BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c102909_g1_i1 len=123 path=[1:0-122]

Length=123
                                                                      Score     E

ref|XP_011085220.1|  PREDICTED: DNA damage-binding protein 1          80.1    8e-16   
ref|XP_006359100.1|  PREDICTED: DNA damage-binding protein 1-like...  79.0    2e-15   
ref|XP_006359099.1|  PREDICTED: DNA damage-binding protein 1-like...  79.0    2e-15   
ref|XP_011096660.1|  PREDICTED: DNA damage-binding protein 1          79.0    2e-15   
ref|XP_008225551.1|  PREDICTED: DNA damage-binding protein 1          78.2    4e-15   
ref|XP_007213714.1|  hypothetical protein PRUPE_ppa000579mg           78.2    4e-15   
ref|NP_001234275.1|  DNA damage-binding protein 1                     77.4    8e-15   
ref|XP_010315587.1|  PREDICTED: DNA damage-binding protein 1 isof...  77.4    8e-15   
ref|XP_007159616.1|  hypothetical protein PHAVU_002G252300g           77.0    9e-15   
ref|XP_009587164.1|  PREDICTED: DNA damage-binding protein 1          76.6    1e-14   
ref|XP_009803985.1|  PREDICTED: DNA damage-binding protein 1 isof...  76.6    1e-14   
ref|XP_009803984.1|  PREDICTED: DNA damage-binding protein 1 isof...  76.6    1e-14   
ref|XP_009362259.1|  PREDICTED: DNA damage-binding protein 1-like     76.3    2e-14   
ref|XP_008372209.1|  PREDICTED: DNA damage-binding protein 1          76.3    2e-14   
ref|XP_002526608.1|  DNA repair protein xp-E, putative                75.1    4e-14   Ricinus communis
ref|XP_007041121.1|  Damaged DNA binding protein 1A isoform 3         74.3    8e-14   
ref|XP_007041120.1|  Damaged DNA binding protein 1A isoform 2         74.3    8e-14   
ref|XP_007041119.1|  Damaged DNA binding protein 1A isoform 1         74.3    8e-14   
gb|KHN06521.1|  DNA damage-binding protein 1                          73.9    1e-13   
ref|XP_003525024.1|  PREDICTED: DNA damage-binding protein 1-like...  73.9    1e-13   
ref|XP_010687033.1|  PREDICTED: DNA damage-binding protein 1          73.9    1e-13   
ref|XP_011046743.1|  PREDICTED: DNA damage-binding protein 1a iso...  73.9    1e-13   
ref|XP_011011819.1|  PREDICTED: DNA damage-binding protein 1a-lik...  73.9    1e-13   
ref|XP_011011818.1|  PREDICTED: DNA damage-binding protein 1a-lik...  73.9    1e-13   
gb|KDP34965.1|  hypothetical protein JCGZ_09253                       73.9    1e-13   
ref|XP_011046742.1|  PREDICTED: DNA damage-binding protein 1a iso...  73.9    1e-13   
ref|XP_011046741.1|  PREDICTED: DNA damage-binding protein 1a iso...  73.9    1e-13   
ref|XP_002300334.1|  DAMAGED DNA BINDING protein 1 B                  73.9    1e-13   Populus trichocarpa [western balsam poplar]
ref|XP_009412027.1|  PREDICTED: DNA damage-binding protein 1          73.6    1e-13   
ref|XP_004304711.1|  PREDICTED: DNA damage-binding protein 1-like     73.6    2e-13   
ref|XP_010110241.1|  DNA damage-binding protein 1a                    72.8    2e-13   
emb|CBI30975.3|  unnamed protein product                              72.8    3e-13   
ref|XP_002280735.1|  PREDICTED: DNA damage-binding protein 1          72.8    3e-13   Vitis vinifera
gb|EPS69820.1|  hypothetical protein M569_04940                       72.8    3e-13   
gb|KFK32210.1|  hypothetical protein AALP_AA6G211800                  72.8    3e-13   
ref|XP_003531313.1|  PREDICTED: DNA damage-binding protein 1-like...  72.8    3e-13   
ref|XP_009377464.1|  PREDICTED: DNA damage-binding protein 1          72.4    4e-13   
ref|XP_008383431.1|  PREDICTED: DNA damage-binding protein 1-like     72.4    4e-13   
ref|XP_008349171.1|  PREDICTED: DNA damage-binding protein 1          72.4    4e-13   
gb|KDO75341.1|  hypothetical protein CISIN_1g001387mg                 72.0    4e-13   
gb|KDO75340.1|  hypothetical protein CISIN_1g001387mg                 72.0    5e-13   
ref|XP_006468270.1|  PREDICTED: DNA damage-binding protein 1a-like    72.0    5e-13   
ref|XP_006448953.1|  hypothetical protein CICLE_v10014106mg           72.0    5e-13   
ref|XP_009114481.1|  PREDICTED: DNA damage-binding protein 1a         71.6    7e-13   
ref|XP_006286947.1|  hypothetical protein CARUB_v10000093mg           71.6    7e-13   
ref|NP_192451.1|  DNA damage-binding protein 1a                       71.6    7e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006396601.1|  hypothetical protein EUTSA_v10028374mg           71.6    7e-13   
ref|XP_002872755.1|  UV-damaged DNA-binding protein 1A                71.6    7e-13   
ref|XP_010422430.1|  PREDICTED: DNA damage-binding protein 1a-like    71.6    8e-13   
ref|XP_010431430.1|  PREDICTED: DNA damage-binding protein 1a iso...  71.6    8e-13   
ref|XP_010431426.1|  PREDICTED: DNA damage-binding protein 1a iso...  71.6    8e-13   
ref|NP_001118940.1|  DNA damage-binding protein 1a                    71.6    8e-13   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF02165.1|  UV-damaged DNA binding factor - like protein         70.9    1e-12   Arabidopsis thaliana [mouse-ear cress]
ref|NP_193842.1|  DNA damage-binding protein 1b                       70.9    1e-12   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD95136.1|  UV-damaged DNA-binding protein- like                 70.9    1e-12   Arabidopsis thaliana [mouse-ear cress]
emb|CAA17529.1|  UV-damaged DNA-binding protein-like                  70.9    1e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004504152.1|  PREDICTED: DNA damage-binding protein 1-like     70.9    2e-12   
ref|XP_010455869.1|  PREDICTED: DNA damage-binding protein 1a-like    69.7    3e-12   
ref|XP_006285730.1|  hypothetical protein CARUB_v10007203mg           69.7    3e-12   
ref|XP_010445239.1|  PREDICTED: DNA damage-binding protein 1b-like    69.7    4e-12   
ref|XP_010449116.1|  PREDICTED: DNA damage-binding protein 1b-like    69.7    4e-12   
ref|XP_010434237.1|  PREDICTED: DNA damage-binding protein 1b         69.7    4e-12   
ref|XP_002867863.1|  hypothetical protein ARALYDRAFT_492777           69.7    4e-12   
emb|CDY57060.1|  BnaC03g64410D                                        68.6    8e-12   
emb|CDX76416.1|  BnaA08g09840D                                        68.6    8e-12   
gb|AET04495.2|  damaged DNA-binding protein 1A                        68.2    1e-11   
ref|XP_008776763.1|  PREDICTED: DNA damage-binding protein 1a iso...  67.8    2e-11   
ref|XP_010025491.1|  PREDICTED: DNA damage-binding protein 1          67.8    2e-11   
ref|XP_008776760.1|  PREDICTED: DNA damage-binding protein 1a iso...  67.4    2e-11   
ref|XP_009108514.1|  PREDICTED: DNA damage-binding protein 1b         67.4    2e-11   
ref|XP_008647719.1|  PREDICTED: uncharacterized protein LOC100279...  67.4    2e-11   
ref|XP_008647718.1|  PREDICTED: uncharacterized protein LOC100279...  67.4    2e-11   
ref|XP_006828193.1|  hypothetical protein AMTR_s00023p00145060        67.4    2e-11   
ref|XP_006413823.1|  hypothetical protein EUTSA_v10024273mg           67.0    3e-11   
ref|XP_010247742.1|  PREDICTED: DNA damage-binding protein 1          67.0    3e-11   
ref|XP_008656105.1|  PREDICTED: DNA damage-binding protein 1a-like    66.6    4e-11   
ref|XP_002440377.1|  hypothetical protein SORBIDRAFT_09g030580        66.6    5e-11   Sorghum bicolor [broomcorn]
ref|XP_010271927.1|  PREDICTED: DNA damage-binding protein 1-like     66.2    5e-11   
ref|XP_010941530.1|  PREDICTED: DNA damage-binding protein 1a iso...  66.2    6e-11   
ref|XP_010941529.1|  PREDICTED: DNA damage-binding protein 1a iso...  65.9    7e-11   
gb|AFW81318.1|  hypothetical protein ZEAMMB73_456332                  65.5    8e-11   
gb|KFK28706.1|  hypothetical protein AALP_AA7G036100                  65.1    1e-10   
ref|XP_004961015.1|  PREDICTED: DNA damage-binding protein 1-like     64.7    2e-10   
ref|XP_006654871.1|  PREDICTED: DNA damage-binding protein 1a-like    64.7    2e-10   
dbj|BAB20761.1|  UV-damaged DNA binding protein                       64.7    2e-10   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001056495.1|  Os05g0592400                                     64.7    2e-10   Oryza sativa Japonica Group [Japonica rice]
gb|EMT15709.1|  DNA damage-binding protein 1                          64.7    2e-10   
gb|EMS49351.1|  DNA damage-binding protein 1                          64.7    2e-10   
gb|EEC79792.1|  hypothetical protein OsI_21216                        64.3    2e-10   Oryza sativa Indica Group [Indian rice]
ref|XP_010537808.1|  PREDICTED: DNA damage-binding protein 1a         63.2    6e-10   
gb|KGN65894.1|  hypothetical protein Csa_1G537440                     62.8    9e-10   
ref|XP_008444949.1|  PREDICTED: DNA damage-binding protein 1          62.8    9e-10   
ref|XP_004135539.1|  PREDICTED: DNA damage-binding protein 1-like     62.8    9e-10   
ref|XP_010906318.1|  PREDICTED: DNA damage-binding protein 1a-like    62.0    1e-09   
emb|CDM83290.1|  unnamed protein product                              62.0    2e-09   
ref|XP_003567788.1|  PREDICTED: DNA damage-binding protein 1a-like    61.2    3e-09   
ref|XP_003569272.1|  PREDICTED: DNA damage-binding protein 1a-lik...  56.6    1e-07   
ref|XP_010231953.1|  PREDICTED: DNA damage-binding protein 1a-lik...  56.6    1e-07   
ref|XP_002976174.1|  hypothetical protein SELMODRAFT_151061           54.3    7e-07   
ref|XP_002968203.1|  hypothetical protein SELMODRAFT_145521           52.0    4e-06   
ref|XP_001785293.1|  predicted protein                                52.0    4e-06   
ref|XP_001776266.1|  predicted protein                                51.6    7e-06   
ref|XP_001702494.1|  UV-damaged DNA binding complex subunit 1 pro...  51.2    9e-06   Chlamydomonas reinhardtii
ref|XP_004158102.1|  PREDICTED: LOW QUALITY PROTEIN: DNA damage-b...  45.4    7e-04   



>ref|XP_011085220.1| PREDICTED: DNA damage-binding protein 1 [Sesamum indicum]
Length=1089

 Score = 80.1 bits (196),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 35/41 (85%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SSTSREL+HEWFAPAGYS+NVATA+  QVLLA GGGHLVYL
Sbjct  473  SSTSRELRHEWFAPAGYSVNVATASATQVLLATGGGHLVYL  513



>ref|XP_006359100.1| PREDICTED: DNA damage-binding protein 1-like isoform X2 [Solanum 
tuberosum]
Length=1090

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/41 (85%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SSTSR+LK+EWFAPAGYS+NVATAN  QVLLA GGGHLVYL
Sbjct  473  SSTSRDLKNEWFAPAGYSVNVATANATQVLLATGGGHLVYL  513



>ref|XP_006359099.1| PREDICTED: DNA damage-binding protein 1-like isoform X1 [Solanum 
tuberosum]
Length=1095

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/41 (85%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SSTSR+LK+EWFAPAGYS+NVATAN  QVLLA GGGHLVYL
Sbjct  478  SSTSRDLKNEWFAPAGYSVNVATANATQVLLATGGGHLVYL  518



>ref|XP_011096660.1| PREDICTED: DNA damage-binding protein 1 [Sesamum indicum]
Length=1082

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/41 (85%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SST+REL++EWFAPAGYSINVATAN  QVLLA GGGHLVYL
Sbjct  473  SSTTRELRNEWFAPAGYSINVATANATQVLLATGGGHLVYL  513



>ref|XP_008225551.1| PREDICTED: DNA damage-binding protein 1 [Prunus mume]
Length=1089

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 36/41 (88%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SSTSRELK+EWFAPAGYSINVATAN  QVLLA GG HLVYL
Sbjct  473  SSTSRELKNEWFAPAGYSINVATANATQVLLATGGKHLVYL  513



>ref|XP_007213714.1| hypothetical protein PRUPE_ppa000579mg [Prunus persica]
 gb|EMJ14913.1| hypothetical protein PRUPE_ppa000579mg [Prunus persica]
Length=1089

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 36/41 (88%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SSTSRELK+EWFAPAGYSINVATAN  QVLLA GG HLVYL
Sbjct  473  SSTSRELKNEWFAPAGYSINVATANATQVLLATGGKHLVYL  513



>ref|NP_001234275.1| DNA damage-binding protein 1 [Solanum lycopersicum]
 ref|NP_001233864.1| UV damaged DNA binding protein 1 [Solanum lycopersicum]
 sp|Q6QNU4.1|DDB1_SOLLC RecName: Full=DNA damage-binding protein 1; AltName: Full=High 
pigmentation protein 1; AltName: Full=UV-damaged DNA-binding 
protein 1 [Solanum lycopersicum]
 gb|AAR20885.1| UV damaged DNA binding protein 1 [Solanum lycopersicum]
 gb|AAS21683.1| UV-damaged DNA binding protein 1 [Solanum lycopersicum]
Length=1090

 Score = 77.4 bits (189),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 34/41 (83%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SSTSR+LK+EWFAP GYS+NVATAN  QVLLA GGGHLVYL
Sbjct  473  SSTSRDLKNEWFAPVGYSVNVATANATQVLLATGGGHLVYL  513



>ref|XP_010315587.1| PREDICTED: DNA damage-binding protein 1 isoform X1 [Solanum lycopersicum]
 sp|Q6E7D1.1|DDB1_SOLCE RecName: Full=DNA damage-binding protein 1; AltName: Full=UV-damaged 
DNA-binding protein 1 [Solanum cheesmaniae]
 gb|AAT66742.1| UV-damaged DNA binding protein 1 [Solanum cheesmaniae]
Length=1095

 Score = 77.4 bits (189),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 34/41 (83%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SSTSR+LK+EWFAP GYS+NVATAN  QVLLA GGGHLVYL
Sbjct  478  SSTSRDLKNEWFAPVGYSVNVATANATQVLLATGGGHLVYL  518



>ref|XP_007159616.1| hypothetical protein PHAVU_002G252300g [Phaseolus vulgaris]
 gb|ESW31610.1| hypothetical protein PHAVU_002G252300g [Phaseolus vulgaris]
Length=1089

 Score = 77.0 bits (188),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 33/41 (80%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SST+REL++EWFAP+GYS+NVATAN  QVLLA GGGHLVYL
Sbjct  473  SSTTRELRNEWFAPSGYSVNVATANATQVLLATGGGHLVYL  513



>ref|XP_009587164.1| PREDICTED: DNA damage-binding protein 1 [Nicotiana tomentosiformis]
Length=1038

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 34/41 (83%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SS SR+LK+EWFAPAGYS+NVATAN  QVLLA GGGHLVYL
Sbjct  421  SSISRDLKNEWFAPAGYSVNVATANATQVLLATGGGHLVYL  461



>ref|XP_009803985.1| PREDICTED: DNA damage-binding protein 1 isoform X2 [Nicotiana 
sylvestris]
Length=1090

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 34/41 (83%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SS SR+LK+EWFAPAGYS+NVATAN  QVLLA GGGHLVYL
Sbjct  473  SSISRDLKNEWFAPAGYSVNVATANATQVLLATGGGHLVYL  513



>ref|XP_009803984.1| PREDICTED: DNA damage-binding protein 1 isoform X1 [Nicotiana 
sylvestris]
Length=1095

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 34/41 (83%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SS SR+LK+EWFAPAGYS+NVATAN  QVLLA GGGHLVYL
Sbjct  478  SSISRDLKNEWFAPAGYSVNVATANATQVLLATGGGHLVYL  518



>ref|XP_009362259.1| PREDICTED: DNA damage-binding protein 1-like [Pyrus x bretschneideri]
Length=1089

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 35/41 (85%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SST+RELKHEW APAGYSINVATAN  QVLLA GG HLVYL
Sbjct  473  SSTTRELKHEWNAPAGYSINVATANATQVLLATGGKHLVYL  513



>ref|XP_008372209.1| PREDICTED: DNA damage-binding protein 1 [Malus domestica]
Length=1089

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 35/41 (85%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SST+RELKHEW APAGYSINVATAN  QVLLA GG HLVYL
Sbjct  473  SSTTRELKHEWNAPAGYSINVATANATQVLLATGGKHLVYL  513



>ref|XP_002526608.1| DNA repair protein xp-E, putative [Ricinus communis]
 gb|EEF35767.1| DNA repair protein xp-E, putative [Ricinus communis]
Length=1033

 Score = 75.1 bits (183),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 34/41 (83%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SST+REL++EW APAGYSINVATAN  QVLLA GGGHLVYL
Sbjct  418  SSTTRELQNEWHAPAGYSINVATANATQVLLATGGGHLVYL  458



>ref|XP_007041121.1| Damaged DNA binding protein 1A isoform 3 [Theobroma cacao]
 gb|EOX96952.1| Damaged DNA binding protein 1A isoform 3 [Theobroma cacao]
Length=985

 Score = 74.3 bits (181),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 33/41 (80%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SS SREL+HEW AP GYS+NVATAN  QVLLA GGGHLVYL
Sbjct  370  SSISRELRHEWNAPPGYSVNVATANATQVLLATGGGHLVYL  410



>ref|XP_007041120.1| Damaged DNA binding protein 1A isoform 2 [Theobroma cacao]
 gb|EOX96951.1| Damaged DNA binding protein 1A isoform 2 [Theobroma cacao]
Length=1040

 Score = 74.3 bits (181),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 33/41 (80%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SS SREL+HEW AP GYS+NVATAN  QVLLA GGGHLVYL
Sbjct  425  SSISRELRHEWNAPPGYSVNVATANATQVLLATGGGHLVYL  465



>ref|XP_007041119.1| Damaged DNA binding protein 1A isoform 1 [Theobroma cacao]
 gb|EOX96950.1| Damaged DNA binding protein 1A isoform 1 [Theobroma cacao]
Length=1088

 Score = 74.3 bits (181),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 33/41 (80%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SS SREL+HEW AP GYS+NVATAN  QVLLA GGGHLVYL
Sbjct  473  SSISRELRHEWNAPPGYSVNVATANATQVLLATGGGHLVYL  513



>gb|KHN06521.1| DNA damage-binding protein 1 [Glycine soja]
Length=1066

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SST+REL++EW AP+GYS+NVATAN  QVLLA GGGHLVYL
Sbjct  473  SSTTRELRNEWHAPSGYSVNVATANATQVLLATGGGHLVYL  513



>ref|XP_003525024.1| PREDICTED: DNA damage-binding protein 1-like isoform 1 [Glycine 
max]
Length=1089

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SST+REL++EW AP+GYS+NVATAN  QVLLA GGGHLVYL
Sbjct  473  SSTTRELRNEWHAPSGYSVNVATANATQVLLATGGGHLVYL  513



>ref|XP_010687033.1| PREDICTED: DNA damage-binding protein 1 [Beta vulgaris subsp. 
vulgaris]
Length=1089

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 33/41 (80%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SS SREL+HEW AP GYS+NVATAN  QVLLA GGGHLVYL
Sbjct  473  SSISRELRHEWKAPTGYSVNVATANASQVLLATGGGHLVYL  513



>ref|XP_011046743.1| PREDICTED: DNA damage-binding protein 1a isoform X3 [Populus 
euphratica]
 ref|XP_011011820.1| PREDICTED: DNA damage-binding protein 1a-like isoform X3 [Populus 
euphratica]
Length=937

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 33/41 (80%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SST+REL+ EW AP+GYSINVATAN  QVLLA GGGHLVYL
Sbjct  322  SSTTRELRQEWNAPSGYSINVATANATQVLLATGGGHLVYL  362



>ref|XP_011011819.1| PREDICTED: DNA damage-binding protein 1a-like isoform X2 [Populus 
euphratica]
Length=976

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 33/41 (80%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SST+REL+ EW AP+GYSINVATAN  QVLLA GGGHLVYL
Sbjct  361  SSTTRELRQEWNAPSGYSINVATANATQVLLATGGGHLVYL  401



>ref|XP_011011818.1| PREDICTED: DNA damage-binding protein 1a-like isoform X1 [Populus 
euphratica]
Length=985

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 33/41 (80%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SST+REL+ EW AP+GYSINVATAN  QVLLA GGGHLVYL
Sbjct  370  SSTTRELRQEWNAPSGYSINVATANATQVLLATGGGHLVYL  410



>gb|KDP34965.1| hypothetical protein JCGZ_09253 [Jatropha curcas]
Length=1088

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 33/41 (80%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SST+REL++EW AP+GYSINVATAN  QVLLA GGGHLVYL
Sbjct  473  SSTTRELRNEWNAPSGYSINVATANATQVLLATGGGHLVYL  513



>ref|XP_011046742.1| PREDICTED: DNA damage-binding protein 1a isoform X2 [Populus 
euphratica]
Length=1079

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 33/41 (80%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SST+REL+ EW AP+GYSINVATAN  QVLLA GGGHLVYL
Sbjct  464  SSTTRELRQEWNAPSGYSINVATANATQVLLATGGGHLVYL  504



>ref|XP_011046741.1| PREDICTED: DNA damage-binding protein 1a isoform X1 [Populus 
euphratica]
Length=1088

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 33/41 (80%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SST+REL+ EW AP+GYSINVATAN  QVLLA GGGHLVYL
Sbjct  473  SSTTRELRQEWNAPSGYSINVATANATQVLLATGGGHLVYL  513



>ref|XP_002300334.1| DAMAGED DNA BINDING protein 1 B [Populus trichocarpa]
 gb|EEE85139.1| DAMAGED DNA BINDING protein 1 B [Populus trichocarpa]
Length=1088

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 33/41 (80%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SST+REL+ EW AP+GYSINVATAN  QVLLA GGGHLVYL
Sbjct  473  SSTTRELRQEWNAPSGYSINVATANATQVLLATGGGHLVYL  513



>ref|XP_009412027.1| PREDICTED: DNA damage-binding protein 1 [Musa acuminata subsp. 
malaccensis]
Length=1089

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 33/41 (80%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SST+REL HEW AP+GYS+NVATAN  QVLLA GGGHLVYL
Sbjct  473  SSTTRELLHEWNAPSGYSVNVATANASQVLLATGGGHLVYL  513



>ref|XP_004304711.1| PREDICTED: DNA damage-binding protein 1-like [Fragaria vesca 
subsp. vesca]
Length=1089

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 34/41 (83%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SSTSR+LK+EW APAGYSINVATAN  QVLLA GG HLVYL
Sbjct  473  SSTSRDLKNEWHAPAGYSINVATANATQVLLATGGKHLVYL  513



>ref|XP_010110241.1| DNA damage-binding protein 1a [Morus notabilis]
 gb|EXC25620.1| DNA damage-binding protein 1a [Morus notabilis]
Length=976

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 33/41 (80%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SS +REL++EW APAGYSINVATAN  QVLLA GGGHLVYL
Sbjct  370  SSITRELRNEWNAPAGYSINVATANATQVLLATGGGHLVYL  410



>emb|CBI30975.3| unnamed protein product [Vitis vinifera]
Length=1043

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +1

Query  4    STSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            STSREL++EW AP+GYS+NVATAN  QVLLA GGGHLVYL
Sbjct  474  STSRELRNEWKAPSGYSVNVATANATQVLLATGGGHLVYL  513



>ref|XP_002280735.1| PREDICTED: DNA damage-binding protein 1 [Vitis vinifera]
Length=1089

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +1

Query  4    STSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            STSREL++EW AP+GYS+NVATAN  QVLLA GGGHLVYL
Sbjct  474  STSRELRNEWKAPSGYSVNVATANATQVLLATGGGHLVYL  513



>gb|EPS69820.1| hypothetical protein M569_04940 [Genlisea aurea]
Length=1091

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 34/41 (83%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SST+REL +EW APAGYSINVATAN  QVLLAAGGG LVYL
Sbjct  475  SSTTRELHNEWLAPAGYSINVATANATQVLLAAGGGLLVYL  515



>gb|KFK32210.1| hypothetical protein AALP_AA6G211800 [Arabis alpina]
Length=1088

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SSTSREL+ EW APAG+++NVATAN  QVLLA GGGHLVYL
Sbjct  473  SSTSRELRDEWHAPAGFTVNVATANASQVLLATGGGHLVYL  513



>ref|XP_003531313.1| PREDICTED: DNA damage-binding protein 1-like isoform 1 [Glycine 
max]
Length=1089

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SST+R+L++EW AP+GYS+NVATAN  QVLLA GGGHLVYL
Sbjct  473  SSTTRDLRNEWHAPSGYSVNVATANATQVLLATGGGHLVYL  513



>ref|XP_009377464.1| PREDICTED: DNA damage-binding protein 1 [Pyrus x bretschneideri]
Length=1089

 Score = 72.4 bits (176),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 34/41 (83%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SST+RELKHEW APAG SINVATAN  QVLLA GG HLVYL
Sbjct  473  SSTTRELKHEWNAPAGNSINVATANATQVLLATGGKHLVYL  513



>ref|XP_008383431.1| PREDICTED: DNA damage-binding protein 1-like [Malus domestica]
Length=1089

 Score = 72.4 bits (176),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 34/41 (83%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SST+RELKHEW APAG SINVATAN  QVLLA GG HLVYL
Sbjct  473  SSTTRELKHEWNAPAGNSINVATANATQVLLATGGKHLVYL  513



>ref|XP_008349171.1| PREDICTED: DNA damage-binding protein 1 [Malus domestica]
Length=1098

 Score = 72.4 bits (176),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 34/41 (83%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SST+RELKHEW APAG SINVATAN  QVLLA GG HLVYL
Sbjct  482  SSTTRELKHEWNAPAGNSINVATANATQVLLATGGKHLVYL  522



>gb|KDO75341.1| hypothetical protein CISIN_1g001387mg [Citrus sinensis]
Length=774

 Score = 72.0 bits (175),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SSTSREL++EW +P GYS+NVATAN  QVLLA GGGHLVYL
Sbjct  159  SSTSRELRNEWKSPPGYSVNVATANASQVLLATGGGHLVYL  199



>gb|KDO75340.1| hypothetical protein CISIN_1g001387mg [Citrus sinensis]
Length=1036

 Score = 72.0 bits (175),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SSTSREL++EW +P GYS+NVATAN  QVLLA GGGHLVYL
Sbjct  421  SSTSRELRNEWKSPPGYSVNVATANASQVLLATGGGHLVYL  461



>ref|XP_006468270.1| PREDICTED: DNA damage-binding protein 1a-like [Citrus sinensis]
 gb|KDO75339.1| hypothetical protein CISIN_1g001387mg [Citrus sinensis]
Length=1088

 Score = 72.0 bits (175),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SSTSREL++EW +P GYS+NVATAN  QVLLA GGGHLVYL
Sbjct  473  SSTSRELRNEWKSPPGYSVNVATANASQVLLATGGGHLVYL  513



>ref|XP_006448953.1| hypothetical protein CICLE_v10014106mg [Citrus clementina]
 gb|ESR62193.1| hypothetical protein CICLE_v10014106mg [Citrus clementina]
Length=1088

 Score = 72.0 bits (175),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SSTSREL++EW +P GYS+NVATAN  QVLLA GGGHLVYL
Sbjct  473  SSTSRELRNEWKSPPGYSVNVATANASQVLLATGGGHLVYL  513



>ref|XP_009114481.1| PREDICTED: DNA damage-binding protein 1a [Brassica rapa]
Length=1088

 Score = 71.6 bits (174),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SST+REL+ EW APAG+++NVATAN  QVLLA GGGHLVYL
Sbjct  473  SSTTRELRDEWHAPAGFTVNVATANASQVLLATGGGHLVYL  513



>ref|XP_006286947.1| hypothetical protein CARUB_v10000093mg [Capsella rubella]
 gb|EOA19845.1| hypothetical protein CARUB_v10000093mg [Capsella rubella]
Length=1088

 Score = 71.6 bits (174),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SST+REL+ EW APAG+++NVATAN  QVLLA GGGHLVYL
Sbjct  473  SSTTRELRDEWHAPAGFTVNVATANASQVLLATGGGHLVYL  513



>ref|NP_192451.1| DNA damage-binding protein 1a [Arabidopsis thaliana]
 sp|Q9M0V3.1|DDB1A_ARATH RecName: Full=DNA damage-binding protein 1a; AltName: Full=UV-damaged 
DNA-binding protein 1a; Short=DDB1a [Arabidopsis thaliana]
 emb|CAB81084.1| UV-damaged DNA binding factor-like protein [Arabidopsis thaliana]
 gb|AAN71904.1| putative UV-damaged DNA binding factor [Arabidopsis thaliana]
 gb|AEE82517.1| DNA damage-binding protein 1a [Arabidopsis thaliana]
Length=1088

 Score = 71.6 bits (174),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SST+REL+ EW APAG+++NVATAN  QVLLA GGGHLVYL
Sbjct  473  SSTTRELRDEWHAPAGFTVNVATANASQVLLATGGGHLVYL  513



>ref|XP_006396601.1| hypothetical protein EUTSA_v10028374mg [Eutrema salsugineum]
 dbj|BAJ34594.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ38054.1| hypothetical protein EUTSA_v10028374mg [Eutrema salsugineum]
Length=1088

 Score = 71.6 bits (174),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SST+REL+ EW APAG+++NVATAN  QVLLA GGGHLVYL
Sbjct  473  SSTTRELRDEWHAPAGFTVNVATANASQVLLATGGGHLVYL  513



>ref|XP_002872755.1| UV-damaged DNA-binding protein 1A [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49014.1| UV-damaged DNA-binding protein 1A [Arabidopsis lyrata subsp. 
lyrata]
Length=1088

 Score = 71.6 bits (174),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SST+REL+ EW APAG+++NVATAN  QVLLA GGGHLVYL
Sbjct  473  SSTTRELRDEWHAPAGFTVNVATANASQVLLATGGGHLVYL  513



>ref|XP_010422430.1| PREDICTED: DNA damage-binding protein 1a-like [Camelina sativa]
Length=1088

 Score = 71.6 bits (174),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SST+REL+ EW APAG+++NVATAN  QVLLA GGGHLVYL
Sbjct  473  SSTTRELRDEWHAPAGFAVNVATANASQVLLATGGGHLVYL  513



>ref|XP_010431430.1| PREDICTED: DNA damage-binding protein 1a isoform X2 [Camelina 
sativa]
Length=1088

 Score = 71.6 bits (174),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SST+REL+ EW APAG+++NVATAN  QVLLA GGGHLVYL
Sbjct  473  SSTTRELRDEWHAPAGFAVNVATANASQVLLATGGGHLVYL  513



>ref|XP_010431426.1| PREDICTED: DNA damage-binding protein 1a isoform X1 [Camelina 
sativa]
Length=1116

 Score = 71.6 bits (174),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SST+REL+ EW APAG+++NVATAN  QVLLA GGGHLVYL
Sbjct  501  SSTTRELRDEWHAPAGFAVNVATANASQVLLATGGGHLVYL  541



>ref|NP_001118940.1| DNA damage-binding protein 1a [Arabidopsis thaliana]
 gb|AEE82518.1| DNA damage-binding protein 1a [Arabidopsis thaliana]
Length=1067

 Score = 71.6 bits (174),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SST+REL+ EW APAG+++NVATAN  QVLLA GGGHLVYL
Sbjct  452  SSTTRELRDEWHAPAGFTVNVATANASQVLLATGGGHLVYL  492



>dbj|BAF02165.1| UV-damaged DNA binding factor - like protein [Arabidopsis thaliana]
Length=727

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SST+REL+ EW APAG+++NVATAN  QVLLA GGGHLVYL
Sbjct  112  SSTTRELRDEWHAPAGFTVNVATANASQVLLATGGGHLVYL  152



>ref|NP_193842.1| DNA damage-binding protein 1b [Arabidopsis thaliana]
 sp|O49552.2|DDB1B_ARATH RecName: Full=DNA damage-binding protein 1b; AltName: Full=UV-damaged 
DNA-binding protein 1b; Short=DDB1b [Arabidopsis thaliana]
 dbj|BAF01636.1| UV-damaged DNA-binding protein- like [Arabidopsis thaliana]
 gb|AEE84401.1| DNA damage-binding protein 1b [Arabidopsis thaliana]
Length=1088

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SST+REL+++W APAG+S+NVATAN  QVLLA GGGHLVYL
Sbjct  473  SSTTRELRNKWDAPAGFSVNVATANASQVLLATGGGHLVYL  513



>dbj|BAD95136.1| UV-damaged DNA-binding protein- like [Arabidopsis thaliana]
Length=1088

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SST+REL+++W APAG+S+NVATAN  QVLLA GGGHLVYL
Sbjct  473  SSTTRELRNKWDAPAGFSVNVATANASQVLLATGGGHLVYL  513



>emb|CAA17529.1| UV-damaged DNA-binding protein-like [Arabidopsis thaliana]
 emb|CAB79110.1| UV-damaged DNA-binding protein-like [Arabidopsis thaliana]
Length=1102

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SST+REL+++W APAG+S+NVATAN  QVLLA GGGHLVYL
Sbjct  487  SSTTRELRNKWDAPAGFSVNVATANASQVLLATGGGHLVYL  527



>ref|XP_004504152.1| PREDICTED: DNA damage-binding protein 1-like [Cicer arietinum]
Length=1088

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SST+REL +EW AP+G+S+NVATAN  QVLLA GGGHLVYL
Sbjct  473  SSTTRELLNEWHAPSGFSVNVATANATQVLLATGGGHLVYL  513



>ref|XP_010455869.1| PREDICTED: DNA damage-binding protein 1a-like [Camelina sativa]
Length=1088

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SST+REL+ EW  PAG+++NVATAN  QVLLA GGGHLVYL
Sbjct  473  SSTTRELRDEWHTPAGFAVNVATANASQVLLATGGGHLVYL  513



>ref|XP_006285730.1| hypothetical protein CARUB_v10007203mg [Capsella rubella]
 gb|EOA18628.1| hypothetical protein CARUB_v10007203mg [Capsella rubella]
Length=1088

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SST+REL+++W APAG+++NVATAN  QVLLA GGGHLVYL
Sbjct  473  SSTTRELRNKWDAPAGFTVNVATANASQVLLATGGGHLVYL  513



>ref|XP_010445239.1| PREDICTED: DNA damage-binding protein 1b-like [Camelina sativa]
Length=969

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SST+REL+++W APAG+++NVATAN  QVLLA GGGHLVYL
Sbjct  409  SSTTRELRNKWDAPAGFAVNVATANASQVLLATGGGHLVYL  449



>ref|XP_010449116.1| PREDICTED: DNA damage-binding protein 1b-like [Camelina sativa]
Length=1088

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SST+REL+++W APAG+++NVATAN  QVLLA GGGHLVYL
Sbjct  473  SSTTRELRNKWDAPAGFAVNVATANASQVLLATGGGHLVYL  513



>ref|XP_010434237.1| PREDICTED: DNA damage-binding protein 1b [Camelina sativa]
Length=1088

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SST+REL+++W APAG+++NVATAN  QVLLA GGGHLVYL
Sbjct  473  SSTTRELRNKWDAPAGFAVNVATANASQVLLATGGGHLVYL  513



>ref|XP_002867863.1| hypothetical protein ARALYDRAFT_492777 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44122.1| hypothetical protein ARALYDRAFT_492777 [Arabidopsis lyrata subsp. 
lyrata]
Length=1088

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SST+REL+++W APAG+++NVATAN  QVLLA GGGHLVYL
Sbjct  473  SSTTRELRNKWDAPAGFAVNVATANASQVLLATGGGHLVYL  513



>emb|CDY57060.1| BnaC03g64410D [Brassica napus]
Length=1103

 Score = 68.6 bits (166),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SST+REL+++W APAG+++NVATAN  QVLLA GGGHLVY+
Sbjct  488  SSTTRELRNKWDAPAGFTVNVATANASQVLLATGGGHLVYI  528



>emb|CDX76416.1| BnaA08g09840D [Brassica napus]
Length=1128

 Score = 68.6 bits (166),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SST+REL+++W APAG+++NVATAN  QVLLA GGGHLVY+
Sbjct  473  SSTTRELRNKWDAPAGFTVNVATANASQVLLATGGGHLVYI  513



>gb|AET04495.2| damaged DNA-binding protein 1A [Medicago truncatula]
Length=1089

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SS++REL +EW AP+ YS+NVATAN  QVLLA GGGHLVYL
Sbjct  473  SSSTRELLNEWHAPSDYSVNVATANATQVLLATGGGHLVYL  513



>ref|XP_008776763.1| PREDICTED: DNA damage-binding protein 1a isoform X4 [Phoenix 
dactylifera]
Length=1037

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SSTSREL  +W AP+G+S+NVATAN  QVLLA GGGHLVY+
Sbjct  421  SSTSRELLDQWNAPSGFSVNVATANASQVLLATGGGHLVYI  461



>ref|XP_010025491.1| PREDICTED: DNA damage-binding protein 1 [Eucalyptus grandis]
 gb|KCW62162.1| hypothetical protein EUGRSUZ_H04822 [Eucalyptus grandis]
Length=1094

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SS +REL++EW +P GYSINVATAN  QVLLA GGG+LVYL
Sbjct  478  SSMTRELRNEWHSPQGYSINVATANATQVLLATGGGNLVYL  518



>ref|XP_008776760.1| PREDICTED: DNA damage-binding protein 1a isoform X1 [Phoenix 
dactylifera]
 ref|XP_008776761.1| PREDICTED: DNA damage-binding protein 1a isoform X2 [Phoenix 
dactylifera]
 ref|XP_008776762.1| PREDICTED: DNA damage-binding protein 1a isoform X3 [Phoenix 
dactylifera]
Length=1089

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SSTSREL  +W AP+G+S+NVATAN  QVLLA GGGHLVY+
Sbjct  473  SSTSRELLDQWNAPSGFSVNVATANASQVLLATGGGHLVYI  513



>ref|XP_009108514.1| PREDICTED: DNA damage-binding protein 1b [Brassica rapa]
Length=1088

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SST+R+L+++W APAG+++NVATAN  QVLLA GGGHLVY+
Sbjct  473  SSTTRQLRNKWDAPAGFTVNVATANASQVLLATGGGHLVYI  513



>ref|XP_008647719.1| PREDICTED: uncharacterized protein LOC100279448 isoform X2 [Zea 
mays]
 gb|AFW79365.1| hypothetical protein ZEAMMB73_562969 [Zea mays]
Length=1089

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            S TSREL ++W APAG+S+NVA+AN  QVLLA GGGHLVYL
Sbjct  474  SCTSRELVNQWNAPAGFSVNVASANASQVLLATGGGHLVYL  514



>ref|XP_008647718.1| PREDICTED: uncharacterized protein LOC100279448 isoform X1 [Zea 
mays]
Length=1093

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            S TSREL ++W APAG+S+NVA+AN  QVLLA GGGHLVYL
Sbjct  478  SCTSRELVNQWNAPAGFSVNVASANASQVLLATGGGHLVYL  518



>ref|XP_006828193.1| hypothetical protein AMTR_s00023p00145060 [Amborella trichopoda]
 gb|ERM95609.1| hypothetical protein AMTR_s00023p00145060 [Amborella trichopoda]
Length=1089

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            S +SREL +EW AP+G+S+NVATAN  QVLLA GGGHLVYL
Sbjct  473  SCSSRELLNEWKAPSGFSVNVATANASQVLLATGGGHLVYL  513



>ref|XP_006413823.1| hypothetical protein EUTSA_v10024273mg [Eutrema salsugineum]
 gb|ESQ55276.1| hypothetical protein EUTSA_v10024273mg [Eutrema salsugineum]
Length=1090

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SST+REL+++W AP G+++NVATAN  QVLLA GGGHLVY+
Sbjct  475  SSTTRELRNKWEAPVGFTVNVATANASQVLLATGGGHLVYI  515



>ref|XP_010247742.1| PREDICTED: DNA damage-binding protein 1 [Nelumbo nucifera]
Length=1089

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SSTSR L  EW AP+G+S+NVATAN  QVLLA GGGHLVYL
Sbjct  473  SSTSRLLLDEWKAPSGFSVNVATANATQVLLATGGGHLVYL  513



>ref|XP_008656105.1| PREDICTED: DNA damage-binding protein 1a-like [Zea mays]
Length=1070

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            S TSREL  +W APAG+S+NVA+AN  QVLLA GGGHLVYL
Sbjct  455  SCTSRELVDQWNAPAGFSVNVASANASQVLLATGGGHLVYL  495



>ref|XP_002440377.1| hypothetical protein SORBIDRAFT_09g030580 [Sorghum bicolor]
 gb|EES18807.1| hypothetical protein SORBIDRAFT_09g030580 [Sorghum bicolor]
Length=1783

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            S TSREL  +W APAG+S+NVA+AN  QVLLA GGGHLVYL
Sbjct  474  SCTSRELVDQWNAPAGFSVNVASANASQVLLATGGGHLVYL  514



>ref|XP_010271927.1| PREDICTED: DNA damage-binding protein 1-like [Nelumbo nucifera]
Length=1089

 Score = 66.2 bits (160),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SSTSR L  EW AP+G+S+NVATAN  QVLLA GGGHLVY+
Sbjct  473  SSTSRMLLDEWKAPSGFSVNVATANATQVLLATGGGHLVYI  513



>ref|XP_010941530.1| PREDICTED: DNA damage-binding protein 1a isoform X2 [Elaeis guineensis]
Length=1037

 Score = 66.2 bits (160),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SSTSR+L  +W AP+G+S+NVATAN  QVLLA GGGHLVY+
Sbjct  421  SSTSRDLLDQWNAPSGFSVNVATANASQVLLATGGGHLVYI  461



>ref|XP_010941529.1| PREDICTED: DNA damage-binding protein 1a isoform X1 [Elaeis guineensis]
Length=1089

 Score = 65.9 bits (159),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SSTSR+L  +W AP+G+S+NVATAN  QVLLA GGGHLVY+
Sbjct  473  SSTSRDLLDQWNAPSGFSVNVATANASQVLLATGGGHLVYI  513



>gb|AFW81318.1| hypothetical protein ZEAMMB73_456332 [Zea mays]
Length=674

 Score = 65.5 bits (158),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            S TSREL  +W APAG+S+NVA+AN  QVLLA GGGHLVYL
Sbjct  59   SCTSRELVDQWNAPAGFSVNVASANASQVLLATGGGHLVYL  99



>gb|KFK28706.1| hypothetical protein AALP_AA7G036100 [Arabis alpina]
Length=1108

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SST+REL+++W +PAG+++NVATA   QVLLA GGGHLVY+
Sbjct  471  SSTTRELRNKWDSPAGFTVNVATATASQVLLATGGGHLVYI  511



>ref|XP_004961015.1| PREDICTED: DNA damage-binding protein 1-like [Setaria italica]
Length=1090

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            S TS+EL  +W APAG+S+NVA+AN  QVLLA GGGHLVYL
Sbjct  474  SCTSQELVDQWNAPAGFSVNVASANASQVLLATGGGHLVYL  514



>ref|XP_006654871.1| PREDICTED: DNA damage-binding protein 1a-like [Oryza brachyantha]
Length=1090

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            S TSREL  +W AP G+S+NVA+AN  QVLLA GGGHLVYL
Sbjct  474  SCTSRELVDQWNAPEGFSVNVASANASQVLLATGGGHLVYL  514



>dbj|BAB20761.1| UV-damaged DNA binding protein [Oryza sativa Japonica Group]
Length=1090

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            S TSREL  +W AP G+S+NVA+AN  QVLLA GGGHLVYL
Sbjct  474  SCTSRELVDQWNAPEGFSVNVASANASQVLLATGGGHLVYL  514



>ref|NP_001056495.1| Os05g0592400 [Oryza sativa Japonica Group]
 gb|AAT44300.1| putative DNA damage binding protein 1 [Oryza sativa Japonica 
Group]
 dbj|BAF18409.1| Os05g0592400 [Oryza sativa Japonica Group]
 dbj|BAG89545.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64898.1| hypothetical protein OsJ_19757 [Oryza sativa Japonica Group]
Length=1090

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            S TSREL  +W AP G+S+NVA+AN  QVLLA GGGHLVYL
Sbjct  474  SCTSRELVDQWNAPEGFSVNVASANASQVLLATGGGHLVYL  514



>gb|EMT15709.1| DNA damage-binding protein 1 [Aegilops tauschii]
Length=1139

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            S TSREL  +W AP G+S+NVA+AN  QVLLA GGGHLVYL
Sbjct  508  SCTSRELVDQWNAPEGFSVNVASANASQVLLATGGGHLVYL  548



>gb|EMS49351.1| DNA damage-binding protein 1 [Triticum urartu]
Length=1189

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            S TSREL  +W AP G+S+NVA+AN  QVLLA GGGHLVYL
Sbjct  573  SCTSRELVDQWNAPEGFSVNVASANASQVLLATGGGHLVYL  613



>gb|EEC79792.1| hypothetical protein OsI_21216 [Oryza sativa Indica Group]
Length=1089

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            S TSREL  +W AP G+S+NVA+AN  QVLLA GGGHLVYL
Sbjct  474  SCTSRELVDQWNAPEGFSVNVASANASQVLLATGGGHLVYL  514



>ref|XP_010537808.1| PREDICTED: DNA damage-binding protein 1a [Tarenaya hassleriana]
Length=1088

 Score = 63.2 bits (152),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SST+REL++EW    GY++NVATAN  QVLLA GGG+LVYL
Sbjct  473  SSTTRELRNEWHVRPGYTVNVATANASQVLLATGGGNLVYL  513



>gb|KGN65894.1| hypothetical protein Csa_1G537440 [Cucumis sativus]
Length=1041

 Score = 62.8 bits (151),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SST+REL +EW AP+ YSINVATAN  QVLLA GGG LV+L
Sbjct  421  SSTTRELLNEWNAPSNYSINVATANASQVLLATGGGVLVHL  461



>ref|XP_008444949.1| PREDICTED: DNA damage-binding protein 1 [Cucumis melo]
Length=1091

 Score = 62.8 bits (151),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SST+REL +EW AP+ YSINVATAN  QVLLA GGG LV+L
Sbjct  473  SSTTRELLNEWNAPSNYSINVATANASQVLLATGGGVLVHL  513



>ref|XP_004135539.1| PREDICTED: DNA damage-binding protein 1-like [Cucumis sativus]
Length=1093

 Score = 62.8 bits (151),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SST+REL +EW AP+ YSINVATAN  QVLLA GGG LV+L
Sbjct  473  SSTTRELLNEWNAPSNYSINVATANASQVLLATGGGVLVHL  513



>ref|XP_010906318.1| PREDICTED: DNA damage-binding protein 1a-like [Elaeis guineensis]
Length=1089

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SSTSR L  +W A +G+S+NVATAN  Q+LLA GGGHLVYL
Sbjct  473  SSTSRALLDQWNASSGFSVNVATANASQILLATGGGHLVYL  513



>emb|CDM83290.1| unnamed protein product [Triticum aestivum]
Length=1061

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SSTSR+L  +WFAP G+ +NVA AN  QVLLA GG HL+YL
Sbjct  454  SSTSRDLLDQWFAPTGFPVNVAAANACQVLLATGGFHLIYL  494



>ref|XP_003567788.1| PREDICTED: DNA damage-binding protein 1a-like [Brachypodium distachyon]
Length=1090

 Score = 61.2 bits (147),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            S  SREL   W AP G+S+NVA+AN  QVLLA GGGHLVYL
Sbjct  474  SCASRELVDHWNAPDGFSVNVASANASQVLLATGGGHLVYL  514



>ref|XP_003569272.1| PREDICTED: DNA damage-binding protein 1a-like isoform X1 [Brachypodium 
distachyon]
Length=1074

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SS S EL  +WFAPA +S+NVA AN  QVLLA G  HLVYL
Sbjct  471  SSVSLELLDQWFAPARFSVNVAAANANQVLLATGNCHLVYL  511



>ref|XP_010231953.1| PREDICTED: DNA damage-binding protein 1a-like isoform X2 [Brachypodium 
distachyon]
Length=1053

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            SS S EL  +WFAPA +S+NVA AN  QVLLA G  HLVYL
Sbjct  450  SSVSLELLDQWFAPARFSVNVAAANANQVLLATGNCHLVYL  490



>ref|XP_002976174.1| hypothetical protein SELMODRAFT_151061 [Selaginella moellendorffii]
 gb|EFJ23079.1| hypothetical protein SELMODRAFT_151061 [Selaginella moellendorffii]
Length=1089

 Score = 54.3 bits (129),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  4    STSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            +TSR    EW  P+G +INVATAN  QVLLA GGG+LVY+
Sbjct  474  ATSRRQLTEWRTPSGVAINVATANASQVLLATGGGNLVYI  513



>ref|XP_002968203.1| hypothetical protein SELMODRAFT_145521 [Selaginella moellendorffii]
 gb|EFJ30457.1| hypothetical protein SELMODRAFT_145521 [Selaginella moellendorffii]
Length=1089

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +1

Query  4    STSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            +TSR    EW  P+  +INVATAN  QVLLA GGG+LVY+
Sbjct  474  ATSRRQLTEWRTPSAVAINVATANASQVLLATGGGNLVYI  513



>ref|XP_001785293.1| predicted protein [Physcomitrella patens]
 gb|EDQ49884.1| predicted protein [Physcomitrella patens]
Length=1090

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 31/41 (76%), Gaps = 1/41 (2%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            + T R+L  EW APA  +INVATAN  QVLLA GGG+LVY+
Sbjct  474  AKTRRQLT-EWKAPAPMTINVATANASQVLLATGGGNLVYI  513



>ref|XP_001776266.1| predicted protein [Physcomitrella patens]
 gb|EDQ58899.1| predicted protein [Physcomitrella patens]
Length=1089

 Score = 51.6 bits (122),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
            ++ +R+   EW APA  +INVATAN  QVLLA GGG+LVY+
Sbjct  473  NAKTRKQLTEWKAPAPMTINVATANASQVLLATGGGNLVYI  513



>ref|XP_001702494.1| UV-damaged DNA binding complex subunit 1 protein [Chlamydomonas 
reinhardtii]
 gb|EDP06273.1| UV-damaged DNA binding complex subunit 1 protein [Chlamydomonas 
reinhardtii]
Length=1147

 Score = 51.2 bits (121),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVLLAAGGGHLVYL  123
             S+S  L  EW  PAG+SINVA  +  QV++A GGGHLVYL
Sbjct  518  DSSSLALVSEWRPPAGFSINVAAGSPTQVVVATGGGHLVYL  558



>ref|XP_004158102.1| PREDICTED: LOW QUALITY PROTEIN: DNA damage-binding protein 1-like 
[Cucumis sativus]
Length=570

 Score = 45.4 bits (106),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 20/30 (67%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = +1

Query  1    SSTSRELKHEWFAPAGYSINVATANTMQVL  90
            SST+REL +EW AP+ YSINVATAN  Q +
Sbjct  473  SSTTRELLNEWNAPSNYSINVATANASQCI  502



Lambda      K        H        a         alpha
   0.316    0.128    0.380    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 516678285084