +  KDY  Q AK TKD++       KDY  + A++
Sbjct  130   ESAKEKVEKTKESAKQKIGEYEDKAKEYKDYAAQKAKDTKDSVMGKVDEYKDYASEKAKE  189

Query  1139  TKDT-LSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQ-----------SAQQAKDT  1282
             TK++ L   G+  KDY  + +++TKD  +   +  KD TV            +A++A D 
Sbjct  190   TKNSALEKTGEY-KDYAAEKSKETKDYTAEKAKEGKDVTVSKLGGLTESAKDAARKAVDF  248

Query  1283  LSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGNKASEAK----  1450
             LSG  +  K+   +T +  KE LS+  + A+  T   K  A +   EA  K  EAK    
Sbjct  249   LSGKKEEVKEKAAETTEATKEKLSETEEVARRKTEGMKLRAEEHREEAAQK--EAKDIEA  306

Query  1451  ERGT  1462
             ERGT
Sbjct  307   ERGT  310



>gb|EYU38595.1| hypothetical protein MIMGU_mgv1a021925mg [Erythranthe guttata]
Length=504

 Score = 56.6 bits (135),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 63/200 (32%), Positives = 99/200 (50%), Gaps = 41/200 (21%)
 Frame = +2

Query  788   IGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKTQQAY  967
             +G+Y+  A +K+ +       K ++AK+TT     +G      K G  +D A +KT++  
Sbjct  138   VGEYKGYAAEKTKETADATAEKAKQAKDTT-----AG------KMGEYRDYAAEKTKET-  185

Query  968   NAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKD------------TLSSAGQTAK  1111
                 D T  K +QAKDT +      +DY  +  K+T D            T +  G+  +
Sbjct  186   ---ADATAEKAKQAKDTTAGKMGEYRDYAAEKTKETADAAAEKAKQAKDTTAAKMGEY-R  241

Query  1112  DYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKD-TLS  1288
             DYT + A++T           KDY  Q A++TKD      + AKD TVQ + +AKD T+ 
Sbjct  242   DYTAEKAKET-----------KDYAAQKAKETKDATVEKAKQAKDTTVQKSAEAKDATME  290

Query  1289  GAGQTAKDYTVQTAQQAKET  1348
              AG+  KDYT + A++ K+T
Sbjct  291   KAGEY-KDYTAEKAKEGKDT  309


 Score = 55.5 bits (132),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 67/212 (32%), Positives = 100/212 (47%), Gaps = 49/212 (23%)
 Frame = +2

Query  866   KNTTKENVQSGSQYLVEKAGAAKDTALQKTQQA---------YNAAK-----DTTISKTQ  1003
             K++T +       Y   KA   KD+A +K +QA         Y A K     D T  K +
Sbjct  102   KDSTAKKAAEYKDYTAGKAVETKDSAAEKAKQAAGKVGEYKGYAAEKTKETADATAEKAK  161

Query  1004  QAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKD--------YTVQSAQQTKDTLSS  1159
             QAKDT +      +DY  +  K+T D  +   + AKD        Y   +A++TK+T  +
Sbjct  162   QAKDTTAGKMGEYRDYAAEKTKETADATAEKAKQAKDTTAGKMGEYRDYAAEKTKETADA  221

Query  1160  AGQTA--------------KDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAG  1297
             A + A              +DYT + A++TKD  +   +  KD TV+ A+QAKDT     
Sbjct  222   AAEKAKQAKDTTAAKMGEYRDYTAEKAKETKDYAAQKAKETKDATVEKAKQAKDT-----  276

Query  1298  QTAKDYTVQTAQQAKE-TLSKAGQAAKDYTVQ  1390
                   TVQ + +AK+ T+ KAG+  KDYT +
Sbjct  277   ------TVQKSAEAKDATMEKAGE-YKDYTAE  301


 Score = 55.5 bits (132),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 67/205 (33%), Positives = 104/205 (51%), Gaps = 20/205 (10%)
 Frame = +2

Query  788   IGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKTQQ--  961
             +G+YR  A +K+ +       K ++AK+TT     +G      K G  +D A +KT++  
Sbjct  171   MGEYRDYAAEKTKETADATAEKAKQAKDTT-----AG------KMGEYRDYAAEKTKETA  219

Query  962   -----AYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQ  1126
                      AKDTT +K  + +D  +   +  KDY  Q AK+TKD      + AKD TVQ
Sbjct  220   DAAAEKAKQAKDTTAAKMGEYRDYTAEKAKETKDYAAQKAKETKDATVEKAKQAKDTTVQ  279

Query  1127  SAQQTKD-TLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQT  1303
              + + KD T+  AG+  KDYT + A++ KDT        KD    +A++A   L+G  + 
Sbjct  280   KSAEAKDATMEKAGEY-KDYTAEKAKEGKDTTVGKMTELKDSAADAARRAMGYLTGKKEE  338

Query  1304  AKDYTVQTAQQAKETLSKAGQAAKD  1378
              K   V+T + AKE   +  +AAK+
Sbjct  339   TKQTAVETGEAAKEKAGETAEAAKE  363



>gb|KHJ90756.1| late embryogeneis abundant protein [Oesophagostomum dentatum]
Length=250

 Score = 55.1 bits (131),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 60/166 (36%), Positives = 78/166 (47%), Gaps = 21/166 (13%)
 Frame = +2

Query  977   KDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLS  1156
             KD   +K  QAKD  S   Q AKD  ++  +Q KD  S   +  KD   +  QQ KD  S
Sbjct  87    KDAAANKLHQAKDAASEKYQEAKDAASERYQQGKDKASQTYEHGKDAASEKYQQAKDAAS  146

Query  1157  SAGQTAKDYTVQSAQQT---KDTLSSAGQTAKDYTVQSAQQAKDTLS-----GAGQT--A  1306
                    D   Q A++    +DT+S   +  K+   Q  QQAKDT S     GA +   A
Sbjct  147   -------DKLHQGAEKVREARDTMSEKYEQGKNAASQKYQQAKDTASEKLHQGAEKVREA  199

Query  1307  KDYTVQTAQQAKETLSKAGQAAKDYTV----QAKDYASQKAGEAGN  1432
             +D   +  QQ K+T S A +  KDY      QAKDYAS+    A N
Sbjct  200   RDTVSEKYQQGKQTASDAYERGKDYAKEKLDQAKDYASENLHHAAN  245



>ref|XP_003593602.1| Late embryogenesis abundant protein [Medicago truncatula]
 gb|AES63853.1| late embryogenesis abundant domain protein, putative [Medicago 
truncatula]
Length=348

 Score = 56.2 bits (134),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 63/238 (26%), Positives = 110/238 (46%), Gaps = 41/238 (17%)
 Frame = +2

Query  770   GLSLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQ  949
             G+  E+I +Y + A +   D  Q A++  EK K+       +GS +  EKA    D A +
Sbjct  83    GVDSEDIKQYSRDANE---DIKQFARDTNEKTKDA------AGSMW--EKAKEGTDRAAE  131

Query  950   KTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQS  1129
             K + A                      G+ A+DY  +   +T +   S    A++ T ++
Sbjct  132   KAENA----------------------GEKARDYAYEVKDRTNEAAGSVWDKAREGTNRA  169

Query  1130  AQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAK  1309
             A++ ++    AG+ A+DY   + ++TKD   +AG++ +DY   +  + K+    AG+ A+
Sbjct  170   AEKAEN----AGEKARDYAYDAKERTKDAAENAGESIRDYAYDAKDRTKEAAESAGEKAR  225

Query  1310  DYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGNKASEAKERGTEMSKNAA  1483
             DY    A  AKE   +      D T +  +  ++K GE    A+EA +   EM+K  A
Sbjct  226   DY----AYDAKERTKEGASYMADKTKEGAEKTAEKTGEVAGSATEALKSAGEMAKKTA  279


 Score = 55.5 bits (132),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 47/163 (29%), Positives = 84/163 (52%), Gaps = 8/163 (5%)
 Frame = +2

Query  1043  KDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLS  1222
             K +   + ++TKD   S  + AK+ T ++A++ ++    AG+ A+DY  +   +T +   
Sbjct  101   KQFARDTNEKTKDAAGSMWEKAKEGTDRAAEKAEN----AGEKARDYAYEVKDRTNEAAG  156

Query  1223  SAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDY  1402
             S    A++ T ++A++A++    AG+ A+DY     ++ K+    AG++ +DY   AKD 
Sbjct  157   SVWDKAREGTNRAAEKAEN----AGEKARDYAYDAKERTKDAAENAGESIRDYAYDAKDR  212

Query  1403  ASQKAGEAGNKASEAKERGTEMSKNAASYAGQKVTEAKDVTVE  1531
               + A  AG KA +      E +K  ASY   K  E  + T E
Sbjct  213   TKEAAESAGEKARDYAYDAKERTKEGASYMADKTKEGAEKTAE  255


 Score = 53.5 bits (127),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 57/203 (28%), Positives = 102/203 (50%), Gaps = 15/203 (7%)
 Frame = +2

Query  758   RDHSGLSLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKE-----NVQSGSQYLVEKA  922
             RD +  + +  G   + A++ +  A + A+N  EKA++   E     N  +GS  + +KA
Sbjct  105   RDTNEKTKDAAGSMWEKAKEGTDRAAEKAENAGEKARDYAYEVKDRTNEAAGS--VWDKA  162

Query  923   GAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQ  1102
                 + A +K + A   A+D      ++ KD   + G++ +DY   +  +TK+   SAG+
Sbjct  163   REGTNRAAEKAENAGEKARDYAYDAKERTKDAAENAGESIRDYAYDAKDRTKEAAESAGE  222

Query  1103  TAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDT  1282
              A+DY   + ++TK+  S      K+   ++A++T +   SA +  K     + + AK T
Sbjct  223   KARDYAYDAKERTKEGASYMADKTKEGAEKTAEKTGEVAGSATEALK----SAGEMAKKT  278

Query  1283  LSGAGQTAKDYTVQTAQQAKETL  1351
               GA +TAKD T    Q+ KET+
Sbjct  279   AQGAWETAKDAT----QKIKETV  297



>ref|XP_006366996.1| PREDICTED: embryonic protein DC-8-like [Solanum tuberosum]
Length=426

 Score = 56.2 bits (134),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 70/233 (30%), Positives = 95/233 (41%), Gaps = 22/233 (9%)
 Frame = +2

Query  758   RDHSGLSLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNT-------TKENVQSGSQYLVE  916
             R H   + +     ++ A+ K+ +A   A  K +   NT        K+       +  +
Sbjct  110   RVHYAYAYDMAANAKEGAKHKASEAYDFAAKKVDDGMNTASQVGREVKDKANHAYDFATD  169

Query  917   KAGAAKDTALQKTQQAYNAAKDT---TISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTL  1087
             KAG A D A     +A + AKD    T  KT QAKD  SS+   AKD     A + KD+ 
Sbjct  170   KAGQAMDKASDMVGEAKDRAKDAYRYTSDKTNQAKDMASSSAANAKDTVEDKASEAKDSA  229

Query  1088  SSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQ  1267
             + A +    Y      Q KD  SS+   AKD     A + KD           YT     
Sbjct  230   NDAYR----YISDKLNQAKDMASSSAVNAKDIVEDKASEAKDAYR--------YTSDKMN  277

Query  1268  QAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGEA  1426
             QAKD  S +   AKD     + +AK+    A +   D   QAKD AS  A  A
Sbjct  278   QAKDMASSSAANAKDTVEDKSSEAKDRAKDAYRYTSDKLNQAKDMASSSAVNA  330


 Score = 54.3 bits (129),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 77/240 (32%), Positives = 99/240 (41%), Gaps = 36/240 (15%)
 Frame = +2

Query  869   NTTKENVQSGSQYLVEKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKD  1048
             N  KE V     Y  + A  AK+ A  K  +AY    D    K     +T S  G+  KD
Sbjct  105   NKAKERVHYA--YAYDMAANAKEGAKHKASEAY----DFAAKKVDDGMNTASQVGREVKD  158

Query  1049  -------YTTQSAKQTKDTLSSAGQTAKD-------YTVQSAQQTKDTLSSAGQTAKDYT  1186
                    + T  A Q  D  S     AKD       YT     Q KD  SS+   AKD  
Sbjct  159   KANHAYDFATDKAGQAMDKASDMVGEAKDRAKDAYRYTSDKTNQAKDMASSSAANAKDTV  218

Query  1187  VQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQ  1366
                A + KD+ + A +    Y      QAKD  S +   AKD     A +AK+    A +
Sbjct  219   EDKASEAKDSANDAYR----YISDKLNQAKDMASSSAVNAKDIVEDKASEAKD----AYR  270

Query  1367  AAKDYTVQAKDYASQKAGEAGN----KASEAKERGTEMSKNAASYAGQKVTEAKDVTVES  1534
                D   QAKD AS  A  A +    K+SEAK+R     K+A  Y   K+ +AKD+   S
Sbjct  271   YTSDKMNQAKDMASSSAANAKDTVEDKSSEAKDRA----KDAYRYTSDKLNQAKDMASSS  326



>ref|XP_010437329.1| PREDICTED: embryonic protein DC-8 [Camelina sativa]
Length=419

 Score = 56.2 bits (134),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 82/249 (33%), Positives = 105/249 (42%), Gaps = 38/249 (15%)
 Frame = +2

Query  881   ENVQSGSQYLVEKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDT-FSSTGQTAKDYTT  1057
             ++ Q+   Y  +KAG AKD A  KT +A    KD   +K  Q KD  F + GQ AKD   
Sbjct  116   DSAQNAKHYAYDKAGDAKDMAYNKTGEA----KDMAYNKAGQTKDMAFDNAGQ-AKDMVY  170

Query  1058  QSAKQTKDT--------LSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKD  1213
                 Q KD            AGQ AKD     A Q KD +     +A D   Q+  +  D
Sbjct  171   DKPGQAKDIAYDKVGSAYDKAGQ-AKDMAYDKAGQAKDKVFEKAGSAYDIAGQAKDRAYD  229

Query  1214  TLSSAGQTAKDYTVQSAQ----QAKDTLSGAGQTAKDYT-------VQTAQQAKETLSKA  1360
                 A   A D T +SA     QAKD        AKD T          A+QAK+     
Sbjct  230   KTGHAKDKAYD-TAESAYEMAGQAKDMAYDKASKAKDMTTDKARSTYDKAEQAKDMAYDK  288

Query  1361  GQAAKDYTVQAKDYASQKA-----------GEAGNKASEAKERGTEMSKNAASYAGQKVT  1507
              + A +   QAKD A  KA           GEA + A E+ ER  E SKNA   A  K  
Sbjct  289   ARLASEKAGQAKDVAYDKAEDAIRMATDKSGEAKDNADESYERFKEGSKNAKDMASDKAQ  348

Query  1508  EAKDVTVES  1534
             + ++ T ++
Sbjct  349   DVRNKTADA  357


 Score = 54.3 bits (129),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 75/230 (33%), Positives = 104/230 (45%), Gaps = 17/230 (7%)
 Frame = +2

Query  854   YEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKTQQAYNAA---KDTTISKTQQAKDT-F  1021
             Y+KA++           +  ++AG+A D+A      AY+ A   KD   +KT +AKD  +
Sbjct  89    YDKAESAYDNAAGYAKDFAADRAGSAYDSAQNAKHYAYDKAGDAKDMAYNKTGEAKDMAY  148

Query  1022  SSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQ  1201
             +  GQT KD    +A Q KD +      AKD          D    AGQ AKD     A 
Sbjct  149   NKAGQT-KDMAFDNAGQAKDMVYDKPGQAKDIAYDKVGSAYDK---AGQ-AKDMAYDKAG  203

Query  1202  QTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDY  1381
             Q KD +     +A D     A QAKD        AKD    TA+ A E   +A   A D 
Sbjct  204   QAKDKVFEKAGSAYD----IAGQAKDRAYDKTGHAKDKAYDTAESAYEMAGQAKDMAYDK  259

Query  1382  TVQAKDYASQKAGEAGNKASEAKERGTEMSKNAASYAGQKVTEAKDVTVE  1531
               +AKD  + KA    +KA +AK    +M+ + A  A +K  +AKDV  +
Sbjct  260   ASKAKDMTTDKARSTYDKAEQAK----DMAYDKARLASEKAGQAKDVAYD  305



>ref|XP_006852474.1| hypothetical protein AMTR_s00021p00128760 [Amborella trichopoda]
 gb|ERN13941.1| hypothetical protein AMTR_s00021p00128760 [Amborella trichopoda]
Length=292

 Score = 55.5 bits (132),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 63/211 (30%), Positives = 98/211 (46%), Gaps = 38/211 (18%)
 Frame = +2

Query  776   SLEEIGKYRQTAQQKSIDALQTAQNKYEKAKN---TTKENVQSGSQYLVEKAGAAKDTAL  946
             S++E+ +YRQ  +Q S++A+  A+  Y KAK    +TK   Q+ + +       A  +AL
Sbjct  26    SVDELRRYRQAMRQNSMEAIMAAEAHYAKAKYHAASTKSEAQNTASH-------AGGSAL  78

Query  947   QKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLS----SAGQTAKD  1114
             Q         KD  ++       T    G++A +Y  Q A + +D  +    +AG+  K 
Sbjct  79    QYA----VVVKDKAMALGADVGATAVDKGRSAGEYVGQKACEARDRAADVGMAAGRCVKG  134

Query  1115  YTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQ------QAK  1276
             Y    AQ+  D    AG+  KDY V             G  AK+  V+ A+      +AK
Sbjct  135   Y---GAQKAGDAKEYAGKV-KDYVV----------GIVGGAAKELAVEEAKECAKDGEAK  180

Query  1277  DTLSGAGQTAKDYTVQTAQQAKETLSKAGQA  1369
             DT   A ++   YT Q A QAKET+++  QA
Sbjct  181   DTARSAQESVTGYTRQRASQAKETVAERAQA  211



>gb|KFK33525.1| hypothetical protein AALP_AA5G024300 [Arabis alpina]
Length=190

 Score = 53.9 bits (128),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 40/139 (29%), Positives = 67/139 (48%), Gaps = 22/139 (16%)
 Frame = +2

Query  1112  DYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSG  1291
             D + ++++  KDT S  G      + Q  Q  KD +    + A++Y V+ A +A D+++ 
Sbjct  70    DASERASKYVKDTGSEVGHV----SAQKGQDLKDQM----ERARNYIVEKASEALDSVAE  121

Query  1292  AGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGNKASEAKERGTEMS  1471
                 A D+ V+ +++  E      + AKD+ V+              KA EAK+  T++S
Sbjct  122   NAHKASDFMVEKSKETTEEAISMTEKAKDFIVE--------------KAGEAKDNATDLS  167

Query  1472  KNAASYAGQKVTEAKDVTV  1528
             K  A Y G K  EAKD  +
Sbjct  168   KRTAKYVGDKAAEAKDAML  186



>ref|XP_010446774.1| PREDICTED: embryonic protein DC-8-like isoform X3 [Camelina sativa]
Length=473

 Score = 56.2 bits (134),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 78/229 (34%), Positives = 100/229 (44%), Gaps = 36/229 (16%)
 Frame = +2

Query  881   ENVQSGSQYLVEKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDT-FSSTGQTAKDYTT  1057
             ++ Q+   Y  +KAG AKD A  KT +    A D   +K  QAKD  F   GQ AKD   
Sbjct  115   DSAQNAKHYAYDKAGDAKDMAYNKTGE----ANDMAYNKAGQAKDMAFDKAGQ-AKDMAY  169

Query  1058  QSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQT  1237
               A Q KD       +A D               AGQ AKD     A Q KD +     +
Sbjct  170   DKAGQAKDIAYDKVGSAYD--------------KAGQ-AKDMAYDKAGQAKDKVYEKAGS  214

Query  1238  AKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKA  1417
             A D + Q+  +A D        AKD    TA  A E   +A   A D   Q KD A  KA
Sbjct  215   AYDISGQAKDRAYDKTG----HAKDKAYDTAGSAYEMAGQAKDMAYDKAGQVKDMAYDKA  270

Query  1418  GEAG----NKASEAKER-------GTEMSKNAASYAGQKVTEAKDVTVE  1531
             G+A     +KASEAK++         EM+  A   A  K ++AKD+T +
Sbjct  271   GQAKDMAYDKASEAKDKIYDTAGSAYEMAGQAKDMAYDKASKAKDMTYD  319


 Score = 55.5 bits (132),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 91/271 (34%), Positives = 119/271 (44%), Gaps = 28/271 (10%)
 Frame = +2

Query  773   LSLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQK  952
              + ++ G  +  A  K+ +A   A NK  +AK+   +          +KAG AKD A  K
Sbjct  123   YAYDKAGDAKDMAYNKTGEANDMAYNKAGQAKDMAFDKAGQAKDMAYDKAGQAKDIAYDK  182

Query  953   TQQAYNAA---KDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTV  1123
                AY+ A   KD    K  QAKD       +A D + Q+  +  D    A   A D T 
Sbjct  183   VGSAYDKAGQAKDMAYDKAGQAKDKVYEKAGSAYDISGQAKDRAYDKTGHAKDKAYD-TA  241

Query  1124  QSAQQTKDTLSSAGQTAKDYTVQSAQQTKDT-LSSAGQTAKDYTVQSAQQAKDTLSG---  1291
              SA +       AGQ AKD     A Q KD     AGQ AKD     A +AKD +     
Sbjct  242   GSAYEM------AGQ-AKDMAYDKAGQVKDMAYDKAGQ-AKDMAYDKASEAKDKIYDTAG  293

Query  1292  -----AGQTAKDYTVQTAQQAKE-TLSKAGQAAKDYTVQAKDYASQKAGEAG----NKAS  1441
                  AGQ AKD     A +AK+ T  KA QA KD        AS+KAG+A     +KAS
Sbjct  294   SAYEMAGQ-AKDMAYDKASKAKDMTYDKAAQA-KDMAYDKARLASEKAGQAKDFAYDKAS  351

Query  1442  EAKERGTEMSKNAASYAGQKVTEAKDVTVES  1534
               K+   + +++    A  K  EAKD   ES
Sbjct  352   HVKDVAYDKAEDVIRMATDKSNEAKDNADES  382


 Score = 55.5 bits (132),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 90/283 (32%), Positives = 118/283 (42%), Gaps = 45/283 (16%)
 Frame = +2

Query  773   LSLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQY---------LVEKAG  925
             ++  + G+ +  A  K+  A   A +K  +AK+   + V  GS Y           +KAG
Sbjct  145   MAYNKAGQAKDMAFDKAGQAKDMAYDKAGQAKDIAYDKV--GSAYDKAGQAKDMAYDKAG  202

Query  926   AAKDTALQKTQQAYNA---AKDTTISKTQQAKD--------TFSSTGQTAKDYTTQSAKQ  1072
              AKD   +K   AY+    AKD    KT  AKD         +   GQ AKD     A Q
Sbjct  203   QAKDKVYEKAGSAYDISGQAKDRAYDKTGHAKDKAYDTAGSAYEMAGQ-AKDMAYDKAGQ  261

Query  1073  TKDT-LSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDY  1249
              KD     AGQ AKD     A + KD +     +A     + A Q KD        AKD 
Sbjct  262   VKDMAYDKAGQ-AKDMAYDKASEAKDKIYDTAGSA----YEMAGQAKDMAYDKASKAKDM  316

Query  1250  TVQSAQQAKDTLSG--------AGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYA  1405
             T   A QAKD            AGQ AKD+    A   K+    A   A+D    A D  
Sbjct  317   TYDKAAQAKDMAYDKARLASEKAGQ-AKDFAYDKASHVKDV---AYDKAEDVIRMATD--  370

Query  1406  SQKAGEAGNKASEAKERGTEMSKNAASYAGQKVTEAKDVTVES  1534
               K+ EA + A E+ ER  E SKNA   A  K  + +D T ++
Sbjct  371   --KSNEAKDNADESYERFKEGSKNAKDMASDKAQDVRDKTADA  411



>ref|XP_006374433.1| embryonic cell protein 63 [Populus trichocarpa]
 gb|ERP52230.1| embryonic cell protein 63 [Populus trichocarpa]
Length=408

 Score = 55.8 bits (133),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 56/195 (29%), Positives = 93/195 (48%), Gaps = 22/195 (11%)
 Frame = +2

Query  854   YEKAKNTTK------ENVQSGSQYLVEKAGAAKDTALQKTQQAYNAAK---DTTISKTQQ  1006
             +E A+ TT+      E  +     + EKA   K+   QK ++  ++A    D T    +Q
Sbjct  75    FEAAEQTTETADAAEEKARENKDSVAEKAKGYKNCTTQKAKETTDSAACKIDETKESAKQ  134

Query  1007  AKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDT-LSSAGQTAKDY  1183
                 +    +  KDY  Q AK TKD++       KDY  + A++TK++ L   G+  KDY
Sbjct  135   KIGEYEDKAKEYKDYAAQKAKDTKDSVMGKVDEYKDYATEKAKETKNSALEKTGEY-KDY  193

Query  1184  TVQSAQQTKDTLSSAGQTAKDYTV-----------QSAQQAKDTLSGAGQTAKDYTVQTA  1330
               + +++TKD  +   +  KD TV            +A++A D LSG  +  K+   +T 
Sbjct  194   AAEKSKETKDYTAEKAKEGKDVTVSKLGGLTESAKDAARKAVDFLSGKKEEVKEKAAETT  253

Query  1331  QQAKETLSKAGQAAK  1375
             +  KE LS+  +AA+
Sbjct  254   EATKEKLSETEEAAR  268



>ref|XP_002863597.1| late embryogenesis abundant domain-containing protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH39856.1| late embryogenesis abundant domain-containing protein [Arabidopsis 
lyrata subsp. lyrata]
Length=331

 Score = 55.5 bits (132),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 49/164 (30%), Positives = 80/164 (49%), Gaps = 11/164 (7%)
 Frame = +2

Query  1001  QQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKD  1180
             ++AKD  +   +  KDY    A+QTK  ++     A D   ++ ++ KD      +  KD
Sbjct  91    EEAKDKANDVKERTKDY----AEQTKGKVNERASRAADKAYETKEKAKDKAYDVKEKTKD  146

Query  1181  YTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKA  1360
             Y    A++TKD ++     A D   ++ ++AKD      + AKDY  +T  + KE  S+A
Sbjct  147   Y----AEETKDKVNEGASRAADKAYETKEKAKDKAYDVKEKAKDYAEETKDKVKEGASRA  202

Query  1361  GQAAKDYTVQAKDYASQ---KAGEAGNKASEAKERGTEMSKNAA  1483
                A D   + KDYA Q   K  E  N+A++  E   + +K+ A
Sbjct  203   ADKAYDVKEKTKDYAEQTKDKVNEGANRAADKAEETKDKAKDYA  246



>ref|XP_010446773.1| PREDICTED: embryonic protein DC-8-like isoform X2 [Camelina sativa]
Length=480

 Score = 55.8 bits (133),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 78/229 (34%), Positives = 100/229 (44%), Gaps = 36/229 (16%)
 Frame = +2

Query  881   ENVQSGSQYLVEKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDT-FSSTGQTAKDYTT  1057
             ++ Q+   Y  +KAG AKD A  KT +    A D   +K  QAKD  F   GQ AKD   
Sbjct  115   DSAQNAKHYAYDKAGDAKDMAYNKTGE----ANDMAYNKAGQAKDMAFDKAGQ-AKDMAY  169

Query  1058  QSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQT  1237
               A Q KD       +A D               AGQ AKD     A Q KD +     +
Sbjct  170   DKAGQAKDIAYDKVGSAYD--------------KAGQ-AKDMAYDKAGQAKDKVYEKAGS  214

Query  1238  AKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKA  1417
             A D + Q+  +A D        AKD    TA  A E   +A   A D   Q KD A  KA
Sbjct  215   AYDISGQAKDRAYDKTG----HAKDKAYDTAGSAYEMAGQAKDMAYDKAGQVKDMAYDKA  270

Query  1418  GEAG----NKASEAKER-------GTEMSKNAASYAGQKVTEAKDVTVE  1531
             G+A     +KASEAK++         EM+  A   A  K ++AKD+T +
Sbjct  271   GQAKDMAYDKASEAKDKIYDTAGSAYEMAGQAKDMAYDKASKAKDMTTD  319


 Score = 54.7 bits (130),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 88/276 (32%), Positives = 118/276 (43%), Gaps = 31/276 (11%)
 Frame = +2

Query  773   LSLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQK  952
              + ++ G  +  A  K+ +A   A NK  +AK+   +          +KAG AKD A  K
Sbjct  123   YAYDKAGDAKDMAYNKTGEANDMAYNKAGQAKDMAFDKAGQAKDMAYDKAGQAKDIAYDK  182

Query  953   TQQAYNAA---KDTTISKTQQAKD--------TFSSTGQT---AKDYTTQSAKQTKDTLS  1090
                AY+ A   KD    K  QAKD         +  +GQ    A D T  +  +  DT  
Sbjct  183   VGSAYDKAGQAKDMAYDKAGQAKDKVYEKAGSAYDISGQAKDRAYDKTGHAKDKAYDTAG  242

Query  1091  SAGQTA---KDYTVQSAQQTKDT-LSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQ  1258
             SA + A   KD     A Q KD     AGQ AKD     A + KD +     +A     +
Sbjct  243   SAYEMAGQAKDMAYDKAGQVKDMAYDKAGQ-AKDMAYDKASEAKDKIYDTAGSA----YE  297

Query  1259  SAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGN--  1432
              A QAKD        AKD    T  +A+ T  KA QA KD        AS+KAG+A +  
Sbjct  298   MAGQAKDMAYDKASKAKD---MTTDKARSTYDKAEQA-KDMAYDKARLASEKAGQAKDFA  353

Query  1433  --KASEAKERGTEMSKNAASYAGQKVTEAKDVTVES  1534
               KAS  K+   + +++    A  K  EAKD   ES
Sbjct  354   YDKASHVKDVAYDKAEDVIRMATDKSNEAKDNADES  389



>ref|NP_001049970.2| Os03g0322900 [Oryza sativa Japonica Group]
 dbj|BAF11884.2| Os03g0322900 [Oryza sativa Japonica Group]
Length=253

 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 55/172 (32%), Positives = 82/172 (48%), Gaps = 22/172 (13%)
 Frame = +2

Query  881   ENVQSGSQYLVEKAG----AAKDTALQKTQQAYNAA-------KDTTISKTQQAKDTFS-  1024
             E+VQ G++  V   G     A+DTA +KT Q  +A        KD T  K ++  D+ + 
Sbjct  73    ESVQEGAKSFVSAVGRTFGGARDTAAEKTSQTADATRDKLGEYKDYTADKARETNDSVAR  132

Query  1025  STGQTA----------KDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTA  1174
              T +TA          KDYT    ++TKD ++     A + T     + KD L+   + A
Sbjct  133   KTNETADASRDKLGEYKDYTADKTRETKDAVAQKASDASEATKNKLGEYKDALARKTRDA  192

Query  1175  KDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTA  1330
             KD T Q A + KD + +  Q  +D T  +A++AKD      QTA D   +TA
Sbjct  193   KDTTAQKATEFKDGVKATAQETRDATADTARKAKDATKDTTQTAADKARETA  244



>gb|ADR66512.1| unknown [Brassica napus]
Length=338

 Score = 55.1 bits (131),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 77/209 (37%), Positives = 93/209 (44%), Gaps = 38/209 (18%)
 Frame = +2

Query  860   KAKNTTKENV--QSGSQYLVEKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTG  1033
             +AKN  K     ++GS Y  +KAG AKD A  K  QA +   DT  S        +   G
Sbjct  8     RAKNMYKVGASDKTGSAY--DKAGQAKDLAYDKASQAKDMIYDTAGS-------AYDKAG  58

Query  1034  QTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKD  1213
             Q AKD     A Q KD +     +A D   Q+  +  D   SA           A Q KD
Sbjct  59    Q-AKDTAYDKADQAKDMVYDTAGSAYDKAGQAKMKAYDKAGSA--------YHKADQAKD  109

Query  1214  TLSSAGQTAKDYTVQSAQQAKDTLS--------GAGQTAKDYTVQTAQQAKETLSKAGQA  1369
              +S    +AKD     A QAKD ++         AGQ AKD     A QAKE   KAGQA
Sbjct  110   MVSDKTGSAKDMVYDKAGQAKDMVNKKAAQAEEKAGQ-AKDMVYDKAAQAKE---KAGQA  165

Query  1370  ------AKDYTVQAKDYASQKAGEAGNKA  1438
                   AKD   QAKD A  KAG+A + A
Sbjct  166   KDMAGQAKDKAGQAKDMAYDKAGQAKDMA  194



>emb|CDJ80107.1| Protein LEA-1, isoform k [Haemonchus contortus]
Length=1213

 Score = 55.8 bits (133),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 66/258 (26%), Positives = 110/258 (43%), Gaps = 47/258 (18%)
 Frame = +2

Query  860   KAKNTTKENVQSGSQYLVEKAGAAKDTALQKTQQAYNAAKDTTISK-TQQAKDTFSSTGQ  1036
             K + T++EN ++  +   E A   KDTA     +A   A+D + ++    AK+  SS G 
Sbjct  376   KDRMTSEENQEAIKEKFNEAAEGVKDTARAARSKAGELAEDLSDNEYVDSAKEKLSSAGS  435

Query  1037  TAKDYTTQSAKQTKDTLSSAGQTAKDY-------TVQSAQQTKDTLSSAGQTAKDYTVQS  1195
               +D   Q+     + LS A +  KD        T + A+  ++T+SSAG    D   Q+
Sbjct  436   QVRDMAGQARDMVGEKLSEAAEGVKDIPRKAWRKTEEFAEDARETISSAGSKVTDAAGQA  495

Query  1196  AQQTKDTLSSAGQTAKDYTVQSAQQ----------------AKDTLSGAGQTAKDYTVQT  1327
               +  + LS A +  KD   ++ ++                A++ LS AG   +D+  Q 
Sbjct  496   RSKVGEKLSEAAEGVKDMPRKARRKAEEFAEDLSDNEYVDTAREKLSSAGSQVRDFAGQA  555

Query  1328  AQQAKETLSKAGQAAKDYTVQAK----------------DYASQKAGEAGNKASEAKERG  1459
               +  E LS+A +  KD   +A+                D A +K   AGN+        
Sbjct  556   TDKVGEKLSEAAEGVKDMPRKARRKAEEFAEDLSDNEYVDSAKEKLNSAGNQVK------  609

Query  1460  TEMSKNAASYAGQKVTEA  1513
              +M+  A   AG+K+ EA
Sbjct  610   -DMAGQARDMAGEKLNEA  626



>ref|XP_010247790.1| PREDICTED: embryonic protein DC-8-like [Nelumbo nucifera]
Length=435

 Score = 55.1 bits (131),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 63/205 (31%), Positives = 97/205 (47%), Gaps = 36/205 (18%)
 Frame = +2

Query  905   YLVEKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKD-  1081
             Y+  KAG  +D A   T++A     DT     QQAKD         +DYT + A++TKD 
Sbjct  119   YVAGKAGETRDAAAGVTRKAV----DTAAGGAQQAKDKMGEF----RDYTAEKARETKDA  170

Query  1082  TLSSAGQTA-----------------KDYTVQSAQQTKD-TLSSAGQTAKDYTVQSAQQT  1207
             T+   G  A                 KDYT   A+Q KD T+   G+  +DYT + A++ 
Sbjct  171   TVDRTGDAADKARQGRDAAMNKMGEYKDYTADKAKQGKDATMEKMGEY-RDYTAEKAKEG  229

Query  1208  KDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAK----  1375
             KD+ + A    KD    + ++A   L+G    A      T + AK+ L +A +AA+    
Sbjct  230   KDSTTGAITNLKDTAAGATRRAMGFLTGRKDDANQQEADTEKTAKKKLGEAEEAARQKIE  289

Query  1376  DYTVQAKDYASQKAGEAGNKASEAK  1450
             D  ++ ++Y +    EA  KA+EA+
Sbjct  290   DLRLRGEEYKN----EAERKAAEAR  310



>ref|XP_010465544.1| PREDICTED: late embryogenesis abundant protein 76-like [Camelina 
sativa]
Length=255

 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 66/191 (35%), Positives = 95/191 (50%), Gaps = 15/191 (8%)
 Frame = +2

Query  917   KAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSA  1096
             +AG  +  A +KT QA    +D    K ++ +D   +T Q+AKD T+Q+A          
Sbjct  9     RAGETRGKAQEKTGQAMGTMRD----KAEEGRDKTQATAQSAKDKTSQTA----------  54

Query  1097  GQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAK  1276
              QTA+    ++AQ  KD  S   QTA+    ++AQ  KD  S   QTA+     +AQ AK
Sbjct  55    -QTAQQKAHETAQAAKDKSSQTAQTAQQKAHETAQAAKDKSSQTAQTAQQKAHDTAQAAK  113

Query  1277  DTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGNKASEAKER  1456
             D  S   QTA+     TAQ AKE  S+AG  A++   +   Y S+      NKA +A + 
Sbjct  114   DKSSQTAQTAQQKAHDTAQAAKEKTSQAGDKAREAKDKTGSYMSETGEAIKNKAQDAAQY  173

Query  1457  GTEMSKNAASY  1489
               E ++ AA Y
Sbjct  174   TKETAQGAAQY  184



>ref|XP_010439531.1| PREDICTED: uncharacterized protein ECU03_1610-like [Camelina 
sativa]
Length=270

 Score = 54.3 bits (129),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 65/130 (50%), Gaps = 0/130 (0%)
 Frame = +2

Query  1076  KDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTV  1255
             +D L  A  +  D    S +  +DT  +  Q AKD   + A +  D      + AKD   
Sbjct  49    RDPLDGARDSRADSAYGSKKWREDTGENYAQAAKDKANEGASKAADKAYETKEQAKDKAY  108

Query  1256  QSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGNK  1435
             ++ +QAKDT   A +TAKDY  +T  +  E  SKA   A+D   +AKDYA     +A  K
Sbjct  109   ETKEQAKDTAYNAKETAKDYAERTKDKVNEGASKAADKAEDTKERAKDYAEDTMDDAKAK  168

Query  1436  ASEAKERGTE  1465
             A +AKE+  E
Sbjct  169   ARDAKEKVKE  178



>ref|XP_004303052.1| PREDICTED: embryonic protein DC-8-like [Fragaria vesca subsp. 
vesca]
Length=520

 Score = 55.1 bits (131),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 86/263 (33%), Positives = 120/263 (46%), Gaps = 49/263 (19%)
 Frame = +2

Query  818   KSIDALQTAQNKYE----KAKNTTK---ENVQSGSQYLVEKAGAAKDTALQKTQQAYNAA  976
             KS DA   A+ + E    KAK TT    E +    + + + A  A D A +KT     A 
Sbjct  83    KSHDASDAARERSEYTTLKAKETTDAPGEKLDEYKEAVAQPAKEAADRAAKKTM----AM  138

Query  977   KDTTISKTQQAKDTFSSTGQTAKD-------YTTQSAKQTKDTLSSAGQTAKDYTV----  1123
             KDTT  K ++  D    T ++AK        YT Q A + KD  +   +  KDY      
Sbjct  139   KDTTAQKAKETADKARETKESAKGNVNEYAGYTAQKATEAKDAAAEKAKQTKDYVADTAN  198

Query  1124  ---QSAQQTKDT-LSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSG  1291
                + A++TKD  +  AG+   DYT Q AQ+ KDT     +   +Y    A++ KDT  G
Sbjct  199   EAAEKAKETKDAAMRKAGEYT-DYTAQKAQEAKDTTVGKAKEYTNYAADKAKEGKDTTVG  257

Query  1292  AGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGNKASEAKERGTEMS  1471
                 A +YT   A++AKE        AKD TV       +KA EA +  +E  +   E +
Sbjct  258   ---KASEYTNYAAEKAKE--------AKDTTV-------EKAKEAKDTTAEKTKETAEAA  299

Query  1472  KN----AASYAGQKVTEAKDVTV  1528
             KN    AA Y  +K  E KD T+
Sbjct  300   KNKTNDAAEYTAEKAKEGKDTTM  322


 Score = 53.5 bits (127),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 71/219 (32%), Positives = 108/219 (49%), Gaps = 33/219 (15%)
 Frame = +2

Query  929   AKDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDY---TTQSAKQTKDTLSSAG  1099
             AKD  + K+  A +AA++ +   T +AK+T  + G+   +Y     Q AK+  D  +   
Sbjct  76    AKDAVVGKSHDASDAARERSEYTTLKAKETTDAPGEKLDEYKEAVAQPAKEAADRAAKKT  135

Query  1100  QTAKDYTVQSAQQTKDTLSSAGQTAKD----------YTVQSAQQTKDTLSSAGQTAKDY  1249
                KD T   AQ+ K+T   A +T +           YT Q A + KD  +   +  KDY
Sbjct  136   MAMKDTT---AQKAKETADKARETKESAKGNVNEYAGYTAQKATEAKDAAAEKAKQTKDY  192

Query  1250  TV----QSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTV-QAKDYASQK  1414
                   ++A++AK+T   A + A +YT  TAQ+A+E        AKD TV +AK+Y +  
Sbjct  193   VADTANEAAEKAKETKDAAMRKAGEYTDYTAQKAQE--------AKDTTVGKAKEYTNY-  243

Query  1415  AGEAGNKASEAKERGTEMSKNAASYAGQKVTEAKDVTVE  1531
                A +KA E K+     +    +YA +K  EAKD TVE
Sbjct  244   ---AADKAKEGKDTTVGKASEYTNYAAEKAKEAKDTTVE  279



>ref|NP_001238546.1| maturation polypeptide [Glycine max]
 gb|AAA33985.1| late embryongenesis abundant protein [Glycine max]
 prf||1905420A late embryogenesis abundant protein
Length=463

 Score = 55.1 bits (131),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 77/244 (32%), Positives = 117/244 (48%), Gaps = 17/244 (7%)
 Frame = +2

Query  869   NTTKENVQSGSQYLVEKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKD  1048
             N T   V   + Y  +KA   KD  ++K  + Y    D    K ++AK T    G   KD
Sbjct  126   NKTGSKVGEYADYASQKAKETKDATMEKAGE-YT---DYASQKAKEAKKTTMEKGGEYKD  181

Query  1049  YTTQSAKQTKD-TLSSAGQTAKDYTVQSAQQTKD-TLSSAGQTAKDYTVQSAQQTKD-TL  1219
             Y+ + AK+ KD T++  G+  KDY  + A++ KD T++  G+  KDY  +  ++ KD T+
Sbjct  182   YSAEKAKERKDATVNKMGEY-KDYAAEKAKEGKDATVNKMGEY-KDYAAEKTKEGKDATV  239

Query  1220  SSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKD  1399
             +  G+  KDYT + A++ KDT  G     KD     A++A   LS   +       + K+
Sbjct  240   NKMGEY-KDYTAEKAKEGKDTTLGKLGELKDTASDAAKRAVGYLSGKKE-------ETKE  291

Query  1400  YASQKAGEAGNKASEAKERGTEMSKNAASYAGQKVTEAKDVTVESgkgavgyagkvaETL  1579
              AS+ A    NKA E KE   + +   A  A  K  E KD   E+ + A     + AE  
Sbjct  292   MASETAEATANKAGEMKEATKKKTAETAEAAKNKAGEIKDRAAETAEAAKNKTAETAEVT  351

Query  1580  KDTA  1591
             K+ A
Sbjct  352   KNKA  355


 Score = 55.1 bits (131),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 78/251 (31%), Positives = 124/251 (49%), Gaps = 29/251 (12%)
 Frame = +2

Query  788   IGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKTQQAY  967
             +G+Y   A QK+           ++ K+ T E     + Y  +KA  AK T ++K  +  
Sbjct  132   VGEYADYASQKA-----------KETKDATMEKAGEYTDYASQKAKEAKKTTMEKGGEY-  179

Query  968   NAAKDTTISKTQQAKD-TFSSTGQTAKDYTTQSAKQTKD-TLSSAGQTAKDYTVQSAQQT  1141
                KD +  K ++ KD T +  G+  KDY  + AK+ KD T++  G+  KDY  +  ++ 
Sbjct  180   ---KDYSAEKAKERKDATVNKMGEY-KDYAAEKAKEGKDATVNKMGEY-KDYAAEKTKEG  234

Query  1142  KD-TLSSAGQTAKDYTVQSAQQTKD-TLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDY  1315
             KD T++  G+  KDYT + A++ KD TL   G+  KD    +A++A   LSG  +  K+ 
Sbjct  235   KDATVNKMGEY-KDYTAEKAKEGKDTTLGKLGEL-KDTASDAAKRAVGYLSGKKEETKEM  292

Query  1316  TVQTAQQAKETLSKAG---QAAKDYTVQAKDYASQKAGEAGNKASEAKERGTEMSKNAAS  1486
               +TA+    T +KAG   +A K  T +  + A  KAGE  ++A+E  E     +   A 
Sbjct  293   ASETAEA---TANKAGEMKEATKKKTAETAEAAKNKAGEIKDRAAETAEAAKNKTAETAE  349

Query  1487  YAGQKVTEAKD  1519
                 K  E KD
Sbjct  350   VTKNKALEMKD  360



>ref|XP_001783572.1| predicted protein [Physcomitrella patens]
 gb|EDQ51604.1| predicted protein [Physcomitrella patens]
Length=534

 Score = 54.7 bits (130),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 74/217 (34%), Positives = 101/217 (47%), Gaps = 30/217 (14%)
 Frame = +2

Query  848   NKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDTF--  1021
             N Y+ AK+  ++   + + Y  +KA  A+D A    Q A N+A+D      QQ K TF  
Sbjct  126   NTYDNAKDNAQKAAANANDYSQQKASEAQDAARSGYQSAANSAQDAA----QQGKSTFQN  181

Query  1022  -----SSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQS---AQQTKDTLSSAGQ---  1168
                   +T  +AKD    +A   KD+  S GQ ++D T Q    AQ+    ++  GQ   
Sbjct  182   VANKVCATAASAKDTVIDNAVAAKDSAYSGGQQSRDVTAQKVGEAQEGIKNMAITGQEGA  241

Query  1169  -TAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKE  1345
               AK Y     QQ  DT+       KD  V  AQQA +        AKD TVQ + +  +
Sbjct  242   QAAKGYV----QQAVDTVLQTAYAVKDAVVGKAQQAANV----AVDAKDTTVQKSMETYD  293

Query  1346  TLS--KAG--QAAKDYTVQAKDYASQKAGEAGNKASE  1444
               S   AG   AAKD  + AKD   QKA EA N A++
Sbjct  294   AGSTKAAGTTSAAKDQILAAKDTTVQKANEAYNMAAQ  330



>sp|A3AHG5.1|LEA1_ORYSJ RecName: Full=Late embryogenesis abundant protein 1 [Oryza sativa 
Japonica Group]
 gb|ABF95684.1| Late embryogenesis abundant protein, expressed [Oryza sativa 
Japonica Group]
 gb|EAZ26754.1| hypothetical protein OsJ_10667 [Oryza sativa Japonica Group]
 gb|AEY11352.1| late embryogenesis abundant protein [Oryza sativa Japonica Group]
Length=344

 Score = 54.3 bits (129),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 57/190 (30%), Positives = 84/190 (44%), Gaps = 29/190 (15%)
 Frame = +2

Query  881   ENVQSGSQYLVEKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQ  1060
             E+VQ G++  V   G           + +  A+DT   KT Q  D         KDYT  
Sbjct  73    ESVQEGAKSFVSAVG-----------RTFGGARDTAAEKTSQTADATRDKLGEYKDYTAD  121

Query  1061  SAKQTKDTLS-SAGQTA----------KDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQT  1207
              A++T D+++    +TA          KDYT    ++TKD ++     A + T     + 
Sbjct  122   KARETNDSVARKTNETADASRDKLGEYKDYTADKTRETKDAVAQKASDASEATKNKLGEY  181

Query  1208  KDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTV  1387
             KD L+   + AKD T Q A + KD +    Q  +D T  TA++AK+       A KD T 
Sbjct  182   KDALARKTRDAKDTTAQKATEFKDGVKATAQETRDATADTARKAKD-------ATKDTTQ  234

Query  1388  QAKDYASQKA  1417
              A D A + A
Sbjct  235   TAADKARETA  244



>ref|XP_010654020.1| PREDICTED: embryonic protein DC-8-like isoform X2 [Vitis vinifera]
Length=328

 Score = 53.9 bits (128),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 70/247 (28%), Positives = 107/247 (43%), Gaps = 52/247 (21%)
 Frame = +2

Query  788   IGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVE---KAGAAKDTALQKTQ  958
             IG   +  Q+    A + A  K ++A   T+E  +  S+   E   K G  KD A +KT+
Sbjct  51    IGSVLRAVQETYEHAKEAATGKSQEAVEKTRETAEVASEKAREAAQKTGQTKDAAAEKTR  110

Query  959   QAYNAA--------------KDTTISKTQQAKDTFSSTGQTAKD-----------YTTQS  1063
                +AA              KD T  K+++AKD+ +   +  KD              + 
Sbjct  111   GVSDAASQKAQEAKEKMRESKDYTADKSKEAKDSAAEKARETKDTGAEKTVEHKNSAAEK  170

Query  1064  AKQTKDTLSSAGQTAKDYTVQSAQQTKDT-LSSAGQTAKDYTVQSAQQTKDTLSSAGQTA  1240
             AK+TKD ++      KDY  + A+  KDT L   G+  KDY  + A++TKD         
Sbjct  171   AKETKDAVAGQAGEYKDYAAEKARGVKDTTLGKTGEY-KDYAAEKAKETKDATVQKAAEY  229

Query  1241  KDYTVQSAQQAKDT----------------------LSGAGQTAKDYTVQTAQQAKETLS  1354
             KDYT   A++ KDT                      L+G  +  K  T +TA+ AKE L+
Sbjct  230   KDYTAGKAEEGKDTSVGKITELKDSAADAARRAMEYLTGKKEETKHKTSETAEAAKERLT  289

Query  1355  KAGQAAK  1375
             +  +AA+
Sbjct  290   ETEEAAR  296



>ref|XP_002884129.1| hypothetical protein ARALYDRAFT_480743 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60388.1| hypothetical protein ARALYDRAFT_480743 [Arabidopsis lyrata subsp. 
lyrata]
Length=444

 Score = 54.3 bits (129),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 77/245 (31%), Positives = 97/245 (40%), Gaps = 17/245 (7%)
 Frame = +2

Query  800   RQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQKTQQAYNAAK  979
             +  A+ K+  A   A +K   AKN   EN      +  +KAG AKD A +    A    K
Sbjct  98    KDFAENKAQYAKDFAYDKTGDAKNMACENAGYAKDFAYDKAGDAKDMAYENAGYA----K  153

Query  980   DTTISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSS  1159
             D    K   AKD     G  AKD+    A   KD        AKD   + A   KD    
Sbjct  154   DFAYDKAGNAKDMAYDKGGYAKDFAYDKAGDAKDMAYEKAPYAKDMAYEKASIAKDM---  210

Query  1160  AGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQA  1339
             A + A D    SAQ+  D+       AKD   + A   KD        AKD   + A  A
Sbjct  211   AYEKAGD-AYGSAQKLMDSGYDKVGDAKDIAYEKAGNVKDMAYEKTGNAKDGAYEKAGIA  269

Query  1340  K-ETLSKAGQAAKDYTVQAKDYASQKAGEAGNKASEAKERGTEMSKNAASYAGQKVTEAK  1516
             K     KAG A        KD A  K G A   A +AK+   E +  A  +A +K   AK
Sbjct  270   KGMAYDKAGNA--------KDMAYDKVGSAYGIAQKAKDSSYEKAGEAKDFAYKKAGNAK  321

Query  1517  DVTVE  1531
             D+  E
Sbjct  322   DLAYE  326



>gb|AFW88513.1| hypothetical protein ZEAMMB73_579239 [Zea mays]
Length=354

 Score = 53.9 bits (128),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 65/221 (29%), Positives = 101/221 (46%), Gaps = 40/221 (18%)
 Frame = +2

Query  881   ENVQSGSQYLVEKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQ  1060
             E+VQ G++ L    G           + +  AKD T+ KT Q   T        +DYT  
Sbjct  62    ESVQEGARSLASAVG-----------RTFGGAKDATVDKTSQTAHTAGDKLGEYRDYTAD  110

Query  1061  SAKQTKDTLS-SAGQTA----------KDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQT  1207
              A++  D++S   G+TA          KD  V+ A++TKD ++         T ++A+ T
Sbjct  111   KAREANDSVSRKTGETAEATRNKLGEYKDSAVEKARETKDAVAQ-------KTSETAEAT  163

Query  1208  KDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTV  1387
             K+ L       KD     A++A DT +G  + AKD T+Q AQ+ ++       A  D   
Sbjct  164   KNKLGE----YKDAAAGKAREAADTTAGKAREAKDATMQKAQETRD-------ATADKAR  212

Query  1388  QAKDYASQKAGEAGNKASEAKERGTEMSKNAASYAGQKVTE  1510
             +A+D   QKAGE  + + EA +   + S+  A  A  K  E
Sbjct  213   EARDVTRQKAGEYTDASREAAQEARDRSRATAQTAADKARE  253



>emb|CDY25166.1| BnaC07g03410D [Brassica napus]
Length=480

 Score = 54.3 bits (129),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 82/291 (28%), Positives = 115/291 (40%), Gaps = 42/291 (14%)
 Frame = +2

Query  773   LSLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQK  952
             ++ E+ G  +  A  K+ +A Q A +K   AK+   E       +  +KAG AK+ A +K
Sbjct  141   MAYEKAGHTKDYAYDKTDNAKQGAYDKAGIAKDIAYEQAGHAKDFAYDKAGNAKNMAYEK  200

Query  953   TQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSA----KQTKDTLSSAGQTAKDYT  1120
                    AKD    K    K+        AKD   +        T D + SA  +AKD  
Sbjct  201   AGH----AKDYAYEKAGDVKEVAYDKASNAKDMAYEKVDNVIDMTYDKVGSAYSSAKDMA  256

Query  1121  VQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDT----LSSAGQTAKDYTVQSAQQAKDT--  1282
               +A  +KD        AKD   + A+  KD     + SA   AKD     A   KD   
Sbjct  257   YDNAGNSKDMAYDKAGNAKDMAYEKAENVKDMTYDKVGSAYGNAKDMAYDKAGNVKDMAY  316

Query  1283  -------------LSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGE  1423
                          +  A  +AKD   + A  AK+ +     AA     +AKDY  +K G+
Sbjct  317   EKAGNVKDMTYEKVGSAYGSAKDMAYEKAGDAKDMVYDKVGAAYGSAEKAKDYGYEKTGD  376

Query  1424  ----AGNKASEAKERGTEMSKN-----------AASYAGQKVTEAKDVTVE  1531
                 A +K+SEA E   E S +           A  Y   K TEA D +VE
Sbjct  377   VIRMATDKSSEAYEGAKERSNSAKDMVADKGEGAVKYGRDKATEAMDESVE  427



>ref|XP_002284002.1| PREDICTED: embryonic protein DC-8-like isoform X1 [Vitis vinifera]
Length=377

 Score = 53.9 bits (128),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 70/247 (28%), Positives = 107/247 (43%), Gaps = 52/247 (21%)
 Frame = +2

Query  788   IGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVE---KAGAAKDTALQKTQ  958
             IG   +  Q+    A + A  K ++A   T+E  +  S+   E   K G  KD A +KT+
Sbjct  51    IGSVLRAVQETYEHAKEAATGKSQEAVEKTRETAEVASEKAREAAQKTGQTKDAAAEKTR  110

Query  959   QAYNAA--------------KDTTISKTQQAKDTFSSTGQTAKD-----------YTTQS  1063
                +AA              KD T  K+++AKD+ +   +  KD              + 
Sbjct  111   GVSDAASQKAQEAKEKMRESKDYTADKSKEAKDSAAEKARETKDTGAEKTVEHKNSAAEK  170

Query  1064  AKQTKDTLSSAGQTAKDYTVQSAQQTKDT-LSSAGQTAKDYTVQSAQQTKDTLSSAGQTA  1240
             AK+TKD ++      KDY  + A+  KDT L   G+  KDY  + A++TKD         
Sbjct  171   AKETKDAVAGQAGEYKDYAAEKARGVKDTTLGKTGEY-KDYAAEKAKETKDATVQKAAEY  229

Query  1241  KDYTVQSAQQAKDT----------------------LSGAGQTAKDYTVQTAQQAKETLS  1354
             KDYT   A++ KDT                      L+G  +  K  T +TA+ AKE L+
Sbjct  230   KDYTAGKAEEGKDTSVGKITELKDSAADAARRAMEYLTGKKEETKHKTSETAEAAKERLT  289

Query  1355  KAGQAAK  1375
             +  +AA+
Sbjct  290   ETEEAAR  296



>dbj|BAN67647.1| PvLEA7 protein [Polypedilum vanderplanki]
Length=200

 Score = 52.0 bits (123),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 61/197 (31%), Positives = 98/197 (50%), Gaps = 25/197 (13%)
 Frame = +2

Query  914   EKAGAAKDTALQKTQQAYNAAKDT---TISKTQQAKDTFSSTGQTAKDYTTQSAKQTKDT  1084
             +K  AA+D A  K ++  + AK+T   T  K Q+ K+      + AKD + Q+  +TKD 
Sbjct  12    DKLKAAEDHATDKLKEGRDKAKETWDDTKQKFQEGKEKGQQKWEEAKDKSNQAMDETKDK  71

Query  1085  LSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQT---AKDYTV  1255
                  +  KD T ++ ++TKD +  AG  A+++   + ++TKD      +T   AKD  V
Sbjct  72    W----EEGKDKTKEAWEETKDKVGEAGDRAEEHWEAAKEETKDIFDKTAETLRNAKDAVV  127

Query  1256  QSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQ----AKDYASQKAGE  1423
                    DTL+GA    KD  V+    AK+  ++   +AKD TV+    AKD  ++  GE
Sbjct  128   -------DTLAGA----KDVVVEKLVGAKDVTAETLVSAKDVTVEKVTNAKDATAEYLGE  176

Query  1424  AGNKASEAKERGTEMSK  1474
                +  +AK+   E  K
Sbjct  177   KKEQIIDAKDATLEYMK  193



>gb|EFA83269.1| hypothetical protein PPL_04059 [Polysphondylium pallidum PN500]
Length=456

 Score = 51.2 bits (121),  Expect(2) = 6e-04, Method: Compositional matrix adjust.
 Identities = 68/247 (28%), Positives = 104/247 (42%), Gaps = 36/247 (15%)
 Frame = +2

Query  854   YEKAKNTTKENVQSGSQYLVEKAGAAKDTA------LQKTQQA-YNAAKDTTISKTQQAK  1012
             YEKAK+    NV +G +   E   AA +        L+K  +A Y  AKD   +  ++ K
Sbjct  116   YEKAKD----NVNAGMEKTKESVAAANEKMKEAAETLKKNMEAGYEKAKDNVNAGIEKTK  171

Query  1013  DTFSSTGQT-------AKDYTTQSAKQTKDTLSSAGQTAK-------DYTVQSAQQTKDT  1150
             + FSSTG+        AK+   +  +  K+ L  AGQ  K       +   + AQ  K  
Sbjct  172   EAFSSTGEKMKEGAEDAKEKLQKQGEIGKEKLDEAGQKMKEGAENLNEKMKEGAQNVKKN  231

Query  1151  LSSAGQTAKDYTVQSAQQTK-------DTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAK  1309
             L    + AK    ++ Q+ K       D +    Q  K    + AQ AK  L  AGQ  K
Sbjct  232   LEEDAEIAKKKMDETGQKMKEGAENLNDKMKEGAQNVKKNLEEDAQIAKKKLDEAGQKTK  291

Query  1310  DYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGNKASEAKERGTEMSKNAASY  1489
                 + A+   + + +  Q  K    +  + A +K  EAG K  E+ +  +E  K A S 
Sbjct  292   ----EGAENLNDKMKEGAQNVKKNLEEDAEIAKKKLSEAGEKTKESWDNASEKVKEAMSN  347

Query  1490  AGQKVTE  1510
               +K+ E
Sbjct  348   TNEKMKE  354


 Score = 21.9 bits (45),  Expect(2) = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/81 (30%), Positives = 35/81 (43%), Gaps = 15/81 (19%)
 Frame = +3

Query  582  VEEMKPQGGKDLKSDLEG-----------*NLKSTVAKEEDKA-HGFKGLKSDLEASKLK  725
            V+E   +G KD+KSD+E             NL+    K  D   H F G + ++E    K
Sbjct  37   VKESVQEGAKDVKSDVENSGIGGKIEEIMHNLQDMAQKTWDNTVHMFSGAQENVEEKAEK  96

Query  726  STLAMAVAK---KEGIIVGFH  779
               +M  AK   KE +  G+ 
Sbjct  97   VGESMENAKNSMKENMEAGYE  117



>ref|XP_006651332.1| PREDICTED: late embryogenesis abundant protein 1-like, partial 
[Oryza brachyantha]
Length=268

 Score = 52.4 bits (124),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 47/145 (32%), Positives = 71/145 (49%), Gaps = 24/145 (17%)
 Frame = +2

Query  881   ENVQSGSQYLVEKAGAAKDTALQKTQQAYNAAKDTTISKTQQ-AKDTFSSTGQTAKDYTT  1057
             E+VQ G++  V   G           + +  A+DT + KT Q A+ T    G+  KDYT 
Sbjct  8     ESVQEGAKSFVSAVG-----------RTFGGARDTAVEKTSQTAEATRDKLGEY-KDYTA  55

Query  1058  QSAKQTKDTLS-SAGQTA----------KDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQ  1204
             + A++T DT+S    +TA          KDYT + A++TKD+++     A   T     +
Sbjct  56    EKARETNDTVSRKTNETADATRNKLGEYKDYTAEKARETKDSVAQTASDASKATKNKLGE  115

Query  1205  TKDTLSSAGQTAKDYTVQSAQQAKD  1279
              KD L+   + AKD T Q A + KD
Sbjct  116   YKDALAGKTREAKDTTAQKATEFKD  140



>ref|XP_008392606.1| PREDICTED: embryonic protein DC-8-like [Malus domestica]
Length=283

 Score = 52.4 bits (124),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 53/175 (30%), Positives = 94/175 (54%), Gaps = 15/175 (9%)
 Frame = +2

Query  860   KAKNTTKENVQSGSQY----LVEKAGAAKDTALQKTQQAYN-------AAKDTTISKTQQ  1006
             KAK    +++++ S+Y      +KA  AKDT + K  +  N        AK+TT++K  +
Sbjct  99    KAKEAANKSMETASEYKDDYAAQKAKGAKDTTVGKASEYINYAAEKAEEAKETTVNKAGE  158

Query  1007  AKDTFSSTGQTAKDYTTQSAKQTKDT-LSSAGQTAKDYTVQSAQQTKDT-LSSAGQTAKD  1180
               +  +   + AKD T    K+ KDT ++ AG+   +Y  + A++TKDT ++ AG+   +
Sbjct  159   DTNYATEKAREAKDTTLNKVKEAKDTTMNKAGEYT-NYANKKAKETKDTTVNKAGEYT-N  216

Query  1181  YTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKE  1345
             Y  + A++ KDT  +      +Y V+ A++AKDT         +YT + A++AK+
Sbjct  217   YAAEKAREAKDTTINKASEYSNYAVEKAKEAKDTTINKASEYSNYTTEKAKEAKD  271



>gb|ACU18424.1| unknown [Glycine max]
Length=309

 Score = 52.4 bits (124),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 63/127 (50%), Gaps = 17/127 (13%)
 Frame = +2

Query  926   AAKDTALQKTQQAYNAAKDTTISK-----TQQAKDTFSSTGQTAKDYTTQSAKQTKDTLS  1090
             AAK+  + K       AK+T + +     TQ+A++T    G+   DY  Q AK+TKD  +
Sbjct  94    AAKEAVVGKPHHEEVYAKETKMGEYSDYATQKARETKQKAGEYT-DYAAQKAKETKDYAA  152

Query  1091  SAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQ  1270
                + AKD TVQ A + KD  +   + AKD TVQ A +            KDYT + A +
Sbjct  153   EKAKNAKDITVQKAGEYKDYTAEKAKNAKDTTVQKAGEY-----------KDYTAEKAIE  201

Query  1271  AKDTLSG  1291
              KD+  G
Sbjct  202   GKDSAVG  208



>ref|XP_009102270.1| PREDICTED: embryonic protein DC-8-like [Brassica rapa]
Length=450

 Score = 53.1 bits (126),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 81/291 (28%), Positives = 116/291 (40%), Gaps = 42/291 (14%)
 Frame = +2

Query  773   LSLEEIGKYRQTAQQKSIDALQTAQNKYEKAKNTTKENVQSGSQYLVEKAGAAKDTALQK  952
             ++ E+ G  +  A  K+ +A Q A +K   AK+   +       +  +KAG AK+ A +K
Sbjct  111   MAYEKAGHTKDYAYDKTDNAKQGAYDKAGIAKDIAYKQAGHAKDFAYDKAGNAKNMAYEK  170

Query  953   TQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQSA----KQTKDTLSSAGQTAKDYT  1120
                    AKD    K    K+        AKD   +        T D + SA  +AKD  
Sbjct  171   AGH----AKDYAYEKAGDVKEVAYDKASNAKDMAYEKVDNVIDMTYDKVGSAYSSAKDMA  226

Query  1121  VQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDT----LSSAGQTAKDYTVQSAQQAKDT--  1282
               +A+ +KD        AKD   + A+  KD     + SA   AKD     A   KD   
Sbjct  227   YDNAENSKDMAYDKAGNAKDMAYEKAENVKDMTYDKVGSAYGNAKDMAYDKAGNVKDMAY  286

Query  1283  -------------LSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGE  1423
                          +  A  +AKD   + A  AK+ +     AA     +AKDY  +K G+
Sbjct  287   EKAGNVKDMTYDKVGSAYGSAKDMAYEKAGDAKDMVYDKVGAAYGSAEKAKDYGYEKTGD  346

Query  1424  ----AGNKASEAKERGTEMSKN-----------AASYAGQKVTEAKDVTVE  1531
                 A +K+SEA E   E S +           A  Y   K TEA D +VE
Sbjct  347   VIRMATDKSSEAYEGAKERSNSAKDMVADKGEGAVKYGRDKATEAMDESVE  397



>ref|XP_002869913.1| late embryogenesis abundant domain-containing protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH46172.1| late embryogenesis abundant domain-containing protein [Arabidopsis 
lyrata subsp. lyrata]
Length=267

 Score = 52.0 bits (123),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 44/130 (34%), Positives = 66/130 (51%), Gaps = 0/130 (0%)
 Frame = +2

Query  1076  KDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTV  1255
             +D L +A  +  D +  S +  +DT  +  Q+AKD   + A +  D      + AKD   
Sbjct  49    RDPLDNARDSRADSSYGSKKWREDTGENYAQSAKDKANEGASKAADKAYETKEQAKDKAY  108

Query  1256  QSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYASQKAGEAGNK  1435
             ++ +QAKDT   A + AKDY  +T  +  +  SKA   A+D   +AKDYA      A  K
Sbjct  109   ETKEQAKDTAYNAKEKAKDYAERTKDKVNQGASKAADKAEDTKERAKDYAEDTMDNAKEK  168

Query  1436  ASEAKERGTE  1465
             A +AKE+  E
Sbjct  169   ARDAKEKVKE  178



>gb|AFW88514.1| hypothetical protein ZEAMMB73_579239 [Zea mays]
Length=265

 Score = 52.0 bits (123),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 66/221 (30%), Positives = 103/221 (47%), Gaps = 40/221 (18%)
 Frame = +2

Query  881   ENVQSGSQYLVEKAGAAKDTALQKTQQAYNAAKDTTISKTQQAKDTFSSTGQTAKDYTTQ  1060
             E+VQ G++ L    G           + +  AKD T+ KT Q   T        +DYT  
Sbjct  62    ESVQEGARSLASAVG-----------RTFGGAKDATVDKTSQTAHTAGDKLGEYRDYTAD  110

Query  1061  SAKQTKDTLS-SAGQTA----------KDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQT  1207
              A++  D++S   G+TA          KD  V+ A++TKD ++         T ++A+ T
Sbjct  111   KAREANDSVSRKTGETAEATRNKLGEYKDSAVEKARETKDAVAQ-------KTSETAEAT  163

Query  1208  KDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTV  1387
             K+ L   G+  KD     A++A DT +G  + AKD T+Q AQ+ ++       A  D   
Sbjct  164   KNKL---GEY-KDAAAGKAREAADTTAGKAREAKDATMQKAQETRD-------ATADKAR  212

Query  1388  QAKDYASQKAGEAGNKASEAKERGTEMSKNAASYAGQKVTE  1510
             +A+D   QKAGE  + + EA +   + S+  A  A  K  E
Sbjct  213   EARDVTRQKAGEYTDASREAAQEARDRSRATAQTAADKARE  253



>ref|XP_010494442.1| PREDICTED: embryonic protein DC-8-like [Camelina sativa]
Length=337

 Score = 52.4 bits (124),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 44/160 (28%), Positives = 80/160 (50%), Gaps = 8/160 (5%)
 Frame = +2

Query  1001  QQAKDTFSSTGQTAKDYTTQSAKQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKD  1180
             +Q KD  +     A D   ++ ++ KD    A +  KDY    A++ +D ++     A D
Sbjct  104   EQTKDKVNEGASRAADKAYETKEKAKDKAYDAKEKTKDY----AEEARDRVNEGASRAAD  159

Query  1181  YTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAKETLSKA  1360
                ++ ++ KD      +  KDY    A++A+D ++     A D T +T ++AKE     
Sbjct  160   KAYETKEKAKDKAYDMKEKTKDY----AEEARDRVNEGASRAADKTYETKEKAKEKAYDV  215

Query  1361  GQAAKDYTVQAKDYASQKAGEAGNKASEAKERGTEMSKNA  1480
              +  KDY  +AKD  ++ A +A +KA E KER  + ++++
Sbjct  216   KENTKDYAEEAKDKVNEGASKASDKAYETKERAKDYAEDS  255



>ref|XP_002984024.1| hypothetical protein SELMODRAFT_119253, partial [Selaginella 
moellendorffii]
 gb|EFJ15036.1| hypothetical protein SELMODRAFT_119253, partial [Selaginella 
moellendorffii]
Length=153

 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 67/111 (60%), Gaps = 3/111 (3%)
 Frame = +2

Query  1046  DYTTQSAKQTKDTLSS-AGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLS  1222
             D T +SA++TKD +   AG+T  D T +SA++TKD ++   +   D T +SA++TKD ++
Sbjct  28    DDTKKSARETKDDIKDRAGKTV-DDTKRSARETKDEMTDKAKRTTDETKKSARETKDEVT  86

Query  1223  SAGQTAKDYTVQSAQQAKDTLSGAGQTAKDYTVQTAQQAK-ETLSKAGQAA  1372
                +   D T +SA++ KD ++   +   D T ++A++ K E   KA ++A
Sbjct  87    DRAKRTTDETKKSARETKDEVTDKAKRVADETKKSARETKDEVTDKAKRSA  137



>gb|ACD14089.1| group 3 LEA protein [Medicago sativa]
Length=436

 Score = 52.8 bits (125),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 57/100 (57%), Gaps = 0/100 (0%)
 Frame = +2

Query  1106  AKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQTKDTLSSAGQTAKDYTVQSAQQAKDTL  1285
             A +YT  +AQ+ K+  ++A Q AK+Y   +A +TKD    A +  K+Y   +AQ+ KD  
Sbjct  186   AGEYTGSAAQKAKEYATNAAQKAKEYATGAAYKTKDYAGDAAEKTKEYAGDAAQKTKDYA  245

Query  1286  SGAGQTAKDYTVQTAQQAKETLSKAGQAAKDYTVQAKDYA  1405
               A + +K+Y  + A ++K+    A Q AKD   + KDYA
Sbjct  246   GDATEKSKEYATEAAYKSKDYAGDAAQMAKDAAYKTKDYA  285



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 7458505238512