BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c103081_g1_i1 len=530 path=[508:0-529]

Length=530
                                                                      Score     E

ref|XP_006439625.1|  hypothetical protein CICLE_v10023072mg             135   2e-37   
ref|XP_009610749.1|  PREDICTED: transcription factor PRE3-like          135   3e-37   
ref|XP_007210171.1|  hypothetical protein PRUPE_ppa018631mg             133   2e-36   
ref|XP_004499430.1|  PREDICTED: transcription factor bHLH135-like       133   2e-36   
ref|XP_009615362.1|  PREDICTED: transcription factor PRE3-like          133   2e-36   
ref|XP_009772499.1|  PREDICTED: transcription factor PRE3-like          132   3e-36   
ref|XP_008453188.1|  PREDICTED: transcription factor PRE3-like          132   5e-36   
ref|XP_007037282.1|  Activation-tagged BRI1(brassinosteroid-insen...    132   5e-36   
ref|XP_009803678.1|  PREDICTED: transcription factor PRE3-like          131   6e-36   
ref|XP_008239815.1|  PREDICTED: transcription factor PRE3-like          131   7e-36   
ref|XP_004241574.1|  PREDICTED: transcription factor PRE3               131   7e-36   
ref|NP_001235265.1|  uncharacterized protein LOC100527636               131   1e-35   
ref|XP_002511551.1|  transcription regulator, putative                  130   2e-35   Ricinus communis
ref|XP_004138158.1|  PREDICTED: transcription factor bHLH135-like       130   2e-35   
ref|XP_010044722.1|  PREDICTED: transcription factor PRE3-like          130   2e-35   
emb|CDY69564.1|  BnaAnng30830D                                          130   2e-35   
ref|XP_010242417.1|  PREDICTED: transcription factor PRE6-like          130   3e-35   
gb|AFK43493.1|  unknown                                                 130   3e-35   
ref|XP_007138203.1|  hypothetical protein PHAVU_009G189200g             129   4e-35   
emb|CDP12359.1|  unnamed protein product                                129   6e-35   
ref|XP_010539967.1|  PREDICTED: transcription factor PRE3               129   7e-35   
gb|AFK36119.1|  unknown                                                 129   7e-35   
ref|XP_010102446.1|  hypothetical protein L484_006129                   128   1e-34   
ref|XP_008437438.1|  PREDICTED: transcription factor PRE3-like          127   2e-34   
ref|XP_008374533.1|  PREDICTED: transcription factor PRE3-like          127   3e-34   
ref|XP_009104757.1|  PREDICTED: transcription factor PRE3-like          127   5e-34   
emb|CDX85840.1|  BnaC06g22940D                                          126   5e-34   
ref|XP_002274840.1|  PREDICTED: transcription factor PRE3               126   5e-34   Vitis vinifera
ref|XP_011087224.1|  PREDICTED: transcription factor PRE3               126   8e-34   
ref|XP_004299384.1|  PREDICTED: transcription factor bHLH135-like       125   1e-33   
emb|CAN67278.1|  hypothetical protein VITISV_022020                     125   1e-33   Vitis vinifera
ref|XP_003527066.1|  PREDICTED: transcription factor bHLH135            125   1e-33   
ref|XP_010037162.1|  PREDICTED: transcription factor PRE3-like          125   2e-33   
ref|XP_009369325.1|  PREDICTED: transcription factor PRE3               125   2e-33   
ref|XP_009128048.1|  PREDICTED: transcription factor PRE3               125   2e-33   
ref|XP_002276549.1|  PREDICTED: transcription factor PRE6               125   2e-33   Vitis vinifera
ref|XP_011071625.1|  PREDICTED: transcription factor PRE3-like          125   2e-33   
ref|XP_002888981.1|  hypothetical protein ARALYDRAFT_476585             124   3e-33   
ref|XP_010416307.1|  PREDICTED: transcription factor PRE3               124   4e-33   
ref|XP_004152438.1|  PREDICTED: transcription factor bHLH135-like       124   5e-33   
ref|XP_011044025.1|  PREDICTED: transcription factor PRE3-like          123   9e-33   
ref|XP_011047163.1|  PREDICTED: transcription factor PRE3-like          123   1e-32   
gb|KHG03267.1|  Transcription factor protein                            123   1e-32   
ref|NP_177590.1|  transcription factor bHLH135                          123   1e-32   Arabidopsis thaliana [mouse-ear cress]
gb|KFK41891.1|  hypothetical protein AALP_AA2G185600                    123   1e-32   
ref|XP_010256912.1|  PREDICTED: transcription factor ILI6-like          123   1e-32   
gb|EYU24397.1|  hypothetical protein MIMGU_mgv1a017140mg                122   2e-32   
ref|XP_009389574.1|  PREDICTED: transcription factor ILI6-like          122   3e-32   
ref|XP_006374476.1|  bHLH family protein                                122   3e-32   
ref|XP_007226915.1|  hypothetical protein PRUPE_ppa016030mg             122   3e-32   
ref|XP_006390417.1|  hypothetical protein EUTSA_v10019683mg             122   4e-32   
ref|XP_011075476.1|  PREDICTED: transcription factor PRE6               122   4e-32   
ref|XP_008385279.1|  PREDICTED: transcription factor PRE3-like          121   5e-32   
ref|XP_002318605.1|  bHLH family protein                                121   6e-32   Populus trichocarpa [western balsam poplar]
ref|XP_003519021.1|  PREDICTED: transcription factor bHLH135            121   7e-32   
ref|XP_007046125.1|  Basic helix-loop-helix DNA-binding superfami...    120   1e-31   
ref|XP_007157666.1|  hypothetical protein PHAVU_002G088400g             120   1e-31   
ref|XP_009106117.1|  PREDICTED: transcription factor PRE3-like          120   1e-31   
ref|XP_003532055.1|  PREDICTED: transcription factor bHLH135            120   2e-31   
ref|XP_003517952.1|  PREDICTED: transcription factor bHLH135-like       119   3e-31   
ref|XP_006827167.1|  hypothetical protein AMTR_s00010p00254240          119   3e-31   
ref|XP_002520108.1|  transcription regulator, putative                  119   3e-31   Ricinus communis
gb|AFK41511.1|  unknown                                                 119   5e-31   
ref|XP_010096378.1|  hypothetical protein L484_021126                   119   5e-31   
ref|XP_009589864.1|  PREDICTED: transcription factor PRE3-like          119   6e-31   
ref|XP_008221650.1|  PREDICTED: transcription factor PRE6-like          118   8e-31   
emb|CDX73095.1|  BnaC06g35430D                                          118   1e-30   
ref|XP_007153819.1|  hypothetical protein PHAVU_003G067500g             117   2e-30   
ref|XP_010695477.1|  PREDICTED: transcription factor PRE3-like          117   3e-30   
gb|EYU22434.1|  hypothetical protein MIMGU_mgv1a017116mg                117   3e-30   
ref|XP_006438657.1|  hypothetical protein CICLE_v10033182mg             117   3e-30   
ref|XP_009360364.1|  PREDICTED: transcription factor PRE6               116   4e-30   
gb|KHG28499.1|  Transcription factor protein                            116   6e-30   
ref|XP_011071014.1|  PREDICTED: transcription factor PRE6-like          119   6e-30   
ref|XP_006357115.1|  PREDICTED: transcription factor bHLH135-like       116   7e-30   
ref|XP_010939543.1|  PREDICTED: transcription factor ILI6-like          116   7e-30   
ref|XP_004233358.1|  PREDICTED: transcription factor PRE6 isoform X2    116   7e-30   
ref|XP_004238782.1|  PREDICTED: transcription factor PRE6-like          115   8e-30   
ref|XP_004151201.1|  PREDICTED: transcription factor bHLH135-like       115   9e-30   
ref|XP_009622200.1|  PREDICTED: transcription factor PRE6-like          115   9e-30   
ref|XP_006482579.1|  PREDICTED: transcription factor bHLH135-like       115   1e-29   
emb|CDP00307.1|  unnamed protein product                                115   1e-29   
gb|KDP41169.1|  hypothetical protein JCGZ_15576                         115   2e-29   
ref|XP_006431132.1|  hypothetical protein CICLE_v10013209mg             114   3e-29   
ref|XP_003543767.1|  PREDICTED: transcription factor bHLH135            114   3e-29   
ref|XP_003534454.1|  PREDICTED: transcription factor bHLH135            114   4e-29   
ref|XP_007032495.1|  Basic helix-loop-helix (bHLH) DNA-binding fa...    114   4e-29   
gb|KDO82876.1|  hypothetical protein CISIN_1g041198mg                   114   5e-29   
ref|XP_008389506.1|  PREDICTED: transcription factor PRE6-like          114   5e-29   
ref|XP_009386696.1|  PREDICTED: transcription factor ILI6-like          114   6e-29   
ref|XP_008797129.1|  PREDICTED: transcription factor ILI6-like          113   6e-29   
ref|XP_009767697.1|  PREDICTED: transcription factor PRE6-like          113   7e-29   
ref|XP_010032347.1|  PREDICTED: transcription factor PRE5-like          113   8e-29   
ref|XP_006344270.1|  PREDICTED: transcription factor bHLH135-like       113   8e-29   
ref|XP_002283094.1|  PREDICTED: transcription factor PRE6               113   9e-29   Vitis vinifera
ref|XP_010681766.1|  PREDICTED: transcription factor PRE3-like          113   1e-28   
ref|XP_008339920.1|  PREDICTED: transcription factor PRE6-like          113   1e-28   
ref|NP_001241066.1|  uncharacterized protein LOC100784537               112   1e-28   
ref|XP_008784394.1|  PREDICTED: transcription factor ILI6-like          112   2e-28   
ref|NP_001237910.1|  uncharacterized protein LOC100305611               112   2e-28   
ref|XP_010550064.1|  PREDICTED: transcription factor PRE5               112   2e-28   
ref|XP_002517494.1|  transcription regulator, putative                  112   2e-28   Ricinus communis
ref|XP_007139582.1|  hypothetical protein PHAVU_008G041800g             112   3e-28   
ref|XP_003621179.1|  Transcription factor style2.1                      111   3e-28   
ref|XP_006661757.1|  PREDICTED: transcription factor bHLH135-like       111   4e-28   
emb|CDY28427.1|  BnaC07g12550D                                          111   4e-28   
ref|XP_004237036.1|  PREDICTED: transcription factor PRE6-like          111   5e-28   
ref|XP_009758713.1|  PREDICTED: transcription factor PRE5-like          111   6e-28   
ref|XP_002323848.2|  hypothetical protein POPTR_0017s11760g             111   6e-28   Populus trichocarpa [western balsam poplar]
ref|XP_003551974.1|  PREDICTED: transcription factor bHLH135-like       111   6e-28   
ref|XP_006404347.1|  hypothetical protein EUTSA_v10010858mg             110   7e-28   
ref|XP_010552588.1|  PREDICTED: transcription factor PRE6               110   7e-28   
ref|XP_004297318.1|  PREDICTED: transcription factor bHLH135-like       110   8e-28   
gb|KDP45499.1|  hypothetical protein JCGZ_09748                         110   8e-28   
ref|XP_003613657.1|  Transcription factor bHLH135                       110   9e-28   
ref|XP_010551862.1|  PREDICTED: transcription factor PRE1-like          110   9e-28   
ref|XP_008780728.1|  PREDICTED: transcription factor ILI6-like          110   9e-28   
ref|XP_010926221.1|  PREDICTED: transcription factor ILI6-like          110   1e-27   
ref|XP_004490021.1|  PREDICTED: transcription factor bHLH135-like       110   1e-27   
ref|NP_849712.1|  basic helix-loop-helix protein KIDARI                 110   1e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009777244.1|  PREDICTED: transcription factor PRE6-like          110   1e-27   
ref|XP_004146747.1|  PREDICTED: transcription factor bHLH135-like       110   1e-27   
ref|XP_004983143.1|  PREDICTED: transcription factor bHLH135-like       110   2e-27   
ref|XP_010550611.1|  PREDICTED: transcription factor PRE4               110   2e-27   
ref|XP_004296550.1|  PREDICTED: transcription factor bHLH135-like       109   2e-27   
ref|XP_010917014.1|  PREDICTED: transcription factor ILI6-like          109   2e-27   
ref|NP_190355.2|  atypical non-DNA binding bHLH protein BNQ3            109   3e-27   Arabidopsis thaliana [mouse-ear cress]
gb|KFK44602.1|  hypothetical protein AALP_AA1G280300                    109   3e-27   
ref|XP_004135185.1|  PREDICTED: transcription factor bHLH135-like       109   3e-27   
ref|XP_006303467.1|  hypothetical protein CARUB_v10010751mg             109   3e-27   
ref|XP_009610531.1|  PREDICTED: transcription factor PRE6-like          109   4e-27   
ref|XP_008465587.1|  PREDICTED: transcription factor PRE6-like          109   4e-27   
ref|XP_009388768.1|  PREDICTED: transcription factor ILI6-like          108   4e-27   
ref|NP_001049112.1|  Os03g0171300                                       108   4e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006415982.1|  hypothetical protein EUTSA_v10009197mg             108   5e-27   
ref|XP_009602440.1|  PREDICTED: transcription factor PRE5-like          108   5e-27   
gb|ABK95506.1|  unknown                                                 108   5e-27   Populus trichocarpa [western balsam poplar]
ref|XP_010937071.1|  PREDICTED: transcription factor ILI6-like          108   5e-27   
ref|XP_010503380.1|  PREDICTED: transcription factor PRE4-like          108   7e-27   
ref|XP_009103115.1|  PREDICTED: transcription factor PRE6-like          108   7e-27   
ref|XP_010460241.1|  PREDICTED: transcription factor PRE6-like          108   8e-27   
ref|XP_003558708.2|  PREDICTED: transcription factor ILI6 isoform X2    108   8e-27   
sp|Q338G6.1|ILI7_ORYSJ  RecName: Full=Transcription factor ILI7; ...    108   8e-27   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ44693.1|  hypothetical protein OsJ_29320                          108   8e-27   Oryza sativa Japonica Group [Japonica rice]
sp|A2Z730.1|ILI7_ORYSI  RecName: Full=Transcription factor ILI7; ...    108   8e-27   Oryza sativa Indica Group [Indian rice]
ref|XP_002305320.1|  hypothetical protein POPTR_0004s13380g             108   9e-27   Populus trichocarpa [western balsam poplar]
ref|XP_011013171.1|  PREDICTED: transcription factor PRE1-like          108   9e-27   
ref|XP_008446331.1|  PREDICTED: transcription factor PRE6-like          108   1e-26   
emb|CDY24160.1|  BnaC03g57170D                                          107   1e-26   
ref|XP_009115425.1|  PREDICTED: transcription factor PRE6-like          107   1e-26   
ref|XP_011012195.1|  PREDICTED: transcription factor PRE1-like          107   2e-26   
ref|XP_007215198.1|  hypothetical protein PRUPE_ppa014004mg             107   2e-26   
ref|XP_009110054.1|  PREDICTED: transcription factor PRE6               107   2e-26   
ref|XP_009393531.1|  PREDICTED: transcription factor ILI6-like          107   2e-26   
ref|XP_010317103.1|  PREDICTED: transcription factor PRE5 isoform X1    107   2e-26   
ref|XP_008459306.1|  PREDICTED: transcription factor PRE6-like          107   2e-26   
ref|XP_004985540.1|  PREDICTED: transcription factor bHLH135-like       106   3e-26   
ref|XP_002465780.1|  hypothetical protein SORBIDRAFT_01g045710          106   3e-26   Sorghum bicolor [broomcorn]
ref|XP_010515078.1|  PREDICTED: transcription factor PRE4-like          106   4e-26   
ref|XP_010426218.1|  PREDICTED: transcription factor PRE4               106   4e-26   
ref|XP_009149879.1|  PREDICTED: transcription factor PRE4               106   5e-26   
ref|XP_006292883.1|  hypothetical protein CARUB_v10019148mg             106   5e-26   
ref|XP_010551523.1|  PREDICTED: transcription factor PRE6-like          105   6e-26   
emb|CDP02219.1|  unnamed protein product                                105   7e-26   
ref|XP_010066932.1|  PREDICTED: transcription factor PRE6               105   7e-26   
ref|XP_009805005.1|  PREDICTED: transcription factor PRE1-like          105   9e-26   
ref|XP_006649473.1|  PREDICTED: transcription factor bHLH135-like...    107   1e-25   
ref|XP_008379346.1|  PREDICTED: transcription factor PRE1               105   1e-25   
ref|XP_008651476.1|  PREDICTED: transcription factor ILI6               104   2e-25   
gb|KEH24995.1|  transcription factor                                    104   2e-25   
ref|NP_974372.1|  protein PACLOBUTRAZOL RESISTANCE 5                    104   2e-25   Arabidopsis thaliana [mouse-ear cress]
gb|KFK33759.1|  hypothetical protein AALP_AA5G056500                    104   3e-25   
ref|XP_008804467.1|  PREDICTED: transcription factor ILI6-like          104   3e-25   
ref|NP_001234290.1|  transcription factor style2.1                      103   3e-25   
ref|XP_009347048.1|  PREDICTED: transcription factor PRE6-like          103   3e-25   
emb|CAB41854.1|  hypothetical protein                                   103   4e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010547809.1|  PREDICTED: transcription factor PRE4-like          103   5e-25   
ref|XP_009390918.1|  PREDICTED: transcription factor ILI6-like          103   5e-25   
ref|XP_008341557.1|  PREDICTED: transcription factor PRE6-like          103   6e-25   
ref|XP_004491783.1|  PREDICTED: transcription factor bHLH135-like       103   6e-25   
gb|AAM67002.1|  DNA-binding protein-like                                103   8e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010528329.1|  PREDICTED: transcription factor PRE5               102   2e-24   
ref|XP_009591471.1|  PREDICTED: transcription factor PRE1-like          102   2e-24   
ref|XP_009380170.1|  PREDICTED: transcription factor ILI7-like          102   2e-24   
gb|EPS68402.1|  hypothetical protein M569_06365                         101   3e-24   
ref|XP_009395121.1|  PREDICTED: transcription factor ILI6-like          101   3e-24   
gb|KFK34072.1|  hypothetical protein AALP_AA5G098800                    104   3e-24   
gb|EPS67081.1|  hypothetical protein M569_07696                         101   5e-24   
emb|CDY65320.1|  BnaC06g42240D                                          100   6e-24   
ref|XP_009151837.1|  PREDICTED: transcription factor PRE5-like          100   7e-24   
ref|XP_006395335.1|  hypothetical protein EUTSA_v10005197mg             100   7e-24   
ref|XP_010435835.1|  PREDICTED: transcription factor PRE1               100   7e-24   
ref|XP_004489383.1|  PREDICTED: transcription factor bHLH135-like       100   9e-24   
ref|XP_009416873.1|  PREDICTED: transcription factor ILI5-like        99.8    1e-23   
ref|XP_009129354.1|  PREDICTED: transcription factor PRE5-like          100   1e-23   
ref|XP_009111609.1|  PREDICTED: transcription factor PRE5             99.8    1e-23   
ref|XP_004293633.1|  PREDICTED: transcription factor bHLH135-like     99.8    1e-23   
ref|XP_004511222.1|  PREDICTED: transcription factor bHLH135-like     99.4    2e-23   
ref|XP_009125118.1|  PREDICTED: transcription factor PRE1             99.4    2e-23   
ref|XP_009409165.1|  PREDICTED: transcription factor ILI3-like        99.0    2e-23   
ref|XP_002870750.1|  hypothetical protein ARALYDRAFT_916307           99.4    2e-23   
ref|XP_010693223.1|  PREDICTED: transcription factor PRE6             99.4    2e-23   
ref|XP_009787611.1|  PREDICTED: transcription factor PRE1-like        99.0    3e-23   
ref|XP_010108968.1|  hypothetical protein L484_027163                 98.6    4e-23   
ref|XP_010939530.1|  PREDICTED: transcription factor ILI5-like        98.2    5e-23   
ref|XP_010937075.1|  PREDICTED: transcription factor ILI5-like        98.2    5e-23   
ref|XP_010926541.1|  PREDICTED: transcription factor ILI3-like        98.2    5e-23   
ref|XP_009403179.1|  PREDICTED: transcription factor ILI5-like        98.2    5e-23   
emb|CDY00110.1|  BnaC09g01910D                                        98.2    5e-23   
emb|CDY04040.1|  BnaC02g37550D                                        98.2    5e-23   
ref|XP_011085763.1|  PREDICTED: transcription factor PRE1-like        98.2    5e-23   
ref|XP_008808056.1|  PREDICTED: transcription factor ILI5-like is...  97.8    6e-23   
ref|XP_006284840.1|  hypothetical protein CARUB_v10006122mg           97.8    8e-23   
ref|XP_009413611.1|  PREDICTED: transcription factor ILI3-like        97.1    2e-22   
ref|XP_006292118.1|  hypothetical protein CARUB_v10018314mg           97.1    2e-22   
ref|NP_198802.1|  bHLH transcription factor PRE1                      96.7    2e-22   Arabidopsis thaliana [mouse-ear cress]
gb|KFK33185.1|  hypothetical protein AALP_AA6G341300                  96.3    3e-22   
ref|XP_010917019.1|  PREDICTED: transcription factor ILI5-like        95.9    3e-22   
ref|XP_011098606.1|  PREDICTED: transcription factor PRE1-like        95.9    4e-22   
ref|XP_010531809.1|  PREDICTED: transcription factor PRE5-like        95.9    4e-22   
ref|XP_009409993.1|  PREDICTED: transcription factor ILI5-like        95.5    5e-22   
ref|XP_008668794.1|  PREDICTED: transcription factor ILI1-like        95.9    6e-22   
ref|XP_009407356.1|  PREDICTED: transcription factor ILI5-like        95.1    7e-22   
ref|XP_008808055.1|  PREDICTED: transcription factor ILI5-like is...  94.0    2e-21   
ref|XP_006343153.1|  PREDICTED: transcription factor bHLH135-like     94.0    2e-21   
ref|XP_002877136.1|  transcription regulator                          94.0    2e-21   
gb|AAM74282.1|AC083943_22  Hypothetical protein similar to putati...  93.6    3e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009401395.1|  PREDICTED: transcription factor ILI5-like        94.4    4e-21   
ref|XP_009126035.1|  PREDICTED: transcription factor PRE2-like        93.2    5e-21   
ref|XP_008784341.1|  PREDICTED: transcription factor ILI5-like        92.8    5e-21   
emb|CDY68961.1|  BnaCnng61200D                                        93.2    5e-21   
emb|CDX91006.1|  BnaC02g05910D                                        92.8    6e-21   
ref|XP_009393721.1|  PREDICTED: transcription factor ILI5-like        92.8    6e-21   
ref|XP_009406651.1|  PREDICTED: transcription factor ILI5-like        92.4    7e-21   
ref|XP_009401191.1|  PREDICTED: transcription factor ILI3-like        92.4    7e-21   
ref|XP_010514602.1|  PREDICTED: transcription factor PRE5             92.4    8e-21   
ref|XP_008803188.1|  PREDICTED: transcription factor ILI3             92.4    8e-21   
ref|XP_006400033.1|  hypothetical protein EUTSA_v10015131mg           91.3    2e-20   
ref|XP_010502885.1|  PREDICTED: transcription factor PRE5-like        91.3    2e-20   
ref|XP_010029295.1|  PREDICTED: transcription factor PRE5-like        91.3    3e-20   
ref|XP_002448623.1|  hypothetical protein SORBIDRAFT_06g030340        91.7    3e-20   Sorghum bicolor [broomcorn]
ref|XP_009131445.1|  PREDICTED: transcription factor PRE2-like        91.3    3e-20   
emb|CDX78615.1|  BnaA03g05270D                                        91.3    3e-20   
gb|KFK25753.1|  hypothetical protein AALP_AA8G155000                  90.9    3e-20   
gb|EMT04374.1|  Transcription factor bHLH135                          91.3    3e-20   
ref|XP_009398947.1|  PREDICTED: transcription factor ILI3-like        90.5    5e-20   
ref|XP_009121603.1|  PREDICTED: transcription factor PRE2             90.1    6e-20   
ref|XP_006661756.1|  PREDICTED: transcription factor bHLH135-like     90.1    6e-20   
gb|EYU34661.1|  hypothetical protein MIMGU_mgv1a018243mg              90.5    7e-20   
ref|XP_004983139.1|  PREDICTED: transcription factor bHLH135-like     89.4    1e-19   
gb|KHG06126.1|  Transcription factor protein                          89.4    1e-19   
gb|EMS57081.1|  hypothetical protein TRIUR3_30914                     89.7    1e-19   
ref|XP_006395334.1|  hypothetical protein EUTSA_v10005197mg           88.6    1e-19   
gb|EMT26736.1|  hypothetical protein F775_32795                       90.1    2e-19   
ref|XP_004977000.1|  PREDICTED: transcription factor bHLH135-like     89.4    2e-19   
emb|CDX85055.1|  BnaC05g20000D                                        88.6    2e-19   
ref|XP_010425666.1|  PREDICTED: transcription factor PRE5-like        88.6    3e-19   
ref|XP_002467276.1|  hypothetical protein SORBIDRAFT_01g022440        88.6    3e-19   Sorghum bicolor [broomcorn]
ref|NP_001152510.1|  DNA binding protein                              88.6    3e-19   Zea mays [maize]
ref|NP_197020.1|  protein banquo 2                                    88.6    3e-19   Arabidopsis thaliana [mouse-ear cress]
gb|EPS59766.1|  protein banquo 3                                      87.8    4e-19   
dbj|BAK06826.1|  predicted protein                                    88.2    4e-19   
emb|CDY63469.1|  BnaCnng42180D                                        87.8    5e-19   
ref|XP_006652899.1|  PREDICTED: transcription factor bHLH135-like     87.8    5e-19   
ref|XP_009380994.1|  PREDICTED: transcription factor ILI3-like        87.4    7e-19   
ref|XP_006288963.1|  hypothetical protein CARUB_v10002337mg           87.4    7e-19   
ref|XP_006649478.1|  PREDICTED: transcription factor bHLH135-like     87.0    8e-19   
sp|Q7X742.2|ILI1_ORYSJ  RecName: Full=Transcription factor ILI1; ...  87.4    9e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004953911.1|  PREDICTED: transcription factor bHLH135-like     87.0    9e-19   
ref|XP_010242423.1|  PREDICTED: transcription factor PRE6-like        87.0    1e-18   
ref|XP_002452552.1|  hypothetical protein SORBIDRAFT_04g027930        86.7    1e-18   Sorghum bicolor [broomcorn]
ref|XP_003570648.1|  PREDICTED: transcription factor ILI5             85.9    3e-18   
ref|NP_001148242.1|  LOC100281850                                     85.9    3e-18   Zea mays [maize]
dbj|BAK04484.1|  predicted protein                                    85.5    4e-18   
sp|Q6YUX0.1|ILI5_ORYSJ  RecName: Full=Transcription factor ILI5; ...  85.5    4e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009389867.1|  PREDICTED: transcription factor ILI3-like        85.1    5e-18   
ref|XP_004985532.1|  PREDICTED: transcription factor bHLH135-like     84.7    6e-18   
ref|NP_001149761.1|  DNA binding protein                              84.3    9e-18   Zea mays [maize]
ref|XP_009419459.1|  PREDICTED: transcription factor ILI3-like        84.0    1e-17   
gb|EMT28039.1|  Transcription factor bHLH135                          83.6    2e-17   
ref|XP_003564054.1|  PREDICTED: transcription factor ILI4-like        83.2    2e-17   
gb|EMT32161.1|  Transcription factor bHLH135                          82.8    3e-17   
ref|XP_009389730.1|  PREDICTED: transcription factor ILI3-like        82.4    5e-17   
ref|NP_001151208.1|  LOC100284841                                     82.0    7e-17   
ref|XP_004965032.1|  PREDICTED: transcription factor bHLH135-like     82.0    7e-17   
ref|XP_002436744.1|  hypothetical protein SORBIDRAFT_10g008000        82.0    7e-17   
ref|XP_006655931.1|  PREDICTED: transcription factor bHLH135-like     81.6    8e-17   
ref|XP_009773320.1|  PREDICTED: transcription factor ILI5-like        81.6    9e-17   
ref|XP_006647889.1|  PREDICTED: transcription factor bHLH135-like     81.6    9e-17   
ref|NP_001049114.1|  Os03g0171700                                     81.3    1e-16   
ref|NP_001152393.1|  DNA binding protein                              81.3    1e-16   
ref|XP_011087225.1|  PREDICTED: transcription factor ILI5-like        80.9    2e-16   
ref|XP_009616651.1|  PREDICTED: transcription factor ILI5-like        80.5    2e-16   
ref|XP_008351836.1|  PREDICTED: transcription factor PRE6-like        80.1    3e-16   
gb|AGT17211.1|  transcription factor                                  80.1    4e-16   
ref|NP_001057203.1|  Os06g0226500                                     79.7    4e-16   
ref|XP_009420735.1|  PREDICTED: transcription factor ILI5-like        79.7    5e-16   
gb|EYU24396.1|  hypothetical protein MIMGU_mgv1a018583mg              79.7    6e-16   
dbj|BAJ91340.1|  predicted protein                                    79.0    8e-16   
ref|XP_002511555.1|  DNA binding protein, putative                    79.0    9e-16   
gb|ABF94217.1|  hypothetical protein LOC_Os03g07510                   79.0    1e-15   
ref|XP_009409145.1|  PREDICTED: transcription factor ILI5-like        78.6    2e-15   
ref|XP_008393139.1|  PREDICTED: transcription factor PRE6-like        78.6    2e-15   
ref|XP_010229116.1|  PREDICTED: transcription factor ILI7 isoform X1  79.3    2e-15   
ref|XP_003558707.1|  PREDICTED: transcription factor ILI3             77.8    2e-15   
ref|XP_003580657.1|  PREDICTED: transcription factor ILI1-like        78.2    3e-15   
ref|XP_006439622.1|  hypothetical protein CICLE_v10024517mg           78.2    3e-15   
gb|EPS71427.1|  transcription factor style2.1                         77.4    4e-15   
gb|EMT13985.1|  hypothetical protein F775_15902                       77.0    4e-15   
dbj|BAJ97978.1|  predicted protein                                    76.3    5e-15   
ref|XP_009631846.1|  PREDICTED: transcription factor PRE6-like        77.0    6e-15   
emb|CBI15246.3|  unnamed protein product                              76.6    6e-15   
gb|KCW48830.1|  hypothetical protein EUGRSUZ_K02466                   76.3    1e-14   
ref|XP_008393138.1|  PREDICTED: transcription factor PRE6-like        74.7    3e-14   
ref|XP_009780893.1|  PREDICTED: transcription factor ILI6-like        74.7    5e-14   
gb|EMT05397.1|  Transcription factor bHLH135                          73.9    9e-14   
emb|CDP12349.1|  unnamed protein product                              71.2    7e-13   
ref|XP_007037290.1|  Basic helix-loop-helix DNA-binding family pr...  71.2    7e-13   
ref|XP_010497842.1|  PREDICTED: transcription factor PRE1-like        70.5    9e-13   
ref|XP_007140557.1|  hypothetical protein PHAVU_008G122600g           70.5    1e-12   
ref|XP_010092048.1|  hypothetical protein L484_005298                 70.1    2e-12   
gb|KGN63980.1|  DNA binding protein                                   69.3    3e-12   
gb|ABD32218.2|  Helix-loop-helix DNA-binding                          68.6    4e-12   
gb|KHN07208.1|  Transcription factor bHLH135                          68.9    5e-12   
ref|XP_008663647.1|  PREDICTED: transcription factor ILI1-like        69.3    5e-12   
ref|NP_001068236.1|  Os11g0603000                                     68.9    7e-12   
gb|KDP31231.1|  hypothetical protein JCGZ_11607                       68.2    1e-11   
gb|EEC68440.1|  hypothetical protein OsI_36646                        67.0    2e-11   
ref|XP_009623625.1|  PREDICTED: transcription factor PRE1-like        65.9    5e-11   
ref|NP_001048118.2|  Os02g0747900                                     62.0    6e-10   
gb|KHN15226.1|  Transcription factor bHLH135                          62.4    1e-09   
ref|XP_008440200.1|  PREDICTED: transcription factor PRE5-like        60.8    3e-09   
ref|XP_003522332.1|  PREDICTED: transcription factor bHLH135-like     58.5    2e-08   
ref|XP_008374534.1|  PREDICTED: transcription factor PRE6-like        58.5    3e-08   
ref|XP_009369317.1|  PREDICTED: transcription factor PRE6-like        58.2    4e-08   
ref|XP_003622994.1|  DNA-binding protein-like protein                 56.6    9e-08   
gb|EPS57632.1|  hypothetical protein M569_17185                       56.2    1e-07   
ref|XP_003528189.1|  PREDICTED: transcription factor bHLH135-like     56.2    1e-07   
emb|CCD74522.1|  unknown                                              53.1    5e-06   
gb|ABD32217.2|  hypothetical protein MtrDRAFT_AC148762g31v2           50.4    9e-06   
ref|XP_007138199.1|  hypothetical protein PHAVU_009G188800g           50.8    1e-05   
ref|XP_004515611.1|  PREDICTED: transcription factor bHLH135-like     49.7    3e-05   
ref|XP_007210662.1|  hypothetical protein PRUPE_ppa022186mg           49.7    3e-05   
ref|XP_007032502.1|  Uncharacterized protein TCM_018486               48.9    5e-05   
gb|KDP45497.1|  hypothetical protein JCGZ_09746                       47.0    3e-04   



>ref|XP_006439625.1| hypothetical protein CICLE_v10023072mg [Citrus clementina]
 ref|XP_006476632.1| PREDICTED: transcription factor bHLH135-like [Citrus sinensis]
 gb|ESR52865.1| hypothetical protein CICLE_v10023072mg [Citrus clementina]
 gb|KDO76090.1| hypothetical protein CISIN_1g048534mg [Citrus sinensis]
Length=91

 Score =   135 bits (341),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/76 (89%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLA  327
            I+DDQINDLVSKLQQLLPELRN  SDKVSA +VLQ+TCNYIRSLHREVDDLSERLSELLA
Sbjct  16   ITDDQINDLVSKLQQLLPELRNNRSDKVSAGKVLQETCNYIRSLHREVDDLSERLSELLA  75

Query  328  TTDTNQAALIRSLLMQ  375
            TTDT QAA+IRSLLMQ
Sbjct  76   TTDTAQAAIIRSLLMQ  91



>ref|XP_009610749.1| PREDICTED: transcription factor PRE3-like [Nicotiana tomentosiformis]
Length=91

 Score =   135 bits (339),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 69/76 (91%), Positives = 73/76 (96%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLA  327
            IS+DQINDLVSKLQQLLPELRN SSDKVSAARVLQ+TCNYIRSLHREVDDLS+RLSELL 
Sbjct  16   ISEDQINDLVSKLQQLLPELRNRSSDKVSAARVLQETCNYIRSLHREVDDLSDRLSELLE  75

Query  328  TTDTNQAALIRSLLMQ  375
            T+DT QAALIRSLLMQ
Sbjct  76   TSDTTQAALIRSLLMQ  91



>ref|XP_007210171.1| hypothetical protein PRUPE_ppa018631mg [Prunus persica]
 gb|EMJ11370.1| hypothetical protein PRUPE_ppa018631mg [Prunus persica]
Length=92

 Score =   133 bits (334),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/81 (85%), Positives = 75/81 (93%), Gaps = 1/81 (1%)
 Frame = +1

Query  136  GASRISDDQINDLVSKLQQLLPELRNTS-SDKVSAARVLQDTCNYIRSLHREVDDLSERL  312
            G +RISDDQINDLVSKLQQLLPE+RN+  SDKVSAA VLQ+TCNYIRSLHREVDDLSERL
Sbjct  12   GGARISDDQINDLVSKLQQLLPEIRNSRRSDKVSAATVLQETCNYIRSLHREVDDLSERL  71

Query  313  SELLATTDTNQAALIRSLLMQ  375
            SELLATTD+ QAA+IRSLL Q
Sbjct  72   SELLATTDSAQAAVIRSLLSQ  92



>ref|XP_004499430.1| PREDICTED: transcription factor bHLH135-like [Cicer arietinum]
Length=93

 Score =   133 bits (334),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/76 (87%), Positives = 74/76 (97%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLA  327
            I+DDQI+DLVSKLQQLLPE+RN SSDKVSA+RVLQ+TCNYIRSLHREVDDLSERLSELLA
Sbjct  18   ITDDQIHDLVSKLQQLLPEIRNRSSDKVSASRVLQETCNYIRSLHREVDDLSERLSELLA  77

Query  328  TTDTNQAALIRSLLMQ  375
            TTD+ QAA+IR+LLMQ
Sbjct  78   TTDSAQAAIIRNLLMQ  93



>ref|XP_009615362.1| PREDICTED: transcription factor PRE3-like [Nicotiana tomentosiformis]
Length=93

 Score =   133 bits (334),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/76 (89%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLA  327
            IS+DQINDLVSKLQ LLPELRN SSDKVSAARVLQDTCNYIR LHREVDDLSERLS+LLA
Sbjct  18   ISEDQINDLVSKLQDLLPELRNRSSDKVSAARVLQDTCNYIRGLHREVDDLSERLSQLLA  77

Query  328  TTDTNQAALIRSLLMQ  375
            T+DT QAALIRSLL+Q
Sbjct  78   TSDTAQAALIRSLLLQ  93



>ref|XP_009772499.1| PREDICTED: transcription factor PRE3-like [Nicotiana sylvestris]
Length=91

 Score =   132 bits (332),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/76 (88%), Positives = 73/76 (96%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLA  327
            IS+DQINDLVSKLQQ+LPEL+N SSDKVSAARVLQ+TCNYIRSLHREVDDLS+RLSELL 
Sbjct  16   ISEDQINDLVSKLQQVLPELQNRSSDKVSAARVLQETCNYIRSLHREVDDLSDRLSELLE  75

Query  328  TTDTNQAALIRSLLMQ  375
            T+DT QAALIRSLLMQ
Sbjct  76   TSDTTQAALIRSLLMQ  91



>ref|XP_008453188.1| PREDICTED: transcription factor PRE3-like [Cucumis melo]
Length=92

 Score =   132 bits (331),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 73/76 (96%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLA  327
            I+DDQINDLVSKLQQLLPE+R+  SDKVSAA+VLQ+TCNYIR+LHREVDDLSERLSELLA
Sbjct  17   ITDDQINDLVSKLQQLLPEIRHRQSDKVSAAKVLQETCNYIRNLHREVDDLSERLSELLA  76

Query  328  TTDTNQAALIRSLLMQ  375
            T+DT QAA+IRSLLMQ
Sbjct  77   TSDTAQAAIIRSLLMQ  92



>ref|XP_007037282.1| Activation-tagged BRI1(brassinosteroid-insensitive 1)-suppressor 
1 [Theobroma cacao]
 gb|EOY21783.1| Activation-tagged BRI1(brassinosteroid-insensitive 1)-suppressor 
1 [Theobroma cacao]
Length=91

 Score =   132 bits (331),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 73/76 (96%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLA  327
            I+DDQI+DLV+KLQQLLPE+RN  SDKVSAA+VLQ+TCNYIRSLHREVDDLSERLSELLA
Sbjct  16   ITDDQIDDLVTKLQQLLPEIRNRHSDKVSAAKVLQETCNYIRSLHREVDDLSERLSELLA  75

Query  328  TTDTNQAALIRSLLMQ  375
            TTD+ QAA+IRSLLMQ
Sbjct  76   TTDSAQAAIIRSLLMQ  91



>ref|XP_009803678.1| PREDICTED: transcription factor PRE3-like [Nicotiana sylvestris]
Length=93

 Score =   131 bits (330),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 67/76 (88%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLA  327
            IS+DQINDLVSKLQ LLPELRN SSDKVS+ARVLQDTCNYIR LHREVDDLSERLS+LLA
Sbjct  18   ISEDQINDLVSKLQDLLPELRNRSSDKVSSARVLQDTCNYIRGLHREVDDLSERLSQLLA  77

Query  328  TTDTNQAALIRSLLMQ  375
            T+DT QAALIRSLL+Q
Sbjct  78   TSDTAQAALIRSLLLQ  93



>ref|XP_008239815.1| PREDICTED: transcription factor PRE3-like [Prunus mume]
Length=92

 Score =   131 bits (330),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 68/81 (84%), Positives = 74/81 (91%), Gaps = 1/81 (1%)
 Frame = +1

Query  136  GASRISDDQINDLVSKLQQLLPELRNTS-SDKVSAARVLQDTCNYIRSLHREVDDLSERL  312
            G +RISDDQINDLVSKLQQLLPE+RN+  SDK SAA VLQ+TCNYIRSLHREVDDLSERL
Sbjct  12   GGARISDDQINDLVSKLQQLLPEIRNSRRSDKASAATVLQETCNYIRSLHREVDDLSERL  71

Query  313  SELLATTDTNQAALIRSLLMQ  375
            SELLATTD+ QAA+IRSLL Q
Sbjct  72   SELLATTDSAQAAVIRSLLSQ  92



>ref|XP_004241574.1| PREDICTED: transcription factor PRE3 [Solanum lycopersicum]
 ref|XP_006354787.1| PREDICTED: transcription factor bHLH135-like [Solanum tuberosum]
Length=92

 Score =   131 bits (330),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 66/76 (87%), Positives = 73/76 (96%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLA  327
            IS+DQINDLV+KLQQLLPELRN SSDKVSA+RVLQDTCNYI+SLHREVDDLS+RLSELL 
Sbjct  17   ISEDQINDLVNKLQQLLPELRNRSSDKVSASRVLQDTCNYIKSLHREVDDLSDRLSELLE  76

Query  328  TTDTNQAALIRSLLMQ  375
            ++DT QAALIRSLLMQ
Sbjct  77   SSDTTQAALIRSLLMQ  92



>ref|NP_001235265.1| uncharacterized protein LOC100527636 [Glycine max]
 ref|XP_006577791.1| PREDICTED: uncharacterized protein LOC100527636 isoform X1 [Glycine 
max]
 gb|ACU16765.1| unknown [Glycine max]
 gb|KHN21870.1| Transcription factor bHLH135 [Glycine soja]
Length=92

 Score =   131 bits (329),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 73/76 (96%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLA  327
            I+DDQINDLVSKLQQLLPE+R+  SDKVSA++VLQ+TCNYIRSLHREVDDLSERLSELLA
Sbjct  17   ITDDQINDLVSKLQQLLPEIRDRRSDKVSASKVLQETCNYIRSLHREVDDLSERLSELLA  76

Query  328  TTDTNQAALIRSLLMQ  375
            TTDT QAA+IR+LLMQ
Sbjct  77   TTDTAQAAIIRNLLMQ  92



>ref|XP_002511551.1| transcription regulator, putative [Ricinus communis]
 gb|EEF52153.1| transcription regulator, putative [Ricinus communis]
Length=91

 Score =   130 bits (327),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/76 (87%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLA  327
            I+DDQI DLVSKLQQLLPE+RN  SDKVSAA+VLQ+TCNYIRSLHREVDDLSERLSELLA
Sbjct  16   ITDDQILDLVSKLQQLLPEIRNRRSDKVSAAKVLQETCNYIRSLHREVDDLSERLSELLA  75

Query  328  TTDTNQAALIRSLLMQ  375
            TTDT QAA+IR+LLMQ
Sbjct  76   TTDTAQAAIIRNLLMQ  91



>ref|XP_004138158.1| PREDICTED: transcription factor bHLH135-like [Cucumis sativus]
 ref|XP_004154981.1| PREDICTED: transcription factor bHLH135-like [Cucumis sativus]
Length=92

 Score =   130 bits (327),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/76 (84%), Positives = 73/76 (96%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLA  327
            I+DDQINDLVSKLQQLLPE+R+  SDKVSA++VLQ+TCNYIR+LHREVDDLSERLSELLA
Sbjct  17   ITDDQINDLVSKLQQLLPEIRHRQSDKVSASKVLQETCNYIRNLHREVDDLSERLSELLA  76

Query  328  TTDTNQAALIRSLLMQ  375
            T+DT QAA+IRSLLMQ
Sbjct  77   TSDTAQAAIIRSLLMQ  92



>ref|XP_010044722.1| PREDICTED: transcription factor PRE3-like [Eucalyptus grandis]
 gb|KCW86822.1| hypothetical protein EUGRSUZ_B03420 [Eucalyptus grandis]
Length=91

 Score =   130 bits (327),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 73/79 (92%), Gaps = 0/79 (0%)
 Frame = +1

Query  136  GASRISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLS  315
            G SRISDDQI DLVSKLQ+L+PE+RN  SDKVSA++VLQ+TCNYIRSLHREVDDLSERLS
Sbjct  13   GGSRISDDQIADLVSKLQRLIPEIRNRRSDKVSASKVLQETCNYIRSLHREVDDLSERLS  72

Query  316  ELLATTDTNQAALIRSLLM  372
            ELLA +D+ QAA+IRSLLM
Sbjct  73   ELLADSDSEQAAIIRSLLM  91



>emb|CDY69564.1| BnaAnng30830D, partial [Brassica napus]
Length=88

 Score =   130 bits (326),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/83 (82%), Positives = 75/83 (90%), Gaps = 1/83 (1%)
 Frame = +1

Query  130  TGGASRISDDQINDLVSKLQQLLPELRNTS-SDKVSAARVLQDTCNYIRSLHREVDDLSE  306
            + G +RIS+DQINDLV KLQQLLPELR++  SDKVSAARVLQDTCNYIR+LHREVDDLSE
Sbjct  6    SSGTTRISEDQINDLVIKLQQLLPELRDSHRSDKVSAARVLQDTCNYIRNLHREVDDLSE  65

Query  307  RLSELLATTDTNQAALIRSLLMQ  375
            RLSELLA +DT QAALIRSLL Q
Sbjct  66   RLSELLANSDTAQAALIRSLLTQ  88



>ref|XP_010242417.1| PREDICTED: transcription factor PRE6-like [Nelumbo nucifera]
Length=92

 Score =   130 bits (326),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 67/77 (87%), Positives = 73/77 (95%), Gaps = 2/77 (3%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLA  327
            I+DDQINDLVSKLQQLLPE+R+  SDKVSAA+VLQ+TCNYIRSLHREVDDLSERLSELLA
Sbjct  16   ITDDQINDLVSKLQQLLPEIRDRRSDKVSAAKVLQETCNYIRSLHREVDDLSERLSELLA  75

Query  328  TTDTN--QAALIRSLLM  372
            TTDTN  QAA+IRSLLM
Sbjct  76   TTDTNSAQAAIIRSLLM  92



>gb|AFK43493.1| unknown [Medicago truncatula]
 gb|KEH33416.1| transcription factor [Medicago truncatula]
Length=92

 Score =   130 bits (326),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 74/76 (97%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLA  327
            I+DDQI+DLVSKLQQLLPE+RN SSDKVSA+RVLQ+TCNYIR+L+REVDDLSERLSELLA
Sbjct  17   ITDDQIHDLVSKLQQLLPEIRNRSSDKVSASRVLQETCNYIRNLNREVDDLSERLSELLA  76

Query  328  TTDTNQAALIRSLLMQ  375
            TTDT QAA+IR+LLMQ
Sbjct  77   TTDTAQAAIIRNLLMQ  92



>ref|XP_007138203.1| hypothetical protein PHAVU_009G189200g [Phaseolus vulgaris]
 gb|ESW10197.1| hypothetical protein PHAVU_009G189200g [Phaseolus vulgaris]
Length=92

 Score =   129 bits (325),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 64/76 (84%), Positives = 73/76 (96%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLA  327
            I+DDQINDLVSKLQQLLPE+R+  SDKVSA++VLQ+TCNYIRSLHREVDDLSERLSELLA
Sbjct  17   ITDDQINDLVSKLQQLLPEIRDRRSDKVSASKVLQETCNYIRSLHREVDDLSERLSELLA  76

Query  328  TTDTNQAALIRSLLMQ  375
            TTD+ QAA+IR+LLMQ
Sbjct  77   TTDSAQAAIIRNLLMQ  92



>emb|CDP12359.1| unnamed protein product [Coffea canephora]
Length=93

 Score =   129 bits (324),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 67/76 (88%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLA  327
            I+DDQI DLVSKLQQLLPELRN  SDKVSAARVLQ+TCNYIRSLHREVDDLSERLSELLA
Sbjct  16   ITDDQIIDLVSKLQQLLPELRNRCSDKVSAARVLQETCNYIRSLHREVDDLSERLSELLA  75

Query  328  TTDTNQAALIRSLLMQ  375
             +DT+QAALIRSLL Q
Sbjct  76   NSDTSQAALIRSLLSQ  91



>ref|XP_010539967.1| PREDICTED: transcription factor PRE3 [Tarenaya hassleriana]
Length=92

 Score =   129 bits (323),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 66/76 (87%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLA  327
            ISDDQINDL+ KLQQLLPELRN SSDKVSA RVLQ+TCNYIR+LHREVDDLSERLSELLA
Sbjct  16   ISDDQINDLILKLQQLLPELRNRSSDKVSAGRVLQETCNYIRNLHREVDDLSERLSELLA  75

Query  328  TTDTNQAALIRSLLMQ  375
             TD+ QAALIRSLL Q
Sbjct  76   NTDSAQAALIRSLLTQ  91



>gb|AFK36119.1| unknown [Lotus japonicus]
Length=92

 Score =   129 bits (323),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 64/76 (84%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLA  327
            I+DDQI+DLVSKLQQLLPE+R   SDKVSA++VLQ+TCNYIRSLHREVDDLSERLSELLA
Sbjct  17   ITDDQIHDLVSKLQQLLPEIRERRSDKVSASKVLQETCNYIRSLHREVDDLSERLSELLA  76

Query  328  TTDTNQAALIRSLLMQ  375
            TTDT QAA+IR+LLMQ
Sbjct  77   TTDTAQAAIIRNLLMQ  92



>ref|XP_010102446.1| hypothetical protein L484_006129 [Morus notabilis]
 gb|EXB93467.1| hypothetical protein L484_006129 [Morus notabilis]
Length=91

 Score =   128 bits (322),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLA  327
            I+DDQINDLVSKLQQLLPE+R+  SDKVSAA+VLQ+TCNYIRSLHREVDDLSERLSELLA
Sbjct  16   ITDDQINDLVSKLQQLLPEIRDRRSDKVSAAKVLQETCNYIRSLHREVDDLSERLSELLA  75

Query  328  TTDTNQAALIRSLLMQ  375
            T+DT QAA+IRSLL Q
Sbjct  76   TSDTAQAAIIRSLLNQ  91



>ref|XP_008437438.1| PREDICTED: transcription factor PRE3-like [Cucumis melo]
Length=90

 Score =   127 bits (320),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/76 (84%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLA  327
            ISD+QI DLV KLQQLLPE+RN  SDKVSAA+VLQ+TCNYIRSLHREVDDLSERLSELLA
Sbjct  15   ISDEQITDLVHKLQQLLPEIRNRHSDKVSAAKVLQETCNYIRSLHREVDDLSERLSELLA  74

Query  328  TTDTNQAALIRSLLMQ  375
            T+DT QAA+IRSLL Q
Sbjct  75   TSDTAQAAIIRSLLTQ  90



>ref|XP_008374533.1| PREDICTED: transcription factor PRE3-like [Malus domestica]
 ref|XP_008356616.1| PREDICTED: transcription factor PRE3-like [Malus domestica]
Length=92

 Score =   127 bits (319),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 66/77 (86%), Positives = 73/77 (95%), Gaps = 1/77 (1%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNT-SSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELL  324
            ISDDQINDLVSKLQQLLPE+RN+  SDKVSA+ VLQ+TCNYIR+LHREVDDLSERLSELL
Sbjct  16   ISDDQINDLVSKLQQLLPEIRNSRXSDKVSASTVLQETCNYIRNLHREVDDLSERLSELL  75

Query  325  ATTDTNQAALIRSLLMQ  375
            ATTDT QAA+IRSLL+Q
Sbjct  76   ATTDTAQAAVIRSLLLQ  92



>ref|XP_009104757.1| PREDICTED: transcription factor PRE3-like [Brassica rapa]
Length=93

 Score =   127 bits (318),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 66/79 (84%), Positives = 73/79 (92%), Gaps = 1/79 (1%)
 Frame = +1

Query  136  GASRISDDQINDLVSKLQQLLPELRNTS-SDKVSAARVLQDTCNYIRSLHREVDDLSERL  312
            G SRIS++QINDL+ KLQQLLPELR++  SDKVSAARVLQ+TCNYIR+LHREVDDLSERL
Sbjct  13   GTSRISEEQINDLIIKLQQLLPELRDSRRSDKVSAARVLQETCNYIRNLHREVDDLSERL  72

Query  313  SELLATTDTNQAALIRSLL  369
            SELLA TDT QAALIRSLL
Sbjct  73   SELLANTDTAQAALIRSLL  91



>emb|CDX85840.1| BnaC06g22940D [Brassica napus]
 emb|CDX85841.1| BnaC06g22930D [Brassica napus]
 emb|CDX68180.1| BnaA07g22200D [Brassica napus]
Length=93

 Score =   126 bits (317),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 66/79 (84%), Positives = 73/79 (92%), Gaps = 1/79 (1%)
 Frame = +1

Query  136  GASRISDDQINDLVSKLQQLLPELRNTS-SDKVSAARVLQDTCNYIRSLHREVDDLSERL  312
            G SRIS++QINDL+ KLQQLLPELR++  SDKVSAARVLQ+TCNYIR+LHREVDDLSERL
Sbjct  13   GTSRISEEQINDLIIKLQQLLPELRDSRRSDKVSAARVLQETCNYIRNLHREVDDLSERL  72

Query  313  SELLATTDTNQAALIRSLL  369
            SELLA TDT QAALIRSLL
Sbjct  73   SELLANTDTAQAALIRSLL  91



>ref|XP_002274840.1| PREDICTED: transcription factor PRE3 [Vitis vinifera]
 emb|CBI15249.3| unnamed protein product [Vitis vinifera]
Length=91

 Score =   126 bits (317),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 64/76 (84%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLA  327
            I+DDQINDLVSKLQQLLPE+R   SDKVSAA+VLQ+TCNYIRSL+REVDDLSERLSELLA
Sbjct  16   ITDDQINDLVSKLQQLLPEIRGRHSDKVSAAKVLQETCNYIRSLNREVDDLSERLSELLA  75

Query  328  TTDTNQAALIRSLLMQ  375
            TTD+ QAA+IRSLL Q
Sbjct  76   TTDSAQAAIIRSLLTQ  91



>ref|XP_011087224.1| PREDICTED: transcription factor PRE3 [Sesamum indicum]
Length=91

 Score =   126 bits (316),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 64/76 (84%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLA  327
            I+DDQIN+LVSKLQQLLPE+ N  SDK SAA+VLQ+TCNYIRSLHREVDDLSERLSELLA
Sbjct  16   ITDDQINELVSKLQQLLPEMHNRRSDKRSAAKVLQETCNYIRSLHREVDDLSERLSELLA  75

Query  328  TTDTNQAALIRSLLMQ  375
             TDT QAALIRSLL Q
Sbjct  76   NTDTTQAALIRSLLTQ  91



>ref|XP_004299384.1| PREDICTED: transcription factor bHLH135-like [Fragaria vesca 
subsp. vesca]
Length=92

 Score =   125 bits (315),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/77 (84%), Positives = 73/77 (95%), Gaps = 1/77 (1%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTS-SDKVSAARVLQDTCNYIRSLHREVDDLSERLSELL  324
            ISDDQINDLV+KLQQLLPE+RN+  SDKVSA+ VLQ+TCNYIR+LHREVDDLSERLSELL
Sbjct  16   ISDDQINDLVTKLQQLLPEIRNSRRSDKVSASTVLQETCNYIRNLHREVDDLSERLSELL  75

Query  325  ATTDTNQAALIRSLLMQ  375
            ATTDT QAA+IRSLL+Q
Sbjct  76   ATTDTAQAAVIRSLLLQ  92



>emb|CAN67278.1| hypothetical protein VITISV_022020 [Vitis vinifera]
Length=91

 Score =   125 bits (315),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/76 (84%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLA  327
            I+DDQINDLVSKLQQLLPE+R   SDKVSAA+VLQ+TCNYIRSL+REVDDLSERLSELLA
Sbjct  16   ITDDQINDLVSKLQQLLPEIRGRHSDKVSAAKVLQETCNYIRSLNREVDDLSERLSELLA  75

Query  328  TTDTNQAALIRSLLMQ  375
            TTD  QAA+IRSLL Q
Sbjct  76   TTDXAQAAIIRSLLTQ  91



>ref|XP_003527066.1| PREDICTED: transcription factor bHLH135 [Glycine max]
 gb|KHN30821.1| Transcription factor bHLH135 [Glycine soja]
Length=92

 Score =   125 bits (315),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLA  327
            I+DDQINDLVSKLQQLLPE+R+  SDKVSA++VLQ+TCNYIRSLHREV DLSERLSELL 
Sbjct  17   ITDDQINDLVSKLQQLLPEIRDRRSDKVSASKVLQETCNYIRSLHREVGDLSERLSELLD  76

Query  328  TTDTNQAALIRSLLMQ  375
            TTDT QAA+IR+LLMQ
Sbjct  77   TTDTAQAAIIRNLLMQ  92



>ref|XP_010037162.1| PREDICTED: transcription factor PRE3-like [Eucalyptus grandis]
 gb|KCW48828.1| hypothetical protein EUGRSUZ_K02464 [Eucalyptus grandis]
Length=91

 Score =   125 bits (314),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLA  327
            ISDDQI DLVSKLQQLLPE+RN  SDKVSAA+VLQ+TCN+IRSLHREVDDLSERLSELLA
Sbjct  16   ISDDQIIDLVSKLQQLLPEIRNRRSDKVSAAKVLQETCNHIRSLHREVDDLSERLSELLA  75

Query  328  TTDTNQAALIRSLLMQ  375
             +D++QAA+IR+LLMQ
Sbjct  76   NSDSDQAAVIRNLLMQ  91



>ref|XP_009369325.1| PREDICTED: transcription factor PRE3 [Pyrus x bretschneideri]
Length=92

 Score =   125 bits (314),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/77 (86%), Positives = 72/77 (94%), Gaps = 1/77 (1%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTS-SDKVSAARVLQDTCNYIRSLHREVDDLSERLSELL  324
            ISDDQINDLVSKLQQLLPE+RN+  SDKVSA+ VLQ+TCNYIR+LHREVDDLSERLSELL
Sbjct  16   ISDDQINDLVSKLQQLLPEIRNSRRSDKVSASTVLQETCNYIRNLHREVDDLSERLSELL  75

Query  325  ATTDTNQAALIRSLLMQ  375
            ATTDT QAA+IRSLL Q
Sbjct  76   ATTDTAQAAVIRSLLSQ  92



>ref|XP_009128048.1| PREDICTED: transcription factor PRE3 [Brassica rapa]
Length=93

 Score =   125 bits (314),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/79 (84%), Positives = 73/79 (92%), Gaps = 1/79 (1%)
 Frame = +1

Query  142  SRISDDQINDLVSKLQQLLPELRNTS-SDKVSAARVLQDTCNYIRSLHREVDDLSERLSE  318
            +RIS+DQINDLV KLQQLLPELR++  SDKVSAARVLQDTCNYIR+LHREVDDLSERLSE
Sbjct  15   TRISEDQINDLVIKLQQLLPELRDSHRSDKVSAARVLQDTCNYIRNLHREVDDLSERLSE  74

Query  319  LLATTDTNQAALIRSLLMQ  375
            LLA +DT QAAL+RSLL Q
Sbjct  75   LLANSDTAQAALLRSLLTQ  93



>ref|XP_002276549.1| PREDICTED: transcription factor PRE6 [Vitis vinifera]
 emb|CAN68305.1| hypothetical protein VITISV_041983 [Vitis vinifera]
 emb|CBI31987.3| unnamed protein product [Vitis vinifera]
Length=92

 Score =   125 bits (313),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 74/81 (91%), Gaps = 2/81 (2%)
 Frame = +1

Query  136  GASRISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLS  315
            G SRISDDQI DLVSKLQQL+PE+RN  SDKVSA++VLQ+TCNYIR+LHREVDDLS+RLS
Sbjct  12   GVSRISDDQIADLVSKLQQLIPEIRNRRSDKVSASKVLQETCNYIRNLHREVDDLSDRLS  71

Query  316  ELLATTDT--NQAALIRSLLM  372
             LLA+TDT  +QAA+IRSLLM
Sbjct  72   ALLASTDTDSDQAAIIRSLLM  92



>ref|XP_011071625.1| PREDICTED: transcription factor PRE3-like [Sesamum indicum]
Length=93

 Score =   125 bits (313),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +1

Query  136  GASRISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLS  315
            G+SRIS+D+IN+L+S+L QL+PE+ N+ SDK SA +VLQ+TCNYIRSL REVDDLSERLS
Sbjct  14   GSSRISEDRINELISQLHQLIPEMHNSRSDKRSAGKVLQETCNYIRSLEREVDDLSERLS  73

Query  316  ELLATTDTNQAALIRSLLMQ  375
            ELLATTD N AAL+RSLLMQ
Sbjct  74   ELLATTDANHAALLRSLLMQ  93



>ref|XP_002888981.1| hypothetical protein ARALYDRAFT_476585 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_006301219.1| hypothetical protein CARUB_v10021619mg [Capsella rubella]
 gb|EFH65240.1| hypothetical protein ARALYDRAFT_476585 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EOA34117.1| hypothetical protein CARUB_v10021619mg [Capsella rubella]
Length=93

 Score =   124 bits (312),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 66/77 (86%), Positives = 71/77 (92%), Gaps = 1/77 (1%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTS-SDKVSAARVLQDTCNYIRSLHREVDDLSERLSELL  324
            IS+DQINDL+ KLQQLLPELR++  SDKVSAARVLQDTCNYIR+LHREVDDLSERLSELL
Sbjct  17   ISEDQINDLIIKLQQLLPELRDSRRSDKVSAARVLQDTCNYIRNLHREVDDLSERLSELL  76

Query  325  ATTDTNQAALIRSLLMQ  375
            A TDT QAALIRSLL Q
Sbjct  77   ANTDTAQAALIRSLLTQ  93



>ref|XP_010416307.1| PREDICTED: transcription factor PRE3 [Camelina sativa]
 ref|XP_010428437.1| PREDICTED: transcription factor PRE3 [Camelina sativa]
 ref|XP_010471539.1| PREDICTED: transcription factor PRE3 [Camelina sativa]
Length=93

 Score =   124 bits (312),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 66/77 (86%), Positives = 71/77 (92%), Gaps = 1/77 (1%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTS-SDKVSAARVLQDTCNYIRSLHREVDDLSERLSELL  324
            IS+DQINDL+ KLQQLLPELR++  SDKVSAARVLQDTCNYIR+LHREVDDLSERLSELL
Sbjct  17   ISEDQINDLILKLQQLLPELRDSRRSDKVSAARVLQDTCNYIRNLHREVDDLSERLSELL  76

Query  325  ATTDTNQAALIRSLLMQ  375
            A TDT QAALIRSLL Q
Sbjct  77   ANTDTAQAALIRSLLTQ  93



>ref|XP_004152438.1| PREDICTED: transcription factor bHLH135-like [Cucumis sativus]
 ref|XP_004169011.1| PREDICTED: transcription factor bHLH135-like [Cucumis sativus]
 gb|KGN64245.1| hypothetical protein Csa_1G045430 [Cucumis sativus]
Length=90

 Score =   124 bits (310),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +1

Query  154  DDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLATT  333
            D+QI DLV KLQQLLPE+RN  SDKVSAA+VLQ+TCNYIRSLHREVDDLSERLSELLAT+
Sbjct  17   DEQITDLVHKLQQLLPEIRNRHSDKVSAAKVLQETCNYIRSLHREVDDLSERLSELLATS  76

Query  334  DTNQAALIRSLLMQ  375
            DT QAA+IRSLL Q
Sbjct  77   DTAQAAIIRSLLTQ  90



>ref|XP_011044025.1| PREDICTED: transcription factor PRE3-like [Populus euphratica]
Length=91

 Score =   123 bits (309),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +1

Query  154  DDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLATT  333
            DDQI DLV+KLQQLLPE+RN  SDKVSAA++LQ+TCNYI+SLHREVDDLSERLSELL TT
Sbjct  18   DDQILDLVTKLQQLLPEIRNRRSDKVSAAKILQETCNYIKSLHREVDDLSERLSELLETT  77

Query  334  DTNQAALIRSLLMQ  375
            DT QAA+IR+LLMQ
Sbjct  78   DTAQAAIIRNLLMQ  91



>ref|XP_011047163.1| PREDICTED: transcription factor PRE3-like [Populus euphratica]
 ref|XP_011047164.1| PREDICTED: transcription factor PRE3-like [Populus euphratica]
Length=91

 Score =   123 bits (309),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +1

Query  136  GASRISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLS  315
            G SRI+DDQI DLV+KLQQLLP  RN  S+KVSAA+ LQ+TCNYI+SLHREVDDLSERLS
Sbjct  12   GGSRINDDQILDLVTKLQQLLPGTRNRRSEKVSAAKALQETCNYIKSLHREVDDLSERLS  71

Query  316  ELLATTDTNQAALIRSLLMQ  375
            ELL TTDT QAA+IR+LL Q
Sbjct  72   ELLETTDTAQAAIIRNLLTQ  91



>gb|KHG03267.1| Transcription factor protein [Gossypium arboreum]
Length=92

 Score =   123 bits (309),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 75/84 (89%), Gaps = 2/84 (2%)
 Frame = +1

Query  127  NTGGASRISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSE  306
            +T G SRISDDQI +LVSKL+QLLPE+R+  SDKVSA++VLQ+TCNYIRSLHREVDDLSE
Sbjct  9    STAGVSRISDDQIIELVSKLRQLLPEIRDRRSDKVSASKVLQETCNYIRSLHREVDDLSE  68

Query  307  RLSELLATTDTN--QAALIRSLLM  372
            RLS+LLAT D +  +AA+IRSL+M
Sbjct  69   RLSQLLATIDADSAEAAIIRSLIM  92



>ref|NP_177590.1| transcription factor bHLH135 [Arabidopsis thaliana]
 sp|Q9CA64.1|PRE3_ARATH RecName: Full=Transcription factor PRE3; AltName: Full=Basic 
helix-loop-helix protein 135; Short=AtbHLH135; Short=bHLH 135; 
AltName: Full=Protein ACTIVATION-TAGGED BRI1 SUPPRESSOR 1; 
Short=ATBS1; AltName: Full=Protein PACLOBUTRAZOL RESISTANCE 
3; AltName: Full=Protein TARGET OF MOOPTEROS 7; AltName: Full=Transcription 
factor EN 67; AltName: Full=bHLH transcription 
factor bHLH135 [Arabidopsis thaliana]
 gb|AAG52350.1|AC011765_2 putative DNA-binding protein; 54988-54618 [Arabidopsis thaliana]
 gb|AAM65825.1| putative DNA-binding protein [Arabidopsis thaliana]
 gb|AAO23611.1| At1g74500 [Arabidopsis thaliana]
 dbj|BAE99399.1| putative DNA-binding protein [Arabidopsis thaliana]
 gb|AEE35600.1| transcription factor bHLH135 [Arabidopsis thaliana]
Length=93

 Score =   123 bits (309),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/77 (84%), Positives = 71/77 (92%), Gaps = 1/77 (1%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTS-SDKVSAARVLQDTCNYIRSLHREVDDLSERLSELL  324
            IS+DQINDL+ KLQQLLPELR++  SDKVSAARVLQDTCNYIR+LHREVDDLSERLSELL
Sbjct  17   ISEDQINDLIIKLQQLLPELRDSRRSDKVSAARVLQDTCNYIRNLHREVDDLSERLSELL  76

Query  325  ATTDTNQAALIRSLLMQ  375
            A +DT QAALIRSLL Q
Sbjct  77   ANSDTAQAALIRSLLTQ  93



>gb|KFK41891.1| hypothetical protein AALP_AA2G185600 [Arabis alpina]
Length=93

 Score =   123 bits (308),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/77 (84%), Positives = 71/77 (92%), Gaps = 1/77 (1%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTS-SDKVSAARVLQDTCNYIRSLHREVDDLSERLSELL  324
            IS+DQINDL+ KLQQLLPELR++  SDKVSAARVLQ+TCNYIR+LHREVDDLSERLSELL
Sbjct  17   ISEDQINDLIIKLQQLLPELRDSRRSDKVSAARVLQETCNYIRNLHREVDDLSERLSELL  76

Query  325  ATTDTNQAALIRSLLMQ  375
            A TDT QAALIRSLL Q
Sbjct  77   ANTDTAQAALIRSLLTQ  93



>ref|XP_010256912.1| PREDICTED: transcription factor ILI6-like [Nelumbo nucifera]
Length=92

 Score =   123 bits (308),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/77 (83%), Positives = 71/77 (92%), Gaps = 2/77 (3%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLA  327
            I+DDQINDLVSKLQQLLPE+R+  SDKVSA+ VLQ+TCNYIRSLHREVDDLSERLSELLA
Sbjct  16   ITDDQINDLVSKLQQLLPEIRDRRSDKVSASMVLQETCNYIRSLHREVDDLSERLSELLA  75

Query  328  TTDTN--QAALIRSLLM  372
            TTD +  QAA+IRSLLM
Sbjct  76   TTDASSAQAAIIRSLLM  92



>gb|EYU24397.1| hypothetical protein MIMGU_mgv1a017140mg [Erythranthe guttata]
Length=91

 Score =   122 bits (307),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLA  327
            ++DDQIN+LVSKLQQLLPE+ +  SDK SAA+VLQ+TCNYIRSLHREVDDLSERLSELL 
Sbjct  16   VTDDQINELVSKLQQLLPEMHSRRSDKRSAAKVLQETCNYIRSLHREVDDLSERLSELLE  75

Query  328  TTDTNQAALIRSLLMQ  375
             TDT QAALIR+LLMQ
Sbjct  76   NTDTTQAALIRNLLMQ  91



>ref|XP_009389574.1| PREDICTED: transcription factor ILI6-like [Musa acuminata subsp. 
malaccensis]
Length=93

 Score =   122 bits (306),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 74/84 (88%), Gaps = 2/84 (2%)
 Frame = +1

Query  127  NTGGASRISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSE  306
             +  ASRI+D+QINDLVSKLQ +LPE R   SD+VSAA+VLQ+TCNYIRSLHREVDDLSE
Sbjct  10   QSSSASRITDEQINDLVSKLQAVLPEARIRRSDRVSAAKVLQETCNYIRSLHREVDDLSE  69

Query  307  RLSELLATTDTN--QAALIRSLLM  372
            RLSELLA+T+++  QAA+IRSLLM
Sbjct  70   RLSELLASTESSSAQAAIIRSLLM  93



>ref|XP_006374476.1| bHLH family protein [Populus trichocarpa]
 gb|ERP52273.1| bHLH family protein [Populus trichocarpa]
Length=91

 Score =   122 bits (305),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLA  327
            I+DDQI DLV+KLQQLLPE RN  S+KVSAA+ LQ+TCNYI+SLHREVDDLSERLSELL 
Sbjct  16   INDDQILDLVTKLQQLLPETRNRRSEKVSAAKALQETCNYIKSLHREVDDLSERLSELLE  75

Query  328  TTDTNQAALIRSLLMQ  375
            TTDT QAA+IR+LLMQ
Sbjct  76   TTDTTQAAIIRNLLMQ  91



>ref|XP_007226915.1| hypothetical protein PRUPE_ppa016030mg [Prunus persica]
 gb|EMJ28114.1| hypothetical protein PRUPE_ppa016030mg [Prunus persica]
Length=93

 Score =   122 bits (305),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 75/83 (90%), Gaps = 2/83 (2%)
 Frame = +1

Query  130  TGGASRISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSER  309
            +G +  ISD+QI DLVSKLQQLLPE+RN  SDKVSA++VLQ+TCNYIR+LHREVDDLS+R
Sbjct  11   SGTSRNISDEQITDLVSKLQQLLPEIRNRRSDKVSASKVLQETCNYIRNLHREVDDLSDR  70

Query  310  LSELLATT--DTNQAALIRSLLM  372
            LSELLA+T  D++QAA+IRSLLM
Sbjct  71   LSELLASTDMDSDQAAIIRSLLM  93



>ref|XP_006390417.1| hypothetical protein EUTSA_v10019683mg [Eutrema salsugineum]
 gb|ESQ27703.1| hypothetical protein EUTSA_v10019683mg [Eutrema salsugineum]
Length=93

 Score =   122 bits (305),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 64/77 (83%), Positives = 71/77 (92%), Gaps = 1/77 (1%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTS-SDKVSAARVLQDTCNYIRSLHREVDDLSERLSELL  324
            IS+DQIN+L+ KLQQLLPELR++  SDKVSAARVLQ+TCNYIR+LHREVDDLSERLSELL
Sbjct  17   ISEDQINELIIKLQQLLPELRDSRRSDKVSAARVLQETCNYIRNLHREVDDLSERLSELL  76

Query  325  ATTDTNQAALIRSLLMQ  375
            A TDT QAALIRSLL Q
Sbjct  77   ANTDTAQAALIRSLLTQ  93



>ref|XP_011075476.1| PREDICTED: transcription factor PRE6 [Sesamum indicum]
Length=95

 Score =   122 bits (305),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 76/83 (92%), Gaps = 4/83 (5%)
 Frame = +1

Query  136  GASRISDDQINDLVSKLQQLLPELRNTS--SDKVSAARVLQDTCNYIRSLHREVDDLSER  309
            GA+RISDDQI DLVSKLQQL+PE+RN+   SDKVSA++VLQ+TCNYIRSLHREVDDLS+R
Sbjct  13   GAARISDDQIADLVSKLQQLIPEIRNSRRRSDKVSASKVLQETCNYIRSLHREVDDLSDR  72

Query  310  LSELLATTDTN--QAALIRSLLM  372
            LSELL +TD++  QAA+IRSLLM
Sbjct  73   LSELLDSTDSDSAQAAIIRSLLM  95



>ref|XP_008385279.1| PREDICTED: transcription factor PRE3-like [Malus domestica]
 ref|XP_008366350.1| PREDICTED: transcription factor PRE3-like [Malus domestica]
Length=92

 Score =   121 bits (304),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 64/77 (83%), Positives = 71/77 (92%), Gaps = 1/77 (1%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTS-SDKVSAARVLQDTCNYIRSLHREVDDLSERLSELL  324
            ISDDQINDLVSKLQQLLPE+RN+  S KVSA+ +LQ+TCNYIR+LHREVDDLSERLSELL
Sbjct  16   ISDDQINDLVSKLQQLLPEIRNSRRSGKVSASTLLQETCNYIRNLHREVDDLSERLSELL  75

Query  325  ATTDTNQAALIRSLLMQ  375
            ATTDT QAA+IRSLL Q
Sbjct  76   ATTDTAQAAVIRSLLSQ  92



>ref|XP_002318605.1| bHLH family protein [Populus trichocarpa]
 gb|EEE96825.1| bHLH family protein [Populus trichocarpa]
Length=91

 Score =   121 bits (304),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +1

Query  154  DDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLATT  333
            DDQI DLV+KLQQLLPE+RN  SDKVSAA++LQ+TCNYI+SLHREV DLSERLSELL TT
Sbjct  18   DDQILDLVTKLQQLLPEIRNRRSDKVSAAKILQETCNYIKSLHREVGDLSERLSELLETT  77

Query  334  DTNQAALIRSLLMQ  375
            DT QAA+IR+LLMQ
Sbjct  78   DTAQAAIIRNLLMQ  91



>ref|XP_003519021.1| PREDICTED: transcription factor bHLH135 [Glycine max]
 gb|KHN01198.1| Transcription factor bHLH135 [Glycine soja]
 gb|KHN08689.1| Transcription factor bHLH135 [Glycine soja]
Length=93

 Score =   121 bits (303),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 73/83 (88%), Gaps = 2/83 (2%)
 Frame = +1

Query  130  TGGASRISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSER  309
            +G ++ I+D QI DLVSKLQQL+PELR   SDKVSAA+VLQ+TCNYI++LHREVDDLS+R
Sbjct  11   SGASAEITDAQITDLVSKLQQLIPELRARRSDKVSAAKVLQETCNYIKNLHREVDDLSDR  70

Query  310  LSELLATTDTN--QAALIRSLLM  372
            LSELLA TD+N  QAA+IRSLLM
Sbjct  71   LSELLANTDSNSAQAAIIRSLLM  93



>ref|XP_007046125.1| Basic helix-loop-helix DNA-binding superfamily protein [Theobroma 
cacao]
 gb|EOY01957.1| Basic helix-loop-helix DNA-binding superfamily protein [Theobroma 
cacao]
Length=92

 Score =   120 bits (302),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 71/77 (92%), Gaps = 2/77 (3%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLA  327
            I+DDQI DLVSKLQQL+PELR   SDKVSA++VLQ+TCNYIRSLHREVDDLS+RLSELLA
Sbjct  16   ITDDQITDLVSKLQQLIPELRGRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSELLA  75

Query  328  TTDT--NQAALIRSLLM  372
            +TDT  +QAA+IRSLLM
Sbjct  76   STDTDSDQAAIIRSLLM  92



>ref|XP_007157666.1| hypothetical protein PHAVU_002G088400g [Phaseolus vulgaris]
 gb|ESW29660.1| hypothetical protein PHAVU_002G088400g [Phaseolus vulgaris]
Length=93

 Score =   120 bits (302),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 72/82 (88%), Gaps = 2/82 (2%)
 Frame = +1

Query  133  GGASRISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERL  312
            G ++ I+D QI DLVSKLQQL+PELR   SDKVSAA+VLQ+TCNYI++LHREVDDLS+RL
Sbjct  12   GASAEITDAQITDLVSKLQQLIPELRARRSDKVSAAKVLQETCNYIKNLHREVDDLSDRL  71

Query  313  SELLATTDTN--QAALIRSLLM  372
            SELLA TD+N  QAA+IRSLLM
Sbjct  72   SELLANTDSNSAQAAIIRSLLM  93



>ref|XP_009106117.1| PREDICTED: transcription factor PRE3-like [Brassica rapa]
 emb|CDX96550.1| BnaA07g31610D [Brassica napus]
Length=90

 Score =   120 bits (301),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/75 (84%), Positives = 69/75 (92%), Gaps = 1/75 (1%)
 Frame = +1

Query  154  DDQINDLVSKLQQLLPELRNTS-SDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLAT  330
            +DQINDL+ KLQQLLPELRN+  SDKVSA+RVLQ+TCNYIR+LHREVDDLSERLSELLA 
Sbjct  16   EDQINDLIIKLQQLLPELRNSRRSDKVSASRVLQETCNYIRNLHREVDDLSERLSELLAN  75

Query  331  TDTNQAALIRSLLMQ  375
            TDT QAALIRSLL Q
Sbjct  76   TDTAQAALIRSLLTQ  90



>ref|XP_003532055.1| PREDICTED: transcription factor bHLH135 [Glycine max]
 gb|KHN06839.1| Transcription factor bHLH135 [Glycine soja]
Length=93

 Score =   120 bits (300),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 74/84 (88%), Gaps = 2/84 (2%)
 Frame = +1

Query  127  NTGGASRISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSE  306
             +G ++ I+D QI DL+SKLQQL+PELR   SDKVSA++VLQ+TCNYI+SLHREVDDLS+
Sbjct  10   QSGVSTEITDAQITDLISKLQQLIPELRARRSDKVSASKVLQETCNYIKSLHREVDDLSD  69

Query  307  RLSELLATTDTN--QAALIRSLLM  372
            RLS+LLATTD+N  QAA+IRSLLM
Sbjct  70   RLSQLLATTDSNSAQAAIIRSLLM  93



>ref|XP_003517952.1| PREDICTED: transcription factor bHLH135-like [Glycine max]
Length=93

 Score =   119 bits (299),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 73/83 (88%), Gaps = 2/83 (2%)
 Frame = +1

Query  130  TGGASRISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSER  309
            +G ++ I+D QI DLVSKLQQL+PELR   SDKVS+A+VLQ+TCNYI++LHREVDDLS+R
Sbjct  11   SGASAEITDAQITDLVSKLQQLIPELRARRSDKVSSAKVLQETCNYIKNLHREVDDLSDR  70

Query  310  LSELLATTDTN--QAALIRSLLM  372
            LSELLA TD+N  QAA+IRSLLM
Sbjct  71   LSELLANTDSNSAQAAIIRSLLM  93



>ref|XP_006827167.1| hypothetical protein AMTR_s00010p00254240 [Amborella trichopoda]
 gb|ERM94404.1| hypothetical protein AMTR_s00010p00254240 [Amborella trichopoda]
Length=92

 Score =   119 bits (299),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/77 (79%), Positives = 71/77 (92%), Gaps = 2/77 (3%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLA  327
            I+DDQI DLVSKLQ LLPE+RN SSDKVSA++VLQ+TCNYI+SLHREVDDLSE+LSELL 
Sbjct  16   ITDDQIIDLVSKLQSLLPEIRNRSSDKVSASKVLQETCNYIKSLHREVDDLSEKLSELLE  75

Query  328  TTDTN--QAALIRSLLM  372
            TT+T+  QAA+IRSLLM
Sbjct  76   TTETSSAQAAIIRSLLM  92



>ref|XP_002520108.1| transcription regulator, putative [Ricinus communis]
 gb|EEF42163.1| transcription regulator, putative [Ricinus communis]
Length=93

 Score =   119 bits (299),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 60/78 (77%), Positives = 72/78 (92%), Gaps = 2/78 (3%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLA  327
            ISDDQI DLVSKLQQL+PE+RN  SDKVSA++VLQ+TCNYI+SLHREVDDLS+RLSELLA
Sbjct  16   ISDDQIIDLVSKLQQLIPEIRNRRSDKVSASKVLQETCNYIKSLHREVDDLSDRLSELLA  75

Query  328  TTDTN--QAALIRSLLMQ  375
            +TD++  QAA+IRSL M+
Sbjct  76   STDSDSAQAAIIRSLFME  93



>gb|AFK41511.1| unknown [Lotus japonicus]
Length=93

 Score =   119 bits (297),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 61/77 (79%), Positives = 70/77 (91%), Gaps = 2/77 (3%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLA  327
            ISD QI DL+SKLQQL+PELR   SDKVSAA+VLQ+TCNYI++LHREVDDLS+RLSELLA
Sbjct  17   ISDAQITDLISKLQQLIPELRARRSDKVSAAKVLQETCNYIKNLHREVDDLSDRLSELLA  76

Query  328  TTDTN--QAALIRSLLM  372
            TTD+N  QAA+IRSLLM
Sbjct  77   TTDSNSAQAAIIRSLLM  93



>ref|XP_010096378.1| hypothetical protein L484_021126 [Morus notabilis]
 gb|EXB63853.1| hypothetical protein L484_021126 [Morus notabilis]
Length=93

 Score =   119 bits (297),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 73/82 (89%), Gaps = 2/82 (2%)
 Frame = +1

Query  133  GGASRISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERL  312
            G +  ISDDQI DLVSKLQ+L+PE+RN  SDKVSA++VLQ+TCNYIR+LHREVDDLS+RL
Sbjct  12   GVSMNISDDQITDLVSKLQRLIPEIRNRRSDKVSASKVLQETCNYIRNLHREVDDLSDRL  71

Query  313  SELLATT--DTNQAALIRSLLM  372
            S+LLATT  D+ QAA+IRSLLM
Sbjct  72   SQLLATTENDSAQAAIIRSLLM  93



>ref|XP_009589864.1| PREDICTED: transcription factor PRE3-like [Nicotiana tomentosiformis]
Length=91

 Score =   119 bits (297),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +1

Query  136  GASRISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLS  315
            G SRI++DQINDLVSKLQQLLPELRN S DKVSAARVLQ+T N IR+L  EVDDLSE+LS
Sbjct  12   GVSRITEDQINDLVSKLQQLLPELRNRSYDKVSAARVLQETSNNIRNLLGEVDDLSEQLS  71

Query  316  ELLATTDTNQAALIRSLLMQ  375
            +LL T+DT QAAL+R LLMQ
Sbjct  72   QLLGTSDTTQAALLRPLLMQ  91



>ref|XP_008221650.1| PREDICTED: transcription factor PRE6-like [Prunus mume]
 ref|XP_008221651.1| PREDICTED: transcription factor PRE6-like [Prunus mume]
Length=94

 Score =   118 bits (296),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 72/77 (94%), Gaps = 2/77 (3%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLA  327
            ISD+QI DLVSKLQQLLPE+RN  SDKVSA++VLQ+TCNYI++LHREVDDLS+RLSELLA
Sbjct  18   ISDEQITDLVSKLQQLLPEIRNRRSDKVSASKVLQETCNYIKNLHREVDDLSDRLSELLA  77

Query  328  TT--DTNQAALIRSLLM  372
            +T  D++QAA+IRSLLM
Sbjct  78   STDMDSDQAAIIRSLLM  94



>emb|CDX73095.1| BnaC06g35430D [Brassica napus]
Length=90

 Score =   118 bits (295),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 62/75 (83%), Positives = 69/75 (92%), Gaps = 1/75 (1%)
 Frame = +1

Query  154  DDQINDLVSKLQQLLPELRNTS-SDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLAT  330
            +DQINDL+ KLQQLLPELRN+  SDKVSA+RVLQ+TC+YIR+LHREVDDLSERLSELLA 
Sbjct  16   EDQINDLIIKLQQLLPELRNSRRSDKVSASRVLQETCSYIRNLHREVDDLSERLSELLAN  75

Query  331  TDTNQAALIRSLLMQ  375
            TDT QAALIRSLL Q
Sbjct  76   TDTAQAALIRSLLTQ  90



>ref|XP_007153819.1| hypothetical protein PHAVU_003G067500g [Phaseolus vulgaris]
 gb|ESW25813.1| hypothetical protein PHAVU_003G067500g [Phaseolus vulgaris]
Length=93

 Score =   117 bits (294),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 72/80 (90%), Gaps = 2/80 (3%)
 Frame = +1

Query  139  ASRISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSE  318
            ++ I+D QI DLVSKLQQL+PELR   SDKVSA++VLQ+TCNYI+SLHREVDDLS+RLS+
Sbjct  14   STEITDAQITDLVSKLQQLIPELRARRSDKVSASKVLQETCNYIKSLHREVDDLSDRLSQ  73

Query  319  LLATTDTN--QAALIRSLLM  372
            LLATTD+N  QAA+IRSLLM
Sbjct  74   LLATTDSNSAQAAIIRSLLM  93



>ref|XP_010695477.1| PREDICTED: transcription factor PRE3-like [Beta vulgaris subsp. 
vulgaris]
Length=92

 Score =   117 bits (292),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 61/77 (79%), Positives = 67/77 (87%), Gaps = 1/77 (1%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTS-SDKVSAARVLQDTCNYIRSLHREVDDLSERLSELL  324
            I+DDQI DLV KLQQLLPEL N    DKVSA+RVLQ+TCNYI+SLHREVDDLSERLS+LL
Sbjct  16   ITDDQIQDLVCKLQQLLPELHNARRPDKVSASRVLQETCNYIKSLHREVDDLSERLSQLL  75

Query  325  ATTDTNQAALIRSLLMQ  375
              TDT QAALIRSLL+Q
Sbjct  76   ENTDTTQAALIRSLLLQ  92



>gb|EYU22434.1| hypothetical protein MIMGU_mgv1a017116mg [Erythranthe guttata]
Length=92

 Score =   117 bits (292),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 70/77 (91%), Gaps = 2/77 (3%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLA  327
            ISDDQI DLVSKLQQL+PE+RN  SDKVS ++VLQ+TCNYI++LHREVDDLS+RLSELL 
Sbjct  16   ISDDQIADLVSKLQQLIPEIRNRRSDKVSGSKVLQETCNYIKNLHREVDDLSDRLSELLE  75

Query  328  TTDTN--QAALIRSLLM  372
            +TD+N  QAA+IRSLLM
Sbjct  76   STDSNSAQAAIIRSLLM  92



>ref|XP_006438657.1| hypothetical protein CICLE_v10033182mg [Citrus clementina]
 ref|XP_006483196.1| PREDICTED: transcription factor bHLH135-like [Citrus sinensis]
 ref|XP_006483197.1| PREDICTED: transcription factor bHLH135-like [Citrus sinensis]
 ref|XP_006495343.1| PREDICTED: transcription factor bHLH135-like [Citrus sinensis]
 gb|ESR51897.1| hypothetical protein CICLE_v10033182mg [Citrus clementina]
Length=93

 Score =   117 bits (292),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 71/77 (92%), Gaps = 2/77 (3%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLA  327
            ISDDQI DLVSKLQQL+PELR+  SDKVSA+++LQ+TC+YIRSLHREVDDLS+RLSELLA
Sbjct  17   ISDDQIGDLVSKLQQLIPELRSRRSDKVSASKILQETCDYIRSLHREVDDLSDRLSELLA  76

Query  328  TTDTN--QAALIRSLLM  372
            + D+N  +AA+IRSLLM
Sbjct  77   SIDSNSAEAAIIRSLLM  93



>ref|XP_009360364.1| PREDICTED: transcription factor PRE6 [Pyrus x bretschneideri]
Length=96

 Score =   116 bits (291),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 68/75 (91%), Gaps = 2/75 (3%)
 Frame = +1

Query  154  DDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLATT  333
            D+QI DLV+KLQQLLPE+RN  SDK SA++VLQDTCNYIR+LHREVDDLSERLSELLATT
Sbjct  22   DEQITDLVTKLQQLLPEIRNRRSDKASASKVLQDTCNYIRNLHREVDDLSERLSELLATT  81

Query  334  --DTNQAALIRSLLM  372
              D +QAA+IRSLLM
Sbjct  82   DIDNDQAAIIRSLLM  96



>gb|KHG28499.1| Transcription factor protein [Gossypium arboreum]
Length=94

 Score =   116 bits (290),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 71/82 (87%), Gaps = 2/82 (2%)
 Frame = +1

Query  133  GGASRISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERL  312
            GG SRISDDQI  LVSKL+ LLPE+R+  SDKVSA++VLQ+TCNYIRSLH+EV+DLS+RL
Sbjct  13   GGVSRISDDQIIALVSKLRHLLPEIRDNRSDKVSASKVLQETCNYIRSLHKEVEDLSDRL  72

Query  313  SELLATTDTN--QAALIRSLLM  372
            S+LLAT D    +AA+IRSLLM
Sbjct  73   SQLLATIDAESAEAAIIRSLLM  94



>ref|XP_011071014.1| PREDICTED: transcription factor PRE6-like [Sesamum indicum]
Length=181

 Score =   119 bits (297),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 71/77 (92%), Gaps = 2/77 (3%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLA  327
            ISDDQI DLVSKLQQL+PE+RN  SDKVSA++VLQ+TCNYIR+LHREVDDLS+RLSELL 
Sbjct  105  ISDDQIADLVSKLQQLIPEIRNRRSDKVSASKVLQETCNYIRNLHREVDDLSDRLSELLD  164

Query  328  TTDTN--QAALIRSLLM  372
            +TD++  QAA+IRSLLM
Sbjct  165  STDSDSAQAAIIRSLLM  181



>ref|XP_006357115.1| PREDICTED: transcription factor bHLH135-like [Solanum tuberosum]
Length=93

 Score =   116 bits (290),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 72/82 (88%), Gaps = 2/82 (2%)
 Frame = +1

Query  133  GGASRISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERL  312
            GG SRISDDQI  LVSKLQQLLPE+RN  S+K SA++VLQ+TCNYIR+LH+EVDDLS+RL
Sbjct  12   GGTSRISDDQIIQLVSKLQQLLPEIRNRRSNKASASKVLQETCNYIRNLHKEVDDLSDRL  71

Query  313  SELLATTDTN--QAALIRSLLM  372
            S+LL+T D +  +AA+IRSL+M
Sbjct  72   SQLLSTIDADSPEAAIIRSLIM  93



>ref|XP_010939543.1| PREDICTED: transcription factor ILI6-like [Elaeis guineensis]
Length=92

 Score =   116 bits (290),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 71/77 (92%), Gaps = 2/77 (3%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLA  327
            ++DDQI DLVSKLQ LLPE RN S+D+VSAA+VLQDTCNYI+SLH+EVD+LSERL+ELLA
Sbjct  16   MTDDQIIDLVSKLQALLPEARNRSTDRVSAAKVLQDTCNYIKSLHQEVDNLSERLAELLA  75

Query  328  TTDT--NQAALIRSLLM  372
            TTDT  +QAA+IRSL+M
Sbjct  76   TTDTTGDQAAVIRSLIM  92



>ref|XP_004233358.1| PREDICTED: transcription factor PRE6 isoform X2 [Solanum lycopersicum]
Length=94

 Score =   116 bits (290),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 72/82 (88%), Gaps = 2/82 (2%)
 Frame = +1

Query  133  GGASRISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERL  312
            GG SRISDDQI  LVSKLQQLLPE+RN  S+K SA++VLQ+TCNYIR+LH+EVDDLS+RL
Sbjct  13   GGTSRISDDQIIQLVSKLQQLLPEIRNRRSNKASASKVLQETCNYIRNLHKEVDDLSDRL  72

Query  313  SELLATTDTN--QAALIRSLLM  372
            S+LL+T D +  +AA+IRSL+M
Sbjct  73   SQLLSTIDADSPEAAIIRSLIM  94



>ref|XP_004238782.1| PREDICTED: transcription factor PRE6-like [Solanum lycopersicum]
 ref|XP_006363238.1| PREDICTED: transcription factor bHLH135-like [Solanum tuberosum]
Length=86

 Score =   115 bits (289),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 70/77 (91%), Gaps = 2/77 (3%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLA  327
            ISDDQI DLVSKLQQL+PE+RN  SDKVSA++VLQ+TCNYIR+LHREVD LSERLS+LL 
Sbjct  10   ISDDQIADLVSKLQQLIPEIRNRRSDKVSASKVLQETCNYIRNLHREVDGLSERLSQLLE  69

Query  328  TTDTN--QAALIRSLLM  372
            +TD++  QAA+IRSLLM
Sbjct  70   STDSDSAQAAIIRSLLM  86



>ref|XP_004151201.1| PREDICTED: transcription factor bHLH135-like, partial [Cucumis 
sativus]
Length=82

 Score =   115 bits (288),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 74/82 (90%), Gaps = 2/82 (2%)
 Frame = +1

Query  136  GASRISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLS  315
             ASRISDDQI +LVSKL+QL+PE+R+   DKVSA++VLQ+TCNYIR+LHREVDDLSERLS
Sbjct  1    SASRISDDQIIELVSKLRQLVPEIRHRRPDKVSASKVLQETCNYIRNLHREVDDLSERLS  60

Query  316  ELLATTDTN--QAALIRSLLMQ  375
            +LL+T D++  +AA+IRSL+MQ
Sbjct  61   QLLSTIDSDSAEAAIIRSLIMQ  82



>ref|XP_009622200.1| PREDICTED: transcription factor PRE6-like [Nicotiana tomentosiformis]
Length=92

 Score =   115 bits (289),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 70/81 (86%), Gaps = 2/81 (2%)
 Frame = +1

Query  136  GASRISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLS  315
            G SRISDDQI DLVSKLQ L+PE+RN  SDKV+A+ VLQ+TCNYIRSLHREV+DLSERLS
Sbjct  12   GVSRISDDQIADLVSKLQLLIPEIRNRRSDKVTASTVLQETCNYIRSLHREVEDLSERLS  71

Query  316  ELLATT--DTNQAALIRSLLM  372
             LL +T  D+ QAA+IRSLLM
Sbjct  72   VLLDSTESDSAQAAIIRSLLM  92



>ref|XP_006482579.1| PREDICTED: transcription factor bHLH135-like [Citrus sinensis]
Length=91

 Score =   115 bits (288),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 71/84 (85%), Gaps = 2/84 (2%)
 Frame = +1

Query  127  NTGGASRISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSE  306
               G SRISDDQI +LVSKL+QLLPE+R+    KVSA++VLQ+TCNYIRSLHREVDDLSE
Sbjct  8    QAAGVSRISDDQIIELVSKLRQLLPEIRDRRPQKVSASKVLQETCNYIRSLHREVDDLSE  67

Query  307  RLSELLATTDTN--QAALIRSLLM  372
            RLS+LL+T D +  +AA+IRSL+M
Sbjct  68   RLSQLLSTIDADSPEAAIIRSLIM  91



>emb|CDP00307.1| unnamed protein product [Coffea canephora]
Length=92

 Score =   115 bits (288),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 70/77 (91%), Gaps = 2/77 (3%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLA  327
            I+DDQI DLV+KLQQL+PELR   SDKVSA++VLQ+TCNYIRSLHREVDDLS+RLSELL 
Sbjct  16   ITDDQIADLVTKLQQLIPELRRRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSELLE  75

Query  328  TTDTN--QAALIRSLLM  372
            +TD++  QAA+IRSLLM
Sbjct  76   STDSDSAQAAIIRSLLM  92



>gb|KDP41169.1| hypothetical protein JCGZ_15576 [Jatropha curcas]
Length=94

 Score =   115 bits (287),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 72/78 (92%), Gaps = 2/78 (3%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLA  327
            ISDDQI DLVSKLQQL+PE+++  SDKVSA++VLQ+TCNYIRSLHREVDDLS+RLS+LLA
Sbjct  17   ISDDQIIDLVSKLQQLIPEIQSRRSDKVSASKVLQETCNYIRSLHREVDDLSDRLSQLLA  76

Query  328  TTDTN--QAALIRSLLMQ  375
            +TD++  QAA+IRSL M+
Sbjct  77   STDSDSAQAAIIRSLFME  94



>ref|XP_006431132.1| hypothetical protein CICLE_v10013209mg [Citrus clementina]
 gb|ESR44372.1| hypothetical protein CICLE_v10013209mg [Citrus clementina]
Length=91

 Score =   114 bits (285),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 71/84 (85%), Gaps = 2/84 (2%)
 Frame = +1

Query  127  NTGGASRISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSE  306
               G SRISDDQI +LV+KL+QLLPE+R+    KVSA++VLQ+TCNYIRSLHREVDDLSE
Sbjct  8    QAAGVSRISDDQIIELVAKLRQLLPEIRDRRPQKVSASKVLQETCNYIRSLHREVDDLSE  67

Query  307  RLSELLATTDTN--QAALIRSLLM  372
            RLS+LL+T D +  +AA+IRSL+M
Sbjct  68   RLSQLLSTIDADSPEAAIIRSLIM  91



>ref|XP_003543767.1| PREDICTED: transcription factor bHLH135 [Glycine max]
 ref|XP_007151219.1| hypothetical protein PHAVU_004G027700g [Phaseolus vulgaris]
 gb|ESW23213.1| hypothetical protein PHAVU_004G027700g [Phaseolus vulgaris]
 gb|KHN13231.1| Transcription factor bHLH135 [Glycine soja]
 gb|KHN45491.1| Transcription factor bHLH135 [Glycine soja]
Length=91

 Score =   114 bits (285),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 72/81 (89%), Gaps = 2/81 (2%)
 Frame = +1

Query  133  GGASRISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERL  312
              ++RISDDQI DLVSKL+QL+PE+R+  SDKVSA++VLQ+TCNYIRSLHREVDDLSERL
Sbjct  10   SASTRISDDQIIDLVSKLRQLVPEIRDRRSDKVSASKVLQETCNYIRSLHREVDDLSERL  69

Query  313  SELLATTDTN--QAALIRSLL  369
            S+LLAT D +  +AA+IRSL+
Sbjct  70   SQLLATIDADSPEAAIIRSLI  90



>ref|XP_003534454.1| PREDICTED: transcription factor bHLH135 [Glycine max]
 gb|KHN11598.1| Transcription factor bHLH135 [Glycine soja]
Length=92

 Score =   114 bits (285),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 71/82 (87%), Gaps = 2/82 (2%)
 Frame = +1

Query  136  GASRISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLS  315
            G++RISDDQI +LVSKL+QL+PE+RN  SDKVSA++VLQ+TCNYIRSLHREV DLSERLS
Sbjct  11   GSTRISDDQIIELVSKLRQLVPEIRNRRSDKVSASKVLQETCNYIRSLHREVSDLSERLS  70

Query  316  ELLATTDTN--QAALIRSLLMQ  375
            +LL T D +  +A +IRSLL Q
Sbjct  71   QLLTTIDADSAEAGIIRSLLNQ  92



>ref|XP_007032495.1| Basic helix-loop-helix (bHLH) DNA-binding family protein [Theobroma 
cacao]
 gb|EOY03421.1| Basic helix-loop-helix (bHLH) DNA-binding family protein [Theobroma 
cacao]
Length=91

 Score =   114 bits (285),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 58/77 (75%), Positives = 71/77 (92%), Gaps = 2/77 (3%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLA  327
            ISDDQI +LVSKL+QLLPE+R+  SDKVSA++VLQ+TCNYIRSLHREVDDLSERLS+LLA
Sbjct  15   ISDDQIIELVSKLRQLLPEIRDRRSDKVSASKVLQETCNYIRSLHREVDDLSERLSQLLA  74

Query  328  TTDTN--QAALIRSLLM  372
            T D++  +AA+IRSL+M
Sbjct  75   TIDSDSAEAAIIRSLIM  91



>gb|KDO82876.1| hypothetical protein CISIN_1g041198mg [Citrus sinensis]
Length=93

 Score =   114 bits (284),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 58/77 (75%), Positives = 70/77 (91%), Gaps = 2/77 (3%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLA  327
            IS DQI DLVSKLQQL+PELR+  SDKVSA+++LQ+TC+YIRSLHREVDDLS+RLSELLA
Sbjct  17   ISYDQIGDLVSKLQQLIPELRSRRSDKVSASKILQETCDYIRSLHREVDDLSDRLSELLA  76

Query  328  TTDTN--QAALIRSLLM  372
            + D+N  +AA+IRSLLM
Sbjct  77   SIDSNSAEAAIIRSLLM  93



>ref|XP_008389506.1| PREDICTED: transcription factor PRE6-like [Malus domestica]
Length=96

 Score =   114 bits (284),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 68/75 (91%), Gaps = 2/75 (3%)
 Frame = +1

Query  154  DDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLATT  333
            D+QI DLV+KLQQLLPE+RN  SDK SA++VL++TCNYIR+LHREVDDLSERLSELLATT
Sbjct  22   DEQITDLVTKLQQLLPEIRNRRSDKASASKVLEETCNYIRNLHREVDDLSERLSELLATT  81

Query  334  --DTNQAALIRSLLM  372
              D +QAA+IRSLLM
Sbjct  82   DMDNDQAAIIRSLLM  96



>ref|XP_009386696.1| PREDICTED: transcription factor ILI6-like [Musa acuminata subsp. 
malaccensis]
Length=93

 Score =   114 bits (284),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 68/76 (89%), Gaps = 2/76 (3%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLA  327
            I+D+QINDLVSKLQ +LPE R   +++VSAARVLQ+TCNYIRSLHREVDDLSERLSELLA
Sbjct  17   ITDEQINDLVSKLQAVLPEARIRGAERVSAARVLQETCNYIRSLHREVDDLSERLSELLA  76

Query  328  TTDTN--QAALIRSLL  369
            TT+ +  QAA+IRSLL
Sbjct  77   TTEASSAQAAIIRSLL  92



>ref|XP_008797129.1| PREDICTED: transcription factor ILI6-like [Phoenix dactylifera]
Length=92

 Score =   113 bits (283),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 69/77 (90%), Gaps = 2/77 (3%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLA  327
            I+D+QINDLVSKLQ LLPE    S+++VSAARVLQDTC+YIR+LHREVDDLSERLSELLA
Sbjct  16   ITDEQINDLVSKLQALLPEAGIRSNERVSAARVLQDTCSYIRNLHREVDDLSERLSELLA  75

Query  328  TTDTN--QAALIRSLLM  372
            TTD +  QAA+IRSLLM
Sbjct  76   TTDASSAQAAIIRSLLM  92



>ref|XP_009767697.1| PREDICTED: transcription factor PRE6-like [Nicotiana sylvestris]
Length=92

 Score =   113 bits (283),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 69/81 (85%), Gaps = 2/81 (2%)
 Frame = +1

Query  136  GASRISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLS  315
              SRISDDQI DLVSKLQ L+PE+RN  SDKV+A++VLQ+TCNYIRSLHREV+DLSERLS
Sbjct  12   AVSRISDDQIADLVSKLQLLIPEIRNRRSDKVTASKVLQETCNYIRSLHREVEDLSERLS  71

Query  316  ELLATT--DTNQAALIRSLLM  372
             LL +T  D+ Q A+IRSLLM
Sbjct  72   VLLDSTESDSAQGAIIRSLLM  92



>ref|XP_010032347.1| PREDICTED: transcription factor PRE5-like [Eucalyptus grandis]
 gb|KCW51755.1| hypothetical protein EUGRSUZ_J01215 [Eucalyptus grandis]
Length=93

 Score =   113 bits (283),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 74/84 (88%), Gaps = 2/84 (2%)
 Frame = +1

Query  127  NTGGASRISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSE  306
             +G  SRI+DDQ+ +LVSKL+QLLPE+R++ SDKVSA++VLQ+TC+YIRSLHREV DLSE
Sbjct  10   QSGTPSRITDDQMIELVSKLRQLLPEIRSSRSDKVSASKVLQETCSYIRSLHREVADLSE  69

Query  307  RLSELLATTDTN--QAALIRSLLM  372
            RLS+LL+T D +  +AA+IRSL+M
Sbjct  70   RLSQLLSTVDADSAEAAIIRSLIM  93



>ref|XP_006344270.1| PREDICTED: transcription factor bHLH135-like [Solanum tuberosum]
Length=95

 Score =   113 bits (283),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 72/84 (86%), Gaps = 3/84 (4%)
 Frame = +1

Query  130  TGGASRISDDQINDLVSKLQQLLPELRNT-SSDKVSAARVLQDTCNYIRSLHREVDDLSE  306
            + GASRISDDQI DLVSKLQ L+PE R+T SSDKV A++VLQ+TCNYIRSLHREV+DLS+
Sbjct  12   SSGASRISDDQIADLVSKLQLLIPESRSTRSSDKVEASKVLQETCNYIRSLHREVEDLSD  71

Query  307  RLSELLATT--DTNQAALIRSLLM  372
            RLS LL +T  D+ QAA+IRSL M
Sbjct  72   RLSVLLESTESDSAQAAIIRSLFM  95



>ref|XP_002283094.1| PREDICTED: transcription factor PRE6 [Vitis vinifera]
 emb|CBI22188.3| unnamed protein product [Vitis vinifera]
Length=90

 Score =   113 bits (282),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 67/75 (89%), Gaps = 2/75 (3%)
 Frame = +1

Query  154  DDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLATT  333
            DDQI +LVSKLQQLLPE+RN  SDKVSA++VLQ+TCNYIRSLHREVDDLSERLS LLAT 
Sbjct  16   DDQIIELVSKLQQLLPEIRNRRSDKVSASKVLQETCNYIRSLHREVDDLSERLSRLLATV  75

Query  334  DTN--QAALIRSLLM  372
            D +  +AA+IRSL+M
Sbjct  76   DADSPEAAIIRSLIM  90



>ref|XP_010681766.1| PREDICTED: transcription factor PRE3-like [Beta vulgaris subsp. 
vulgaris]
Length=94

 Score =   113 bits (282),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 73/85 (86%), Gaps = 5/85 (6%)
 Frame = +1

Query  130  TGGASRISDDQINDLVSKLQQLLPELRNT--SSDKVSAARVLQDTCNYIRSLHREVDDLS  303
            +GG S ISDDQI DLV KLQQL+PE+R +  +SDK SA RVLQ+TCNYIRSLHREVDDLS
Sbjct  11   SGGVSGISDDQIADLVHKLQQLIPEIRGSRRNSDK-SANRVLQETCNYIRSLHREVDDLS  69

Query  304  ERLSELLATTDTN--QAALIRSLLM  372
            +RL+ELLA+TD++  QAA+IRSL M
Sbjct  70   DRLAELLASTDSDSAQAAIIRSLFM  94



>ref|XP_008339920.1| PREDICTED: transcription factor PRE6-like [Malus domestica]
Length=96

 Score =   113 bits (282),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 67/75 (89%), Gaps = 2/75 (3%)
 Frame = +1

Query  154  DDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLATT  333
            DDQI DLVSKLQQLLPE+R   S+K SA++VLQ+TCNYIR+LHREVDDLSERLSELLATT
Sbjct  22   DDQITDLVSKLQQLLPEIRPRRSNKASASKVLQETCNYIRNLHREVDDLSERLSELLATT  81

Query  334  --DTNQAALIRSLLM  372
              D +QAA+IRSLLM
Sbjct  82   DMDNDQAAIIRSLLM  96



>ref|NP_001241066.1| uncharacterized protein LOC100784537 [Glycine max]
 gb|ACU19172.1| unknown [Glycine max]
 gb|KHN13624.1| Transcription factor bHLH135 [Glycine soja]
Length=92

 Score =   112 bits (281),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 70/82 (85%), Gaps = 2/82 (2%)
 Frame = +1

Query  136  GASRISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLS  315
            G++RISDDQI +LVSKL+QL+PE+RN  SDKVSA++VLQ+TCNYIR LHREV DLSERLS
Sbjct  11   GSTRISDDQIIELVSKLRQLVPEIRNRRSDKVSASKVLQETCNYIRGLHREVSDLSERLS  70

Query  316  ELLATTDTN--QAALIRSLLMQ  375
            +LL T D +  +A +IRSLL Q
Sbjct  71   QLLTTIDADSAEAGIIRSLLNQ  92



>ref|XP_008784394.1| PREDICTED: transcription factor ILI6-like [Phoenix dactylifera]
Length=92

 Score =   112 bits (280),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 68/77 (88%), Gaps = 2/77 (3%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLA  327
            I+DDQI DLVSKLQ LLPE R  S+D+ SAA+VLQDTCNYIRSLH+E+D LSERL+ELLA
Sbjct  16   ITDDQIIDLVSKLQALLPEARRRSTDRGSAAKVLQDTCNYIRSLHQEMDGLSERLAELLA  75

Query  328  TTDT--NQAALIRSLLM  372
            TTDT  +QAA+IRSLLM
Sbjct  76   TTDTTSDQAAIIRSLLM  92



>ref|NP_001237910.1| uncharacterized protein LOC100305611 [Glycine max]
 gb|ACU13383.1| unknown [Glycine max]
Length=91

 Score =   112 bits (280),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 72/81 (89%), Gaps = 2/81 (2%)
 Frame = +1

Query  133  GGASRISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERL  312
              ++RISDDQI DLVSKL+QL+PE+R+  SDKVSA++VLQ+TCNYIRSLHREV+DLSERL
Sbjct  10   SASTRISDDQIIDLVSKLRQLVPEIRDRRSDKVSASKVLQETCNYIRSLHREVNDLSERL  69

Query  313  SELLATTDTN--QAALIRSLL  369
            S+LLAT D +  +AA+IRSL+
Sbjct  70   SQLLATIDADSPEAAIIRSLI  90



>ref|XP_010550064.1| PREDICTED: transcription factor PRE5 [Tarenaya hassleriana]
Length=91

 Score =   112 bits (280),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 71/83 (86%), Gaps = 3/83 (4%)
 Frame = +1

Query  133  GGASRISDDQINDLVSKLQQLLPELR-NTSSDKVSAARVLQDTCNYIRSLHREVDDLSER  309
               SRISDDQI DLVSKL+QLLPE+R N  SDKVSA++VLQ+TCNYIR+LHREVDDLSER
Sbjct  9    ASVSRISDDQIIDLVSKLRQLLPEIRPNRRSDKVSASKVLQETCNYIRNLHREVDDLSER  68

Query  310  LSELLATTDTN--QAALIRSLLM  372
            LS+LL T D +  +AA+IRSL+M
Sbjct  69   LSQLLETIDADSPEAAIIRSLIM  91



>ref|XP_002517494.1| transcription regulator, putative [Ricinus communis]
 gb|EEF45036.1| transcription regulator, putative [Ricinus communis]
Length=90

 Score =   112 bits (280),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 69/81 (85%), Gaps = 2/81 (2%)
 Frame = +1

Query  136  GASRISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLS  315
               RI+DDQI DLVSKL+QLLPE+R    DKVSA++VLQ+TCNYIR+LHREVDDLSERLS
Sbjct  10   SVPRITDDQIIDLVSKLRQLLPEIRQRRPDKVSASKVLQETCNYIRNLHREVDDLSERLS  69

Query  316  ELLAT--TDTNQAALIRSLLM  372
            +LLAT   D+ +AA+IRSL+M
Sbjct  70   QLLATIDADSPEAAIIRSLIM  90



>ref|XP_007139582.1| hypothetical protein PHAVU_008G041800g [Phaseolus vulgaris]
 gb|ESW11576.1| hypothetical protein PHAVU_008G041800g [Phaseolus vulgaris]
Length=92

 Score =   112 bits (279),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 71/82 (87%), Gaps = 2/82 (2%)
 Frame = +1

Query  136  GASRISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLS  315
            G++RISDDQI +LVSKL+QL+PE+R+  SDKVSA++VLQ+TCNYIRSLHREV DLSERLS
Sbjct  11   GSTRISDDQIIELVSKLRQLVPEIRSRRSDKVSASKVLQETCNYIRSLHREVSDLSERLS  70

Query  316  ELLATTDTN--QAALIRSLLMQ  375
            +LL T D +  +A +IRSLL Q
Sbjct  71   QLLTTIDADSAEAGIIRSLLNQ  92



>ref|XP_003621179.1| Transcription factor style2.1 [Medicago truncatula]
 gb|AES77397.1| transcription factor [Medicago truncatula]
Length=93

 Score =   111 bits (278),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 73/84 (87%), Gaps = 2/84 (2%)
 Frame = +1

Query  130  TGGASRISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSER  309
            +GG++RISDDQI DLV KL+QL+PE+RN  SDKV A++VLQ+TCNYIR+L REVDDLS R
Sbjct  10   SGGSTRISDDQIIDLVCKLRQLVPEIRNRRSDKVPASKVLQETCNYIRNLQREVDDLSLR  69

Query  310  LSELLATTDTN--QAALIRSLLMQ  375
            LS+LLAT D++  +A++IRSLL Q
Sbjct  70   LSQLLATIDSDSAEASIIRSLLNQ  93



>ref|XP_006661757.1| PREDICTED: transcription factor bHLH135-like [Oryza brachyantha]
Length=94

 Score =   111 bits (278),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 70/81 (86%), Gaps = 3/81 (4%)
 Frame = +1

Query  139  ASRISDDQINDLVSKLQQLLPELR-NTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLS  315
            A+RI+D+QI DLVSKLQ LLPE R  +S+D+V +ARVLQ+TC+YIRSLHREVDDLSERL+
Sbjct  14   AARITDEQIGDLVSKLQALLPEARLRSSNDRVPSARVLQETCSYIRSLHREVDDLSERLA  73

Query  316  ELLATTD--TNQAALIRSLLM  372
            ELLA  D  T QAA+IRSLLM
Sbjct  74   ELLAAADVSTAQAAVIRSLLM  94



>emb|CDY28427.1| BnaC07g12550D [Brassica napus]
Length=94

 Score =   111 bits (278),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 68/76 (89%), Gaps = 2/76 (3%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLA  327
            ISDDQI+DLV+KLQ L+PELR   SDKVSA++VLQ+TCNYIR+LHREVDDLS+RLSE LA
Sbjct  17   ISDDQISDLVTKLQHLIPELRRRRSDKVSASKVLQETCNYIRNLHREVDDLSDRLSEFLA  76

Query  328  TTDTN--QAALIRSLL  369
            +TD N  +AA+IRSLL
Sbjct  77   STDDNSAEAAIIRSLL  92



>ref|XP_004237036.1| PREDICTED: transcription factor PRE6-like [Solanum lycopersicum]
Length=95

 Score =   111 bits (277),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 71/84 (85%), Gaps = 3/84 (4%)
 Frame = +1

Query  130  TGGASRISDDQINDLVSKLQQLLPELRNT-SSDKVSAARVLQDTCNYIRSLHREVDDLSE  306
            + GASRISDDQI DLVSKLQ L+PE R+T SSDKV A++VLQ+ CNYIRSLHREV+DLS+
Sbjct  12   SSGASRISDDQIADLVSKLQLLIPESRSTRSSDKVEASKVLQEICNYIRSLHREVEDLSD  71

Query  307  RLSELLATT--DTNQAALIRSLLM  372
            RLS LL +T  D+ QAA+IRSL M
Sbjct  72   RLSVLLESTESDSAQAAIIRSLFM  95



>ref|XP_009758713.1| PREDICTED: transcription factor PRE5-like [Nicotiana sylvestris]
Length=92

 Score =   111 bits (277),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 70/81 (86%), Gaps = 2/81 (2%)
 Frame = +1

Query  136  GASRISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLS  315
            G SRISDDQI +L+SKLQQLLPE+R   + K SA++VLQ+TCNYIRSLH+EVDDLS+RLS
Sbjct  12   GTSRISDDQIIELMSKLQQLLPEIRTRRTSKASASKVLQETCNYIRSLHKEVDDLSDRLS  71

Query  316  ELLATTDTN--QAALIRSLLM  372
            +LL+T D +  +AA+IRSLLM
Sbjct  72   QLLSTIDADSPEAAIIRSLLM  92



>ref|XP_002323848.2| hypothetical protein POPTR_0017s11760g [Populus trichocarpa]
 gb|EEF03981.2| hypothetical protein POPTR_0017s11760g [Populus trichocarpa]
Length=90

 Score =   111 bits (277),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 69/82 (84%), Gaps = 2/82 (2%)
 Frame = +1

Query  133  GGASRISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERL  312
                RI+DDQI DLVSKL+QLLPE+    SDKVSA++VLQ+TCNYIR+LHREVDDLSERL
Sbjct  9    SSVPRITDDQIIDLVSKLRQLLPEISQRRSDKVSASKVLQETCNYIRNLHREVDDLSERL  68

Query  313  SELLAT--TDTNQAALIRSLLM  372
            S+LLAT   D+ +AA+IRSL+M
Sbjct  69   SQLLATIDADSPEAAIIRSLIM  90



>ref|XP_003551974.1| PREDICTED: transcription factor bHLH135-like [Glycine max]
 gb|KHN32887.1| Transcription factor bHLH135 [Glycine soja]
Length=93

 Score =   111 bits (277),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 71/80 (89%), Gaps = 2/80 (3%)
 Frame = +1

Query  139  ASRISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSE  318
            ++ I+D QI D++SKLQQL+PEL    SDKVSA++VLQ+TCNYI+SLHREVDDLS+RLS+
Sbjct  14   STEITDAQITDIISKLQQLIPELDARRSDKVSASKVLQETCNYIKSLHREVDDLSDRLSQ  73

Query  319  LLATTDTN--QAALIRSLLM  372
            LLATTD+N  QAA+IRSLL+
Sbjct  74   LLATTDSNSAQAAIIRSLLL  93



>ref|XP_006404347.1| hypothetical protein EUTSA_v10010858mg [Eutrema salsugineum]
 gb|ESQ45800.1| hypothetical protein EUTSA_v10010858mg [Eutrema salsugineum]
Length=92

 Score =   110 bits (276),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 71/81 (88%), Gaps = 1/81 (1%)
 Frame = +1

Query  136  GASRISDDQINDLVSKLQQLLPELRNTS-SDKVSAARVLQDTCNYIRSLHREVDDLSERL  312
            GAS  ++DQINDLV +L +LLPEL NT  S KVSA++VLQ+TC+YIR+L++EVDDLSERL
Sbjct  12   GASMFTEDQINDLVHQLHRLLPELGNTRRSGKVSASKVLQETCSYIRNLNKEVDDLSERL  71

Query  313  SELLATTDTNQAALIRSLLMQ  375
            S+LL +TD+ QAALIRSLLMQ
Sbjct  72   SQLLESTDSAQAALIRSLLMQ  92



>ref|XP_010552588.1| PREDICTED: transcription factor PRE6 [Tarenaya hassleriana]
Length=95

 Score =   110 bits (276),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 69/78 (88%), Gaps = 2/78 (3%)
 Frame = +1

Query  142  SRISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSEL  321
            SRIS+DQI DLVSKLQ L+PELR   SDKVSA++VLQ+TCNYI++LHREVDDL +RLSEL
Sbjct  16   SRISEDQIADLVSKLQLLIPELRRRRSDKVSASKVLQETCNYIKNLHREVDDLGDRLSEL  75

Query  322  LATTDTN--QAALIRSLL  369
            LA+TD N  +AA+IRSLL
Sbjct  76   LASTDHNSPEAAIIRSLL  93



>ref|XP_004297318.1| PREDICTED: transcription factor bHLH135-like [Fragaria vesca 
subsp. vesca]
Length=98

 Score =   110 bits (276),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 72/78 (92%), Gaps = 3/78 (4%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTSSD-KVSAARVLQDTCNYIRSLHREVDDLSERLSELL  324
            ISD+QI DLVSKLQQLLPE+R+  SD KVSA++VLQ+TCNYI++LHREVDDLSERLS+LL
Sbjct  21   ISDEQIADLVSKLQQLLPEIRHRRSDNKVSASKVLQETCNYIKNLHREVDDLSERLSQLL  80

Query  325  ATT--DTNQAALIRSLLM  372
            ATT  D++QA++IRSLLM
Sbjct  81   ATTDMDSDQASIIRSLLM  98



>gb|KDP45499.1| hypothetical protein JCGZ_09748 [Jatropha curcas]
Length=91

 Score =   110 bits (276),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 71/84 (85%), Gaps = 2/84 (2%)
 Frame = +1

Query  127  NTGGASRISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSE  306
             +    RISD+QI +L+SKL+QLLPE+R+  SDKVSA++VLQ+TCNYIR+LHREVDDLSE
Sbjct  8    QSASVPRISDEQIIELISKLRQLLPEIRDRRSDKVSASKVLQETCNYIRNLHREVDDLSE  67

Query  307  RLSELLAT--TDTNQAALIRSLLM  372
            RLS+LL T   D+ +AA+IRSL+M
Sbjct  68   RLSQLLTTIDADSPEAAIIRSLIM  91



>ref|XP_003613657.1| Transcription factor bHLH135 [Medicago truncatula]
 gb|AES96615.1| transcription factor [Medicago truncatula]
 gb|AFK37543.1| unknown [Medicago truncatula]
Length=93

 Score =   110 bits (276),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 55/77 (71%), Positives = 69/77 (90%), Gaps = 2/77 (3%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLA  327
            I+D QI DL+SKLQQL+PEL  + S+KVSA +VLQ+TCNYI++LHREVDDLS+RLS+LLA
Sbjct  17   ITDAQITDLISKLQQLIPELHASRSNKVSATKVLQETCNYIKNLHREVDDLSDRLSQLLA  76

Query  328  TTDTN--QAALIRSLLM  372
            +TD+N  QAA+IRSLLM
Sbjct  77   STDSNSAQAAIIRSLLM  93



>ref|XP_010551862.1| PREDICTED: transcription factor PRE1-like [Tarenaya hassleriana]
Length=91

 Score =   110 bits (275),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 72/83 (87%), Gaps = 3/83 (4%)
 Frame = +1

Query  133  GGASRISDDQINDLVSKLQQLLPELR-NTSSDKVSAARVLQDTCNYIRSLHREVDDLSER  309
              ASRISDDQI DLVSKL+QLLPE+R N  SDKVSA++VLQ+TCNYIR+L+REVDDLSER
Sbjct  9    ASASRISDDQIIDLVSKLRQLLPEIRPNRRSDKVSASKVLQETCNYIRNLNREVDDLSER  68

Query  310  LSELLATTDTN--QAALIRSLLM  372
            LS+LL T D +  +AA++RSL+M
Sbjct  69   LSQLLETIDADSPEAAIVRSLIM  91



>ref|XP_008780728.1| PREDICTED: transcription factor ILI6-like [Phoenix dactylifera]
Length=92

 Score =   110 bits (275),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 64/75 (85%), Gaps = 2/75 (3%)
 Frame = +1

Query  154  DDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLATT  333
            ++QINDLVSKL+ LLPE    S+   SAARVLQDTCNYIRSLHREVDDLSERLSELLATT
Sbjct  18   EEQINDLVSKLEALLPEASIRSNSSASAARVLQDTCNYIRSLHREVDDLSERLSELLATT  77

Query  334  DTN--QAALIRSLLM  372
            DT   QAA+IRSLLM
Sbjct  78   DTTSAQAAIIRSLLM  92



>ref|XP_010926221.1| PREDICTED: transcription factor ILI6-like [Elaeis guineensis]
Length=93

 Score =   110 bits (275),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 67/77 (87%), Gaps = 2/77 (3%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLA  327
            I+D+QINDLVSKLQ LLPE    S++ + AARVLQDTCN+IRSLH+EVDDLSERLSELLA
Sbjct  17   ITDEQINDLVSKLQALLPEAGIRSNNSMPAARVLQDTCNHIRSLHQEVDDLSERLSELLA  76

Query  328  TTDTN--QAALIRSLLM  372
            TTDT   QAA+IRSLLM
Sbjct  77   TTDTTSAQAAIIRSLLM  93



>ref|XP_004490021.1| PREDICTED: transcription factor bHLH135-like [Cicer arietinum]
Length=94

 Score =   110 bits (275),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 70/78 (90%), Gaps = 2/78 (3%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLA  327
            I+D QI DLV+KL +L+PELR + S KVSAA+VLQ+TCNYI++LHREVDDLS+RLS+LLA
Sbjct  17   ITDAQITDLVAKLLRLIPELRPSRSGKVSAAKVLQETCNYIKNLHREVDDLSDRLSQLLA  76

Query  328  TTDTN--QAALIRSLLMQ  375
            TTD+N  QAA+IRSLLM+
Sbjct  77   TTDSNSAQAAIIRSLLMK  94



>ref|NP_849712.1| basic helix-loop-helix protein KIDARI [Arabidopsis thaliana]
 ref|XP_002893369.1| hypothetical protein ARALYDRAFT_472704 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_010498979.1| PREDICTED: transcription factor PRE6 [Camelina sativa]
 sp|Q8GW32.1|PRE6_ARATH RecName: Full=Transcription factor PRE6; AltName: Full=Basic 
helix-loop-helix protein 163; Short=AtbHLH163; Short=bHLH 163; 
AltName: Full=Protein KIDARI; AltName: Full=Protein PACLOBUTRAZOL 
RESISTANCE 6; AltName: Full=bHLH transcription factor 
bHLH163 [Arabidopsis thaliana]
 dbj|BAC43682.1| unknown protein [Arabidopsis thaliana]
 gb|AAO42932.1| At1g26948 [Arabidopsis thaliana]
 gb|EFH69628.1| hypothetical protein ARALYDRAFT_472704 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AEE30763.1| basic helix-loop-helix protein KIDARI [Arabidopsis thaliana]
Length=94

 Score =   110 bits (275),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 67/74 (91%), Gaps = 2/74 (3%)
 Frame = +1

Query  154  DDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLATT  333
            DDQI+DLVSKLQ L+PELR   SDKVSA++VLQ+TCNYIR+LHREVDDLS+RLSELLA+T
Sbjct  19   DDQISDLVSKLQHLIPELRRRRSDKVSASKVLQETCNYIRNLHREVDDLSDRLSELLAST  78

Query  334  DTN--QAALIRSLL  369
            D N  +AA+IRSLL
Sbjct  79   DDNSAEAAIIRSLL  92



>ref|XP_009777244.1| PREDICTED: transcription factor PRE6-like [Nicotiana sylvestris]
Length=93

 Score =   110 bits (274),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 69/77 (90%), Gaps = 2/77 (3%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLA  327
            ISDDQI DLVSKLQQL+PE+RN  SDKV+A++VLQ+TCNYIR+LHREVD LS+RLS+LL 
Sbjct  17   ISDDQIADLVSKLQQLIPEIRNRRSDKVTASKVLQETCNYIRNLHREVDGLSDRLSQLLE  76

Query  328  TT--DTNQAALIRSLLM  372
            +T  D+ QA++IRSLLM
Sbjct  77   STESDSVQASIIRSLLM  93



>ref|XP_004146747.1| PREDICTED: transcription factor bHLH135-like [Cucumis sativus]
 ref|XP_004162540.1| PREDICTED: transcription factor bHLH135-like [Cucumis sativus]
 gb|KGN47805.1| hypothetical protein Csa_6G404200 [Cucumis sativus]
Length=96

 Score =   110 bits (274),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 69/84 (82%), Gaps = 3/84 (4%)
 Frame = +1

Query  130  TGGASRISDDQINDLVSKLQQLLPELRNT-SSDKVSAARVLQDTCNYIRSLHREVDDLSE  306
            T  +  ISDDQI DLVSKLQ+L+PELRN  +S K SA+RVLQ+TCNYIR+LHREVDDLSE
Sbjct  13   TAASPLISDDQIADLVSKLQRLIPELRNPRASHKASASRVLQETCNYIRNLHREVDDLSE  72

Query  307  RLSELLATT--DTNQAALIRSLLM  372
            RLS+LLA T  D+ +A +IRSL M
Sbjct  73   RLSQLLAATENDSAEATIIRSLFM  96



>ref|XP_004983143.1| PREDICTED: transcription factor bHLH135-like [Setaria italica]
Length=94

 Score =   110 bits (274),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/77 (75%), Positives = 68/77 (88%), Gaps = 2/77 (3%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLA  327
            ISD+QI+DLV+KLQ LLPE R  S+D+V +ARVLQ+TC+YIRSLHREVDDLS+RLSELLA
Sbjct  18   ISDEQISDLVAKLQALLPEARLRSNDRVPSARVLQETCSYIRSLHREVDDLSDRLSELLA  77

Query  328  TTD--TNQAALIRSLLM  372
            T D  T QAA+IRSLLM
Sbjct  78   TADVSTAQAAVIRSLLM  94



>ref|XP_010550611.1| PREDICTED: transcription factor PRE4 [Tarenaya hassleriana]
Length=92

 Score =   110 bits (274),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 70/81 (86%), Gaps = 1/81 (1%)
 Frame = +1

Query  136  GASRISDDQINDLVSKLQQLLPELRNT-SSDKVSAARVLQDTCNYIRSLHREVDDLSERL  312
            GA  I+++QINDLV +L +L+PELR+  SS+KVSA+RVLQ+TC+YIRSLH+EVDDLSERL
Sbjct  12   GAPMITEEQINDLVVQLHRLVPELRDRRSSNKVSASRVLQETCSYIRSLHKEVDDLSERL  71

Query  313  SELLATTDTNQAALIRSLLMQ  375
            S+LL T D+ QAA IRSLL Q
Sbjct  72   SQLLETADSAQAAFIRSLLTQ  92



>ref|XP_004296550.1| PREDICTED: transcription factor bHLH135-like [Fragaria vesca 
subsp. vesca]
Length=94

 Score =   109 bits (273),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 70/78 (90%), Gaps = 2/78 (3%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLA  327
            I DDQI +LVSKL+QL+PE+R+  SDKVSA++VLQ+TC+YIR+LHREVDDLSERLS+LLA
Sbjct  17   IKDDQIIELVSKLRQLVPEIRDRRSDKVSASKVLQETCSYIRNLHREVDDLSERLSQLLA  76

Query  328  TTDTN--QAALIRSLLMQ  375
            T D +  +AA+IRSL+MQ
Sbjct  77   TIDADSAEAAIIRSLIMQ  94



>ref|XP_010917014.1| PREDICTED: transcription factor ILI6-like [Elaeis guineensis]
Length=92

 Score =   109 bits (273),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/77 (75%), Positives = 67/77 (87%), Gaps = 2/77 (3%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLA  327
            I+D+QINDLVSKLQ LLPE    S+++VSAA VLQDTCNYIRSLH+E +DLSERLSELLA
Sbjct  16   ITDEQINDLVSKLQALLPEAGIRSNERVSAASVLQDTCNYIRSLHQEANDLSERLSELLA  75

Query  328  TTDTN--QAALIRSLLM  372
            TTD +  QAA+IRSLLM
Sbjct  76   TTDASSAQAAIIRSLLM  92



>ref|NP_190355.2| atypical non-DNA binding bHLH protein BNQ3 [Arabidopsis thaliana]
 sp|F4JCN9.1|PRE4_ARATH RecName: Full=Transcription factor PRE4; AltName: Full=Basic 
helix-loop-helix protein 161; Short=AtbHLH161; Short=bHLH 161; 
AltName: Full=Protein BANQUO 3; AltName: Full=Protein PACLOBUTRAZOL 
RESISTANCE 4; AltName: Full=bHLH transcription factor 
bHLH161 [Arabidopsis thaliana]
 gb|AEE78321.1| protein banquo 3 [Arabidopsis thaliana]
Length=92

 Score =   109 bits (272),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 70/81 (86%), Gaps = 1/81 (1%)
 Frame = +1

Query  136  GASRISDDQINDLVSKLQQLLPELRNTS-SDKVSAARVLQDTCNYIRSLHREVDDLSERL  312
            GAS I+D+QINDLV +L +LLPEL N   S KVSA+RVLQ+TC+YIR+L +EVDDLSERL
Sbjct  12   GASMITDEQINDLVLQLHRLLPELANNRRSGKVSASRVLQETCSYIRNLSKEVDDLSERL  71

Query  313  SELLATTDTNQAALIRSLLMQ  375
            S+LL +TD+ QAALIRSLLMQ
Sbjct  72   SQLLESTDSAQAALIRSLLMQ  92



>gb|KFK44602.1| hypothetical protein AALP_AA1G280300 [Arabis alpina]
Length=94

 Score =   109 bits (273),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 67/74 (91%), Gaps = 2/74 (3%)
 Frame = +1

Query  154  DDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLATT  333
            DDQI+DLVSKLQ L+PE+R   SDKVSA++VLQ+TCNYIR+LHREVDDLS+RLSELLA+T
Sbjct  19   DDQISDLVSKLQHLIPEIRRRRSDKVSASKVLQETCNYIRNLHREVDDLSDRLSELLAST  78

Query  334  DTN--QAALIRSLL  369
            D N  +AA+IRSLL
Sbjct  79   DDNSAEAAIIRSLL  92



>ref|XP_004135185.1| PREDICTED: transcription factor bHLH135-like [Cucumis sativus]
 ref|XP_004155314.1| PREDICTED: transcription factor bHLH135-like [Cucumis sativus]
 gb|KGN51900.1| Transcription regulator [Cucumis sativus]
Length=95

 Score =   109 bits (272),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 70/78 (90%), Gaps = 3/78 (4%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNT-SSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELL  324
            ISD+QI DL+SKLQQL+PE+RN  SS +VSA++VLQ+TCNYIRSL REVDDLS+RLSELL
Sbjct  18   ISDEQIADLISKLQQLIPEIRNGRSSSRVSASKVLQETCNYIRSLQREVDDLSDRLSELL  77

Query  325  ATTD--TNQAALIRSLLM  372
            A+TD  + QAA+IRSLLM
Sbjct  78   ASTDPESAQAAIIRSLLM  95



>ref|XP_006303467.1| hypothetical protein CARUB_v10010751mg [Capsella rubella]
 gb|EOA36365.1| hypothetical protein CARUB_v10010751mg [Capsella rubella]
Length=94

 Score =   109 bits (272),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 67/74 (91%), Gaps = 2/74 (3%)
 Frame = +1

Query  154  DDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLATT  333
            DDQI+DLV+KLQ L+PELR   SDKVSA++VLQ+TCNYIR+LHREVDDLS+RLSELLA+T
Sbjct  19   DDQISDLVTKLQHLIPELRRRRSDKVSASKVLQETCNYIRNLHREVDDLSDRLSELLAST  78

Query  334  DTN--QAALIRSLL  369
            D N  +AA+IRSLL
Sbjct  79   DDNSAEAAIIRSLL  92



>ref|XP_009610531.1| PREDICTED: transcription factor PRE6-like [Nicotiana tomentosiformis]
Length=93

 Score =   109 bits (272),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 68/77 (88%), Gaps = 2/77 (3%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLA  327
            ISDDQI DLVSKLQQL+PE+RN  SDKVSA++VLQ+TCNYIR+LH EVD LS+RLS+LL 
Sbjct  17   ISDDQIADLVSKLQQLIPEIRNRRSDKVSASKVLQETCNYIRNLHSEVDGLSDRLSQLLE  76

Query  328  TT--DTNQAALIRSLLM  372
            +T  D+ QA++IRSLLM
Sbjct  77   STESDSAQASIIRSLLM  93



>ref|XP_008465587.1| PREDICTED: transcription factor PRE6-like [Cucumis melo]
Length=96

 Score =   109 bits (272),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 69/78 (88%), Gaps = 3/78 (4%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNT-SSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELL  324
            ISDDQI DLVSKLQ+L+PELRN  +S KVSA+RVLQ+TCNYIR+LHREVDDLSERLS+LL
Sbjct  19   ISDDQIADLVSKLQRLIPELRNPRASHKVSASRVLQETCNYIRNLHREVDDLSERLSQLL  78

Query  325  ATT--DTNQAALIRSLLM  372
            A T  D+ +AA+IRSL +
Sbjct  79   AATENDSAEAAIIRSLFL  96



>ref|XP_009388768.1| PREDICTED: transcription factor ILI6-like [Musa acuminata subsp. 
malaccensis]
Length=92

 Score =   108 bits (271),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 66/76 (87%), Gaps = 2/76 (3%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLA  327
            I+D+QINDL++KLQ +LPE    S+D+VSAA+VLQDTCNYIRSLHREVDDLSERLSELLA
Sbjct  16   ITDEQINDLLTKLQAVLPEAHLRSTDRVSAAKVLQDTCNYIRSLHREVDDLSERLSELLA  75

Query  328  TTDTN--QAALIRSLL  369
              D N  QAA+IRSLL
Sbjct  76   NNDINSAQAAIIRSLL  91



>ref|NP_001049112.1| Os03g0171300 [Oryza sativa Japonica Group]
 sp|Q0DUR2.1|ILI6_ORYSJ RecName: Full=Transcription factor ILI6; Short=OsILI6; AltName: 
Full=Protein INCREASED LEAF INCLINATION 6; AltName: Full=Protein 
POSITIVE REGULATOR OF GRAIN LENGTH 1 [Oryza sativa Japonica 
Group]
 sp|B8APB5.1|ILI6_ORYSI RecName: Full=Transcription factor ILI6; Short=OsILI6; AltName: 
Full=Protein INCREASED LEAF INCLINATION 6 [Oryza sativa Indica 
Group]
 dbj|BAF11026.1| Os03g0171300 [Oryza sativa Japonica Group]
 gb|EAZ25749.1| hypothetical protein OsJ_09588 [Oryza sativa Japonica Group]
 gb|EEC74604.1| hypothetical protein OsI_10199 [Oryza sativa Indica Group]
Length=92

 Score =   108 bits (271),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 57/77 (74%), Positives = 69/77 (90%), Gaps = 2/77 (3%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLA  327
            I+D+QI+DLVSKLQ LLPE R  S+D+V ++RVLQ+TCNYIRSLH+EVDDLSERLSELLA
Sbjct  16   ITDEQISDLVSKLQDLLPEARLRSNDRVPSSRVLQETCNYIRSLHQEVDDLSERLSELLA  75

Query  328  TTDTN--QAALIRSLLM  372
            T+D +  QAA+IRSLLM
Sbjct  76   TSDMSSAQAAIIRSLLM  92



>ref|XP_006415982.1| hypothetical protein EUTSA_v10009197mg [Eutrema salsugineum]
 gb|ESQ34335.1| hypothetical protein EUTSA_v10009197mg [Eutrema salsugineum]
Length=94

 Score =   108 bits (271),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 67/74 (91%), Gaps = 2/74 (3%)
 Frame = +1

Query  154  DDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLATT  333
            DDQI+DLVSKLQ L+PELR   SDKVSA++VLQ+TCNYIR+LHREVDDLS+RLSELL++T
Sbjct  19   DDQISDLVSKLQHLIPELRRRRSDKVSASKVLQETCNYIRNLHREVDDLSDRLSELLSST  78

Query  334  DTN--QAALIRSLL  369
            D N  +AA+IRSLL
Sbjct  79   DDNSAEAAIIRSLL  92



>ref|XP_009602440.1| PREDICTED: transcription factor PRE5-like [Nicotiana tomentosiformis]
Length=93

 Score =   108 bits (271),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 70/81 (86%), Gaps = 2/81 (2%)
 Frame = +1

Query  136  GASRISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLS  315
            G SRISDDQI +L+SKLQQLLPE+    ++K SA++VLQ+TCNYIRSLH+EVDDLS+RLS
Sbjct  13   GTSRISDDQIIELMSKLQQLLPEIPTRRTNKASASKVLQETCNYIRSLHKEVDDLSDRLS  72

Query  316  ELLAT--TDTNQAALIRSLLM  372
            +LL+T   D+ +AA+IRSLLM
Sbjct  73   QLLSTIDADSPEAAIIRSLLM  93



>gb|ABK95506.1| unknown [Populus trichocarpa]
Length=84

 Score =   108 bits (270),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 69/82 (84%), Gaps = 2/82 (2%)
 Frame = +1

Query  133  GGASRISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERL  312
                RI+DDQI  LVSKL+QLLPE+R   SDKVSA++VLQ+TCNYI++LHREVDDLSERL
Sbjct  3    SSVPRITDDQIIHLVSKLRQLLPEIRQRRSDKVSASKVLQETCNYIKNLHREVDDLSERL  62

Query  313  SELLATTDTN--QAALIRSLLM  372
            S+LLAT D++  +A +IRSL+M
Sbjct  63   SQLLATIDSDSPEAEIIRSLIM  84



>ref|XP_010937071.1| PREDICTED: transcription factor ILI6-like [Elaeis guineensis]
Length=92

 Score =   108 bits (270),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 57/77 (74%), Positives = 68/77 (88%), Gaps = 2/77 (3%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLA  327
            I+DDQI DLVSKLQ LLPE    S+++ SAA+VLQDTCNYIRSLH+E+DDLSERL+ELLA
Sbjct  16   ITDDQIIDLVSKLQALLPESHRRSTERESAAKVLQDTCNYIRSLHQEMDDLSERLAELLA  75

Query  328  TTDT--NQAALIRSLLM  372
            TT+T  +QAA+IRSLLM
Sbjct  76   TTETTSDQAAIIRSLLM  92



>ref|XP_010503380.1| PREDICTED: transcription factor PRE4-like [Camelina sativa]
Length=93

 Score =   108 bits (270),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 70/81 (86%), Gaps = 1/81 (1%)
 Frame = +1

Query  136  GASRISDDQINDLVSKLQQLLPELRNT-SSDKVSAARVLQDTCNYIRSLHREVDDLSERL  312
            GA  I+++QINDLV +L +LLPEL N  SS KVSA+RVLQ+TC+YIR+L +EVDDLSERL
Sbjct  13   GAPMITEEQINDLVLQLHRLLPELGNNRSSGKVSASRVLQETCSYIRNLSKEVDDLSERL  72

Query  313  SELLATTDTNQAALIRSLLMQ  375
            S+LL +TD+ QAALIRSLLMQ
Sbjct  73   SQLLESTDSAQAALIRSLLMQ  93



>ref|XP_009103115.1| PREDICTED: transcription factor PRE6-like [Brassica rapa]
 emb|CDY40269.1| BnaA07g09310D [Brassica napus]
Length=94

 Score =   108 bits (270),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 66/74 (89%), Gaps = 2/74 (3%)
 Frame = +1

Query  154  DDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLATT  333
            DDQI+DLV+KLQ L+PELR   SDKVSA++VLQ+TCNYIR+LHREVDDLS+RLSE LA+T
Sbjct  19   DDQISDLVTKLQHLIPELRRRRSDKVSASKVLQETCNYIRNLHREVDDLSDRLSEFLAST  78

Query  334  DTN--QAALIRSLL  369
            D N  +AA+IRSLL
Sbjct  79   DDNSAEAAIIRSLL  92



>ref|XP_010460241.1| PREDICTED: transcription factor PRE6-like [Camelina sativa]
 ref|XP_010477789.1| PREDICTED: transcription factor PRE6-like [Camelina sativa]
Length=94

 Score =   108 bits (269),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 66/74 (89%), Gaps = 2/74 (3%)
 Frame = +1

Query  154  DDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLATT  333
            DDQI+DLVSKLQ L+PEL    SDKVSA++VLQ+TCNYIR+LHREVDDLS+RLSELLA+T
Sbjct  19   DDQISDLVSKLQHLIPELHRRRSDKVSASKVLQETCNYIRNLHREVDDLSDRLSELLAST  78

Query  334  DTN--QAALIRSLL  369
            D N  +AA+IRSLL
Sbjct  79   DDNSAEAAIIRSLL  92



>ref|XP_003558708.2| PREDICTED: transcription factor ILI6 isoform X2 [Brachypodium 
distachyon]
Length=122

 Score =   108 bits (271),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 57/77 (74%), Positives = 69/77 (90%), Gaps = 2/77 (3%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLA  327
            I+D+QI+DLVSKLQ LLPE R  S+D+V ++RVLQ+TC+YIRSLHREVDDLSERLSELLA
Sbjct  46   ITDEQISDLVSKLQDLLPEARLRSNDRVPSSRVLQETCSYIRSLHREVDDLSERLSELLA  105

Query  328  TTDTN--QAALIRSLLM  372
            T+D +  QAA+IRSLLM
Sbjct  106  TSDMSSAQAAIIRSLLM  122



>sp|Q338G6.1|ILI7_ORYSJ RecName: Full=Transcription factor ILI7; Short=OsILI7; AltName: 
Full=Basic helix-loop-helix protein 173; Short=OsbHLH173; 
AltName: Full=Protein INCREASED LEAF INCLINATION 7; AltName: 
Full=bHLH transcription factor bHLH173 [Oryza sativa Japonica 
Group]
 gb|ABB47567.1| hypothetical protein LOC_Os10g26460 [Oryza sativa Japonica Group]
Length=91

 Score =   108 bits (269),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 65/77 (84%), Gaps = 2/77 (3%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLA  327
            I+D+QI DLVSKLQ LLPE R  S+D+V +ARVLQ+TC+YIRSLHREVDDLSERL+ELLA
Sbjct  15   ITDEQIGDLVSKLQALLPEARLRSNDRVPSARVLQETCSYIRSLHREVDDLSERLAELLA  74

Query  328  TTD--TNQAALIRSLLM  372
              D  T QAA+IR LLM
Sbjct  75   AADVSTAQAAVIRGLLM  91



>gb|EAZ44693.1| hypothetical protein OsJ_29320 [Oryza sativa Japonica Group]
Length=91

 Score =   108 bits (269),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 65/77 (84%), Gaps = 2/77 (3%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLA  327
            I+D+QI DLVSKLQ LLPE R  S+D+V +ARVLQ+TC+YIRSLHREVDDLSERL+ELLA
Sbjct  15   ITDEQIGDLVSKLQALLPEARLRSNDRVPSARVLQETCSYIRSLHREVDDLSERLAELLA  74

Query  328  TTD--TNQAALIRSLLM  372
              D  T QAA+IR LLM
Sbjct  75   AADVSTAQAAVIRGLLM  91



>sp|A2Z730.1|ILI7_ORYSI RecName: Full=Transcription factor ILI7; AltName: Full=Basic 
helix-loop-helix protein 173; AltName: Full=Protein INCREASED 
LEAF INCLINATION 7; AltName: Full=bHLH transcription factor 
bHLH173 [Oryza sativa Indica Group]
 gb|EAY78414.1| hypothetical protein OsI_33503 [Oryza sativa Indica Group]
Length=91

 Score =   108 bits (269),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 65/77 (84%), Gaps = 2/77 (3%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLA  327
            I+D+QI DLVSKLQ LLPE R  S+D+V +ARVLQ+TC+YIRSLHREVDDLSERL+ELLA
Sbjct  15   ITDEQIGDLVSKLQALLPEARLRSNDRVPSARVLQETCSYIRSLHREVDDLSERLAELLA  74

Query  328  TTD--TNQAALIRSLLM  372
              D  T QAA+IR LLM
Sbjct  75   AADVSTAQAAVIRGLLM  91



>ref|XP_002305320.1| hypothetical protein POPTR_0004s13380g [Populus trichocarpa]
 gb|EEE85831.1| hypothetical protein POPTR_0004s13380g [Populus trichocarpa]
Length=90

 Score =   108 bits (269),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 69/80 (86%), Gaps = 2/80 (3%)
 Frame = +1

Query  139  ASRISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSE  318
              RI+DDQI  LVSKL+QLLPE+R   SDKVSA++VLQ+TCNYI++LHREVDDLSERLS+
Sbjct  11   VPRITDDQIIHLVSKLRQLLPEIRQRRSDKVSASKVLQETCNYIKNLHREVDDLSERLSQ  70

Query  319  LLATTDTN--QAALIRSLLM  372
            LLAT D++  +A +IRSL+M
Sbjct  71   LLATIDSDSPEAEIIRSLIM  90



>ref|XP_011013171.1| PREDICTED: transcription factor PRE1-like [Populus euphratica]
Length=90

 Score =   108 bits (269),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 69/80 (86%), Gaps = 2/80 (3%)
 Frame = +1

Query  139  ASRISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSE  318
              RI+DDQI +LVSKL+QLLPE+R   SDKVSA++VLQ+TCNYI++LHREVDDLSERLS+
Sbjct  11   VPRITDDQIINLVSKLRQLLPEIRQRRSDKVSASKVLQETCNYIKNLHREVDDLSERLSQ  70

Query  319  LLATT--DTNQAALIRSLLM  372
            LLAT   D+ +A +IRSL+M
Sbjct  71   LLATIDFDSPEAEIIRSLIM  90



>ref|XP_008446331.1| PREDICTED: transcription factor PRE6-like [Cucumis melo]
Length=95

 Score =   108 bits (269),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/78 (73%), Positives = 70/78 (90%), Gaps = 3/78 (4%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNT-SSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELL  324
            ISD+QI DL+SKLQQL+PE+RN  SS +VSA++VLQ+TCNYIRSL REVDDLS+RLS+LL
Sbjct  18   ISDEQIADLISKLQQLIPEIRNGRSSSRVSASKVLQETCNYIRSLQREVDDLSDRLSQLL  77

Query  325  ATTD--TNQAALIRSLLM  372
            A+TD  + QAA+IRSLLM
Sbjct  78   ASTDPESAQAAIIRSLLM  95



>emb|CDY24160.1| BnaC03g57170D [Brassica napus]
Length=93

 Score =   107 bits (268),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 69/81 (85%), Gaps = 2/81 (2%)
 Frame = +1

Query  136  GASRISDDQINDLVSKLQQLLPELRNTS--SDKVSAARVLQDTCNYIRSLHREVDDLSER  309
            GAS IS+DQINDLV +L +LLPEL N    S KVSA++VLQ+TC YIR+L++EVDDLSER
Sbjct  13   GASMISEDQINDLVLQLHRLLPELGNNHRRSGKVSASKVLQETCTYIRNLNKEVDDLSER  72

Query  310  LSELLATTDTNQAALIRSLLM  372
            LS+LL +TD+ QAALIRSLLM
Sbjct  73   LSQLLESTDSAQAALIRSLLM  93



>ref|XP_009115425.1| PREDICTED: transcription factor PRE6-like [Brassica rapa]
 emb|CDY16207.1| BnaA09g29410D [Brassica napus]
Length=95

 Score =   107 bits (268),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 66/74 (89%), Gaps = 2/74 (3%)
 Frame = +1

Query  154  DDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLATT  333
            DDQI+DLV++LQ L+PELR   SDKVSA+ VLQ+TCNYIR+LHREVDDLS+RLSELLATT
Sbjct  20   DDQISDLVTRLQHLIPELRRRRSDKVSASTVLQETCNYIRNLHREVDDLSDRLSELLATT  79

Query  334  DTN--QAALIRSLL  369
            D N  +AA+IRSLL
Sbjct  80   DDNSAEAAIIRSLL  93



>ref|XP_011012195.1| PREDICTED: transcription factor PRE1-like [Populus euphratica]
Length=90

 Score =   107 bits (267),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 68/78 (87%), Gaps = 2/78 (3%)
 Frame = +1

Query  145  RISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELL  324
            RI+DDQI DLVSKL+QLLPE+    S+K SA++VLQ+TCNYIR+LHREVDDLSERLS+LL
Sbjct  13   RITDDQIIDLVSKLRQLLPEISQRRSEKASASKVLQETCNYIRNLHREVDDLSERLSQLL  72

Query  325  ATTDTN--QAALIRSLLM  372
            AT D +  +AA+IRSL+M
Sbjct  73   ATIDADSPEAAIIRSLIM  90



>ref|XP_007215198.1| hypothetical protein PRUPE_ppa014004mg [Prunus persica]
 ref|XP_007215199.1| hypothetical protein PRUPE_ppa014004mg [Prunus persica]
 ref|XP_008230751.1| PREDICTED: transcription factor PRE6-like [Prunus mume]
 gb|EMJ16397.1| hypothetical protein PRUPE_ppa014004mg [Prunus persica]
 gb|EMJ16398.1| hypothetical protein PRUPE_ppa014004mg [Prunus persica]
Length=91

 Score =   107 bits (267),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 70/83 (84%), Gaps = 2/83 (2%)
 Frame = +1

Query  133  GGASRISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERL  312
             G   I DDQI +LVSKL+QL+PE+R+  SDKVSA++VLQ+TC+YIR+LHREVDDLSERL
Sbjct  9    SGTPTIKDDQIIELVSKLRQLVPEIRDRRSDKVSASKVLQETCSYIRNLHREVDDLSERL  68

Query  313  SELLATTDTN--QAALIRSLLMQ  375
            S+LL+T D +  +AA+IRSL+ Q
Sbjct  69   SQLLSTIDADSPEAAIIRSLITQ  91



>ref|XP_009110054.1| PREDICTED: transcription factor PRE6 [Brassica rapa]
 emb|CDY46428.1| BnaA08g20020D [Brassica napus]
Length=94

 Score =   107 bits (267),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 67/74 (91%), Gaps = 2/74 (3%)
 Frame = +1

Query  154  DDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLATT  333
            DDQI+DLV+KLQ L+PELR   SDKVSA++VLQ+TCNYIR+LHREVDDLS+RLSELLA+T
Sbjct  19   DDQISDLVTKLQHLIPELRRRRSDKVSASKVLQETCNYIRNLHREVDDLSDRLSELLAST  78

Query  334  DTN--QAALIRSLL  369
            D +  +AA+IRSLL
Sbjct  79   DDDSAEAAIIRSLL  92



>ref|XP_009393531.1| PREDICTED: transcription factor ILI6-like [Musa acuminata subsp. 
malaccensis]
Length=92

 Score =   107 bits (266),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 67/79 (85%), Gaps = 2/79 (3%)
 Frame = +1

Query  142  SRISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSEL  321
            +RI+D+QIN+L+SKLQ +LPE R   +D+VSAA+VLQ+TC++IR LHREVDDLSERLSEL
Sbjct  14   TRITDEQINELISKLQSVLPEARRGGNDRVSAAKVLQETCSHIRRLHREVDDLSERLSEL  73

Query  322  LATTDTN--QAALIRSLLM  372
            L + D N  QAA IRSLLM
Sbjct  74   LDSADLNSAQAAFIRSLLM  92



>ref|XP_010317103.1| PREDICTED: transcription factor PRE5 isoform X1 [Solanum lycopersicum]
Length=106

 Score =   107 bits (267),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 72/94 (77%), Gaps = 14/94 (15%)
 Frame = +1

Query  133  GGASRISDDQINDLVSKLQQLLPELRNTSSDK------------VSAARVLQDTCNYIRS  276
            GG SRISDDQI  LVSKLQQLLPE+RN  S+K             SA++VLQ+TCNYIR+
Sbjct  13   GGTSRISDDQIIQLVSKLQQLLPEIRNRRSNKKSTMNLRIDPSQASASKVLQETCNYIRN  72

Query  277  LHREVDDLSERLSELLATTDTN--QAALIRSLLM  372
            LH+EVDDLS+RLS+LL+T D +  +AA+IRSL+M
Sbjct  73   LHKEVDDLSDRLSQLLSTIDADSPEAAIIRSLIM  106



>ref|XP_008459306.1| PREDICTED: transcription factor PRE6-like [Cucumis melo]
 gb|KGN52451.1| Transcription regulator [Cucumis sativus]
Length=91

 Score =   107 bits (266),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 69/76 (91%), Gaps = 2/76 (3%)
 Frame = +1

Query  154  DDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLATT  333
            DDQI +LVSKL+QL+PE+R+   DKVSA++VLQ+TCNYIR+LHREVDDLSERLS+LL+T 
Sbjct  16   DDQIIELVSKLRQLVPEIRHRRPDKVSASKVLQETCNYIRNLHREVDDLSERLSQLLSTI  75

Query  334  DTN--QAALIRSLLMQ  375
            D++  +AA+IRSL+MQ
Sbjct  76   DSDSAEAAIIRSLIMQ  91



>ref|XP_004985540.1| PREDICTED: transcription factor bHLH135-like [Setaria italica]
Length=92

 Score =   106 bits (265),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 68/77 (88%), Gaps = 2/77 (3%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLA  327
            I+++QI+DLVSKLQ LLPE R  S+ +V +ARVLQ+TCNYIRSLH+EVDDLSERLSELLA
Sbjct  16   ITEEQISDLVSKLQDLLPEARLQSNARVPSARVLQETCNYIRSLHQEVDDLSERLSELLA  75

Query  328  TTDTN--QAALIRSLLM  372
            T+D +  QAA+IRSLLM
Sbjct  76   TSDMSSAQAAIIRSLLM  92



>ref|XP_002465780.1| hypothetical protein SORBIDRAFT_01g045710 [Sorghum bicolor]
 gb|EER92778.1| hypothetical protein SORBIDRAFT_01g045710 [Sorghum bicolor]
Length=92

 Score =   106 bits (265),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 68/77 (88%), Gaps = 2/77 (3%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLA  327
            I+++QI+DLVSKLQ LLPE R  S+ +V +ARVLQ+TCNYIRSLH+EVDDLSERLSELLA
Sbjct  16   ITEEQISDLVSKLQDLLPEARLQSNARVPSARVLQETCNYIRSLHQEVDDLSERLSELLA  75

Query  328  TTDTN--QAALIRSLLM  372
            T+D +  QAA+IRSLLM
Sbjct  76   TSDMSSAQAAVIRSLLM  92



>ref|XP_010515078.1| PREDICTED: transcription factor PRE4-like [Camelina sativa]
Length=93

 Score =   106 bits (265),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 69/81 (85%), Gaps = 1/81 (1%)
 Frame = +1

Query  136  GASRISDDQINDLVSKLQQLLPELRNTS-SDKVSAARVLQDTCNYIRSLHREVDDLSERL  312
            GA  I+++QINDLV +L +LLPEL N   S KVSA+RVLQ+TC+YIR+L +EVDDLSERL
Sbjct  13   GAPMITEEQINDLVLQLHRLLPELGNNRRSGKVSASRVLQETCSYIRNLSKEVDDLSERL  72

Query  313  SELLATTDTNQAALIRSLLMQ  375
            S+LL +TD+ QAALIRSLLMQ
Sbjct  73   SQLLESTDSAQAALIRSLLMQ  93



>ref|XP_010426218.1| PREDICTED: transcription factor PRE4 [Camelina sativa]
Length=93

 Score =   106 bits (264),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 69/81 (85%), Gaps = 1/81 (1%)
 Frame = +1

Query  136  GASRISDDQINDLVSKLQQLLPELRNTS-SDKVSAARVLQDTCNYIRSLHREVDDLSERL  312
            GA  I+++QINDLV +L +LLPEL N   S KVSA+RVLQ+TC+YIR+L +EVDDLSERL
Sbjct  13   GAPMITEEQINDLVLQLHRLLPELGNNRRSGKVSASRVLQETCSYIRNLSKEVDDLSERL  72

Query  313  SELLATTDTNQAALIRSLLMQ  375
            S+LL +TD+ QAALIRSLLMQ
Sbjct  73   SQLLESTDSAQAALIRSLLMQ  93



>ref|XP_009149879.1| PREDICTED: transcription factor PRE4 [Brassica rapa]
 emb|CDY36934.1| BnaA06g17190D [Brassica napus]
Length=93

 Score =   106 bits (264),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 69/81 (85%), Gaps = 2/81 (2%)
 Frame = +1

Query  136  GASRISDDQINDLVSKLQQLLPELRNTS--SDKVSAARVLQDTCNYIRSLHREVDDLSER  309
            G S IS+DQINDLV +L +LLPEL N +  S KVSA++VLQ+TC YIR+L++EVDDLSER
Sbjct  13   GTSMISEDQINDLVLQLHRLLPELGNNNRRSGKVSASKVLQETCTYIRNLNKEVDDLSER  72

Query  310  LSELLATTDTNQAALIRSLLM  372
            LS+LL +TD+ QAALIRSLLM
Sbjct  73   LSQLLESTDSAQAALIRSLLM  93



>ref|XP_006292883.1| hypothetical protein CARUB_v10019148mg [Capsella rubella]
 gb|EOA25781.1| hypothetical protein CARUB_v10019148mg [Capsella rubella]
Length=92

 Score =   106 bits (264),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 69/81 (85%), Gaps = 1/81 (1%)
 Frame = +1

Query  136  GASRISDDQINDLVSKLQQLLPELRNTS-SDKVSAARVLQDTCNYIRSLHREVDDLSERL  312
            G   IS++QINDLV +L +LLPEL N   S KVSA+RVLQ+TC+YIR+L +EVDDLSERL
Sbjct  12   GTPMISEEQINDLVLQLHRLLPELGNNRRSGKVSASRVLQETCSYIRNLSKEVDDLSERL  71

Query  313  SELLATTDTNQAALIRSLLMQ  375
            S+LL +TD++QAALIRSLLMQ
Sbjct  72   SQLLESTDSDQAALIRSLLMQ  92



>ref|XP_010551523.1| PREDICTED: transcription factor PRE6-like [Tarenaya hassleriana]
Length=94

 Score =   105 bits (263),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 67/76 (88%), Gaps = 2/76 (3%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLA  327
            IS+DQI DLVSKLQ+L+PELR   SDKVSA+RVLQ+TC YI++LH+EVD LSERLSELLA
Sbjct  17   ISEDQIADLVSKLQRLIPELRRRRSDKVSASRVLQETCEYIKNLHKEVDGLSERLSELLA  76

Query  328  TTDTN--QAALIRSLL  369
            +TD N  +AA+IR+LL
Sbjct  77   STDDNSPEAAIIRNLL  92



>emb|CDP02219.1| unnamed protein product [Coffea canephora]
Length=93

 Score =   105 bits (263),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 68/78 (87%), Gaps = 2/78 (3%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLA  327
            I+DDQI +LVSKLQQLLPE+R   S+K SA++VLQDTCNYIRSLH+EVDDLS+RLS+LL+
Sbjct  15   ITDDQIIELVSKLQQLLPEIRTRRSNKASASKVLQDTCNYIRSLHKEVDDLSDRLSQLLS  74

Query  328  TTDTN--QAALIRSLLMQ  375
            T D +  +AA+IRSLL +
Sbjct  75   TIDADSPEAAIIRSLLAE  92



>ref|XP_010066932.1| PREDICTED: transcription factor PRE6 [Eucalyptus grandis]
 gb|KCW64977.1| hypothetical protein EUGRSUZ_G02519 [Eucalyptus grandis]
Length=94

 Score =   105 bits (263),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 72/77 (94%), Gaps = 2/77 (3%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLA  327
            +SD+QI+DL+SKL+QL+P+LR   +DKVSA+++LQ+TCNYIRSLHREVDDLS++LS+LLA
Sbjct  18   MSDEQISDLLSKLRQLIPQLRTNHTDKVSASKLLQETCNYIRSLHREVDDLSDQLSQLLA  77

Query  328  TT--DTNQAALIRSLLM  372
            +T  D++QAA+IRSLL+
Sbjct  78   STDRDSDQAAIIRSLLL  94



>ref|XP_009805005.1| PREDICTED: transcription factor PRE1-like [Nicotiana sylvestris]
Length=92

 Score =   105 bits (262),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 55/77 (71%), Positives = 68/77 (88%), Gaps = 2/77 (3%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLA  327
            ISDDQI DLVSKLQQLLPE+R   S+K SA++VLQ+TCNYIR+L+REVDDLS+RLS+LL+
Sbjct  16   ISDDQIIDLVSKLQQLLPEIRTRRSNKASASKVLQETCNYIRNLNREVDDLSDRLSQLLS  75

Query  328  TTDTN--QAALIRSLLM  372
            T D +  +AA+IRSLLM
Sbjct  76   TIDADSPEAAIIRSLLM  92



>ref|XP_006649473.1| PREDICTED: transcription factor bHLH135-like isoform X1 [Oryza 
brachyantha]
 ref|XP_006649474.1| PREDICTED: transcription factor bHLH135-like isoform X2 [Oryza 
brachyantha]
 ref|XP_006649475.1| PREDICTED: transcription factor bHLH135-like isoform X3 [Oryza 
brachyantha]
Length=157

 Score =   107 bits (267),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/77 (71%), Positives = 69/77 (90%), Gaps = 2/77 (3%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLA  327
            I+D+QI+DLVSKLQ LLPE R  S+D++ ++RVLQ+TCNYIRSLH+EVDDLSERLSELLA
Sbjct  81   ITDEQISDLVSKLQDLLPEARLRSNDRMPSSRVLQETCNYIRSLHQEVDDLSERLSELLA  140

Query  328  TTDTN--QAALIRSLLM  372
            ++D +  QAA+IRSLLM
Sbjct  141  SSDMSSAQAAIIRSLLM  157



>ref|XP_008379346.1| PREDICTED: transcription factor PRE1 [Malus domestica]
Length=91

 Score =   105 bits (261),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 69/83 (83%), Gaps = 2/83 (2%)
 Frame = +1

Query  133  GGASRISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERL  312
             G   I DDQI +LVSKL+QL+PE+R+  S+K  A++VLQ+TC+YIR+LHREVDDLSERL
Sbjct  9    SGTPAIKDDQIIELVSKLRQLVPEIRDRRSNKAPASKVLQETCSYIRNLHREVDDLSERL  68

Query  313  SELLAT--TDTNQAALIRSLLMQ  375
            S+LL+T   D+ +AA+IRSL+MQ
Sbjct  69   SQLLSTIDADSPEAAIIRSLIMQ  91



>ref|XP_008651476.1| PREDICTED: transcription factor ILI6 [Zea mays]
 tpg|DAA43623.1| TPA: putative HLH DNA-binding domain superfamily protein [Zea 
mays]
 gb|AIB05569.1| bHLH transcription factor, partial [Zea mays]
Length=92

 Score =   104 bits (260),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/77 (71%), Positives = 68/77 (88%), Gaps = 2/77 (3%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLA  327
            I+++QI+DLVSKLQ LLPE R  S+ +V +ARVLQ+TCNYIR+LH+EVDDLSERLSELLA
Sbjct  16   ITEEQISDLVSKLQDLLPEARLQSNARVPSARVLQETCNYIRNLHQEVDDLSERLSELLA  75

Query  328  TTDTN--QAALIRSLLM  372
            T+D +  QAA+IRSLLM
Sbjct  76   TSDMSSAQAAVIRSLLM  92



>gb|KEH24995.1| transcription factor [Medicago truncatula]
Length=92

 Score =   104 bits (260),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 68/78 (87%), Gaps = 2/78 (3%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLA  327
            ISDDQI +LVSKL+QL+PE+R+  SDKVSA++VLQ+TCNYIR+LHREVDDLSERLS+LL 
Sbjct  15   ISDDQIIELVSKLRQLVPEIRHRRSDKVSASKVLQETCNYIRNLHREVDDLSERLSQLLV  74

Query  328  TTDTN--QAALIRSLLMQ  375
            T D +  +A +IRSL+ Q
Sbjct  75   TIDADSPEANIIRSLINQ  92



>ref|NP_974372.1| protein PACLOBUTRAZOL RESISTANCE 5 [Arabidopsis thaliana]
 sp|Q9LJX1.1|PRE5_ARATH RecName: Full=Transcription factor PRE5; AltName: Full=Basic 
helix-loop-helix protein 164; Short=AtbHLH164; Short=bHLH 164; 
AltName: Full=Protein PACLOBUTRAZOL RESISTANCE 5; AltName: 
Full=bHLH transcription factor bHLH164 [Arabidopsis thaliana]
 dbj|BAB02128.1| DNA-binding protein-like [Arabidopsis thaliana]
 gb|ABD57465.1| At3g28857 [Arabidopsis thaliana]
 gb|AEE77497.1| basic helix-loop-helix (bHLH) DNA-binding family protein [Arabidopsis 
thaliana]
Length=92

 Score =   104 bits (259),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 69/84 (82%), Gaps = 3/84 (4%)
 Frame = +1

Query  130  TGGASRISDDQINDLVSKLQQLLPELRNTS-SDKVSAARVLQDTCNYIRSLHREVDDLSE  306
            T  ASRISDDQ+ DLVSKL+Q LPE+     SDKVSA++VLQ+TCNYIR LHREVD+LS+
Sbjct  9    TSNASRISDDQMIDLVSKLRQFLPEIHERRRSDKVSASKVLQETCNYIRKLHREVDNLSD  68

Query  307  RLSELLATTDTN--QAALIRSLLM  372
            RLS+LL + D +  +AA+IRSLLM
Sbjct  69   RLSQLLDSVDEDSPEAAVIRSLLM  92



>gb|KFK33759.1| hypothetical protein AALP_AA5G056500 [Arabis alpina]
Length=92

 Score =   104 bits (259),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 70/84 (83%), Gaps = 3/84 (4%)
 Frame = +1

Query  130  TGGASRISDDQINDLVSKLQQLLPELRNTS-SDKVSAARVLQDTCNYIRSLHREVDDLSE  306
            +  ASRISDDQ+ DLVSKL+QLLPE+R    SDKVSA++VLQ+TCNYIR LHREVD+LS+
Sbjct  9    SSTASRISDDQMIDLVSKLRQLLPEIRERRRSDKVSASKVLQETCNYIRKLHREVDNLSD  68

Query  307  RLSELLATTD--TNQAALIRSLLM  372
            RLS+LL + D  + +A +IRSLLM
Sbjct  69   RLSQLLESVDEESPEATVIRSLLM  92



>ref|XP_008804467.1| PREDICTED: transcription factor ILI6-like [Phoenix dactylifera]
Length=92

 Score =   104 bits (259),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 55/77 (71%), Positives = 64/77 (83%), Gaps = 2/77 (3%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLA  327
            ++DDQI DLVSKLQ LLPE    S+D+ SA +VLQD  NYIRSLH+EVDDLSERL+ELLA
Sbjct  16   MTDDQITDLVSKLQALLPEAPTRSTDRESATKVLQDAWNYIRSLHQEVDDLSERLAELLA  75

Query  328  TTD--TNQAALIRSLLM  372
            TTD   +QAA+IRSLLM
Sbjct  76   TTDITGDQAAIIRSLLM  92



>ref|NP_001234290.1| transcription factor style2.1 [Solanum lycopersicum]
 ref|XP_006338463.1| PREDICTED: transcription factor bHLH135-like [Solanum tuberosum]
 gb|ABX82930.1| transcription factor style2.1 [Solanum lycopersicum]
 gb|ABX82931.1| transcription factor style2.1 [Solanum pennellii]
 gb|ABX82932.1| transcription factor style2.1 [Solanum lycopersicum]
 gb|ABX82933.1| transcription factor style2.1 [Solanum pennellii]
Length=92

 Score =   103 bits (258),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 54/77 (70%), Positives = 68/77 (88%), Gaps = 2/77 (3%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLA  327
            ISDDQI +LVSKLQQLLPE+RN  S K SA++VLQ+TCNYIR+L+R+VDDLS+RLS+LL+
Sbjct  16   ISDDQIIELVSKLQQLLPEIRNRRSSKASASKVLQETCNYIRNLNRQVDDLSDRLSQLLS  75

Query  328  TTDTN--QAALIRSLLM  372
            T D +  +AA+IRSLLM
Sbjct  76   TIDADSPEAAIIRSLLM  92



>ref|XP_009347048.1| PREDICTED: transcription factor PRE6-like [Pyrus x bretschneideri]
Length=91

 Score =   103 bits (258),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 69/82 (84%), Gaps = 2/82 (2%)
 Frame = +1

Query  136  GASRISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLS  315
            G   I DDQI +LVSKL+QL+PE+R+  S+KV A++VLQ+TC+YIR+LHREVDDLSERLS
Sbjct  10   GTPAIKDDQIIELVSKLRQLVPEIRDRRSNKVPASKVLQETCSYIRNLHREVDDLSERLS  69

Query  316  ELLAT--TDTNQAALIRSLLMQ  375
            +LL+T   D+ +AA+IRSL+ Q
Sbjct  70   QLLSTIDADSPEAAIIRSLITQ  91



>emb|CAB41854.1| hypothetical protein [Arabidopsis thaliana]
Length=78

 Score =   103 bits (257),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 55/77 (71%), Positives = 67/77 (87%), Gaps = 1/77 (1%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTS-SDKVSAARVLQDTCNYIRSLHREVDDLSERLSELL  324
            I+D+QINDLV +L +LLPEL N   S KVSA+RVLQ+TC+YIR+L +EVDDLSERLS+LL
Sbjct  2    ITDEQINDLVLQLHRLLPELANNRRSGKVSASRVLQETCSYIRNLSKEVDDLSERLSQLL  61

Query  325  ATTDTNQAALIRSLLMQ  375
             +TD+ QAALIRSLLMQ
Sbjct  62   ESTDSAQAALIRSLLMQ  78



>ref|XP_010547809.1| PREDICTED: transcription factor PRE4-like [Tarenaya hassleriana]
Length=93

 Score =   103 bits (257),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 66/79 (84%), Gaps = 1/79 (1%)
 Frame = +1

Query  136  GASRISDDQINDLVSKLQQLLPELRNT-SSDKVSAARVLQDTCNYIRSLHREVDDLSERL  312
            G S I+DDQIND+V +L +++PEL N   SDKVSA+R LQ+TC+YIR+LH+EVDDLSERL
Sbjct  12   GGSMITDDQINDIVVQLHRIVPELGNRRPSDKVSASRALQETCSYIRNLHKEVDDLSERL  71

Query  313  SELLATTDTNQAALIRSLL  369
            ++LL + D+ QAA IRSLL
Sbjct  72   TQLLESADSAQAAFIRSLL  90



>ref|XP_009390918.1| PREDICTED: transcription factor ILI6-like [Musa acuminata subsp. 
malaccensis]
Length=92

 Score =   103 bits (257),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 53/77 (69%), Positives = 66/77 (86%), Gaps = 2/77 (3%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLA  327
            I+D+QINDL++KLQ +LPE R   + +VSAARVLQ+TC+Y+RSLHREVDDLSERLSELLA
Sbjct  16   ITDEQINDLMAKLQAVLPEARLGINHRVSAARVLQETCSYLRSLHREVDDLSERLSELLA  75

Query  328  TTDTN--QAALIRSLLM  372
              D +  +AA+IRSLLM
Sbjct  76   MADISGAEAAIIRSLLM  92



>ref|XP_008341557.1| PREDICTED: transcription factor PRE6-like [Malus domestica]
Length=91

 Score =   103 bits (257),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 68/82 (83%), Gaps = 2/82 (2%)
 Frame = +1

Query  136  GASRISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLS  315
            G   I DDQI +LVSKL+QL+PE+R+  S+KV A++VLQ+TCNYIR+LH EVDDLSERLS
Sbjct  10   GTPAIKDDQIIELVSKLRQLVPEIRDRRSNKVPASKVLQETCNYIRNLHXEVDDLSERLS  69

Query  316  ELLAT--TDTNQAALIRSLLMQ  375
            +LL+T   D+ +AA+IRSL+ Q
Sbjct  70   QLLSTIDADSPEAAIIRSLITQ  91



>ref|XP_004491783.1| PREDICTED: transcription factor bHLH135-like [Cicer arietinum]
Length=93

 Score =   103 bits (257),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 69/84 (82%), Gaps = 2/84 (2%)
 Frame = +1

Query  130  TGGASRISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSER  309
            +GG++RISDDQI DLV KL+QL+PE+RN   +K  A++VLQ+TCNYIRSL REV+DLS R
Sbjct  10   SGGSTRISDDQIIDLVCKLRQLVPEIRNRHPNKAPASKVLQETCNYIRSLQREVEDLSLR  69

Query  310  LSELLATTDTN--QAALIRSLLMQ  375
            LS+LL T D +  +A++IRSLL Q
Sbjct  70   LSQLLDTIDADSAEASIIRSLLNQ  93



>gb|AAM67002.1| DNA-binding protein-like [Arabidopsis thaliana]
Length=92

 Score =   103 bits (256),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 68/84 (81%), Gaps = 3/84 (4%)
 Frame = +1

Query  130  TGGASRISDDQINDLVSKLQQLLPELRNTS-SDKVSAARVLQDTCNYIRSLHREVDDLSE  306
            T  ASRISDDQ+ DLVSKL+Q LPE+     SDKVSA+ VLQ+TCNYIR LHREVD+LS+
Sbjct  9    TSNASRISDDQMIDLVSKLRQFLPEIHERRRSDKVSASXVLQETCNYIRKLHREVDNLSD  68

Query  307  RLSELLATTDTN--QAALIRSLLM  372
            RLS+LL + D +  +AA+IRSLLM
Sbjct  69   RLSQLLDSVDEDSPEAAVIRSLLM  92



>ref|XP_010528329.1| PREDICTED: transcription factor PRE5 [Tarenaya hassleriana]
Length=92

 Score =   102 bits (253),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 69/84 (82%), Gaps = 3/84 (4%)
 Frame = +1

Query  130  TGGASRISDDQINDLVSKLQQLLPELRNTS-SDKVSAARVLQDTCNYIRSLHREVDDLSE  306
            +  + RISDDQI DLV KL+QLLPE+R    S+KVSA++VLQ+TCNYIR+LHREVD+LSE
Sbjct  9    SSNSPRISDDQIIDLVGKLRQLLPEIRERRRSNKVSASKVLQETCNYIRNLHREVDNLSE  68

Query  307  RLSELLATTDTN--QAALIRSLLM  372
            RLS+LL + D +  +AA+IRSL M
Sbjct  69   RLSQLLDSVDEDSAEAAVIRSLFM  92



>ref|XP_009591471.1| PREDICTED: transcription factor PRE1-like [Nicotiana tomentosiformis]
Length=93

 Score =   102 bits (253),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 66/75 (88%), Gaps = 2/75 (3%)
 Frame = +1

Query  154  DDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLATT  333
            DDQI DLVSKLQQLLPE+R   S+K SA++VLQ+TCNYIR+L+REVDDLS+RLS+LL+T 
Sbjct  19   DDQIIDLVSKLQQLLPEIRTRRSNKASASKVLQETCNYIRNLNREVDDLSDRLSQLLSTI  78

Query  334  DTN--QAALIRSLLM  372
            D +  +AA+IRSLLM
Sbjct  79   DADSPEAAIIRSLLM  93



>ref|XP_009380170.1| PREDICTED: transcription factor ILI7-like [Musa acuminata subsp. 
malaccensis]
Length=92

 Score =   102 bits (253),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/77 (70%), Positives = 63/77 (82%), Gaps = 2/77 (3%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELL-  324
            I+D QI+DL+SKLQ LL E R  S D+ SAA+VLQDTC+YIRSLHREVDDLSERLSELL 
Sbjct  16   ITDQQIDDLMSKLQSLLHEARLGSHDRASAAKVLQDTCSYIRSLHREVDDLSERLSELLD  75

Query  325  -ATTDTNQAALIRSLLM  372
             A   ++QAA+IRSL M
Sbjct  76   AAGVSSDQAAIIRSLFM  92



>gb|EPS68402.1| hypothetical protein M569_06365 [Genlisea aurea]
Length=93

 Score =   101 bits (252),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 53/83 (64%), Positives = 70/83 (84%), Gaps = 3/83 (4%)
 Frame = +1

Query  130  TGGASRISDDQINDLVSKLQQLLPELR-NTSSDKVSAARVLQDTCNYIRSLHREVDDLSE  306
            + GA RI+DDQI +LVSKL QLLPE+R N  S+K+SA +VLQ+TCNYIR LH+EV DLSE
Sbjct  11   SNGAGRITDDQIIELVSKLHQLLPEIRANRGSNKLSANKVLQETCNYIRDLHKEVIDLSE  70

Query  307  RLSELLATTDTN--QAALIRSLL  369
            RLS+LL+T D++  +AA+IR+L+
Sbjct  71   RLSQLLSTIDSDSPEAAIIRNLI  93



>ref|XP_009395121.1| PREDICTED: transcription factor ILI6-like [Musa acuminata subsp. 
malaccensis]
Length=92

 Score =   101 bits (252),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 67/80 (84%), Gaps = 2/80 (3%)
 Frame = +1

Query  139  ASRISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSE  318
            +SRI+D+QI DL++KLQ LLPE R  S+D+VSAA VLQD CN+IRSL REVD LS RL++
Sbjct  13   SSRITDEQIADLLAKLQALLPEHRIRSTDRVSAAEVLQDACNHIRSLQREVDGLSGRLAQ  72

Query  319  LLATTDTN--QAALIRSLLM  372
            LLA TD++  QAA+IRSLLM
Sbjct  73   LLAMTDSSDAQAAVIRSLLM  92



>gb|KFK34072.1| hypothetical protein AALP_AA5G098800 [Arabis alpina]
Length=204

 Score =   104 bits (259),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 68/80 (85%), Gaps = 2/80 (3%)
 Frame = +1

Query  136  GASRISDDQINDLVSKLQQLLPELRNTS--SDKVSAARVLQDTCNYIRSLHREVDDLSER  309
            GAS IS+DQINDLV +L +LLPEL N    S +VSA+RVLQ+TC+YIR+L++EVDDLSER
Sbjct  12   GASMISEDQINDLVVQLHRLLPELANNRRLSGEVSASRVLQETCSYIRNLNKEVDDLSER  71

Query  310  LSELLATTDTNQAALIRSLL  369
            LS+LL +TD+ QAALIR LL
Sbjct  72   LSQLLESTDSAQAALIRKLL  91



>gb|EPS67081.1| hypothetical protein M569_07696, partial [Genlisea aurea]
Length=96

 Score =   101 bits (251),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 70/83 (84%), Gaps = 7/83 (8%)
 Frame = +1

Query  142  SRISDDQINDLVSKLQQLLPE-----LRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSE  306
            +RISDDQI DLVS+LQQL+PE      R++ SDKV A++VLQDTCNYIRSLH+EV +LS+
Sbjct  14   TRISDDQIADLVSRLQQLVPESHRGGRRSSPSDKVPASKVLQDTCNYIRSLHQEVGNLSD  73

Query  307  RLSELLATT--DTNQAALIRSLL  369
            +LSELL T+  D++QAA+IRSLL
Sbjct  74   QLSELLETSNVDSDQAAIIRSLL  96



>emb|CDY65320.1| BnaC06g42240D [Brassica napus]
 emb|CDX67440.1| BnaA07g14800D [Brassica napus]
Length=92

 Score =   100 bits (249),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 70/81 (86%), Gaps = 3/81 (4%)
 Frame = +1

Query  139  ASRISDDQINDLVSKLQQLLPEL-RNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLS  315
            A RISDDQI DLV+KL+Q+LPE+ +   SDKVSA++VLQ+TCNYIR+L+REVD+LSERL+
Sbjct  12   APRISDDQIIDLVTKLRQILPEIGQRRRSDKVSASKVLQETCNYIRNLNREVDNLSERLA  71

Query  316  ELLATT--DTNQAALIRSLLM  372
            +LL +   D+ QAA+IRSLLM
Sbjct  72   QLLESVDEDSPQAAVIRSLLM  92



>ref|XP_009151837.1| PREDICTED: transcription factor PRE5-like [Brassica rapa]
 emb|CDX86409.1| BnaA06g31260D [Brassica napus]
Length=92

 Score =   100 bits (249),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 68/81 (84%), Gaps = 3/81 (4%)
 Frame = +1

Query  139  ASRISDDQINDLVSKLQQLLPELRNTS-SDKVSAARVLQDTCNYIRSLHREVDDLSERLS  315
            A+RISDDQI DLVSKL+Q LPE+R    SDKVSA++VLQ+TCNYIR LHREVD++S+RLS
Sbjct  12   ATRISDDQIIDLVSKLRQFLPEIRERRRSDKVSASKVLQETCNYIRKLHREVDNISDRLS  71

Query  316  ELLATT--DTNQAALIRSLLM  372
             LL +   D+ +AA+IR+LLM
Sbjct  72   LLLDSVDEDSQEAAVIRNLLM  92



>ref|XP_006395335.1| hypothetical protein EUTSA_v10005197mg [Eutrema salsugineum]
 gb|ESQ32621.1| hypothetical protein EUTSA_v10005197mg [Eutrema salsugineum]
Length=92

 Score =   100 bits (249),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 69/81 (85%), Gaps = 3/81 (4%)
 Frame = +1

Query  139  ASRISDDQINDLVSKLQQLLPELRNTS-SDKVSAARVLQDTCNYIRSLHREVDDLSERLS  315
            A RISDDQ+ DLVSKL+QLLPE+R    SDKVSA++VLQ+TCNYIR LH EVD+LS+RLS
Sbjct  12   ALRISDDQMIDLVSKLRQLLPEIRERRRSDKVSASKVLQETCNYIRKLHSEVDNLSDRLS  71

Query  316  ELLATT--DTNQAALIRSLLM  372
            +LL +   D+++AA+IRSLLM
Sbjct  72   QLLDSVDEDSHEAAVIRSLLM  92



>ref|XP_010435835.1| PREDICTED: transcription factor PRE1 [Camelina sativa]
 ref|XP_010441099.1| PREDICTED: transcription factor PRE1 [Camelina sativa]
 ref|XP_010450758.1| PREDICTED: transcription factor PRE1 [Camelina sativa]
Length=93

 Score =   100 bits (249),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 70/81 (86%), Gaps = 3/81 (4%)
 Frame = +1

Query  139  ASRISDDQINDLVSKLQQLLPEL-RNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLS  315
            A RISDDQ+ DLV+KL+Q+LPE+ +   SDKVSA++VLQ+TCNYIRSL+REVD+LSERLS
Sbjct  13   APRISDDQMIDLVTKLRQILPEIGQRRRSDKVSASKVLQETCNYIRSLNREVDNLSERLS  72

Query  316  ELLATT--DTNQAALIRSLLM  372
            +LL +   D+ +AA+IRSLLM
Sbjct  73   QLLESVDEDSPEAAVIRSLLM  93



>ref|XP_004489383.1| PREDICTED: transcription factor bHLH135-like [Cicer arietinum]
Length=92

 Score =   100 bits (248),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 68/78 (87%), Gaps = 2/78 (3%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLA  327
            ISD+QI +LVSKL+QL+PE+R+  SDKVSA++VLQ+TCNYIR+L+REVDDLSERLS+LL 
Sbjct  15   ISDEQIIELVSKLRQLVPEIRHRRSDKVSASKVLQETCNYIRTLNREVDDLSERLSQLLT  74

Query  328  TTDTN--QAALIRSLLMQ  375
            T D +  +A +IRSL+ Q
Sbjct  75   TIDADSPEANIIRSLINQ  92



>ref|XP_009416873.1| PREDICTED: transcription factor ILI5-like [Musa acuminata subsp. 
malaccensis]
Length=85

 Score = 99.8 bits (247),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 64/78 (82%), Gaps = 2/78 (3%)
 Frame = +1

Query  142  SRISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSEL  321
            SRIS+++I +L+SKLQ LLPE R   + + SAA+VL++TCNYI+SLHREVDDLS+RLSEL
Sbjct  6    SRISEEEITELISKLQSLLPETRRRGASRASAAKVLKETCNYIKSLHREVDDLSDRLSEL  65

Query  322  LATTDTN--QAALIRSLL  369
            +AT D +  QA ++RSL 
Sbjct  66   MATMDVDSAQAEIVRSLF  83



>ref|XP_009129354.1| PREDICTED: transcription factor PRE5-like [Brassica rapa]
 emb|CDY70014.1| BnaA02g36990D [Brassica napus]
Length=92

 Score =   100 bits (248),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 68/81 (84%), Gaps = 3/81 (4%)
 Frame = +1

Query  139  ASRISDDQINDLVSKLQQLLPELRNTS-SDKVSAARVLQDTCNYIRSLHREVDDLSERLS  315
            A RISDDQ+ DLVSKL QLLPE+R    SDKVSA++VLQ+TCNYIR LHREVD+LS+RLS
Sbjct  12   ALRISDDQMIDLVSKLCQLLPEIRERRRSDKVSASKVLQETCNYIRKLHREVDNLSDRLS  71

Query  316  ELLATT--DTNQAALIRSLLM  372
            +LL     D+++A++IRSLLM
Sbjct  72   QLLDAVDEDSHEASVIRSLLM  92



>ref|XP_009111609.1| PREDICTED: transcription factor PRE5 [Brassica rapa]
 emb|CDY20013.1| BnaA09g02380D [Brassica napus]
Length=92

 Score = 99.8 bits (247),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 68/81 (84%), Gaps = 3/81 (4%)
 Frame = +1

Query  139  ASRISDDQINDLVSKLQQLLPELRNTS-SDKVSAARVLQDTCNYIRSLHREVDDLSERLS  315
            A RISDDQ+ DLVSKL+ LLPE+R    SDKVSA++VLQ+TCNYIR LHREVD+LS+RLS
Sbjct  12   ALRISDDQMIDLVSKLRVLLPEIRERRRSDKVSASKVLQETCNYIRKLHREVDNLSDRLS  71

Query  316  ELLATT--DTNQAALIRSLLM  372
            +LL +   D+ +AA+IRSLLM
Sbjct  72   QLLDSVDEDSQEAAVIRSLLM  92



>ref|XP_004293633.1| PREDICTED: transcription factor bHLH135-like [Fragaria vesca 
subsp. vesca]
Length=93

 Score = 99.8 bits (247),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 67/78 (86%), Gaps = 2/78 (3%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLA  327
            I DDQI +LVSKL+QL+PE R+  SD+VSA++VLQ+TC+YIR+L REV+DLSERLS+LLA
Sbjct  16   IRDDQIIELVSKLRQLVPETRDRRSDQVSASKVLQETCSYIRNLQREVEDLSERLSQLLA  75

Query  328  TTDTN--QAALIRSLLMQ  375
            T D +  +AA+ RSL+MQ
Sbjct  76   TIDADSAEAAIFRSLIMQ  93



>ref|XP_004511222.1| PREDICTED: transcription factor bHLH135-like [Cicer arietinum]
Length=92

 Score = 99.4 bits (246),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 66/80 (83%), Gaps = 3/80 (4%)
 Frame = +1

Query  139  ASRISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSE  318
            +S I+D QINDL++KLQ+L+PEL    SDKVS  +VL++TCNYI++LHREVDDLS+RLS+
Sbjct  14   SSEITDAQINDLINKLQRLIPELAR-RSDKVSPTKVLKETCNYIKNLHREVDDLSDRLSQ  72

Query  319  LLATTDTN--QAALIRSLLM  372
            LL T D N  QAA+IRSL M
Sbjct  73   LLDTIDPNSAQAAIIRSLFM  92



>ref|XP_009125118.1| PREDICTED: transcription factor PRE1 [Brassica rapa]
Length=92

 Score = 99.4 bits (246),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 70/81 (86%), Gaps = 3/81 (4%)
 Frame = +1

Query  139  ASRISDDQINDLVSKLQQLLPEL-RNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLS  315
            A RISDDQI DLV+KL+++LPE+ +   SDKVSA++VLQ+TCNYIR+L+REVD+LSERL+
Sbjct  12   APRISDDQIIDLVTKLREILPEIGQRRRSDKVSASKVLQETCNYIRNLNREVDNLSERLA  71

Query  316  ELLATTDTN--QAALIRSLLM  372
            +LL + D +  QAA+IRSLLM
Sbjct  72   QLLESVDEDSPQAAVIRSLLM  92



>ref|XP_009409165.1| PREDICTED: transcription factor ILI3-like [Musa acuminata subsp. 
malaccensis]
Length=85

 Score = 99.0 bits (245),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 68/82 (83%), Gaps = 2/82 (2%)
 Frame = +1

Query  130  TGGASRISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSER  309
            +G  SRI+D++IN+LVSKLQ LLPE R  ++ +VSA+++L++TC+YI+SLHREVD LS+R
Sbjct  2    SGRGSRITDEEINELVSKLQSLLPESRRRNTGRVSASKLLKETCSYIKSLHREVDGLSDR  61

Query  310  LSELLATTDTN--QAALIRSLL  369
            LS L+ T D+N  QA +IRSLL
Sbjct  62   LSGLMVTMDSNSPQAEIIRSLL  83



>ref|XP_002870750.1| hypothetical protein ARALYDRAFT_916307 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_006405588.1| hypothetical protein EUTSA_v10028074mg [Eutrema salsugineum]
 gb|EFH47009.1| hypothetical protein ARALYDRAFT_916307 [Arabidopsis lyrata subsp. 
lyrata]
 gb|ESQ47041.1| hypothetical protein EUTSA_v10028074mg [Eutrema salsugineum]
Length=92

 Score = 99.4 bits (246),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 70/81 (86%), Gaps = 3/81 (4%)
 Frame = +1

Query  139  ASRISDDQINDLVSKLQQLLPEL-RNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLS  315
            A RISDDQ+ DLV+KL+Q+LPE+ +   SDKVSA++VLQ+TCNYIR+L+REVD+LSERLS
Sbjct  12   APRISDDQMIDLVTKLRQILPEIGQRRRSDKVSASKVLQETCNYIRNLNREVDNLSERLS  71

Query  316  ELLATTDTN--QAALIRSLLM  372
            +LL + D +  +AA+IRSLLM
Sbjct  72   QLLESVDEDSPEAAVIRSLLM  92



>ref|XP_010693223.1| PREDICTED: transcription factor PRE6 [Beta vulgaris subsp. vulgaris]
Length=93

 Score = 99.4 bits (246),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 64/76 (84%), Gaps = 2/76 (3%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLA  327
            ISDDQI  LVSKLQQL+PE+R   SDKVSA++VLQ+TCNYIR+L RE+DDLS+RLS+LL 
Sbjct  16   ISDDQIIQLVSKLQQLVPEVRQRRSDKVSASKVLQETCNYIRNLQREMDDLSDRLSQLLT  75

Query  328  TT--DTNQAALIRSLL  369
            T   D+ +A +IRSLL
Sbjct  76   TVDADSEEAQIIRSLL  91



>ref|XP_009787611.1| PREDICTED: transcription factor PRE1-like [Nicotiana sylvestris]
Length=90

 Score = 99.0 bits (245),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 65/75 (87%), Gaps = 2/75 (3%)
 Frame = +1

Query  154  DDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLATT  333
            DDQI DLVSKLQQLLPE+R   S K SA++VLQ+TCNYIRSL+RE+DDLS+RLS+LL+T 
Sbjct  16   DDQIIDLVSKLQQLLPEIRTRRSSKASASKVLQETCNYIRSLNRELDDLSDRLSQLLSTV  75

Query  334  DTN--QAALIRSLLM  372
            D +  +AA+IRSL++
Sbjct  76   DADSPEAAIIRSLII  90



>ref|XP_010108968.1| hypothetical protein L484_027163 [Morus notabilis]
 gb|EXC20608.1| hypothetical protein L484_027163 [Morus notabilis]
Length=91

 Score = 98.6 bits (244),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 67/76 (88%), Gaps = 2/76 (3%)
 Frame = +1

Query  154  DDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLATT  333
            DDQI +LVSKL++L+PE+R+  S KV+A++VLQ+TCNYIR+LHREVDDLS+RL++LLAT 
Sbjct  16   DDQILELVSKLRRLVPEIRDRPSGKVAASKVLQETCNYIRNLHREVDDLSQRLTQLLATI  75

Query  334  DTN--QAALIRSLLMQ  375
            D +  +AA+IRSL+ Q
Sbjct  76   DADSAEAAIIRSLVTQ  91



>ref|XP_010939530.1| PREDICTED: transcription factor ILI5-like [Elaeis guineensis]
Length=85

 Score = 98.2 bits (243),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 66/78 (85%), Gaps = 2/78 (3%)
 Frame = +1

Query  142  SRISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSEL  321
            SRI++++IN+L+SKLQ +LPE R   + + SA+++L++TCNYI+SLHREVDDLS+RLS+L
Sbjct  6    SRITEEEINELISKLQSILPETRRRGTSRASASKLLKETCNYIKSLHREVDDLSDRLSDL  65

Query  322  LATTDTN--QAALIRSLL  369
            LAT DTN   A ++RSLL
Sbjct  66   LATMDTNSPHAEIVRSLL  83



>ref|XP_010937075.1| PREDICTED: transcription factor ILI5-like [Elaeis guineensis]
Length=85

 Score = 98.2 bits (243),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 67/78 (86%), Gaps = 2/78 (3%)
 Frame = +1

Query  142  SRISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSEL  321
            SRI++++IN+L+SKLQ +LPE R   + + SA+++L++TCNYI+SLHREVDDLS+RLS+L
Sbjct  6    SRITEEEINELISKLQSVLPEARRRGASRASASKLLKETCNYIKSLHREVDDLSDRLSDL  65

Query  322  LATTDTN--QAALIRSLL  369
            +A+ DTN  QA ++RSLL
Sbjct  66   MASMDTNSPQAEIVRSLL  83



>ref|XP_010926541.1| PREDICTED: transcription factor ILI3-like [Elaeis guineensis]
Length=85

 Score = 98.2 bits (243),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 67/78 (86%), Gaps = 2/78 (3%)
 Frame = +1

Query  142  SRISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSEL  321
            SRISD++IN+L+SKLQ LLPE R  S+ + SA+++L++TC+YI+SL REVDDLS+RLS+L
Sbjct  6    SRISDEEINELISKLQALLPESRRPSTSRASASKLLKETCSYIKSLRREVDDLSDRLSDL  65

Query  322  LATTDTN--QAALIRSLL  369
            LAT D+N  QA +IRSLL
Sbjct  66   LATMDSNSPQAEIIRSLL  83



>ref|XP_009403179.1| PREDICTED: transcription factor ILI5-like [Musa acuminata subsp. 
malaccensis]
Length=85

 Score = 98.2 bits (243),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 63/78 (81%), Gaps = 2/78 (3%)
 Frame = +1

Query  142  SRISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSEL  321
            SR+S+++IN+L+SKLQ LLPE R     + SAA++L++TCNYIRSL+REVDDLS RLS L
Sbjct  6    SRVSEEEINELISKLQSLLPEARRRGGGRASAAKLLKETCNYIRSLNREVDDLSGRLSAL  65

Query  322  LATTDTN--QAALIRSLL  369
            +AT D N  +A +IRSLL
Sbjct  66   MATMDNNSAEAEIIRSLL  83



>emb|CDY00110.1| BnaC09g01910D [Brassica napus]
Length=92

 Score = 98.2 bits (243),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 68/81 (84%), Gaps = 3/81 (4%)
 Frame = +1

Query  139  ASRISDDQINDLVSKLQQLLPELRNTS-SDKVSAARVLQDTCNYIRSLHREVDDLSERLS  315
            A RISDDQ+ DLVSKL+ LLPE+R    SDKVSA++VLQ+TCNYIR LHR+VD+LS+RLS
Sbjct  12   ALRISDDQMIDLVSKLRVLLPEIRERRRSDKVSASKVLQETCNYIRKLHRKVDNLSDRLS  71

Query  316  ELLATT--DTNQAALIRSLLM  372
            +LL +   D+ +AA+IRSLLM
Sbjct  72   QLLDSVDEDSQEAAVIRSLLM  92



>emb|CDY04040.1| BnaC02g37550D [Brassica napus]
Length=92

 Score = 98.2 bits (243),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 67/81 (83%), Gaps = 3/81 (4%)
 Frame = +1

Query  139  ASRISDDQINDLVSKLQQLLPELRNTS-SDKVSAARVLQDTCNYIRSLHREVDDLSERLS  315
            A RISDDQ+ DLVSKL QLLPE+R    SDKVSA++VL +TCNYIR LHREVD+LS+RLS
Sbjct  12   ALRISDDQMIDLVSKLCQLLPEIRERRRSDKVSASKVLHETCNYIRKLHREVDNLSDRLS  71

Query  316  ELLATT--DTNQAALIRSLLM  372
            +LL     D+++A++IRSLLM
Sbjct  72   QLLDAVDEDSHEASVIRSLLM  92



>ref|XP_011085763.1| PREDICTED: transcription factor PRE1-like [Sesamum indicum]
Length=95

 Score = 98.2 bits (243),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 68/78 (87%), Gaps = 4/78 (5%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELRNTS--SDKVSAARVLQDTCNYIRSLHREVDDLSERLSEL  321
            I+DDQI +LVSKL QLLPE+RNT+  S+K SA +VLQ+TCNYIR+LH+E+DDLS RLS+L
Sbjct  18   ITDDQIIELVSKLHQLLPEIRNTTRRSNKASADKVLQETCNYIRNLHKEMDDLSARLSQL  77

Query  322  LATTDTN--QAALIRSLL  369
            L+T DT+  +AA+IR+L+
Sbjct  78   LSTVDTDSPEAAIIRTLI  95



>ref|XP_008808056.1| PREDICTED: transcription factor ILI5-like isoform X2 [Phoenix 
dactylifera]
Length=85

 Score = 97.8 bits (242),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 66/78 (85%), Gaps = 2/78 (3%)
 Frame = +1

Query  142  SRISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSEL  321
            SRI++++IN+L+SKLQ +LPE R   + + SA+++L++TCNYI+SLHREVDDLS+RLS+L
Sbjct  6    SRITEEEINELISKLQSILPESRRRGTSRASASKLLKETCNYIKSLHREVDDLSDRLSDL  65

Query  322  LATTDTN--QAALIRSLL  369
            LAT DTN   A ++RSLL
Sbjct  66   LATMDTNSAHAEIVRSLL  83



>ref|XP_006284840.1| hypothetical protein CARUB_v10006122mg [Capsella rubella]
 gb|EOA17738.1| hypothetical protein CARUB_v10006122mg [Capsella rubella]
Length=94

 Score = 97.8 bits (242),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 69/81 (85%), Gaps = 3/81 (4%)
 Frame = +1

Query  139  ASRISDDQINDLVSKLQQLLPEL-RNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLS  315
            A RISDDQ+ DLV+KL+Q+LPE+ +   SDKVSA++VLQ+TCNYIR+L+REVD+LSERLS
Sbjct  14   APRISDDQMIDLVTKLRQILPEIGQRRRSDKVSASKVLQETCNYIRNLNREVDNLSERLS  73

Query  316  ELLATT--DTNQAALIRSLLM  372
            +LL +   D+ +AA+IRSL M
Sbjct  74   QLLESVDEDSPEAAVIRSLFM  94



>ref|XP_009413611.1| PREDICTED: transcription factor ILI3-like [Musa acuminata subsp. 
malaccensis]
Length=87

 Score = 97.1 bits (240),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 67/81 (83%), Gaps = 2/81 (2%)
 Frame = +1

Query  133  GGASRISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERL  312
            G +SRI+D++IN+LVSKLQ LLPE R  +  + SA+++L++TC+YI+SLHR+VDDLS+RL
Sbjct  5    GSSSRITDEEINELVSKLQSLLPESRRRNIGRASASKLLKETCSYIKSLHRDVDDLSDRL  64

Query  313  SELLATTDTN--QAALIRSLL  369
            S L+AT D N  QA +IRSLL
Sbjct  65   SALMATMDANSPQADIIRSLL  85



>ref|XP_006292118.1| hypothetical protein CARUB_v10018314mg [Capsella rubella]
 gb|EOA25016.1| hypothetical protein CARUB_v10018314mg [Capsella rubella]
Length=92

 Score = 97.1 bits (240),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 63/76 (83%), Gaps = 3/76 (4%)
 Frame = +1

Query  154  DDQINDLVSKLQQLLPELRNTS-SDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLAT  330
            DDQI DLVSKL+Q LPE+R    SDKVSA +VLQ+TCNYIR LHREVD+LS+RLS+LL +
Sbjct  17   DDQIIDLVSKLRQFLPEIRERRRSDKVSATKVLQETCNYIRRLHREVDNLSDRLSQLLES  76

Query  331  TDTN--QAALIRSLLM  372
             D +  +AA+IRSLLM
Sbjct  77   VDEDSPEAAVIRSLLM  92



>ref|NP_198802.1| bHLH transcription factor PRE1 [Arabidopsis thaliana]
 sp|Q9FLE9.1|PRE1_ARATH RecName: Full=Transcription factor PRE1; AltName: Full=Basic 
helix-loop-helix protein 136; Short=AtbHLH136; Short=bHLH 136; 
AltName: Full=Protein BANQUO 1; AltName: Full=Protein PACLOBUTRAZOL 
RESISTANCE 1; AltName: Full=bHLH transcription factor 
bHLH136 [Arabidopsis thaliana]
 dbj|BAB10210.1| DNA-binding protein-like [Arabidopsis thaliana]
 gb|AAM65786.1| DNA-binding protein-like [Arabidopsis thaliana]
 gb|AED94484.1| bHLH transcription factor PRE1 [Arabidopsis thaliana]
Length=92

 Score = 96.7 bits (239),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 69/81 (85%), Gaps = 3/81 (4%)
 Frame = +1

Query  139  ASRISDDQINDLVSKLQQLLPEL-RNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLS  315
            A RISD+Q+ DLVSKL+Q+LPE+ +   SDK SA++VLQ+TCNYIR+L+REVD+LSERLS
Sbjct  12   APRISDNQMIDLVSKLRQILPEIGQRRRSDKASASKVLQETCNYIRNLNREVDNLSERLS  71

Query  316  ELLATT--DTNQAALIRSLLM  372
            +LL +   D+ +AA+IRSLLM
Sbjct  72   QLLESVDEDSPEAAVIRSLLM  92



>gb|KFK33185.1| hypothetical protein AALP_AA6G341300 [Arabis alpina]
Length=92

 Score = 96.3 bits (238),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 71/84 (85%), Gaps = 3/84 (4%)
 Frame = +1

Query  130  TGGASRISDDQINDLVSKLQQLLPEL-RNTSSDKVSAARVLQDTCNYIRSLHREVDDLSE  306
            +  A RISDDQ+ DLV+KL+Q+LPE+ +   SDKVSA++VLQ+TCNYIR+L++EVD+LS+
Sbjct  9    SPSAPRISDDQMIDLVTKLRQILPEMGQRRRSDKVSASKVLQETCNYIRNLNKEVDNLSD  68

Query  307  RLSELLATT--DTNQAALIRSLLM  372
            RLS+LL +   D+ +AA+IRSLLM
Sbjct  69   RLSQLLESVDEDSPEAAVIRSLLM  92



>ref|XP_010917019.1| PREDICTED: transcription factor ILI5-like [Elaeis guineensis]
Length=85

 Score = 95.9 bits (237),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 66/77 (86%), Gaps = 2/77 (3%)
 Frame = +1

Query  145  RISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELL  324
            RISD++IN+L+SKLQ LLPE R  +  + SA+++L++TC+YI+SLHREVDDLS+RLS+L+
Sbjct  7    RISDEEINELISKLQSLLPESRRRNIGRASASKLLKETCSYIKSLHREVDDLSDRLSDLI  66

Query  325  ATTDTN--QAALIRSLL  369
            AT D+N  QA +IRSLL
Sbjct  67   ATMDSNSPQAEIIRSLL  83



>ref|XP_011098606.1| PREDICTED: transcription factor PRE1-like [Sesamum indicum]
Length=94

 Score = 95.9 bits (237),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 62/75 (83%), Gaps = 3/75 (4%)
 Frame = +1

Query  154  DDQINDLVSKLQQLLPELRNTS-SDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLAT  330
            DDQI DLVSKL QLLPE+R T   +K SA +VLQ+TCNYIR LH+EVD+LSERLS+LL+T
Sbjct  20   DDQIIDLVSKLHQLLPEIRTTRRPNKASANKVLQETCNYIRDLHKEVDNLSERLSQLLST  79

Query  331  TDTN--QAALIRSLL  369
             D N  +AA+IRSL+
Sbjct  80   IDANSPEAAIIRSLI  94



>ref|XP_010531809.1| PREDICTED: transcription factor PRE5-like [Tarenaya hassleriana]
Length=92

 Score = 95.9 bits (237),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 64/76 (84%), Gaps = 3/76 (4%)
 Frame = +1

Query  154  DDQINDLVSKLQQLLPELRNTS-SDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLAT  330
            DDQI DLV+KL+  LPE+R+   SDKVSA++VLQ+TCNYIR+LHREVD+LSERLS+LL +
Sbjct  17   DDQIVDLVTKLRHFLPEIRDRRRSDKVSASKVLQETCNYIRNLHREVDNLSERLSQLLDS  76

Query  331  TDTN--QAALIRSLLM  372
             D +  +AA+IRSL M
Sbjct  77   VDEDSAEAAVIRSLFM  92



>ref|XP_009409993.1| PREDICTED: transcription factor ILI5-like [Musa acuminata subsp. 
malaccensis]
Length=85

 Score = 95.5 bits (236),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 63/78 (81%), Gaps = 2/78 (3%)
 Frame = +1

Query  142  SRISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSEL  321
            SRIS+++IN+L+SKLQ LLPE R   + + S+A++LQ+TCNYIRSL REVDDLS+RLS L
Sbjct  6    SRISEEEINELISKLQSLLPETRRRGAGRASSAKLLQETCNYIRSLRREVDDLSDRLSAL  65

Query  322  LATTDTN--QAALIRSLL  369
            + T D N  +A ++RSLL
Sbjct  66   METMDNNSAEAEIVRSLL  83



>ref|XP_008668794.1| PREDICTED: transcription factor ILI1-like [Zea mays]
 tpg|DAA35748.1| TPA: putative HLH DNA-binding domain superfamily protein [Zea 
mays]
Length=104

 Score = 95.9 bits (237),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 65/77 (84%), Gaps = 4/77 (5%)
 Frame = +1

Query  154  DDQINDLVSKLQQLLPE--LRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLA  327
            +DQI++L+SKLQ LLPE   RN  + + SAARVLQDTC+YIRSLH+EVD+LSE L+ELLA
Sbjct  28   EDQISELLSKLQALLPESQARNGGAHRGSAARVLQDTCSYIRSLHQEVDNLSETLAELLA  87

Query  328  TTD--TNQAALIRSLLM  372
            + D  ++QAA+IRSLLM
Sbjct  88   SADVTSDQAAVIRSLLM  104



>ref|XP_009407356.1| PREDICTED: transcription factor ILI5-like [Musa acuminata subsp. 
malaccensis]
Length=85

 Score = 95.1 bits (235),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 64/78 (82%), Gaps = 2/78 (3%)
 Frame = +1

Query  142  SRISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSEL  321
            SRIS+++I +L+SKLQ LLPE R   + + S+A++L++TCNYI+SLHREVDDLS+RLSE+
Sbjct  6    SRISEEEIAELLSKLQSLLPEARRRGTSRASSAKLLKETCNYIKSLHREVDDLSDRLSEM  65

Query  322  LATTDTN--QAALIRSLL  369
            +AT D +  QA +IRSL 
Sbjct  66   MATMDMDSAQAEIIRSLF  83



>ref|XP_008808055.1| PREDICTED: transcription factor ILI5-like isoform X1 [Phoenix 
dactylifera]
Length=86

 Score = 94.0 bits (232),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/79 (61%), Positives = 67/79 (85%), Gaps = 3/79 (4%)
 Frame = +1

Query  142  SRISDDQINDLVSKLQQLLPE-LRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSE  318
            SRI++++IN+L+SKLQ +LPE  R  +S + SA+++L++TCNYI+SLHREVDDLS+RLS+
Sbjct  6    SRITEEEINELISKLQSILPESRRRGTSRQASASKLLKETCNYIKSLHREVDDLSDRLSD  65

Query  319  LLATTDTN--QAALIRSLL  369
            LLAT DTN   A ++RSLL
Sbjct  66   LLATMDTNSAHAEIVRSLL  84



>ref|XP_006343153.1| PREDICTED: transcription factor bHLH135-like [Solanum tuberosum]
Length=96

 Score = 94.0 bits (232),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 62/75 (83%), Gaps = 2/75 (3%)
 Frame = +1

Query  154  DDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLATT  333
            DDQI +LVSKL Q LPE++   S+K SA +VLQ+TCNYIRSL+REV+DLS+RLS+LL+T 
Sbjct  22   DDQIIELVSKLHQFLPEIQTRRSNKASATKVLQETCNYIRSLNREVNDLSDRLSQLLSTI  81

Query  334  DTN--QAALIRSLLM  372
            DT   +AA+IR L+M
Sbjct  82   DTESPEAAIIRRLIM  96



>ref|XP_002877136.1| transcription regulator [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53395.1| transcription regulator [Arabidopsis lyrata subsp. lyrata]
Length=92

 Score = 94.0 bits (232),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 64/76 (84%), Gaps = 3/76 (4%)
 Frame = +1

Query  154  DDQINDLVSKLQQLLPELRNTS-SDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLAT  330
            DDQ+ DLVSKL+Q LPE++    SDKVSA++VLQ+TCNYIR LHREVD+LS+RLS+LL +
Sbjct  17   DDQMIDLVSKLRQFLPEIQERRRSDKVSASKVLQETCNYIRKLHREVDNLSDRLSQLLDS  76

Query  331  TDTN--QAALIRSLLM  372
             D +  +AA+IRSLLM
Sbjct  77   VDEDSPEAAVIRSLLM  92



>gb|AAM74282.1|AC083943_22 Hypothetical protein similar to putative DNA binding proteins 
[Oryza sativa Japonica Group]
 gb|AAP53674.1| bHLH family protein, putative, expressed [Oryza sativa Japonica 
Group]
 gb|EAY78413.1| hypothetical protein OsI_33502 [Oryza sativa Indica Group]
 gb|EAZ16009.1| hypothetical protein OsJ_31454 [Oryza sativa Japonica Group]
Length=88

 Score = 93.6 bits (231),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 65/82 (79%), Gaps = 4/82 (5%)
 Frame = +1

Query  136  GASRISDDQINDLVSKLQQLLPE--LRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSER  309
             + RI+DD+IN+L+SKLQ LLPE   R  ++ +  A ++L++ C+YI+SLHREVDDLSER
Sbjct  6    ASGRITDDEINELISKLQSLLPESSRRRGATSRSPATKLLKEMCSYIKSLHREVDDLSER  65

Query  310  LSELLATTDTN--QAALIRSLL  369
            LSEL+AT D+N  QA +IRSLL
Sbjct  66   LSELMATMDSNSPQADIIRSLL  87



>ref|XP_009401395.1| PREDICTED: transcription factor ILI5-like [Musa acuminata subsp. 
malaccensis]
Length=130

 Score = 94.4 bits (233),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 64/78 (82%), Gaps = 2/78 (3%)
 Frame = +1

Query  142  SRISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSEL  321
            SRIS+++IN+LVSKLQ LLPE R   S + SA+++L++TCNYIR L+REVDDLS RLS L
Sbjct  51   SRISEEEINELVSKLQSLLPEARRRGSGRASASKLLKETCNYIRKLNREVDDLSNRLSAL  110

Query  322  LAT--TDTNQAALIRSLL  369
            +AT  +D+ +A +IRSLL
Sbjct  111  MATMDSDSAEADIIRSLL  128



>ref|XP_009126035.1| PREDICTED: transcription factor PRE2-like [Brassica rapa]
 emb|CDX85562.1| BnaA02g02510D [Brassica napus]
Length=93

 Score = 93.2 bits (230),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 49/75 (65%), Positives = 62/75 (83%), Gaps = 3/75 (4%)
 Frame = +1

Query  154  DDQINDLVSKLQQLLPELR-NTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLAT  330
            DDQI DL+SKL+Q +PE+R N  S  VSA++VLQ+TCNYIR+LH+E DDLS+RLS+LL T
Sbjct  17   DDQITDLISKLRQSIPEIRQNRRSSTVSASKVLQETCNYIRNLHKEADDLSDRLSQLLET  76

Query  331  TDTN--QAALIRSLL  369
             D N  QAA+IRSL+
Sbjct  77   IDPNSPQAAIIRSLI  91



>ref|XP_008784341.1| PREDICTED: transcription factor ILI5-like [Phoenix dactylifera]
Length=85

 Score = 92.8 bits (229),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 65/78 (83%), Gaps = 2/78 (3%)
 Frame = +1

Query  142  SRISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSEL  321
            SRI++++I++L+SKLQ  LPE R   + + SA+++L++TCNYI+SLHREVDDLS+RLS+L
Sbjct  6    SRITEEEISELISKLQSALPEARRRGASRASASKLLKETCNYIKSLHREVDDLSDRLSDL  65

Query  322  LATTDTN--QAALIRSLL  369
            +A+ DTN  QA ++R LL
Sbjct  66   VASLDTNSPQAEIVRGLL  83



>emb|CDY68961.1| BnaCnng61200D [Brassica napus]
Length=93

 Score = 93.2 bits (230),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 49/75 (65%), Positives = 62/75 (83%), Gaps = 3/75 (4%)
 Frame = +1

Query  154  DDQINDLVSKLQQLLPELR-NTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLAT  330
            DDQI DL+SKL+Q +PE+R N  S  VSA++VLQ+TCNYIR+LH+E DDLS+RLS+LL T
Sbjct  17   DDQITDLISKLRQSIPEIRQNRRSSTVSASKVLQETCNYIRNLHKEADDLSDRLSQLLET  76

Query  331  TDTN--QAALIRSLL  369
             D N  QAA+IRSL+
Sbjct  77   IDPNNPQAAIIRSLI  91



>emb|CDX91006.1| BnaC02g05910D [Brassica napus]
Length=93

 Score = 92.8 bits (229),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 49/75 (65%), Positives = 62/75 (83%), Gaps = 3/75 (4%)
 Frame = +1

Query  154  DDQINDLVSKLQQLLPELR-NTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLAT  330
            DDQI DL+SKL+Q +PE+R N  S  VSA++VLQ+TCNYIR+LH+E DDLS+RLS+LL T
Sbjct  17   DDQITDLISKLRQSIPEIRQNRRSSTVSASKVLQETCNYIRNLHKEADDLSDRLSQLLET  76

Query  331  TDTN--QAALIRSLL  369
             D N  QAA+IRSL+
Sbjct  77   IDPNSPQAAVIRSLI  91



>ref|XP_009393721.1| PREDICTED: transcription factor ILI5-like [Musa acuminata subsp. 
malaccensis]
Length=85

 Score = 92.8 bits (229),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 65/78 (83%), Gaps = 2/78 (3%)
 Frame = +1

Query  142  SRISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSEL  321
            SR+S+++IN LVSKLQ LLPE R   + + SAA++L++TCNYIRSL+R+VDDLS+RLS +
Sbjct  6    SRVSEEEINRLVSKLQSLLPETRQRGAGRASAAKLLKETCNYIRSLNRDVDDLSDRLSAI  65

Query  322  LATTDTN--QAALIRSLL  369
            +AT D++  +A ++RSLL
Sbjct  66   MATMDSSSAEAEMVRSLL  83



>ref|XP_009406651.1| PREDICTED: transcription factor ILI5-like [Musa acuminata subsp. 
malaccensis]
Length=85

 Score = 92.4 bits (228),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 64/82 (78%), Gaps = 2/82 (2%)
 Frame = +1

Query  130  TGGASRISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSER  309
            +G  SRIS+++I +L+SKL+ LLPE R     +  AA++LQ+TCNYI SLHR+VDDLS+R
Sbjct  2    SGRRSRISEEEIKELISKLRFLLPETRRQGGSRALAAKLLQETCNYIESLHRDVDDLSDR  61

Query  310  LSELLATTDTN--QAALIRSLL  369
            L+EL+AT D +  QA ++RSLL
Sbjct  62   LTELMATMDISSAQAEIVRSLL  83



>ref|XP_009401191.1| PREDICTED: transcription factor ILI3-like [Musa acuminata subsp. 
malaccensis]
Length=85

 Score = 92.4 bits (228),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 66/82 (80%), Gaps = 2/82 (2%)
 Frame = +1

Query  130  TGGASRISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSER  309
            +G   RI+D++IN+LVSKLQ LLPE R  +  + SA+++L++TC+YI+SLHREVD LS+R
Sbjct  2    SGRGRRITDEEINELVSKLQSLLPESRRRNIGRASASKLLKETCSYIKSLHREVDGLSDR  61

Query  310  LSELLATTDTN--QAALIRSLL  369
            LS L+AT D++  QA +IRSLL
Sbjct  62   LSGLMATMDSDSPQADIIRSLL  83



>ref|XP_010514602.1| PREDICTED: transcription factor PRE5 [Camelina sativa]
Length=92

 Score = 92.4 bits (228),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 64/76 (84%), Gaps = 3/76 (4%)
 Frame = +1

Query  154  DDQINDLVSKLQQLLPELRNTS-SDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLAT  330
            DDQ+ DLV KL+Q LPE+R    S+KVSA++VLQ+TCNYIR+LHREVD+LS+RLS+LL +
Sbjct  17   DDQMIDLVGKLRQFLPEIRERRRSEKVSASKVLQETCNYIRNLHREVDNLSDRLSQLLDS  76

Query  331  TDTN--QAALIRSLLM  372
             D +  +AA+IRSLLM
Sbjct  77   VDEDSPEAAVIRSLLM  92



>ref|XP_008803188.1| PREDICTED: transcription factor ILI3 [Phoenix dactylifera]
Length=85

 Score = 92.4 bits (228),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 66/77 (86%), Gaps = 2/77 (3%)
 Frame = +1

Query  145  RISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELL  324
            RI+D++IN+L+SKLQ LLPE R  +  + SA+++L++TC+YI+SLH+EVDDLS+RLS+L+
Sbjct  7    RITDEEINELISKLQTLLPESRRRNIGRASASKLLKETCSYIKSLHQEVDDLSDRLSDLI  66

Query  325  ATTDTN--QAALIRSLL  369
            AT D+N  QA +IRSLL
Sbjct  67   ATMDSNSPQAEIIRSLL  83



>ref|XP_006400033.1| hypothetical protein EUTSA_v10015131mg [Eutrema salsugineum]
 gb|ESQ41486.1| hypothetical protein EUTSA_v10015131mg [Eutrema salsugineum]
Length=94

 Score = 91.3 bits (225),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 63/75 (84%), Gaps = 3/75 (4%)
 Frame = +1

Query  154  DDQINDLVSKLQQLLPELR-NTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLAT  330
            DDQI DL+SKL+Q +PE+R N  S+ VSA++VLQ+TCNYIR+L++E DDLS+RLS+LL T
Sbjct  18   DDQITDLISKLRQSIPEIRQNRRSNTVSASKVLQETCNYIRNLNKEADDLSDRLSQLLET  77

Query  331  TDTN--QAALIRSLL  369
             D N  QAA+IRSL+
Sbjct  78   IDPNSPQAAIIRSLI  92



>ref|XP_010502885.1| PREDICTED: transcription factor PRE5-like [Camelina sativa]
Length=92

 Score = 91.3 bits (225),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 62/76 (82%), Gaps = 3/76 (4%)
 Frame = +1

Query  154  DDQINDLVSKLQQLLPELRNTS-SDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLAT  330
            DDQI DLV KL+Q LPE+R    S+KVSA++VLQ+TCNYIR LHREVD+LS+RLS+LL +
Sbjct  17   DDQIIDLVGKLRQFLPEIRERRRSEKVSASKVLQETCNYIRKLHREVDNLSDRLSQLLDS  76

Query  331  TDTN--QAALIRSLLM  372
             D +  +AA+I SLLM
Sbjct  77   VDEDSPEAAVISSLLM  92



>ref|XP_010029295.1| PREDICTED: transcription factor PRE5-like [Eucalyptus grandis]
 gb|KCW56186.1| hypothetical protein EUGRSUZ_I01936 [Eucalyptus grandis]
Length=90

 Score = 91.3 bits (225),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 65/75 (87%), Gaps = 3/75 (4%)
 Frame = +1

Query  154  DDQINDLVSKLQQLLPELRNTS-SDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLAT  330
            DDQI DLVSKL+Q LPE+R+   SDKV A++VLQ+TCN+I++LH+EVD+LSERLS+LL+T
Sbjct  16   DDQITDLVSKLRQHLPEIRDRRRSDKVPASKVLQETCNHIKNLHQEVDNLSERLSQLLST  75

Query  331  TDTN--QAALIRSLL  369
             D +  +AA+IRSL+
Sbjct  76   IDPDSPEAAIIRSLI  90



>ref|XP_002448623.1| hypothetical protein SORBIDRAFT_06g030340 [Sorghum bicolor]
 gb|EES12951.1| hypothetical protein SORBIDRAFT_06g030340 [Sorghum bicolor]
Length=104

 Score = 91.7 bits (226),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 65/77 (84%), Gaps = 5/77 (6%)
 Frame = +1

Query  154  DDQINDLVSKLQQLLPE--LRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLA  327
            +DQI++L+SKLQ LLPE   RN  + + SAARVLQDTC+YIRSLH+EVD+LSE L+ELLA
Sbjct  29   EDQISELLSKLQALLPESQTRN-GAHRGSAARVLQDTCSYIRSLHQEVDNLSETLAELLA  87

Query  328  TTD--TNQAALIRSLLM  372
            + D  ++QAA+IRSLLM
Sbjct  88   SADVTSDQAAVIRSLLM  104



>ref|XP_009131445.1| PREDICTED: transcription factor PRE2-like [Brassica rapa]
Length=94

 Score = 91.3 bits (225),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 65/77 (84%), Gaps = 3/77 (4%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELR-NTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELL  324
            I+DDQI +L+SKL+Q +PE+R N  S+ VSA++VLQ+TCNYIR+L++E DDLS+RLS+LL
Sbjct  16   INDDQITELISKLRQSIPEIRQNRRSNTVSASKVLQETCNYIRNLNKEADDLSDRLSQLL  75

Query  325  ATTDTN--QAALIRSLL  369
             T D N  QAA+IRSL+
Sbjct  76   ETIDPNSPQAAVIRSLI  92



>emb|CDX78615.1| BnaA03g05270D [Brassica napus]
 emb|CDX70597.1| BnaC03g06810D [Brassica napus]
Length=94

 Score = 91.3 bits (225),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 65/77 (84%), Gaps = 3/77 (4%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPELR-NTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELL  324
            I+DDQI +L+SKL+Q +PE+R N  S+ VSA++VLQ+TCNYIR+L++E DDLS+RLS+LL
Sbjct  16   INDDQITELISKLRQSIPEIRQNRRSNTVSASKVLQETCNYIRNLNKEADDLSDRLSQLL  75

Query  325  ATTDTN--QAALIRSLL  369
             T D N  QAA+IRSL+
Sbjct  76   ETIDPNSPQAAVIRSLI  92



>gb|KFK25753.1| hypothetical protein AALP_AA8G155000 [Arabis alpina]
Length=92

 Score = 90.9 bits (224),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 63/75 (84%), Gaps = 3/75 (4%)
 Frame = +1

Query  154  DDQINDLVSKLQQLLPELR-NTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLAT  330
            DDQI DL+SKL+Q +PE+R N  S+ VSA++VLQ+TCNYIR+L++E DDLS+RLS+LL T
Sbjct  16   DDQITDLISKLRQSIPEIRQNRRSNTVSASKVLQETCNYIRNLNKEADDLSDRLSQLLET  75

Query  331  TDTN--QAALIRSLL  369
             D N  QAA+IRSL+
Sbjct  76   IDPNSPQAAIIRSLI  90



>gb|EMT04374.1| Transcription factor bHLH135 [Aegilops tauschii]
Length=96

 Score = 91.3 bits (225),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 63/79 (80%), Gaps = 5/79 (6%)
 Frame = +1

Query  148  ISDDQINDLVSKLQQLLPE--LRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSEL  321
            IS+DQI++L+SKLQ LLPE   RN  + + SAARVLQ+TC+YIRSLHREVDDLSE L+ L
Sbjct  19   ISEDQISELLSKLQALLPESQARN-GAHRGSAARVLQETCSYIRSLHREVDDLSETLAAL  77

Query  322  LAT--TDTNQAALIRSLLM  372
            LA+      QAA+IRSLLM
Sbjct  78   LASDAVTAEQAAVIRSLLM  96



>ref|XP_009398947.1| PREDICTED: transcription factor ILI3-like [Musa acuminata subsp. 
malaccensis]
Length=85

 Score = 90.5 bits (223),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 64/78 (82%), Gaps = 2/78 (3%)
 Frame = +1

Query  142  SRISDDQINDLVSKLQQLLPELRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSEL  321
            SRI+  +IN+L SKL+ LLPE R  +  +VSA+++L++TC+YI+SLHREVDDLS RLS+L
Sbjct  6    SRITGKEINELASKLRSLLPESRRRNMSRVSASKLLKETCSYIKSLHREVDDLSSRLSDL  65

Query  322  LAT--TDTNQAALIRSLL  369
            ++T  TD+ QA +IRS+L
Sbjct  66   MSTMETDSPQAEIIRSIL  83



>ref|XP_009121603.1| PREDICTED: transcription factor PRE2 [Brassica rapa]
 emb|CDX69545.1| BnaA10g18940D [Brassica napus]
Length=94

 Score = 90.1 bits (222),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 62/75 (83%), Gaps = 3/75 (4%)
 Frame = +1

Query  154  DDQINDLVSKLQQLLPELR-NTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLSELLAT  330
            DDQI DL+SKL+Q +PE+R N  S  VSA++VLQ+TCNYIR+L++E DDLS+RLS+LL T
Sbjct  18   DDQITDLISKLRQSIPEIRQNRRSSTVSASKVLQETCNYIRNLNKEADDLSDRLSQLLET  77

Query  331  TDTN--QAALIRSLL  369
             D N  QAA+IRSL+
Sbjct  78   IDPNSPQAAIIRSLI  92



>ref|XP_006661756.1| PREDICTED: transcription factor bHLH135-like [Oryza brachyantha]
Length=89

 Score = 90.1 bits (222),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 64/82 (78%), Gaps = 5/82 (6%)
 Frame = +1

Query  139  ASRISDDQINDLVSKLQQLLPE---LRNTSSDKVSAARVLQDTCNYIRSLHREVDDLSER  309
            + RI+DD+I +L+SKLQ LLP+    R  +     AA++L++TC+YI+SLHREVDDLSER
Sbjct  7    SGRITDDEITELISKLQSLLPDSSRRRGATGRPSPAAKLLKETCSYIQSLHREVDDLSER  66

Query  310  LSELLATTDTN--QAALIRSLL  369
            LSEL+AT D+N  QA +IR+LL
Sbjct  67   LSELMATMDSNSPQADIIRTLL  88



>gb|EYU34661.1| hypothetical protein MIMGU_mgv1a018243mg [Erythranthe guttata]
Length=99

 Score = 90.5 bits (223),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 68/88 (77%), Gaps = 9/88 (10%)
 Frame = +1

Query  133  GGASR--ISDDQINDLVSKLQQLLPELRNTS-----SDKVSAARVLQDTCNYIRSLHREV  291
            G +SR  I+DD+I +LVSKLQQLLP+ RNTS     S+K SA +VLQ+TCNYI+ L +E+
Sbjct  12   GASSRRTITDDEIIELVSKLQQLLPQTRNTSNTTPASNKASANKVLQETCNYIKKLQKEM  71

Query  292  DDLSERLSELLATTDTN--QAALIRSLL  369
            DDLS RL +LL+T D +  +AA+IR+L+
Sbjct  72   DDLSVRLCQLLSTVDADSAEAAVIRALI  99



>ref|XP_004983139.1| PREDICTED: transcription factor bHLH135-like [Setaria italica]
Length=88

 Score = 89.4 bits (220),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 63/80 (79%), Gaps = 3/80 (4%)
 Frame = +1

Query  139  ASRISDDQINDLVSKLQQLLPEL-RNTSSDKVSAARVLQDTCNYIRSLHREVDDLSERLS  315
            A RI+DD+IN+L+SKLQ +LPE  R  ++ + SA+++LQ+TC YIR LHREVDDL+ RLS
Sbjct  6    AGRINDDEINELISKLQSVLPESSRRGAAGRSSASKLLQETCQYIRRLHREVDDLNNRLS  65

Query  316  ELLATTDTN--QAALIRSLL  369
            EL+ T D +  QA +IRSLL
Sbjct  66   ELMETMDGDSPQADIIRSLL  85



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 514890587360